3SERA

Zn-mediated polymer of maltose-binding protein k26h/k30h by synthetic symmetrization
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGHKFEHDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
total genus 116
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3serA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3serA01
1IZ1A 1Z7NE 5CMCA 3HHFA 4KPTA 4X48A 3IJXB 2Q8JA 2XXTA 1XVYA 2I48A 3LSXA 3OSQA 4LUBA 4OETA 1WDNA 1OQGA 1TFDA 1B2HA 4PFYA 4WKMA 5TP9A 4PP0A 2XXUA 3N5LA 4ZZEA 1AMFA 4UACA 1B3EA 1FTLA 2DWIA 3M8UA 4KD5A 2F36A 1M5DA 3T9UA 1QVSA 2ESNA 1MQJA 1MY4A 3HO7A 4ZZAA 4G68C 4IO4A 5H8FA 1OLAA 2WKYA 5I56B 4XKPA 2G93A 3T9VA 4XKNA 4JDFA 4F2QA 1H43A 1GR2A 1UTBB 1UQWA 2R6GE 5CMBA 2RC7A 4N13A 1B9JA 3MP6A 5AA2D 1SDXA 2LAOA 3VVFA 4DZ1A 1YPNA 2DE2A 1XOCA 1FQBA 5CC2A 3OENA 3UP9A 1HSLA 4Q8RA 1LFHA 3IB1A 5L8DA 1DTGA 1B7HA 3Q25A 1JNFA 2OBGA 4ESWA 2Z22A 5CMKA 4U21A 1NL5A 4BDRA 1N84A 3PUWE 3PV0E 2B3FA 1JW4A 1LAHE 3CI8A 3KOSA 5I59A 1O63A 3VDFA 1ELJA 1MXXA 3C34A 3TELA 4F1VA 4H6DA 3FXRA 5I58A 5AA4B 1QKBA 3H6TA 5IAIA 4H8IA 4NF5A 5AA2A 1MXZA 5HM4B 3H6VA 4DXUA 2NOOA 1LAFE 5CMMA 5CBRA 1B5JA 2OJTA 1LCFA 1VSOA 4RY1A 2YLNA 4NF5B 1SW4A 4Q5TA 4AQ4A 3CFLA 5AA2B 5AA4A 2GH9A 4QSEA 1N04A 3K6XA 4LATA 3AXFA 4U4XA 3TTKA 1UIUA 3G3GA 3MW0A 4P0IA 4F39A 5IKBA 1Y3PA 1MXVA 1EZOA 3V5AA 5B70A 4BDNA 2XD2A 2VP1A 1QKAA 5H8SA 1JW5A 4DE8A 2V3QA 3CRBA 4POXA 3TCGA 3PPRA 5LOMA 1ZIUA 3FV2A 4U22A 4OYVA 1Y9UA 3LSWA 1AH5A 1B5HA 1D3KA 2DQVA 2DP8A 3TCFA 3ZSFA 1PC3A 1VFDA 4F3SA 2XHDA 2O69A 2ZYNA 3P7IA 3PUYE 4JB7A 3G3FA 2QL3A 3PMXA 3H06B 4GOTA 3TPAA 4F31B 1ZKBA 4JWOA 4G8NA 3PU5A 3TTNA 2UXAA 1UTBA 4DXBA 2PT1A 3F11A 3K1MA 3QYTA 3MUQA 1H44A 1Y1ZA 2P0SA 3HCQA 4KYDA 3RUMA 3TODA 4XKRA 2ONSA 1RKMA 3OEMA 4PETA 1USYE 4YZZA 3VV5A 2X7QA 3DM0A 1MPBA 2UVIA 2ZYOA 3EHSA 2E0SA 4GF8A 4GL8A 4MLQA 4OMBA 5TP9B 2QRYA 3CIJA 3GZGA 3OMBA 2RKMA 4RPNA 4G8HA 4R74A 5FTIA 4DLDA 3PUZE 3O29A 3S9NC 4OEVA 3A09A 3WAEA 3S9MC 2O7UA 3ILUB 4NTLA 1MY0A 4MLVA 5H8QB 3OO9A 4F1UA 3B6TA 5FTHA 4OWDA 3KJ7A 2ABHA 5CM6A 2I6EA 3DP8A 3E9XA 3U92A 2I3VA 2PYYA 1MY3A 3M3KA 4DIGA 3FZVA 3EQ1A 3W9WA 4XXUA 4RK2A 1IUDA 1B4HA 2PBWA 3T9XB 4I8CA 3RQTA 3L6HA 1Y1MA 4KCCA 3T66A 5I57B 1R9QA 4NF4A 1FQAA 1AL3A 1UTHB 4G77A 4QFPA 4ZS9A 3IORA 1NNTA 1S9TA 1OVTA 3SEUA 2F7AA 3PPOA 5H8HB 5BUUA 4I9DA 1B3FA 3OELA 1YAEA 2O68A 1R1NA 2AIXA 4LVQA 3S9LC 1H45A 3KEIA 2Z8DA 3R6UA 3LUYA 2QPQA 1B7ZA 3RTFB 4POWA 1FTOA 1B58A 2O7IA 2UVGA 4KHZE 2Y7IA 4R9FA 4X1DA 4H67A 3VVDA 5FHOA 2Q89A 1OVBA 2I4BA 1IXHA 2O84X 1JVXA 2ZMBA 2H9BA 1FTJA 3FJMA 2RINA 1US5A 1UIVA 3QSLA 1L5TA 4C0RA 1PDAA 4ESXA 3S9EA 3OEKA 3RNNA 2G29A 2GHAA 4JSDA 1SYIA 4U2RA 4OERA 4EF1A 4F29A 1B40A 3C33A 1EZPA 3IOUA 1F9BA 3FXUA 5JK4A 1PB7A 2E1SA 1NKXA 2B65A 4E0WA 4FJPA 1NH8A 1ZLQA 4N6PA 3HPIA 1HSEA 1LGBC 2IEEA 2O1LA 2Y7PA 3EHTA 3FVOA 4GQOA 1SI0A 4KFQA 5FHMA 1I6QA 4F3GA 1B51A 2QJEA 4GFRA 1GVCA 5H8QA 5I59B 1H76A 2KLFA 3OSRA 2HEUA 2DOJA 3MAMA 4RPOA 1NNFA 3I6VA 4F2OA 4EXKA 3VFJA 2V25A 3SEVA 1IEJA 4ECFA 3RY3A 2RF1A 3SDFA 1J1NA 2F6PA 2I0CA 3FJ7A 2Q2CA 3KOTA 2VHAA 4LP2B 1JW1A 3MZBA 1PBQA 2CMOA 2NUVA 4H5FA 4PQJA 4OESA 4EQBA 2VD3A 1MDQA 3IO4A 3UK4A 4YB7A 3VLVA 3RLFE 5I2NB 4P0GA 4ZDMA 2H5YA 3UA8A 2D3IA 4RJZA 3LSLA 5KCJB 3H4ZA 4I1DA 4DDDA 2Q88A 4WEDA 1MRPA 3O9PA 2QS2A 3O6HA 1URGA 1ZBMA 4GVOA 5A5XA 3MPKA 3VE1B 4ZEDA 3FUZA 2XX9A 3O6GA 3MZ1A 1SD3A 2XXYA 3E4RA 1N3XA 3MVYA 4OTEA 3THIA 3DP4A 3N94A 4YB6A 3HN0A 2FA7A 3ODBA 5B7DA 3IOWA 4F3BA 1M5EA 2PX1A 4YMAA 1OIBA 2REJA 3KN3A 4NF8B 5TPAB 3FIRA 5BWJA 2XXWA 4RK9A 1LFIA 4GWOA 3EPEA 1D9VA 2DSFA 4H1XA 1P1OA 1BTJA 3KN7A 3KGCA 3TQWA 3I3VA 4BDQA 3IL1B 5H8NA 1IITA 2AL4A 5J1DA 4YB5A 4QFKA 3OD7A 4M4GA 3PD8A 4EF2A 1Y4CA 3GLBA 3D4CA 3ONMA 1TXFA 3M3LA 4X9TA 5M2VA 3PMWA 1P1QA 1QW0A 4G4PA 1XT8A 2ZXTA 3G3JA 4OENA 4Q30B 1MS7A 1MQGA 2GFEA 3PMVA 4HCYA 4PFWA 4YKIA 1M5FA 2P1SA 2X7PA 4ELOA 2ANJA 3MP8A 4YICA 2DE4A 4KR5A 4F22A 4LZ7A 2F35A 4R75A 4U4SA 1MM6A 2H98A 2QS1A 3CG1A 1MY1A 3Q27A 3SEYA 5EHMA 2W7YA 2AYSA 1FQDA 1Y4TA 1EH3A 2BJJX 2O51A 1URSA 2Y7RA 3ILTB 3MC2A 4GL0A 4OZ9A 3FGSA 3PPNA 1A8EA 2HQ0A 4IB2A 5H8HA 3TCHA 1LB9A 2QS4A 2ZYMA 5DEXB 4F3PA 1FQEA 2ALUA 2DE3A 1D9YA 2H99A 3MZ9A 3ZS6A 5I57A 4FEBA 1NMUA 3PUVE 2F8DA 3MP1A 4AB5A 1FW0A 1B3LA 2XXVA 3IAZA 3O28A 3T9HB 3TYHA 1URDA 1MXYA 4KQPA 1SW2A 1BKAA 3OXNA 2VOZA 3O2AA 1T0KA 3V83A 4Q0CA 1XC1A 1SI1A 4YKPA 4F18A 1FTMA 3CSBA 3MVWA 2OZZA 3A3UA 4YKJA 3FVGA 3TDJA 1S7YA 4GRKA 4ELRA 5AE4A 1B3HA 2O1MA 2Y7KA 3QIMA 1IXCA 3S2VA 5F1QA 1AOVA 3KSXA 1Y20A 1A8FA 1DTZA 2D5WA 2UYFA 4EQ7A 1WVJA 2RC9A 1LCTA 1QUIA 1USYH 2REGA 3C36A 4LQ2A 5DVJA 2QSXA 3ZKLA 4GXAA 4KYSA 2DVZA 2RCBA 2CZLA 3DELB 4BLAA 5ELVA 4G2ZA 1DMBA 1ZJLA 2HCAA 2ONKE 3PPQA 4IO7A 4QSDA 3KN8A 4GLIA 3JV9A 2Z8EA 5L9MA 5L9OA 4FATA 4OXVA 1S50A 3BBRA 2HFBA 1B32A 1IXIA 5ICQA 4PFTA 5I84A 1P99A 4C1TA 2RCAA 4F19A 2I58A 2Q2AA 3D4GA 1VR5A 3FV1A 4OEUA 5JTYA 3TMGA 3DLNA 3FASA 1CB6A 1MPDA 3H03A 5TPAA 1IIWA 1GV8A 2XD3A 1SQYA 4ZEBA 4RA1A 4TQUQ 1B7UA 1Y3QA 3H3GA 3GBBA 1FQFA 3R7XA 1A54A 2QMXA 2F7CA 1A40A 3N6TA 5CBSA 5ISUA 2D21A 2ZNUA 4DCYA 3IB2A 1MH4A 3S4UA 3G3HA 1Z7ME 4X1BA 1O7TA 4THIA 4TOZA 4JBZA 3B7DA 1SVXB 2XX7A 5A5XB 3TUSA 3T93B 3TEPA 4KI0E 4F1YA 2DXRA 3KJTA 3RGYA 1B1HA 5I58B 1OLCA 4ND9A 1LBBA 2DYXA 4YU0A 4Z7EA 1I6BA 1NNKA 1D4NA 1RYOA 3UGWA 2A5TB 4BDMA 4IO2A 3SESA 4JWYA 1XHYA 4YKKA 3RPWA 3VXBA 2V3UA 4K3FA 4I62A 4O3CA 1DPPA 3CFZA 4RYAA 5HBCA 3USDA 1TT1A 3SERA 4E0XA 2YJPA 1XVXA 1N7WA 1JQFA 1P1UA 4OFJA 4QHQA 4P11A 2ZNSA 4N07A 1Q35A 3FATA 3RT8A 3T22A 4BDOA 1ZTYA 1B1XA 4XIGQ 1LLSA 1IQ7A 1PB8A 1POY1 1A55A 1MQHA 3E3KA 2XX8A 4ISUA 3U94A 3C32A 2Z8FA 3ZKKA 2I49A 2F34A 2V3TA 3GBAA 2VD2A 2I0BA 2OWSA 3K00A 3PPPA 2NXOA 1VFEA 1I6AA 1NFTA 1POTA 4JXIA 2DWHA 4R73A 4R72A 4QFLA 3H7MA 5H8FB 5HPQA 3MVXA 4H5GA 2V84A 1R6ZA 1II5A 3B6WA 2DS9A 4GXSB 1US4A 1JVYA 3IX1A 3BFUA 3HHGA 3EF7A 5TU0A 3TQLA 1XS5A 2PVUA 1PB9A 1KWHA 2V93A 2XXPA 4QFNA 3RTWB 1QUKA 4FECA 4G8MA 1RYXA 4LONB 4R2FA 4DCXA 3MVZA 3HSTA 1N3WA 1ZMGA 4G68B 4JSOA 3IO6A 4FAJA 3A3CA 4ELQA 1SYHA 5L9SA 1YTVA 3VLUA 1WODA 4TLLB 2THIA 1QULA 4FORA 2FYIA 3FVKA 5EHSA 1DPEA 2F97A 2XXHA 1JEVA 3PGFA 4H8JA 3E13X 1I69A 1MDP1 3QUFA 1EZ9A 3C35A 4NF6B 1LB8A 3CFXA 4YAHX 3TTLA 5AA3A 1ZU0A 2Y84A 4FE8A 2DWJA 2GRVA 5ITPA 2OCUA 3C9HA 4UA8A 4R2BA 1DOTA 3K1NA 1H3DA 1MXUA 2QMWA 3UORA 2R9JA 2YPNA 3R26A 3V8XB 4C1UA 5I2KA 1UTHA 2UVHA 1LAXA 3U1OA 3KZGA 4ZEKA 3UIFA 2IA4A 4QSCA 3RN8A 5H8NB 3PUXE 4HW8A 5CI5A 4PE5B 1BIYA 1MQDA 3M3FA 5KDTA 3VLWA 1P1WA 1B3GA 4IY6A 4LQ5A 3TKDA 1LBCA 4EUOA 3G3KA 3UN6A 3K1PA 1MXWA 2X26A 4MFIA 4XTCQ 1NNPA 1FCKA 3IK6B 2Q9TA 4QF9A 3U8QA 5ICTA 1B5IA 2XXQA 4XKQA 2HAUA 1AIVA 5KDTB 2UYEA 3MQ9A 4KCDA 3BKIB 5JEIA 3O6IA 4ZECA 2A5TA 3ECRA 1SW1A 4H65A 1QUJA 3K02A 4HS7A 4PFUA 1ANFA 2PT2A 1JEUA 5K2XA 5K2YA 2A5SA 4NF6A 3IJOB 3DP6A 4R6HA 5DT6A 3SEWA 1B46A 3Q26A 1BP5A 1LAGE 3GXAA 1O64A 3SKPA 3VXCA 4ELPA 3B6QA 3G3IA 4Z0IA 1B4ZA 2RC8A 5DVIA 3KSJA 4ZEFA 5I56A 2AL5A 3SETA 3W9VA 4ZE9A 1MH3A 1PEBA 3QUJA 4G68A 4GIZA 2P2AA 2ZNTA 2XXXA 4HTGA 4OQOA 1MQIA 2F7BA 1TWYA 1M5BA 4OVJA 1M5CA 5DVFA 3N26A 1VE4A 3I5OA 2NWJA 4MH5A 4QRZA 3OOAA 3TAJA 4FIMA 3V89B 2DXYA 5KCJA 4WXJA 3EN3A 3MWBA 3C4MA 4IY5A 4RNSA 4OFLA 3WAFA 4BDLA 3HV1A 2I3WA 5I2NA 5F7VA 1NH7A 2R71A 1DSNA 3MJNA 3TFLA 3JZJA 1Y3NA 4AB6A 1MG1A 1BLFA 4NEDA 4U23A 3W15C 1B0LA 1OMPA 3CSGA 1LFGA 4IGTA 4IGRA 3SEXA 4IO5A 4MBPA 4RXLA 2HXWA 4NMYA 2F78A 4U1ZA 4ONYA 2FNCA 1FQCA 3K0VA 3KG2A 5DTBA 3TTMA 1GGGA 3Q29A 1HSJA 3FJGA 3H6WA 4O3AA 2DVCA 3CG3A 4R6YA 3TZAA 2OK2A 4YMBA 3H6UA 2M8CA 2OWTA 1B52A 3BFTA 3C31A 3CR9A 3LSFB 3U93A 3IOTA 1N7XA 1MY2A 3IOVA 4EXLA 3RT6B 1JETA 4NWCA 2ONRA 2F6GA 4ZEIA 1FTKA 3QK6A 4WEPA 1OQHA 1B6HA 2I4CA 4OFOA 3K4UA 2PMSA 1P1NA 5DYHA 3K6UA 4HCWA 5AA1A 1TFAA 4U1OA 4DXCA 1N76A 1A99A 1PBPA 2HZLA 3K6WA 3OO6A 1YCJA 4IO6A 2H25A 3OO7A 1A7LA 4R6KA 4L17A 3U72A 3L6GA 1R9LA 4JWXA 3MPLA 4GD5A 4IO3A 2UVJA 5DEXA 2O6AA 4FEDA 3EHUA 4ZE8A 4EQ9A 1ATGA 4NWDA 1N0TA 3FVNA 1Q1KA 4LZ5A 2XXRA 2XXIA 3IR1A 3QAXA 4TLMB 3FD3A 4LA9A 1B0HA 2H4IA 1QJMA 3LC8A 3OO8A 5EYFA 5JTYB 1EU8A 3K2DA 3TTRA 2F5XA 2Y7WA 5FHNA 2HZKA 2Z23A 3JYRA 5CRYA 3MBPA 1SW5A 3K01A 3KFMA 3T96B 4KYEA 1CE2A 4R9GA 1MPCA 3O66A 5I2KB 4OHNA 2HAVA 4EDPA 2OLBA 3G7WA 1SBPA 1MM7A 4NF4B 3Q28A 2B3BA 3N6UA 4LZ8A 2GHBA 4H0WA 1B05A 2NVUB 1LSTA 2ZYKA 3VVEA 3KBRA 1IXGA 2VGQA 3QXMA 4M1VA 4O3BA 5KZTA 1GTKA 3O97A 4NE4A 3CVGA 3FXQA 2QS3A 4NF8A 3PD9A 4MF3A 2DWAA 3LR1A 4QFOA 3IB0A 3LBSA 3K6VA 5ITOA
