3SERA

Zn-mediated polymer of maltose-binding protein k26h/k30h by synthetic symmetrization
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGHKFEHDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
total genus 116
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3serA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3serA01
3UGWA 4EUOA 4QRZA 2ZNTA 3CSBA 5I56B 4U22A 3CG3A 3FIRA 3K4UA 2Y7PA 4MBPA 1QKAA 2RF1A 1A40A 3VVDA 2DE4A 4JXIA 1B0LA 2V84A 3OO9A 2I58A 4H8IA 3K2DA 3TODA 3K01A 3S2VA 3G3FA 4F18A 2Q9TA 3IB0A 3CI8A 4G8HA 3U93A 3IK6B 4ZE8A 2NOOA 5DVJA 3V89B 2GFEA 1XVXA 4M1VA 5HM4B 4DLDA 3IORA 3V83A 4G68A 1MQGA 5CM6A 3QIMA 4NF5B 4YU0A 3DLNA 1MY2A 3KBRA 1H3DA 2XHDA 4DCYA 5AA4B 3U8QA 3AXFA 4YB7A 3TQLA 3IJXB 4F31B 1IXHA 3FXUA 4BDRA 3F11A 3MQ9A 3T66A 2V25A 3S4UA 4OFOA 1LLSA 5A5XA 3RLFE 4U4XA 5I2KB 4LQ2A 2I4BA 1P1NA 2O51A 3O6HA 4Q5TA 4EQ9A 1IQ7A 1S9TA 2ZYOA 2FYIA 4F1UA 4ZEBA 3I3VA 3DP8A 2OZZA 1EH3A 3RNNA 4GF8A 3U1OA 1NNFA 3O9PA 5FHMA 1TFAA 2XXHA 4EQ7A 5IAIA 3PMVA 3H6WA 2PMSA 2DWHA 3O6GA 1MRPA 3FXRA 2RC7A 1H45A 4F1YA 3O29A 2ANJA 3FZVA 2A5SA 3FJMA 3V8XB 1OQGA 1VSOA 3W9WA 4K3FA 1OVBA 3TUSA 3I6VA 1PBQA 2Y84A 4YMAA 3R7XA 5FHNA 2UXAA 1LCTA 1B5JA 2ZNSA 4U23A 3S9NC 4QSDA 1MY3A 4WEPA 1B1HA 5TPAA 5H8NA 3E9XA 1JW1A 2KLFA 3SEXA 3HN0A 1D9VA 3PPPA 2DS9A 3RN8A 1EZ9A 3HHFA 1LFHA 4PFUA 5M2VA 4ONYA 3TQWA 2XXQA 4I8CA 4R75A 3FV2A 2YPNA 2RKMA 4G68C 4OESA 4XIGQ 3O66A 3LUYA 1PB8A 2O7UA 2CMOA 4HS7A 3H3GA 3PUXE 4FIMA 4R73A 3KOTA 2D5WA 4QFPA 3BKIB 4LZ7A 1B1XA 5KZTA 1MXWA 3KFMA 1LBCA 5AA2A 3KZGA 3PUVE 4DIGA 2F78A 1UIVA 3ILUB 5L9SA 1NKXA 2F6PA 1GR2A 1CE2A 2NWJA 2NXOA 2R9JA 2ZXTA 4MLVA 4XKRA 5BWJA 3EHSA 1YPNA 4QSCA 