3SERA

Zn-mediated polymer of maltose-binding protein k26h/k30h by synthetic symmetrization
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGHKFEHDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 116
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3serA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3serA01
3CSGA 2H98A 4IO4A 1SYIA 3PMXA 3E4RA 2W7YA 3T66A 3MQ9A 1MDP1 3TCHA 3IO6A 5I2KB 1JQFA 1N7WA 3EHSA 4QRZA 5I56A 3GBAA 5H8NB 4X1DA 4UA8A 3IB1A 1NNTA 4Z0IA 1Y3PA 2X7PA 2Y7WA 1MH3A 5ICQA 3QSLA 2FYIA 1II5A 1JNFA 4GFRA 4G4PA 4KCCA 3CFXA 3UORA 1MY3A 2I48A 1FQEA 3EF7A 1BLFA 5CBSA 1H3DA 3T9UA 1AOVA 4DIGA 3MVXA 1MS7A 4H8JA 1B51A 2XX8A 4XTCQ 3F11A 5LOMA 3VFJA 3RNNA 3TZAA 3IAZA 2I4BA 4LZ7A 2DWHA 2A5TB 3FATA 3CRBA 4YAHX 4U1OA 1Y9UA 4IO7A 1MXVA 3O6GA 1PDAA 1B52A 2DXYA 1FQFA 3THIA 3VVFA 2F7CA 3KEIA 3GLBA 1Y1MA 2V25A 1GR2A 1POTA 3ZS6A 4EXKA 3IOWA 4O3BA 3C9HA 3A09A 2ZYNA 1O7TA 4FE8A 1FQBA 1O64A 4DCXA 1B9JA 3U72A 2PT2A 3T9VA 1IUDA 1UTBA 1QULA 4KYEA 4U21A 3UK4A 2NWJA 3K6XA 1B6HA 1MPDA 4RPNA 1Y4TA 4NF4B 2Y84A 3TCGA 5H8HB 3H06B 3IB2A 3MPKA 4H5GA 1B32A 2VD3A 1FTLA 3LSLA 4OENA 1PEBA 2P1SA 2I49A 1B0HA 3VLUA 4ZECA 2XXVA 5CBRA 1GVCA 2D21A 1AMFA 5TP9B 4MBPA 5I58A 1B5JA 3VDFA 2UVIA 4I1DA 3KN7A 3MVYA 4F2OA 1N3WA 3V89B 3FXQA 2V3TA 2BJJX 1UIVA 4U2RA 2ZNUA 1MY0A 2I0BA 5DVIA 2F97A 3L6HA 3SEXA 4TLMB 2REJA 4MFIA 3USDA 3QUFA 4NF5A 1MY1A 2ONKE 2AL4A 1NFTA 4JSDA 1QKAA 2DE3A 5DT6A 2DE2A 4ZEFA 2PBWA 4F1VA 3G3HA 1FQAA 1NNPA 1LLSA 4F22A 4RYAA 1IITA 4JB7A 1EU8A 1NH8A 1B4ZA 2ONRA 4ZS9A 5M2VA 5DEXB 3T22A 2XXHA 2ABHA 4ONYA 1WODA 4FEBA 5H8QA 3PPNA 3JZJA 3S9LC 1HSJA 4QF9A 2I3VA 1BKAA 3DM0A 3KJ7A 1CB6A 4IO5A 1NNFA 1P1OA 5EHMA 4L17A 4ELQA 3H03A 4DCYA 1DTGA 2DP8A 3RT8A 3IB0A 4ELRA 3H4ZA 1YCJA 3KJTA 4ZZAA 3SDFA 2O51A 4DE8A 5L9MA 3SERA 4KQPA 5BWJA 4IGRA 3H6TA 2RINA 3SETA 2XXIA 3TUSA 4GL0A 4KYDA 2DQVA 3GBBA 1JEUA 3QIMA 2H4IA 4RXLA 5AA2D 3MZ1A 4LQ5A 3PD8A 2A5TA 2XXPA 4FJPA 4ZEBA 1IIWA 1YPNA 3G3KA 2OZZA 2QMXA 2UVJA 1MG1A 2AL5A 2Q88A 3OD7A 2Z8FA 2Q89A 2Y7KA 2Y7PA 2H5YA 1JW1A 1PB7A 3MVWA 4ZEKA 2YPNA 4JWXA 1ELJA 4GVOA 2XHDA 5FHOA 4KHZE 4RNSA 3Q28A 5AA1A 3KN3A 4I8CA 1SBPA 1LB9A 1ZIUA 4BDMA 3TTNA 2DWJA 4IGTA 3UN6A 4QSDA 1LCFA 1IEJA 4G8NA 4AB5A 2VOZA 1B3FA 4H1XA 3TDJA 4OVJA 4NF4A 4YICA 4F3PA 3KOSA 3N94A 3MW0A 2HEUA 5K2XA 1EZ9A 1AL3A 3W15C 3U8QA 2HCAA 3MVZA 3FASA 2P2AA 3HPIA 4R75A 3IORA 1MQJA 3PGFA 4PQJA 3TEPA 4YB7A 2DS9A 4Z7EA 1USYH 5F1QA 2GFEA 4KPTA 5TP9A 4C1TA 4ZZEA 5CMBA 3RLFE 2RCAA 4OXVA 3ECRA 4F18A 2Q8JA 3OO6A 3VLWA 4O3CA 2Z8DA 2O6AA 3FUZA 2ONSA 3FIRA 1CE2A 3IL1B 4GXAA 2RC9A 1ANFA 1RYOA 3OOAA 3GXAA 1NL5A 4ELPA 1US4A 1OLAA 4C0RA 3Q26A 3PMVA 4OWDA 5L9SA 4H65A 1FTJA 2F78A 2DYXA 3EHTA 1FTKA 3FVKA 1SVXB 3ILUB 3LSXA 2FA7A 1LFGA 4WXJA 2UVGA 3LBSA 3CR9A 5KZTA 4PFUA 3OENA 4KYSA 2QS2A 2YLNA 3IX1A 4OFLA 3IJXB 1GV8A 4F39A 3PUZE 3MP1A 4FEDA 3FJMA 2O7IA 2V84A 4YB6A 1B1XA 3VVEA 4ISUA 4EDPA 5FHMA 3MP8A 2IA4A 3MZBA 4H6DA 4F1YA 4THIA 1SW2A 3O66A 3M3LA 4WKMA 3OELA 4AB6A 1MXXA 4AQ4A 1MQHA 1ZTYA 1I69A 5H8QB 1MM6A 3B6QA 1A8EA 1PC3A 5DVJA 3S2VA 4DLDA 3SKPA 2DXRA 3O6HA 3FXUA 1LB8A 2DWIA 2F7BA 4G68B 1Y1ZA 4NEDA 5KDTA 4MF3A 3TAJA 3BBRA 3EHUA 3E13X 4U23A 3H7MA 1LAFE 4OHNA 3V8XB 3R6UA 1BP5A 1MM7A 3TQLA 3T93B 4OFJA 1JVYA 4H8IA 3OSRA 2VHAA 3OO7A 5H8FB 3D4CA 3I3VA 4YKPA 1AIVA 2XD2A 1ZMGA 1OMPA 3FJ7A 5CC2A 2V3UA 4YKIA 4U4XA 3TQWA 3O2AA 4PFWA 4NE4A 5BUUA 3WAEA 2GH9A 1XT8A 4I9DA 3M8UA 1ZU0A 2R71A 3KFMA 1OLCA 2Y7RA 3HO7A 3G3IA 4G68C 1NKXA 3O6IA 3S9EA 1R9LA 1SI0A 1Q1KA 3JV9A 3FJGA 5CRYA 2V3QA 4GOTA 4FORA 4POWA 4GF8A 3T9HB 4G8HA 5K2YA 1DMBA 3PU5A 1OQHA 1VFEA 3C32A 3HV1A 3MZ9A 4C1UA 4IO3A 3Q29A 2ZNSA 4M4GA 1H45A 4KD5A 2OWTA 2QSXA 3WAFA 1EZPA 4DZ1A 2F35A 1I6QA 1PB8A 1JW4A 1O63A 5TU0A 5H8SA 3TELA 2DWAA 5EYFA 2HZLA 1QW0A 5FTHA 4KCDA 4JWOA 1P99A 3H6VA 4ESXA 2X7QA 4RA1A 5AA2B 4RPOA 1B40A 2XX9A 4LZ5A 3K4UA 4BDRA 4NF8A 3O9PA 4Q30B 2ALUA 5CM6A 1MQDA 4NMYA 3K6WA 3IJOB 5AA4A 1S7YA 1UQWA 4MH5A 5J1DA 3LSFB 1EH3A 1QUKA 4QFOA 1QUIA 3IR1A 2ZNTA 4F29A 1MQIA 4PFTA 1POY1 3DLNA 4FATA 4HW8A 2XXQA 3K02A 1DOTA 2PVUA 5I84A 2UVHA 5I59B 4RY1A 3N6UA 2Z23A 1MRPA 3C36A 2P0SA 4RJZA 4R2BA 5ITOA 1A55A 3PPRA 5IKBA 2F8DA 3FZVA 1IXIA 3RPWA 1H44A 1L5TA 1P1QA 3TMGA 3DP6A 3H6WA 2F36A 1ATGA 1A40A 3PMWA 4TQUQ 3A3UA 1JEVA 2XXTA 3EPEA 2DE4A 4NWDA 1B58A 4ECFA 3K1MA 4G68A 4HCWA 3TTRA 4PFYA 1BTJA 2V93A 2XXUA 1B46A 4IO2A 5HPQA 1M5CA 3IOVA 1A8FA 1UTHB 1P1UA 2OWSA 3ILTB 2ESNA 5B70A 2QPQA 1MQGA 5H8FA 3MAMA 4E0WA 3MWBA 2OK2A 5KDTB 4R72A 1N3XA 2QS3A 3HCQA 3CFLA 3UGWA 1XVYA 3UIFA 3OEKA 3M3KA 2E0SA 3LSWA 4YU0A 3RQTA 4ELOA 5JTYB 4F1UA 1TFAA 1D3KA 4Q8RA 5CI5A 2O68A 1IXHA 5AA3A 3QYTA 4EUOA 1QUJA 5ISUA 4I62A 2UXAA 2WKYA 1B4HA 2I0CA 3PPQA 4OEVA 1D9YA 5A5XA 1F9BA 1FTOA 1SW1A 3QUJA 2HFBA 4LUBA 3OMBA 2F7AA 4NWCA 4U1ZA 4ZEIA 1VR5A 1B0LA 3O29A 3U92A 1NMUA 5JEIA 4XKPA 3L6GA 1QVSA 4MLQA 4HCYA 4H0WA 3C34A 4X48A 1LFHA 3N5LA 5FHNA 2O1LA 1T0KA 2H99A 5DYHA 1Y3QA 1B7UA 2H25A 3Q27A 1R1NA 5AA2A 1SDXA 3RTWB 3B6WA 1HSLA 1GTKA 3IK6B 4FECA 1B1HA 4JDFA 3H3GA 5EHSA 1TT1A 1IZ1A 3K6UA 4LA9A 1I6BA 4M1VA 5I57A 3K6VA 3ZKLA 4R6YA 1P1NA 1URSA 4ND9A 2NXOA 5L8DA 1MY4A 3KSJA 2A5SA 1B05A 2THIA 3KBRA 4N07A 4EF2A 2QMWA 3GZGA 3TODA 4TLLB 2E1SA 4NF8B 4JBZA 1VSOA 3VV5A 3K00A 1N84A 4X1BA 4TOZA 3T96B 4H67A 5AA4B 1XOCA 5I59A 3D4GA 1FCKA 2Z8EA 3UP9A 1B3GA 2XXWA 4R9GA 3TTLA 3FVOA 5CMKA 4JWYA 3HHGA 1B3EA 3K1NA 3FVNA 2OCUA 2AYSA 4LATA 4U22A 5L9OA 1US5A 2RF1A 3ONMA 3UA8A 1A54A 2R9JA 1N7XA 1B2HA 3SEVA 3KGCA 3U94A 3OEMA 2PMSA 1IXGA 4G8MA 3PUYE 4U4SA 4OESA 4OZ9A 3ODBA 3EQ1A 4N13A 4P0GA 3FVGA 3BFUA 4ZEDA 3V83A 4XKQA 1B3HA 2O84X 2FNCA 5HM4B 1LBCA 1QKBA 1B7ZA 2YJPA 2XXRA 2B3FA 4BDOA 2HAVA 1RKMA 4R9FA 4YMBA 3PUXE 1B7HA 2OLBA 3FXRA 1VFDA 3OSQA 3SEYA 2Q2CA 3CI8A 2HQ0A 1H76A 2QRYA 1D9VA 1R9QA 4QFLA 3TTMA 3R7XA 1UTHA 4YZZA 4G77A 2QL3A 3MJNA 3HHFA 1JETA 1ZKBA 3PUWE 4PP0A 4DXCA 2DOJA 1DTZA 1OVBA 4ZE8A 1FTMA 4G2ZA 1S50A 4F31B 2GHBA 1Y3NA 5KCJB 3VXBA 3ZSFA 2PT1A 3PPOA 5JTYA 3QXMA 4POXA 2H9BA 1Y4CA 2VD2A 1WVJA 4XIGQ 1XC1A 1GGGA 4IO6A 4Q0CA 3P7IA 4PETA 3N26A 2B65A 1NNKA 4LQ2A 2CMOA 3JYRA 1MDQA 1DPPA 1MPCA 3I5OA 1N0TA 1B5IA 2I3WA 2REGA 5CMMA 4MLVA 1TFDA 3RTFB 5DTBA 3FV1A 3S4UA 2HAUA 1PBQA 4NTLA 1FQCA 2F5XA 4QSCA 5A5XB 2D3IA 3RT6B 1FW0A 3K01A 1P1WA 3ZKKA 1M5DA 1M5EA 4F3GA 4QFPA 1TWYA 4OYVA 2B3BA 5F7VA 3VVDA 2DVCA 2IEEA 4KI0E 5TPAA 2I6EA 5ITPA 5HBCA 1SQYA 4RK2A 5I2NB 3V5AA 3I6VA 4RK9A 4K3FA 4H5FA 4QFNA 3DP4A 3T9XB 4JSOA 5ELVA 1R6ZA 3B6TA 3OO9A 3IOTA 4EQBA 2NUVA 3TTKA 3VXCA 2HZKA 3W9WA 3G7WA 2M8CA 2PYYA 3C35A 3KZGA 4HS7A 4FAJA 3SEUA 3KN8A 3K1PA 2RC7A 4BLAA 4GL8A 1TXFA 3E9XA 5I57B 4YKJA 4GRKA 4NF6A 4IB2A 3PPPA 4JXIA 1I6AA 4GWOA 2X26A 4XKRA 3VE1B 3TFLA 2G29A 1KWHA 4R74A 1FQDA 2DVZA 3KSXA 5JK4A 4F2QA 2KLFA 2G93A 2LAOA 3LC8A 4YB5A 3DP8A 1DPEA 2QS1A 1A7LA 2XD3A 3S9NC 5DVFA 3O97A 3C31A 4F19A 4EQ9A 1YTVA 1JW5A 4IY5A 5B7DA 3K2DA 3PUVE 4XKNA 4P0IA 3RGYA 2UYEA 5CMCA 1Q35A 4OMBA 1D4NA 1LFIA 3G3GA 4XXUA 3TKDA 4R2FA 3N6TA 4WEDA 3B7DA 4ZE9A 3KOTA 1ZBMA 1SYHA 3U1OA 5IAIA 3MUQA 3BFTA 2Z22A 4PE5B 1IXCA 1LAHE 5I2KA 2ANJA 4R73A 4LVQA 5AE4A 2GRVA 4LZ8A 1NH7A 3C4MA 1Z7ME 4DXUA 4OFOA 2O1MA 1H43A 1LSTA 3FGSA 5H8NA 2VGQA 3LUYA 3QAXA 3R26A 4R6HA 1MH4A 4R6KA 1N04A 1LAXA 3S9MC 4Q5TA 4UACA 3MPLA 4O3AA 4DXBA 2O7UA 5KCJA 1PB9A 3MC2A 3CG3A 1XVXA 1LGBC 1LBBA 4FIMA 4YMAA 4P11A 2O69A 2R6GE 1JVXA 2XX7A 5I56B 1SD3A 2Y7IA 1MXZA 2VP1A 4E0XA 2Q9TA 3RUMA 4OEUA 3CFZA 4OTEA 2ZYOA 1OQGA 4IY6A 5FTIA 1XHYA 2ZYKA 1B3LA 4KFQA 3LR1A 3H6UA 1ZJLA 4YKKA 1ZLQA 4X9TA 3TCFA 1M5BA 1HSEA 3C33A 2QS4A 2XXXA 1S9TA 1DSNA 4GLIA 3RN8A 2XXYA 3SEWA 2NVUB 3HN0A 4QHQA 4KR5A 3G3FA 1WDNA 3QK6A 3RY3A 2RCBA 1MPBA 2I4CA 4QFKA 2F6GA 3G3JA 1MXWA 2Q2AA 4GD5A 4GQOA 4N6PA 3FD3A 1XS5A 5I2NA 3OXNA 4EQ7A 2RKMA 2OJTA 1MXYA 1RYXA 4DDDA 1B5HA 4WEPA 1SI1A 3A3CA 4ESWA 1M5FA 3IO4A 5H8HA 3CSBA 5TPAB 1MY2A 4OQOA 3E3KA 2ZXTA 3EN3A 1SW5A 3CG1A 4F3SA 2DSFA 3CIJA 1BIYA 1UTBB 2ZMBA 3IOUA 2PX1A 3TPAA 5ICTA 1PBPA 1IQ7A 3BKIB 2NOOA 4OETA 3DELB 3U93A 3PD9A 2CZLA 3FV2A 2D5WA 3VLVA 1EZOA 4BDNA 2AIXA 4NF6B 1LCTA 4LONB 3HSTA 4GIZA 1QJMA 1Z7NE 1OIBA 1SW4A 4EXLA 4GXSB 2GHAA 2QJEA 2ZYMA 1OVTA 4F3BA 4HTGA 5I58B 3CVGA 1J1NA 3MP6A 4OERA 2I58A 2F34A 1VE4A 1Y20A 1N76A 3Q25A 1LAGE 3M3FA 3AXFA 4LP2B 3W9VA 2UYFA 3KG2A 1URDA 2RC8A 1YAEA 4EF1A 1URGA 3PV0E 2OBGA 2F6PA 3K0VA 3MBPA 4BDLA 4QSEA 3O28A 3OO8A 4NF5B 1MXUA 1USYE 1AH5A 5DEXA 4ZDMA 3TYHA 3SESA 2HXWA 1A99A 1UIUA 4BDQA