chains in the Genus database with same CATH superfamily
1IZ1A 4X48A 4OVRA 4OETA 3OSQA 4WKMA 4UACA 1M5DA 1QVSA 1MY4A 4ZZAA 1BK4A 4GBVA 4G68C 2WKYA 5I56B 3T9VA 4MJOA 4XF5A 2R6GE 4N13A 3MP6A 2FIEA 1K9YA 1FQBA 3OENA 4Q8RA 1LFHA 3IB1A 1JP4A 1B7HA 1JNFA 4OVTA 5CMKA 1NL5A 3PUWE 2B3FA 1MXXA 5I58A 1QKBA 1FBPA 2NOOA 1B5JA 2OJTA 1VSOA 4RY1A 1RDXA 4Q5TA 4AQ4A 2GH9A 3K6XA 1NUXA 1MXVA 3V5AA 5B70A 2XD2A 5H8SA 4DE8A 4POXA 5LOMA 3EKIA 2ZZXA 1AH5A 3T1BA 1VFDA 4JB7A 2VPOA 2QL3A 3PMXA 3H06B 3TPAA 1Q9DA 4G8NA 3TTNA 1UTBA 2XWIA 3F11A 3QYTA 1H44A 3HCQA 4XKRA 5EYHA 3OEMA 1NV4A 4YZZA 2UVIA 4GL8A 4MLQA 2QVVA 4GF8A 3GZGA 3OMBA 4RPNA 4DLDA 1FBHA 3S9NC 2O7UA 4MLVA 3OO9A 3B6TA 3KJ7A 4OVQA 3DP8A 2PYYA 1FPLA 1NUWA 5DW8A 4RK2A 4I8CA 3T66A 5I57B 1UTHB 4QFPA 5I5PA 3OELA 3KEIA 2Z8DA 1B58A 4JVCA 2WYKA 1OVBA 4AS4A 2ZMBA 1FTJA 3FJMA 4C0RA 1PDAA 4ESXA 3S9EA 3IOUA 2E1SA 2B65A 4E0WA 4FJPA 4N6PA 1HSEA 1LGBC 2O1LA 3EHTA 4F3GA 2QJEA 1KA0A 2KLFA 2DOJA 5EQ8A 2V25A 1IEJA 3E79A 3RY3A 3FJ7A 4LN5A 3KOTA 1PBQA 2NUVA 4PQJA 2XWVA 4MNCA 2D3IA 3LSLA 2Q88A 4WEDA 3O9PA 2QS2A 5A5XA 3FUZA 1QGXA 1N3XA 3MVYA 3THIA 3DP4A 3N94A 3HN0A 4OANA 4JVDA 4N4UA 4N6KA 2REJA 2XXWA 1P1OA 1BTJA 3KN7A 3KGCA 3FXBA 1IITA 2AL4A 1EYKA 3ONMA 1RDYA 3M3LA 1QW0A 4G4PA 2ZXTA 2GFEA 2X7PA 2DE4A 1MM6A 3B50A 3Q27A 2AYSA 4OZ9A 2O51A 3ILTB 3FGSA 3PPNA 1LB9A 4F3PA 2H99A 5I57A 1NMUA 4MAGA 2F8DA 2XXVA 3TYHA 2VOZA 3O2AA 3V83A 2P3VA 1FTMA 3MVWA 4YKJA 3TDJA 2Y7KA 1FBDA 1IXCA 5F1QA 1Y20A 1DTZA 2B4MA 1WVJA 4EQ7A 1LCTA 4N81A 3RPLA 2CZLA 5ELVA 1NV0A 2HCAA 4IO7A 4GLIA 3JV9A 4P1LA 4OXVA 4PAIA 1B32A 1IXIA 5ICQA 4PFTA 2I58A 1FBEA 5JTYA 3DLNA 2ZZVA 1MPDA 3FASA 1GV8A 2XD3A 1SQYA 1B7UA 1FBCA 3N6TA 4DCYA 2OWZA 4TOZA 3TUSA 3MYUA 4F1YA 2DXRA 4ND9A 2DYXA 4YU0A 1I6BA 4H46A 1D4NA 1RYOA 3UGWA 4IO2A 4JWYA 2V3UA 4K3FA 4RYAA 5HBCA 1XVXA 1JQFA 2HHMA 3ISPA 4N07A 3FATA 4PE3A 4BDOA 1ZTYA 4XIGQ 1LLSA 3IFAA 4ISUA 3ZKKA 1VDWA 2VD2A 4JXIA 1VFEA 3SZPA 4R73A 1FPDA 4H5GA 4GXSB 3BFUA 3EF7A 4OVSA 5TU0A 2V93A 4G8MA 1RYXA 4LONB 3HSTA 4JSOA 3A3CA 4ELQA 1SYHA 5I7IA 5L9SA 1QULA 2F97A 2ZZWA 3PGFA 4H8JA 5AA3A 3CFXA 2DDKA 1FBGA 1ZU0A 1RDZA 4R2BA 1H3DA 3V8XB 4C1UA 3U1OA 5J16A 4QSCA 1FJ9A 1MQDA 4MMPA 1P1WA 3TKDA 3G3KA 2X26A 4MFIA 3U8QA 3NOHA 2XXQA 4XKQA 5KDTB 2UYEA 1LBXA 4KCDA 3BKIB 2A5TA 3ECRA 4H65A 2PCRA 2PT2A 1IMFA 3HFUA 3SEWA 2KQZA 3G3IA 1B4ZA 5DVIA 3KSJA 1PEBA 3QUJA 3FBPA 4HTGA 1MQIA 3QMFA 2F7BA 1TWYA 4OVJA 4PF6A 3OOAA 3V89B 3MWBA 4IY5A 3WAFA 4BDLA 5I2NA 3MJNA 4AB6A 3W15C 1B0LA 2FBPA 3CSGA 4IGRA 4X04A 3SEXA 1NV6A 4U1ZA 3KG2A 1FQCA 4GWUA 2DVCA 4YMBA 3BFTA 3U93A 3IOVA 3QK6A 1OQHA 2I4CA 3K6UA 4HCWA 4DXCA 2HZLA 1A99A 3K6WA 3OO7A 3MSTA 1R9LA 4JWXA 4GD5A 1ATGA 4TLMB 2XXRA 2XXIA 3LC8A 2H4IA 1QJMA 2Z23A 1SW5A 1EYJA 2R8TA 1MPCA 4EDPA 4NF4B 3Q28A 4LZ8A 1B05A 1LSTA 3VVEA 3KBRA 4O3BA 3CVGA 3PD9A 3IB0A 4N8YA 5ITOA 1NV5A 5CMCA 2XXTA 3LSXA 4LUBA 1WDNA 1OQGA 4PFYA 5TP9A 1AMFA 1B3EA 2DWIA 3M8UA 4GX6A 4JDFA 4F2QA 1H43A 1GR2A 2RC7A 4MHFA 3BIHA 4DZ1A 1YPNA 2BJIA 2DE2A 1XOCA 5CC2A 1HSLA 5L8DA 4U21A 5LDZA 1N84A 3KOSA 5I59A 1O63A 1ELJA 3TELA 4F1VA 4H6DA 5IM2A 5AA4B 5IAIA 4H8IA 1MXZA 5HM4B 4DXUA 5CMMA 4JVIA 2YLNA 4QSEA 4LATA 3AXFA 1UIUA 3G3GA 2VP1A 1JW5A 4NAPA 3PPRA 1ZIUA 4U22A 4OYVA 1Y9UA 3LSWA 1D3KA 3TCFA 2DP8A 2WX9A 4F3SA 3PUYE 2O69A 3G3FA 4F31B 2CZHA 2Y5KA 5F24A 2HPGA 1SPIA 4MCOA 2ZYOA 2E0SA 4PFRA 5FTIA 3PUZE 4OEVA 3A09A 3S9MC 3ILUB 4F1UA 5FTHA 2I6EA 3E9XA 3EQ1A 2CZKA 1Y1MA 4G77A 4QBAA 4ZS9A 4GWSA 1OVTA 5H8HB 4I9DA 1B3FA 1YAEA 2AIXA 4LVQA 3S9LC 3LUYA 1B7ZA 3RTFB 2O7IA 5T3JA 2Y7IA 4H67A 3PV0E 2I4BA 4PTKA 2H9BA 2RINA 1US5A 1FPIA 3RNNA 1LBVA 2G29A 2GHAA 1SYIA 4EF1A 1NUZA 5JK4A 1PB7A 2IEEA 4ZEDA 4GQOA 5FHMA 2Y7PA 1SI0A 1I6QA 5I59B 1FPJA 2FHYA 1NNFA 2RF1A 3SDFA 2Q2CA 2VHAA 1JW1A 2CMOA 4OESA 2VD3A 3RLFE 2H5YA 4RJZA 4DDDA 3O6HA 4GVOA 3MPKA 3VE1B 2QVRA 2XX9A 4OTEA 4YB6A 3IOWA 4F3BA 2PX1A 1OIBA 3FIRA 5EQ9A 3EPEA 3TQWA 3I3VA 4GWXA 4EF2A 4M4GA 5M2VA 3PMWA 1G0HA 3G3JA 4NN3A 2OX3A 1MS7A 4YKIA 1M5FA 2ANJA 3MP8A 4F22A 4PF8A 3CG1A 2W7YA 2BJJX 1URSA 2Y7RA 2PFYA 5H8HA 4O8MA 1FQEA 2DE3A 3T0JA 2VPNA 3PUVE 4AB5A 1URDA 1MXYA 4KQPA 1SW2A 1BKAA 4Q0CA 1XC1A 1SI1A 2OZZA 3FVGA 1S7YA 4GRKA 3U65A 1AOVA 3KSXA 1QUIA 2REGA 3C36A 2QSXA 2DVZA 1DMBA 2ONKE 4BDMA 4FATA 3BBRA 2HFBA 5I84A 4C1TA 4F19A 2Q2AA 1VR5A 4PGPA 3H03A 5TPAA 4ZEBA 4XFEA 1Y3QA 2QVUA 3GBBA 1FQFA 2QMXA 5CBSA 5ISUA 2D21A 5ET8A 4NGUA 4THIA 3T93B 4Z7EA 2A5TB 3SESA 4N15A 3USDA 4E0XA 1N7WA 1P1UA 1YYZA 3RT8A 3T22A 1B1XA 1IQ7A 1A55A 3C32A 2Z8FA 1YXIA 3PPPA 1I6AA 5H8FB 4QFLA 3H7MA 2V84A 1R6ZA 3IX1A 1JVYA 1XI6A 3RPLB 1XS5A 1KWHA 3RTWB 4G68B 4FAJA 2XA5A 4FORA 2FYIA 5EHSA 1DPEA 3E78A 1MDP1 3QUFA 3C35A 4NF6B 2Y84A 4FE8A 2DWJA 1DOTA 3K1NA 2QMWA 3UORA 1IMAA 2IA4A 3RN8A 5H8NB 5CI5A 1BIYA 1FPGA 4IY6A 1LBCA 1MXWA 4XTCQ 3IK6B 4PAFA 4QF9A 5ICTA 2HAUA 3LUZA 1JEUA 5K2XA 4R6HA 3DP6A 1B46A 1LAGE 1FBFA 3GXAA 3VXCA 4Z0IA 3SETA 4ZE9A 4KXPA 3KBZA 2P2AA 2ZNTA 1M5CA 3I5OA 4MH5A 4QRZA 3TAJA 4WXJA 4OFLA 1MG1A 1BLFA 4NEDA 4U23A 4H45A 4NMYA 4ONYA 5DTBA 3H6WA 3TZAA 2OK2A 1B52A 3C31A 3CR9A 4EXLA 1MY2A 1JETA 2ONRA 1P1NA 5AA1A 4IO6A 4R6KA 1LBZA 3U72A 3L6GA 5DEXA 4PC9A 2UVJA 2O6AA 4EQ9A 3EHUA 4O94A 1B0HA 2F5XA 2Y7WA 2HZKA 3JYRA 5CRYA 3K01A 3KFMA 4PGNA 3O66A 2Q74A 2HAVA 2WBBA 1SBPA 1MM7A 2VT5A 2QS3A 4NF8A 2DWAA 3LR1A 3K6VA 4KPTA 3IJXB 1NV2A 1B2HA 2XXUA 3N5LA 4ZZEA 1OLAA 4XKPA 1UTBB 1B9JA 1SDXA 2HXRA 2LAOA 3VVFA 3UP9A 4PDDA 2Z22A 1DK4A 4BDRA 1JW4A 3CI8A 3VDFA 3FXRA 5ESYA 3H6TA 4NF5A 5AA2A 3H6VA 4NF5B 2V4CA 5AA2B 4U4XA 1N04A 3MW0A 1FPBA 4P0IA 1Y3PA 4BDNA 5ET6A 3FV2A 1B5HA 2Y5LA 3ZSFA 1PC3A 4P56A 3P7IA 5IZZA 4GOTA 1ZKBA 3PU5A 2UXAA 4I3YA 4KYDA 3RUMA 1RKMA 2X7QA 3DM0A 1MPBA 4OMBA 2RKMA 1FSAA 3O29A 3WAEA 4NTLA 1MY0A 5H8QB 4OWDA 2ABHA 3IFCA 3FZVA 4XXUA 1IUDA 3T9XB 3A29A 3IORA 1NNTA 1S9TA 4POWA 1FTOA 4KHZE 4R9FA 2Q89A 2O84X 1L5TA 1LBYA 4U2RA 4F29A 1B40A 1AWBA 1F9BA 3FXUA 1NKXA 1NH8A 2GQ1A 1IMEA 3HPIA 4KFQA 1FRPA 1B51A 4GFRA 5H8QA 4RPOA 3MAMA 3I6VA 4F2OA 1LEVA 3VFJA 4NQ8A 2F6PA 4LP2B 2I0CA 3D1RA 3TTLA 3MZBA 4H5FA 1MDQA 3IO4A 3UK4A 3VLVA 2CZIA 4P0GA 4ZDMA 3UA8A 1FJ6A 3H4ZA 1URGA 4MNIA 3O6GA 3MZ1A 2P3NA 2FA7A 3ODBA 1M5EA 3KN3A 4NF8B 5BWJA 4PCDA 4GWOA 3IL1B 5J1DA 1NV3A 3PD8A 3GLBA 4DI3D 1XT8A 4OENA 4Q30B 4HCYA 3PMVA 1IMDA 4PFWA 4ELOA 4KR5A 4LZ7A 2F35A 4U4SA 2QS1A 1MY1A 5EHMA 1FQDA 1Y4TA 1EH3A 3MC2A 1A8EA 3TCHA 5DEXB 1D9QA 2WEFA 2ALUA 1D9YA 3ZS6A 4FEBA 3MP1A 1IMBA 1B3LA 2F3BA 3T9HB 4P47A 5FBPA 5EYGA 4YKPA 4F18A 1YZ0A 4ELRA 5AE4A 1B3HA 2O1MA 3S2VA 1LBWA 2D5WA 2RC9A 4LQ2A 1DCUA 5DVJA 4GXAA 4KYSA 2RCBA 4BLAA 3KN8A 5ET5A 2Z8EA 5L9MA 5L9OA 2WBDA 1S50A 3D4GA 4N91A 4HE0A 1IIWA 4TQUQ 3H3GA 1A54A 2F7CA 2ZNUA 3S4UA 1Z7ME 4X1BA 1O7TA 3B7DA 1SVXB 2XX7A 5A5XB 1B1HA 5I58B 1OLCA 1XHYA 3RPWA 3VXBA 2Q8MA 3SERA 2YJPA 4P11A 5IZ3A 1POY1 1MQHA 3E3KA 3U94A 2V3TA 3GBAA 3RQTA 3K00A 1POTA 5HPQA 3MVXA 2XWKA 1II5A 3B6WA 2DS9A 1US4A 2CEYA 3TQLA 1PB9A 4QFNA 2XXPA 1QUKA 2WYPA 4R2FA 4DCXA 3MVZA 1N3WA 3IO6A 1YTVA 4TLLB 2THIA 4PAKA 3FVKA 1I69A 1EZ9A 1LB8A 2GRVA 5ITPA 4UA8A 3C9HA 5I2KA 1UTHA 1NI9A 3KZGA 4ZEKA 3UIFA 4HW8A 4PE5B 3VLWA 3K1PA 1FCKA 1B5IA 3MQ9A 5JEIA 3O6IA 4ZECA 3ROJA 1SW1A 1QUJA 4HS7A 4PFUA 2A5SA 4NF6A 3Q26A 4ELPA 3PTYA 3B6QA 5I56A 4ZEFA 4MX6A 3RYDA 4GX3A 1MH3A 4G68A 4OQOA 5DVFA 3KC0A 1VE4A 4FIMA 5KCJA 3EN3A 3C4MA 5F7VA 2R71A 1DSNA 1NV1A 2XXKA 4GWZA 4MBPA 2F78A 4P9KA 1HSJA 4R6YA 2M8CA 2OWTA 3RT6B 4UABA 2F6GA 1B6HA 3K4UA 2PMSA 4FBPA 4U1OA 3OO6A 1YCJA 1DBZA 1A7LA 2FIXA 3MPLA 4IO3A 4FEDA 3FVNA 4IR8A 3IR1A 3FD3A 5EYFA 3OO8A 4PDHA 3LV0A 3MBPA 4KYEA 1CE2A 4PBHA 2L5VA 2OLBA 2B3BA 3N6UA 2GHBA 4H0WA 2NVUB 5EQ7A 1IXGA 2VGQA 3QXMA 5KZTA 4NE4A 4O7IA 3FXQA 4MF3A 4QFOA 3LBSA 1Z7NE 3HHFA 2Q8JA 1XVYA 2I48A 1TFDA 4PP0A 4KD5A 1FTLA 2F36A 3T9UA 2ESNA 1MQJA 3HO7A 4IO4A 4MEVA 5H8FA 2G93A 4XKNA 1UQWA 5CMBA 5AA2D 1DTGA 3Q25A 2OBGA 4ESWA 1LAHE 3C34A 5LTCA 4P3LA 2F3DA 1INPA 1LAFE 5ET7A 5CBRA 4P8BA 1LCFA 1SW4A 3CFLA 5AA4A 1IMCA 3TTKA 4F39A 5IKBA 1EZOA 1QKAA 1KA1A 2V3QA 3CRBA 3TCGA 2DQVA 2XHDA 2ZYNA 4QXDA 4JWOA 4DXBA 2PT1A 3K1MA 3MUQA 1Y1ZA 2P0SA 3TODA 3CHGA 2ONSA 