3SERA

Zn-mediated polymer of maltose-binding protein k26h/k30h by synthetic symmetrization
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGHKFEHDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 116
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3serA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3serA01
4G8HA 2PBWA 1GR2A 3U93A 1LAXA 3DM0A 3PD8A 2Y7WA 3TTRA 1J1NA 1QW0A 4ZS9A 4THIA 5L9SA 2HFBA 4H5GA 3A3UA 4MLQA 1D9YA 3WAFA 2XXIA 3H6TA 2QL3A 2GRVA 5IKBA 1ZMGA 3A3CA 3TMGA 1WDNA 5TPAB 3PD9A 4EUOA 4F1VA 1JNFA 3JZJA 3QIMA 3OELA 2OWSA 2F97A 4H1XA 4UACA 4K3FA 4N6PA 1WODA 1MPCA 1N84A 3SKPA 4BDOA 4OETA 4HW8A 1B5IA 1A8EA 1FTLA 2ESNA 3V83A 1QKAA 1GTKA 5H8NA 1MY2A 5FTHA 4U22A 2BJJX 4YKKA 1FW0A 5CMKA 4OVJA 5I57A 4BDRA 2V84A 4YKPA 2E1SA 4IB2A 3EHTA 3R6UA 4KR5A 3N5LA 1O63A 3OXNA 4GRKA 4U23A 5KZTA 3PMVA 1MY0A 1TWYA 3THIA 3JYRA 1A7LA 3CFXA 3N6TA 4WEDA 4ESXA 1TXFA 5I59B 5FTIA 1OMPA 3FXRA 4JXIA 2DP8A 2O1LA 3W15C 3OO6A 3Q29A 1M5CA 2DXRA 4LP2B 1B2HA 1XHYA 1A40A 1MQIA 2RKMA 1EZ9A 4R6KA 1MDQA 5CC2A 3FJ7A 4POXA 3PPNA 4X1BA 4ZEDA 4JWYA 4OEVA 4NMYA 4F3GA 1B32A 4NF8B 1IZ1A 3IB0A 4EF2A 3SEVA 3C36A 3HV1A 3O6IA 1Y9UA 3O66A 3MP1A 3MZ9A 2ALUA 4OFLA 4H8IA 3V8XB 3PGFA 4G8MA 4GFRA 3UIFA 2I49A 3MP6A 3LSWA 1PB8A 3PU5A 4QFPA 1A55A 3U94A 2B3BA 3O29A 4TLLB 3I3VA 3VXCA 4ZE8A 1LAFE 3K6UA 3ZSFA 4FJPA 4BDMA 2F6PA 5AA2B 4I1DA 2UXAA 1QKBA 3TTMA 1CE2A 2FYIA 1Y4CA 3IR1A 4ELPA 3KOSA 2O68A 2VOZA 3B6TA 3SERA 4I62A 1BTJA 2RC8A 2RC9A 3PV0E 2HAUA 1LCFA 5ELVA 3UGWA 3KGCA 2ONKE 4N07A 5I2NB 2HXWA 3E4RA 1ATGA 2XXYA 1CB6A 4R75A 3IO6A 1M5FA 2XHDA 3KG2A 3K6WA 3G3IA 3K6VA 4Z0IA 4KI0E 4RYAA 2OWTA 1OVBA 1MXXA 1DTGA 1USYE 4HS7A 4IO2A 2GH9A 3T9VA 3EQ1A 5TP9A 5TU0A 3K0VA 5KDTB 4OFOA 2A5TB 4F31B 3GLBA 2ABHA 1H3DA 2O7UA 1MH4A 3TQLA 1XS5A 2DVCA 1URDA 1WVJA 2IEEA 1Y3PA 5JEIA 3S2VA 5A5XA 1EZPA 1MQJA 5CMCA 1RYXA 2V3QA 2VD2A 5L9OA 4M4GA 3S9EA 1XT8A 4ZE9A 1NL5A 1IXCA 1FTJA 4RK9A 5H8HB 2XX9A 4YMBA 5CMBA 1SI1A 2O1MA 5HM4B 4KCCA 1Y3NA 3FGSA 2YLNA 5BWJA 2RF1A 2UVHA 3U1OA 3PUVE 4R2BA 1ZKBA 1FQDA 5I59A 2VP1A 2F34A 2VGQA 1JEVA 3H4ZA 2R71A 4BDNA 2V25A 4OMBA 3FXUA 1BIYA 2KLFA 4RA1A 2GFEA 2DWJA 4RXLA 4F39A 1JQFA 3FVGA 1FQBA 5AA1A 1UTHA 4NF8A 5ITOA 4ZEBA 1FTOA 5H8NB 4H0WA 4QFLA 1I6QA 4JBZA 3PMXA 4NEDA 5I57B 5L9MA 3TCHA 4OERA 4NTLA 1POY1 2REGA 4DE8A 3C33A 3HCQA 4R74A 1Q1KA 1EH3A 1H44A 3QUJA 2QS3A 2DE2A 4RJZA 4FORA 4OFJA 2UVJA 2YJPA 5F7VA 4PQJA 2B3FA 3ONMA 4GXSB 1M5DA 1DPPA 3CG3A 1Y20A 3IO4A 2G93A 4F18A 2F7CA 4KCDA 2GHAA 5ICQA 4C1UA 2DQVA 2DE3A 3R7XA 3MZBA 1SW5A 3CR9A 2Z22A 3M3LA 2H9BA 3QK6A 4ND9A 2W7YA 4R6YA 3OMBA 3G3FA 1OLAA 1PB7A 4UA8A 3UP9A 1B9JA 5IAIA 2B65A 1D9VA 5I2NA 1USYH 3ZS6A 1NKXA 3P7IA 3BBRA 4ZDMA 4TLMB 1B7HA 2Q2CA 5B70A 4FIMA 4XIGQ 1MG1A 4GD5A 3KN8A 4YB6A 4YKJA 3OENA 1IXGA 1VE4A 3KZGA 1I69A 5DEXA 1DMBA 2I48A 3FVKA 3CSBA 4GLIA 3ECRA 3C9HA 2CMOA 3HO7A 4IY5A 1JVXA 1B3LA 3KSXA 3M3KA 1LCTA 2ZYOA 4BLAA 2AL5A 3S9MC 1FQEA 3GBAA 5FHMA 2DWIA 4KHZE 2HEUA 3IK6B 1GVCA 1LBCA 3U92A 2QS4A 2FA7A 5I2KA 5DVIA 1JW5A 4JB7A 4ESWA 3RPWA 2Y7PA 4R9FA 4MH5A 3E3KA 4GL8A 3SDFA 1L5TA 1NNFA 3SEYA 3TPAA 1N3XA 4NF5B 3JV9A 2I3WA 2XXRA 1B4HA 1PBQA 2ZNSA 1LFIA 1S7YA 5JK4A 1MH3A 3IOWA 3VV5A 3OEMA 4I8CA 3OD7A 3H6VA 3T9UA 1R9LA 5CRYA 1MS7A 2Z8EA 3KBRA 4PFUA 4Q0CA 1MQDA 4OTEA 5TP9B 1P1WA 1QUIA 2UYEA 2PT2A 3T96B 2NUVA 1SDXA 3LUYA 4IO4A 2UVGA 3OSQA 2ZMBA 4ZZAA 3G3HA 3GXAA 2XD3A 2R6GE 4ELQA 3H3GA 3OSRA 1LAHE 3S9LC 5JTYB 4O3CA 5A5XB 1ZTYA 3MJNA 4N13A 5CI5A 1O7TA 1FTMA 1XC1A 2GHBA 3TKDA 1NNPA 1RYOA 3O9PA 1P1QA 4JWXA 4EQ7A 2H98A 4LUBA 1PB9A 4F3SA 4YAHX 2FNCA 1FQFA 3KFMA 1DOTA 3IB1A 3V5AA 3FASA 3VVFA 3K1PA 4XKQA 1ZIUA 4JWOA 4ECFA 1XVXA 4MBPA 5I84A 4GF8A 4PFTA 4IGRA 4G77A 4O3BA 3RNNA 2NXOA 1IUDA 1KWHA 4GXAA 2RCBA 5H8FB 3SEUA 1YTVA 3H6UA 3IJOB 4LQ2A 4WXJA 3IJXB 1MPBA 3TDJA 4MF3A 2F6GA 4L17A 4TQUQ 1JW4A 1UTHB 4PFYA 4X48A 4QSDA 2DWAA 3LSLA 4QFOA 1US4A 3CFLA 3V89B 4E0XA 4H67A 5DYHA 3MVWA 2AIXA 3FVOA 4U21A 5HBCA 2DYXA 3OO8A 4ZEKA 3VVEA 1POTA 2P1SA 2DXYA 1MY3A 2VHAA 3O6HA 1B4ZA 1URSA 2Q2AA 4AB6A 1N7WA 3RTWB 1Q35A 4LZ5A 1QVSA 2OBGA 5BUUA 3IOUA 3S4UA 4KD5A 3EF7A 1SBPA 4EXLA 1S9TA 3QSLA 2Q88A 1B3GA 2HAVA 2V3UA 1NH8A 5EYFA 2I4CA 2X26A 4P11A 3SEWA 4NF6A 4H8JA 4JDFA 4KYEA 4NF5A 2Q8JA 1PBPA 1IQ7A 4KQPA 3QAXA 3E9XA 4IO6A 2QMXA 4X1DA 1DPEA 3VLWA 1Y4TA 5K2XA 2Y7IA 1MRPA 4GIZA 2H25A 1SQYA 1IXIA 4OZ9A 5DEXB 1FQAA 4DXCA 1B5HA 4P0GA 4YKIA 4F19A 4FEBA 3IOTA 4OYVA 4F3PA 1EU8A 3EHUA 3UORA 2A5SA 3G7WA 3TZAA 2OJTA 1P1NA 3FVNA 1N7XA 4ISUA 5JTYA 2UVIA 4OXVA 5I2KB 4GL0A 4TOZA 4WKMA 1B1HA 2P2AA 5DT6A 1MPDA 3CG1A 5FHOA 3PUYE 2Y84A 2XXQA 3PPPA 1F9BA 3O2AA 1MDP1 4LA9A 4M1VA 3KEIA 1MM6A 4U1ZA 3VLVA 3UA8A 4HCYA 5DTBA 3K4UA 2RCAA 2V3TA 1B05A 1A8FA 1B3HA 3PPOA 5F1QA 1GGGA 3T66A 1UIUA 2PT1A 2PX1A 4Z7EA 4O3AA 3T9XB 1AL3A 5H8FA 4F2QA 3K2DA 1MY1A 4LZ7A 1N3WA 4LATA 3L6HA 1ZU0A 4P0IA 2X7QA 3FD3A 4NF4A 1D4NA 4QSCA 3T9HB 2XXTA 4LVQA 3SETA 1LSTA 1SVXB 4HCWA 4FATA 3CVGA 1VR5A 4ZEIA 4DCXA 4FAJA 4G68A 1LBBA 4MFIA 1LFGA 3MPKA 3Q25A 3RTFB 4NE4A 4LQ5A 2I4BA 4QSEA 3RQTA 2QJEA 1DSNA 4ONYA 1SYIA 1B5JA 1FQCA 3K02A 4H6DA 1M5BA 1MXYA 1JEUA 2CZLA 2HQ0A 3C34A 1R1NA 3ILUB 5KCJA 1SD3A 4EQBA 2F5XA 5H8SA 2PMSA 1PEBA 1YPNA 3G3KA 5CM6A 1QUJA 5AA3A 2F8DA 3UN6A 2ZYMA 3MQ9A 3HHGA 3FXQA 2THIA 4DCYA 4PFWA 3K01A 4DXUA 2XXWA 3MUQA 4U2RA 3PPRA 4ZEFA 3HSTA 3FIRA 2I6EA 1FCKA 2XX8A 2ZYNA 4G2ZA 3GZGA 1Y3QA 1SYHA 1URGA 4ELRA 1MQGA 2QPQA 2HZKA 4QFNA 1YAEA 3K1NA 2O51A 4EXKA 1BLFA 5J1DA 1MM7A 5H8QA 2H99A 2ONRA 2NOOA 4FE8A 4NF6B 3TTLA 4NWCA 3OO9A 2D21A 2VD3A 3LSXA 3BFTA 3K00A 1ZLQA 2Q9TA 1AH5A 3K1MA 1US5A 4POWA 1O64A 2I0CA 2D5WA 3Q27A 1SI0A 1QULA 1HSLA 3AXFA 5ISUA 3FZVA 1OQHA 3I6VA 4IGTA 3USDA 1Y1MA 4XKPA 5I58A 2QSXA 2H4IA 3RUMA 3HPIA 3IL1B 4QF9A 1NNTA 3BFUA 2O69A 4BDQA 1OLCA 3O97A 4QHQA 2F35A 1ZBMA 3WAEA 2H5YA 1UQWA 1JVYA 4LZ8A 1HSJA 3MBPA 2Z8FA 4GQOA 2XXUA 3ZKKA 3VXBA 3RN8A 1UTBA 1LB9A 1B6HA 3OO7A 1TT1A 3LC8A 3QYTA 1B7UA 2I0BA 4KYDA 1LB8A 3TFLA 1XOCA 4BDLA 1Z7ME 1LFHA 1QUKA 1IXHA 4C1TA 1B52A 2R9JA 2Y7KA 2QS1A 4GVOA 3TYHA 5LOMA 4YB5A 1IIWA 4IO5A 3FV1A 1S50A 5M2VA 3R26A 2AL4A 1II5A 3TTKA 4U4XA 4OESA 4GWOA 2XXPA 4YMAA 4QFKA 1OVTA 2DSFA 1N0TA 1HSEA 4EF1A 3I5OA 2REJA 3ZKLA 1H76A 3C32A 3MC2A 3C31A 4G4PA 5AA2D 1IEJA 3SESA 3K6XA 4YB7A 4WEPA 3PUZE 1P1UA 1OIBA 1D3KA 2QMWA 4DXBA 4NF4B 3EN3A 2F7BA 3B6WA 4F1YA 1Y1ZA 1R6ZA 1P99A 3T93B 3CI8A 3MP8A 4PP0A 3RLFE 5AE4A 1H43A 1MXUA 3DELB 1ANFA 3O28A 4G68B 3U72A 3FUZA 4YICA 1Z7NE 1AIVA 3KOTA 3TEPA 3M3FA 2PYYA 3N6UA 3T22A 2DOJA 4LONB 1ELJA 2OZZA 4JSOA 4YU0A 3OOAA 2ONSA 4YZZA 5L8DA 1B46A 4C0RA 1MXWA 3VVDA 1B7ZA 5I56B 4Q8RA 3LR1A 2NVUB 4XXUA 3PMWA 4G68C 5ICTA 5KCJB 3DP8A 2RINA 1R9QA 1LGBC 4F29A 5AA4B 4PETA 4IY6A 4HTGA 3Q26A 3VLUA 3U8QA 1B1XA 3MPLA 4RNSA 3CIJA 3MW0A 1SW2A 3C35A 2UYFA 3IX1A 3TQWA 3DLNA 3SEXA 4FEDA 1B40A 3FV2A 5DVFA 4F2OA 4GOTA 3RT8A 3GBBA 3RT6B 3LBSA 5K2YA 4QRZA 4R73A 5B7DA 4R72A 3B6QA 4IO7A 4H65A 3BKIB 2F7AA 1AOVA 3QUFA 1MQHA 4XKNA 2IA4A 5EHMA 4R2FA 5TPAA 3TELA 1A99A 4RPOA 3N26A 3O6GA 1NNKA 1B3EA 2ZXTA 2LAOA 4FECA 1MXZA 1QJMA 2P0SA 3TODA 3DP6A 2WKYA 4H5FA 1JETA 3CFZA 5H8QB 3Q28A 1BKAA 1VFEA 3F11A 4ZECA 2OCUA 2V93A 1AMFA 2Z8DA 2I3VA 4NWDA 1B58A 2M8CA 3ODBA 2ZNUA 3H7MA 4KPTA 1A54A 3LSFB 3MWBA 4ZZEA 2HCAA 1I6AA 2XD2A 1B51A 1NFTA 3H06B 5I58B 3FJGA 1BP5A 3TCFA 2E0SA 3OEKA 4KYSA 2F36A 2NWJA 4OENA 1UIVA 2QRYA 1PC3A 1N76A 2Y7RA 3EPEA 3KN3A 2YPNA 4EQ9A 1LLSA 1H45A 1OQGA 5HPQA 1N04A 4F22A 3DP4A 4RY1A 3G3JA 3KSJA 3MZ1A 4X9TA 1B0HA 2O6AA 3RGYA 1UTBB 5CBRA 4G8NA 3C4MA 5CBSA 2DVZA 4ELOA 4R9GA 4DZ1A 3HHFA 2HZLA 3ILTB 3QXMA 4JSDA 2QS2A 3W9WA 4U1OA 2DS9A 4PE5B 2X7PA 1YCJA 4DIGA 4OEUA 3D4GA 4MLVA 2O7IA 4F1UA 1GV8A 3HN0A 5DVJA 4AB5A 4R6HA 1DTZA 2O84X 1IITA 2RC7A 3M8UA 1B3FA 2PVUA 3W9VA 2OK2A 3FJMA 1NMUA 3VDFA 3KN7A 1VFDA 5I56A 2ZYKA 2G29A 5AA2A 1XVYA 5ITPA 4RK2A 4Q30B 1TFAA 3IOVA 3TAJA 1MXVA 3H6WA 5AA4A 3CSGA 4EDPA 1SW4A 3PPQA 1RKMA 3S9NC 3B7DA 2Q89A 3IAZA 3N94A 1NH7A 3MAMA 4E0WA 3KJ7A 3EHSA 4Q5TA 3G3GA 4U4SA 4RPNA 2ANJA 1I6BA 1T0KA 1LAGE 3TTNA 4I9DA 3PUWE 4F3BA 3UK4A 3KJTA 3VFJA 2Z23A 5EHSA 3MVXA 1JW1A 1B0LA 1VSOA 2XXXA 3VE1B 2F78A 1P1OA 3RY3A 2DE4A 1EZOA 3IB2A 2XXHA 3CRBA 5KDTA 2D3IA 2A5TA 4OHNA 3D4CA 3L6GA 1ZJLA 3TCGA 5CMMA 3MVYA 3E13X 4IO3A 3IORA 4XTCQ 3TUSA 1TFDA 4DDDA 5FHNA 1M5EA 2XXVA 2DWHA 2OLBA 4XKRA 2ZNTA 4OQOA 3H03A 1MY4A 1FTKA 1PDAA 3A09A 3PUXE 4KFQA 2XX7A 4DLDA 4AQ4A 1SW1A 5H8HA 2I58A 3FATA 3MVZA 4OWDA 2AYSA