chains in the Genus database with same CATH superfamily
3CSGA 2H98A 2WYPA 4I3YA 4IO4A 1SYIA 3PMXA 3E4RA 2W7YA 4XF5A 3T66A 3MQ9A 1MDP1 3TCHA 3IO6A 1JP4A 5I2KB 2DDKA 1JQFA 5FBPA 1N7WA 4MHFA 3EHSA 4PTKA 4QRZA 5I56A 3GBAA 5H8NB 4PAKA 4X1DA 4UA8A 3IB1A 3FBPA 1NNTA 4I3EA 4Z0IA 1Y3PA 2X7PA 2Y7WA 5LDZA 1MH3A 5ICQA 1NUXA 3QSLA 1LBVA 2FYIA 1II5A 1JNFA 4GFRA 4N8YA 4NQ8A 2OWZA 4G4PA 4KCCA 1D9QA 3CFXA 3UORA 1MY3A 2I48A 1FQEA 3EF7A 1FSAA 1BLFA 5CBSA 1H3DA 3T9UA 1AOVA 4DIGA 3MVXA 1MS7A 4H8JA 1B51A 2XX8A 4N17A 2FIXA 4XTCQ 3F11A 5IGAA 1G0IA 2QVUA 4GBWA 5LOMA 3VFJA 3RNNA 3TZAA 3IAZA 2I4BA 4LZ7A 2DWHA 2A5TB 3FATA 3CRBA 4YAHX 4U1OA 1Y9UA 4IO7A 1MXVA 3O6GA 1PDAA 1B52A 2DXYA 2Y5LA 1FQFA 3THIA 3VVFA 2F7CA 3KEIA 3GLBA 4PFRA 1Y1MA 2V25A 1GR2A 1POTA 1FJ6A 3ZS6A 4QBAA 4EXKA 3B50A 3IOWA 4O3BA 4PGPA 3C9HA 3A09A 2ZYNA 1O7TA 4FE8A 1FQBA 3RPLA 1O64A 4DCXA 1B9JA 3U72A 1IMDA 2PT2A 1KA1A 3T9VA 1IUDA 1UTBA 1QULA 5I3SA 4KYEA 4U21A 3UK4A 2P3VA 2NWJA 1NV0A 1B6HA 3K6XA 1MPDA 1VDWA 4RPNA 1Y4TA 4NF4B 2Y84A 3TCGA 3HFUA 5H8HB 3H06B 3IB2A 3MPKA 4MIJA 4H5GA 1B32A 2VD3A 1FTLA 3LSLA 4OENA 3IFCA 1PEBA 4DI3D 2P1SA 2I49A 5IZ3B 1B0HA 3VLUA 4ZECA 2XXVA 5CBRA 1GVCA 1Q9DA 2D21A 1AMFA 5TP9B 4MBPA 5I58A 1B5JA 3VDFA 2UVIA 4MNIA 4I1DA 3KN7A 3MVYA 5EQ7A 4F2OA 1N3WA 3V89B 3FXQA 5F24A 2V3TA 1FPGA 2B4LA 2BJJX 1UIVA 4U2RA 2ZNUA 1MY0A 2I0BA 5DVIA 2F97A 3L6HA 3SEXA 4TLMB 2REJA 4MFIA 3KC0A 3USDA 3QUFA 4NF5A 4N15A 1MY1A 2ONKE 2AL4A 1NFTA 4JSDA 1QKAA 2DE3A 5ET8A 5DT6A 2DE2A 2PBWA 4ZEFA 4F1VA 3G3HA 1FQAA 1NNPA 1LLSA 4GWUA 4F22A 4RYAA 1IITA 5J16A 4JB7A 2OX3A 1EU8A 1NH8A 3A29A 1B4ZA 4P1LA 4MMPA 2ONRA 4ZS9A 5M2VA 5DEXB 3T22A 2XXHA 1NV7A 2ABHA 4ONYA 1WODA 4FEBA 5H8QA 3PPNA 3JZJA 2F3DA 3S9LC 1HSJA 4QF9A 2I3VA 1LBZA 1BKAA 3DM0A 3KJ7A 1CB6A 4IO5A 1NNFA 1P1OA 5EHMA 1DCUA 4L17A 4ELQA 3H03A 4DCYA 1DTGA 2DP8A 3RT8A 1NV6A 3IB0A 3KJTA 3H4ZA 1YCJA 4ELRA 4ZZAA 3SDFA 2O51A 4DE8A 2KR0A 5L9MA 3SERA 4KQPA 5BWJA 1FBHA 3H6TA 4IGRA 2RINA 3SETA 2XXIA 3TUSA 4GL0A 4KYDA 2DQVA 5IZZA 3GBBA 4XEQA 1JEUA 3QIMA 2H4IA 4RXLA 5AA2D 3MZ1A 4O94A 4LQ5A 3PD8A 5ESYA 2A5TA 2XXPA 4FJPA 4ZEBA 1IIWA 1YPNA 3G3KA 2OZZA 2QMXA 2UVJA 1MG1A 2AL5A 3KBZA 2Q88A 3OD7A 2Z8FA 2Q89A 2Y7KA 2Y7PA 2H5YA 3EKIA 1JW1A 1PB7A 3MVWA 4ZEKA 2V4CA 2YPNA 4JWXA 1ELJA 4GVOA 2XHDA 5FHOA 4KHZE 4RNSA 4N81A 4GX6A 3Q28A 5AA1A 3KN3A 1NV4A 4I8CA 2FHYA 1SBPA 1LB9A 1LBXA 1ZIUA 3NOHA 4AS4A 4BDMA 3TTNA 2DWJA 4IGTA 3UN6A 4QSDA 1LCFA 1IEJA 4G8NA 4AB5A 2VOZA 1B3FA 4H1XA 3TDJA 4OVJA 4NF4A 4YICA 1FBEA 3KOSA 4F3PA 3N94A 4OVRA 3MW0A 3RPLB 2HEUA 5K2XA 1EZ9A 1AL3A 3W15C 3U8QA 2HCAA 1DK4A 3MVZA 3FASA 4NX1A 2P2AA 3HPIA 2R8TA 4R75A 3IORA 1MQJA 3PGFA 4PQJA 3TEPA 4YB7A 2DS9A 4Z7EA 1USYH 5F1QA 2GFEA 4GWYA 4KPTA 5TP9A 4C1TA 4ZZEA 5CMBA 3RLFE 2RCAA 1RDYA 4OXVA 3ECRA 4F18A 2Q8JA 3OO6A 3VLWA 2XA5A 4O3CA 2Z8DA 2O6AA 2P3NA 3FUZA 2ONSA 3FIRA 1CE2A 3IL1B 2PFYA 2RC9A 1ANFA 4GXAA 4MNPA 1RYOA 3OOAA 3GXAA 1NL5A 1FJ9A 4ELPA 1US4A 1OLAA 4C0RA 3Q26A 3PMVA 4OWDA 5L9SA 4H65A 1FTJA 2F78A 2DYXA 2FBPA 3EHTA 1FTKA 3FVKA 1SVXB 3ILUB 3LSXA 2FA7A 1LFGA 4WXJA 1LBWA 2UVGA 3LBSA 3CR9A 4JVDA 5KZTA 4MJOA 4PFUA 2CZHA 3OENA 4KYSA 2QS2A 2YLNA 3IX1A 4OFLA 3IJXB 1GV8A 4F39A 3PUZE 3MP1A 4FEDA 4IR8A 3FJMA 2O7IA 3ISPA 2V84A 4YB6A 1B1XA 3VVEA 4ISUA 4EDPA 5FHMA 3MP8A 2IA4A 3MZBA 4H6DA 4F1YA 4THIA 1SW2A 3O66A 3M3LA 4WKMA 3OELA 4AB6A 4MAGA 1MXXA 4AQ4A 1MQHA 1ZTYA 1I69A 5H8QB 5I5PA 1MM6A 3B6QA 1A8EA 1PC3A 5DVJA 3S2VA 4DLDA 3SKPA 2DXRA 3O6HA 3FXUA 1LB8A 2DWIA 2F7BA 4G68B 1Y1ZA 4NEDA 5KDTA 4MF3A 1FPFA 2PCRA 4KXPA 3TAJA 3BBRA 3EHUA 3E13X 1AWBA 4U23A 3H7MA 1LAFE 4OHNA 3V8XB 3R6UA 1BP5A 1MM7A 5EQ9A 3TQLA 3T93B 4OFJA 1NV1A 1JVYA 2WBBA 4H8IA 3OSRA 2HXRA 2VHAA 3OO7A 5H8FB 3D4CA 4O8MA 3I3VA 4YKPA 1AIVA 2XD2A 4G61A 1ZMGA 4P8BA 2ZZXA 1OMPA 3FJ7A 5CC2A 2V3UA 4PE3A 4YKIA 4U4XA 2PFZA 3TQWA 3O2AA 4PFWA 4NE4A 1XI6A 2FVZA 5BUUA 3WAEA 2GH9A 1XT8A 4I9DA 3M8UA 1ZU0A 1EYIA 2R71A 3KFMA 1OLCA 1G0HA 2Y7RA 3HO7A 3G3IA 4G68C 1NKXA 3O6IA 2L5VA 3S9EA 1R9LA 1FPLA 1SI0A 1Q1KA 3JV9A 3FJGA 5CRYA 2V3QA 4GOTA 4FORA 4POWA 4GF8A 2XXKA 3T9HB 4G8HA 4P3LA 5K2YA 2XWOA 1DMBA 3PU5A 1OQHA 1VFEA 3C32A 3HV1A 3MZ9A 4C1UA 4IO3A 3Q29A 2ZNSA 4M4GA 1H45A 4KD5A 2OWTA 2QSXA 3T1BA 2MKZA 3WAFA 1EZPA 4DZ1A 2F35A 1I6QA 1LBYA 1PB8A 1JW4A 1O63A 1K9ZA 5TU0A 5H8SA 3TELA 4OVQA 2DWAA 5EYFA 2HZLA 1QW0A 5FTHA 4KCDA 4JWOA 2VT5A 1P99A 4OVTA 3H6VA 4ESXA 4JVCA 1FBDA 2X7QA 4RA1A 5AA2B 4RPOA 4MEVA 1B40A 2XX9A 4LZ5A 3K4UA 4BDRA 4NF8A 3O9PA 4Q30B 2F3BA 2ALUA 5CM6A 1MQDA 4OA4A 4NMYA 5T3JA 3K6WA 3IJOB 5AA4A 1S7YA 1UQWA 4MH5A 2XWIA 5J1DA 3LSFB 1EH3A 1QUKA 4QFOA 1QUIA 4NAPA 3IR1A 2ZNTA 4F29A 2XWVA 1NUZA 5EQAA 1MQIA 4PFTA 1POY1 3DLNA 4FATA 4HW8A 2XXQA 3K02A 1DOTA 3BIHA 2PVUA 5I84A 2UVHA 2CZIA 5I59B 4RY1A 3N6UA 2Z23A 4N4UA 1MRPA 3C36A 2P0SA 3GYYA 5ET5A 4RJZA 4R2BA 1FBCA 5ITOA 1A55A 3PPRA 5IKBA 4GWWA 2F8DA 2XWKA 2VPOA 3LUZA 3FZVA 1IXIA 3RPWA 1H44A 4HE1A 1L5TA 4PBHA 1P1QA 4O7IA 3TMGA 3DP6A 3H6WA 2F36A 1FTAA 1ATGA 3B8BA 1A40A 4OVSA 3PMWA 4TQUQ 2KQZA 3A3UA 1JEVA 2XXTA 5IM2A 3EPEA 4PFBA 2CZKA 2DE4A 3MYUA 4NWDA 1B58A 4ECFA 3K1MA 4G68A 4HCWA 3TTRA 4PFYA 1BTJA 2V93A 2XXUA 1B46A 4IO2A 5HPQA 1M5CA 3IOVA 1A8FA 4NHBA 1UTHB 2WEFA 1P1UA 1KA0A 2OWSA 3ILTB 2ESNA 5B70A 2QPQA 1MQGA 5H8FA 3MAMA 4E0WA 3MWBA 4FBPA 2OK2A 5KDTB 4R72A 1N3XA 2QS3A 3HCQA 3CFLA 4LN5A 3UGWA 1XVYA 3UIFA 4N8GA 3OEKA 4OVPA 4NF0A 3M3KA 2E0SA 3LSWA 4YU0A 3RQTA 4ELOA 5JTYB 4F1UA 1EYJA 1TFAA 1D3KA 4Q8RA 5CI5A 2O68A 1IXHA 5AA3A 4PDDA 3QYTA 4EUOA 1QUJA 4NG7A 1INPA 5ISUA 4H46A 4MCOA 4I62A 2UXAA 2WKYA 1B4HA 2I0CA 3PPQA 4OEVA 1D9YA 4HE0A 3FXBA 1F9BA 5A5XA 1FTOA 1SW1A 3QUJA 2HFBA 4LUBA 3OMBA 2ZZVA 2F7AA 4NWCA 4U1ZA 4ZEIA 2QFLA 1NUWA 1VR5A 1B0LA 3O29A 3U92A 1NMUA 5JEIA 4XKPA 3L6GA 1QVSA 4MLQA 2Y5KA 4HCYA 4H0WA 3C34A 4X48A 1LFHA 3N5LA 4PDHA 5FHNA 2O1LA 5EYGA 1T0KA 2H99A 5DYHA 1Y3QA 1B7UA 2H25A 3Q27A 1R1NA 5AA2A 1SDXA 3RTWB 3B6WA 3ROJA 3T0JA 1HSLA 1GTKA 4P47A 3IK6B 4FECA 1B1HA 4NGUA 4JDFA 3H3GA 5EHSA 1TT1A 1IZ1A 3K6UA 4LA9A 1I6BA 4M1VA 5I57A 3K6VA 3ZKLA 1FPBA 4R6YA 1P1NA 1URSA 4ND9A 2NXOA 5L8DA 1MY4A 3KSJA 2A5SA 4GWZA 1B05A 2THIA 3KBRA 4N07A 4PC9A 4EF2A 2QMWA 3GZGA 4PF6A 4MNCA 3TODA 1FPIA 1DBZA 4TLLB 2E1SA 4NF8B 4JBZA 1VSOA 3VV5A 3K00A 4X8RA 1N84A 4X1BA 4TOZA 3T96B 4H67A 5AA4B 1XOCA 5I59A 3D4GA 1FCKA 2Z8EA 3UP9A 1B3GA 2XXWA 4R9GA 3TTLA 3FVOA 5CMKA 4JWYA 3HHGA 1B3EA 3K1NA 3FVNA 2BJIA 2OCUA 2AYSA 4LATA 4U22A 5L9OA 1US5A 2RF1A 3ONMA 4MX6A 3UA8A 1A54A 2R9JA 1N7XA 1B2HA 3SEVA 3KGCA 3U94A 3OEMA 2PMSA 1IXGA 4G8MA 3PUYE 4U4SA 5EYHA 3PTYA 1NUYA 4OESA 4OZ9A 3ODBA 4PGNA 3EQ1A 4N13A 4P0GA 1EYKA 3FVGA 3BFUA 4ZEDA 3V83A 4XKQA 1B3HA 2O84X 2FNCA 5HM4B 1LBCA 1QKBA 1B7ZA 2YJPA 3E79A 2XXRA 2B3FA 4BDOA 2HAVA 1RKMA 4R9FA 4P9KA 4YMBA 1RDXA 3PUXE 1B7HA 2OLBA 3FXRA 1VFDA 3OSQA 3SEYA 3IFAA 2Q2CA 3CI8A 2HQ0A 1H76A 2QRYA 1D9VA 1R9QA 4QFLA 3TTMA 3R7XA 1UTHA 4YZZA 4G77A 2QL3A 3MJNA 3HHFA 1JETA 1ZKBA 3PUWE 4PP0A 4DXCA 2DOJA 1DTZA 1OVBA 4ZE8A 1FTMA 4G2ZA 1S50A 4F31B 2GHBA 1Y3NA 5KCJB 3VXBA 3ZSFA 2PT1A 3PPOA 5JTYA 3QXMA 4POXA 2H9BA 1Y4CA 2VD2A 2CEXA 1WVJA 4XIGQ 1XC1A 1GGGA 2B4MA 4IO6A 4Q0CA 3P7IA 4PETA 3N26A 2B65A 1NNKA 4LQ2A 2CMOA 1NV5A 3JYRA 1NV3A 1MDQA 3U65A 4PF8A 1DPPA 4QXDA 4P1EA 1MPCA 1IMEA 1N0TA 1B5IA 2I3WA 3I5OA 2REGA 5CMMA 4MLVA 1TFDA 2FIEA 3QMFA 3RTFB 2GQ1A 5DTBA 3FV1A 3S4UA 1NV2A 2HAUA 1PBQA 4NTLA 1FBGA 1FQCA 2F5XA 4QSCA 5A5XB 2D3IA 5I7IA 3RT6B 1FW0A 3K01A 1P1WA 3ZKKA 1M5DA 1M5EA 4F3GA 4QFPA 1TWYA 4OYVA 2B3BA 5F7VA 3VVDA 2DVCA 2IEEA 4KI0E 5TPAA 2HHMA 2I6EA 5ITPA 5HBCA 1SQYA 4RK2A 5I2NB 5DW8A 5EQ8A 3V5AA 1FPEA 3I6VA 4RK9A 4K3FA 4H5FA 4QFNA 3DP4A 3T9XB 4JSOA 5ELVA 1R6ZA 4XFEA 3B6TA 3OO9A 3IOTA 4EQBA 2NUVA 4N6KA 3TTKA 2CEYA 3VXCA 2HZKA 1FBPA 3W9WA 3G7WA 2M8CA 2PYYA 3C35A 3KZGA 4HS7A 4FAJA 3SEUA 3KN8A 3K1PA 2RC7A 4BLAA 4GL8A 1TXFA 3E9XA 5I57B 4YKJA 4GRKA 4NF6A 4IB2A 1LEVA 3PPPA 4PCDA 4JXIA 1I6AA 4GWOA 4N91A 2X26A 3LV0A 4XKRA 3VE1B 3TFLA 2G29A 1KWHA 2WX9A 3SZPA 4R74A 1FQDA 2DVZA 1YYZA 3KSXA 5JK4A 4F2QA 2KLFA 2G93A 2LAOA 3LC8A 4YB5A 3DP8A 1DPEA 2QS1A 1A7LA 2XD3A 1BK4A 5DVFA 3S9NC 3MSTA 3O97A 3C31A 4F19A 4EQ9A 1YTVA 1JW5A 