4PETA 1USYE 3VV5A 4MIJA 5EQAA 3EHSA 5TP9B 2QRYA 3CIJA 4G8HA 4R74A 5CM6A 4NX1A 3U92A 2I3VA 1MY3A 3M3KA 4DIGA 3W9WA 1B4HA 2PBWA 2B4LA 3L6HA 4KCCA 1R9QA 4NF4A 1FQAA 1AL3A 3SEUA 2F7AA 3PPOA 2O68A 1R1NA 1H45A 3R6UA 2QPQA 2UVGA 4I40A 4X1DA 3VVDA 5FHOA 1KZ8A 3BIGA 1IXHA 3QSLA 1JVXA 1UIVA 3OEKA 4N8GA 3B8BA 4JSDA 4I3EA 4OERA 1EZPA 3C33A 3KC1A 5A5LA 1ZLQA 1FPEA 1NUYA 3FVOA 1GVCA 1H76A 3OSRA 2HEUA 4EXKA 3SEVA 4ECFA 3GYYA 1J1NA 4EQBA 4NF0A 4YB7A 1NV7A 5I2NB 4X8RA 5KCJB 4I1DA 1MRPA 1ZBMA 4AS5A 1SD3A 2XXYA 3E4RA 5B7DA 4YMAA 4HE1A 5TPAB 4RK9A 1LFIA 1D9VA 2DSFA 4H1XA 4BDQA 5H8NA 4YB5A 4QFKA 3OD7A 1Y4CA 3D4CA 1TXFA 4G61A 4X9TA 1P1QA 4GX4A 1MQGA 2P1SA 4YICA 2QFLA 4R75A 2H98A 1FPKA 3SEYA 4GL0A 2HQ0A 4IB2A 2QS4A 2ZYMA 3MZ9A 4NHBA 1FW0A 3O28A 3IAZA 2FVZA 1EYIA 3OXNA 4PFBA 3CSBA 3A3UA 5IGAA 3QIMA 1A8FA 2UYFA 1USYH 4OA4A 3ZKLA 4GWYA 3DELB 4G2ZA 1ZJLA 2CEXA 3PPQA 4QSDA 1P99A 2RCAA 3FV1A 4OEUA 3TMGA 1CB6A 4RA1A 3R7XA 2XWOA 1A40A 3IB2A 1MH4A 3G3HA 4HXVA 4N6DA 4JBZA 3TEPA 4KI0E 3KJTA 3RGYA 1LBBA 1NNKA 5IZ1A 1FTAA 4YKKA 4NG7A 4I62A 1DPPA 3CFZA 1TT1A 4OFJA 4QHQA 2ZNSA 1Q35A 4PFIA 1PB8A 2XX8A 2I49A 4O3CA 2F34A 2I0BA 4GBWA 2OWSA 2NXOA 4R72A 1NFTA 2DWHA 3HHGA 2PVUA 4FECA 1ZMGA 3VLUA 1WODA 4MNPA 2JJKA 2XXHA 1JEVA 3E13X 5K2YA 4YAHX 2OCUA 1MXUA 2R9JA 2YPNA 3R26A 2UVHA 1LAXA 3PUXE 3M3FA 5KDTA 1B3GA 4LQ5A 1G0IA 2PFZA 4EUOA 3UN6A 1NNPA 2Q9TA 1AIVA 3K02A 1ANFA 4OVPA 5DT6A 3IJOB 1BP5A 1O64A 3SKPA 1CNQA 2RC8A 2AL5A 3W9VA 4GWWA 4GIZA 4DI4B 2XXXA 2KR0A 1M5BA 3N26A 2NWJA 2DXYA 4RNSA 3HV1A 2I3WA 1NH7A 3TFLA 3JZJA 1Y3NA 1OMPA 1LFGA 4IGTA 4IO5A 4RXLA 2HXWA 5IZ3B 3TTMA 2FNCA 3K0VA 1GGGA 3Q29A 2MKZA 3FJGA 4O3AA 3CG3A 4N17A 3H6UA 3LSFB 1FPFA 3IOTA 1N7XA 4P1EA 4NWCA 4ZEIA 1FTKA 4WEPA 4OFOA 5DYHA 1TFAA 1N76A 1PBPA 2H25A 4L17A 1T0KA 4ZE8A 4NWDA 1N0TA 1Q1KA 4LZ5A 3QAXA 4XEQA 4HE2A 4LA9A 5JTYB 1EU8A 1K9ZA 3K2DA 3TTRA 5FHNA 3T96B 4R9GA 5I2KB 4OHNA 5I3SA 3G7WA 4O7MA 4PBQA 2ZYKA 4M1VA 1GTKA 3O97A 5BUUA
chains in the Genus database with same CATH topology
1IZ1A 1Z7NE 5CMCA 3HHFA 4KPTA 4X48A 3IJXB 2Q8JA 2XXTA 1XVYA 2I48A 3LSXA 3OSQA 4LUBA 4OETA 1WDNA 1OQGA 1TFDA 1B2HA 4PFYA 4WKMA 5TP9A 4PP0A 2XXUA 3N5LA 4ZZEA 1AMFA 4UACA 1B3EA 1FTLA 2DWIA 3M8UA 4KD5A 2F36A 1M5DA 3T9UA 1QVSA 2ESNA 1MQJA 1MY4A 3HO7A 4ZZAA 4G68C 4IO4A 5H8FA 1OLAA 2WKYA 5I56B 4XKPA 2G93A 3T9VA 4XKNA 4JDFA 4F2QA 1H43A 1GR2A 1UTBB 1UQWA 2R6GE 5CMBA 2RC7A 4N13A 1B9JA 3MP6A 5AA2D 1SDXA 2LAOA 3VVFA 4DZ1A 1YPNA 2DE2A 1XOCA 1FQBA 5CC2A 3OENA 3UP9A 1HSLA 4Q8RA 1LFHA 3IB1A 5L8DA 1DTGA 1B7HA 3Q25A 1JNFA 2OBGA 4ESWA 2Z22A 5CMKA 4U21A 1NL5A 4BDRA 1N84A 3PUWE 3PV0E 2B3FA 1JW4A 1LAHE 3CI8A 3KOSA 5I59A 1O63A 3VDFA 1ELJA 1MXXA 3C34A 3TELA 4F1VA 4H6DA 3FXRA 5I58A 5AA4B 1QKBA 3H6TA 5IAIA 4H8IA 4NF5A 5AA2A 1MXZA 5HM4B 3H6VA 4DXUA 2NOOA 1LAFE 5CMMA 5CBRA 1B5JA 2OJTA 1LCFA 1VSOA 4RY1A 2YLNA 4NF5B 1SW4A 4Q5TA 4AQ4A 3CFLA 5AA2B 5AA4A 2GH9A 4QSEA 1N04A 3K6XA 4LATA 3AXFA 4U4XA 3TTKA 1UIUA 3G3GA 3MW0A 4P0IA 4F39A 5IKBA 1Y3PA 1MXVA 1EZOA 3V5AA 5B70A 4BDNA 2XD2A 2VP1A 1QKAA 5H8SA 1JW5A 4DE8A 2V3QA 3CRBA 4POXA 3TCGA 3PPRA 5LOMA 1ZIUA 3FV2A 4U22A 4OYVA 1Y9UA 3LSWA 1AH5A 1B5HA 1D3KA 2DQVA 2DP8A 3TCFA 3ZSFA 1PC3A 1VFDA 4F3SA 2XHDA 2O69A 2ZYNA 3P7IA 3PUYE 4JB7A 3G3FA 2QL3A 3PMXA 3H06B 4GOTA 3TPAA 4F31B 1ZKBA 4JWOA 4G8NA 3PU5A 3TTNA 2UXAA 1UTBA 4DXBA 2PT1A 3F11A 3K1MA 3QYTA 3MUQA 1H44A 1Y1ZA 2P0SA 3HCQA 4KYDA 3RUMA 3TODA 4XKRA 2ONSA 1RKMA 3OEMA 4PETA 1USYE 4YZZA 3VV5A 2X7QA 3DM0A 1MPBA 2UVIA 2ZYOA 3EHSA 2E0SA 4GF8A 4GL8A 4MLQA 4OMBA 5TP9B 2QRYA 3CIJA 3GZGA 3OMBA 2RKMA 4RPNA 4G8HA 4R74A 5FTIA 4DLDA 3PUZE 3O29A 3S9NC 4OEVA 3A09A 3WAEA 3S9MC 2O7UA 3ILUB 4NTLA 1MY0A 4MLVA 5H8QB 3OO9A 4F1UA 3B6TA 5FTHA 4OWDA 3KJ7A 2ABHA 5CM6A 2I6EA 3DP8A 3E9XA 3U92A 2I3VA 2PYYA 1MY3A 3M3KA 4DIGA 3FZVA 3EQ1A 3W9WA 4XXUA 4RK2A 1IUDA 1B4HA 2PBWA 3T9XB 4I8CA 3RQTA 3L6HA 1Y1MA 4KCCA 3T66A 5I57B 1R9QA 4NF4A 1FQAA 1AL3A 1UTHB 4G77A 4QFPA 4ZS9A 3IORA 1NNTA 1S9TA 1OVTA 3SEUA 2F7AA 3PPOA 5H8HB 5BUUA 4I9DA 1B3FA 3OELA 1YAEA 2O68A 1R1NA 2AIXA 4LVQA 3S9LC 1H45A 3KEIA 2Z8DA 3R6UA 3LUYA 2QPQA 1B7ZA 3RTFB 4POWA 1FTOA 1B58A 2O7IA 2UVGA 4KHZE 2Y7IA 4R9FA 4X1DA 4H67A 3VVDA 5FHOA 2Q89A 1OVBA 2I4BA 1IXHA 2O84X 1JVXA 2ZMBA 2H9BA 1FTJA 3FJMA 2RINA 1US5A 1UIVA 3QSLA 1L5TA 4C0RA 1PDAA 4ESXA 3S9EA 3OEKA 3RNNA 2G29A 2GHAA 4JSDA 1SYIA 4U2RA 4OERA 4EF1A 4F29A 1B40A 3C33A 1EZPA 3IOUA 1F9BA 3FXUA 5JK4A 1PB7A 2E1SA 1NKXA 2B65A 4E0WA 4FJPA 1NH8A 1ZLQA 4N6PA 3HPIA 1HSEA 1LGBC 2IEEA 2O1LA 2Y7PA 3EHTA 3FVOA 4GQOA 1SI0A 4KFQA 5FHMA 1I6QA 4F3GA 1B51A 2QJEA 4GFRA 1GVCA 5H8QA 5I59B 1H76A 2KLFA 3OSRA 2HEUA 2DOJA 3MAMA 4RPOA 1NNFA 3I6VA 4F2OA 4EXKA 3VFJA 2V25A 3SEVA 1IEJA 4ECFA 3RY3A 2RF1A 3SDFA 1J1NA 2F6PA 2I0CA 3FJ7A 2Q2CA 3KOTA 2VHAA 4LP2B 1JW1A 3MZBA 1PBQA 2CMOA 2NUVA 4H5FA 4PQJA 4OESA 4EQBA 2VD3A 1MDQA 3IO4A 3UK4A 4YB7A 3VLVA 3RLFE 5I2NB 4P0GA 4ZDMA 2H5YA 3UA8A 2D3IA 4RJZA 3LSLA 5KCJB 3H4ZA 4I1DA 4DDDA 2Q88A 4WEDA 1MRPA 3O9PA 2QS2A 3O6HA 1URGA 1ZBMA 4GVOA 5A5XA 3MPKA 3VE1B 4ZEDA 3FUZA 2XX9A 3O6GA 3MZ1A 1SD3A 2XXYA 3E4RA 1N3XA 3MVYA 4OTEA 3THIA 3DP4A 3N94A 4YB6A 3HN0A 2FA7A 3ODBA 5B7DA 3IOWA 4F3BA 1M5EA 2PX1A 4YMAA 1OIBA 2REJA 3KN3A 4NF8B 5TPAB 3FIRA 5BWJA 2XXWA 4RK9A 1LFIA 4GWOA 3EPEA 1D9VA 2DSFA 4H1XA 1P1OA 1BTJA 3KN7A 3KGCA 3TQWA 3I3VA 4BDQA 3IL1B 5H8NA 1IITA 2AL4A 5J1DA 4YB5A 4QFKA 3OD7A 4M4GA 3PD8A 4EF2A 1Y4CA 3GLBA 3D4CA 3ONMA 1TXFA 3M3LA 4X9TA 5M2VA 3PMWA 1P1QA 1QW0A 4G4PA 1XT8A 2ZXTA 3G3JA 4OENA 4Q30B 1MS7A 1MQGA 2GFEA 3PMVA 4HCYA 4PFWA 4YKIA 1M5FA 2P1SA 2X7PA 4ELOA 2ANJA 3MP8A 4YICA 2DE4A 4KR5A 4F22A 4LZ7A 2F35A 4R75A 4U4SA 1MM6A 2H98A 2QS1A 3CG1A 1MY1A 3Q27A 3SEYA 5EHMA 2W7YA 2AYSA 1FQDA 1Y4TA 1EH3A 2BJJX 2O51A 1URSA 2Y7RA 3ILTB 3MC2A 4GL0A 4OZ9A 3FGSA 3PPNA 1A8EA 2HQ0A 4IB2A 5H8HA 3TCHA 1LB9A 2QS4A 2ZYMA 5DEXB 4F3PA 1FQEA 2ALUA 2DE3A 1D9YA 2H99A 3MZ9A 3ZS6A 5I57A 4FEBA 1NMUA 3PUVE 2F8DA 3MP1A 4AB5A 1FW0A 1B3LA 2XXVA 3IAZA 3O28A 3T9HB 3TYHA 1URDA 1MXYA 4KQPA 1SW2A 1BKAA 3OXNA 2VOZA 3O2AA 1T0KA 3V83A 4Q0CA 1XC1A 1SI1A 4YKPA 4F18A 1FTMA 3CSBA 3MVWA 2OZZA 3A3UA 4YKJA 3FVGA 3TDJA 1S7YA 4GRKA 4ELRA 5AE4A 1B3HA 2O1MA 2Y7KA 3QIMA 1IXCA 3S2VA 5F1QA 1AOVA 3KSXA 1Y20A 1A8FA 1DTZA 2D5WA 2UYFA 4EQ7A 1WVJA 2RC9A 1LCTA 1QUIA 1USYH 2REGA 3C36A 4LQ2A 5DVJA 2QSXA 3ZKLA 4GXAA 4KYSA 2DVZA 2RCBA 2CZLA 3DELB 4BLAA 5ELVA 4G2ZA 1DMBA 1ZJLA 2HCAA 2ONKE 3PPQA 4IO7A 4QSDA 3KN8A 4GLIA 3JV9A 2Z8EA 5L9MA 5L9OA 4FATA 4OXVA 1S50A 3BBRA 2HFBA 1B32A 1IXIA 5ICQA 4PFTA 5I84A 1P99A 4C1TA 2RCAA 4F19A 2I58A 2Q2AA 3D4GA 1VR5A 3FV1A 4OEUA 5JTYA 3TMGA 3DLNA 3FASA 1CB6A 1MPDA 3H03A 5TPAA 1IIWA 1GV8A 2XD3A 1SQYA 4ZEBA 4RA1A 4TQUQ 1B7UA 1Y3QA 3H3GA 3GBBA 1FQFA 3R7XA 1A54A 2QMXA 2F7CA 1A40A 3N6TA 5CBSA 5ISUA 2D21A 2ZNUA 4DCYA 3IB2A 1MH4A 3S4UA 3G3HA 1Z7ME 4X1BA 1O7TA 4THIA 4TOZA 4JBZA 3B7DA 1SVXB 2XX7A 5A5XB 3TUSA 3T93B 3TEPA 4KI0E 4F1YA 2DXRA 3KJTA 3RGYA 1B1HA 5I58B 1OLCA 4ND9A 1LBBA 2DYXA 4YU0A 4Z7EA 1I6BA 1NNKA 1D4NA 1RYOA 3UGWA 2A5TB 4BDMA 4IO2A 3SESA 4JWYA 1XHYA 4YKKA 3RPWA 3VXBA 2V3UA 4K3FA 4I62A 4O3CA 1DPPA 3CFZA 4RYAA 5HBCA 3USDA 1TT1A 3SERA 4E0XA 2YJPA 1XVXA 1N7WA 1JQFA 1P1UA 4OFJA 4QHQA 4P11A 2ZNSA 4N07A 1Q35A 3FATA 3RT8A 3T22A 4BDOA 1ZTYA 1B1XA 4XIGQ 1LLSA 1IQ7A 1PB8A 1POY1 1A55A 1MQHA 3E3KA 2XX8A 4ISUA 3U94A 3C32A 2Z8FA 3ZKKA 2I49A 2F34A 2V3TA 3GBAA 2VD2A 2I0BA 2OWSA 3K00A 3PPPA 2NXOA 1VFEA 1I6AA 1NFTA 1POTA 4JXIA 2DWHA 4R73A 4R72A 4QFLA 3H7MA 5H8FB 5HPQA 3MVXA 4H5GA 2V84A 1R6ZA 1II5A 3B6WA 2DS9A 4GXSB 1US4A 1JVYA 3IX1A 3BFUA 3HHGA 3EF7A 5TU0A 3TQLA 1XS5A 2PVUA 1PB9A 1KWHA 2V93A 2XXPA 4QFNA 3RTWB 1QUKA 4FECA 4G8MA 1RYXA 4LONB 4R2FA 4DCXA 3MVZA 3HSTA 1N3WA 1ZMGA 4G68B 4JSOA 3IO6A 4FAJA 3A3CA 4ELQA 1SYHA 5L9SA 1YTVA 3VLUA 1WODA 4TLLB 2THIA 1QULA 4FORA 2FYIA 3FVKA 5EHSA 1DPEA 2F97A 2XXHA 1JEVA 3PGFA 4H8JA 3E13X 1I69A 1MDP1 3QUFA 1EZ9A 3C35A 4NF6B 1LB8A 3CFXA 4YAHX 3TTLA 5AA3A 1ZU0A 2Y84A 4FE8A 2DWJA 2GRVA 5ITPA 2OCUA 3C9HA 4UA8A 4R2BA 1DOTA 3K1NA 1H3DA 1MXUA 2QMWA 3UORA 2R9JA 2YPNA 3R26A 3V8XB 4C1UA 5I2KA 1UTHA 2UVHA 1LAXA 3U1OA 3KZGA 4ZEKA 3UIFA 2IA4A 4QSCA 3RN8A 5H8NB 3PUXE 4HW8A 5CI5A 4PE5B 1BIYA 1MQDA 3M3FA 5KDTA 3VLWA 1P1WA 1B3GA 4IY6A 4LQ5A 3TKDA 1LBCA 4EUOA 3G3KA 3UN6A 3K1PA 1MXWA 2X26A 4MFIA 4XTCQ 1NNPA 1FCKA 3IK6B 2Q9TA 