chains in the Genus database with same CATH superfamily
4G8HA 2PBWA 1GR2A 3U93A 1LAXA 3DM0A 3PD8A 2Y7WA 3TTRA 4AS4A 1J1NA 1QW0A 4ZS9A 4THIA 5L9SA 2HFBA 4H5GA 3A3UA 4MLQA 1D9YA 3WAFA 2XXIA 5IM2A 3RPLB 3H6TA 2QL3A 2GRVA 5IKBA 1ZMGA 3A3CA 3TMGA 1WDNA 1FBDA 5TPAB 3PD9A 4EUOA 4F1VA 1JNFA 3JZJA 3QIMA 3OELA 2OWSA 2F97A 4P47A 4H1XA 4OANA 4UACA 4K3FA 4N6PA 1WODA 1MPCA 4OVQA 1N84A 3SKPA 4BDOA 4OETA 4HW8A 1B5IA 1A8EA 1FTLA 2Q8MA 2ESNA 3V83A 1QKAA 4NAPA 4N6KA 1GTKA 5H8NA 1MY2A 1LBZA 2CZHA 4PF8A 5FTHA 1DBZA 4U22A 2BJJX 4YKKA 1FW0A 3T1BA 5CMKA 4OVJA 5I57A 4BDRA 2V84A 4YKPA 2E1SA 4IB2A 3EHTA 3R6UA 4KR5A 3N5LA 1FBCA 1O63A 3OXNA 4GRKA 4U23A 5KZTA 1D9QA 3PMVA 1MY0A 1TWYA 3THIA 3JYRA 1A7LA 2OWZA 3CFXA 1JP4A 3N6TA 4WEDA 4ESXA 1TXFA 5I59B 5FTIA 1OMPA 3FXRA 4JXIA 2DP8A 2O1LA 3W15C 1BK4A 3OO6A 4MNPA 3Q29A 1M5CA 2DXRA 4LP2B 1B2HA 1XHYA 1A40A 1MQIA 2RKMA 1EZ9A 4R6KA 1MDQA 5CC2A 3FJ7A 4POXA 3PPNA 4X1BA 4ZEDA 4JWYA 4OEVA 4NMYA 2P3VA 4F3GA 1B32A 4NF8B 1IZ1A 1FPKA 3IB0A 4EF2A 1IMBA 3SEVA 3C36A 4I40A 3HV1A 3O6IA 1Y9UA 3O66A 3MP1A 3MZ9A 3D1RA 3E79A 2ALUA 4OFLA 4H8IA 3V8XB 3PGFA 4G8MA 4GFRA 3UIFA 2I49A 4PGPA 3MP6A 3LSWA 1PB8A 3PU5A 4QFPA 1A55A 3KC1A 3U94A 2B3BA 3O29A 4TLLB 3I3VA 3VXCA 4ZE8A 4OVRA 1LAFE 3K6UA 3ZSFA 4FJPA 4BDMA 2F6PA 4OVSA 5AA2B 4I1DA 2UXAA 1QKBA 4GX3A 3T0JA 4PFRA 3TTMA 1CE2A 1YXIA 2FYIA 1Y4CA 2Y5KA 3IR1A 4ELPA 3KOSA 2O68A 4O8MA 2VOZA 3B6TA 2B4MA 3SERA 4I62A 1BTJA 1LEVA 2RC8A 2RC9A 3PV0E 2KQZA 2HAUA 1LCFA 5ELVA 3UGWA 3KGCA 5ET6A 4PF6A 2ONKE 4N07A 5I2NB 4IR8A 2HXWA 3E4RA 4PDHA 1ATGA 2XXYA 4KXPA 1CB6A 4R75A 3IO6A 1M5FA 5T3JA 2XHDA 3KG2A 3K6WA 4H46A 4H45A 3G3IA 3K6VA 4Z0IA 4I3EA 4FBPA 4KI0E 4RYAA 2OWTA 1OVBA 1MXXA 1DTGA 1USYE 4HS7A 4IO2A 2GH9A 3T9VA 3EQ1A 5TP9A 5TU0A 1KA0A 3K0VA 5KDTB 4NHBA 2PFYA 4OFOA 2A5TB 4F31B 3GLBA 2ABHA 1H3DA 2O7UA 1MH4A 3TQLA 1XS5A 2DVCA 1URDA 1WVJA 2IEEA 3E78A 1Y3PA 3HFUA 5JEIA 3S2VA 4PBHA 5A5XA 1EZPA 1MQJA 5CMCA 1RYXA 2V3QA 2VD2A 1NV2A 5L9OA 4M4GA 3S9EA 1XT8A 4ZE9A 4GBVA 1NL5A 1IXCA 1FTJA 4RK9A 4HE2A 5H8HB 2XX9A 4YMBA 5CMBA 1SI1A 2O1MA 5HM4B 4KCCA 5EQ8A 1Y3NA 3FGSA 1Q9DA 2YLNA 5IZ3B 5BWJA 2RF1A 4OA4A 2UVHA 3U1OA 3PUVE 4R2BA 1ZKBA 3U65A 1FQDA 5I59A 2VP1A 3A29A 2F34A 2VGQA 1FTAA 1JEVA 3H4ZA 2R71A 4BDNA 4OVPA 2V25A 3QMFA 4OMBA 3FXUA 4P3LA 1BIYA 2KLFA 4RA1A 3IFAA 2GFEA 2DWJA 4RXLA 2PCRA 4F39A 1JQFA 3FVGA 1FQBA 3BIHA 5AA1A 1UTHA 4NF8A 5ITOA 4ZEBA 4N17A 1K9YA 1FTOA 5H8NB 4H0WA 4QFLA 1I6QA 4JBZA 3PMXA 4JVDA 4NEDA 1FPDA 5I57B 5L9MA 3TCHA 4OERA 4NTLA 1POY1 2REGA 4X04A 4DE8A 3C33A 3HCQA 4R74A 1Q1KA 1EH3A 1IMAA 1H44A 3QUJA 4GX6A 2QS3A 2DE2A 4RJZA 5I7IA 4GWYA 4PDDA 4FORA 4OFJA 2UVJA 2YJPA 4MEVA 5F7VA 4PQJA 2B3FA 3ONMA 4GXSB 1M5DA 1DPPA 3CG3A 1Y20A 3IO4A 2G93A 4F18A 2F7CA 4KCDA 2GHAA 1LBXA 5ICQA 4C1UA 2DQVA 1LBYA 2DE3A 3R7XA 3MZBA 1SW5A 3CR9A 2Z22A 3M3LA 2H9BA 3QK6A 4ND9A 2W7YA 4R6YA 2JJKA 3OMBA 2HPGA 3G3FA 1OLAA 1PB7A 4UA8A 3UP9A 1B9JA 5IAIA 2B65A 1D9VA 5I2NA 1USYH 5EQAA 3ZS6A 4MNCA 1NKXA 3P7IA 4GWUA 3BBRA 4NGUA 4ZDMA 4TLMB 1B7HA 2Q2CA 5B70A 4FIMA 3LV0A 4XIGQ 1MG1A 4GD5A 3KN8A 4YB6A 4YKJA 3OENA 1IXGA 4N4UA 1VE4A 3KZGA 2WYKA 1I69A 5DEXA 1DMBA 2I48A 3FVKA 3CSBA 4GLIA 3LUZA 4PE3A 3ECRA 3C9HA 2CMOA 3HO7A 4IY5A 1JVXA 1B3LA 3KSXA 3M3KA 1LCTA 2ZYOA 4BLAA 2AL5A 3S9MC 1FQEA 3GBAA 5FHMA 2DWIA 4KHZE 2HEUA 2WX9A 3IK6B 1GVCA 1LBCA 1KZ8A 3U92A 2QS4A 2FA7A 5I2KA 5DVIA 1JW5A 4JB7A 4ESWA 3RPWA 2Y7PA 4R9FA 4MH5A 3E3KA 4GL8A 3SDFA 1L5TA 1NNFA 3SEYA 3TPAA 1N3XA 4NF5B 3JV9A 2I3WA 1NUXA 2XXRA 5FBPA 2R8TA 1B4HA 1PBQA 2ZNSA 1LFIA 1S7YA 5JK4A 1NV7A 1INPA 1MH3A 3IOWA 3VV5A 3OEMA 5IZ3A 4I8CA 3OD7A 3KBZA 3H6VA 1NI9A 3T9UA 2VPNA 1R9LA 5CRYA 1MS7A 2Z8EA 4NQ8A 1DK4A 3KBRA 4PFUA 4Q0CA 1MQDA 4OTEA 5TP9B 1P1WA 1QUIA 4GBWA 2UYEA 2PT2A 3T96B 2NUVA 1SDXA 3LUYA 1SPIA 2HXRA 4IO4A 2UVGA 3MSTA 3OSQA 2ZMBA 4ZZAA 1NUWA 3G3HA 3GXAA 2XD3A 2R6GE 3GYYA 1DCUA 4ELQA 3H3GA 3OSRA 1LAHE 3FBPA 3S9LC 5JTYB 4O3CA 1FBPA 5A5XB 1ZTYA 3MJNA 4N13A 5CI5A 5DW8A 1O7TA 1FTMA 1XC1A 2GHBA 3TKDA 1NNPA 1RYOA 3O9PA 1P1QA 4JWXA 4EQ7A 2H98A 5EQ9A 4LUBA 2KR0A 1YYZA 1PB9A 2XXKA 4F3SA 4YAHX 4P1EA 4NX1A 2FNCA 4GWXA 1FQFA 3KFMA 1DOTA 3BIGA 3IB1A 3V5AA 3FASA 3VVFA 3K1PA 4XKQA 1ZIUA 4JWOA 4ECFA 1XVXA 4MBPA 1AWBA 5EYGA 2CZIA 5I84A 4GF8A 4PFTA 4PGNA 4IGRA 4G77A 4O3BA 2CEXA 2ZZVA 1CNQA 3RNNA 2NXOA 1IUDA 1KWHA 4GXAA 2RCBA 5H8FB 3SEUA 1YTVA 3H6UA 3IJOB 3RYDA 4LQ2A 4WXJA 3IJXB 4JVCA 1MPBA 3TDJA 4MF3A 2F6GA 4L17A 4TQUQ 1JW4A 1UTHB 4PFYA 4X48A 4QSDA 2DWAA 3LSLA 4QFOA 1US4A 3CFLA 3V89B 3FXBA 4E0XA 4H67A 5DYHA 4X8RA 3MVWA 2AIXA 3FVOA 4U21A 5HBCA 2DYXA 2FBPA 3OO8A 4ZEKA 3VVEA 1POTA 2P1SA 2DXYA 1MY3A 2VHAA 3O6HA 1B4ZA 1URSA 2Q2AA 4AB6A 1N7WA 3RTWB 1Q35A 4LZ5A 1QVSA 2OBGA 5BUUA 3IOUA 3S4UA 4KD5A 3MYUA 1G0HA 3EF7A 1SBPA 4EXLA 1FPJA 1S9TA 3QSLA 4MNIA 2Q88A 4MIJA 1B3GA 1KA1A 2HAVA 2V3UA 1NH8A 5EYFA 2I4CA 2X26A 2B4LA 4P11A 3SEWA 4NF6A 1FPEA 4H8JA 4JDFA 4KYEA 4NF5A 2Q8JA 1PBPA 1IQ7A 4LN5A 4KQPA 3QAXA 3E9XA 4IO6A 2QMXA 4QBAA 4X1DA 1DPEA 3VLWA 1Y4TA 2ZZXA 1FBGA 5K2XA 2Y7IA 1MRPA 4GIZA 2FHYA 2H25A 1SQYA 1IXIA 4N8YA 4OZ9A 5DEXB 1FQAA 4O94A 4N91A 4DXCA 1B5HA 4P0GA 4YKIA 4F19A 4FEBA 3IOTA 4OYVA 4PTKA 4F3PA 1EU8A 3EHUA 3UORA 2A5SA 3G7WA 3TZAA 5LTCA 2OJTA 1P1NA 3FVNA 1N7XA 4O7MA 4MHFA 4ISUA 5JTYA 2L5VA 1NV1A 2UVIA 4OXVA 4N8GA 5I2KB 4GL0A 4TOZA 4HE1A 4WKMA 4P9KA 1B1HA 4P1LA 2P2AA 5DT6A 4PFIA 5I3SA 1MPDA 3CG1A 5FHOA 3PUYE 4MX6A 2Y84A 4DI3D 2XXQA 1EYIA 3PPPA 1F9BA 3O2AA 1MDP1 4LA9A 4M1VA 3KEIA 1MM6A 4U1ZA 2BJIA 3VLVA 3UA8A 4HCYA 5LDZA 5DTBA 3K4UA 2RCAA 2V3TA 2ZZWA 1FPLA 2WEFA 4N81A 1B05A 1A8FA 1B3HA 3PPOA 2PFZA 5F1QA 1GGGA 4JVIA 1UIUA 2PT1A 2PX1A 3T66A 4Z7EA 4O3AA 3T9XB 5J16A 3NOHA 1AL3A 5H8FA 4F2QA 3K2DA 4QXDA 1MY1A 4LZ7A 1N3WA 4LATA 3L6HA 1ZU0A 4P0IA 4HXVA 2X7QA 3CHGA 3FD3A 4NF4A 5ET7A 1D4NA 4QSCA 3T9HB 2XXTA 4LVQA 3SETA 1LSTA 1SVXB 4HCWA 4FATA 3CVGA 1VR5A 4ZEIA 4DCXA 4FAJA 2V4CA 4G68A 1LBBA 4MFIA 4XFEA 1LFGA 4NF0A 3MPKA 3ROJA 3Q25A 3RTFB 4NE4A 4LQ5A 1FBHA 2I4BA 1NUZA 4QSEA 3RQTA 4MJOA 1IMCA 2QJEA 1DSNA 4ONYA 1SYIA 1B5JA 1FQCA 3K02A 4H6DA 1M5BA 1MXYA 2QFLA 1JEUA 2CZLA 2HQ0A 4PC9A 2XWOA 3C34A 1R1NA 3ILUB 4NN3A 4I3YA 5KCJA 1G0IA 2XWIA 1SD3A 4EQBA 2F5XA 5H8SA 2PMSA 1PEBA 1YPNA 3G3KA 2VT5A 1YZ0A 5CM6A 1QUJA 5AA3A 2FIXA 2F8DA 3UN6A 5IZZA 2ZYMA 3MQ9A 4N6DA 3HHGA 1NV4A 3FXQA 2THIA 4DCYA 4PFWA 3K01A 4DXUA 1FJ9A 2XXWA 3MUQA 4U2RA 3PPRA 4ZEFA 5ET8A 3HSTA 3FIRA 2I6EA 1FCKA 2XX8A 2ZYNA 4G2ZA 1XI6A 3GZGA 1Y3QA 4XF5A 5ET5A 1SYHA 1NUYA 1URGA 4ELRA 1MQGA 2QPQA 2GQ1A 2HZKA 4QFNA 5A5LA 1YAEA 3K1NA 2O51A 2WBBA 4EXKA 1BLFA 5J1DA 1MM7A 5H8QA 2H99A 2ONRA 2NOOA 4FE8A 3IFCA 4NF6B 3TTLA 4NWCA 4GX4A 3OO9A 2D21A 2VD3A 1VDWA 3LSXA 3BFTA 3K00A 1ZLQA 2Q9TA 1AH5A 3K1MA 1US5A 4POWA 1O64A 2I0CA 2D5WA 3Q27A 1SI0A 1QULA 1HSLA 3AXFA 5ISUA 3FZVA 1OQHA 3I6VA 4IGTA 3USDA 1Y1MA 4XKPA 5I58A 2QSXA 4P8BA 2H4IA 3RUMA 3HPIA 3IL1B 4QF9A 1NNTA 3BFUA 2O69A 4BDQA 1OLCA 3O97A 4QHQA 2XA5A 2F35A 1NV6A 1ZBMA 5I5PA 3WAEA 2H5YA 1UQWA 4HE0A 1JVYA 4LZ8A 1HSJA 3MBPA 2Z8FA 4GQOA 2XXUA 2OX3A 3ZKKA 3VXBA 3RN8A 1UTBA 1LB9A 1B6HA 3OO7A 1TT1A 4PAFA 4AS5A 3LC8A 3QYTA 1B7UA 2I0BA 4KYDA 4PAIA 1LB8A 3TFLA 1XOCA 2Q74A 4BDLA 1Z7ME 1LFHA 1QUKA 1IXHA 4C1TA 1B52A 4GWWA 2R9JA 2Y7KA 2QS1A 2XWVA 2CEYA 4GVOA 3TYHA 5LOMA 4YB5A 1IIWA 4IO5A 4P56A 3FV1A 1S50A 5M2VA 3R26A 2AL4A 1II5A 3TTKA 1K9ZA 4U4XA 4OESA 4GWOA 1EYJA 2XXPA 4YMAA 4N15A 1LBVA 4QFKA 1OVTA 2DSFA 1N0TA 1HSEA 4EF1A 3I5OA 2REJA 3ZKLA 1H76A 3C32A 3MC2A 3C31A 4G4PA 5AA2D 1FPBA 1IEJA 3SESA 3K6XA 4YB7A 1RDXA 4WEPA 3PUZE 1P1UA 1OIBA 1D3KA 2QMWA 4DXBA 4NF4B 3EN3A 2F7BA 3B6WA 1FJ6A 1LBWA 4F1YA 1Y1ZA 4XEQA 1R6ZA 1P99A 3T93B 3CI8A 3MP8A 4PP0A 3RLFE 5AE4A 1H43A 1MXUA 5ESYA 3DELB 1ANFA 3O28A 4G68B 3U72A 3FUZA 4YICA 1Z7NE 1AIVA 3KOTA 2P3NA 3B50A 3TEPA 4DI4B 3M3FA 2PYYA 3N6UA 3T22A 2DOJA 4LONB 3KC0A 1ELJA 2QVRA 4OVTA 2OZZA 4JSOA 4YU0A 3OOAA 2ONSA 4YZZA 5L8DA 1B46A 4C0RA 1MXWA 2QVVA 3VVDA 1B7ZA 5I56B 4Q8RA 3LR1A 1FPGA 2NVUB 4XXUA 3PMWA 4G68C 5ICTA 5KCJB 3DP8A 2RINA 1R9QA 1LGBC 4F29A 5AA4B 4PETA 1NV5A 4IY6A 4UABA 4HTGA 3Q26A 3VLUA 3U8QA 1B1XA 3MPLA 4RNSA 3CIJA 3MW0A 1SW2A 3C35A 2UYFA 3IX1A 4GWSA 