4IY5A 5B7DA 4GWXA 3K2DA 4OANA 4AS5A 3PUVE 4XKNA 4P0IA 3RGYA 2UYEA 5CMCA 1Q35A 4OMBA 1D4NA 1LFIA 3G3GA 4XXUA 3TKDA 4R2FA 3N6TA 2QVRA 4WEDA 3B7DA 2Q74A 4ZE9A 3KOTA 1FBFA 1YXIA 1ZBMA 1SYHA 3U1OA 5IAIA 3MUQA 3BFTA 2Z22A 4PE5B 1IXCA 1LAHE 5I2KA 2ANJA 4R73A 4LVQA 5AE4A 2GRVA 4LZ8A 1NH7A 2QVVA 3C4MA 1IMFA 1NI9A 1Z7ME 2WYKA 4DXUA 4OFOA 2O1MA 1H43A 1LSTA 3FGSA 5H8NA 2VGQA 3LUYA 3BIGA 3QAXA 3R26A 4R6HA 1MH4A 4R6KA 1N04A 1LAXA 4HXVA 3S9MC 4Q5TA 4UACA 3MPLA 4O3AA 4DXBA 2O7UA 5KCJA 1PB9A 3MC2A 3CG3A 1XVXA 1LGBC 1LBBA 4N6DA 4FIMA 4YMAA 1K9YA 4P11A 2O69A 2R6GE 1JVXA 2XX7A 4H45A 5I56B 1SD3A 5IZ1A 2Q8MA 2Y7IA 1MXZA 2VP1A 4HE2A 1FPDA 4E0XA 2Q9TA 3RUMA 4OEUA 3CFZA 4OTEA 2HPGA 2ZYOA 1OQGA 5ET6A 4IY6A 5FTIA 5LTCA 1XHYA 2ZYKA 4DI4B 1B3LA 4KFQA 3LR1A 3H6UA 1ZJLA 4YKKA 1ZLQA 4X9TA 3TCFA 1M5BA 1HSEA 3C33A 2QS4A 2XXXA 1S9TA 1DSNA 4GLIA 3RN8A 1SPIA 2XXYA 3SEWA 2NVUB 2VPNA 3HN0A 4GX3A 4QHQA 4KR5A 3G3FA 1WDNA 3QK6A 3RY3A 2RCBA 1MPBA 2I4CA 4QFKA 2F6GA 3G3JA 4UABA 3KC1A 1MXWA 2Q2AA 1FPKA 4GD5A 4GQOA 4N6PA 3RYDA 3FD3A 1XS5A 5I2NA 3OXNA 1FPJA 4EQ7A 1YZ0A 2RKMA 2OJTA 1MXYA 1RYXA 4DDDA 1B5HA 4WEPA 1SI1A 3A3CA 4ESWA 1M5FA 3IO4A 4PAIA 5H8HA 3CSBA 4PBQA 5TPAB 1MY2A 4JVIA 1RDZA 4OQOA 3E3KA 2ZXTA 3EN3A 1SW5A 3CG1A 4F3SA 2DSFA 3CIJA 1BIYA 1UTBB 4O7MA 5IZ3A 2ZMBA 3IOUA 2PX1A 3CHGA 3TPAA 5ICTA 1PBPA 4P56A 1IQ7A 3BKIB 2NOOA 4OETA 3DELB 4GBVA 3U93A 4NN3A 3PD9A 2CZLA 4I40A 2ZZWA 3FV2A 2D5WA 3VLVA 4GX4A 1EZOA 3D1RA 4BDNA 2AIXA 4NF6B 1LCTA 4LONB 1FRPA 3HSTA 4GIZA 1QJMA 1Z7NE 1OIBA 1SW4A 4EXLA 4GXSB 1IMCA 2GHAA 4PFIA 1IMBA 2QJEA 2ZYMA 1OVTA 4F3BA 4HTGA 5I58B 3CVGA 1QGXA 1J1NA 1KZ8A 3MP6A 4OERA 2I58A 2F34A 1VE4A 5ET7A 1Y20A 1CNQA 1N76A 3Q25A 4GWSA 1LAGE 3M3FA 3AXFA 4PAFA 4LP2B 3W9VA 2UYFA 3KG2A 1URDA 2RC8A 1YAEA 4EF1A 1URGA 4X04A 3PV0E 2OBGA 2WBDA 2F6PA 5A5LA 3K0VA 3MBPA 4BDLA 1IMAA 4QSEA 3O28A 2JJKA 3OO8A 4NF5B 1MXUA 1USYE 1AH5A 5DEXA 3E78A 4ZDMA 3TYHA 3SESA 2HXWA 1A99A 1UIUA 4BDQA
chains in the Genus database with same CATH topology
3CSGA 2H98A 4IO4A 1SYIA 3PMXA 3E4RA 2W7YA 3T66A 3MQ9A 1MDP1 3TCHA 3IO6A 5I2KB 1JQFA 1N7WA 3EHSA 4QRZA 5I56A 3GBAA 5H8NB 4X1DA 4UA8A 3IB1A 1NNTA 4Z0IA 1Y3PA 2X7PA 2Y7WA 1MH3A 5ICQA 3QSLA 2FYIA 1II5A 1JNFA 4GFRA 4G4PA 4KCCA 3CFXA 3UORA 1MY3A 2I48A 1FQEA 3EF7A 1BLFA 5CBSA 1H3DA 3T9UA 1AOVA 4DIGA 3MVXA 1MS7A 4H8JA 1B51A 2XX8A 4XTCQ 3F11A 5LOMA 3VFJA 3RNNA 3TZAA 3IAZA 2I4BA 4LZ7A 2DWHA 2A5TB 3FATA 3CRBA 4YAHX 4U1OA 1Y9UA 4IO7A 1MXVA 3O6GA 1PDAA 1B52A 2DXYA 1FQFA 3THIA 3VVFA 2F7CA 3KEIA 3GLBA 1Y1MA 2V25A 1GR2A 1POTA 3ZS6A 4EXKA 3IOWA 4O3BA 3C9HA 3A09A 2ZYNA 1O7TA 4FE8A 1FQBA 1O64A 4DCXA 1B9JA 3U72A 2PT2A 3T9VA 1IUDA 1UTBA 1QULA 4KYEA 4U21A 3UK4A 2NWJA 3K6XA 1B6HA 1MPDA 4RPNA 1Y4TA 4NF4B 2Y84A 3TCGA 5H8HB 3H06B 3IB2A 3MPKA 4H5GA 1B32A 2VD3A 1FTLA 3LSLA 4OENA 1PEBA 2P1SA 2I49A 1B0HA 3VLUA 4ZECA 2XXVA 5CBRA 1GVCA 2D21A 1AMFA 5TP9B 4MBPA 5I58A 1B5JA 3VDFA 2UVIA 4I1DA 3KN7A 3MVYA 4F2OA 1N3WA 3V89B 3FXQA 2V3TA 2BJJX 1UIVA 4U2RA 2ZNUA 1MY0A 2I0BA 5DVIA 2F97A 3L6HA 3SEXA 4TLMB 2REJA 4MFIA 3USDA 3QUFA 4NF5A 1MY1A 2ONKE 2AL4A 1NFTA 4JSDA 1QKAA 2DE3A 5DT6A 2DE2A 4ZEFA 2PBWA 4F1VA 3G3HA 1FQAA 1NNPA 1LLSA 4F22A 4RYAA 1IITA 4JB7A 1EU8A 1NH8A 1B4ZA 2ONRA 4ZS9A 5M2VA 5DEXB 3T22A 2XXHA 2ABHA 4ONYA 1WODA 4FEBA 5H8QA 3PPNA 3JZJA 3S9LC 1HSJA 4QF9A 2I3VA 1BKAA 3DM0A 3KJ7A 1CB6A 4IO5A 1NNFA 1P1OA 5EHMA 4L17A 4ELQA 3H03A 4DCYA 1DTGA 2DP8A 3RT8A 3IB0A 4ELRA 3H4ZA 1YCJA 3KJTA 4ZZAA 3SDFA 2O51A 4DE8A 5L9MA 3SERA 4KQPA 5BWJA 4IGRA 3H6TA 2RINA 3SETA 2XXIA 3TUSA 4GL0A 4KYDA 2DQVA 3GBBA 1JEUA 3QIMA 2H4IA 4RXLA 5AA2D 3MZ1A 4LQ5A 3PD8A 2A5TA 2XXPA 4FJPA 4ZEBA 1IIWA 1YPNA 3G3KA 2OZZA 2QMXA 2UVJA 1MG1A 2AL5A 2Q88A 3OD7A 2Z8FA 2Q89A 2Y7KA 2Y7PA 2H5YA 1JW1A 1PB7A 3MVWA 4ZEKA 2YPNA 4JWXA 1ELJA 4GVOA 2XHDA 5FHOA 4KHZE 4RNSA 3Q28A 5AA1A 3KN3A 4I8CA 1SBPA 1LB9A 1ZIUA 4BDMA 3TTNA 2DWJA 4IGTA 3UN6A 4QSDA 1LCFA 1IEJA 4G8NA 4AB5A 2VOZA 1B3FA 4H1XA 3TDJA 4OVJA 4NF4A 4YICA 4F3PA 3KOSA 3N94A 3MW0A 2HEUA 5K2XA 1EZ9A 1AL3A 3W15C 3U8QA 2HCAA 3MVZA 3FASA 2P2AA 3HPIA 4R75A 3IORA 1MQJA 3PGFA 4PQJA 3TEPA 4YB7A 2DS9A 4Z7EA 1USYH 5F1QA 2GFEA 4KPTA 5TP9A 4C1TA 4ZZEA 5CMBA 3RLFE 2RCAA 4OXVA 3ECRA 4F18A 2Q8JA 3OO6A 3VLWA 4O3CA 2Z8DA 2O6AA 3FUZA 2ONSA 3FIRA 1CE2A 3IL1B 4GXAA 2RC9A 1ANFA 1RYOA 3OOAA 3GXAA 1NL5A 4ELPA 1US4A 1OLAA 4C0RA 3Q26A 3PMVA 4OWDA 5L9SA 4H65A 1FTJA 2F78A 2DYXA 3EHTA 1FTKA 3FVKA 1SVXB 3ILUB 3LSXA 2FA7A 1LFGA 4WXJA 2UVGA 3LBSA 3CR9A 5KZTA 4PFUA 3OENA 4KYSA 2QS2A 2YLNA 3IX1A 4OFLA 3IJXB 1GV8A 4F39A 3PUZE 3MP1A 4FEDA 3FJMA 2O7IA 2V84A 4YB6A 1B1XA 3VVEA 4ISUA 4EDPA 5FHMA 3MP8A 2IA4A 3MZBA 4H6DA 4F1YA 4THIA 1SW2A 3O66A 3M3LA 4WKMA 3OELA 4AB6A 1MXXA 4AQ4A 1MQHA 1ZTYA 1I69A 5H8QB 1MM6A 3B6QA 1A8EA 1PC3A 5DVJA 3S2VA 4DLDA 3SKPA 2DXRA 3O6HA 3FXUA 1LB8A 2DWIA 2F7BA 4G68B 1Y1ZA 4NEDA 5KDTA 4MF3A 3TAJA 3BBRA 3EHUA 3E13X 4U23A 3H7MA 1LAFE 4OHNA 3V8XB 3R6UA 1BP5A 1MM7A 3TQLA 3T93B 4OFJA 1JVYA 4H8IA 3OSRA 2VHAA 3OO7A 5H8FB 3D4CA 3I3VA 4YKPA 1AIVA 2XD2A 1ZMGA 1OMPA 3FJ7A 5CC2A 2V3UA 4YKIA 4U4XA 3TQWA 3O2AA 4PFWA 4NE4A 5BUUA 3WAEA 2GH9A 1XT8A 4I9DA 3M8UA 1ZU0A 2R71A 3KFMA 1OLCA 2Y7RA 3HO7A 3G3IA 4G68C 1NKXA 3O6IA 3S9EA 1R9LA 1SI0A 1Q1KA 3JV9A 3FJGA 5CRYA 2V3QA 4GOTA 4FORA 4POWA 4GF8A 3T9HB 4G8HA 5K2YA 1DMBA 3PU5A 1OQHA 1VFEA 3C32A 3HV1A 3MZ9A 4C1UA 4IO3A 3Q29A 2ZNSA 4M4GA 1H45A 4KD5A 2OWTA 2QSXA 3WAFA 1EZPA 4DZ1A 2F35A 1I6QA 1PB8A 1JW4A 1O63A 5TU0A 5H8SA 3TELA 2DWAA 5EYFA 2HZLA 1QW0A 5FTHA 4KCDA 4JWOA 1P99A 3H6VA 4ESXA 2X7QA 4RA1A 5AA2B 4RPOA 1B40A 2XX9A 4LZ5A 3K4UA 4BDRA 4NF8A 3O9PA 4Q30B 2ALUA 5CM6A 1MQDA 4NMYA 3K6WA 3IJOB 5AA4A 1S7YA 1UQWA 4MH5A 5J1DA 3LSFB 1EH3A 1QUKA 4QFOA 1QUIA 3IR1A 2ZNTA 4F29A 1MQIA 4PFTA 1POY1 3DLNA 4FATA 4HW8A 2XXQA 3K02A 1DOTA 2PVUA 5I84A 2UVHA 5I59B 4RY1A 3N6UA 2Z23A 1MRPA 3C36A 2P0SA 4RJZA 4R2BA 5ITOA 1A55A 3PPRA 5IKBA 2F8DA 3FZVA 1IXIA 3RPWA 1H44A 1L5TA 1P1QA 3TMGA 3DP6A 3H6WA 2F36A 1ATGA 1A40A 3PMWA 4TQUQ 3A3UA 1JEVA 2XXTA 3EPEA 2DE4A 4NWDA 1B58A 4ECFA 3K1MA 4G68A 4HCWA 3TTRA 4PFYA 1BTJA 2V93A 2XXUA 1B46A 4IO2A 5HPQA 1M5CA 3IOVA 1A8FA 1UTHB 1P1UA 2OWSA 3ILTB 2ESNA 5B70A 2QPQA 1MQGA 5H8FA 3MAMA 4E0WA 3MWBA 2OK2A 5KDTB 4R72A 1N3XA 2QS3A 3HCQA 3CFLA 3UGWA 1XVYA 3UIFA 3OEKA 3M3KA 2E0SA 3LSWA 4YU0A 3RQTA 4ELOA 5JTYB 4F1UA 1TFAA 1D3KA 4Q8RA 5CI5A 2O68A 1IXHA 5AA3A 3QYTA 4EUOA 1QUJA 5ISUA 4I62A 2UXAA 2WKYA 1B4HA 2I0CA 3PPQA 4OEVA 1D9YA 5A5XA 1F9BA 1FTOA 1SW1A 3QUJA 2HFBA 4LUBA 3OMBA 2F7AA 4NWCA 4U1ZA 4ZEIA 1VR5A 1B0LA 3O29A 3U92A 1NMUA 5JEIA 4XKPA 3L6GA 1QVSA 4MLQA 4HCYA 4H0WA 3C34A 4X48A 1LFHA 3N5LA 5FHNA 2O1LA 1T0KA 2H99A 5DYHA 1Y3QA 1B7UA 2H25A 3Q27A 1R1NA 5AA2A 1SDXA 3RTWB 3B6WA 1HSLA 1GTKA 3IK6B 4FECA 1B1HA 4JDFA 3H3GA 5EHSA 1TT1A 1IZ1A 3K6UA 4LA9A 1I6BA 4M1VA 5I57A 3K6VA 3ZKLA 4R6YA 1P1NA 1URSA 4ND9A 2NXOA 5L8DA 1MY4A 3KSJA 2A5SA 1B05A 2THIA 3KBRA 4N07A 4EF2A 2QMWA 3GZGA 3TODA 4TLLB 2E1SA 4NF8B 4JBZA 1VSOA 3VV5A 3K00A 1N84A 4X1BA 4TOZA 3T96B 4H67A 5AA4B 1XOCA 5I59A 3D4GA 1FCKA 2Z8EA 3UP9A 1B3GA 2XXWA 4R9GA 3TTLA 3FVOA 5CMKA 4JWYA 3HHGA 1B3EA 3K1NA 3FVNA 2OCUA 2AYSA 4LATA 4U22A 5L9OA 1US5A 2RF1A 3ONMA 3UA8A 1A54A 2R9JA 1N7XA 1B2HA 3SEVA 3KGCA 3U94A 3OEMA 2PMSA 1IXGA 4G8MA 3PUYE 4U4SA 4OESA 4OZ9A 3ODBA 3EQ1A 4N13A 4P0GA 3FVGA 3BFUA 4ZEDA 3V83A 4XKQA 1B3HA 2O84X 2FNCA 5HM4B 1LBCA 1QKBA 1B7ZA 2YJPA 2XXRA 2B3FA 4BDOA 2HAVA 1RKMA 4R9FA 4YMBA 3PUXE 1B7HA 2OLBA 3FXRA 1VFDA 3OSQA 3SEYA 2Q2CA 3CI8A 2HQ0A 1H76A 2QRYA 1D9VA 1R9QA 4QFLA 3TTMA 3R7XA 1UTHA 4YZZA 4G77A 2QL3A 3MJNA 3HHFA 1JETA 1ZKBA 3PUWE 4PP0A 4DXCA 2DOJA 1DTZA 1OVBA 4ZE8A 1FTMA 4G2ZA 1S50A 4F31B 2GHBA 1Y3NA 5KCJB 3VXBA 3ZSFA 2PT1A 3PPOA 5JTYA 3QXMA 4POXA 2H9BA 1Y4CA 2VD2A 1WVJA 4XIGQ 1XC1A 1GGGA 4IO6A 4Q0CA 3P7IA 4PETA 3N26A 2B65A 1NNKA 4LQ2A 2CMOA 3JYRA 1MDQA 1DPPA 1MPCA 3I5OA 1N0TA 1B5IA 2I3WA 2REGA 5CMMA 4MLVA 1TFDA 3RTFB 5DTBA 3FV1A 3S4UA 2HAUA 1PBQA 4NTLA 1FQCA 2F5XA 4QSCA 5A5XB 2D3IA 3RT6B 1FW0A 3K01A 1P1WA 3ZKKA 1M5DA 1M5EA 4F3GA 4QFPA 1TWYA 4OYVA 2B3BA 5F7VA 3VVDA 2DVCA 2IEEA 4KI0E 5TPAA 2I6EA 5ITPA 5HBCA 1SQYA 4RK2A 5I2NB 3V5AA 3I6VA 4RK9A 4K3FA 4H5FA 4QFNA 3DP4A 3T9XB 4JSOA 5ELVA 1R6ZA 3B6TA 3OO9A 3IOTA 4EQBA 2NUVA 3TTKA 3VXCA 2HZKA 3W9WA 3G7WA 2M8CA 2PYYA 3C35A 3KZGA 4HS7A 4FAJA 3SEUA 3KN8A 3K1PA 