4QF9A 3U8QA 5ICTA 1B5IA 2XXQA 4XKQA 2HAUA 1AIVA 5KDTB 2UYEA 3MQ9A 4KCDA 3BKIB 5JEIA 3O6IA 4ZECA 2A5TA 3ECRA 1SW1A 4H65A 1QUJA 3K02A 4HS7A 4PFUA 1ANFA 2PT2A 1JEUA 5K2XA 5K2YA 2A5SA 4NF6A 3IJOB 3DP6A 4R6HA 5DT6A 3SEWA 1B46A 3Q26A 1BP5A 1LAGE 3GXAA 1O64A 3SKPA 3VXCA 4ELPA 3B6QA 3G3IA 4Z0IA 1B4ZA 2RC8A 5DVIA 3KSJA 4ZEFA 5I56A 2AL5A 3SETA 3W9VA 4ZE9A 1MH3A 1PEBA 3QUJA 4G68A 4GIZA 2P2AA 2ZNTA 2XXXA 4HTGA 4OQOA 1MQIA 2F7BA 1TWYA 1M5BA 4OVJA 1M5CA 5DVFA 3N26A 1VE4A 3I5OA 2NWJA 4MH5A 4QRZA 3OOAA 3TAJA 4FIMA 3V89B 2DXYA 5KCJA 4WXJA 3EN3A 3MWBA 3C4MA 4IY5A 4RNSA 4OFLA 3WAFA 4BDLA 3HV1A 2I3WA 5I2NA 5F7VA 1NH7A 2R71A 1DSNA 3MJNA 3TFLA 3JZJA 1Y3NA 4AB6A 1MG1A 1BLFA 4NEDA 4U23A 3W15C 1B0LA 1OMPA 3CSGA 1LFGA 4IGTA 4IGRA 3SEXA 4IO5A 4MBPA 4RXLA 2HXWA 4NMYA 2F78A 4U1ZA 4ONYA 2FNCA 1FQCA 3K0VA 3KG2A 5DTBA 3TTMA 1GGGA 3Q29A 1HSJA 3FJGA 3H6WA 4O3AA 2DVCA 3CG3A 4R6YA 3TZAA 2OK2A 4YMBA 3H6UA 2M8CA 2OWTA 1B52A 3BFTA 3C31A 3CR9A 3LSFB 3U93A 3IOTA 1N7XA 1MY2A 3IOVA 4EXLA 3RT6B 1JETA 4NWCA 2ONRA 2F6GA 4ZEIA 1FTKA 3QK6A 4WEPA 1OQHA 1B6HA 2I4CA 4OFOA 3K4UA 2PMSA 1P1NA 5DYHA 3K6UA 4HCWA 5AA1A 1TFAA 4U1OA 4DXCA 1N76A 1A99A 1PBPA 2HZLA 3K6WA 3OO6A 1YCJA 4IO6A 2H25A 3OO7A 1A7LA 4R6KA 4L17A 3U72A 3L6GA 1R9LA 4JWXA 3MPLA 4GD5A 4IO3A 2UVJA 5DEXA 2O6AA 4FEDA 3EHUA 4ZE8A 4EQ9A 1ATGA 4NWDA 1N0TA 3FVNA 1Q1KA 4LZ5A 2XXRA 2XXIA 3IR1A 3QAXA 4TLMB 3FD3A 4LA9A 1B0HA 2H4IA 1QJMA 3LC8A 3OO8A 5EYFA 5JTYB 1EU8A 3K2DA 3TTRA 2F5XA 2Y7WA 5FHNA 2HZKA 2Z23A 3JYRA 5CRYA 3MBPA 1SW5A 3K01A 3KFMA 3T96B 4KYEA 1CE2A 4R9GA 1MPCA 3O66A 5I2KB 4OHNA 2HAVA 4EDPA 2OLBA 3G7WA 1SBPA 1MM7A 4NF4B 3Q28A 2B3BA 3N6UA 4LZ8A 2GHBA 4H0WA 1B05A 2NVUB 1LSTA 2ZYKA 3VVEA 3KBRA 1IXGA 2VGQA 3QXMA 4M1VA 4O3BA 5KZTA 1GTKA 3O97A 4NE4A 3CVGA 3FXQA 2QS3A 4NF8A 3PD9A 4MF3A 2DWAA 3LR1A 4QFOA 3IB0A 3LBSA 3K6VA 5ITOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZ1 A;  1Z7N E;  5CMC A;  3HHF A;  4KPT A;  4X48 A;  3IJX B;  2Q8J A;  2XXT A;  1XVY A;  2I48 A;  3LSX A;  3OSQ A;  4LUB A;  4OET A;  1WDN A;  1OQG A;  1TFD A;  1B2H A;  4PFY A;  4WKM A;  5TP9 A;  4PP0 A;  2XXU A;  3N5L A;  4ZZE A;  1AMF A;  4UAC A;  1B3E A;  1FTL A;  2DWI A;  3M8U A;  4KD5 A;  2F36 A;  1M5D A;  3T9U A;  1QVS A;  2ESN A;  1MQJ A;  1MY4 A;  3HO7 A;  4ZZA A;  4G68 C;  4IO4 A;  5H8F A;  1OLA A;  2WKY A;  5I56 B;  4XKP A;  2G93 A;  3T9V A;  4XKN A;  4JDF A;  4F2Q A;  1H43 A;  1GR2 A;  1UTB B;  1UQW A;  2R6G E;  5CMB A;  2RC7 A;  4N13 A;  1B9J A;  3MP6 A;  5AA2 D;  1SDX A;  2LAO A;  3VVF A;  4DZ1 A;  1YPN A;  2DE2 A;  1XOC A;  1FQB A;  5CC2 A;  3OEN A;  3UP9 A;  1HSL A;  4Q8R A;  1LFH A;  3IB1 A;  5L8D A;  1DTG A;  1B7H A;  3Q25 A;  1JNF A;  2OBG A;  4ESW A;  2Z22 A;  5CMK A;  4U21 A;  1NL5 A;  4BDR A;  1N84 A;  3PUW E;  3PV0 E;  2B3F A;  1JW4 A;  1LAH E;  3CI8 A;  3KOS A;  5I59 A;  1O63 A;  3VDF A;  1ELJ A;  1MXX A;  3C34 A;  3TEL A;  4F1V A;  4H6D A;  3FXR A;  5I58 A;  5AA4 B;  1QKB A;  3H6T A;  5IAI A;  4H8I A;  4NF5 A;  5AA2 A;  1MXZ A;  5HM4 B;  3H6V A;  4DXU A;  2NOO A;  1LAF E;  5CMM A;  5CBR A;  1B5J A;  2OJT A;  1LCF A;  1VSO A;  4RY1 A;  2YLN A;  4NF5 B;  1SW4 A;  4Q5T A;  4AQ4 A;  3CFL A;  5AA2 B;  5AA4 A;  2GH9 A;  4QSE A;  1N04 A;  3K6X A;  4LAT A;  3AXF A;  4U4X A;  3TTK A;  1UIU A;  3G3G A;  3MW0 A;  4P0I A;  4F39 A;  5IKB A;  1Y3P A;  1MXV A;  1EZO A;  3V5A A;  5B70 A;  4BDN A;  2XD2 A;  2VP1 A;  1QKA A;  5H8S A;  1JW5 A;  4DE8 A;  2V3Q A;  3CRB A;  4POX A;  3TCG A;  3PPR A;  5LOM A;  1ZIU A;  3FV2 A;  4U22 A;  4OYV A;  1Y9U A;  3LSW A;  1AH5 A;  1B5H A;  1D3K A;  2DQV A;  2DP8 A;  3TCF A;  3ZSF A;  1PC3 A;  1VFD A;  4F3S A;  2XHD A;  2O69 A;  2ZYN A;  3P7I A;  3PUY E;  4JB7 A;  3G3F A;  2QL3 A;  3PMX A;  3H06 B;  4GOT A;  3TPA A;  4F31 B;  1ZKB A;  4JWO A;  4G8N A;  3PU5 A;  3TTN A;  2UXA A;  1UTB A;  4DXB A;  2PT1 A;  3F11 A;  3K1M A;  3QYT A;  3MUQ A;  1H44 A;  1Y1Z A;  2P0S A;  3HCQ A;  4KYD A;  3RUM A;  3TOD A;  4XKR A;  2ONS A;  1RKM A;  3OEM A;  4PET A;  1USY E;  4YZZ A;  3VV5 A;  2X7Q A;  3DM0 A;  1MPB A;  2UVI A;  2ZYO A;  3EHS A;  2E0S A;  4GF8 A;  4GL8 A;  4MLQ A;  4OMB A;  5TP9 B;  2QRY A;  3CIJ A;  3GZG A;  3OMB A;  2RKM A;  4RPN A;  4G8H A;  4R74 A;  5FTI A;  4DLD A;  3PUZ E;  3O29 A;  3S9N C;  4OEV A;  3A09 A;  3WAE A;  3S9M C;  2O7U A;  3ILU B;  4NTL A;  1MY0 A;  4MLV A;  5H8Q B;  3OO9 A;  4F1U A;  3B6T A;  5FTH A;  4OWD A;  3KJ7 A;  2ABH A;  5CM6 A;  2I6E A;  3DP8 A;  3E9X A;  3U92 A;  2I3V A;  2PYY A;  1MY3 A;  3M3K A;  4DIG A;  3FZV A;  3EQ1 A;  3W9W A;  4XXU A;  4RK2 A;  1IUD A;  1B4H A;  2PBW A;  3T9X B;  4I8C A;  3RQT A;  3L6H A;  1Y1M A;  4KCC A;  3T66 A;  5I57 B;  1R9Q A;  4NF4 A;  1FQA A;  1AL3 A;  1UTH B;  4G77 A;  4QFP A;  4ZS9 A;  3IOR A;  1NNT A;  1S9T A;  1OVT A;  3SEU A;  2F7A A;  3PPO A;  5H8H B;  5BUU A;  4I9D A;  1B3F A;  3OEL A;  1YAE A;  2O68 A;  1R1N A;  2AIX A;  4LVQ A;  3S9L C;  1H45 A;  3KEI A;  2Z8D A;  3R6U A;  3LUY A;  2QPQ A;  1B7Z A;  3RTF B;  4POW A;  1FTO A;  1B58 A;  2O7I A;  2UVG A;  4KHZ E;  2Y7I A;  4R9F A;  4X1D A;  4H67 A;  3VVD A;  5FHO A;  2Q89 A;  1OVB A;  2I4B A;  1IXH A;  2O84 X;  1JVX A;  2ZMB A;  2H9B A;  1FTJ A;  3FJM A;  2RIN A;  1US5 A;  1UIV A;  3QSL A;  1L5T A;  4C0R A;  1PDA A;  4ESX A;  3S9E A;  3OEK A;  3RNN A;  2G29 A;  2GHA A;  4JSD A;  1SYI A;  4U2R A;  4OER A;  4EF1 A;  4F29 A;  1B40 A;  3C33 A;  1EZP A;  3IOU A;  1F9B A;  3FXU A;  5JK4 A;  1PB7 A;  2E1S A;  1NKX A;  2B65 A;  4E0W A;  4FJP A;  1NH8 A;  1ZLQ A;  4N6P A;  3HPI A;  1HSE A;  1LGB C;  2IEE A;  2O1L A;  2Y7P A;  3EHT A;  3FVO A;  4GQO A;  1SI0 A;  4KFQ A;  5FHM A;  1I6Q A;  4F3G A;  1B51 A;  2QJE A;  4GFR A;  1GVC A;  5H8Q A;  5I59 B;  1H76 A;  2KLF A;  3OSR A;  2HEU A;  2DOJ A;  3MAM A;  4RPO A;  1NNF A;  3I6V A;  4F2O A;  4EXK A;  3VFJ A;  2V25 A;  3SEV A;  1IEJ A;  4ECF A;  3RY3 A;  2RF1 A;  3SDF A;  1J1N A;  2F6P A;  2I0C A;  3FJ7 A;  2Q2C A;  3KOT A;  2VHA A;  4LP2 B;  1JW1 A;  3MZB A;  1PBQ A;  2CMO A;  2NUV A;  4H5F A;  4PQJ A;  4OES A;  4EQB A;  2VD3 A;  1MDQ A;  3IO4 A;  3UK4 A;  4YB7 A;  3VLV A;  3RLF E;  5I2N B;  4P0G A;  4ZDM A;  2H5Y A;  3UA8 A;  2D3I A;  4RJZ A;  3LSL A;  5KCJ B;  3H4Z A;  4I1D A;  4DDD A;  2Q88 A;  4WED A;  1MRP A;  3O9P A;  2QS2 A;  3O6H A;  1URG A;  1ZBM A;  4GVO A;  5A5X A;  3MPK A;  3VE1 B;  4ZED A;  3FUZ A;  2XX9 A;  3O6G A;  3MZ1 A;  1SD3 A;  2XXY A;  3E4R A;  1N3X A;  3MVY A;  4OTE A;  3THI A;  3DP4 A;  3N94 A;  4YB6 A;  3HN0 A;  2FA7 A;  3ODB A;  5B7D A;  3IOW A;  4F3B A;  1M5E A;  2PX1 A;  4YMA A;  1OIB A;  2REJ A;  3KN3 A;  4NF8 B;  5TPA B;  3FIR A;  5BWJ A;  2XXW A;  4RK9 A;  1LFI A;  4GWO A;  3EPE A;  1D9V A;  2DSF A;  4H1X A;  1P1O A;  1BTJ A;  3KN7 A;  3KGC A;  3TQW A;  3I3V A;  4BDQ A;  3IL1 B;  5H8N A;  1IIT A;  2AL4 A;  5J1D A;  4YB5 A;  4QFK A;  3OD7 A;  4M4G A;  3PD8 A;  4EF2 A;  1Y4C A;  3GLB A;  3D4C A;  3ONM A;  1TXF A;  3M3L A;  4X9T A;  5M2V A;  3PMW A;  1P1Q A;  1QW0 A;  4G4P A;  1XT8 A;  2ZXT A;  3G3J A;  4OEN A;  4Q30 B;  1MS7 A;  1MQG A;  2GFE A;  3PMV A;  4HCY A;  4PFW A;  4YKI A;  1M5F A;  2P1S A;  2X7P A;  4ELO A;  2ANJ A;  3MP8 A;  4YIC A;  2DE4 A;  4KR5 A;  4F22 A;  4LZ7 A;  2F35 A;  4R75 A;  4U4S A;  1MM6 A;  2H98 A;  2QS1 A;  3CG1 A;  1MY1 A;  3Q27 A;  3SEY A;  5EHM A;  2W7Y A;  2AYS A;  1FQD A;  1Y4T A;  1EH3 A;  2BJJ X;  2O51 A;  1URS A;  2Y7R A;  3ILT B;  3MC2 A;  4GL0 A;  4OZ9 A;  3FGS A;  3PPN A;  1A8E A;  2HQ0 A;  4IB2 A;  5H8H A;  3TCH A;  1LB9 A;  2QS4 A;  2ZYM A;  5DEX B;  4F3P A;  1FQE A;  2ALU A;  2DE3 A;  1D9Y A;  2H99 A;  3MZ9 A;  3ZS6 A;  5I57 A;  4FEB A;  1NMU A;  3PUV E;  2F8D A;  3MP1 A;  4AB5 A;  1FW0 A;  1B3L A;  2XXV A;  3IAZ A;  3O28 A;  3T9H B;  3TYH A;  1URD A;  1MXY A;  4KQP A;  1SW2 A;  1BKA A;  3OXN A;  2VOZ A;  3O2A A;  1T0K A;  3V83 A;  4Q0C A;  1XC1 A;  1SI1 A;  4YKP A;  4F18 A;  1FTM A;  3CSB A;  3MVW A;  2OZZ A;  3A3U A;  4YKJ A;  3FVG A;  3TDJ A;  1S7Y A;  4GRK A;  4ELR A;  5AE4 A;  1B3H A;  2O1M A;  2Y7K A;  3QIM A;  1IXC A;  3S2V A;  5F1Q A;  1AOV A;  3KSX A;  1Y20 A;  1A8F A;  1DTZ A;  2D5W A;  2UYF A;  4EQ7 A;  1WVJ A;  2RC9 A;  1LCT A;  1QUI A;  1USY H;  2REG A;  3C36 A;  4LQ2 