2H5YA 3VXBA 4LZ5A 4EDPA 5ICQA 3JZJA 1B0HA 5CC2A 2ALUA 3TMGA 2Q8JA 3U72A 3FD3A 3K02A 4RA1A 3SEWA 3RQTA 4NF8A 4F3GA 5KDTA 4R6HA 3G3JA 1B52A 1S7YA 1PEBA 1IITA 5L9MA 3KJ7A 2GH9A 1ELJA 1AOVA 4QFOA 5AA1A 3Q29A 1MQJA 1OLAA 3EHTA 3GBAA 5TP9B 2LAOA 3K1MA 3IR1A 1P1UA 3D4GA 3UORA 3KJTA 2ZYKA 3E13X 3QUJA 2VOZA 2VD2A 4ND9A 4NF6A 4OMBA 2OK2A 1B7HA 4KI0E 1SI0A 4U1OA 1B7ZA 1A7LA 1L5TA 2Y7IA 1FQBA 3CRBA 2F35A 4LA9A 3G7WA 5I58A 3G3GA 3MJNA 1IUDA 3FJ7A 3UK4A 3L6GA 4RYAA 3OELA 4LQ5A 3OXNA 3U94A 3H7MA 4AQ4A 1UQWA 1MH4A 3MC2A 4H65A 1ATGA 1MY0A 3S9EA 2IEEA 3IL1B 1FQEA 3LSFB 1FTKA 4WEDA 4FE8A 2RCAA 4GVOA 4QFLA 1IXIA 3CIJA 2A5TA 3OSQA 2DWIA 4YMBA 2QS1A 2O7IA 3IOTA 2PT1A 1QUJA 5I57A 3OMBA 4H6DA 3PV0E 3KEIA 3K1NA 2XXVA 3VLVA 2ZYMA 4IGRA 3U92A 1P1OA 4X1BA 4G68B 3QAXA 4THIA 4PQJA 4GL8A 1JQFA 1SI1A 4JWXA 5HPQA 1JVYA 5AE4A 3FVKA 3IJOB 5DTBA 3TKDA 1P1QA 1GTKA 3DP6A 1LBBA 1YTVA 4U4SA 3TTMA 1JVXA 1B3HA 1NFTA 5A5XB 2G93A 4AB6A 3N26A 1TT1A 1MH3A 2VP1A 4DXBA 4XTCQ 1N76A 4FECA 5CMMA 2F8DA 1SD3A 1JNFA 1A55A 2O69A 4ZS9A 5I59A 4G77A 4PP0A 4NMYA 5EHSA 2X7QA 3PPOA 4BDLA 1BP5A 4ZDMA 1M5FA 4X48A 4OEVA 3IB1A 3SEUA 3S9LC 1FTOA 3O28A 3PD8A 1DMBA 1QULA 3WAFA 1FTLA 2GRVA 4NEDA 2XXWA 3DM0A 1ZKBA 2H25A 3TTLA 3WAEA 4EF2A 4C1UA 3QSLA 2HXWA 1LAFE 3C34A 3TELA 2PVUA 4R6YA 3H6UA 2Z23A 4IO4A 3PD9A 5JK4A 1H43A 4H0WA 4QHQA 2RCBA 2HFBA 1ZBMA 3ODBA 1SW1A 5TPAB 3PGFA 3DELB 5H8NB 2NUVA 1A8FA 1LFGA 4IY5A 3P7IA 4HCWA 1UTHA 2FNCA 3ILTB 3Q27A 3MP6A 4IO7A 3IX1A 3EQ1A 3E4RA 4F1VA 2DE3A 1DTZA 2OWTA 3OO8A 3RUMA 1ZIUA 4KQPA 3T9VA 2DWJA 1US5A 1DPPA 2PBWA 1VFDA 1UIUA 5DEXA 4Z0IA 3OD7A 3SDFA 4XKPA 3ZKLA 3C31A 3LR1A 4XKNA 5DYHA 3KG2A 2HAUA 5H8HA 4R9GA 2OLBA 2DE2A 4O3BA 