2RC7A 4BLAA 4GL8A 1TXFA 3E9XA 5I57B 4YKJA 4GRKA 4NF6A 4IB2A 3PPPA 4JXIA 1I6AA 4GWOA 2X26A 4XKRA 3VE1B 3TFLA 2G29A 1KWHA 4R74A 1FQDA 2DVZA 3KSXA 5JK4A 4F2QA 2KLFA 2G93A 2LAOA 3LC8A 4YB5A 3DP8A 1DPEA 2QS1A 1A7LA 2XD3A 3S9NC 5DVFA 3O97A 3C31A 4F19A 4EQ9A 1YTVA 1JW5A 4IY5A 5B7DA 3K2DA 3PUVE 4XKNA 4P0IA 3RGYA 2UYEA 5CMCA 1Q35A 4OMBA 1D4NA 1LFIA 3G3GA 4XXUA 3TKDA 4R2FA 3N6TA 4WEDA 3B7DA 4ZE9A 3KOTA 1ZBMA 1SYHA 3U1OA 5IAIA 3MUQA 3BFTA 2Z22A 4PE5B 1IXCA 1LAHE 5I2KA 2ANJA 4R73A 4LVQA 5AE4A 2GRVA 4LZ8A 1NH7A 3C4MA 1Z7ME 4DXUA 4OFOA 2O1MA 1H43A 1LSTA 3FGSA 5H8NA 2VGQA 3LUYA 3QAXA 3R26A 4R6HA 1MH4A 4R6KA 1N04A 1LAXA 3S9MC 4Q5TA 4UACA 3MPLA 4O3AA 4DXBA 2O7UA 5KCJA 1PB9A 3MC2A 3CG3A 1XVXA 1LGBC 1LBBA 4FIMA 4YMAA 4P11A 2O69A 2R6GE 1JVXA 2XX7A 5I56B 1SD3A 2Y7IA 1MXZA 2VP1A 4E0XA 2Q9TA 3RUMA 4OEUA 3CFZA 4OTEA 2ZYOA 1OQGA 4IY6A 5FTIA 1XHYA 2ZYKA 1B3LA 4KFQA 3LR1A 3H6UA 1ZJLA 4YKKA 1ZLQA 4X9TA 3TCFA 1M5BA 1HSEA 3C33A 2QS4A 2XXXA 1S9TA 1DSNA 4GLIA 3RN8A 2XXYA 3SEWA 2NVUB 3HN0A 4QHQA 4KR5A 3G3FA 1WDNA 3QK6A 3RY3A 2RCBA 1MPBA 2I4CA 4QFKA 2F6GA 3G3JA 1MXWA 2Q2AA 4GD5A 4GQOA 4N6PA 3FD3A 1XS5A 5I2NA 3OXNA 4EQ7A 2RKMA 2OJTA 1MXYA 1RYXA 4DDDA 1B5HA 4WEPA 1SI1A 3A3CA 4ESWA 1M5FA 3IO4A 5H8HA 3CSBA 5TPAB 1MY2A 4OQOA 3E3KA 2ZXTA 3EN3A 1SW5A 3CG1A 4F3SA 2DSFA 3CIJA 1BIYA 1UTBB 2ZMBA 3IOUA 2PX1A 3TPAA 5ICTA 1PBPA 1IQ7A 3BKIB 2NOOA 4OETA 3DELB 3U93A 3PD9A 2CZLA 3FV2A 2D5WA 3VLVA 1EZOA 4BDNA 2AIXA 4NF6B 1LCTA 4LONB 3HSTA 4GIZA 1QJMA 1Z7NE 1OIBA 1SW4A 4EXLA 4GXSB 2GHAA 2QJEA 2ZYMA 1OVTA 4F3BA 4HTGA 5I58B 3CVGA 1J1NA 3MP6A 4OERA 2I58A 2F34A 1VE4A 1Y20A 1N76A 3Q25A 1LAGE 3M3FA 3AXFA 4LP2B 3W9VA 2UYFA 3KG2A 1URDA 2RC8A 1YAEA 4EF1A 1URGA 3PV0E 2OBGA 2F6PA 3K0VA 3MBPA 4BDLA 4QSEA 3O28A 3OO8A 4NF5B 1MXUA 1USYE 1AH5A 5DEXA 4ZDMA 3TYHA 3SESA 2HXWA 1A99A 1UIUA 4BDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSG A;  2H98 A;  4IO4 A;  1SYI A;  3PMX A;  3E4R A;  2W7Y A;  3T66 A;  3MQ9 A;  1MDP 1;  3TCH A;  3IO6 A;  5I2K B;  1JQF A;  1N7W A;  3EHS A;  4QRZ A;  5I56 A;  3GBA A;  5H8N B;  4X1D A;  4UA8 A;  3IB1 A;  1NNT A;  4Z0I A;  1Y3P A;  2X7P A;  2Y7W A;  1MH3 A;  5ICQ A;  3QSL A;  2FYI A;  1II5 A;  1JNF A;  4GFR A;  4G4P A;  4KCC A;  3CFX A;  3UOR A;  1MY3 A;  2I48 A;  1FQE A;  3EF7 A;  1BLF A;  5CBS A;  1H3D A;  3T9U A;  1AOV A;  4DIG A;  3MVX A;  1MS7 A;  4H8J A;  1B51 A;  2XX8 A;  4XTC Q;  3F11 A;  5LOM A;  3VFJ A;  3RNN A;  3TZA A;  3IAZ A;  2I4B A;  4LZ7 A;  2DWH A;  2A5T B;  3FAT A;  3CRB A;  4YAH X;  4U1O A;  1Y9U A;  4IO7 A;  1MXV A;  3O6G A;  1PDA A;  1B52 A;  2DXY A;  1FQF A;  3THI A;  3VVF A;  2F7C A;  3KEI A;  3GLB A;  1Y1M A;  2V25 A;  1GR2 A;  1POT A;  3ZS6 A;  4EXK A;  3IOW A;  4O3B A;  3C9H A;  3A09 A;  2ZYN A;  1O7T A;  4FE8 A;  1FQB A;  1O64 A;  4DCX A;  1B9J A;  3U72 A;  2PT2 A;  3T9V A;  1IUD A;  1UTB A;  1QUL A;  4KYE A;  4U21 A;  3UK4 A;  2NWJ A;  3K6X A;  1B6H A;  1MPD A;  4RPN A;  1Y4T A;  4NF4 B;  2Y84 A;  3TCG A;  5H8H B;  3H06 B;  3IB2 A;  3MPK A;  4H5G A;  1B32 A;  2VD3 A;  1FTL A;  3LSL A;  4OEN A;  1PEB A;  2P1S A;  2I49 A;  1B0H A;  3VLU A;  4ZEC A;  2XXV A;  5CBR A;  1GVC A;  2D21 A;  1AMF A;  5TP9 B;  4MBP A;  5I58 A;  1B5J A;  3VDF A;  2UVI A;  4I1D A;  3KN7 A;  3MVY A;  4F2O A;  1N3W A;  3V89 B;  3FXQ A;  2V3T A;  2BJJ X;  1UIV A;  4U2R A;  2ZNU A;  1MY0 A;  2I0B A;  5DVI A;  2F97 A;  3L6H A;  3SEX A;  4TLM B;  2REJ A;  4MFI A;  3USD A;  3QUF A;  4NF5 A;  1MY1 A;  2ONK E;  2AL4 A;  1NFT A;  4JSD A;  1QKA A;  2DE3 A;  5DT6 A;  2DE2 A;  4ZEF A;  2PBW A;  4F1V A;  3G3H A;  1FQA A;  1NNP A;  1LLS A;  4F22 A;  4RYA A;  1IIT A;  4JB7 A;  1EU8 A;  1NH8 A;  1B4Z A;  2ONR A;  4ZS9 A;  5M2V A;  5DEX B;  3T22 A;  2XXH A;  2ABH A;  4ONY A;  1WOD A;  4FEB A;  5H8Q A;  3PPN A;  3JZJ A;  3S9L C;  1HSJ A;  4QF9 A;  2I3V A;  1BKA A;  3DM0 A;  3KJ7 A;  1CB6 A;  4IO5 A;  1NNF A;  1P1O A;  5EHM A;  4L17 A;  4ELQ A;  3H03 A;  4DCY A;  1DTG A;  2DP8 A;  3RT8 A;  3IB0 A;  4ELR A;  3H4Z A;  1YCJ A;  3KJT A;  4ZZA A;  3SDF A;  2O51 A;  4DE8 A;  5L9M A;  3SER A;  4KQP A;  5BWJ A;  4IGR A;  3H6T A;  2RIN A;  3SET A;  2XXI A;  3TUS A;  4GL0 A;  4KYD A;  2DQV A;  3GBB A;  1JEU A;  3QIM A;  2H4I A;  4RXL A;  5AA2 D;  3MZ1 A;  4LQ5 A;  3PD8 A;  2A5T A;  2XXP A;  4FJP A;  4ZEB A;  1IIW A;  1YPN A;  3G3K A;  2OZZ A;  2QMX A;  2UVJ A;  1MG1 A;  2AL5 A;  2Q88 A;  3OD7 A;  2Z8F A;  2Q89 A;  2Y7K A;  2Y7P A;  2H5Y A;  1JW1 A;  1PB7 A;  3MVW A;  4ZEK A;  2YPN A;  4JWX A;  1ELJ A;  4GVO A;  2XHD A;  5FHO A;  4KHZ E;  4RNS A;  3Q28 A;  5AA1 A;  3KN3 A;  4I8C A;  1SBP A;  1LB9 A;  1ZIU A;  4BDM A;  3TTN A;  2DWJ A;  4IGT A;  3UN6 A;  4QSD A;  1LCF A;  1IEJ A;  4G8N A;  4AB5 A;  2VOZ A;  1B3F A;  4H1X A;  3TDJ A;  4OVJ A;  4NF4 A;  4YIC A;  4F3P A;  3KOS A;  3N94 A;  3MW0 A;  2HEU A;  5K2X A;  1EZ9 A;  1AL3 A;  3W15 C;  3U8Q A;  2HCA A;  3MVZ A;  3FAS A;  2P2A A;  3HPI A;  4R75 A;  3IOR A;  1MQJ A;  3PGF A;  4PQJ A;  3TEP A;  4YB7 A;  2DS9 A;  4Z7E A;  1USY H;  5F1Q A;  2GFE A;  4KPT A;  5TP9 A;  4C1T A;  4ZZE A;  5CMB A;  3RLF E;  2RCA A;  4OXV A;  3ECR A;  4F18 A;  2Q8J A;  3OO6 A;  3VLW A;  4O3C A;  2Z8D A;  2O6A A;  3FUZ A;  2ONS A;  3FIR A;  1CE2 A;  3IL1 B;  4GXA A;  2RC9 A;  1ANF A;  1RYO A;  3OOA A;  3GXA A;  1NL5 A;  4ELP A;  1US4 A;  1OLA A;  4C0R A;  3Q26 A;  3PMV A;  4OWD A;  5L9S A;  4H65 A;  1FTJ A;  2F78 A;  2DYX A;  3EHT A;  1FTK A;  3FVK A;  1SVX B;  3ILU B;  3LSX A;  2FA7 A;  1LFG A;  4WXJ A;  2UVG A;  3LBS A;  3CR9 A;  5KZT A;  4PFU A;  3OEN A;  4KYS A;  2QS2 A;  2YLN A;  3IX1 A;  4OFL A;  3IJX B;  1GV8 A;  4F39 A;  3PUZ E;  3MP1 A;  4FED A;  3FJM A;  2O7I A;  2V84 A;  4YB6 A;  1B1X A;  3VVE A;  4ISU A;  4EDP A;  5FHM A;  3MP8 A;  2IA4 A;  3MZB A;  4H6D A;  4F1Y A;  4THI A;  1SW2 A;  3O66 A;  3M3L A;  4WKM A;  3OEL A;  4AB6 A;  1MXX A;  4AQ4 A;  1MQH A;  1ZTY A;  1I69 A;  5H8Q B;  1MM6 A;  3B6Q A;  1A8E A;  1PC3 A;  5DVJ A;  3S2V A;  4DLD A;  3SKP A;  2DXR A;  3O6H A;  3FXU A;  1LB8 A;  2DWI A;  2F7B A;  4G68 B;  1Y1Z A;  4NED A;  5KDT A;  4MF3 A;  3TAJ A;  3BBR A;  3EHU A;  3E13 X;  4U23 A;  3H7M A;  1LAF E;  4OHN A;  3V8X B;  3R6U A;  1BP5 A;  1MM7 A;  3TQL A;  3T93 B;  4OFJ A;  1JVY A;  4H8I A;  3OSR A;  2VHA A;  3OO7 A;  5H8F B;  3D4C A;  3I3V A;  4YKP A;  1AIV A;  2XD2 A;  1ZMG A;  1OMP A;  3FJ7 A;  5CC2 A;  2V3U A;  4YKI A;  4U4X A;  3TQW A;  3O2A A;  4PFW A;  4NE4 A;  5BUU A;  3WAE A;  2GH9 A;  1XT8 A;  4I9D A;  3M8U A;  1ZU0 A;  2R71 A;  3KFM A;  1OLC A;  2Y7R A;  3HO7 A;  3G3I A;  4G68 C;  1NKX A;  3O6I A;  3S9E A;  1R9L A;  1SI0 A;  1Q1K A;  3JV9 A;  3FJG A;  5CRY A;  2V3Q A;  4GOT A;  4FOR A;  4POW A;  4GF8 A;  3T9H B;  4G8H A;  5K2Y A;  1DMB A;  3PU5 A;  1OQH A;  1VFE A;  3C32 A;  3HV1 A;  3MZ9 A;  4C1U A;  4IO3 A;  3Q29 A;  2ZNS A;  4M4G A;  1H45 A;  4KD5 A;  2OWT A;  2QSX A;  3WAF A;  1EZP A;  4DZ1 A;  2F35 A;  1I6Q A;  1PB8 A;  1JW4 A;  1O63 A;  5TU0 A;  5H8S A;  3TEL A;  2DWA A;  5EYF A;  2HZL A;  1QW0 A;  5FTH A;  4KCD A;  4JWO A;  1P99 A;  3H6V A;  4ESX A;  2X7Q A;  4RA1 A;  5AA2 B;  4RPO A;  1B40 A;  2XX9 A;  4LZ5 A;  3K4U A;  4BDR A;  4NF8 A;  3O9P A;  4Q30 B;  2ALU A;  5CM6 A;  1MQD A;  4NMY A;  3K6W A;  3IJO B;  5AA4 A;  1S7Y A;  1UQW A;  4MH5 A;  5J1D A;  3LSF B;  1EH3 A;  1QUK A;  4QFO A;  1QUI A;  3IR1 A;  2ZNT A;  4F29 A;  1MQI A;  4PFT A;  1POY 1;  3DLN A;  4FAT A;  4HW8 A;  2XXQ A;  3K02 A;  1DOT A;  2PVU A;  5I84 A;  2UVH A;  5I59 B;  4RY1 A;  3N6U A;  2Z23 A;  1MRP A;  3C36 A;  2P0S A;  4RJZ A;  4R2B A;  5ITO A;  1A55 A;  3PPR A;  5IKB A;  2F8D A;  3FZV A;  1IXI A;  3RPW A;  1H44 A;  1L5T A;  1P1Q A;  3TMG A;  3DP6 A;  3H6W A;  2F36 A;  1ATG A;  1A40 A;  3PMW A;  4TQU Q;  3A3U A;  1JEV A;  2XXT A;  3EPE A;  2DE4 A;  4NWD A;  1B58 A;  4ECF A;  3K1M A;  4G68 A;  4HCW A;  3TTR A;  4PFY A;  1BTJ A;  2V93 A;  2XXU A;  1B46 A;  4IO2 A;  5HPQ A;  1M5C A;  3IOV A;  1A8F A;  1UTH B;  1P1U A;  2OWS A;  3ILT B;  2ESN A;  5B70 A;  2QPQ A;  1MQG A;  5H8F A;  3MAM A;  4E0W A;  3MWB A;  2OK2 A;  5KDT B;  4R72 A;  1N3X A;  2QS3 A;  3HCQ A;  3CFL A;  3UGW A;  1XVY A;  3UIF A;  3OEK A;  3M3K A;  2E0S A;  3LSW A;  4YU0 A;  3RQT