A;  5DVJ A;  2QSX A;  3ZKL A;  4GXA A;  4KYS A;  2DVZ A;  2RCB A;  2CZL A;  3DEL B;  4BLA A;  5ELV A;  4G2Z A;  1DMB A;  1ZJL A;  2HCA A;  2ONK E;  3PPQ A;  4IO7 A;  4QSD A;  3KN8 A;  4GLI A;  3JV9 A;  2Z8E A;  5L9M A;  5L9O A;  4FAT A;  4OXV A;  1S50 A;  3BBR A;  2HFB A;  1B32 A;  1IXI A;  5ICQ A;  4PFT A;  5I84 A;  1P99 A;  4C1T A;  2RCA A;  4F19 A;  2I58 A;  2Q2A A;  3D4G A;  1VR5 A;  3FV1 A;  4OEU A;  5JTY A;  3TMG A;  3DLN A;  3FAS A;  1CB6 A;  1MPD A;  3H03 A;  5TPA A;  1IIW A;  1GV8 A;  2XD3 A;  1SQY A;  4ZEB A;  4RA1 A;  4TQU Q;  1B7U A;  1Y3Q A;  3H3G A;  3GBB A;  1FQF A;  3R7X A;  1A54 A;  2QMX A;  2F7C A;  1A40 A;  3N6T A;  5CBS A;  5ISU A;  2D21 A;  2ZNU A;  4DCY A;  3IB2 A;  1MH4 A;  3S4U A;  3G3H A;  1Z7M E;  4X1B A;  1O7T A;  4THI A;  4TOZ A;  4JBZ A;  3B7D A;  1SVX B;  2XX7 A;  5A5X B;  3TUS A;  3T93 B;  3TEP A;  4KI0 E;  4F1Y A;  2DXR A;  3KJT A;  3RGY A;  1B1H A;  5I58 B;  1OLC A;  4ND9 A;  1LBB A;  2DYX A;  4YU0 A;  4Z7E A;  1I6B A;  1NNK A;  1D4N A;  1RYO A;  3UGW A;  2A5T B;  4BDM A;  4IO2 A;  3SES A;  4JWY A;  1XHY A;  4YKK A;  3RPW A;  3VXB A;  2V3U A;  4K3F A;  4I62 A;  4O3C A;  1DPP A;  3CFZ A;  4RYA A;  5HBC A;  3USD A;  1TT1 A;  3SER A;  4E0X A;  2YJP A;  1XVX A;  1N7W A;  1JQF A;  1P1U A;  4OFJ A;  4QHQ A;  4P11 A;  2ZNS A;  4N07 A;  1Q35 A;  3FAT A;  3RT8 A;  3T22 A;  4BDO A;  1ZTY A;  1B1X A;  4XIG Q;  1LLS A;  1IQ7 A;  1PB8 A;  1POY 1;  1A55 A;  1MQH A;  3E3K A;  2XX8 A;  4ISU A;  3U94 A;  3C32 A;  2Z8F A;  3ZKK A;  2I49 A;  2F34 A;  2V3T A;  3GBA A;  2VD2 A;  2I0B A;  2OWS A;  3K00 A;  3PPP A;  2NXO A;  1VFE A;  1I6A A;  1NFT A;  1POT A;  4JXI A;  2DWH A;  4R73 A;  4R72 A;  4QFL A;  3H7M A;  5H8F B;  5HPQ A;  3MVX A;  4H5G A;  2V84 A;  1R6Z A;  1II5 A;  3B6W A;  2DS9 A;  4GXS B;  1US4 A;  1JVY A;  3IX1 A;  3BFU A;  3HHG A;  3EF7 A;  5TU0 A;  3TQL A;  1XS5 A;  2PVU A;  1PB9 A;  1KWH A;  2V93 A;  2XXP A;  4QFN A;  3RTW B;  1QUK A;  4FEC A;  4G8M A;  1RYX A;  4LON B;  4R2F A;  4DCX A;  3MVZ A;  3HST A;  1N3W A;  1ZMG A;  4G68 B;  4JSO A;  3IO6 A;  4FAJ A;  3A3C A;  4ELQ A;  1SYH A;  5L9S A;  1YTV A;  3VLU A;  1WOD A;  4TLL B;  2THI A;  1QUL A;  4FOR A;  2FYI A;  3FVK A;  5EHS A;  1DPE A;  2F97 A;  2XXH A;  1JEV A;  3PGF A;  4H8J A;  3E13 X;  1I69 A;  1MDP 1;  3QUF A;  1EZ9 A;  3C35 A;  4NF6 B;  1LB8 A;  3CFX A;  4YAH X;  3TTL A;  5AA3 A;  1ZU0 A;  2Y84 A;  4FE8 A;  2DWJ A;  2GRV A;  5ITP A;  2OCU A;  3C9H A;  4UA8 A;  4R2B A;  1DOT A;  3K1N A;  1H3D A;  1MXU A;  2QMW A;  3UOR A;  2R9J A;  2YPN A;  3R26 A;  3V8X B;  4C1U A;  5I2K A;  1UTH A;  2UVH A;  1LAX A;  3U1O A;  3KZG A;  4ZEK A;  3UIF A;  2IA4 A;  4QSC A;  3RN8 A;  5H8N B;  3PUX E;  4HW8 A;  5CI5 A;  4PE5 B;  1BIY A;  1MQD A;  3M3F A;  5KDT A;  3VLW A;  1P1W A;  1B3G A;  4IY6 A;  4LQ5 A;  3TKD A;  1LBC A;  4EUO A;  3G3K A;  3UN6 A;  3K1P A;  1MXW A;  2X26 A;  4MFI A;  4XTC Q;  1NNP A;  1FCK A;  3IK6 B;  2Q9T A;  4QF9 A;  3U8Q A;  5ICT A;  1B5I A;  2XXQ A;  4XKQ A;  2HAU A;  1AIV A;  5KDT B;  2UYE A;  3MQ9 A;  4KCD A;  3BKI B;  5JEI A;  3O6I A;  4ZEC A;  2A5T A;  3ECR A;  1SW1 A;  4H65 A;  1QUJ A;  3K02 A;  4HS7 A;  4PFU A;  1ANF A;  2PT2 A;  1JEU A;  5K2X A;  5K2Y A;  2A5S A;  4NF6 A;  3IJO B;  3DP6 A;  4R6H A;  5DT6 A;  3SEW A;  1B46 A;  3Q26 A;  1BP5 A;  1LAG E;  3GXA A;  1O64 A;  3SKP A;  3VXC A;  4ELP A;  3B6Q A;  3G3I A;  4Z0I A;  1B4Z A;  2RC8 A;  5DVI A;  3KSJ A;  4ZEF A;  5I56 A;  2AL5 A;  3SET A;  3W9V A;  4ZE9 A;  1MH3 A;  1PEB A;  3QUJ A;  4G68 A;  4GIZ A;  2P2A A;  2ZNT A;  2XXX A;  4HTG A;  4OQO A;  1MQI A;  2F7B A;  1TWY A;  1M5B A;  4OVJ A;  1M5C A;  5DVF A;  3N26 A;  1VE4 A;  3I5O A;  2NWJ A;  4MH5 A;  4QRZ A;  3OOA A;  3TAJ A;  4FIM A;  3V89 B;  2DXY A;  5KCJ A;  4WXJ A;  3EN3 A;  3MWB A;  3C4M A;  4IY5 A;  4RNS A;  4OFL A;  3WAF A;  4BDL A;  3HV1 A;  2I3W A;  5I2N A;  5F7V A;  1NH7 A;  2R71 A;  1DSN A;  3MJN A;  3TFL A;  3JZJ A;  1Y3N A;  4AB6 A;  1MG1 A;  1BLF A;  4NED A;  4U23 A;  3W15 C;  1B0L A;  1OMP A;  3CSG A;  1LFG A;  4IGT A;  4IGR A;  3SEX A;  4IO5 A;  4MBP A;  4RXL A;  2HXW A;  4NMY A;  2F78 A;  4U1Z A;  4ONY A;  2FNC A;  1FQC A;  3K0V A;  3KG2 A;  5DTB A;  3TTM A;  1GGG A;  3Q29 A;  1HSJ A;  3FJG A;  3H6W A;  4O3A A;  2DVC A;  3CG3 A;  4R6Y A;  3TZA A;  2OK2 A;  4YMB A;  3H6U A;  2M8C A;  2OWT A;  1B52 A;  3BFT A;  3C31 A;  3CR9 A;  3LSF B;  3U93 A;  3IOT A;  1N7X A;  1MY2 A;  3IOV A;  4EXL A;  3RT6 B;  1JET A;  4NWC A;  2ONR A;  2F6G A;  4ZEI A;  1FTK A;  3QK6 A;  4WEP A;  1OQH A;  1B6H A;  2I4C A;  4OFO A;  3K4U A;  2PMS A;  1P1N A;  5DYH A;  3K6U A;  4HCW A;  5AA1 A;  1TFA A;  4U1O A;  4DXC A;  1N76 A;  1A99 A;  1PBP A;  2HZL A;  3K6W A;  3OO6 A;  1YCJ A;  4IO6 A;  2H25 A;  3OO7 A;  1A7L A;  4R6K A;  4L17 A;  3U72 A;  3L6G A;  1R9L A;  4JWX A;  3MPL A;  4GD5 A;  4IO3 A;  2UVJ A;  5DEX A;  2O6A A;  4FED A;  3EHU A;  4ZE8 A;  4EQ9 A;  1ATG A;  4NWD A;  1N0T A;  3FVN A;  1Q1K A;  4LZ5 A;  2XXR A;  2XXI A;  3IR1 A;  3QAX A;  4TLM B;  3FD3 A;  4LA9 A;  1B0H A;  2H4I A;  1QJM A;  3LC8 A;  3OO8 A;  5EYF A;  5JTY B;  1EU8 A;  3K2D A;  3TTR A;  2F5X A;  2Y7W A;  5FHN A;  2HZK A;  2Z23 A;  3JYR A;  5CRY A;  3MBP A;  1SW5 A;  3K01 A;  3KFM A;  3T96 B;  4KYE A;  1CE2 A;  4R9G A;  1MPC A;  3O66 A;  5I2K B;  4OHN A;  2HAV A;  4EDP A;  2OLB A;  3G7W A;  1SBP A;  1MM7 A;  4NF4 B;  3Q28 A;  2B3B A;  3N6U A;  4LZ8 A;  2GHB A;  4H0W A;  1B05 A;  2NVU B;  1LST A;  2ZYK A;  3VVE A;  3KBR A;  1IXG A;  2VGQ A;  3QXM A;  4M1V A;  4O3B A;  5KZT A;  1GTK A;  3O97 A;  4NE4 A;  3CVG A;  3FXQ A;  2QS3 A;  4NF8 A;  3PD9 A;  4MF3 A;  2DWA A;  3LR1 A;  4QFO A;  3IB0 A;  3LBS A;  3K6V A;  5ITO A; 
#chains in the Genus database with same CATH topology
 1IZ1 A;  4X48 A;  4OVR A;  4OET A;  3OSQ A;  4WKM A;  4UAC A;  1M5D A;  1QVS A;  1MY4 A;  4ZZA A;  1BK4 A;  4GBV A;  4G68 C;  2WKY A;  5I56 B;  3T9V A;  4MJO A;  4XF5 A;  2R6G E;  4N13 A;  3MP6 A;  2FIE A;  1K9Y A;  1FQB A;  3OEN A;  4Q8R A;  1LFH A;  3IB1 A;  1JP4 A;  1B7H A;  1JNF A;  4OVT A;  5CMK A;  1NL5 A;  3PUW E;  2B3F A;  1MXX A;  5I58 A;  1QKB A;  1FBP A;  2NOO A;  1B5J A;  2OJT A;  1VSO A;  4RY1 A;  1RDX A;  4Q5T A;  4AQ4 A;  2GH9 A;  3K6X A;  1NUX A;  1MXV A;  3V5A A;  5B70 A;  2XD2 A;  5H8S A;  4DE8 A;  4POX A;  5LOM A;  3EKI A;  2ZZX A;  1AH5 A;  3T1B A;  1VFD A;  4JB7 A;  2VPO A;  2QL3 A;  3PMX A;  3H06 B;  3TPA A;  1Q9D A;  4G8N A;  3TTN A;  1UTB A;  2XWI A;  3F11 A;  3QYT A;  1H44 A;  3HCQ A;  4XKR A;  5EYH A;  3OEM A;  1NV4 A;  4YZZ A;  2UVI A;  4GL8 A;  4MLQ A;  2QVV A;  4GF8 A;  3GZG A;  3OMB A;  4RPN A;  4DLD A;  1FBH A;  3S9N C;  2O7U A;  4MLV A;  3OO9 A;  3B6T A;  3KJ7 A;  4OVQ A;  3DP8 A;  2PYY A;  1FPL A;  1NUW A;  5DW8 A;  4RK2 A;  4I8C A;  3T66 A;  5I57 B;  1UTH B;  4QFP A;  5I5P A;  3OEL A;  3KEI A;  2Z8D A;  1B58 A;  4JVC A;  2WYK A;  1OVB A;  4AS4 A;  2ZMB A;  1FTJ A;  3FJM A;  4C0R A;  1PDA A;  4ESX A;  3S9E A;  3IOU A;  2E1S A;  2B65 A;  4E0W A;  4FJP A;  4N6P A;  1HSE A;  1LGB C;  2O1L A;  3EHT A;  4F3G A;  2QJE A;  1KA0 A;  2KLF A;  2DOJ A;  5EQ8 A;  2V25 A;  1IEJ A;  3E79 A;  3RY3 A;  3FJ7 A;  4LN5 A;  3KOT A;  1PBQ A;  2NUV A;  4PQJ A;  2XWV A;  4MNC A;  2D3I A;  3LSL A;  2Q88 A;  4WED A;  3O9P A;  2QS2 A;  5A5X A;  3FUZ A;  1QGX A;  1N3X A;  3MVY A;  3THI A;  3DP4 A;  3N94 A;  3HN0 A;  4OAN A;  4JVD A;  4N4U A;  4N6K A;  2REJ A;  2XXW A;  1P1O A;  1BTJ A;  3KN7 A;  3KGC A;  3FXB A;  1IIT A;  2AL4 A;  1EYK A;  3ONM A;  1RDY A;  3M3L A;  1QW0 A;  4G4P A;  2ZXT A;  2GFE A;  2X7P A;  2DE4 A;  1MM6 A;  3B50 A;  3Q27 A;  2AYS A;  4OZ9 A;  2O51 A;  3ILT B;  3FGS A;  3PPN A;  1LB9 A;  4F3P A;  2H99 A;  5I57 A;  1NMU A;  4MAG A;  2F8D A;  2XXV A;  3TYH A;  2VOZ A;  3O2A A;  3V83 A;  2P3V A;  1FTM A;  3MVW A;  4YKJ A;  3TDJ A;  2Y7K A;  1FBD A;  1IXC A;  5F1Q A;  1Y20 A;  1DTZ A;  2B4M A;  1WVJ A;  4EQ7 A;  1LCT A;  4N81 A;  3RPL A;  2CZL A;  5ELV A;  1NV0 A;  2HCA A;  4IO7 A;  4GLI A;  3JV9 A;  4P1L A;  4OXV A;  4PAI A;  1B32 A;  1IXI A;  5ICQ A;  4PFT A;  2I58 A;  1FBE A;  5JTY A;  3DLN A;  2ZZV A;  1MPD A;  3FAS A;  1GV8 A;  2XD3 A;  1SQY A;  1B7U A;  