3VV5A 4H8JA 3VVEA 4QFKA 2X7PA 4YKJA 2DYXA 3PUYE 4ZEDA 5AA2B 1B5IA 3THIA 5H8FA 2F6GA 5EYFA 3QXMA 3TTRA 3A3CA 1OMPA 4R2BA 3TCGA 2FA7A 2DP8A 3TEPA 3LSWA 4FATA 4L17A 4U2RA 5JTYA 1US4A 1B9JA 4DZ1A 3RTFB 1URSA 1NH8A 1Y1ZA 4R72A 3V5AA 1AIVA 3KGCA 4BDQA 2UVIA 2ONRA 1MXUA 5CMBA 4C1TA 4U1ZA 1Y20A 4GWOA 2I0CA 4R9FA 3I5OA 1A99A 2XD2A 5ITPA 4NF4B 4X9TA 4ISUA 2Z8FA 1MM7A 1GV8A 1I69A 3MP1A 2Q2AA 5TU0A 4KCCA 3S9MC 2F36A 4OHNA 1O64A 5FTIA 1SDXA 3T96B 5I2NA 1ANFA 4KFQA 3RT8A 1PBPA 4G2ZA 1EU8A 4NF6B 1R1NA 2O6AA 2OJTA 3USDA 3MVZA 3MVYA 3IOUA 3CG1A 1II5A 1XVYA 2XXYA 1B58A 3O6IA 4WXJA 5L8DA 1B3FA 1EZPA 2AL5A 5I56A 1Y3QA 5I58B 5KCJA 2ONKE 4Q30B 5ITOA 3ZKKA 3C32A 5FHOA 4F3BA 2UVHA 1MM6A 5I84A 3PMXA 3K6VA 3SKPA 4POXA 2HZLA 3CVGA 4R74A 1QJMA 1J1NA 4HTGA 4BDNA 3BFTA 1POY1 4OEUA 2OWSA 4FJPA 2F97A 3RT6B 1D4NA 3N94A 3R26A 5L9OA 1Q35A 2A5TB 2XXRA 3PU5A 1Y3PA 2R71A 2V3TA 2XX8A 3SETA 4E0WA 1DPEA 3MP8A 4NF5A 4GOTA 2Q88A 5DVFA 3KSXA 4R6KA 4P0IA 1LSTA 4OERA 4I1DA 4RPNA 4OETA 4LZ8A 3HO7A 1BLFA 5AA3A 2HZKA 1EZOA 2DXRA 3G3HA 1P99A 2ZMBA 4PFYA 2QMWA 4ELPA 3T9XB 3TTNA 1B7UA 1P1WA 5BUUA 1Z7ME 1SW4A 2O68A 3MPLA 3MZ9A 4KD5A 1ZLQA 4ELRA 4ESWA 4P11A 3UP9A 4F29A 3OSRA 1B32A 3B7DA 3OO6A 3OO7A 1JW5A 2NVUB 3VXCA 1MQDA 4OWDA 4QF9A 1Y3NA 1M5DA 1S50A 2AL4A 4RK2A 2HEUA 3E3KA 1USYE 2H4IA 1RYOA 1WODA 4YICA 3ZSFA 2REGA 4NWCA 1M5BA 3MVWA 1MXXA 1QW0A 5J1DA 3LSXA 1TWYA 1PB7A 2GHAA 3M3LA 2RC8A 1Y4CA 1FQAA 2THIA 1HSEA 2YJPA 4WKMA 4QFNA 4ZEFA 2DVZA 1POTA 1Z7NE 3RGYA 4OFLA 3K0VA 3LBSA 5ISUA 2QRYA 5CI5A 1JETA 2F5XA 4ZZAA 4ZEIA 4OTEA 2H98A 1BKAA 4JSOA 5H8QA 1GGGA 3OEKA 1LB9A 4BDMA 1B3LA 2HAVA 2E1SA 2I0BA 3MAMA 3FJGA 4RNSA 5K2YA 2WKYA 1MS7A 3UIFA 4HCYA 