3TQWA 2F3BA 3DLNA 3SEXA 4FEDA 1B40A 3FV2A 5DVFA 4F2OA 4GOTA 3RT8A 4PBQA 4PCDA 3GBBA 4PFBA 3RT6B 3LBSA 5K2YA 1RDYA 4QRZA 3EKIA 4O7IA 4R73A 5B7DA 4R72A 4MMPA 1IMFA 3B6QA 4IO7A 4H65A 3BKIB 2F7AA 1AOVA 3RPLA 3QUFA 1MQHA 4XKNA 1IMEA 2IA4A 5EHMA 4R2FA 5TPAA 3TELA 1A99A 4RPOA 3N26A 3O6GA 1NNKA 1B3EA 2ZXTA 2LAOA 4FECA 1MXZA 1QJMA 2P0SA 3TODA 3DP6A 2WKYA 4H5FA 1JETA 3CFZA 5H8QB 4MAGA 3Q28A 1BKAA 1VFEA 1FPFA 3F11A 4ZECA 2OCUA 2V93A 1AMFA 2Z8DA 2I3VA 4NWDA 1B58A 2M8CA 3ODBA 2ZNUA 1FPIA 3H7MA 4KPTA 3SZPA 1A54A 3LSFB 3MWBA 4ZZEA 2HCAA 1I6AA 2XD2A 1B51A 1FBEA 1NFTA 2FVZA 3H06B 5I58B 3FJGA 4GWZA 1BP5A 3TCFA 2E0SA 3OEKA 4KYSA 2F36A 2NWJA 4OENA 2DDKA 1UIVA 1FRPA 2QRYA 1PC3A 1N76A 2Y7RA 3EPEA 1NV0A 3KN3A 2YPNA 4EQ9A 1LLSA 2Y5LA 5EQ7A 2VPOA 1H45A 1OQGA 5HPQA 1N04A 4F22A 4NG7A 3DP4A 4RY1A 3G3JA 3KSJA 3MZ1A 1EYKA 4X9TA 1B0HA 2O6AA 3RGYA 1UTBB 5CBRA 4G8NA 3C4MA 5CBSA 2DVZA 4ELOA 4R9GA 4DZ1A 3HHFA 2HZLA 3ILTB 3QXMA 4JSDA 2QS2A 3W9WA 4U1OA 2DS9A 4PE5B 2X7PA 1YCJA 4DIGA 2F3DA 4OEUA 3D4GA 4MLVA 2O7IA 4F1UA 1GV8A 3HN0A 5DVJA 4AB5A 4R6HA 1DTZA 2O84X 1IITA 2RC7A 3M8UA 1B3FA 4G61A 2PVUA 3W9VA 2OK2A 3FJMA 1FBFA 1NMUA 3VDFA 3KN7A 1VFDA 2MKZA 5I56A 2ZYKA 2G29A 3PTYA 5AA2A 1XVYA 5ITPA 4RK2A 2HHMA 4Q30B 1TFAA 3IOVA 3TAJA 1MXVA 3H6WA 5AA4A 3CSGA 4EDPA 1SW4A 3PPQA 2QVUA 1RKMA 1FSAA 3S9NC 5IGAA 1IMDA 3B7DA 2Q89A 2CZKA 3IAZA 3N94A 1NH7A 3MAMA 4E0WA 3KJ7A 2WYPA 3EHSA 4Q5TA 3G3GA 4U4SA 4RPNA 2ANJA 1I6BA 1T0KA 1LAGE 3TTNA 4I9DA 3PUWE 2XWKA 4F3BA 5IZ1A 3UK4A 3KJTA 3VFJA 2Z23A 5EHSA 1NV3A 3MVXA 1JW1A 1RDZA 1B0LA 1VSOA 2XXXA 3VE1B 3ISPA 2F78A 5EYHA 5F24A 1P1OA 3RY3A 2DE4A 1EZOA 3IB2A 1QGXA 2XXHA 2WBDA 3CRBA 5KDTA 4PAKA 2D3IA 2A5TA 4OHNA 3D4CA 3L6GA 1ZJLA 2FIEA 3TCGA 5CMMA 3MVYA 3E13X 4IO3A 3IORA 4XTCQ 3TUSA 1TFDA 4DDDA 5FHNA 1M5EA 2XXVA 2DWHA 4MCOA 2OLBA 4XKRA 2ZNTA 4OQOA 3H03A 1MY4A 1FTKA 1PDAA 3A09A 3PUXE 4KFQA 2XX7A 4DLDA 4AQ4A 1SW1A 5H8HA 2I58A 3FATA 3MVZA 4OWDA 3B8BA 2AYSA
chains in the Genus database with same CATH topology
4G8HA 2PBWA 1GR2A 3U93A 1LAXA 3DM0A 3PD8A 2Y7WA 3TTRA 1J1NA 1QW0A 4ZS9A 4THIA 5L9SA 2HFBA 4H5GA 3A3UA 4MLQA 1D9YA 3WAFA 2XXIA 3H6TA 2QL3A 2GRVA 5IKBA 1ZMGA 3A3CA 3TMGA 1WDNA 5TPAB 3PD9A 4EUOA 4F1VA 1JNFA 3JZJA 3QIMA 3OELA 2OWSA 2F97A 4H1XA 4UACA 4K3FA 4N6PA 1WODA 1MPCA 1N84A 3SKPA 4BDOA 4OETA 4HW8A 1B5IA 1A8EA 1FTLA 2ESNA 3V83A 1QKAA 1GTKA 5H8NA 1MY2A 5FTHA 4U22A 2BJJX 4YKKA 1FW0A 5CMKA 4OVJA 5I57A 4BDRA 2V84A 4YKPA 2E1SA 4IB2A 3EHTA 3R6UA 4KR5A 3N5LA 1O63A 3OXNA 4GRKA 4U23A 5KZTA 3PMVA 1MY0A 1TWYA 3THIA 3JYRA 1A7LA 3CFXA 3N6TA 4WEDA 4ESXA 1TXFA 5I59B 5FTIA 1OMPA 3FXRA 4JXIA 2DP8A 2O1LA 3W15C 3OO6A 3Q29A 1M5CA 2DXRA 4LP2B 1B2HA 1XHYA 1A40A 1MQIA 2RKMA 1EZ9A 4R6KA 1MDQA 5CC2A 3FJ7A 4POXA 3PPNA 4X1BA 4ZEDA 4JWYA 4OEVA 4NMYA 4F3GA 1B32A 4NF8B 1IZ1A 3IB0A 4EF2A 3SEVA 3C36A 3HV1A 3O6IA 1Y9UA 3O66A 3MP1A 3MZ9A 2ALUA 4OFLA 4H8IA 3V8XB 3PGFA 4G8MA 4GFRA 3UIFA 2I49A 3MP6A 3LSWA 1PB8A 3PU5A 4QFPA 1A55A 3U94A 2B3BA 3O29A 4TLLB 3I3VA 3VXCA 4ZE8A 1LAFE 3K6UA 3ZSFA 4FJPA 4BDMA 2F6PA 5AA2B 4I1DA 2UXAA 1QKBA 3TTMA 1CE2A 2FYIA 1Y4CA 3IR1A 4ELPA 3KOSA 2O68A 2VOZA 3B6TA 3SERA 4I62A 1BTJA 2RC8A 2RC9A 3PV0E 2HAUA 1LCFA 5ELVA 3UGWA 3KGCA 2ONKE 4N07A 5I2NB 2HXWA 3E4RA 1ATGA 2XXYA 1CB6A 4R75A 3IO6A 1M5FA 2XHDA 3KG2A 3K6WA 3G3IA 3K6VA 4Z0IA 4KI0E 4RYAA 2OWTA 1OVBA 1MXXA 1DTGA 1USYE 4HS7A 4IO2A 2GH9A 3T9VA 3EQ1A 5TP9A 5TU0A 3K0VA 5KDTB 4OFOA 2A5TB 4F31B 3GLBA 2ABHA 1H3DA 2O7UA 1MH4A 3TQLA 1XS5A 2DVCA 1URDA 1WVJA 2IEEA 1Y3PA 5JEIA 3S2VA 5A5XA 1EZPA 1MQJA 5CMCA 1RYXA 2V3QA 2VD2A 5L9OA 4M4GA 3S9EA 1XT8A 4ZE9A 1NL5A 1IXCA 1FTJA 4RK9A 5H8HB 2XX9A 4YMBA 5CMBA 1SI1A 2O1MA 5HM4B 4KCCA 1Y3NA 3FGSA 2YLNA 5BWJA 2RF1A 2UVHA 3U1OA 3PUVE 4R2BA 1ZKBA 1FQDA 5I59A 2VP1A 2F34A 2VGQA 1JEVA 3H4ZA 2R71A 4BDNA 2V25A 4OMBA 3FXUA 1BIYA 2KLFA 4RA1A 2GFEA 2DWJA 4RXLA 4F39A 1JQFA 3FVGA 1FQBA 5AA1A 1UTHA 4NF8A 5ITOA 4ZEBA 1FTOA 5H8NB 4H0WA 4QFLA 1I6QA 4JBZA 3PMXA 4NEDA 5I57B 5L9MA 3TCHA 4OERA 4NTLA 1POY1 2REGA 4DE8A 3C33A 3HCQA 4R74A 1Q1KA 1EH3A 1H44A 3QUJA 2QS3A 2DE2A 4RJZA 4FORA 4OFJA 2UVJA 2YJPA 5F7VA 4PQJA 2B3FA 3ONMA 4GXSB 1M5DA 1DPPA 3CG3A 1Y20A 3IO4A 2G93A 4F18A 2F7CA 4KCDA 2GHAA 5ICQA 4C1UA 2DQVA 2DE3A 3R7XA 3MZBA 1SW5A 3CR9A 2Z22A 3M3LA 2H9BA 3QK6A 4ND9A 2W7YA 4R6YA 3OMBA 3G3FA 1OLAA 1PB7A 4UA8A 3UP9A 1B9JA 5IAIA 2B65A 1D9VA 5I2NA 1USYH 3ZS6A 1NKXA 3P7IA 3BBRA 4ZDMA 4TLMB 1B7HA 2Q2CA 5B70A 4FIMA 4XIGQ 1MG1A 4GD5A 3KN8A 4YB6A 4YKJA 3OENA 1IXGA 1VE4A 3KZGA 1I69A 5DEXA 1DMBA 2I48A 3FVKA 3CSBA 4GLIA 3ECRA 3C9HA 2CMOA 3HO7A 4IY5A 1JVXA 1B3LA 3KSXA 3M3KA 1LCTA 2ZYOA 4BLAA 2AL5A 3S9MC 1FQEA 3GBAA 5FHMA 2DWIA 4KHZE 2HEUA 3IK6B 1GVCA 1LBCA 3U92A 2QS4A 2FA7A 5I2KA 5DVIA 1JW5A 4JB7A 4ESWA 3RPWA 2Y7PA 4R9FA 4MH5A 3E3KA 4GL8A 3SDFA 1L5TA 1NNFA 3SEYA 3TPAA 1N3XA 4NF5B 3JV9A 2I3WA 2XXRA 1B4HA 1PBQA 2ZNSA 1LFIA 1S7YA 5JK4A 1MH3A 3IOWA 3VV5A 3OEMA 4I8CA 3OD7A 3H6VA 3T9UA 1R9LA 5CRYA 1MS7A 2Z8EA 3KBRA 4PFUA 4Q0CA 1MQDA 4OTEA 5TP9B 1P1WA 1QUIA 2UYEA 2PT2A 3T96B 2NUVA 1SDXA 3LUYA 4IO4A 2UVGA 3OSQA 2ZMBA 4ZZAA 3G3HA 3GXAA 2XD3A 2R6GE 4ELQA 3H3GA 3OSRA 1LAHE 3S9LC 5JTYB 4O3CA 5A5XB 1ZTYA 3MJNA 4N13A 5CI5A 1O7TA 1FTMA 1XC1A 2GHBA 3TKDA 1NNPA 1RYOA 3O9PA 1P1QA 4JWXA 4EQ7A 2H98A 4LUBA 1PB9A 4F3SA 4YAHX 2FNCA 1FQFA 3KFMA 1DOTA 3IB1A 3V5AA 3FASA 3VVFA 3K1PA 4XKQA 1ZIUA 4JWOA 4ECFA 1XVXA 4MBPA 5I84A 4GF8A 4PFTA 4IGRA 4G77A 4O3BA 3RNNA 2NXOA 1IUDA 1KWHA 4GXAA 2RCBA 5H8FB 3SEUA 1YTVA 3H6UA 3IJOB 4LQ2A 4WXJA 3IJXB 1MPBA 3TDJA 4MF3A 2F6GA 4L17A 4TQUQ 1JW4A 1UTHB 4PFYA 4X48A 4QSDA 2DWAA 3LSLA 4QFOA 1US4A 3CFLA 3V89B 4E0XA 4H67A 5DYHA 3MVWA 2AIXA 3FVOA 4U21A 5HBCA 2DYXA 3OO8A 4ZEKA 3VVEA 1POTA 2P1SA 2DXYA 1MY3A 2VHAA 3O6HA 1B4ZA 1URSA 2Q2AA 4AB6A 1N7WA 3RTWB 1Q35A 4LZ5A 1QVSA 2OBGA 5BUUA 3IOUA 3S4UA 4KD5A 3EF7A 1SBPA 4EXLA 1S9TA 3QSLA 2Q88A 1B3GA 2HAVA 2V3UA 1NH8A 5EYFA 2I4CA 2X26A 4P11A 3SEWA 4NF6A 4H8JA 4JDFA 4KYEA 4NF5A 2Q8JA 1PBPA 1IQ7A 4KQPA 3QAXA 3E9XA 4IO6A 2QMXA 4X1DA 1DPEA 3VLWA 1Y4TA 5K2XA 2Y7IA 1MRPA 4GIZA 2H25A 1SQYA 1IXIA 4OZ9A 5DEXB 1FQAA 4DXCA 1B5HA 4P0GA 4YKIA 4F19A 4FEBA 3IOTA 4OYVA 4F3PA 1EU8A 3EHUA 3UORA 2A5SA 3G7WA 3TZAA 2OJTA 1P1NA 3FVNA 1N7XA 4ISUA 5JTYA 2UVIA 4OXVA 5I2KB 4GL0A 4TOZA 4WKMA 1B1HA 2P2AA 5DT6A 1MPDA 3CG1A 5FHOA 3PUYE 2Y84A 2XXQA 3PPPA 1F9BA 3O2AA 1MDP1 4LA9A 4M1VA 3KEIA 1MM6A 4U1ZA 3VLVA 3UA8A 4HCYA 5DTBA 3K4UA 2RCAA 2V3TA 1B05A 1A8FA 1B3HA 3PPOA 5F1QA 1GGGA 3T66A 1UIUA 2PT1A 2PX1A 4Z7EA 4O3AA 3T9XB 1AL3A 5H8FA 4F2QA 3K2DA 1MY1A 4LZ7A 1N3WA 4LATA 3L6HA 1ZU0A 4P0IA 2X7QA 3FD3A 4NF4A 1D4NA 4QSCA 3T9HB 2XXTA 4LVQA 3SETA 1LSTA 1SVXB 4HCWA 4FATA 3CVGA 1VR5A 4ZEIA 4DCXA 4FAJA 4G68A 1LBBA 4MFIA 1LFGA 3MPKA 3Q25A 3RTFB 4NE4A 4LQ5A 2I4BA 4QSEA 3RQTA 2QJEA 1DSNA 4ONYA 1SYIA 1B5JA 1FQCA 3K02A 4H6DA 1M5BA 1MXYA 1JEUA 2CZLA 2HQ0A 3C34A 1R1NA 3ILUB 5KCJA 1SD3A 4EQBA 2F5XA 5H8SA 2PMSA 1PEBA 1YPNA 3G3KA 5CM6A 1QUJA 5AA3A 2F8DA 3UN6A 2ZYMA 3MQ9A 3HHGA 3FXQA 2THIA 4DCYA 4PFWA 3K01A 4DXUA 2XXWA 3MUQA 4U2RA 3PPRA 4ZEFA 3HSTA 3FIRA 2I6EA 1FCKA 2XX8A 2ZYNA 4G2ZA 3GZGA 1Y3QA 1SYHA 1URGA 4ELRA 1MQGA 2QPQA 2HZKA 4QFNA 1YAEA 3K1NA 2O51A 4EXKA 1BLFA 5J1DA 1MM7A 5H8QA 2H99A 2ONRA 2NOOA 4FE8A 4NF6B 3TTLA 4NWCA 3OO9A 2D21A 2VD3A 3LSXA 3BFTA 3K00A 1ZLQA 2Q9TA 1AH5A 3K1MA 1US5A 4POWA 1O64A 2I0CA 2D5WA 3Q27A 1SI0A 1QULA 1HSLA 3AXFA 5ISUA 3FZVA 1OQHA 3I6VA 4IGTA 3USDA 1Y1MA 4XKPA 5I58A 2QSXA 2H4IA 3RUMA 3HPIA 3IL1B 4QF9A 1NNTA 3BFUA 2O69A 4BDQA 1OLCA 3O97A 4QHQA 2F35A 1ZBMA 3WAEA 2H5YA 1UQWA 1JVYA 4LZ8A 1HSJA 3MBPA 2Z8FA 4GQOA 2XXUA 3ZKKA 3VXBA 3RN8A 1UTBA 1LB9A 1B6HA 3OO7A 1TT1A 3LC8A 3QYTA 1B7UA 2I0BA 4KYDA 1LB8A 3TFLA 1XOCA 4BDLA 1Z7ME 1LFHA 1QUKA 1IXHA 4C1TA 1B52A 2R9JA 2Y7KA 2QS1A 4GVOA 3TYHA 5LOMA 4YB5A 1IIWA 4IO5A 3FV1A 1S50A 5M2VA 3R26A 2AL4A 1II5A 3TTKA 4U4XA 4OESA 4GWOA 2XXPA 4YMAA 4QFKA 1OVTA 2DSFA 1N0TA 1HSEA 4EF1A 3I5OA 2REJA 3ZKLA 1H76A 3C32A 3MC2A 3C31A 4G4PA 5AA2D 1IEJA 3SESA 3K6XA 4YB7A 4WEPA 3PUZE 1P1UA 1OIBA 1D3KA 2QMWA 4DXBA 4NF4B 3EN3A 2F7BA 3B6WA 4F1YA 1Y1ZA 1R6ZA 1P99A 3T93B 3CI8A 3MP8A 4PP0A 3RLFE 5AE4A 1H43A 1MXUA 3DELB 1ANFA 3O28A 4G68B 3U72A 3FUZA 4YICA 1Z7NE 1AIVA 3KOTA 3TEPA 3M3FA 2PYYA 3N6UA 3T22A 2DOJA 4LONB 1ELJA 2OZZA 4JSOA 4YU0A 3OOAA 2ONSA 4YZZA 5L8DA 1B46A 4C0RA 1MXWA 