A;  4ELO A;  5JTY B;  4F1U A;  1TFA A;  1D3K A;  4Q8R A;  5CI5 A;  2O68 A;  1IXH A;  5AA3 A;  3QYT A;  4EUO A;  1QUJ A;  5ISU A;  4I62 A;  2UXA A;  2WKY A;  1B4H A;  2I0C A;  3PPQ A;  4OEV A;  1D9Y A;  5A5X A;  1F9B A;  1FTO A;  1SW1 A;  3QUJ A;  2HFB A;  4LUB A;  3OMB A;  2F7A A;  4NWC A;  4U1Z A;  4ZEI A;  1VR5 A;  1B0L A;  3O29 A;  3U92 A;  1NMU A;  5JEI A;  4XKP A;  3L6G A;  1QVS A;  4MLQ A;  4HCY A;  4H0W A;  3C34 A;  4X48 A;  1LFH A;  3N5L A;  5FHN A;  2O1L A;  1T0K A;  2H99 A;  5DYH A;  1Y3Q A;  1B7U A;  2H25 A;  3Q27 A;  1R1N A;  5AA2 A;  1SDX A;  3RTW B;  3B6W A;  1HSL A;  1GTK A;  3IK6 B;  4FEC A;  1B1H A;  4JDF A;  3H3G A;  5EHS A;  1TT1 A;  1IZ1 A;  3K6U A;  4LA9 A;  1I6B A;  4M1V A;  5I57 A;  3K6V A;  3ZKL A;  4R6Y A;  1P1N A;  1URS A;  4ND9 A;  2NXO A;  5L8D A;  1MY4 A;  3KSJ A;  2A5S A;  1B05 A;  2THI A;  3KBR A;  4N07 A;  4EF2 A;  2QMW A;  3GZG A;  3TOD A;  4TLL B;  2E1S A;  4NF8 B;  4JBZ A;  1VSO A;  3VV5 A;  3K00 A;  1N84 A;  4X1B A;  4TOZ A;  3T96 B;  4H67 A;  5AA4 B;  1XOC A;  5I59 A;  3D4G A;  1FCK A;  2Z8E A;  3UP9 A;  1B3G A;  2XXW A;  4R9G A;  3TTL A;  3FVO A;  5CMK A;  4JWY A;  3HHG A;  1B3E A;  3K1N A;  3FVN A;  2OCU A;  2AYS A;  4LAT A;  4U22 A;  5L9O A;  1US5 A;  2RF1 A;  3ONM A;  3UA8 A;  1A54 A;  2R9J A;  1N7X A;  1B2H A;  3SEV A;  3KGC A;  3U94 A;  3OEM A;  2PMS A;  1IXG A;  4G8M A;  3PUY E;  4U4S A;  4OES A;  4OZ9 A;  3ODB A;  3EQ1 A;  4N13 A;  4P0G A;  3FVG A;  3BFU A;  4ZED A;  3V83 A;  4XKQ A;  1B3H A;  2O84 X;  2FNC A;  5HM4 B;  1LBC A;  1QKB A;  1B7Z A;  2YJP A;  2XXR A;  2B3F A;  4BDO A;  2HAV A;  1RKM A;  4R9F A;  4YMB A;  3PUX E;  1B7H A;  2OLB A;  3FXR A;  1VFD A;  3OSQ A;  3SEY A;  2Q2C A;  3CI8 A;  2HQ0 A;  1H76 A;  2QRY A;  1D9V A;  1R9Q A;  4QFL A;  3TTM A;  3R7X A;  1UTH A;  4YZZ A;  4G77 A;  2QL3 A;  3MJN A;  3HHF A;  1JET A;  1ZKB A;  3PUW E;  4PP0 A;  4DXC A;  2DOJ A;  1DTZ A;  1OVB A;  4ZE8 A;  1FTM A;  4G2Z A;  1S50 A;  4F31 B;  2GHB A;  1Y3N A;  5KCJ B;  3VXB A;  3ZSF A;  2PT1 A;  3PPO A;  5JTY A;  3QXM A;  4POX A;  2H9B A;  1Y4C A;  2VD2 A;  1WVJ A;  4XIG Q;  1XC1 A;  1GGG A;  4IO6 A;  4Q0C A;  3P7I A;  4PET A;  3N26 A;  2B65 A;  1NNK A;  4LQ2 A;  2CMO A;  3JYR A;  1MDQ A;  1DPP A;  1MPC A;  3I5O A;  1N0T A;  1B5I A;  2I3W A;  2REG A;  5CMM A;  4MLV A;  1TFD A;  3RTF B;  5DTB A;  3FV1 A;  3S4U A;  2HAU A;  1PBQ A;  4NTL A;  1FQC A;  2F5X A;  4QSC A;  5A5X B;  2D3I A;  3RT6 B;  1FW0 A;  3K01 A;  1P1W A;  3ZKK A;  1M5D A;  1M5E A;  4F3G A;  4QFP A;  1TWY A;  4OYV A;  2B3B A;  5F7V A;  3VVD A;  2DVC A;  2IEE A;  4KI0 E;  5TPA A;  2I6E A;  5ITP A;  5HBC A;  1SQY A;  4RK2 A;  5I2N B;  3V5A A;  3I6V A;  4RK9 A;  4K3F A;  4H5F A;  4QFN A;  3DP4 A;  3T9X B;  4JSO A;  5ELV A;  1R6Z A;  3B6T A;  3OO9 A;  3IOT A;  4EQB A;  2NUV A;  3TTK A;  3VXC A;  2HZK A;  3W9W A;  3G7W A;  2M8C A;  2PYY A;  3C35 A;  3KZG A;  4HS7 A;  4FAJ A;  3SEU A;  3KN8 A;  3K1P A;  2RC7 A;  4BLA A;  4GL8 A;  1TXF A;  3E9X A;  5I57 B;  4YKJ A;  4GRK A;  4NF6 A;  4IB2 A;  3PPP A;  4JXI A;  1I6A A;  4GWO A;  2X26 A;  4XKR A;  3VE1 B;  3TFL A;  2G29 A;  1KWH A;  4R74 A;  1FQD A;  2DVZ A;  3KSX A;  5JK4 A;  4F2Q A;  2KLF A;  2G93 A;  2LAO A;  3LC8 A;  4YB5 A;  3DP8 A;  1DPE A;  2QS1 A;  1A7L A;  2XD3 A;  3S9N C;  5DVF A;  3O97 A;  3C31 A;  4F19 A;  4EQ9 A;  1YTV A;  1JW5 A;  4IY5 A;  5B7D A;  3K2D A;  3PUV E;  4XKN A;  4P0I A;  3RGY A;  2UYE A;  5CMC A;  1Q35 A;  4OMB A;  1D4N A;  1LFI A;  3G3G A;  4XXU A;  3TKD A;  4R2F A;  3N6T A;  4WED A;  3B7D A;  4ZE9 A;  3KOT A;  1ZBM A;  1SYH A;  3U1O A;  5IAI A;  3MUQ A;  3BFT A;  2Z22 A;  4PE5 B;  1IXC A;  1LAH E;  5I2K A;  2ANJ A;  4R73 A;  4LVQ A;  5AE4 A;  2GRV A;  4LZ8 A;  1NH7 A;  3C4M A;  1Z7M E;  4DXU A;  4OFO A;  2O1M A;  1H43 A;  1LST A;  3FGS A;  5H8N A;  2VGQ A;  3LUY A;  3QAX A;  3R26 A;  4R6H A;  1MH4 A;  4R6K A;  1N04 A;  1LAX A;  3S9M C;  4Q5T A;  4UAC A;  3MPL A;  4O3A A;  4DXB A;  2O7U A;  5KCJ A;  1PB9 A;  3MC2 A;  3CG3 A;  1XVX A;  1LGB C;  1LBB A;  4FIM A;  4YMA A;  4P11 A;  2O69 A;  2R6G E;  1JVX A;  2XX7 A;  5I56 B;  1SD3 A;  2Y7I A;  1MXZ A;  2VP1 A;  4E0X A;  2Q9T A;  3RUM A;  4OEU A;  3CFZ A;  4OTE A;  2ZYO A;  1OQG A;  4IY6 A;  5FTI A;  1XHY A;  2ZYK A;  1B3L A;  4KFQ A;  3LR1 A;  3H6U A;  1ZJL A;  4YKK A;  1ZLQ A;  4X9T A;  3TCF A;  1M5B A;  1HSE A;  3C33 A;  2QS4 A;  2XXX A;  1S9T A;  1DSN A;  4GLI A;  3RN8 A;  2XXY A;  3SEW A;  2NVU B;  3HN0 A;  4QHQ A;  4KR5 A;  3G3F A;  1WDN A;  3QK6 A;  3RY3 A;  2RCB A;  1MPB A;  2I4C A;  4QFK A;  2F6G A;  3G3J A;  1MXW A;  2Q2A A;  4GD5 A;  4GQO A;  4N6P A;  3FD3 A;  1XS5 A;  5I2N A;  3OXN A;  4EQ7 A;  2RKM A;  2OJT A;  1MXY A;  1RYX A;  4DDD A;  1B5H A;  4WEP A;  1SI1 A;  3A3C A;  4ESW A;  1M5F A;  3IO4 A;  5H8H A;  3CSB A;  5TPA B;  1MY2 A;  4OQO A;  3E3K A;  2ZXT A;  3EN3 A;  1SW5 A;  3CG1 A;  4F3S A;  2DSF A;  3CIJ A;  1BIY A;  1UTB B;  2ZMB A;  3IOU A;  2PX1 A;  3TPA A;  5ICT A;  1PBP A;  1IQ7 A;  3BKI B;  2NOO A;  4OET A;  3DEL B;  3U93 A;  3PD9 A;  2CZL A;  3FV2 A;  2D5W A;  3VLV A;  1EZO A;  4BDN A;  2AIX A;  4NF6 B;  1LCT A;  4LON B;  3HST A;  4GIZ A;  1QJM A;  1Z7N E;  1OIB A;  1SW4 A;  4EXL A;  4GXS B;  2GHA A;  2QJE A;  2ZYM A;  1OVT A;  4F3B A;  4HTG A;  5I58 B;  3CVG A;  1J1N A;  3MP6 A;  4OER A;  2I58 A;  2F34 A;  1VE4 A;  1Y20 A;  1N76 A;  3Q25 A;  1LAG E;  3M3F A;  3AXF A;  4LP2 B;  3W9V A;  2UYF A;  3KG2 A;  1URD A;  2RC8 A;  1YAE A;  4EF1 A;  1URG A;  3PV0 E;  2OBG A;  2F6P A;  3K0V A;  3MBP A;  4BDL A;  4QSE A;  3O28 A;  3OO8 A;  4NF5 B;  1MXU A;  1USY E;  1AH5 A;  5DEX A;  4ZDM A;  3TYH A;  3SES A;  2HXW A;  1A99 A;  1UIU A;  4BDQ A; 
#chains in the Genus database with same CATH topology
 3CSG A;  2H98 A;  2WYP A;  4I3Y A;  4IO4 A;  1SYI A;  3PMX A;  3E4R A;  2W7Y A;  4XF5 A;  3T66 A;  3MQ9 A;  1MDP 1;  3TCH A;  3IO6 A;  1JP4 A;  5I2K B;  2DDK A;  1JQF A;  5FBP A;  1N7W A;  4MHF A;  3EHS A;  4PTK A;  4QRZ A;  5I56 A;  3GBA A;  5H8N B;  4PAK A;  4X1D A;  4UA8 A;  3IB1 A;  3FBP A;  1NNT A;  4I3E A;  4Z0I A;  1Y3P A;  2X7P A;  2Y7W A;  5LDZ A;  1MH3 A;  5ICQ A;  1NUX A;  3QSL A;  1LBV A;  2FYI A;  1II5 A;  1JNF A;  4GFR A;  4N8Y A;  4NQ8 A;  2OWZ A;  4G4P A;  4KCC A;  1D9Q A;  3CFX A;  3UOR A;  1MY3 A;  2I48 A;  1FQE A;  3EF7 A;  1FSA A;  1BLF A;  5CBS A;  1H3D A;  3T9U A;  1AOV A;  4DIG A;  3MVX A;  1MS7 A;  4H8J A;  1B51 A;  2XX8 A;  4N17 A;  2FIX A;  4XTC Q;  3F11 A;  5IGA A;  1G0I A;  2QVU A;  4GBW A;  5LOM A;  3VFJ A;  3RNN A;  3TZA A;  3IAZ A;  2I4B A;  4LZ7 A;  2DWH A;  2A5T B;  3FAT A;  3CRB A;  4YAH X;  4U1O A;  1Y9U A;  4IO7 A;  1MXV A;  3O6G A;  1PDA A;  1B52 A;  2DXY A;  2Y5L A;  1FQF A;  3THI A;  3VVF A;  2F7C A;  3KEI A;  3GLB A;  4PFR A;  1Y1M A;  2V25 A;  1GR2 A;  1POT A;  1FJ6 A;  3ZS6 A;  4QBA A;  4EXK A;  3B50 A;  3IOW A;  4O3B A;  4PGP A;  3C9H A;  3A09 A;  2ZYN A;  1O7T A;  4FE8 A;  1FQB A;  3RPL A;  1O64 A;  4DCX A;  1B9J A;  3U72 A;  1IMD A;  2PT2 A;  1KA1 A;  3T9V A;  1IUD A;  1UTB A;  1QUL A;  5I3S A;  4KYE A;  4U21 A;  3UK4 A;  2P3V A;  2NWJ A;  1NV0 A;  1B6H A;  3K6X A;  1MPD A;  1VDW A;  4RPN A;  1Y4T A;  4NF4 B;  2Y84 A;  3TCG A;  3HFU A;  5H8H B;  3H06 B;  3IB2 A;  3MPK A;  4MIJ A;  4H5G A;  1B32 A;  2VD3 A;  1FTL A;  3LSL A;  4OEN A;  3IFC A;  1PEB A;  4DI3 D;  2P1S A;  2I49 A;  5IZ3 B;  1B0H A;  3VLU A;  4ZEC A;  2XXV A;  5CBR A;  1GVC A;  1Q9D A;  2D21 A;  1AMF A;  5TP9 B;  4MBP A;  5I58 A;  1B5J A;  3VDF A;  2UVI A;  4MNI A;  4I1D A;  3KN7 A;  3MVY A;  5EQ7 A;  4F2O A;  1N3W A;  3V89 B;  3FXQ A;  5F24 A;  2V3T A;  1FPG A;  2B4L A;  2BJJ X;  1UIV A;  4U2R A;  2ZNU A;  1MY0 A;  2I0B A;  5DVI A;  2F97 A;  3L6H A;  3SEX A;  4TLM B;  2REJ A;  4MFI A;  3KC0 A;  3USD A;  3QUF A;  4NF5 A;  4N15 A;  1MY1 A;  2ONK E;  2AL4 A;  1NFT A;  4JSD A;  1QKA A;  2DE3 A;  5ET8 A;  5DT6 A;  2DE2 A;  2PBW A;  4ZEF A;  4F1V A;  3G3H A;  1FQA A;  1NNP A;  1LLS A;  4GWU A;  4F22 A;  4RYA A;  1IIT A;  5J16 A;  4JB7 A;  2OX3 A;  1EU8 A;  1NH8 A;  3A29 A;  1B4Z A;  4P1L A;  4MMP A;  2ONR A;  4ZS9 A;  5M2V A;  5DEX B;  3T22 A;  2XXH A;  1NV7 A;  2ABH A;  4ONY A;  1WOD