2ZNUA 1MPCA 2OCUA 4ELQA 5AA2D 1Q1KA 2G29A 1JW4A 2BJJX 4M4GA 2UYFA 1SYHA 2I3VA 4GXAA 3JV9A 5B70A 2Z22A 2CZLA 1LAHE 4ZEKA 1SQYA 1VR5A 1VE4A 5K2XA 4N6PA 3T9UA 4OENA 5H8HB 3IO4A 3HHGA 4YKPA 1LFIA 1MXZA 3KSJA 1N3WA 1B3EA 3K6XA 3M3KA 1O7TA 3K1PA 3SEVA 1B5HA 4TLMB 2Z8DA 3FV1A 3H03A 5H8FB 5CBSA 2P0SA 4TOZA 4F2OA 3FATA 3MUQA 4G4PA 3CSGA 1VFEA 4PE5B 3FUZA 5JTYB 4YB6A 2RINA 2D21A 1FTMA 3HCQA 4LUBA 1URDA 2RC9A 1RKMA 4Q0CA 1PDAA 1FQCA 3TCFA 1NNKA 3CFLA 4EXLA 3H6TA 2V3QA 1N7WA 3T22A 4FORA 3A09A 1QUKA 2DVCA 3OENA 4OQOA 4N13A 1R9LA 4KPTA 4UACA 1MDP1 4POWA 2HCAA 3PMWA 3MW0A 1OIBA 3JYRA 4G8MA 4JSDA 2XXXA 3MBPA 2V93A 3TCHA 1JEVA 3PUZE 3LC8A 2Q89A 3KN7A 1AL3A 4TLLB 2UYEA 5I2NB 2XXTA 2R6GE 3SESA 4LP2B 4JDFA 4PETA 2P1SA 5LOMA 1Y9UA 1PC3A 4I9DA 1PB9A 3ECRA 5FTHA 5CMKA 4U21A 2I3WA 3VLWA 1QKBA 1N84A 2QS4A 2XX7A 1LAXA 1MXVA 4MLQA 5KCJB 1N04A 3TFLA 3L6HA 3MWBA 1D3KA 4TQUQ 1B4ZA 4OXVA 3ZS6A 1FCKA 2Y7KA 3SERA 2X26A 5H8SA 2XD3A 3TTKA 3EHUA 1IZ1A 3G3KA 3ONMA 3IO6A 4KYDA 1LAGE 2I4CA 1KWHA 4RY1A 3GBBA 2HQ0A 3CR9A 4AB5A 4GXSB 4ELOA 1SVXB 1R9QA 3W9VA 3FASA 2DOJA 1LGBC 2DQVA 2Z8EA 4R2FA 1NNPA 2XXPA 4IY6A 4JWYA 1H76A 1GVCA 3IOVA 5EHMA 2ONSA 5IKBA 4RJZA 4F3SA 1N0TA 5CMCA 5HBCA 3UA8A 3M3FA 4N07A 1FQDA 1NNTA 3B6QA 1DSNA 3H6VA 1N7XA 1WVJA 3C35A 4PFWA 1SW2A 1OVTA 4DXCA 1MY1A 3QUFA 1BTJA 3QK6A 2Y7WA 1USYH 1SYIA 2PT2A 3FVOA 4DCXA 5DVIA 2QS2A 1URGA 3MVXA 3FXQA 2F34A 3K00A 4NF8B 3MPKA 1IXCA 3KN3A 4PFTA 3MZ1A 5KDTB 1FQFA 1IXGA 1WDNA 2YLNA 3OEMA 3HSTA 2DSFA 3K6WA 1B4HA 4IGTA 1MQIA 2E0SA 4UA8A 3GLBA 3SEYA 4LATA 1B51A 1ZU0A 2F7BA 5B7DA 2VD3A 1TXFA 3N5LA 1UTBA 3LSLA 2VHAA 1XS5A 3BBRA 5F1QA 4OVJA 1QUIA 3B6TA 3TPAA 1SW5A 2UVJA 1B3GA 3H06B 3HV1A 