3VVDA 1B7ZA 5I56B 4Q8RA 3LR1A 2NVUB 4XXUA 3PMWA 4G68C 5ICTA 5KCJB 3DP8A 2RINA 1R9QA 1LGBC 4F29A 5AA4B 4PETA 4IY6A 4HTGA 3Q26A 3VLUA 3U8QA 1B1XA 3MPLA 4RNSA 3CIJA 3MW0A 1SW2A 3C35A 2UYFA 3IX1A 3TQWA 3DLNA 3SEXA 4FEDA 1B40A 3FV2A 5DVFA 4F2OA 4GOTA 3RT8A 3GBBA 3RT6B 3LBSA 5K2YA 4QRZA 4R73A 5B7DA 4R72A 3B6QA 4IO7A 4H65A 3BKIB 2F7AA 1AOVA 3QUFA 1MQHA 4XKNA 2IA4A 5EHMA 4R2FA 5TPAA 3TELA 1A99A 4RPOA 3N26A 3O6GA 1NNKA 1B3EA 2ZXTA 2LAOA 4FECA 1MXZA 1QJMA 2P0SA 3TODA 3DP6A 2WKYA 4H5FA 1JETA 3CFZA 5H8QB 3Q28A 1BKAA 1VFEA 3F11A 4ZECA 2OCUA 2V93A 1AMFA 2Z8DA 2I3VA 4NWDA 1B58A 2M8CA 3ODBA 2ZNUA 3H7MA 4KPTA 1A54A 3LSFB 3MWBA 4ZZEA 2HCAA 1I6AA 2XD2A 1B51A 1NFTA 3H06B 5I58B 3FJGA 1BP5A 3TCFA 2E0SA 3OEKA 4KYSA 2F36A 2NWJA 4OENA 1UIVA 2QRYA 1PC3A 1N76A 2Y7RA 3EPEA 3KN3A 2YPNA 4EQ9A 1LLSA 1H45A 1OQGA 5HPQA 1N04A 4F22A 3DP4A 4RY1A 3G3JA 3KSJA 3MZ1A 4X9TA 1B0HA 2O6AA 3RGYA 1UTBB 5CBRA 4G8NA 3C4MA 5CBSA 2DVZA 4ELOA 4R9GA 4DZ1A 3HHFA 2HZLA 3ILTB 3QXMA 4JSDA 2QS2A 3W9WA 4U1OA 2DS9A 4PE5B 2X7PA 1YCJA 4DIGA 4OEUA 3D4GA 4MLVA 2O7IA 4F1UA 1GV8A 3HN0A 5DVJA 4AB5A 4R6HA 1DTZA 2O84X 1IITA 2RC7A 3M8UA 1B3FA 2PVUA 3W9VA 2OK2A 3FJMA 1NMUA 3VDFA 3KN7A 1VFDA 5I56A 2ZYKA 2G29A 5AA2A 1XVYA 5ITPA 4RK2A 4Q30B 1TFAA 3IOVA 3TAJA 1MXVA 3H6WA 5AA4A 3CSGA 4EDPA 1SW4A 3PPQA 1RKMA 3S9NC 3B7DA 2Q89A 3IAZA 3N94A 1NH7A 3MAMA 4E0WA 3KJ7A 3EHSA 4Q5TA 3G3GA 4U4SA 4RPNA 2ANJA 1I6BA 1T0KA 1LAGE 3TTNA 4I9DA 3PUWE 4F3BA 3UK4A 3KJTA 3VFJA 2Z23A 5EHSA 3MVXA 1JW1A 1B0LA 1VSOA 2XXXA 3VE1B 2F78A 1P1OA 3RY3A 2DE4A 1EZOA 3IB2A 2XXHA 3CRBA 5KDTA 2D3IA 2A5TA 4OHNA 3D4CA 3L6GA 1ZJLA 3TCGA 5CMMA 3MVYA 3E13X 4IO3A 3IORA 4XTCQ 3TUSA 1TFDA 4DDDA 5FHNA 1M5EA 2XXVA 2DWHA 2OLBA 4XKRA 2ZNTA 4OQOA 3H03A 1MY4A 1FTKA 1PDAA 3A09A 3PUXE 4KFQA 2XX7A 4DLDA 4AQ4A 1SW1A 5H8HA 2I58A 3FATA 3MVZA 4OWDA 2AYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G8H A;  2PBW A;  1GR2 A;  3U93 A;  1LAX A;  3DM0 A;  3PD8 A;  2Y7W A;  3TTR A;  1J1N A;  1QW0 A;  4ZS9 A;  4THI A;  5L9S A;  2HFB A;  4H5G A;  3A3U A;  4MLQ A;  1D9Y A;  3WAF A;  2XXI A;  3H6T A;  2QL3 A;  2GRV A;  5IKB A;  1ZMG A;  3A3C A;  3TMG A;  1WDN A;  5TPA B;  3PD9 A;  4EUO A;  4F1V A;  1JNF A;  3JZJ A;  3QIM A;  3OEL A;  2OWS A;  2F97 A;  4H1X A;  4UAC A;  4K3F A;  4N6P A;  1WOD A;  1MPC A;  1N84 A;  3SKP A;  4BDO A;  4OET A;  4HW8 A;  1B5I A;  1A8E A;  1FTL A;  2ESN A;  3V83 A;  1QKA A;  1GTK A;  5H8N A;  1MY2 A;  5FTH A;  4U22 A;  2BJJ X;  4YKK A;  1FW0 A;  5CMK A;  4OVJ A;  5I57 A;  4BDR A;  2V84 A;  4YKP A;  2E1S A;  4IB2 A;  3EHT A;  3R6U A;  4KR5 A;  3N5L A;  1O63 A;  3OXN A;  4GRK A;  4U23 A;  5KZT A;  3PMV A;  1MY0 A;  1TWY A;  3THI A;  3JYR A;  1A7L A;  3CFX A;  3N6T A;  4WED A;  4ESX A;  1TXF A;  5I59 B;  5FTI A;  1OMP A;  3FXR A;  4JXI A;  2DP8 A;  2O1L A;  3W15 C;  3OO6 A;  3Q29 A;  1M5C A;  2DXR A;  4LP2 B;  1B2H A;  1XHY A;  1A40 A;  1MQI A;  2RKM A;  1EZ9 A;  4R6K A;  1MDQ A;  5CC2 A;  3FJ7 A;  4POX A;  3PPN A;  4X1B A;  4ZED A;  4JWY A;  4OEV A;  4NMY A;  4F3G A;  1B32 A;  4NF8 B;  1IZ1 A;  3IB0 A;  4EF2 A;  3SEV A;  3C36 A;  3HV1 A;  3O6I A;  1Y9U A;  3O66 A;  3MP1 A;  3MZ9 A;  2ALU A;  4OFL A;  4H8I A;  3V8X B;  3PGF A;  4G8M A;  4GFR A;  3UIF A;  2I49 A;  3MP6 A;  3LSW A;  1PB8 A;  3PU5 A;  4QFP A;  1A55 A;  3U94 A;  2B3B A;  3O29 A;  4TLL B;  3I3V A;  3VXC A;  4ZE8 A;  1LAF E;  3K6U A;  3ZSF A;  4FJP A;  4BDM A;  2F6P A;  5AA2 B;  4I1D A;  2UXA A;  1QKB A;  3TTM A;  1CE2 A;  2FYI A;  1Y4C A;  3IR1 A;  4ELP A;  3KOS A;  2O68 A;  2VOZ A;  3B6T A;  3SER A;  4I62 A;  1BTJ A;  2RC8 A;  2RC9 A;  3PV0 E;  2HAU A;  1LCF A;  5ELV A;  3UGW A;  3KGC A;  2ONK E;  4N07 A;  5I2N B;  2HXW A;  3E4R A;  1ATG A;  2XXY A;  1CB6 A;  4R75 A;  3IO6 A;  1M5F A;  2XHD A;  3KG2 A;  3K6W A;  3G3I A;  3K6V A;  4Z0I A;  4KI0 E;  4RYA A;  2OWT A;  1OVB A;  1MXX A;  1DTG A;  1USY E;  4HS7 A;  4IO2 A;  2GH9 A;  3T9V A;  3EQ1 A;  5TP9 A;  5TU0 A;  3K0V A;  5KDT B;  4OFO A;  2A5T B;  4F31 B;  3GLB A;  2ABH A;  1H3D A;  2O7U A;  1MH4 A;  3TQL A;  1XS5 A;  2DVC A;  1URD A;  1WVJ A;  2IEE A;  1Y3P A;  5JEI A;  3S2V A;  5A5X A;  1EZP A;  1MQJ A;  5CMC A;  1RYX A;  2V3Q A;  2VD2 A;  5L9O A;  4M4G A;  3S9E A;  1XT8 A;  4ZE9 A;  1NL5 A;  1IXC A;  1FTJ A;  4RK9 A;  5H8H B;  2XX9 A;  4YMB A;  5CMB A;  1SI1 A;  2O1M A;  5HM4 B;  4KCC A;  1Y3N A;  3FGS A;  2YLN A;  5BWJ A;  2RF1 A;  2UVH A;  3U1O A;  3PUV E;  4R2B A;  1ZKB A;  1FQD A;  5I59 A;  2VP1 A;  2F34 A;  2VGQ A;  1JEV A;  3H4Z A;  2R71 A;  4BDN A;  2V25 A;  4OMB A;  3FXU A;  1BIY A;  2KLF A;  4RA1 A;  2GFE A;  2DWJ A;  4RXL A;  4F39 A;  1JQF A;  3FVG A;  1FQB A;  5AA1 A;  1UTH A;  4NF8 A;  5ITO A;  4ZEB A;  1FTO A;  5H8N B;  4H0W A;  4QFL A;  1I6Q A;  4JBZ A;  3PMX A;  4NED A;  5I57 B;  5L9M A;  3TCH A;  4OER A;  4NTL A;  1POY 1;  2REG A;  4DE8 A;  3C33 A;  3HCQ A;  4R74 A;  1Q1K A;  1EH3 A;  1H44 A;  3QUJ A;  2QS3 A;  2DE2 A;  4RJZ A;  4FOR A;  4OFJ A;  2UVJ A;  2YJP A;  5F7V A;  4PQJ A;  2B3F A;  3ONM A;  4GXS B;  1M5D A;  1DPP A;  3CG3 A;  1Y20 A;  3IO4 A;  2G93 A;  4F18 A;  2F7C A;  4KCD A;  2GHA A;  5ICQ A;  4C1U A;  2DQV A;  2DE3 A;  3R7X A;  3MZB A;  1SW5 A;  3CR9 A;  2Z22 A;  3M3L A;  2H9B A;  3QK6 A;  4ND9 A;  2W7Y A;  4R6Y A;  3OMB A;  3G3F A;  1OLA A;  1PB7 A;  4UA8 A;  3UP9 A;  1B9J A;  5IAI A;  2B65 A;  1D9V A;  5I2N A;  1USY H;  3ZS6 A;  1NKX A;  3P7I A;  3BBR A;  4ZDM A;  4TLM B;  1B7H A;  2Q2C A;  5B70 A;  4FIM A;  4XIG Q;  1MG1 A;  4GD5 A;  3KN8 A;  4YB6 A;  4YKJ A;  3OEN A;  1IXG A;  1VE4 A;  3KZG A;  1I69 A;  5DEX A;  1DMB A;  2I48 A;  3FVK A;  3CSB A;  4GLI A;  3ECR A;  3C9H A;  2CMO A;  3HO7 A;  4IY5 A;  1JVX A;  1B3L A;  3KSX A;  3M3K A;  1LCT A;  2ZYO A;  4BLA A;  2AL5 A;  3S9M C;  1FQE A;  3GBA A;  5FHM A;  2DWI A;  4KHZ E;  2HEU A;  3IK6 B;  1GVC A;  1LBC A;  3U92 A;  2QS4 A;  2FA7 A;  5I2K A;  5DVI A;  1JW5 A;  4JB7 A;  4ESW A;  3RPW A;  2Y7P A;  4R9F A;  4MH5 A;  3E3K A;  4GL8 A;  3SDF A;  1L5T A;  1NNF A;  3SEY A;  3TPA A;  1N3X A;  4NF5 B;  3JV9 A;  2I3W A;  2XXR A;  1B4H A;  1PBQ A;  2ZNS A;  1LFI A;  1S7Y A;  5JK4 A;  1MH3 A;  3IOW A;  3VV5 A;  3OEM A;  4I8C A;  3OD7 A;  3H6V A;  3T9U A;  1R9L A;  5CRY A;  1MS7 A;  2Z8E A;  3KBR A;  4PFU A;  4Q0C A;  1MQD A;  4OTE A;  5TP9 B;  1P1W A;  1QUI A;  2UYE A;  2PT2 A;  3T96 B;  2NUV A;  1SDX A;  3LUY A;  4IO4 A;  2UVG A;  3OSQ A;  2ZMB A;  4ZZA A;  3G3H A;  3GXA A;  2XD3 A;  2R6G E;  4ELQ A;  3H3G A;  3OSR A;  1LAH E;  3S9L C;  5JTY B;  4O3C A;  5A5X B;  1ZTY A;  3MJN A;  4N13 A;  5CI5 A;  1O7T A;  1FTM A;  1XC1 A;  2GHB A;  3TKD A;  1NNP A;  1RYO A;  3O9P A;  1P1Q A;  4JWX A;  4EQ7 A;  2H98 A;  4LUB A;  1PB9 A;  4F3S A;  4YAH X;  2FNC A;  1FQF A;  3KFM A;  1DOT A;  3IB1 A;  3V5A A;  3FAS A;  3VVF A;  3K1P A;  4XKQ A;  1ZIU A;  4JWO A;  4ECF A;  1XVX A;  4MBP A;  5I84 A;  4GF8 A;  4PFT A;  4IGR A;  4G77 A;  4O3B A;  3RNN A;  2NXO A;  1IUD A;  1KWH A;  4GXA A;  2RCB A;  5H8F B;  3SEU A;  1YTV A;  3H6U A;  3IJO B;  4LQ2 A;  4WXJ A;  3IJX B;  1MPB A;  3TDJ A;  4MF3 A;  2F6G A;  4L17 A;  4TQU Q;  1JW4 A;  1UTH B;  4PFY A;  4X48 A;  4QSD A;  2DWA A;  3LSL A;  4QFO A;  1US4 A;  3CFL A;  3V89 B;  4E0X A;  4H67 A;  5DYH A;  3MVW A;  2AIX A;  3FVO A;  4U21 A;  5HBC A;  2DYX A;  3OO8 A;  4ZEK A;  3VVE A;  1POT A;  2P1S A;  2DXY A;  1MY3 A;  2VHA A;  3O6H A;  1B4Z A;  1URS A;  2Q2A A;  4AB6 A;  1N7W A;  3RTW B;  1Q35 A;  4LZ5 A;  1QVS A;  2OBG A;  5BUU A;  3IOU A;  3S4U A;  4KD5 A;  3EF7 A;  1SBP A;  4EXL A;  1S9T A;  3QSL A;  2Q88 A;  1B3G A;  2HAV A;  2V3U A;  1NH8 A;  5EYF A;  2I4C A;  2X26 A;  4P11 A;  3SEW A;  4NF6 A;  4H8J A;  4JDF A;  4KYE A;  4NF5 A;  2Q8J A;  1PBP A;  1IQ7 A;  4KQP A;  3QAX A;  3E9X A;  4IO6 A;  2QMX A;  4X1D A;  1DPE A;  3VLW A;  1Y4T A;  5K2X A;  2Y7I A;  1MRP A;  4GIZ A;  2H25 A;  1SQY A;  1IXI A;  4OZ9 A;  5DEX B;  1FQA A;  4DXC A;  1B5H A;  4P0G A;  4YKI A;  4F19 A;  4FEB A;  3IOT A;  4OYV A;  4F3P A;  1EU8 A;  3EHU A;  3UOR A;  2A5S A;  3G7W A;  3TZA A;  2OJT A;  1P1N A;  3FVN A;  1N7X A;  4ISU A;  5JTY A;  2UVI A;  4OXV A;  5I2K B;  4GL0 A;  4TOZ A;  4WKM A;  1B1H A;  2P2A A;  5DT6 A;  1MPD A;  3CG1 A;  5FHO