A;  4FEB A;  5H8Q A;  3PPN A;  3JZJ A;  2F3D A;  3S9L C;  1HSJ A;  4QF9 A;  2I3V A;  1LBZ A;  1BKA A;  3DM0 A;  3KJ7 A;  1CB6 A;  4IO5 A;  1NNF A;  1P1O A;  5EHM A;  1DCU A;  4L17 A;  4ELQ A;  3H03 A;  4DCY A;  1DTG A;  2DP8 A;  3RT8 A;  1NV6 A;  3IB0 A;  3KJT A;  3H4Z A;  1YCJ A;  4ELR A;  4ZZA A;  3SDF A;  2O51 A;  4DE8 A;  2KR0 A;  5L9M A;  3SER A;  4KQP A;  5BWJ A;  1FBH A;  3H6T A;  4IGR A;  2RIN A;  3SET A;  2XXI A;  3TUS A;  4GL0 A;  4KYD A;  2DQV A;  5IZZ A;  3GBB A;  4XEQ A;  1JEU A;  3QIM A;  2H4I A;  4RXL A;  5AA2 D;  3MZ1 A;  4O94 A;  4LQ5 A;  3PD8 A;  5ESY A;  2A5T A;  2XXP A;  4FJP A;  4ZEB A;  1IIW A;  1YPN A;  3G3K A;  2OZZ A;  2QMX A;  2UVJ A;  1MG1 A;  2AL5 A;  3KBZ A;  2Q88 A;  3OD7 A;  2Z8F A;  2Q89 A;  2Y7K A;  2Y7P A;  2H5Y A;  3EKI A;  1JW1 A;  1PB7 A;  3MVW A;  4ZEK A;  2V4C A;  2YPN A;  4JWX A;  1ELJ A;  4GVO A;  2XHD A;  5FHO A;  4KHZ E;  4RNS A;  4N81 A;  4GX6 A;  3Q28 A;  5AA1 A;  3KN3 A;  1NV4 A;  4I8C A;  2FHY A;  1SBP A;  1LB9 A;  1LBX A;  1ZIU A;  3NOH A;  4AS4 A;  4BDM A;  3TTN A;  2DWJ A;  4IGT A;  3UN6 A;  4QSD A;  1LCF A;  1IEJ A;  4G8N A;  4AB5 A;  2VOZ A;  1B3F A;  4H1X A;  3TDJ A;  4OVJ A;  4NF4 A;  4YIC A;  1FBE A;  3KOS A;  4F3P A;  3N94 A;  4OVR A;  3MW0 A;  3RPL B;  2HEU A;  5K2X A;  1EZ9 A;  1AL3 A;  3W15 C;  3U8Q A;  2HCA A;  1DK4 A;  3MVZ A;  3FAS A;  4NX1 A;  2P2A A;  3HPI A;  2R8T A;  4R75 A;  3IOR A;  1MQJ A;  3PGF A;  4PQJ A;  3TEP A;  4YB7 A;  2DS9 A;  4Z7E A;  1USY H;  5F1Q A;  2GFE A;  4GWY A;  4KPT A;  5TP9 A;  4C1T A;  4ZZE A;  5CMB A;  3RLF E;  2RCA A;  1RDY A;  4OXV A;  3ECR A;  4F18 A;  2Q8J A;  3OO6 A;  3VLW A;  2XA5 A;  4O3C A;  2Z8D A;  2O6A A;  2P3N A;  3FUZ A;  2ONS A;  3FIR A;  1CE2 A;  3IL1 B;  2PFY A;  2RC9 A;  1ANF A;  4GXA A;  4MNP A;  1RYO A;  3OOA A;  3GXA A;  1NL5 A;  1FJ9 A;  4ELP A;  1US4 A;  1OLA A;  4C0R A;  3Q26 A;  3PMV A;  4OWD A;  5L9S A;  4H65 A;  1FTJ A;  2F78 A;  2DYX A;  2FBP A;  3EHT A;  1FTK A;  3FVK A;  1SVX B;  3ILU B;  3LSX A;  2FA7 A;  1LFG A;  4WXJ A;  1LBW A;  2UVG A;  3LBS A;  3CR9 A;  4JVD A;  5KZT A;  4MJO A;  4PFU A;  2CZH A;  3OEN A;  4KYS A;  2QS2 A;  2YLN A;  3IX1 A;  4OFL A;  3IJX B;  1GV8 A;  4F39 A;  3PUZ E;  3MP1 A;  4FED A;  4IR8 A;  3FJM A;  2O7I A;  3ISP A;  2V84 A;  4YB6 A;  1B1X A;  3VVE A;  4ISU A;  4EDP A;  5FHM A;  3MP8 A;  2IA4 A;  3MZB A;  4H6D A;  4F1Y A;  4THI A;  1SW2 A;  3O66 A;  3M3L A;  4WKM A;  3OEL A;  4AB6 A;  4MAG A;  1MXX A;  4AQ4 A;  1MQH A;  1ZTY A;  1I69 A;  5H8Q B;  5I5P A;  1MM6 A;  3B6Q A;  1A8E A;  1PC3 A;  5DVJ A;  3S2V A;  4DLD A;  3SKP A;  2DXR A;  3O6H A;  3FXU A;  1LB8 A;  2DWI A;  2F7B A;  4G68 B;  1Y1Z A;  4NED A;  5KDT A;  4MF3 A;  1FPF A;  2PCR A;  4KXP A;  3TAJ A;  3BBR A;  3EHU A;  3E13 X;  1AWB A;  4U23 A;  3H7M A;  1LAF E;  4OHN A;  3V8X B;  3R6U A;  1BP5 A;  1MM7 A;  5EQ9 A;  3TQL A;  3T93 B;  4OFJ A;  1NV1 A;  1JVY A;  2WBB A;  4H8I A;  3OSR A;  2HXR A;  2VHA A;  3OO7 A;  5H8F B;  3D4C A;  4O8M A;  3I3V A;  4YKP A;  1AIV A;  2XD2 A;  4G61 A;  1ZMG A;  4P8B A;  2ZZX A;  1OMP A;  3FJ7 A;  5CC2 A;  2V3U A;  4PE3 A;  4YKI A;  4U4X A;  2PFZ A;  3TQW A;  3O2A A;  4PFW A;  4NE4 A;  1XI6 A;  2FVZ A;  5BUU A;  3WAE A;  2GH9 A;  1XT8 A;  4I9D A;  3M8U A;  1ZU0 A;  1EYI A;  2R71 A;  3KFM A;  1OLC A;  1G0H A;  2Y7R A;  3HO7 A;  3G3I A;  4G68 C;  1NKX A;  3O6I A;  2L5V A;  3S9E A;  1R9L A;  1FPL A;  1SI0 A;  1Q1K A;  3JV9 A;  3FJG A;  5CRY A;  2V3Q A;  4GOT A;  4FOR A;  4POW A;  4GF8 A;  2XXK A;  3T9H B;  4G8H A;  4P3L A;  5K2Y A;  2XWO A;  1DMB A;  3PU5 A;  1OQH A;  1VFE A;  3C32 A;  3HV1 A;  3MZ9 A;  4C1U A;  4IO3 A;  3Q29 A;  2ZNS A;  4M4G A;  1H45 A;  4KD5 A;  2OWT A;  2QSX A;  3T1B A;  2MKZ A;  3WAF A;  1EZP A;  4DZ1 A;  2F35 A;  1I6Q A;  1LBY A;  1PB8 A;  1JW4 A;  1O63 A;  1K9Z A;  5TU0 A;  5H8S A;  3TEL A;  4OVQ A;  2DWA A;  5EYF A;  2HZL A;  1QW0 A;  5FTH A;  4KCD A;  4JWO A;  2VT5 A;  1P99 A;  4OVT A;  3H6V A;  4ESX A;  4JVC A;  1FBD A;  2X7Q A;  4RA1 A;  5AA2 B;  4RPO A;  4MEV A;  1B40 A;  2XX9 A;  4LZ5 A;  3K4U A;  4BDR A;  4NF8 A;  3O9P A;  4Q30 B;  2F3B A;  2ALU A;  5CM6 A;  1MQD A;  4OA4 A;  4NMY A;  5T3J A;  3K6W A;  3IJO B;  5AA4 A;  1S7Y A;  1UQW A;  4MH5 A;  2XWI A;  5J1D A;  3LSF B;  1EH3 A;  1QUK A;  4QFO A;  1QUI A;  4NAP A;  3IR1 A;  2ZNT A;  4F29 A;  2XWV A;  1NUZ A;  5EQA A;  1MQI A;  4PFT A;  1POY 1;  3DLN A;  4FAT A;  4HW8 A;  2XXQ A;  3K02 A;  1DOT A;  3BIH A;  2PVU A;  5I84 A;  2UVH A;  2CZI A;  5I59 B;  4RY1 A;  3N6U A;  2Z23 A;  4N4U A;  1MRP A;  3C36 A;  2P0S A;  3GYY A;  5ET5 A;  4RJZ A;  4R2B A;  1FBC A;  5ITO A;  1A55 A;  3PPR A;  5IKB A;  4GWW A;  2F8D A;  2XWK A;  2VPO A;  3LUZ A;  3FZV A;  1IXI A;  3RPW A;  1H44 A;  4HE1 A;  1L5T A;  4PBH A;  1P1Q A;  4O7I A;  3TMG A;  3DP6 A;  3H6W A;  2F36 A;  1FTA A;  1ATG A;  3B8B A;  1A40 A;  4OVS A;  3PMW A;  4TQU Q;  2KQZ A;  3A3U A;  1JEV A;  2XXT A;  5IM2 A;  3EPE A;  4PFB A;  2CZK A;  2DE4 A;  3MYU A;  4NWD A;  1B58 A;  4ECF A;  3K1M A;  4G68 A;  4HCW A;  3TTR A;  4PFY A;  1BTJ A;  2V93 A;  2XXU A;  1B46 A;  4IO2 A;  5HPQ A;  1M5C A;  3IOV A;  1A8F A;  4NHB A;  1UTH B;  2WEF A;  1P1U A;  1KA0 A;  2OWS A;  3ILT B;  2ESN A;  5B70 A;  2QPQ A;  1MQG A;  5H8F A;  3MAM A;  4E0W A;  3MWB A;  4FBP A;  2OK2 A;  5KDT B;  4R72 A;  1N3X A;  2QS3 A;  3HCQ A;  3CFL A;  4LN5 A;  3UGW A;  1XVY A;  3UIF A;  4N8G A;  3OEK A;  4OVP A;  4NF0 A;  3M3K A;  2E0S A;  3LSW A;  4YU0 A;  3RQT A;  4ELO A;  5JTY B;  4F1U A;  1EYJ A;  1TFA A;  1D3K A;  4Q8R A;  5CI5 A;  2O68 A;  1IXH A;  5AA3 A;  4PDD A;  3QYT A;  4EUO A;  1QUJ A;  4NG7 A;  1INP A;  5ISU A;  4H46 A;  4MCO A;  4I62 A;  2UXA A;  2WKY A;  1B4H A;  2I0C A;  3PPQ A;  4OEV A;  1D9Y A;  4HE0 A;  3FXB A;  1F9B A;  5A5X A;  1FTO A;  1SW1 A;  3QUJ A;  2HFB A;  4LUB A;  3OMB A;  2ZZV A;  2F7A A;  4NWC A;  4U1Z A;  4ZEI A;  2QFL A;  1NUW A;  1VR5 A;  1B0L A;  3O29 A;  3U92 A;  1NMU A;  5JEI A;  4XKP A;  3L6G A;  1QVS A;  4MLQ A;  2Y5K A;  4HCY A;  4H0W A;  3C34 A;  4X48 A;  1LFH A;  3N5L A;  4PDH A;  5FHN A;  2O1L A;  5EYG A;  1T0K A;  2H99 A;  5DYH A;  1Y3Q A;  1B7U A;  2H25 A;  3Q27 A;  1R1N A;  5AA2 A;  1SDX A;  3RTW B;  3B6W A;  3ROJ A;  3T0J A;  1HSL A;  1GTK A;  4P47 A;  3IK6 B;  4FEC A;  1B1H A;  4NGU A;  4JDF A;  3H3G A;  5EHS A;  1TT1 A;  1IZ1 A;  3K6U A;  4LA9 A;  1I6B A;  4M1V A;  5I57 A;  3K6V A;  3ZKL A;  1FPB A;  4R6Y A;  1P1N A;  1URS A;  4ND9 A;  2NXO A;  5L8D A;  1MY4 A;  3KSJ A;  2A5S A;  4GWZ A;  1B05 A;  2THI A;  3KBR A;  4N07 A;  4PC9 A;  4EF2 A;  2QMW A;  3GZG A;  4PF6 A;  4MNC A;  3TOD A;  1FPI A;  1DBZ A;  4TLL B;  2E1S A;  4NF8 B;  4JBZ A;  1VSO A;  3VV5 A;  3K00 A;  4X8R A;  1N84 A;  4X1B A;  4TOZ A;  3T96 B;  4H67 A;  5AA4 B;  1XOC A;  5I59 A;  3D4G A;  1FCK A;  2Z8E A;  3UP9 A;  1B3G A;  2XXW A;  4R9G A;  3TTL A;  3FVO A;  5CMK A;  4JWY A;  3HHG A;  1B3E A;  3K1N A;  3FVN A;  2BJI A;  2OCU A;  2AYS A;  4LAT A;  4U22 A;  5L9O A;  1US5 A;  2RF1 A;  3ONM A;  4MX6 A;  3UA8 A;  1A54 A;  2R9J A;  1N7X A;  1B2H A;  3SEV A;  3KGC A;  3U94 A;  3OEM A;  2PMS A;  1IXG A;  4G8M A;  3PUY E;  4U4S A;  5EYH A;  3PTY A;  1NUY A;  4OES A;  4OZ9 A;  3ODB A;  4PGN A;  3EQ1 A;  4N13 A;  4P0G A;  1EYK A;  3FVG A;  3BFU A;  4ZED A;  3V83 A;  4XKQ A;  1B3H A;  2O84 X;  2FNC A;  5HM4 B;  1LBC A;  1QKB A;  1B7Z A;  2YJP A;  3E79 A;  2XXR A;  2B3F A;  4BDO A;  2HAV A;  1RKM A;  4R9F A;  4P9K A;  4YMB A;  1RDX A;  3PUX E;  1B7H A;  2OLB A;  3FXR A;  1VFD A;  3OSQ A;  3SEY A;  3IFA A;  2Q2C A;  3CI8 A;  2HQ0 A;  1H76 A;  2QRY A;  1D9V A;  1R9Q A;  4QFL A;  3TTM A;  3R7X A;  1UTH A;  4YZZ A;  4G77 A;  2QL3 A;  3MJN A;  3HHF A;  1JET A;  1ZKB A;  3PUW E;  4PP0 A;  4DXC A;  2DOJ A;  1DTZ A;  1OVB A;  4ZE8 A;  1FTM A;  4G2Z A;  1S50 A;  4F31 B;  2GHB A;  1Y3N A;  5KCJ B;  3VXB A;  3ZSF A;  2PT1 A;  3PPO A;  5JTY A;  3QXM A;  4POX A;  2H9B A;  1Y4C A;  2VD2 A;  2CEX A;  1WVJ A;  4XIG Q;  1XC1 A;  1GGG A;  2B4M A;  4IO6 A;  4Q0C A;  3P7I A;  4PET A;  3N26 A;  2B65 A;  1NNK A;  4LQ2 A;  2CMO A;  1NV5 A;  3JYR A;  1NV3 A;  1MDQ A;  3U65 A;  4PF8 A;  1DPP A;  4QXD A;  4P1E A;  1MPC A;  