3B6WA 3N6TA 1SBPA 3IB2A 4P0GA 1AMFA 1JEUA 5H8QB 4O3CA 1XC1A 3CFZA 2F7CA 3W15C 4EXKA 2H9BA 1ZJLA 5ELVA 2GHBA 1B46A 3PUWE 4GIZA 3G3IA 1FW0A 3OOAA 1CB6A 2F7AA 4JBZA 1XHYA 1IIWA 2QPQA 1I6BA 3VE1B 5ICTA 2DXYA 3DP4A 2ABHA 2XX9A 5I57B 4ESXA 1Y1MA 4G8NA 4LONB 3C36A 2W7YA 3IOWA 3UN6A 5AA4A 4EQBA 4O3AA 4JWOA 4RXLA 1B6HA 1IEJA 2I48A 4DDDA 4IO5A 4NTLA 4GFRA 4MFIA 5JEIA 2OBGA 2QJEA 4ZZEA 4EF1A 1XOCA 1NH7A 4H1XA 5I2KA 4RPOA 2Q2CA 1I6QA 3BFUA 3O97A 3QYTA 2H99A 1MPBA 1F9BA 3PPRA 4YAHX 5DT6A 3RY3A 3TYHA 4I62A 4KYEA 3MZBA 3T93B 1H44A 2B3BA 2VGQA 4BDOA 1HSJA 1T0KA 4BLAA 4X1DA 1A54A 2V3UA 3H4ZA 5I59B 1OQHA 2I49A 4YB5A 1I6AA 4IO6A 4IO2A 3FGSA 2O1MA 2O1LA 3Q25A 2ZYNA 4NF4A 3VVFA 4F39A 3RTWB 4F2QA 1M5CA 4KHZE 4H67A 3R6UA 1RYXA 1BIYA 4MF3A 3Q26A 5F7VA 1TFDA 1M5EA 3EN3A 1AH5A 2O84X 1DOTA 3A3UA 1FTJA 4E0XA 3RPWA 1MG1A 4H5GA 1ZTYA 3PPNA 1ZMGA 1R6ZA 1MY4A 1DTGA 2AIXA 4YKKA 1QVSA 4GLIA 3TZAA 2M8CA 3EF7A 2DWAA 2XXIA 2I6EA 4F3PA 1B40A 4RK9A 5CBRA 3VDFA 1MPDA 4OYVA 1LCFA 3TAJA 4XKQA 3C4MA 2AYSA 1UTHB 1LB8A 1MQHA 3C33A 1Y4TA 4JB7A 3O2AA 4KR5A 3VFJA 2UVGA 3PPQA 2XXUA 4ZECA 3T9HB 2QL3A 1MDQA 2PX1A 3FVNA 4XXUA 5CRYA 2D3IA 4LVQA 1B2HA 2Y7RA 4YKIA 3M8UA 4GQOA 2IA4A 5DEXB 1OLCA 4IB2A 4HW8A 1N3XA 3GZGA 4IO3A 4MH5A 3N6UA 4GD5A 4DE8A 4F22A 4ECFA 3VLUA 3K6UA 2B65A 4C0RA 4F19A 4H5FA 3IAZA 4DXUA 4FEDA 2QMXA 4FEBA 4NWDA 1A8EA 1YAEA 3EPEA 3D4CA 3C9HA 3Q28A 4Z7EA 1NMUA 2ESNA 2PYYA 4GRKA 1D9YA 3CFXA 5TP9A 4NE4A 3KOSA 1XT8A 4YZZA 4Q8RA 4OZ9A 2REJA 2B3FA 4GL0A 1MXYA 3TDJA 4KYSA 3KN8A 1HSLA 2QSXA 3HPIA 1NL5A 4KCDA 1O63A 3GXAA 2P2AA 4ZE9A 1UTBB 4FAJA 1YCJA 2QS3A 4OFJA 1B05A 3FVGA 4QSEA
chains in the Genus database with same CATH superfamily