A;  3PUY E;  2Y84 A;  2XXQ A;  3PPP A;  1F9B A;  3O2A A;  1MDP 1;  4LA9 A;  4M1V A;  3KEI A;  1MM6 A;  4U1Z A;  3VLV A;  3UA8 A;  4HCY A;  5DTB A;  3K4U A;  2RCA A;  2V3T A;  1B05 A;  1A8F A;  1B3H A;  3PPO A;  5F1Q A;  1GGG A;  3T66 A;  1UIU A;  2PT1 A;  2PX1 A;  4Z7E A;  4O3A A;  3T9X B;  1AL3 A;  5H8F A;  4F2Q A;  3K2D A;  1MY1 A;  4LZ7 A;  1N3W A;  4LAT A;  3L6H A;  1ZU0 A;  4P0I A;  2X7Q A;  3FD3 A;  4NF4 A;  1D4N A;  4QSC A;  3T9H B;  2XXT A;  4LVQ A;  3SET A;  1LST A;  1SVX B;  4HCW A;  4FAT A;  3CVG A;  1VR5 A;  4ZEI A;  4DCX A;  4FAJ A;  4G68 A;  1LBB A;  4MFI A;  1LFG A;  3MPK A;  3Q25 A;  3RTF B;  4NE4 A;  4LQ5 A;  2I4B A;  4QSE A;  3RQT A;  2QJE A;  1DSN A;  4ONY A;  1SYI A;  1B5J A;  1FQC A;  3K02 A;  4H6D A;  1M5B A;  1MXY A;  1JEU A;  2CZL A;  2HQ0 A;  3C34 A;  1R1N A;  3ILU B;  5KCJ A;  1SD3 A;  4EQB A;  2F5X A;  5H8S A;  2PMS A;  1PEB A;  1YPN A;  3G3K A;  5CM6 A;  1QUJ A;  5AA3 A;  2F8D A;  3UN6 A;  2ZYM A;  3MQ9 A;  3HHG A;  3FXQ A;  2THI A;  4DCY A;  4PFW A;  3K01 A;  4DXU A;  2XXW A;  3MUQ A;  4U2R A;  3PPR A;  4ZEF A;  3HST A;  3FIR A;  2I6E A;  1FCK A;  2XX8 A;  2ZYN A;  4G2Z A;  3GZG A;  1Y3Q A;  1SYH A;  1URG A;  4ELR A;  1MQG A;  2QPQ A;  2HZK A;  4QFN A;  1YAE A;  3K1N A;  2O51 A;  4EXK A;  1BLF A;  5J1D A;  1MM7 A;  5H8Q A;  2H99 A;  2ONR A;  2NOO A;  4FE8 A;  4NF6 B;  3TTL A;  4NWC A;  3OO9 A;  2D21 A;  2VD3 A;  3LSX A;  3BFT A;  3K00 A;  1ZLQ A;  2Q9T A;  1AH5 A;  3K1M A;  1US5 A;  4POW A;  1O64 A;  2I0C A;  2D5W A;  3Q27 A;  1SI0 A;  1QUL A;  1HSL A;  3AXF A;  5ISU A;  3FZV A;  1OQH A;  3I6V A;  4IGT A;  3USD A;  1Y1M A;  4XKP A;  5I58 A;  2QSX A;  2H4I A;  3RUM A;  3HPI A;  3IL1 B;  4QF9 A;  1NNT A;  3BFU A;  2O69 A;  4BDQ A;  1OLC A;  3O97 A;  4QHQ A;  2F35 A;  1ZBM A;  3WAE A;  2H5Y A;  1UQW A;  1JVY A;  4LZ8 A;  1HSJ A;  3MBP A;  2Z8F A;  4GQO A;  2XXU A;  3ZKK A;  3VXB A;  3RN8 A;  1UTB A;  1LB9 A;  1B6H A;  3OO7 A;  1TT1 A;  3LC8 A;  3QYT A;  1B7U A;  2I0B A;  4KYD A;  1LB8 A;  3TFL A;  1XOC A;  4BDL A;  1Z7M E;  1LFH A;  1QUK A;  1IXH A;  4C1T A;  1B52 A;  2R9J A;  2Y7K A;  2QS1 A;  4GVO A;  3TYH A;  5LOM A;  4YB5 A;  1IIW A;  4IO5 A;  3FV1 A;  1S50 A;  5M2V A;  3R26 A;  2AL4 A;  1II5 A;  3TTK A;  4U4X A;  4OES A;  4GWO A;  2XXP A;  4YMA A;  4QFK A;  1OVT A;  2DSF A;  1N0T A;  1HSE A;  4EF1 A;  3I5O A;  2REJ A;  3ZKL A;  1H76 A;  3C32 A;  3MC2 A;  3C31 A;  4G4P A;  5AA2 D;  1IEJ A;  3SES A;  3K6X A;  4YB7 A;  4WEP A;  3PUZ E;  1P1U A;  1OIB A;  1D3K A;  2QMW A;  4DXB A;  4NF4 B;  3EN3 A;  2F7B A;  3B6W A;  4F1Y A;  1Y1Z A;  1R6Z A;  1P99 A;  3T93 B;  3CI8 A;  3MP8 A;  4PP0 A;  3RLF E;  5AE4 A;  1H43 A;  1MXU A;  3DEL B;  1ANF A;  3O28 A;  4G68 B;  3U72 A;  3FUZ A;  4YIC A;  1Z7N E;  1AIV A;  3KOT A;  3TEP A;  3M3F A;  2PYY A;  3N6U A;  3T22 A;  2DOJ A;  4LON B;  1ELJ A;  2OZZ A;  4JSO A;  4YU0 A;  3OOA A;  2ONS A;  4YZZ A;  5L8D A;  1B46 A;  4C0R A;  1MXW A;  3VVD A;  1B7Z A;  5I56 B;  4Q8R A;  3LR1 A;  2NVU B;  4XXU A;  3PMW A;  4G68 C;  5ICT A;  5KCJ B;  3DP8 A;  2RIN A;  1R9Q A;  1LGB C;  4F29 A;  5AA4 B;  4PET A;  4IY6 A;  4HTG A;  3Q26 A;  3VLU A;  3U8Q A;  1B1X A;  3MPL A;  4RNS A;  3CIJ A;  3MW0 A;  1SW2 A;  3C35 A;  2UYF A;  3IX1 A;  3TQW A;  3DLN A;  3SEX A;  4FED A;  1B40 A;  3FV2 A;  5DVF A;  4F2O A;  4GOT A;  3RT8 A;  3GBB A;  3RT6 B;  3LBS A;  5K2Y A;  4QRZ A;  4R73 A;  5B7D A;  4R72 A;  3B6Q A;  4IO7 A;  4H65 A;  3BKI B;  2F7A A;  1AOV A;  3QUF A;  1MQH A;  4XKN A;  2IA4 A;  5EHM A;  4R2F A;  5TPA A;  3TEL A;  1A99 A;  4RPO A;  3N26 A;  3O6G A;  1NNK A;  1B3E A;  2ZXT A;  2LAO A;  4FEC A;  1MXZ A;  1QJM A;  2P0S A;  3TOD A;  3DP6 A;  2WKY A;  4H5F A;  1JET A;  3CFZ A;  5H8Q B;  3Q28 A;  1BKA A;  1VFE A;  3F11 A;  4ZEC A;  2OCU A;  2V93 A;  1AMF A;  2Z8D A;  2I3V A;  4NWD A;  1B58 A;  2M8C A;  3ODB A;  2ZNU A;  3H7M A;  4KPT A;  1A54 A;  3LSF B;  3MWB A;  4ZZE A;  2HCA A;  1I6A A;  2XD2 A;  1B51 A;  1NFT A;  3H06 B;  5I58 B;  3FJG A;  1BP5 A;  3TCF A;  2E0S A;  3OEK A;  4KYS A;  2F36 A;  2NWJ A;  4OEN A;  1UIV A;  2QRY A;  1PC3 A;  1N76 A;  2Y7R A;  3EPE A;  3KN3 A;  2YPN A;  4EQ9 A;  1LLS A;  1H45 A;  1OQG A;  5HPQ A;  1N04 A;  4F22 A;  3DP4 A;  4RY1 A;  3G3J A;  3KSJ A;  3MZ1 A;  4X9T A;  1B0H A;  2O6A A;  3RGY A;  1UTB B;  5CBR A;  4G8N A;  3C4M A;  5CBS A;  2DVZ A;  4ELO A;  4R9G A;  4DZ1 A;  3HHF A;  2HZL A;  3ILT B;  3QXM A;  4JSD A;  2QS2 A;  3W9W A;  4U1O A;  2DS9 A;  4PE5 B;  2X7P A;  1YCJ A;  4DIG A;  4OEU A;  3D4G A;  4MLV A;  2O7I A;  4F1U A;  1GV8 A;  3HN0 A;  5DVJ A;  4AB5 A;  4R6H A;  1DTZ A;  2O84 X;  1IIT A;  2RC7 A;  3M8U A;  1B3F A;  2PVU A;  3W9V A;  2OK2 A;  3FJM A;  1NMU A;  3VDF A;  3KN7 A;  1VFD A;  5I56 A;  2ZYK A;  2G29 A;  5AA2 A;  1XVY A;  5ITP A;  4RK2 A;  4Q30 B;  1TFA A;  3IOV A;  3TAJ A;  1MXV A;  3H6W A;  5AA4 A;  3CSG A;  4EDP A;  1SW4 A;  3PPQ A;  1RKM A;  3S9N C;  3B7D A;  2Q89 A;  3IAZ A;  3N94 A;  1NH7 A;  3MAM A;  4E0W A;  3KJ7 A;  3EHS A;  4Q5T A;  3G3G A;  4U4S A;  4RPN A;  2ANJ A;  1I6B A;  1T0K A;  1LAG E;  3TTN A;  4I9D A;  3PUW E;  4F3B A;  3UK4 A;  3KJT A;  3VFJ A;  2Z23 A;  5EHS A;  3MVX A;  1JW1 A;  1B0L A;  1VSO A;  2XXX A;  3VE1 B;  2F78 A;  1P1O A;  3RY3 A;  2DE4 A;  1EZO A;  3IB2 A;  2XXH A;  3CRB A;  5KDT A;  2D3I A;  2A5T A;  4OHN A;  3D4C A;  3L6G A;  1ZJL A;  3TCG A;  5CMM A;  3MVY A;  3E13 X;  4IO3 A;  3IOR A;  4XTC Q;  3TUS A;  1TFD A;  4DDD A;  5FHN A;  1M5E A;  2XXV A;  2DWH A;  2OLB A;  4XKR A;  2ZNT A;  4OQO A;  3H03 A;  1MY4 A;  1FTK A;  1PDA A;  3A09 A;  3PUX E;  4KFQ A;  2XX7 A;  4DLD A;  4AQ4 A;  1SW1 A;  5H8H A;  2I58 A;  3FAT A;  3MVZ A;  4OWD A;  2AYS A; 
#chains in the Genus database with same CATH topology
 4G8H A;  2PBW A;  1GR2 A;  3U93 A;  1LAX A;  3DM0 A;  3PD8 A;  2Y7W A;  3TTR A;  4AS4 A;  1J1N A;  1QW0 A;  4ZS9 A;  4THI A;  5L9S A;  2HFB A;  4H5G A;  3A3U A;  4MLQ A;  1D9Y A;  3WAF A;  2XXI A;  5IM2 A;  3RPL B;  3H6T A;  2QL3 A;  2GRV A;  5IKB A;  1ZMG A;  3A3C A;  3TMG A;  1WDN A;  1FBD A;  5TPA B;  3PD9 A;  4EUO A;  4F1V A;  1JNF A;  3JZJ A;  3QIM A;  3OEL A;  2OWS A;  2F97 A;  4P47 A;  4H1X A;  4OAN A;  4UAC A;  4K3F A;  4N6P A;  1WOD A;  1MPC A;  4OVQ A;  1N84 A;  3SKP A;  4BDO A;  4OET A;  4HW8 A;  1B5I A;  1A8E A;  1FTL A;  2Q8M A;  2ESN A;  3V83 A;  1QKA A;  4NAP A;  4N6K A;  1GTK A;  5H8N A;  1MY2 A;  1LBZ A;  2CZH A;  4PF8 A;  5FTH A;  1DBZ A;  4U22 A;  2BJJ X;  4YKK A;  1FW0 A;  3T1B A;  5CMK A;  4OVJ A;  5I57 A;  4BDR A;  2V84 A;  4YKP A;  2E1S A;  4IB2 A;  3EHT A;  3R6U A;  4KR5 A;  3N5L A;  1FBC A;  1O63 A;  3OXN A;  4GRK A;  4U23 A;  5KZT A;  1D9Q A;  3PMV A;  1MY0 A;  1TWY A;  3THI A;  3JYR A;  1A7L A;  2OWZ A;  3CFX A;  1JP4 A;  3N6T A;  4WED A;  4ESX A;  1TXF A;  5I59 B;  5FTI A;  1OMP A;  3FXR A;  4JXI A;  2DP8 A;  2O1L A;  3W15 C;  1BK4 A;  3OO6 A;  4MNP A;  3Q29 A;  1M5C A;  2DXR A;  4LP2 B;  1B2H A;  1XHY A;  1A40 A;  1MQI A;  2RKM A;  1EZ9 A;  4R6K A;  1MDQ A;  5CC2 A;  3FJ7 A;  4POX A;  3PPN A;  4X1B A;  4ZED A;  4JWY A;  4OEV A;  4NMY A;  2P3V A;  4F3G A;  1B32 A;  4NF8 B;  1IZ1 A;  1FPK A;  3IB0 A;  4EF2 A;  1IMB A;  3SEV A;  3C36 A;  4I40 A;  3HV1 A;  3O6I A;  1Y9U A;  3O66 A;  3MP1 A;  3MZ9 A;  3D1R A;  3E79 A;  2ALU A;  4OFL A;  4H8I A;  3V8X B;  3PGF A;  4G8M A;  4GFR A;  3UIF A;  2I49 A;  4PGP A;  3MP6 A;  3LSW A;  1PB8 A;  3PU5 A;  4QFP A;  1A55 A;  3KC1 A;  3U94 A;  2B3B A;  3O29 A;  4TLL B;  3I3V A;  3VXC A;  4ZE8 A;  4OVR A;  1LAF E;  3K6U A;  3ZSF A;  4FJP A;  4BDM A;  2F6P A;  4OVS A;  5AA2 B;  4I1D A;  2UXA A;  1QKB A;  4GX3 A;  3T0J A;  4PFR A;  3TTM A;  1CE2 A;  1YXI A;  2FYI A;  1Y4C A;  2Y5K A;  3IR1 A;  4ELP A;  3KOS A;  2O68 A;  4O8M A;  2VOZ A;  3B6T A;  2B4M A;  3SER A;  4I62 A;  1BTJ A;  1LEV A;  2RC8 A;  2RC9 A;  3PV0 E;  2KQZ A;  2HAU A;  1LCF A;  5ELV A;  3UGW A;  3KGC A;  5ET6 A;  4PF6 A;  2ONK E;  4N07 A;  5I2N B;  4IR8 A;  2HXW A;  3E4R A;  4PDH A;  1ATG A;  2XXY A;  4KXP A;  1CB6 A;  4R75 A;  3IO6 A;  1M5F A;  5T3J A;  2XHD A;  3KG2 A;  3K6W A;  4H46 A;  4H45 A;  3G3I A;  3K6V A;  4Z0I A;  4I3E A;  4FBP A;  4KI0 E;  4RYA A;  2OWT