1IME A;  1N0T A;  1B5I A;  2I3W A;  3I5O A;  2REG A;  5CMM A;  4MLV A;  1TFD A;  2FIE A;  3QMF A;  3RTF B;  2GQ1 A;  5DTB A;  3FV1 A;  3S4U A;  1NV2 A;  2HAU A;  1PBQ A;  4NTL A;  1FBG A;  1FQC A;  2F5X A;  4QSC A;  5A5X B;  2D3I A;  5I7I A;  3RT6 B;  1FW0 A;  3K01 A;  1P1W A;  3ZKK A;  1M5D A;  1M5E A;  4F3G A;  4QFP A;  1TWY A;  4OYV A;  2B3B A;  5F7V A;  3VVD A;  2DVC A;  2IEE A;  4KI0 E;  5TPA A;  2HHM A;  2I6E A;  5ITP A;  5HBC A;  1SQY A;  4RK2 A;  5I2N B;  5DW8 A;  5EQ8 A;  3V5A A;  1FPE A;  3I6V A;  4RK9 A;  4K3F A;  4H5F A;  4QFN A;  3DP4 A;  3T9X B;  4JSO A;  5ELV A;  1R6Z A;  4XFE A;  3B6T A;  3OO9 A;  3IOT A;  4EQB A;  2NUV A;  4N6K A;  3TTK A;  2CEY A;  3VXC A;  2HZK A;  1FBP A;  3W9W A;  3G7W A;  2M8C A;  2PYY A;  3C35 A;  3KZG A;  4HS7 A;  4FAJ A;  3SEU A;  3KN8 A;  3K1P A;  2RC7 A;  4BLA A;  4GL8 A;  1TXF A;  3E9X A;  5I57 B;  4YKJ A;  4GRK A;  4NF6 A;  4IB2 A;  1LEV A;  3PPP A;  4PCD A;  4JXI A;  1I6A A;  4GWO A;  4N91 A;  2X26 A;  3LV0 A;  4XKR A;  3VE1 B;  3TFL A;  2G29 A;  1KWH A;  2WX9 A;  3SZP A;  4R74 A;  1FQD A;  2DVZ A;  1YYZ A;  3KSX A;  5JK4 A;  4F2Q A;  2KLF A;  2G93 A;  2LAO A;  3LC8 A;  4YB5 A;  3DP8 A;  1DPE A;  2QS1 A;  1A7L A;  2XD3 A;  1BK4 A;  5DVF A;  3S9N C;  3MST A;  3O97 A;  3C31 A;  4F19 A;  4EQ9 A;  1YTV A;  1JW5 A;  4IY5 A;  5B7D A;  4GWX A;  3K2D A;  4OAN A;  4AS5 A;  3PUV E;  4XKN A;  4P0I A;  3RGY A;  2UYE A;  5CMC A;  1Q35 A;  4OMB A;  1D4N A;  1LFI A;  3G3G A;  4XXU A;  3TKD A;  4R2F A;  3N6T A;  2QVR A;  4WED A;  3B7D A;  2Q74 A;  4ZE9 A;  3KOT A;  1FBF A;  1YXI A;  1ZBM A;  1SYH A;  3U1O A;  5IAI A;  3MUQ A;  3BFT A;  2Z22 A;  4PE5 B;  1IXC A;  1LAH E;  5I2K A;  2ANJ A;  4R73 A;  4LVQ A;  5AE4 A;  2GRV A;  4LZ8 A;  1NH7 A;  2QVV A;  3C4M A;  1IMF A;  1NI9 A;  1Z7M E;  2WYK A;  4DXU A;  4OFO A;  2O1M A;  1H43 A;  1LST A;  3FGS A;  5H8N A;  2VGQ A;  3LUY A;  3BIG A;  3QAX A;  3R26 A;  4R6H A;  1MH4 A;  4R6K A;  1N04 A;  1LAX A;  4HXV A;  3S9M C;  4Q5T A;  4UAC A;  3MPL A;  4O3A A;  4DXB A;  2O7U A;  5KCJ A;  1PB9 A;  3MC2 A;  3CG3 A;  1XVX A;  1LGB C;  1LBB A;  4N6D A;  4FIM A;  4YMA A;  1K9Y A;  4P11 A;  2O69 A;  2R6G E;  1JVX A;  2XX7 A;  4H45 A;  5I56 B;  1SD3 A;  5IZ1 A;  2Q8M A;  2Y7I A;  1MXZ A;  2VP1 A;  4HE2 A;  1FPD A;  4E0X A;  2Q9T A;  3RUM A;  4OEU A;  3CFZ A;  4OTE A;  2HPG A;  2ZYO A;  1OQG A;  5ET6 A;  4IY6 A;  5FTI A;  5LTC A;  1XHY A;  2ZYK A;  4DI4 B;  1B3L A;  4KFQ A;  3LR1 A;  3H6U A;  1ZJL A;  4YKK A;  1ZLQ A;  4X9T A;  3TCF A;  1M5B A;  1HSE A;  3C33 A;  2QS4 A;  2XXX A;  1S9T A;  1DSN A;  4GLI A;  3RN8 A;  1SPI A;  2XXY A;  3SEW A;  2NVU B;  2VPN A;  3HN0 A;  4GX3 A;  4QHQ A;  4KR5 A;  3G3F A;  1WDN A;  3QK6 A;  3RY3 A;  2RCB A;  1MPB A;  2I4C A;  4QFK A;  2F6G A;  3G3J A;  4UAB A;  3KC1 A;  1MXW A;  2Q2A A;  1FPK A;  4GD5 A;  4GQO A;  4N6P A;  3RYD A;  3FD3 A;  1XS5 A;  5I2N A;  3OXN A;  1FPJ A;  4EQ7 A;  1YZ0 A;  2RKM A;  2OJT A;  1MXY A;  1RYX A;  4DDD A;  1B5H A;  4WEP A;  1SI1 A;  3A3C A;  4ESW A;  1M5F A;  3IO4 A;  4PAI A;  5H8H A;  3CSB A;  4PBQ A;  5TPA B;  1MY2 A;  4JVI A;  1RDZ A;  4OQO A;  3E3K A;  2ZXT A;  3EN3 A;  1SW5 A;  3CG1 A;  4F3S A;  2DSF A;  3CIJ A;  1BIY A;  1UTB B;  4O7M A;  5IZ3 A;  2ZMB A;  3IOU A;  2PX1 A;  3CHG A;  3TPA A;  5ICT A;  1PBP A;  4P56 A;  1IQ7 A;  3BKI B;  2NOO A;  4OET A;  3DEL B;  4GBV A;  3U93 A;  4NN3 A;  3PD9 A;  2CZL A;  4I40 A;  2ZZW A;  3FV2 A;  2D5W A;  3VLV A;  4GX4 A;  1EZO A;  3D1R A;  4BDN A;  2AIX A;  4NF6 B;  1LCT A;  4LON B;  1FRP A;  3HST A;  4GIZ A;  1QJM A;  1Z7N E;  1OIB A;  1SW4 A;  4EXL A;  4GXS B;  1IMC A;  2GHA A;  4PFI A;  1IMB A;  2QJE A;  2ZYM A;  1OVT A;  4F3B A;  4HTG A;  5I58 B;  3CVG A;  1QGX A;  1J1N A;  1KZ8 A;  3MP6 A;  4OER A;  2I58 A;  2F34 A;  1VE4 A;  5ET7 A;  1Y20 A;  1CNQ A;  1N76 A;  3Q25 A;  4GWS A;  1LAG E;  3M3F A;  3AXF A;  4PAF A;  4LP2 B;  3W9V A;  2UYF A;  3KG2 A;  1URD A;  2RC8 A;  1YAE A;  4EF1 A;  1URG A;  4X04 A;  3PV0 E;  2OBG A;  2WBD A;  2F6P A;  5A5L A;  3K0V A;  3MBP A;  4BDL A;  1IMA A;  4QSE A;  3O28 A;  2JJK A;  3OO8 A;  4NF5 B;  1MXU A;  1USY E;  1AH5 A;  5DEX A;  3E78 A;  4ZDM A;  3TYH A;  3SES A;  2HXW A;  1A99 A;  1UIU A;  4BDQ A; 
#chains in the Genus database with same CATH homology
 3CSG A;  2H98 A;  4IO4 A;  1SYI A;  3PMX A;  3E4R A;  2W7Y A;  3T66 A;  3MQ9 A;  1MDP 1;  3TCH A;  3IO6 A;  5I2K B;  1JQF A;  1N7W A;  3EHS A;  4QRZ A;  5I56 A;  3GBA A;  5H8N B;  4X1D A;  4UA8 A;  3IB1 A;  1NNT A;  4Z0I A;  1Y3P A;  2X7P A;  2Y7W A;  1MH3 A;  5ICQ A;  3QSL A;  2FYI A;  1II5 A;  1JNF A;  4GFR A;  4G4P A;  4KCC A;  3CFX A;  3UOR A;  1MY3 A;  2I48 A;  1FQE A;  3EF7 A;  1BLF A;  5CBS A;  1H3D A;  3T9U A;  1AOV A;  4DIG A;  3MVX A;  1MS7 A;  4H8J A;  1B51 A;  2XX8 A;  4XTC Q;  3F11 A;  5LOM A;  3VFJ A;  3RNN A;  3TZA A;  3IAZ A;  2I4B A;  4LZ7 A;  2DWH A;  2A5T B;  3FAT A;  3CRB A;  4YAH X;  4U1O A;  1Y9U A;  4IO7 A;  1MXV A;  3O6G A;  1PDA A;  1B52 A;  2DXY A;  1FQF A;  3THI A;  3VVF A;  2F7C A;  3KEI A;  3GLB A;  1Y1M A;  2V25 A;  1GR2 A;  1POT A;  3ZS6 A;  4EXK A;  3IOW A;  4O3B A;  3C9H A;  3A09 A;  2ZYN A;  1O7T A;  4FE8 A;  1FQB A;  1O64 A;  4DCX A;  1B9J A;  3U72 A;  2PT2 A;  3T9V A;  1IUD A;  1UTB A;  1QUL A;  4KYE A;  4U21 A;  3UK4 A;  2NWJ A;  3K6X A;  1B6H A;  1MPD A;  4RPN A;  1Y4T A;  4NF4 B;  2Y84 A;  3TCG A;  5H8H B;  3H06 B;  3IB2 A;  3MPK A;  4H5G A;  1B32 A;  2VD3 A;  1FTL A;  3LSL A;  4OEN A;  1PEB A;  2P1S A;  2I49 A;  1B0H A;  3VLU A;  4ZEC A;  2XXV A;  5CBR A;  1GVC A;  2D21 A;  1AMF A;  5TP9 B;  4MBP A;  5I58 A;  1B5J A;  3VDF A;  2UVI A;  4I1D A;  3KN7 A;  3MVY A;  4F2O A;  1N3W A;  3V89 B;  3FXQ A;  2V3T A;  2BJJ X;  1UIV A;  4U2R A;  2ZNU A;  1MY0 A;  2I0B A;  5DVI A;  2F97 A;  3L6H A;  3SEX A;  4TLM B;  2REJ A;  4MFI A;  3USD A;  3QUF A;  4NF5 A;  1MY1 A;  2ONK E;  2AL4 A;  1NFT A;  4JSD A;  1QKA A;  2DE3 A;  5DT6 A;  2DE2 A;  4ZEF A;  2PBW A;  4F1V A;  3G3H A;  1FQA A;  1NNP A;  1LLS A;  4F22 A;  4RYA A;  1IIT A;  4JB7 A;  1EU8 A;  1NH8 A;  1B4Z A;  2ONR A;  4ZS9 A;  5M2V A;  5DEX B;  3T22 A;  2XXH A;  2ABH A;  4ONY A;  1WOD A;  4FEB A;  5H8Q A;  3PPN A;  3JZJ A;  3S9L C;  1HSJ A;  4QF9 A;  2I3V A;  1BKA A;  3DM0 A;  3KJ7 A;  1CB6 A;  4IO5 A;  1NNF A;  1P1O A;  5EHM A;  4L17 A;  4ELQ A;  3H03 A;  4DCY A;  1DTG A;  2DP8 A;  3RT8 A;  3IB0 A;  4ELR A;  3H4Z A;  1YCJ A;  3KJT A;  4ZZA A;  3SDF A;  2O51 A;  4DE8 A;  5L9M A;  3SER A;  4KQP A;  5BWJ A;  4IGR A;  3H6T A;  2RIN A;  3SET A;  2XXI A;  3TUS A;  4GL0 A;  4KYD A;  2DQV A;  3GBB A;  1JEU A;  3QIM A;  2H4I A;  4RXL A;  5AA2 D;  3MZ1 A;  4LQ5 A;  3PD8 A;  2A5T A;  2XXP A;  4FJP A;  4ZEB A;  1IIW A;  1YPN A;  3G3K A;  2OZZ A;  2QMX A;  2UVJ A;  1MG1 A;  2AL5 A;  2Q88 A;  3OD7 A;  2Z8F A;  2Q89 A;  2Y7K A;  2Y7P A;  2H5Y A;  1JW1 A;  1PB7 A;  3MVW A;  4ZEK A;  2YPN A;  4JWX A;  1ELJ A;  4GVO A;  2XHD A;  5FHO A;  4KHZ E;  4RNS A;  3Q28 A;  5AA1 A;  3KN3 A;  4I8C A;  1SBP A;  1LB9 A;  1ZIU A;  4BDM A;  3TTN A;  2DWJ A;  4IGT A;  3UN6 A;  4QSD A;  1LCF A;  1IEJ A;  4G8N A;  4AB5 A;  2VOZ A;  1B3F A;  4H1X A;  3TDJ A;  4OVJ A;  4NF4 A;  4YIC A;  4F3P A;  3KOS A;  3N94 A;  3MW0 A;  2HEU A;  5K2X A;  1EZ9 A;  1AL3 A;  3W15 C;  3U8Q A;  2HCA A;  3MVZ A;  3FAS A;  2P2A A;  3HPI A;  4R75 A;  3IOR A;  1MQJ A;  3PGF A;  4PQJ A;  3TEP A;  4YB7 A;  2DS9 A;  4Z7E A;  1USY H;  5F1Q A;  2GFE A;  4KPT A;  5TP9 A;  4C1T A;  4ZZE A;  5CMB A;  3RLF E;  2RCA A;  4OXV A;  3ECR A;  4F18 A;  2Q8J A;  3OO6 A;  3VLW A;  4O3C A;  2Z8D A;  2O6A A;  3FUZ A;  2ONS A;  3FIR A;  1CE2 A;  3IL1 B;  4GXA A;  2RC9 A;  1ANF A;  1RYO A;  3OOA A;  3GXA A;  1NL5 A;  4ELP A;  1US4 A;  1OLA A;  4C0R A;  3Q26 A;  3PMV A;  4OWD A;  5L9S A;  4H65 A;  1FTJ A;  2F78 A;  2DYX A;  3EHT A;  1FTK A;  3FVK A;  1SVX B;  3ILU B;  3LSX A;  2FA7 A;  1LFG A;  4WXJ A;  2UVG A;  3LBS A;  3CR9 A;  5KZT A;  4PFU A;  3OEN A;  4KYS A;  2QS2 A;  2YLN A;  3IX1 A;  4OFL A;  3IJX B;  1GV8 A;  4F39 A;  3PUZ E;  3MP1 A;  4FED A;  3FJM A;  2O7I A;  2V84 A;  4YB6 A;  1B1X A;  3VVE A;  4ISU A;  4EDP A;  5FHM A;  3MP8 A;  2IA4 A;  3MZB A;  