2FVZA 3UGWA 4EUOA 4QRZA 1CNQA 5DW8A 2ZNTA 3CSBA 5I56B 4U22A 1LBZA 3CG3A 3FIRA 3K4UA 2Y7PA 4MBPA 1QKAA 2RF1A 1A40A 3VVDA 2DE4A 1K9YA 4JXIA 1B0LA 2V84A 3OO9A 2FIXA 2I58A 4GWXA 3K2DA 4H8IA 1FBGA 3TODA 3K01A 3S2VA 3G3FA 4F18A 2Q9TA 3IB0A 3CI8A 4G8HA 3U93A 3IK6B 4ZE8A 2NOOA 4MNPA 5DVJA 3V89B 2GFEA 3IFAA 1XVXA 4M1VA 5HM4B 4DLDA 3IORA 3V83A 1FBDA 4G68A 1MQGA 1NV5A 5CM6A 3QIMA 2Q8MA 4NF5B 4YU0A 3DLNA 1MY2A 3KBRA 1H3DA 2XHDA 4DCYA 5AA4B 3U8QA 3AXFA 4YB7A 3TQLA 3IJXB 3RPLB 4F31B 1IXHA 3FXUA 5ET5A 4BDRA 2PFZA 3F11A 3MQ9A 3T66A 1FPIA 2V25A 3U65A 3S4UA 4OFOA 1LLSA 5A5XA 3RLFE 1NUZA 5EQ8A 3KC1A 4U4XA 5I2KB 4LQ2A 2I4BA 4XFEA 2HHMA 1P1NA 2O51A 3O6HA 4Q5TA 4EQ9A 1IQ7A 1S9TA 2ZYOA 4AS5A 2FYIA 1LBVA 4F1UA 4ZEBA 3I3VA 5EQ9A 3DP8A 2OZZA 1EH3A 2JJKA 5LDZA 3RNNA 4GF8A 3U1OA 1NNFA 3O9PA 3ISPA 3LUZA 5FHMA 4I3EA 1TFAA 2XXHA 4EQ7A 5IAIA 3PMVA 3H6WA 2PMSA 2DWHA 3O6GA 2ZZVA 1MRPA 3FXRA 2XXKA 2RC7A 1H45A 2PCRA 4F1YA 3O29A 2ANJA 2F3BA 2A5SA 3FZVA 3FJMA 3V8XB 1OQGA 1VSOA 1SPIA 3W9WA 4K3FA 1OVBA 4NN3A 3TUSA 3I6VA 1PBQA 2Y84A 4YMAA 4NX1A 3R7XA 5FHNA 2WYKA 2UXAA 1LCTA 1B5JA 2ZNSA 4U23A 3S9NC 4QSDA 1MY3A 4WEPA 1B1HA 5TPAA 2ZZWA 5H8NA 3E9XA 1JW1A 2KLFA 3SEXA 3HN0A 1D9VA 2KQZA 3PPPA 2DS9A 2QVRA 3RN8A 1EZ9A 3HHFA 1LFHA 5IZ3A 4PFUA 5M2VA 4ONYA 2QVVA 2XXQA 3TQWA 1NV3A 4I8CA 4R75A 3FV2A 2YPNA 2RKMA 4MIJA 4G68C 1KA0A 4GWZA 4OESA 4XIGQ 3O66A 3LUYA 1PB8A 1INPA 2O7UA 1EYKA 2CMOA 4HS7A 3H3GA 3PUXE 4FIMA 4R73A 3KOTA 2D5WA 4QFPA 3BKIB 4LZ7A 1B1XA 5KZTA 1MXWA 3KFMA 1LBCA 5AA2A 3KZGA 3PUVE 4DIGA 1FBEA 2F78A 1UIVA 3ILUB 5L9SA 1NKXA 3BIHA 2F6PA 1GR2A 1CE2A 2NWJA 2NXOA 2R9JA 2ZXTA 4MLVA 4XKRA 5BWJA 3EHSA 4PCDA 1YPNA 4QSCA 2H5YA 3VXBA 4LZ5A 4EDPA 