1FBC A;  3N6T A;  4DCY A;  2OWZ A;  4TOZ A;  3TUS A;  3MYU A;  4F1Y A;  2DXR A;  4ND9 A;  2DYX A;  4YU0 A;  1I6B A;  4H46 A;  1D4N A;  1RYO A;  3UGW A;  4IO2 A;  4JWY A;  2V3U A;  4K3F A;  4RYA A;  5HBC A;  1XVX A;  1JQF A;  2HHM A;  3ISP A;  4N07 A;  3FAT A;  4PE3 A;  4BDO A;  1ZTY A;  4XIG Q;  1LLS A;  3IFA A;  4ISU A;  3ZKK A;  1VDW A;  2VD2 A;  4JXI A;  1VFE A;  3SZP A;  4R73 A;  1FPD A;  4H5G A;  4GXS B;  3BFU A;  3EF7 A;  4OVS A;  5TU0 A;  2V93 A;  4G8M A;  1RYX A;  4LON B;  3HST A;  4JSO A;  3A3C A;  4ELQ A;  1SYH A;  5I7I A;  5L9S A;  1QUL A;  2F97 A;  2ZZW A;  3PGF A;  4H8J A;  5AA3 A;  3CFX A;  2DDK A;  1FBG A;  1ZU0 A;  1RDZ A;  4R2B A;  1H3D A;  3V8X B;  4C1U A;  3U1O A;  5J16 A;  4QSC A;  1FJ9 A;  1MQD A;  4MMP A;  1P1W A;  3TKD A;  3G3K A;  2X26 A;  4MFI A;  3U8Q A;  3NOH A;  2XXQ A;  4XKQ A;  5KDT B;  2UYE A;  1LBX A;  4KCD A;  3BKI B;  2A5T A;  3ECR A;  4H65 A;  2PCR A;  2PT2 A;  1IMF A;  3HFU A;  3SEW A;  2KQZ A;  3G3I A;  1B4Z A;  5DVI A;  3KSJ A;  1PEB A;  3QUJ A;  3FBP A;  4HTG A;  1MQI A;  3QMF A;  2F7B A;  1TWY A;  4OVJ A;  4PF6 A;  3OOA A;  3V89 B;  3MWB A;  4IY5 A;  3WAF A;  4BDL A;  5I2N A;  3MJN A;  4AB6 A;  3W15 C;  1B0L A;  2FBP A;  3CSG A;  4IGR A;  4X04 A;  3SEX A;  1NV6 A;  4U1Z A;  3KG2 A;  1FQC A;  4GWU A;  2DVC A;  4YMB A;  3BFT A;  3U93 A;  3IOV A;  3QK6 A;  1OQH A;  2I4C A;  3K6U A;  4HCW A;  4DXC A;  2HZL A;  1A99 A;  3K6W A;  3OO7 A;  3MST A;  1R9L A;  4JWX A;  4GD5 A;  1ATG A;  4TLM B;  2XXR A;  2XXI A;  3LC8 A;  2H4I A;  1QJM A;  2Z23 A;  1SW5 A;  1EYJ A;  2R8T A;  1MPC A;  4EDP A;  4NF4 B;  3Q28 A;  4LZ8 A;  1B05 A;  1LST A;  3VVE A;  3KBR A;  4O3B A;  3CVG A;  3PD9 A;  3IB0 A;  4N8Y A;  5ITO A;  1NV5 A;  5CMC A;  2XXT A;  3LSX A;  4LUB A;  1WDN A;  1OQG A;  4PFY A;  5TP9 A;  1AMF A;  1B3E A;  2DWI A;  3M8U A;  4GX6 A;  4JDF A;  4F2Q A;  1H43 A;  1GR2 A;  2RC7 A;  4MHF A;  3BIH A;  4DZ1 A;  1YPN A;  2BJI A;  2DE2 A;  1XOC A;  5CC2 A;  1HSL A;  5L8D A;  4U21 A;  5LDZ A;  1N84 A;  3KOS A;  5I59 A;  1O63 A;  1ELJ A;  3TEL A;  4F1V A;  4H6D A;  5IM2 A;  5AA4 B;  5IAI A;  4H8I A;  1MXZ A;  5HM4 B;  4DXU A;  5CMM A;  4JVI A;  2YLN A;  4QSE A;  4LAT A;  3AXF A;  1UIU A;  3G3G A;  2VP1 A;  1JW5 A;  4NAP A;  3PPR A;  1ZIU A;  4U22 A;  4OYV A;  1Y9U A;  3LSW A;  1D3K A;  3TCF A;  2DP8 A;  2WX9 A;  4F3S A;  3PUY E;  2O69 A;  3G3F A;  4F31 B;  2CZH A;  2Y5K A;  5F24 A;  2HPG A;  1SPI A;  4MCO A;  2ZYO A;  2E0S A;  4PFR A;  5FTI A;  3PUZ E;  4OEV A;  3A09 A;  3S9M C;  3ILU B;  4F1U A;  5FTH A;  2I6E A;  3E9X A;  3EQ1 A;  2CZK A;  1Y1M A;  4G77 A;  4QBA A;  4ZS9 A;  4GWS A;  1OVT A;  5H8H B;  4I9D A;  1B3F A;  1YAE A;  2AIX A;  4LVQ A;  3S9L C;  3LUY A;  1B7Z A;  3RTF B;  2O7I A;  5T3J A;  2Y7I A;  4H67 A;  3PV0 E;  2I4B A;  4PTK A;  2H9B A;  2RIN A;  1US5 A;  1FPI A;  3RNN A;  1LBV A;  2G29 A;  2GHA A;  1SYI A;  4EF1 A;  1NUZ A;  5JK4 A;  1PB7 A;  2IEE A;  4ZED A;  4GQO A;  5FHM A;  2Y7P A;  1SI0 A;  1I6Q A;  5I59 B;  1FPJ A;  2FHY A;  1NNF A;  2RF1 A;  3SDF A;  2Q2C A;  2VHA A;  1JW1 A;  2CMO A;  4OES A;  2VD3 A;  3RLF E;  2H5Y A;  4RJZ A;  4DDD A;  3O6H A;  4GVO A;  3MPK A;  3VE1 B;  2QVR A;  2XX9 A;  4OTE A;  4YB6 A;  3IOW A;  4F3B A;  2PX1 A;  1OIB A;  3FIR A;  5EQ9 A;  3EPE A;  3TQW A;  3I3V A;  4GWX A;  4EF2 A;  4M4G A;  5M2V A;  3PMW A;  1G0H A;  3G3J A;  4NN3 A;  2OX3 A;  1MS7 A;  4YKI A;  1M5F A;  2ANJ A;  3MP8 A;  4F22 A;  4PF8 A;  3CG1 A;  2W7Y A;  2BJJ X;  1URS A;  2Y7R A;  2PFY A;  5H8H A;  4O8M A;  1FQE A;  2DE3 A;  3T0J A;  2VPN A;  3PUV E;  4AB5 A;  1URD A;  1MXY A;  4KQP A;  1SW2 A;  1BKA A;  4Q0C A;  1XC1 A;  1SI1 A;  2OZZ A;  3FVG A;  1S7Y A;  4GRK A;  3U65 A;  1AOV A;  3KSX A;  1QUI A;  2REG A;  3C36 A;  2QSX A;  2DVZ A;  1DMB A;  2ONK E;  4BDM A;  4FAT A;  3BBR A;  2HFB A;  5I84 A;  4C1T A;  4F19 A;  2Q2A A;  1VR5 A;  4PGP A;  3H03 A;  5TPA A;  4ZEB A;  4XFE A;  1Y3Q A;  2QVU A;  3GBB A;  1FQF A;  2QMX A;  5CBS A;  5ISU A;  2D21 A;  5ET8 A;  4NGU A;  4THI A;  3T93 B;  4Z7E A;  2A5T B;  3SES A;  4N15 A;  3USD A;  4E0X A;  1N7W A;  1P1U A;  1YYZ A;  3RT8 A;  3T22 A;  1B1X A;  1IQ7 A;  1A55 A;  3C32 A;  2Z8F A;  1YXI A;  3PPP A;  1I6A A;  5H8F B;  4QFL A;  3H7M A;  2V84 A;  1R6Z A;  3IX1 A;  1JVY A;  1XI6 A;  3RPL B;  1XS5 A;  1KWH A;  3RTW B;  4G68 B;  4FAJ A;  2XA5 A;  4FOR A;  2FYI A;  5EHS A;  1DPE A;  3E78 A;  1MDP 1;  3QUF A;  3C35 A;  4NF6 B;  2Y84 A;  4FE8 A;  2DWJ A;  1DOT A;  3K1N A;  2QMW A;  3UOR A;  1IMA A;  2IA4 A;  3RN8 A;  5H8N B;  5CI5 A;  1BIY A;  1FPG A;  4IY6 A;  1LBC A;  1MXW A;  4XTC Q;  3IK6 B;  4PAF A;  4QF9 A;  5ICT A;  2HAU A;  3LUZ A;  1JEU A;  5K2X A;  4R6H A;  3DP6 A;  1B46 A;  1LAG E;  1FBF A;  3GXA A;  3VXC A;  4Z0I A;  3SET A;  4ZE9 A;  4KXP A;  3KBZ A;  2P2A A;  2ZNT A;  1M5C A;  3I5O A;  4MH5 A;  4QRZ A;  3TAJ A;  4WXJ A;  4OFL A;  1MG1 A;  1BLF A;  4NED A;  4U23 A;  4H45 A;  4NMY A;  4ONY A;  5DTB A;  3H6W A;  3TZA A;  2OK2 A;  1B52 A;  3C31 A;  3CR9 A;  4EXL A;  1MY2 A;  1JET A;  2ONR A;  1P1N A;  5AA1 A;  4IO6 A;  4R6K A;  1LBZ A;  3U72 A;  3L6G A;  5DEX A;  4PC9 A;  2UVJ A;  2O6A A;  4EQ9 A;  3EHU A;  4O94 A;  1B0H A;  2F5X A;  2Y7W A;  2HZK A;  3JYR A;  5CRY A;  3K01 A;  3KFM A;  4PGN A;  3O66 A;  2Q74 A;  2HAV A;  2WBB A;  1SBP A;  1MM7 A;  2VT5 A;  2QS3 A;  4NF8 A;  2DWA A;  3LR1 A;  3K6V A;  4KPT A;  3IJX B;  1NV2 A;  1B2H A;  2XXU A;  3N5L A;  4ZZE A;  1OLA A;  4XKP A;  1UTB B;  1B9J A;  1SDX A;  2HXR A;  2LAO A;  3VVF A;  3UP9 A;  4PDD A;  2Z22 A;  1DK4 A;  4BDR A;  1JW4 A;  3CI8 A;  3VDF A;  3FXR A;  5ESY A;  3H6T A;  4NF5 A;  5AA2 A;  3H6V A;  4NF5 B;  2V4C A;  5AA2 B;  4U4X A;  1N04 A;  3MW0 A;  1FPB A;  4P0I A;  1Y3P A;  4BDN A;  5ET6 A;  3FV2 A;  1B5H A;  2Y5L A;  3ZSF A;  1PC3 A;  4P56 A;  3P7I A;  5IZZ A;  4GOT A;  1ZKB A;  3PU5 A;  2UXA A;  4I3Y A;  4KYD A;  3RUM A;  1RKM A;  2X7Q A;  3DM0 A;  1MPB A;  4OMB A;  2RKM A;  1FSA A;  3O29 A;  3WAE A;  4NTL A;  1MY0 A;  5H8Q B;  4OWD A;  2ABH A;  3IFC A;  3FZV A;  4XXU A;  1IUD A;  3T9X B;  3A29 A;  3IOR A;  1NNT A;  1S9T A;  4POW A;  1FTO A;  4KHZ E;  4R9F A;  2Q89 A;  2O84 X;  1L5T A;  1LBY A;  4U2R A;  4F29 A;  1B40 A;  1AWB A;  1F9B A;  3FXU A;  1NKX A;  1NH8 A;  2GQ1 A;  1IME A;  3HPI A;  4KFQ A;  1FRP A;  1B51 A;  4GFR A;  5H8Q A;  4RPO A;  3MAM A;  3I6V A;  4F2O A;  1LEV A;  3VFJ A;  4NQ8 A;  2F6P A;  4LP2 B;  2I0C A;  3D1R A;  3TTL A;  3MZB A;  4H5F A;  1MDQ A;  3IO4 A;  3UK4 A;  3VLV A;  2CZI A;  4P0G A;  4ZDM A;  3UA8 A;  1FJ6 A;  3H4Z A;  1URG A;  4MNI A;  3O6G A;  3MZ1 A;  2P3N A;  2FA7 A;  3ODB A;  1M5E A;  3KN3 A;  4NF8 B;  5BWJ A;  4PCD A;  4GWO A;  3IL1 B;  5J1D A;  1NV3 A;  3PD8 A;  3GLB A;  4DI3 D;  1XT8 A;  4OEN A;  4Q30 B;  4HCY A;  3PMV A;  1IMD A;  4PFW A;  4ELO A;  4KR5 A;  4LZ7 A;  2F35 A;  4U4S A;  2QS1 A;  1MY1 A;  5EHM A;  1FQD A;  1Y4T A;  1EH3 A;  3MC2 A;  1A8E A;  3TCH A;  5DEX B;  1D9Q A;  2WEF A;  2ALU A;  1D9Y A;  3ZS6 A;  4FEB A;  3MP1 A;  1IMB A;  1B3L A;  2F3B A;  3T9H B;  4P47 A;  5FBP A;  5EYG A;  4YKP A;  4F18 A;  1YZ0 A;  4ELR A;  5AE4 A;  1B3H A;  2O1M A;  3S2V A;  1LBW A;  2D5W A;  2RC9 A;  4LQ2 A;  1DCU A;  5DVJ A;  4GXA A;  4KYS A;  2RCB A;  4BLA A;  3KN8 A;  5ET5 A;  2Z8E A;  5L9M A;  5L9O A;  2WBD A;  1S50 A;  3D4G A;  4N91 A;  4HE0 A;  1IIW A;  4TQU Q;  3H3G A;  1A54 A;  2F7C A;  2ZNU A;  3S4U A;  1Z7M E;  4X1B A;  1O7T A;  3B7D A;  1SVX B;  2XX7 A;  5A5X B;  1B1H A;  5I58 B;  1OLC A;  1XHY A;  3RPW A;  3VXB A;  2Q8M A;  3SER A;  2YJP A;  4P11 A;  5IZ3 A;  1POY 1;  1MQH A;  3E3K A;  3U94 A;  2V3T A;  3GBA A;  3RQT A;  3K00 A;  1POT A;  5HPQ A;  3MVX A;  2XWK A;  1II5 A;  3B6W A;  2DS9 A;  1US4 A;  2CEY A;  3TQL A;  1PB9 A;  4QFN A;  2XXP A;  1QUK A;  2WYP A;  4R2F A;  4DCX A;  3MVZ A;  1N3W A;  3IO6 A;  1YTV A;  4TLL B;  2THI A;  4PAK A;  3FVK A;  1I69 A;  1EZ9 A;  1LB8 A;  2GRV A;  5ITP A;  4UA8 A;  3C9H A;  5I2K A;  1UTH A;  1NI9 A;  3KZG A;  4ZEK A;  3UIF A;  4HW8 A;  4PE5 B;  3VLW A;  3K1P A;  1FCK A;  1B5I A;  3MQ9 A;  5JEI A;  3O6I A;  4ZEC A;  3ROJ A;  1SW1 A;  1QUJ A;  4HS7 A;  4PFU A;  2A5S A;  4NF6 A;  3Q26 A;  4ELP