4H6D A;  4F1Y A;  4THI A;  1SW2 A;  3O66 A;  3M3L A;  4WKM A;  3OEL A;  4AB6 A;  1MXX A;  4AQ4 A;  1MQH A;  1ZTY A;  1I69 A;  5H8Q B;  1MM6 A;  3B6Q A;  1A8E A;  1PC3 A;  5DVJ A;  3S2V A;  4DLD A;  3SKP A;  2DXR A;  3O6H A;  3FXU A;  1LB8 A;  2DWI A;  2F7B A;  4G68 B;  1Y1Z A;  4NED A;  5KDT A;  4MF3 A;  3TAJ A;  3BBR A;  3EHU A;  3E13 X;  4U23 A;  3H7M A;  1LAF E;  4OHN A;  3V8X B;  3R6U A;  1BP5 A;  1MM7 A;  3TQL A;  3T93 B;  4OFJ A;  1JVY A;  4H8I A;  3OSR A;  2VHA A;  3OO7 A;  5H8F B;  3D4C A;  3I3V A;  4YKP A;  1AIV A;  2XD2 A;  1ZMG A;  1OMP A;  3FJ7 A;  5CC2 A;  2V3U A;  4YKI A;  4U4X A;  3TQW A;  3O2A A;  4PFW A;  4NE4 A;  5BUU A;  3WAE A;  2GH9 A;  1XT8 A;  4I9D A;  3M8U A;  1ZU0 A;  2R71 A;  3KFM A;  1OLC A;  2Y7R A;  3HO7 A;  3G3I A;  4G68 C;  1NKX A;  3O6I A;  3S9E A;  1R9L A;  1SI0 A;  1Q1K A;  3JV9 A;  3FJG A;  5CRY A;  2V3Q A;  4GOT A;  4FOR A;  4POW A;  4GF8 A;  3T9H B;  4G8H A;  5K2Y A;  1DMB A;  3PU5 A;  1OQH A;  1VFE A;  3C32 A;  3HV1 A;  3MZ9 A;  4C1U A;  4IO3 A;  3Q29 A;  2ZNS A;  4M4G A;  1H45 A;  4KD5 A;  2OWT A;  2QSX A;  3WAF A;  1EZP A;  4DZ1 A;  2F35 A;  1I6Q A;  1PB8 A;  1JW4 A;  1O63 A;  5TU0 A;  5H8S A;  3TEL A;  2DWA A;  5EYF A;  2HZL A;  1QW0 A;  5FTH A;  4KCD A;  4JWO A;  1P99 A;  3H6V A;  4ESX A;  2X7Q A;  4RA1 A;  5AA2 B;  4RPO A;  1B40 A;  2XX9 A;  4LZ5 A;  3K4U A;  4BDR A;  4NF8 A;  3O9P A;  4Q30 B;  2ALU A;  5CM6 A;  1MQD A;  4NMY A;  3K6W A;  3IJO B;  5AA4 A;  1S7Y A;  1UQW A;  4MH5 A;  5J1D A;  3LSF B;  1EH3 A;  1QUK A;  4QFO A;  1QUI A;  3IR1 A;  2ZNT A;  4F29 A;  1MQI A;  4PFT A;  1POY 1;  3DLN A;  4FAT A;  4HW8 A;  2XXQ A;  3K02 A;  1DOT A;  2PVU A;  5I84 A;  2UVH A;  5I59 B;  4RY1 A;  3N6U A;  2Z23 A;  1MRP A;  3C36 A;  2P0S A;  4RJZ A;  4R2B A;  5ITO A;  1A55 A;  3PPR A;  5IKB A;  2F8D A;  3FZV A;  1IXI A;  3RPW A;  1H44 A;  1L5T A;  1P1Q A;  3TMG A;  3DP6 A;  3H6W A;  2F36 A;  1ATG A;  1A40 A;  3PMW A;  4TQU Q;  3A3U A;  1JEV A;  2XXT A;  3EPE A;  2DE4 A;  4NWD A;  1B58 A;  4ECF A;  3K1M A;  4G68 A;  4HCW A;  3TTR A;  4PFY A;  1BTJ A;  2V93 A;  2XXU A;  1B46 A;  4IO2 A;  5HPQ A;  1M5C A;  3IOV A;  1A8F A;  1UTH B;  1P1U A;  2OWS A;  3ILT B;  2ESN A;  5B70 A;  2QPQ A;  1MQG A;  5H8F A;  3MAM A;  4E0W A;  3MWB A;  2OK2 A;  5KDT B;  4R72 A;  1N3X A;  2QS3 A;  3HCQ A;  3CFL A;  3UGW A;  1XVY A;  3UIF A;  3OEK A;  3M3K A;  2E0S A;  3LSW A;  4YU0 A;  3RQT A;  4ELO A;  5JTY B;  4F1U A;  1TFA A;  1D3K A;  4Q8R A;  5CI5 A;  2O68 A;  1IXH A;  5AA3 A;  3QYT A;  4EUO A;  1QUJ A;  5ISU A;  4I62 A;  2UXA A;  2WKY A;  1B4H A;  2I0C A;  3PPQ A;  4OEV A;  1D9Y A;  5A5X A;  1F9B A;  1FTO A;  1SW1 A;  3QUJ A;  2HFB A;  4LUB A;  3OMB A;  2F7A A;  4NWC A;  4U1Z A;  4ZEI A;  1VR5 A;  1B0L A;  3O29 A;  3U92 A;  1NMU A;  5JEI A;  4XKP A;  3L6G A;  1QVS A;  4MLQ A;  4HCY A;  4H0W A;  3C34 A;  4X48 A;  1LFH A;  3N5L A;  5FHN A;  2O1L A;  1T0K A;  2H99 A;  5DYH A;  1Y3Q A;  1B7U A;  2H25 A;  3Q27 A;  1R1N A;  5AA2 A;  1SDX A;  3RTW B;  3B6W A;  1HSL A;  1GTK A;  3IK6 B;  4FEC A;  1B1H A;  4JDF A;  3H3G A;  5EHS A;  1TT1 A;  1IZ1 A;  3K6U A;  4LA9 A;  1I6B A;  4M1V A;  5I57 A;  3K6V A;  3ZKL A;  4R6Y A;  1P1N A;  1URS A;  4ND9 A;  2NXO A;  5L8D A;  1MY4 A;  3KSJ A;  2A5S A;  1B05 A;  2THI A;  3KBR A;  4N07 A;  4EF2 A;  2QMW A;  3GZG A;  3TOD A;  4TLL B;  2E1S A;  4NF8 B;  4JBZ A;  1VSO A;  3VV5 A;  3K00 A;  1N84 A;  4X1B A;  4TOZ A;  3T96 B;  4H67 A;  5AA4 B;  1XOC A;  5I59 A;  3D4G A;  1FCK A;  2Z8E A;  3UP9 A;  1B3G A;  2XXW A;  4R9G A;  3TTL A;  3FVO A;  5CMK A;  4JWY A;  3HHG A;  1B3E A;  3K1N A;  3FVN A;  2OCU A;  2AYS A;  4LAT A;  4U22 A;  5L9O A;  1US5 A;  2RF1 A;  3ONM A;  3UA8 A;  1A54 A;  2R9J A;  1N7X A;  1B2H A;  3SEV A;  3KGC A;  3U94 A;  3OEM A;  2PMS A;  1IXG A;  4G8M A;  3PUY E;  4U4S A;  4OES A;  4OZ9 A;  3ODB A;  3EQ1 A;  4N13 A;  4P0G A;  3FVG A;  3BFU A;  4ZED A;  3V83 A;  4XKQ A;  1B3H A;  2O84 X;  2FNC A;  5HM4 B;  1LBC A;  1QKB A;  1B7Z A;  2YJP A;  2XXR A;  2B3F A;  4BDO A;  2HAV A;  1RKM A;  4R9F A;  4YMB A;  3PUX E;  1B7H A;  2OLB A;  3FXR A;  1VFD A;  3OSQ A;  3SEY A;  2Q2C A;  3CI8 A;  2HQ0 A;  1H76 A;  2QRY A;  1D9V A;  1R9Q A;  4QFL A;  3TTM A;  3R7X A;  1UTH A;  4YZZ A;  4G77 A;  2QL3 A;  3MJN A;  3HHF A;  1JET A;  1ZKB A;  3PUW E;  4PP0 A;  4DXC A;  2DOJ A;  1DTZ A;  1OVB A;  4ZE8 A;  1FTM A;  4G2Z A;  1S50 A;  4F31 B;  2GHB A;  1Y3N A;  5KCJ B;  3VXB A;  3ZSF A;  2PT1 A;  3PPO A;  5JTY A;  3QXM A;  4POX A;  2H9B A;  1Y4C A;  2VD2 A;  1WVJ A;  4XIG Q;  1XC1 A;  1GGG A;  4IO6 A;  4Q0C A;  3P7I A;  4PET A;  3N26 A;  2B65 A;  1NNK A;  4LQ2 A;  2CMO A;  3JYR A;  1MDQ A;  1DPP A;  1MPC A;  3I5O A;  1N0T A;  1B5I A;  2I3W A;  2REG A;  5CMM A;  4MLV A;  1TFD A;  3RTF B;  5DTB A;  3FV1 A;  3S4U A;  2HAU A;  1PBQ A;  4NTL A;  1FQC A;  2F5X A;  4QSC A;  5A5X B;  2D3I A;  3RT6 B;  1FW0 A;  3K01 A;  1P1W A;  3ZKK A;  1M5D A;  1M5E A;  4F3G A;  4QFP A;  1TWY A;  4OYV A;  2B3B A;  5F7V A;  3VVD A;  2DVC A;  2IEE A;  4KI0 E;  5TPA A;  2I6E A;  5ITP A;  5HBC A;  1SQY A;  4RK2 A;  5I2N B;  3V5A A;  3I6V A;  4RK9 A;  4K3F A;  4H5F A;  4QFN A;  3DP4 A;  3T9X B;  4JSO A;  5ELV A;  1R6Z A;  3B6T A;  3OO9 A;  3IOT A;  4EQB A;  2NUV A;  3TTK A;  3VXC A;  2HZK A;  3W9W A;  3G7W A;  2M8C A;  2PYY A;  3C35 A;  3KZG A;  4HS7 A;  4FAJ A;  3SEU A;  3KN8 A;  3K1P A;  2RC7 A;  4BLA A;  4GL8 A;  1TXF A;  3E9X A;  5I57 B;  4YKJ A;  4GRK A;  4NF6 A;  4IB2 A;  3PPP A;  4JXI A;  1I6A A;  4GWO A;  2X26 A;  4XKR A;  3VE1 B;  3TFL A;  2G29 A;  1KWH A;  4R74 A;  1FQD A;  2DVZ A;  3KSX A;  5JK4 A;  4F2Q A;  2KLF A;  2G93 A;  2LAO A;  3LC8 A;  4YB5 A;  3DP8 A;  1DPE A;  2QS1 A;  1A7L A;  2XD3 A;  3S9N C;  5DVF A;  3O97 A;  3C31 A;  4F19 A;  4EQ9 A;  1YTV A;  1JW5 A;  4IY5 A;  5B7D A;  3K2D A;  3PUV E;  4XKN A;  4P0I A;  3RGY A;  2UYE A;  5CMC A;  1Q35 A;  4OMB A;  1D4N A;  1LFI A;  3G3G A;  4XXU A;  3TKD A;  4R2F A;  3N6T A;  4WED A;  3B7D A;  4ZE9 A;  3KOT A;  1ZBM A;  1SYH A;  3U1O A;  5IAI A;  3MUQ A;  3BFT A;  2Z22 A;  4PE5 B;  1IXC A;  1LAH E;  5I2K A;  2ANJ A;  4R73 A;  4LVQ A;  5AE4 A;  2GRV A;  4LZ8 A;  1NH7 A;  3C4M A;  1Z7M E;  4DXU A;  4OFO A;  2O1M A;  1H43 A;  1LST A;  3FGS A;  5H8N A;  2VGQ A;  3LUY A;  3QAX A;  3R26 A;  4R6H A;  1MH4 A;  4R6K A;  1N04 A;  1LAX A;  3S9M C;  4Q5T A;  4UAC A;  3MPL A;  4O3A A;  4DXB A;  2O7U A;  5KCJ A;  1PB9 A;  3MC2 A;  3CG3 A;  1XVX A;  1LGB C;  1LBB A;  4FIM A;  4YMA A;  4P11 A;  2O69 A;  2R6G E;  1JVX A;  2XX7 A;  5I56 B;  1SD3 A;  2Y7I A;  1MXZ A;  2VP1 A;  4E0X A;  2Q9T A;  3RUM A;  4OEU A;  3CFZ A;  4OTE A;  2ZYO A;  1OQG A;  4IY6 A;  5FTI A;  1XHY A;  2ZYK A;  1B3L A;  4KFQ A;  3LR1 A;  3H6U A;  1ZJL A;  4YKK A;  1ZLQ A;  4X9T A;  3TCF A;  1M5B A;  1HSE A;  3C33 A;  2QS4 A;  2XXX A;  1S9T A;  1DSN A;  4GLI A;  3RN8 A;  2XXY A;  3SEW A;  2NVU B;  3HN0 A;  4QHQ A;  4KR5 A;  3G3F A;  1WDN A;  3QK6 A;  3RY3 A;  2RCB A;  1MPB A;  2I4C A;  4QFK A;  2F6G A;  3G3J A;  1MXW A;  2Q2A A;  4GD5 A;  4GQO A;  4N6P A;  3FD3 A;  1XS5 A;  5I2N A;  3OXN A;  4EQ7 A;  2RKM A;  2OJT A;  1MXY A;  1RYX A;  4DDD A;  1B5H A;  4WEP A;  1SI1 A;  3A3C A;  4ESW A;  1M5F A;  3IO4 A;  5H8H A;  3CSB A;  5TPA B;  1MY2 A;  4OQO A;  3E3K A;  2ZXT A;  3EN3 A;  1SW5 A;  3CG1 A;  4F3S A;  2DSF A;  3CIJ A;  1BIY A;  1UTB B;  2ZMB A;  3IOU A;  2PX1 A;  3TPA A;  5ICT A;  1PBP A;  1IQ7 A;  3BKI B;  2NOO A;  4OET A;  3DEL B;  3U93 A;  3PD9 A;  2CZL A;  3FV2 A;  2D5W A;  3VLV A;  1EZO A;  4BDN A;  2AIX A;  4NF6 B;  1LCT A;  4LON B;  3HST A;  4GIZ A;  1QJM A;  1Z7N E;  1OIB A;  1SW4 A;  4EXL A;  4GXS B;  2GHA A;  2QJE A;  2ZYM A;  1OVT A;  4F3B A;  4HTG A;  5I58 B;  3CVG A;  1J1N A;  3MP6 A;  4OER A;  2I58 A;  2F34 A;  1VE4 A;  1Y20 A;  1N76 A;  3Q25 A;  1LAG E;  3M3F A;  3AXF A;  4LP2 B;  3W9V A;  2UYF A;  3KG2 A;  1URD A;  2RC8 A;  1YAE A;  4EF1 A;  1URG A;  3PV0 E;  2OBG A;  2F6P A;  3K0V A;  3MBP A;  4BDL A;  4QSE A;  3O28 A;  3OO8 A;  4NF5 B;  1MXU A;  1USY E;  1AH5 A;  5DEX A;  4ZDM A;  3TYH A;  3SES A;  2HXW A;  1A99 A;  1UIU A;  4BDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...