5ICQA 3JZJA 1B0HA 5CC2A 2ALUA 3TMGA 2Q8JA 3U72A 3FD3A 3K02A 4RA1A 3SEWA 3RQTA 1NV6A 4NF8A 4F3GA 2WEFA 5KDTA 4R6HA 3G3JA 1B52A 1S7YA 1PEBA 1IITA 5L9MA 4PTKA 3KJ7A 2GH9A 1ELJA 1AOVA 4QFOA 5T3JA 5AA1A 5EYHA 3Q29A 1MQJA 1OLAA 3EHTA 3GBAA 5TP9B 4P3LA 5ESYA 2LAOA 3K1MA 3IR1A 1P1UA 3D4GA 3UORA 3KJTA 1FPEA 2ZYKA 3E13X 3QUJA 4N81A 2VOZA 2VD2A 4ND9A 4NF6A 4OMBA 2OK2A 1B7HA 4KI0E 1SI0A 4U1OA 1B7ZA 4N15A 2V4CA 1A7LA 1L5TA 2Y7IA 4N8GA 1FQBA 3CRBA 2F35A 4LA9A 3G7WA 5I58A 3G3GA 3MJNA 1FPGA 1IUDA 1FBPA 3FJ7A 3UK4A 3L6GA 4RYAA 3OELA 4LQ5A 3OXNA 3U94A 2FBPA 3H7MA 4AQ4A 1UQWA 1MH4A 3MC2A 4H65A 1ATGA 5IGAA 1MY0A 4OVTA 3S9EA 1LEVA 2IEEA 4GX4A 3IL1B 1FQEA 3LSFB 4MEVA 4GWUA 1FTKA 4WEDA 4FE8A 1FSAA 2RCAA 4GVOA 4QFLA 1IXIA 1DCUA 3CIJA 2A5TA 3OSQA 2DWIA 3ROJA 4YMBA 2QS1A 2Y5LA 4XEQA 4MJOA 2O7IA 3IOTA 2PT1A 1QUJA 5I57A 3OMBA 4H6DA 2FHYA 3GYYA 1LBWA 1FPBA 3PV0E 5EQAA 3KEIA 3K1NA 2XXVA 1DBZA 3BIGA 4NF0A 1IMAA 3VLVA 2ZYMA 4IGRA 3U92A 1P1OA 4X1BA 4G68B 3QAXA 4OVRA 4THIA 4N8YA 4PQJA 4GL8A 1JQFA 1SI1A 4JWXA 4O7IA 5HPQA 1JVYA 5AE4A 3FVKA 3IJOB 1NV2A 5DTBA 3TKDA 4I40A 1P1QA 3T1BA 1GTKA 1IMBA 3DP6A 1LBBA 1YTVA 4U4SA 3TTMA 1JVXA 1B3HA 1NFTA 5A5XB 2G93A 4JVCA 4P8BA 4AB6A 3N26A 1TT1A 1MH3A 2VP1A 4DXBA 4XTCQ 1BK4A 4DI4B 1N76A 4FECA 5CMMA 2F8DA 1SD3A 1JNFA 1A55A 2O69A 4ZS9A 5I59A 4O8MA 4G77A 4PP0A 4NMYA 4P56A 1NI9A 5EHSA 2X7QA 3PPOA 4BDLA 1BP5A 4ZDMA 1M5FA 4X48A 4OEVA 3IB1A 2BJIA 4MNIA 3SEUA 3S9LC 4OANA 1FTOA 3O28A 3PD8A 1DMBA 1FPDA 1QULA 3WAFA 1FTLA 2XWIA 2GRVA 4NEDA 4PBQA 2XXWA 3DM0A 1ZKBA 2H25A 4LN5A 3TTLA 4UABA 3WAEA 4EF2A 4C1UA 3QSLA 2HXWA 1LAFE 3C34A 3TELA 2PVUA 4R6YA 3H6UA 2Z23A 4IO4A 3PD9A 5JK4A 1H43A 4H0WA 4QHQA 2RCBA 2HFBA 