A;  1OVB A;  1MXX A;  1DTG A;  1USY E;  4HS7 A;  4IO2 A;  2GH9 A;  3T9V A;  3EQ1 A;  5TP9 A;  5TU0 A;  1KA0 A;  3K0V A;  5KDT B;  4NHB A;  2PFY A;  4OFO A;  2A5T B;  4F31 B;  3GLB A;  2ABH A;  1H3D A;  2O7U A;  1MH4 A;  3TQL A;  1XS5 A;  2DVC A;  1URD A;  1WVJ A;  2IEE A;  3E78 A;  1Y3P A;  3HFU A;  5JEI A;  3S2V A;  4PBH A;  5A5X A;  1EZP A;  1MQJ A;  5CMC A;  1RYX A;  2V3Q A;  2VD2 A;  1NV2 A;  5L9O A;  4M4G A;  3S9E A;  1XT8 A;  4ZE9 A;  4GBV A;  1NL5 A;  1IXC A;  1FTJ A;  4RK9 A;  4HE2 A;  5H8H B;  2XX9 A;  4YMB A;  5CMB A;  1SI1 A;  2O1M A;  5HM4 B;  4KCC A;  5EQ8 A;  1Y3N A;  3FGS A;  1Q9D A;  2YLN A;  5IZ3 B;  5BWJ A;  2RF1 A;  4OA4 A;  2UVH A;  3U1O A;  3PUV E;  4R2B A;  1ZKB A;  3U65 A;  1FQD A;  5I59 A;  2VP1 A;  3A29 A;  2F34 A;  2VGQ A;  1FTA A;  1JEV A;  3H4Z A;  2R71 A;  4BDN A;  4OVP A;  2V25 A;  3QMF A;  4OMB A;  3FXU A;  4P3L A;  1BIY A;  2KLF A;  4RA1 A;  3IFA A;  2GFE A;  2DWJ A;  4RXL A;  2PCR A;  4F39 A;  1JQF A;  3FVG A;  1FQB A;  3BIH A;  5AA1 A;  1UTH A;  4NF8 A;  5ITO A;  4ZEB A;  4N17 A;  1K9Y A;  1FTO A;  5H8N B;  4H0W A;  4QFL A;  1I6Q A;  4JBZ A;  3PMX A;  4JVD A;  4NED A;  1FPD A;  5I57 B;  5L9M A;  3TCH A;  4OER A;  4NTL A;  1POY 1;  2REG A;  4X04 A;  4DE8 A;  3C33 A;  3HCQ A;  4R74 A;  1Q1K A;  1EH3 A;  1IMA A;  1H44 A;  3QUJ A;  4GX6 A;  2QS3 A;  2DE2 A;  4RJZ A;  5I7I A;  4GWY A;  4PDD A;  4FOR A;  4OFJ A;  2UVJ A;  2YJP A;  4MEV A;  5F7V A;  4PQJ A;  2B3F A;  3ONM A;  4GXS B;  1M5D A;  1DPP A;  3CG3 A;  1Y20 A;  3IO4 A;  2G93 A;  4F18 A;  2F7C A;  4KCD A;  2GHA A;  1LBX A;  5ICQ A;  4C1U A;  2DQV A;  1LBY A;  2DE3 A;  3R7X A;  3MZB A;  1SW5 A;  3CR9 A;  2Z22 A;  3M3L A;  2H9B A;  3QK6 A;  4ND9 A;  2W7Y A;  4R6Y A;  2JJK A;  3OMB A;  2HPG A;  3G3F A;  1OLA A;  1PB7 A;  4UA8 A;  3UP9 A;  1B9J A;  5IAI A;  2B65 A;  1D9V A;  5I2N A;  1USY H;  5EQA A;  3ZS6 A;  4MNC A;  1NKX A;  3P7I A;  4GWU A;  3BBR A;  4NGU A;  4ZDM A;  4TLM B;  1B7H A;  2Q2C A;  5B70 A;  4FIM A;  3LV0 A;  4XIG Q;  1MG1 A;  4GD5 A;  3KN8 A;  4YB6 A;  4YKJ A;  3OEN A;  1IXG A;  4N4U A;  1VE4 A;  3KZG A;  2WYK A;  1I69 A;  5DEX A;  1DMB A;  2I48 A;  3FVK A;  3CSB A;  4GLI A;  3LUZ A;  4PE3 A;  3ECR A;  3C9H A;  2CMO A;  3HO7 A;  4IY5 A;  1JVX A;  1B3L A;  3KSX A;  3M3K A;  1LCT A;  2ZYO A;  4BLA A;  2AL5 A;  3S9M C;  1FQE A;  3GBA A;  5FHM A;  2DWI A;  4KHZ E;  2HEU A;  2WX9 A;  3IK6 B;  1GVC A;  1LBC A;  1KZ8 A;  3U92 A;  2QS4 A;  2FA7 A;  5I2K A;  5DVI A;  1JW5 A;  4JB7 A;  4ESW A;  3RPW A;  2Y7P A;  4R9F A;  4MH5 A;  3E3K A;  4GL8 A;  3SDF A;  1L5T A;  1NNF A;  3SEY A;  3TPA A;  1N3X A;  4NF5 B;  3JV9 A;  2I3W A;  1NUX A;  2XXR A;  5FBP A;  2R8T A;  1B4H A;  1PBQ A;  2ZNS A;  1LFI A;  1S7Y A;  5JK4 A;  1NV7 A;  1INP A;  1MH3 A;  3IOW A;  3VV5 A;  3OEM A;  5IZ3 A;  4I8C A;  3OD7 A;  3KBZ A;  3H6V A;  1NI9 A;  3T9U A;  2VPN A;  1R9L A;  5CRY A;  1MS7 A;  2Z8E A;  4NQ8 A;  1DK4 A;  3KBR A;  4PFU A;  4Q0C A;  1MQD A;  4OTE A;  5TP9 B;  1P1W A;  1QUI A;  4GBW A;  2UYE A;  2PT2 A;  3T96 B;  2NUV A;  1SDX A;  3LUY A;  1SPI A;  2HXR A;  4IO4 A;  2UVG A;  3MST A;  3OSQ A;  2ZMB A;  4ZZA A;  1NUW A;  3G3H A;  3GXA A;  2XD3 A;  2R6G E;  3GYY A;  1DCU A;  4ELQ A;  3H3G A;  3OSR A;  1LAH E;  3FBP A;  3S9L C;  5JTY B;  4O3C A;  1FBP A;  5A5X B;  1ZTY A;  3MJN A;  4N13 A;  5CI5 A;  5DW8 A;  1O7T A;  1FTM A;  1XC1 A;  2GHB A;  3TKD A;  1NNP A;  1RYO A;  3O9P A;  1P1Q A;  4JWX A;  4EQ7 A;  2H98 A;  5EQ9 A;  4LUB A;  2KR0 A;  1YYZ A;  1PB9 A;  2XXK A;  4F3S A;  4YAH X;  4P1E A;  4NX1 A;  2FNC A;  4GWX A;  1FQF A;  3KFM A;  1DOT A;  3BIG A;  3IB1 A;  3V5A A;  3FAS A;  3VVF A;  3K1P A;  4XKQ A;  1ZIU A;  4JWO A;  4ECF A;  1XVX A;  4MBP A;  1AWB A;  5EYG A;  2CZI A;  5I84 A;  4GF8 A;  4PFT A;  4PGN A;  4IGR A;  4G77 A;  4O3B A;  2CEX A;  2ZZV A;  1CNQ A;  3RNN A;  2NXO A;  1IUD A;  1KWH A;  4GXA A;  2RCB A;  5H8F B;  3SEU A;  1YTV A;  3H6U A;  3IJO B;  3RYD A;  4LQ2 A;  4WXJ A;  3IJX B;  4JVC A;  1MPB A;  3TDJ A;  4MF3 A;  2F6G A;  4L17 A;  4TQU Q;  1JW4 A;  1UTH B;  4PFY A;  4X48 A;  4QSD A;  2DWA A;  3LSL A;  4QFO A;  1US4 A;  3CFL A;  3V89 B;  3FXB A;  4E0X A;  4H67 A;  5DYH A;  4X8R A;  3MVW A;  2AIX A;  3FVO A;  4U21 A;  5HBC A;  2DYX A;  2FBP A;  3OO8 A;  4ZEK A;  3VVE A;  1POT A;  2P1S A;  2DXY A;  1MY3 A;  2VHA A;  3O6H A;  1B4Z A;  1URS A;  2Q2A A;  4AB6 A;  1N7W A;  3RTW B;  1Q35 A;  4LZ5 A;  1QVS A;  2OBG A;  5BUU A;  3IOU A;  3S4U A;  4KD5 A;  3MYU A;  1G0H A;  3EF7 A;  1SBP A;  4EXL A;  1FPJ A;  1S9T A;  3QSL A;  4MNI A;  2Q88 A;  4MIJ A;  1B3G A;  1KA1 A;  2HAV A;  2V3U A;  1NH8 A;  5EYF A;  2I4C A;  2X26 A;  2B4L A;  4P11 A;  3SEW A;  4NF6 A;  1FPE A;  4H8J A;  4JDF A;  4KYE A;  4NF5 A;  2Q8J A;  1PBP A;  1IQ7 A;  4LN5 A;  4KQP A;  3QAX A;  3E9X A;  4IO6 A;  2QMX A;  4QBA A;  4X1D A;  1DPE A;  3VLW A;  1Y4T A;  2ZZX A;  1FBG A;  5K2X A;  2Y7I A;  1MRP A;  4GIZ A;  2FHY A;  2H25 A;  1SQY A;  1IXI A;  4N8Y A;  4OZ9 A;  5DEX B;  1FQA A;  4O94 A;  4N91 A;  4DXC A;  1B5H A;  4P0G A;  4YKI A;  4F19 A;  4FEB A;  3IOT A;  4OYV A;  4PTK A;  4F3P A;  1EU8 A;  3EHU A;  3UOR A;  2A5S A;  3G7W A;  3TZA A;  5LTC A;  2OJT A;  1P1N A;  3FVN A;  1N7X A;  4O7M A;  4MHF A;  4ISU A;  5JTY A;  2L5V A;  1NV1 A;  2UVI A;  4OXV A;  4N8G A;  5I2K B;  4GL0 A;  4TOZ A;  4HE1 A;  4WKM A;  4P9K A;  1B1H A;  4P1L A;  2P2A A;  5DT6 A;  4PFI A;  5I3S A;  1MPD A;  3CG1 A;  5FHO A;  3PUY E;  4MX6 A;  2Y84 A;  4DI3 D;  2XXQ A;  1EYI A;  3PPP A;  1F9B A;  3O2A A;  1MDP 1;  4LA9 A;  4M1V A;  3KEI A;  1MM6 A;  4U1Z A;  2BJI A;  3VLV A;  3UA8 A;  4HCY A;  5LDZ A;  5DTB A;  3K4U A;  2RCA A;  2V3T A;  2ZZW A;  1FPL A;  2WEF A;  4N81 A;  1B05 A;  1A8F A;  1B3H A;  3PPO A;  2PFZ A;  5F1Q A;  1GGG A;  4JVI A;  1UIU A;  2PT1 A;  2PX1 A;  3T66 A;  4Z7E A;  4O3A A;  3T9X B;  5J16 A;  3NOH A;  1AL3 A;  5H8F A;  4F2Q A;  3K2D A;  4QXD A;  1MY1 A;  4LZ7 A;  1N3W A;  4LAT A;  3L6H A;  1ZU0 A;  4P0I A;  4HXV A;  2X7Q A;  3CHG A;  3FD3 A;  4NF4 A;  5ET7 A;  1D4N A;  4QSC A;  3T9H B;  2XXT A;  4LVQ A;  3SET A;  1LST A;  1SVX B;  4HCW A;  4FAT A;  3CVG A;  1VR5 A;  4ZEI A;  4DCX A;  4FAJ A;  2V4C A;  4G68 A;  1LBB A;  4MFI A;  4XFE A;  1LFG A;  4NF0 A;  3MPK A;  3ROJ A;  3Q25 A;  3RTF B;  4NE4 A;  4LQ5 A;  1FBH A;  2I4B A;  1NUZ A;  4QSE A;  3RQT A;  4MJO A;  1IMC A;  2QJE A;  1DSN A;  4ONY A;  1SYI A;  1B5J A;  1FQC A;  3K02 A;  4H6D A;  1M5B A;  1MXY A;  2QFL A;  1JEU A;  2CZL A;  2HQ0 A;  4PC9 A;  2XWO A;  3C34 A;  1R1N A;  3ILU B;  4NN3 A;  4I3Y A;  5KCJ A;  1G0I A;  2XWI A;  1SD3 A;  4EQB A;  2F5X A;  5H8S A;  2PMS A;  1PEB A;  1YPN A;  3G3K A;  2VT5 A;  1YZ0 A;  5CM6 A;  1QUJ A;  5AA3 A;  2FIX A;  2F8D A;  3UN6 A;  5IZZ A;  2ZYM A;  3MQ9 A;  4N6D A;  3HHG A;  1NV4 A;  3FXQ A;  2THI A;  4DCY A;  4PFW A;  3K01 A;  4DXU A;  1FJ9 A;  2XXW A;  3MUQ A;  4U2R A;  3PPR A;  4ZEF A;  5ET8 A;  3HST A;  3FIR A;  2I6E A;  1FCK A;  2XX8 A;  2ZYN A;  4G2Z A;  1XI6 A;  3GZG A;  1Y3Q A;  4XF5 A;  5ET5 A;  1SYH A;  1NUY A;  1URG A;  4ELR A;  1MQG A;  2QPQ A;  2GQ1 A;  2HZK A;  4QFN A;  5A5L A;  1YAE A;  3K1N A;  2O51 A;  2WBB A;  4EXK A;  1BLF A;  5J1D A;  1MM7 A;  5H8Q A;  2H99 A;  2ONR A;  2NOO A;  4FE8 A;  3IFC A;  4NF6 B;  3TTL A;  4NWC A;  4GX4 A;  3OO9 A;  2D21 A;  2VD3 A;  1VDW A;  3LSX A;  3BFT A;  3K00 A;  1ZLQ A;  2Q9T A;  1AH5 A;  3K1M A;  1US5 A;  4POW A;  1O64 A;  2I0C A;  2D5W A;  3Q27 A;  1SI0 A;  1QUL A;  1HSL A;  3AXF A;  5ISU A;  3FZV A;  1OQH A;  3I6V A;  4IGT A;  3USD A;  1Y1M A;  4XKP A;  5I58 A;  2QSX A;  4P8B A;  2H4I A;  3RUM A;  3HPI A;  3IL1 B;  4QF9 A;  1NNT A;  3BFU A;  2O69 A;  4BDQ A;  1OLC A;  3O97 A;  4QHQ A;  2XA5 A;  2F35 A;  1NV6 A;  1ZBM A;  5I5P A;  3WAE A;  2H5Y A;  1UQW A;  4HE0 A;  1JVY A;  4LZ8 A;  1HSJ A;  3MBP A;  2Z8F A;  4GQO A;  2XXU A;  2OX3 A;  3ZKK A;  3VXB A;  3RN8 A;  1UTB A;  1LB9 A;  1B6H A;  3OO7 A;  1TT1 A;  4PAF A;  4AS5 A;  3LC8 A;  3QYT A;  1B7U A;  2I0B A;  4KYD A;  4PAI A;  1LB8 A;  3TFL A;  1XOC A;  2Q74 A;  4BDL A;  1Z7M E;  1LFH A;  1QUK A;  1IXH A;  4C1T A;  1B52 A;  4GWW A;  2R9J A;  2Y7K A;  2QS1 A;  2XWV A;  2CEY A;  