A;  3PTY A;  3B6Q A;  5I56 A;  4ZEF A;  4MX6 A;  3RYD A;  4GX3 A;  1MH3 A;  4G68 A;  4OQO A;  5DVF A;  3KC0 A;  1VE4 A;  4FIM A;  5KCJ A;  3EN3 A;  3C4M A;  5F7V A;  2R71 A;  1DSN A;  1NV1 A;  2XXK A;  4GWZ A;  4MBP A;  2F78 A;  4P9K A;  1HSJ A;  4R6Y A;  2M8C A;  2OWT A;  3RT6 B;  4UAB A;  2F6G A;  1B6H A;  3K4U A;  2PMS A;  4FBP A;  4U1O A;  3OO6 A;  1YCJ A;  1DBZ A;  1A7L A;  2FIX A;  3MPL A;  4IO3 A;  4FED A;  3FVN A;  4IR8 A;  3IR1 A;  3FD3 A;  5EYF A;  3OO8 A;  4PDH A;  3LV0 A;  3MBP A;  4KYE A;  1CE2 A;  4PBH A;  2L5V A;  2OLB A;  2B3B A;  3N6U A;  2GHB A;  4H0W A;  2NVU B;  5EQ7 A;  1IXG A;  2VGQ A;  3QXM A;  5KZT A;  4NE4 A;  4O7I A;  3FXQ A;  4MF3 A;  4QFO A;  3LBS A;  1Z7N E;  3HHF A;  2Q8J A;  1XVY A;  2I48 A;  1TFD A;  4PP0 A;  4KD5 A;  1FTL A;  2F36 A;  3T9U A;  2ESN A;  1MQJ A;  3HO7 A;  4IO4 A;  4MEV A;  5H8F A;  2G93 A;  4XKN A;  1UQW A;  5CMB A;  5AA2 D;  1DTG A;  3Q25 A;  2OBG A;  4ESW A;  1LAH E;  3C34 A;  5LTC A;  4P3L A;  2F3D A;  1INP A;  1LAF E;  5ET7 A;  5CBR A;  4P8B A;  1LCF A;  1SW4 A;  3CFL A;  5AA4 A;  1IMC A;  3TTK A;  4F39 A;  5IKB A;  1EZO A;  1QKA A;  1KA1 A;  2V3Q A;  3CRB A;  3TCG A;  2DQV A;  2XHD A;  2ZYN A;  4QXD A;  4JWO A;  4DXB A;  2PT1 A;  3K1M A;  3MUQ A;  1Y1Z A;  2P0S A;  3TOD A;  3CHG A;  2ONS A;  4PET A;  1USY E;  3VV5 A;  4MIJ A;  5EQA A;  3EHS A;  5TP9 B;  2QRY A;  3CIJ A;  4G8H A;  4R74 A;  5CM6 A;  4NX1 A;  3U92 A;  2I3V A;  1MY3 A;  3M3K A;  4DIG A;  3W9W A;  1B4H A;  2PBW A;  2B4L A;  3L6H A;  4KCC A;  1R9Q A;  4NF4 A;  1FQA A;  1AL3 A;  3SEU A;  2F7A A;  3PPO A;  2O68 A;  1R1N A;  1H45 A;  3R6U A;  2QPQ A;  2UVG A;  4I40 A;  4X1D A;  3VVD A;  5FHO A;  1KZ8 A;  3BIG A;  1IXH A;  3QSL A;  1JVX A;  1UIV A;  3OEK A;  4N8G A;  3B8B A;  4JSD A;  4I3E A;  4OER A;  1EZP A;  3C33 A;  3KC1 A;  5A5L A;  1ZLQ A;  1FPE A;  1NUY A;  3FVO A;  1GVC A;  1H76 A;  3OSR A;  2HEU A;  4EXK A;  3SEV A;  4ECF A;  3GYY A;  1J1N A;  4EQB A;  4NF0 A;  4YB7 A;  1NV7 A;  5I2N B;  4X8R A;  5KCJ B;  4I1D A;  1MRP A;  1ZBM A;  4AS5 A;  1SD3 A;  2XXY A;  3E4R A;  5B7D A;  4YMA A;  4HE1 A;  5TPA B;  4RK9 A;  1LFI A;  1D9V A;  2DSF A;  4H1X A;  4BDQ A;  5H8N A;  4YB5 A;  4QFK A;  3OD7 A;  1Y4C A;  3D4C A;  1TXF A;  4G61 A;  4X9T A;  1P1Q A;  4GX4 A;  1MQG A;  2P1S A;  4YIC A;  2QFL A;  4R75 A;  2H98 A;  1FPK A;  3SEY A;  4GL0 A;  2HQ0 A;  4IB2 A;  2QS4 A;  2ZYM A;  3MZ9 A;  4NHB A;  1FW0 A;  3O28 A;  3IAZ A;  2FVZ A;  1EYI A;  3OXN A;  4PFB A;  3CSB A;  3A3U A;  5IGA A;  3QIM A;  1A8F A;  2UYF A;  1USY H;  4OA4 A;  3ZKL A;  4GWY A;  3DEL B;  4G2Z A;  1ZJL A;  2CEX A;  3PPQ A;  4QSD A;  1P99 A;  2RCA A;  3FV1 A;  4OEU A;  3TMG A;  1CB6 A;  4RA1 A;  3R7X A;  2XWO A;  1A40 A;  3IB2 A;  1MH4 A;  3G3H A;  4HXV A;  4N6D A;  4JBZ A;  3TEP A;  4KI0 E;  3KJT A;  3RGY A;  1LBB A;  1NNK A;  5IZ1 A;  1FTA A;  4YKK A;  4NG7 A;  4I62 A;  1DPP A;  3CFZ A;  1TT1 A;  4OFJ A;  4QHQ A;  2ZNS A;  1Q35 A;  4PFI A;  1PB8 A;  2XX8 A;  2I49 A;  4O3C A;  2F34 A;  2I0B A;  4GBW A;  2OWS A;  2NXO A;  4R72 A;  1NFT A;  2DWH A;  3HHG A;  2PVU A;  4FEC A;  1ZMG A;  3VLU A;  1WOD A;  4MNP A;  2JJK A;  2XXH A;  1JEV A;  3E13 X;  5K2Y A;  4YAH X;  2OCU A;  1MXU A;  2R9J A;  2YPN A;  3R26 A;  2UVH A;  1LAX A;  3PUX E;  3M3F A;  5KDT A;  1B3G A;  4LQ5 A;  1G0I A;  2PFZ A;  4EUO A;  3UN6 A;  1NNP A;  2Q9T A;  1AIV A;  3K02 A;  1ANF A;  4OVP A;  5DT6 A;  3IJO B;  1BP5 A;  1O64 A;  3SKP A;  1CNQ A;  2RC8 A;  2AL5 A;  3W9V A;  4GWW A;  4GIZ A;  4DI4 B;  2XXX A;  2KR0 A;  1M5B A;  3N26 A;  2NWJ A;  2DXY A;  4RNS A;  3HV1 A;  2I3W A;  1NH7 A;  3TFL A;  3JZJ A;  1Y3N A;  1OMP A;  1LFG A;  4IGT A;  4IO5 A;  4RXL A;  2HXW A;  5IZ3 B;  3TTM A;  2FNC A;  3K0V A;  1GGG A;  3Q29 A;  2MKZ A;  3FJG A;  4O3A A;  3CG3 A;  4N17 A;  3H6U A;  3LSF B;  1FPF A;  3IOT A;  1N7X A;  4P1E A;  4NWC A;  4ZEI A;  1FTK A;  4WEP A;  4OFO A;  5DYH A;  1TFA A;  1N76 A;  1PBP A;  2H25 A;  4L17 A;  1T0K A;  4ZE8 A;  4NWD A;  1N0T A;  1Q1K A;  4LZ5 A;  3QAX A;  4XEQ A;  4HE2 A;  4LA9 A;  5JTY B;  1EU8 A;  1K9Z A;  3K2D A;  3TTR A;  5FHN A;  3T96 B;  4R9G A;  5I2K B;  4OHN A;  5I3S A;  3G7W A;  4O7M A;  4PBQ A;  2ZYK A;  4M1V A;  1GTK A;  3O97 A;  5BUU A; 
#chains in the Genus database with same CATH homology
 1IZ1 A;  1Z7N E;  5CMC A;  3HHF A;  4KPT A;  4X48 A;  3IJX B;  2Q8J A;  2XXT A;  1XVY A;  2I48 A;  3LSX A;  3OSQ A;  4LUB A;  4OET A;  1WDN A;  1OQG A;  1TFD A;  1B2H A;  4PFY A;  4WKM A;  5TP9 A;  4PP0 A;  2XXU A;  3N5L A;  4ZZE A;  1AMF A;  4UAC A;  1B3E A;  1FTL A;  2DWI A;  3M8U A;  4KD5 A;  2F36 A;  1M5D A;  3T9U A;  1QVS A;  2ESN A;  1MQJ A;  1MY4 A;  3HO7 A;  4ZZA A;  4G68 C;  4IO4 A;  5H8F A;  1OLA A;  2WKY A;  5I56 B;  4XKP A;  2G93 A;  3T9V A;  4XKN A;  4JDF A;  4F2Q A;  1H43 A;  1GR2 A;  1UTB B;  1UQW A;  2R6G E;  5CMB A;  2RC7 A;  4N13 A;  1B9J A;  3MP6 A;  5AA2 D;  1SDX A;  2LAO A;  3VVF A;  4DZ1 A;  1YPN A;  2DE2 A;  1XOC A;  1FQB A;  5CC2 A;  3OEN A;  3UP9 A;  1HSL A;  4Q8R A;  1LFH A;  3IB1 A;  5L8D A;  1DTG A;  1B7H A;  3Q25 A;  1JNF A;  2OBG A;  4ESW A;  2Z22 A;  5CMK A;  4U21 A;  1NL5 A;  4BDR A;  1N84 A;  3PUW E;  3PV0 E;  2B3F A;  1JW4 A;  1LAH E;  3CI8 A;  3KOS A;  5I59 A;  1O63 A;  3VDF A;  1ELJ A;  1MXX A;  3C34 A;  3TEL A;  4F1V A;  4H6D A;  3FXR A;  5I58 A;  5AA4 B;  1QKB A;  3H6T A;  5IAI A;  4H8I A;  4NF5 A;  5AA2 A;  1MXZ A;  5HM4 B;  3H6V A;  4DXU A;  2NOO A;  1LAF E;  5CMM A;  5CBR A;  1B5J A;  2OJT A;  1LCF A;  1VSO A;  4RY1 A;  2YLN A;  4NF5 B;  1SW4 A;  4Q5T A;  4AQ4 A;  3CFL A;  5AA2 B;  5AA4 A;  2GH9 A;  4QSE A;  1N04 A;  3K6X A;  4LAT A;  3AXF A;  4U4X A;  3TTK A;  1UIU A;  3G3G A;  3MW0 A;  4P0I A;  4F39 A;  5IKB A;  1Y3P A;  1MXV A;  1EZO A;  3V5A A;  5B70 A;  4BDN A;  2XD2 A;  2VP1 A;  1QKA A;  5H8S A;  1JW5 A;  4DE8 A;  2V3Q A;  3CRB A;  4POX A;  3TCG A;  3PPR A;  5LOM A;  1ZIU A;  3FV2 A;  4U22 A;  4OYV A;  1Y9U A;  3LSW A;  1AH5 A;  1B5H A;  1D3K A;  2DQV A;  2DP8 A;  3TCF A;  3ZSF A;  1PC3 A;  1VFD A;  4F3S A;  2XHD A;  2O69 A;  2ZYN A;  3P7I A;  3PUY E;  4JB7 A;  3G3F A;  2QL3 A;  3PMX A;  3H06 B;  4GOT A;  3TPA A;  4F31 B;  1ZKB A;  4JWO A;  4G8N A;  3PU5 A;  3TTN A;  2UXA A;  1UTB A;  4DXB A;  2PT1 A;  3F11 A;  3K1M A;  3QYT A;  3MUQ A;  1H44 A;  1Y1Z A;  2P0S A;  3HCQ A;  4KYD A;  3RUM A;  3TOD A;  4XKR A;  2ONS A;  1RKM A;  3OEM A;  4PET A;  1USY E;  4YZZ A;  3VV5 A;  2X7Q A;  3DM0 A;  1MPB A;  2UVI A;  2ZYO A;  3EHS A;  2E0S A;  4GF8 A;  4GL8 A;  4MLQ A;  4OMB A;  5TP9 B;  2QRY A;  3CIJ A;  3GZG A;  3OMB A;  2RKM A;  4RPN A;  4G8H A;  4R74 A;  5FTI A;  4DLD A;  3PUZ E;  3O29 A;  3S9N C;  4OEV A;  3A09 A;  3WAE A;  3S9M C;  2O7U A;  3ILU B;  4NTL A;  1MY0 A;  4MLV A;  5H8Q B;  3OO9 A;  4F1U A;  3B6T A;  5FTH A;  4OWD A;  3KJ7 A;  2ABH A;  5CM6 A;  2I6E A;  3DP8 A;  3E9X A;  3U92 A;  2I3V A;  2PYY A;  1MY3 A;  3M3K A;  4DIG A;  3FZV A;  3EQ1 A;  3W9W A;  4XXU A;  4RK2 A;  1IUD A;  1B4H A;  2PBW A;  3T9X B;  4I8C A;  3RQT A;  3L6H A;  1Y1M A;  4KCC A;  3T66 A;  5I57 B;  1R9Q A;  4NF4 A;  1FQA A;  1AL3 A;  1UTH B;  4G77 A;  4QFP A;  4ZS9 A;  3IOR A;  1NNT A;  1S9T A;  1OVT A;  3SEU A;  2F7A A;  3PPO A;  5H8H B;  5BUU A;  4I9D A;  1B3F A;  3OEL A;  1YAE A;  2O68 A;  1R1N A;  2AIX A;  4LVQ A;  3S9L C;  1H45 A;  3KEI A;  2Z8D A;  3R6U A;  3LUY A;  2QPQ A;  1B7Z A;  3RTF B;  4POW A;  1FTO A;  1B58 A;  2O7I A;  2UVG A;  4KHZ E;  2Y7I A;  4R9F A;  4X1D A;  4H67 A;  3VVD A;  5FHO A;  2Q89 A;  1OVB A;  2I4B A;  1IXH A;  2O84 X;  1JVX A;  2ZMB A;  2H9B A;  1FTJ A;  3FJM A;  2RIN A;  1US5 A;  1UIV A;  3QSL A;  1L5T A;  4C0R A;  1PDA A;  4ESX A;  3S9E A;  3OEK A;  3RNN A;  2G29 A;  2GHA A;  4JSD A;  1SYI A;  4U2R A;  4OER A;  4EF1 A;  4F29 A;  1B40 A;  3C33 A;  1EZP A;  3IOU A;  1F9B A;  3FXU A;  5JK4 A;  1PB7 A;  2E1S A;  1NKX A;  2B65 A;  4E0W A;  4FJP A;  1NH8 A;  1ZLQ A;  4N6P A;  3HPI A;  1HSE A;  1LGB C;  2IEE A;  2O1L A;  2Y7P A;  3EHT A;  3FVO A;  4GQO A;  1SI0 A;  4KFQ A;  5FHM A;  1I6Q A;  4F3G A;  1B51 A;  2QJE A;  4GFR A;  1GVC A;  5H8Q A;  5I59 B;  1H76 A;  2KLF A;  3OSR A;  2HEU A;  2DOJ A;  3MAM A;  4RPO A;  