4GVO A;  3TYH A;  5LOM A;  4YB5 A;  1IIW A;  4IO5 A;  4P56 A;  3FV1 A;  1S50 A;  5M2V A;  3R26 A;  2AL4 A;  1II5 A;  3TTK A;  1K9Z A;  4U4X A;  4OES A;  4GWO A;  1EYJ A;  2XXP A;  4YMA A;  4N15 A;  1LBV A;  4QFK A;  1OVT A;  2DSF A;  1N0T A;  1HSE A;  4EF1 A;  3I5O A;  2REJ A;  3ZKL A;  1H76 A;  3C32 A;  3MC2 A;  3C31 A;  4G4P A;  5AA2 D;  1FPB A;  1IEJ A;  3SES A;  3K6X A;  4YB7 A;  1RDX A;  4WEP A;  3PUZ E;  1P1U A;  1OIB A;  1D3K A;  2QMW A;  4DXB A;  4NF4 B;  3EN3 A;  2F7B A;  3B6W A;  1FJ6 A;  1LBW A;  4F1Y A;  1Y1Z A;  4XEQ A;  1R6Z A;  1P99 A;  3T93 B;  3CI8 A;  3MP8 A;  4PP0 A;  3RLF E;  5AE4 A;  1H43 A;  1MXU A;  5ESY A;  3DEL B;  1ANF A;  3O28 A;  4G68 B;  3U72 A;  3FUZ A;  4YIC A;  1Z7N E;  1AIV A;  3KOT A;  2P3N A;  3B50 A;  3TEP A;  4DI4 B;  3M3F A;  2PYY A;  3N6U A;  3T22 A;  2DOJ A;  4LON B;  3KC0 A;  1ELJ A;  2QVR A;  4OVT A;  2OZZ A;  4JSO A;  4YU0 A;  3OOA A;  2ONS A;  4YZZ A;  5L8D A;  1B46 A;  4C0R A;  1MXW A;  2QVV A;  3VVD A;  1B7Z A;  5I56 B;  4Q8R A;  3LR1 A;  1FPG A;  2NVU B;  4XXU A;  3PMW A;  4G68 C;  5ICT A;  5KCJ B;  3DP8 A;  2RIN A;  1R9Q A;  1LGB C;  4F29 A;  5AA4 B;  4PET A;  1NV5 A;  4IY6 A;  4UAB A;  4HTG A;  3Q26 A;  3VLU A;  3U8Q A;  1B1X A;  3MPL A;  4RNS A;  3CIJ A;  3MW0 A;  1SW2 A;  3C35 A;  2UYF A;  3IX1 A;  4GWS A;  3TQW A;  2F3B A;  3DLN A;  3SEX A;  4FED A;  1B40 A;  3FV2 A;  5DVF A;  4F2O A;  4GOT A;  3RT8 A;  4PBQ A;  4PCD A;  3GBB A;  4PFB A;  3RT6 B;  3LBS A;  5K2Y A;  1RDY A;  4QRZ A;  3EKI A;  4O7I A;  4R73 A;  5B7D A;  4R72 A;  4MMP A;  1IMF A;  3B6Q A;  4IO7 A;  4H65 A;  3BKI B;  2F7A A;  1AOV A;  3RPL A;  3QUF A;  1MQH A;  4XKN A;  1IME A;  2IA4 A;  5EHM A;  4R2F A;  5TPA A;  3TEL A;  1A99 A;  4RPO A;  3N26 A;  3O6G A;  1NNK A;  1B3E A;  2ZXT A;  2LAO A;  4FEC A;  1MXZ A;  1QJM A;  2P0S A;  3TOD A;  3DP6 A;  2WKY A;  4H5F A;  1JET A;  3CFZ A;  5H8Q B;  4MAG A;  3Q28 A;  1BKA A;  1VFE A;  1FPF A;  3F11 A;  4ZEC A;  2OCU A;  2V93 A;  1AMF A;  2Z8D A;  2I3V A;  4NWD A;  1B58 A;  2M8C A;  3ODB A;  2ZNU A;  1FPI A;  3H7M A;  4KPT A;  3SZP A;  1A54 A;  3LSF B;  3MWB A;  4ZZE A;  2HCA A;  1I6A A;  2XD2 A;  1B51 A;  1FBE A;  1NFT A;  2FVZ A;  3H06 B;  5I58 B;  3FJG A;  4GWZ A;  1BP5 A;  3TCF A;  2E0S A;  3OEK A;  4KYS A;  2F36 A;  2NWJ A;  4OEN A;  2DDK A;  1UIV A;  1FRP A;  2QRY A;  1PC3 A;  1N76 A;  2Y7R A;  3EPE A;  1NV0 A;  3KN3 A;  2YPN A;  4EQ9 A;  1LLS A;  2Y5L A;  5EQ7 A;  2VPO A;  1H45 A;  1OQG A;  5HPQ A;  1N04 A;  4F22 A;  4NG7 A;  3DP4 A;  4RY1 A;  3G3J A;  3KSJ A;  3MZ1 A;  1EYK A;  4X9T A;  1B0H A;  2O6A A;  3RGY A;  1UTB B;  5CBR A;  4G8N A;  3C4M A;  5CBS A;  2DVZ A;  4ELO A;  4R9G A;  4DZ1 A;  3HHF A;  2HZL A;  3ILT B;  3QXM A;  4JSD A;  2QS2 A;  3W9W A;  4U1O A;  2DS9 A;  4PE5 B;  2X7P A;  1YCJ A;  4DIG A;  2F3D A;  4OEU A;  3D4G A;  4MLV A;  2O7I A;  4F1U A;  1GV8 A;  3HN0 A;  5DVJ A;  4AB5 A;  4R6H A;  1DTZ A;  2O84 X;  1IIT A;  2RC7 A;  3M8U A;  1B3F A;  4G61 A;  2PVU A;  3W9V A;  2OK2 A;  3FJM A;  1FBF A;  1NMU A;  3VDF A;  3KN7 A;  1VFD A;  2MKZ A;  5I56 A;  2ZYK A;  2G29 A;  3PTY A;  5AA2 A;  1XVY A;  5ITP A;  4RK2 A;  2HHM A;  4Q30 B;  1TFA A;  3IOV A;  3TAJ A;  1MXV A;  3H6W A;  5AA4 A;  3CSG A;  4EDP A;  1SW4 A;  3PPQ A;  2QVU A;  1RKM A;  1FSA A;  3S9N C;  5IGA A;  1IMD A;  3B7D A;  2Q89 A;  2CZK A;  3IAZ A;  3N94 A;  1NH7 A;  3MAM A;  4E0W A;  3KJ7 A;  2WYP A;  3EHS A;  4Q5T A;  3G3G A;  4U4S A;  4RPN A;  2ANJ A;  1I6B A;  1T0K A;  1LAG E;  3TTN A;  4I9D A;  3PUW E;  2XWK A;  4F3B A;  5IZ1 A;  3UK4 A;  3KJT A;  3VFJ A;  2Z23 A;  5EHS A;  1NV3 A;  3MVX A;  1JW1 A;  1RDZ A;  1B0L A;  1VSO A;  2XXX A;  3VE1 B;  3ISP A;  2F78 A;  5EYH A;  5F24 A;  1P1O A;  3RY3 A;  2DE4 A;  1EZO A;  3IB2 A;  1QGX A;  2XXH A;  2WBD A;  3CRB A;  5KDT A;  4PAK A;  2D3I A;  2A5T A;  4OHN A;  3D4C A;  3L6G A;  1ZJL A;  2FIE A;  3TCG A;  5CMM A;  3MVY A;  3E13 X;  4IO3 A;  3IOR A;  4XTC Q;  3TUS A;  1TFD A;  4DDD A;  5FHN A;  1M5E A;  2XXV A;  2DWH A;  4MCO A;  2OLB A;  4XKR A;  2ZNT A;  4OQO A;  3H03 A;  1MY4 A;  1FTK A;  1PDA A;  3A09 A;  3PUX E;  4KFQ A;  2XX7 A;  4DLD A;  4AQ4 A;  1SW1 A;  5H8H A;  2I58 A;  3FAT A;  3MVZ A;  4OWD A;  3B8B A;  2AYS A; 
#chains in the Genus database with same CATH homology
 4G8H A;  2PBW A;  1GR2 A;  3U93 A;  1LAX A;  3DM0 A;  3PD8 A;  2Y7W A;  3TTR A;  1J1N A;  1QW0 A;  4ZS9 A;  4THI A;  5L9S A;  2HFB A;  4H5G A;  3A3U A;  4MLQ A;  1D9Y A;  3WAF A;  2XXI A;  3H6T A;  2QL3 A;  2GRV A;  5IKB A;  1ZMG A;  3A3C A;  3TMG A;  1WDN A;  5TPA B;  3PD9 A;  4EUO A;  4F1V A;  1JNF A;  3JZJ A;  3QIM A;  3OEL A;  2OWS A;  2F97 A;  4H1X A;  4UAC A;  4K3F A;  4N6P A;  1WOD A;  1MPC A;  1N84 A;  3SKP A;  4BDO A;  4OET A;  4HW8 A;  1B5I A;  1A8E A;  1FTL A;  2ESN A;  3V83 A;  1QKA A;  1GTK A;  5H8N A;  1MY2 A;  5FTH A;  4U22 A;  2BJJ X;  4YKK A;  1FW0 A;  5CMK A;  4OVJ A;  5I57 A;  4BDR A;  2V84 A;  4YKP A;  2E1S A;  4IB2 A;  3EHT A;  3R6U A;  4KR5 A;  3N5L A;  1O63 A;  3OXN A;  4GRK A;  4U23 A;  5KZT A;  3PMV A;  1MY0 A;  1TWY A;  3THI A;  3JYR A;  1A7L A;  3CFX A;  3N6T A;  4WED A;  4ESX A;  1TXF A;  5I59 B;  5FTI A;  1OMP A;  3FXR A;  4JXI A;  2DP8 A;  2O1L A;  3W15 C;  3OO6 A;  3Q29 A;  1M5C A;  2DXR A;  4LP2 B;  1B2H A;  1XHY A;  1A40 A;  1MQI A;  2RKM A;  1EZ9 A;  4R6K A;  1MDQ A;  5CC2 A;  3FJ7 A;  4POX A;  3PPN A;  4X1B A;  4ZED A;  4JWY A;  4OEV A;  4NMY A;  4F3G A;  1B32 A;  4NF8 B;  1IZ1 A;  3IB0 A;  4EF2 A;  3SEV A;  3C36 A;  3HV1 A;  3O6I A;  1Y9U A;  3O66 A;  3MP1 A;  3MZ9 A;  2ALU A;  4OFL A;  4H8I A;  3V8X B;  3PGF A;  4G8M A;  4GFR A;  3UIF A;  2I49 A;  3MP6 A;  3LSW A;  1PB8 A;  3PU5 A;  4QFP A;  1A55 A;  3U94 A;  2B3B A;  3O29 A;  4TLL B;  3I3V A;  3VXC A;  4ZE8 A;  1LAF E;  3K6U A;  3ZSF A;  4FJP A;  4BDM A;  2F6P A;  5AA2 B;  4I1D A;  2UXA A;  1QKB A;  3TTM A;  1CE2 A;  2FYI A;  1Y4C A;  3IR1 A;  4ELP A;  3KOS A;  2O68 A;  2VOZ A;  3B6T A;  3SER A;  4I62 A;  1BTJ A;  2RC8 A;  2RC9 A;  3PV0 E;  2HAU A;  1LCF A;  5ELV A;  3UGW A;  3KGC A;  2ONK E;  4N07 A;  5I2N B;  2HXW A;  3E4R A;  1ATG A;  2XXY A;  1CB6 A;  4R75 A;  3IO6 A;  1M5F A;  2XHD A;  3KG2 A;  3K6W A;  3G3I A;  3K6V A;  4Z0I A;  4KI0 E;  4RYA A;  2OWT A;  1OVB A;  1MXX A;  1DTG A;  1USY E;  4HS7 A;  4IO2 A;  2GH9 A;  3T9V A;  3EQ1 A;  5TP9 A;  5TU0 A;  3K0V A;  5KDT B;  4OFO A;  2A5T B;  4F31 B;  3GLB A;  2ABH A;  1H3D A;  2O7U A;  1MH4 A;  3TQL A;  1XS5 A;  2DVC A;  1URD A;  1WVJ A;  2IEE A;  1Y3P A;  5JEI A;  3S2V A;  5A5X A;  1EZP A;  1MQJ A;  5CMC A;  1RYX A;  2V3Q A;  2VD2 A;  5L9O A;  4M4G A;  3S9E A;  1XT8 A;  4ZE9 A;  1NL5 A;  1IXC A;  1FTJ A;  4RK9 A;  5H8H B;  2XX9 A;  4YMB A;  5CMB A;  1SI1 A;  2O1M A;  5HM4 B;  4KCC A;  1Y3N A;  3FGS A;  2YLN A;  5BWJ A;  2RF1 A;  2UVH A;  3U1O A;  3PUV E;  4R2B A;  1ZKB A;  1FQD A;  5I59 A;  2VP1 A;  2F34 A;  2VGQ A;  1JEV A;  3H4Z A;  2R71 A;  4BDN A;  2V25 A;  4OMB A;  3FXU A;  1BIY A;  2KLF A;  4RA1 A;  2GFE A;  2DWJ A;  4RXL A;  4F39 A;  1JQF A;  3FVG A;  1FQB A;  5AA1 A;  1UTH A;  4NF8 A;  5ITO A;  4ZEB A;  1FTO A;  5H8N B;  4H0W A;  4QFL A;  1I6Q A;  4JBZ A;  3PMX A;  4NED A;  5I57 B;  5L9M A;  3TCH A;  4OER A;  4NTL A;  1POY 1;  2REG A;  4DE8 A;  3C33 A;  3HCQ A;  4R74 A;  1Q1K A;  1EH3 A;  1H44 A;  3QUJ A;  2QS3 A;  2DE2 A;  4RJZ A;  4FOR A;  4OFJ A;  2UVJ A;  2YJP A;  5F7V A;  4PQJ A;  2B3F A;  3ONM A;  4GXS B;  1M5D A;  1DPP A;  3CG3 A;  1Y20 A;  3IO4 A;  2G93 A;  4F18 A;  2F7C A;  4KCD A;  2GHA A;  5ICQ A;  4C1U A;  2DQV A;  2DE3 A;  3R7X A;  3MZB A;  1SW5 A;  3CR9 A;  2Z22 A;  3M3L A;  2H9B A;  3QK6 A;  4ND9 A;  2W7Y A;  4R6Y A;  3OMB A;  3G3F A;  1OLA A;  1PB7 A;  4UA8 A;  3UP9 A;  1B9J A;  5IAI A;  2B65 A;  1D9V A;  5I2N A;  1USY H;  3ZS6 A;  1NKX A;  3P7I A;  3BBR A;  4ZDM A;  4TLM B;  1B7H A;  2Q2C A;  5B70 A;  4FIM A;  4XIG Q;  1MG1 A;  4GD5 A;  3KN8 A;  4YB6 A;  4YKJ A;  3OEN A;  1IXG A;  1VE4 A;  3KZG A;  1I69 A;  5DEX A;  1DMB A;  2I48 A;  3FVK A;  3CSB A;  4GLI A;  3ECR A;  3C9H A;  2CMO A;  3HO7 A;  4IY5 A;  1JVX A;  1B3L A;  3KSX A;  3M3K A;  1LCT A;  2ZYO A;  4BLA A;  2AL5 A;  3S9M C;  1FQE A;  