1NNF A;  3I6V A;  4F2O A;  4EXK A;  3VFJ A;  2V25 A;  3SEV A;  1IEJ A;  4ECF A;  3RY3 A;  2RF1 A;  3SDF A;  1J1N A;  2F6P A;  2I0C A;  3FJ7 A;  2Q2C A;  3KOT A;  2VHA A;  4LP2 B;  1JW1 A;  3MZB A;  1PBQ A;  2CMO A;  2NUV A;  4H5F A;  4PQJ A;  4OES A;  4EQB A;  2VD3 A;  1MDQ A;  3IO4 A;  3UK4 A;  4YB7 A;  3VLV A;  3RLF E;  5I2N B;  4P0G A;  4ZDM A;  2H5Y A;  3UA8 A;  2D3I A;  4RJZ A;  3LSL A;  5KCJ B;  3H4Z A;  4I1D A;  4DDD A;  2Q88 A;  4WED A;  1MRP A;  3O9P A;  2QS2 A;  3O6H A;  1URG A;  1ZBM A;  4GVO A;  5A5X A;  3MPK A;  3VE1 B;  4ZED A;  3FUZ A;  2XX9 A;  3O6G A;  3MZ1 A;  1SD3 A;  2XXY A;  3E4R A;  1N3X A;  3MVY A;  4OTE A;  3THI A;  3DP4 A;  3N94 A;  4YB6 A;  3HN0 A;  2FA7 A;  3ODB A;  5B7D A;  3IOW A;  4F3B A;  1M5E A;  2PX1 A;  4YMA A;  1OIB A;  2REJ A;  3KN3 A;  4NF8 B;  5TPA B;  3FIR A;  5BWJ A;  2XXW A;  4RK9 A;  1LFI A;  4GWO A;  3EPE A;  1D9V A;  2DSF A;  4H1X A;  1P1O A;  1BTJ A;  3KN7 A;  3KGC A;  3TQW A;  3I3V A;  4BDQ A;  3IL1 B;  5H8N A;  1IIT A;  2AL4 A;  5J1D A;  4YB5 A;  4QFK A;  3OD7 A;  4M4G A;  3PD8 A;  4EF2 A;  1Y4C A;  3GLB A;  3D4C A;  3ONM A;  1TXF A;  3M3L A;  4X9T A;  5M2V A;  3PMW A;  1P1Q A;  1QW0 A;  4G4P A;  1XT8 A;  2ZXT A;  3G3J A;  4OEN A;  4Q30 B;  1MS7 A;  1MQG A;  2GFE A;  3PMV A;  4HCY A;  4PFW A;  4YKI A;  1M5F A;  2P1S A;  2X7P A;  4ELO A;  2ANJ A;  3MP8 A;  4YIC A;  2DE4 A;  4KR5 A;  4F22 A;  4LZ7 A;  2F35 A;  4R75 A;  4U4S A;  1MM6 A;  2H98 A;  2QS1 A;  3CG1 A;  1MY1 A;  3Q27 A;  3SEY A;  5EHM A;  2W7Y A;  2AYS A;  1FQD A;  1Y4T A;  1EH3 A;  2BJJ X;  2O51 A;  1URS A;  2Y7R A;  3ILT B;  3MC2 A;  4GL0 A;  4OZ9 A;  3FGS A;  3PPN A;  1A8E A;  2HQ0 A;  4IB2 A;  5H8H A;  3TCH A;  1LB9 A;  2QS4 A;  2ZYM A;  5DEX B;  4F3P A;  1FQE A;  2ALU A;  2DE3 A;  1D9Y A;  2H99 A;  3MZ9 A;  3ZS6 A;  5I57 A;  4FEB A;  1NMU A;  3PUV E;  2F8D A;  3MP1 A;  4AB5 A;  1FW0 A;  1B3L A;  2XXV A;  3IAZ A;  3O28 A;  3T9H B;  3TYH A;  1URD A;  1MXY A;  4KQP A;  1SW2 A;  1BKA A;  3OXN A;  2VOZ A;  3O2A A;  1T0K A;  3V83 A;  4Q0C A;  1XC1 A;  1SI1 A;  4YKP A;  4F18 A;  1FTM A;  3CSB A;  3MVW A;  2OZZ A;  3A3U A;  4YKJ A;  3FVG A;  3TDJ A;  1S7Y A;  4GRK A;  4ELR A;  5AE4 A;  1B3H A;  2O1M A;  2Y7K A;  3QIM A;  1IXC A;  3S2V A;  5F1Q A;  1AOV A;  3KSX A;  1Y20 A;  1A8F A;  1DTZ A;  2D5W A;  2UYF A;  4EQ7 A;  1WVJ A;  2RC9 A;  1LCT A;  1QUI A;  1USY H;  2REG A;  3C36 A;  4LQ2 A;  5DVJ A;  2QSX A;  3ZKL A;  4GXA A;  4KYS A;  2DVZ A;  2RCB A;  2CZL A;  3DEL B;  4BLA A;  5ELV A;  4G2Z A;  1DMB A;  1ZJL A;  2HCA A;  2ONK E;  3PPQ A;  4IO7 A;  4QSD A;  3KN8 A;  4GLI A;  3JV9 A;  2Z8E A;  5L9M A;  5L9O A;  4FAT A;  4OXV A;  1S50 A;  3BBR A;  2HFB A;  1B32 A;  1IXI A;  5ICQ A;  4PFT A;  5I84 A;  1P99 A;  4C1T A;  2RCA A;  4F19 A;  2I58 A;  2Q2A A;  3D4G A;  1VR5 A;  3FV1 A;  4OEU A;  5JTY A;  3TMG A;  3DLN A;  3FAS A;  1CB6 A;  1MPD A;  3H03 A;  5TPA A;  1IIW A;  1GV8 A;  2XD3 A;  1SQY A;  4ZEB A;  4RA1 A;  4TQU Q;  1B7U A;  1Y3Q A;  3H3G A;  3GBB A;  1FQF A;  3R7X A;  1A54 A;  2QMX A;  2F7C A;  1A40 A;  3N6T A;  5CBS A;  5ISU A;  2D21 A;  2ZNU A;  4DCY A;  3IB2 A;  1MH4 A;  3S4U A;  3G3H A;  1Z7M E;  4X1B A;  1O7T A;  4THI A;  4TOZ A;  4JBZ A;  3B7D A;  1SVX B;  2XX7 A;  5A5X B;  3TUS A;  3T93 B;  3TEP A;  4KI0 E;  4F1Y A;  2DXR A;  3KJT A;  3RGY A;  1B1H A;  5I58 B;  1OLC A;  4ND9 A;  1LBB A;  2DYX A;  4YU0 A;  4Z7E A;  1I6B A;  1NNK A;  1D4N A;  1RYO A;  3UGW A;  2A5T B;  4BDM A;  4IO2 A;  3SES A;  4JWY A;  1XHY A;  4YKK A;  3RPW A;  3VXB A;  2V3U A;  4K3F A;  4I62 A;  4O3C A;  1DPP A;  3CFZ A;  4RYA A;  5HBC A;  3USD A;  1TT1 A;  3SER A;  4E0X A;  2YJP A;  1XVX A;  1N7W A;  1JQF A;  1P1U A;  4OFJ A;  4QHQ A;  4P11 A;  2ZNS A;  4N07 A;  1Q35 A;  3FAT A;  3RT8 A;  3T22 A;  4BDO A;  1ZTY A;  1B1X A;  4XIG Q;  1LLS A;  1IQ7 A;  1PB8 A;  1POY 1;  1A55 A;  1MQH A;  3E3K A;  2XX8 A;  4ISU A;  3U94 A;  3C32 A;  2Z8F A;  3ZKK A;  2I49 A;  2F34 A;  2V3T A;  3GBA A;  2VD2 A;  2I0B A;  2OWS A;  3K00 A;  3PPP A;  2NXO A;  1VFE A;  1I6A A;  1NFT A;  1POT A;  4JXI A;  2DWH A;  4R73 A;  4R72 A;  4QFL A;  3H7M A;  5H8F B;  5HPQ A;  3MVX A;  4H5G A;  2V84 A;  1R6Z A;  1II5 A;  3B6W A;  2DS9 A;  4GXS B;  1US4 A;  1JVY A;  3IX1 A;  3BFU A;  3HHG A;  3EF7 A;  5TU0 A;  3TQL A;  1XS5 A;  2PVU A;  1PB9 A;  1KWH A;  2V93 A;  2XXP A;  4QFN A;  3RTW B;  1QUK A;  4FEC A;  4G8M A;  1RYX A;  4LON B;  4R2F A;  4DCX A;  3MVZ A;  3HST A;  1N3W A;  1ZMG A;  4G68 B;  4JSO A;  3IO6 A;  4FAJ A;  3A3C A;  4ELQ A;  1SYH A;  5L9S A;  1YTV A;  3VLU A;  1WOD A;  4TLL B;  2THI A;  1QUL A;  4FOR A;  2FYI A;  3FVK A;  5EHS A;  1DPE A;  2F97 A;  2XXH A;  1JEV A;  3PGF A;  4H8J A;  3E13 X;  1I69 A;  1MDP 1;  3QUF A;  1EZ9 A;  3C35 A;  4NF6 B;  1LB8 A;  3CFX A;  4YAH X;  3TTL A;  5AA3 A;  1ZU0 A;  2Y84 A;  4FE8 A;  2DWJ A;  2GRV A;  5ITP A;  2OCU A;  3C9H A;  4UA8 A;  4R2B A;  1DOT A;  3K1N A;  1H3D A;  1MXU A;  2QMW A;  3UOR A;  2R9J A;  2YPN A;  3R26 A;  3V8X B;  4C1U A;  5I2K A;  1UTH A;  2UVH A;  1LAX A;  3U1O A;  3KZG A;  4ZEK A;  3UIF A;  2IA4 A;  4QSC A;  3RN8 A;  5H8N B;  3PUX E;  4HW8 A;  5CI5 A;  4PE5 B;  1BIY A;  1MQD A;  3M3F A;  5KDT A;  3VLW A;  1P1W A;  1B3G A;  4IY6 A;  4LQ5 A;  3TKD A;  1LBC A;  4EUO A;  3G3K A;  3UN6 A;  3K1P A;  1MXW A;  2X26 A;  4MFI A;  4XTC Q;  1NNP A;  1FCK A;  3IK6 B;  2Q9T A;  4QF9 A;  3U8Q A;  5ICT A;  1B5I A;  2XXQ A;  4XKQ A;  2HAU A;  1AIV A;  5KDT B;  2UYE A;  3MQ9 A;  4KCD A;  3BKI B;  5JEI A;  3O6I A;  4ZEC A;  2A5T A;  3ECR A;  1SW1 A;  4H65 A;  1QUJ A;  3K02 A;  4HS7 A;  4PFU A;  1ANF A;  2PT2 A;  1JEU A;  5K2X A;  5K2Y A;  2A5S A;  4NF6 A;  3IJO B;  3DP6 A;  4R6H A;  5DT6 A;  3SEW A;  1B46 A;  3Q26 A;  1BP5 A;  1LAG E;  3GXA A;  1O64 A;  3SKP A;  3VXC A;  4ELP A;  3B6Q A;  3G3I A;  4Z0I A;  1B4Z A;  2RC8 A;  5DVI A;  3KSJ A;  4ZEF A;  5I56 A;  2AL5 A;  3SET A;  3W9V A;  4ZE9 A;  1MH3 A;  1PEB A;  3QUJ A;  4G68 A;  4GIZ A;  2P2A A;  2ZNT A;  2XXX A;  4HTG A;  4OQO A;  1MQI A;  2F7B A;  1TWY A;  1M5B A;  4OVJ A;  1M5C A;  5DVF A;  3N26 A;  1VE4 A;  3I5O A;  2NWJ A;  4MH5 A;  4QRZ A;  3OOA A;  3TAJ A;  4FIM A;  3V89 B;  2DXY A;  5KCJ A;  4WXJ A;  3EN3 A;  3MWB A;  3C4M A;  4IY5 A;  4RNS A;  4OFL A;  3WAF A;  4BDL A;  3HV1 A;  2I3W A;  5I2N A;  5F7V A;  1NH7 A;  2R71 A;  1DSN A;  3MJN A;  3TFL A;  3JZJ A;  1Y3N A;  4AB6 A;  1MG1 A;  1BLF A;  4NED A;  4U23 A;  3W15 C;  1B0L A;  1OMP A;  3CSG A;  1LFG A;  4IGT A;  4IGR A;  3SEX A;  4IO5 A;  4MBP A;  4RXL A;  2HXW A;  4NMY A;  2F78 A;  4U1Z A;  4ONY A;  2FNC A;  1FQC A;  3K0V A;  3KG2 A;  5DTB A;  3TTM A;  1GGG A;  3Q29 A;  1HSJ A;  3FJG A;  3H6W A;  4O3A A;  2DVC A;  3CG3 A;  4R6Y A;  3TZA A;  2OK2 A;  4YMB A;  3H6U A;  2M8C A;  2OWT A;  1B52 A;  3BFT A;  3C31 A;  3CR9 A;  3LSF B;  3U93 A;  3IOT A;  1N7X A;  1MY2 A;  3IOV A;  4EXL A;  3RT6 B;  1JET A;  4NWC A;  2ONR A;  2F6G A;  4ZEI A;  1FTK A;  3QK6 A;  4WEP A;  1OQH A;  1B6H A;  2I4C A;  4OFO A;  3K4U A;  2PMS A;  1P1N A;  5DYH A;  3K6U A;  4HCW A;  5AA1 A;  1TFA A;  4U1O A;  4DXC A;  1N76 A;  1A99 A;  1PBP A;  2HZL A;  3K6W A;  3OO6 A;  1YCJ A;  4IO6 A;  2H25 A;  3OO7 A;  1A7L A;  4R6K A;  4L17 A;  3U72 A;  3L6G A;  1R9L A;  4JWX A;  3MPL A;  4GD5 A;  4IO3 A;  2UVJ A;  5DEX A;  2O6A A;  4FED A;  3EHU A;  4ZE8 A;  4EQ9 A;  1ATG A;  4NWD A;  1N0T A;  3FVN A;  1Q1K A;  4LZ5 A;  2XXR A;  2XXI A;  3IR1 A;  3QAX A;  4TLM B;  3FD3 A;  4LA9 A;  1B0H A;  2H4I A;  1QJM A;  3LC8 A;  3OO8 A;  5EYF A;  5JTY B;  1EU8 A;  3K2D A;  3TTR A;  2F5X A;  2Y7W A;  5FHN A;  2HZK A;  2Z23 A;  3JYR A;  5CRY A;  3MBP A;  1SW5 A;  3K01 A;  3KFM A;  3T96 B;  4KYE A;  1CE2 A;  4R9G A;  1MPC A;  3O66 A;  5I2K B;  4OHN A;  2HAV A;  4EDP A;  2OLB A;  3G7W A;  1SBP A;  1MM7 A;  4NF4 B;  3Q28 A;  2B3B A;  3N6U A;  4LZ8 A;  2GHB A;  4H0W A;  1B05 A;  2NVU B;  1LST A;  2ZYK A;  3VVE A;  3KBR A;  1IXG A;  2VGQ A;  3QXM A;  4M1V A;  4O3B A;  5KZT A;  1GTK A;  3O97 A;  4NE4 A;  3CVG A;  3FXQ A;  2QS3 A;  4NF8 A;  3PD9 A;  4MF3 A;  2DWA A;  3LR1 A;  4QFO A;  3IB0 A;  3LBS A;  3K6V A;  5ITO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...