3GBA A;  5FHM A;  2DWI A;  4KHZ E;  2HEU A;  3IK6 B;  1GVC A;  1LBC A;  3U92 A;  2QS4 A;  2FA7 A;  5I2K A;  5DVI A;  1JW5 A;  4JB7 A;  4ESW A;  3RPW A;  2Y7P A;  4R9F A;  4MH5 A;  3E3K A;  4GL8 A;  3SDF A;  1L5T A;  1NNF A;  3SEY A;  3TPA A;  1N3X A;  4NF5 B;  3JV9 A;  2I3W A;  2XXR A;  1B4H A;  1PBQ A;  2ZNS A;  1LFI A;  1S7Y A;  5JK4 A;  1MH3 A;  3IOW A;  3VV5 A;  3OEM A;  4I8C A;  3OD7 A;  3H6V A;  3T9U A;  1R9L A;  5CRY A;  1MS7 A;  2Z8E A;  3KBR A;  4PFU A;  4Q0C A;  1MQD A;  4OTE A;  5TP9 B;  1P1W A;  1QUI A;  2UYE A;  2PT2 A;  3T96 B;  2NUV A;  1SDX A;  3LUY A;  4IO4 A;  2UVG A;  3OSQ A;  2ZMB A;  4ZZA A;  3G3H A;  3GXA A;  2XD3 A;  2R6G E;  4ELQ A;  3H3G A;  3OSR A;  1LAH E;  3S9L C;  5JTY B;  4O3C A;  5A5X B;  1ZTY A;  3MJN A;  4N13 A;  5CI5 A;  1O7T A;  1FTM A;  1XC1 A;  2GHB A;  3TKD A;  1NNP A;  1RYO A;  3O9P A;  1P1Q A;  4JWX A;  4EQ7 A;  2H98 A;  4LUB A;  1PB9 A;  4F3S A;  4YAH X;  2FNC A;  1FQF A;  3KFM A;  1DOT A;  3IB1 A;  3V5A A;  3FAS A;  3VVF A;  3K1P A;  4XKQ A;  1ZIU A;  4JWO A;  4ECF A;  1XVX A;  4MBP A;  5I84 A;  4GF8 A;  4PFT A;  4IGR A;  4G77 A;  4O3B A;  3RNN A;  2NXO A;  1IUD A;  1KWH A;  4GXA A;  2RCB A;  5H8F B;  3SEU A;  1YTV A;  3H6U A;  3IJO B;  4LQ2 A;  4WXJ A;  3IJX B;  1MPB A;  3TDJ A;  4MF3 A;  2F6G A;  4L17 A;  4TQU Q;  1JW4 A;  1UTH B;  4PFY A;  4X48 A;  4QSD A;  2DWA A;  3LSL A;  4QFO A;  1US4 A;  3CFL A;  3V89 B;  4E0X A;  4H67 A;  5DYH A;  3MVW A;  2AIX A;  3FVO A;  4U21 A;  5HBC A;  2DYX A;  3OO8 A;  4ZEK A;  3VVE A;  1POT A;  2P1S A;  2DXY A;  1MY3 A;  2VHA A;  3O6H A;  1B4Z A;  1URS A;  2Q2A A;  4AB6 A;  1N7W A;  3RTW B;  1Q35 A;  4LZ5 A;  1QVS A;  2OBG A;  5BUU A;  3IOU A;  3S4U A;  4KD5 A;  3EF7 A;  1SBP A;  4EXL A;  1S9T A;  3QSL A;  2Q88 A;  1B3G A;  2HAV A;  2V3U A;  1NH8 A;  5EYF A;  2I4C A;  2X26 A;  4P11 A;  3SEW A;  4NF6 A;  4H8J A;  4JDF A;  4KYE A;  4NF5 A;  2Q8J A;  1PBP A;  1IQ7 A;  4KQP A;  3QAX A;  3E9X A;  4IO6 A;  2QMX A;  4X1D A;  1DPE A;  3VLW A;  1Y4T A;  5K2X A;  2Y7I A;  1MRP A;  4GIZ A;  2H25 A;  1SQY A;  1IXI A;  4OZ9 A;  5DEX B;  1FQA A;  4DXC A;  1B5H A;  4P0G A;  4YKI A;  4F19 A;  4FEB A;  3IOT A;  4OYV A;  4F3P A;  1EU8 A;  3EHU A;  3UOR A;  2A5S A;  3G7W A;  3TZA A;  2OJT A;  1P1N A;  3FVN A;  1N7X A;  4ISU A;  5JTY A;  2UVI A;  4OXV A;  5I2K B;  4GL0 A;  4TOZ A;  4WKM A;  1B1H A;  2P2A A;  5DT6 A;  1MPD A;  3CG1 A;  5FHO A;  3PUY E;  2Y84 A;  2XXQ A;  3PPP A;  1F9B A;  3O2A A;  1MDP 1;  4LA9 A;  4M1V A;  3KEI A;  1MM6 A;  4U1Z A;  3VLV A;  3UA8 A;  4HCY A;  5DTB A;  3K4U A;  2RCA A;  2V3T A;  1B05 A;  1A8F A;  1B3H A;  3PPO A;  5F1Q A;  1GGG A;  3T66 A;  1UIU A;  2PT1 A;  2PX1 A;  4Z7E A;  4O3A A;  3T9X B;  1AL3 A;  5H8F A;  4F2Q A;  3K2D A;  1MY1 A;  4LZ7 A;  1N3W A;  4LAT A;  3L6H A;  1ZU0 A;  4P0I A;  2X7Q A;  3FD3 A;  4NF4 A;  1D4N A;  4QSC A;  3T9H B;  2XXT A;  4LVQ A;  3SET A;  1LST A;  1SVX B;  4HCW A;  4FAT A;  3CVG A;  1VR5 A;  4ZEI A;  4DCX A;  4FAJ A;  4G68 A;  1LBB A;  4MFI A;  1LFG A;  3MPK A;  3Q25 A;  3RTF B;  4NE4 A;  4LQ5 A;  2I4B A;  4QSE A;  3RQT A;  2QJE A;  1DSN A;  4ONY A;  1SYI A;  1B5J A;  1FQC A;  3K02 A;  4H6D A;  1M5B A;  1MXY A;  1JEU A;  2CZL A;  2HQ0 A;  3C34 A;  1R1N A;  3ILU B;  5KCJ A;  1SD3 A;  4EQB A;  2F5X A;  5H8S A;  2PMS A;  1PEB A;  1YPN A;  3G3K A;  5CM6 A;  1QUJ A;  5AA3 A;  2F8D A;  3UN6 A;  2ZYM A;  3MQ9 A;  3HHG A;  3FXQ A;  2THI A;  4DCY A;  4PFW A;  3K01 A;  4DXU A;  2XXW A;  3MUQ A;  4U2R A;  3PPR A;  4ZEF A;  3HST A;  3FIR A;  2I6E A;  1FCK A;  2XX8 A;  2ZYN A;  4G2Z A;  3GZG A;  1Y3Q A;  1SYH A;  1URG A;  4ELR A;  1MQG A;  2QPQ A;  2HZK A;  4QFN A;  1YAE A;  3K1N A;  2O51 A;  4EXK A;  1BLF A;  5J1D A;  1MM7 A;  5H8Q A;  2H99 A;  2ONR A;  2NOO A;  4FE8 A;  4NF6 B;  3TTL A;  4NWC A;  3OO9 A;  2D21 A;  2VD3 A;  3LSX A;  3BFT A;  3K00 A;  1ZLQ A;  2Q9T A;  1AH5 A;  3K1M A;  1US5 A;  4POW A;  1O64 A;  2I0C A;  2D5W A;  3Q27 A;  1SI0 A;  1QUL A;  1HSL A;  3AXF A;  5ISU A;  3FZV A;  1OQH A;  3I6V A;  4IGT A;  3USD A;  1Y1M A;  4XKP A;  5I58 A;  2QSX A;  2H4I A;  3RUM A;  3HPI A;  3IL1 B;  4QF9 A;  1NNT A;  3BFU A;  2O69 A;  4BDQ A;  1OLC A;  3O97 A;  4QHQ A;  2F35 A;  1ZBM A;  3WAE A;  2H5Y A;  1UQW A;  1JVY A;  4LZ8 A;  1HSJ A;  3MBP A;  2Z8F A;  4GQO A;  2XXU A;  3ZKK A;  3VXB A;  3RN8 A;  1UTB A;  1LB9 A;  1B6H A;  3OO7 A;  1TT1 A;  3LC8 A;  3QYT A;  1B7U A;  2I0B A;  4KYD A;  1LB8 A;  3TFL A;  1XOC A;  4BDL A;  1Z7M E;  1LFH A;  1QUK A;  1IXH A;  4C1T A;  1B52 A;  2R9J A;  2Y7K A;  2QS1 A;  4GVO A;  3TYH A;  5LOM A;  4YB5 A;  1IIW A;  4IO5 A;  3FV1 A;  1S50 A;  5M2V A;  3R26 A;  2AL4 A;  1II5 A;  3TTK A;  4U4X A;  4OES A;  4GWO A;  2XXP A;  4YMA A;  4QFK A;  1OVT A;  2DSF A;  1N0T A;  1HSE A;  4EF1 A;  3I5O A;  2REJ A;  3ZKL A;  1H76 A;  3C32 A;  3MC2 A;  3C31 A;  4G4P A;  5AA2 D;  1IEJ A;  3SES A;  3K6X A;  4YB7 A;  4WEP A;  3PUZ E;  1P1U A;  1OIB A;  1D3K A;  2QMW A;  4DXB A;  4NF4 B;  3EN3 A;  2F7B A;  3B6W A;  4F1Y A;  1Y1Z A;  1R6Z A;  1P99 A;  3T93 B;  3CI8 A;  3MP8 A;  4PP0 A;  3RLF E;  5AE4 A;  1H43 A;  1MXU A;  3DEL B;  1ANF A;  3O28 A;  4G68 B;  3U72 A;  3FUZ A;  4YIC A;  1Z7N E;  1AIV A;  3KOT A;  3TEP A;  3M3F A;  2PYY A;  3N6U A;  3T22 A;  2DOJ A;  4LON B;  1ELJ A;  2OZZ A;  4JSO A;  4YU0 A;  3OOA A;  2ONS A;  4YZZ A;  5L8D A;  1B46 A;  4C0R A;  1MXW A;  3VVD A;  1B7Z A;  5I56 B;  4Q8R A;  3LR1 A;  2NVU B;  4XXU A;  3PMW A;  4G68 C;  5ICT A;  5KCJ B;  3DP8 A;  2RIN A;  1R9Q A;  1LGB C;  4F29 A;  5AA4 B;  4PET A;  4IY6 A;  4HTG A;  3Q26 A;  3VLU A;  3U8Q A;  1B1X A;  3MPL A;  4RNS A;  3CIJ A;  3MW0 A;  1SW2 A;  3C35 A;  2UYF A;  3IX1 A;  3TQW A;  3DLN A;  3SEX A;  4FED A;  1B40 A;  3FV2 A;  5DVF A;  4F2O A;  4GOT A;  3RT8 A;  3GBB A;  3RT6 B;  3LBS A;  5K2Y A;  4QRZ A;  4R73 A;  5B7D A;  4R72 A;  3B6Q A;  4IO7 A;  4H65 A;  3BKI B;  2F7A A;  1AOV A;  3QUF A;  1MQH A;  4XKN A;  2IA4 A;  5EHM A;  4R2F A;  5TPA A;  3TEL A;  1A99 A;  4RPO A;  3N26 A;  3O6G A;  1NNK A;  1B3E A;  2ZXT A;  2LAO A;  4FEC A;  1MXZ A;  1QJM A;  2P0S A;  3TOD A;  3DP6 A;  2WKY A;  4H5F A;  1JET A;  3CFZ A;  5H8Q B;  3Q28 A;  1BKA A;  1VFE A;  3F11 A;  4ZEC A;  2OCU A;  2V93 A;  1AMF A;  2Z8D A;  2I3V A;  4NWD A;  1B58 A;  2M8C A;  3ODB A;  2ZNU A;  3H7M A;  4KPT A;  1A54 A;  3LSF B;  3MWB A;  4ZZE A;  2HCA A;  1I6A A;  2XD2 A;  1B51 A;  1NFT A;  3H06 B;  5I58 B;  3FJG A;  1BP5 A;  3TCF A;  2E0S A;  3OEK A;  4KYS A;  2F36 A;  2NWJ A;  4OEN A;  1UIV A;  2QRY A;  1PC3 A;  1N76 A;  2Y7R A;  3EPE A;  3KN3 A;  2YPN A;  4EQ9 A;  1LLS A;  1H45 A;  1OQG A;  5HPQ A;  1N04 A;  4F22 A;  3DP4 A;  4RY1 A;  3G3J A;  3KSJ A;  3MZ1 A;  4X9T A;  1B0H A;  2O6A A;  3RGY A;  1UTB B;  5CBR A;  4G8N A;  3C4M A;  5CBS A;  2DVZ A;  4ELO A;  4R9G A;  4DZ1 A;  3HHF A;  2HZL A;  3ILT B;  3QXM A;  4JSD A;  2QS2 A;  3W9W A;  4U1O A;  2DS9 A;  4PE5 B;  2X7P A;  1YCJ A;  4DIG A;  4OEU A;  3D4G A;  4MLV A;  2O7I A;  4F1U A;  1GV8 A;  3HN0 A;  5DVJ A;  4AB5 A;  4R6H A;  1DTZ A;  2O84 X;  1IIT A;  2RC7 A;  3M8U A;  1B3F A;  2PVU A;  3W9V A;  2OK2 A;  3FJM A;  1NMU A;  3VDF A;  3KN7 A;  1VFD A;  5I56 A;  2ZYK A;  2G29 A;  5AA2 A;  1XVY A;  5ITP A;  4RK2 A;  4Q30 B;  1TFA A;  3IOV A;  3TAJ A;  1MXV A;  3H6W A;  5AA4 A;  3CSG A;  4EDP A;  1SW4 A;  3PPQ A;  1RKM A;  3S9N C;  3B7D A;  2Q89 A;  3IAZ A;  3N94 A;  1NH7 A;  3MAM A;  4E0W A;  3KJ7 A;  3EHS A;  4Q5T A;  3G3G A;  4U4S A;  4RPN A;  2ANJ A;  1I6B A;  1T0K A;  1LAG E;  3TTN A;  4I9D A;  3PUW E;  4F3B A;  3UK4 A;  3KJT A;  3VFJ A;  2Z23 A;  5EHS A;  3MVX A;  1JW1 A;  1B0L A;  1VSO A;  2XXX A;  3VE1 B;  2F78 A;  1P1O A;  3RY3 A;  2DE4 A;  1EZO A;  3IB2 A;  2XXH A;  3CRB A;  5KDT A;  2D3I A;  2A5T A;  4OHN A;  3D4C A;  3L6G A;  1ZJL A;  3TCG A;  5CMM A;  3MVY A;  3E13 X;  4IO3 A;  3IOR A;  4XTC Q;  3TUS A;  1TFD A;  4DDD A;  5FHN A;  1M5E A;  2XXV A;  2DWH A;  2OLB A;  4XKR A;  2ZNT A;  4OQO A;  3H03 A;  1MY4 A;  1FTK A;  1PDA A;  3A09 A;  3PUX E;  4KFQ A;  2XX7 A;  4DLD A;  4AQ4 A;  1SW1 A;  5H8H A;  2I58 A;  3FAT A;  3MVZ A;  4OWD A;  2AYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...