1ZBMA 3ODBA 1SW1A 5TPAB 3PGFA 3DELB 5H8NB 1FRPA 2NUVA 1A8FA 1LFGA 4IY5A 3P7IA 4HCWA 2B4MA 4MMPA 1UTHA 2FNCA 3ILTB 5IZ3B 3Q27A 3MP6A 4IO7A 3IX1A 1FPKA 3EQ1A 3E4RA 4F1VA 2DE3A 1DTZA 2OWTA 3OO8A 3RUMA 1ZIUA 4N91A 4KQPA 2CZIA 3T9VA 2DWJA 1FPLA 1US5A 1DPPA 2WYPA 2PBWA 1VFDA 1UIUA 4KXPA 3D1RA 5DEXA 4Z0IA 3OD7A 2F3DA 3SDFA 4MAGA 4XKPA 3ZKLA 3C31A 3LR1A 4XKNA 5DYHA 3KG2A 2HAUA 5H8HA 4R9GA 2OLBA 2DE2A 4O3BA 2OX3A 3VV5A 4H8JA 3VVEA 4QFKA 2X7PA 4YKJA 2DYXA 3PUYE 4HE2A 4X04A 4ZEDA 5AA2B 1B5IA 3THIA 5I3SA 5H8FA 2F6GA 5EYFA 3QXMA 3TTRA 4GWYA 3A3CA 1OMPA 4R2BA 3TCGA 4I3YA 3T0JA 2FA7A 2DP8A 2HXRA 3TEPA 3LSWA 4FATA 4L17A 4U2RA 5JTYA 1US4A 4PAFA 1B9JA 2OWZA 4DZ1A 3RTFB 1URSA 4XF5A 1NH8A 1Y1ZA 4R72A 3V5AA 1AIVA 4AS4A 3KGCA 4BDQA 2UVIA 2ONRA 1MXUA 5CMBA 4C1TA 1FBCA 4U1ZA 1Y20A 4GWOA 2I0CA 1NV1A 4R9FA 3I5OA 1A99A 2XD2A 5ITPA 4NF4B 4X9TA 4ISUA 2Z8FA 1MM7A 1GV8A 2WX9A 4GBVA 1I69A 3MP1A 2Q2AA 5TU0A 4KCCA 3S9MC 5F24A 2F36A 4OHNA 1O64A 5FTIA 1SDXA 3T96B 5I2NA 1ANFA 4KFQA 3RT8A 1PBPA 4G2ZA 1EU8A 4NF6B 1R1NA 2O6AA 2OJTA 3USDA 1K9ZA 3MVZA 3MVYA 3IOUA 3NOHA 3CG1A 1II5A 1XVYA 3A29A 4PDDA 2XXYA 1B58A 3O6IA 4WXJA 5L8DA 1B3FA 1EZPA 2AL5A 2WBDA 5I56A 1Y3QA 4MHFA 5I58B 5KCJA 2ONKE 4MX6A 4Q30B 5ITOA 3ZKKA 3C32A 5FHOA 4GX3A 4F3BA 2UVHA 1MM6A 5I84A 3PMXA 3K6VA 3SKPA 4POXA 2HZLA 3CVGA 4R74A 1QJMA 1J1NA 4HTGA 4BDNA 3BFTA 1POY1 1RDYA 4OEUA 2OWSA 4FJPA 2F97A 3RT6B 1D4NA 3N94A 3R26A 5L9OA 1Q35A 2A5TB 2XXRA 3PU5A 1Y3PA 2R71A 2V3TA 2XX8A 3SETA 4E0WA 1DPEA 3MP8A 4NF5A 4GOTA 2Q88A 5DVFA 3KSXA 1JP4A 4R6KA 2XWKA 1FJ6A 4P0IA 1LSTA 4OERA 4I1DA 4RPNA 3RPLA 4OETA 4HE1A 4LZ8A 3HO7A 1BLFA 4NQ8A 4N17A 5AA3A 2HZKA 1EZOA 2DXRA 3G3HA 1P99A 2ZMBA 4PFYA 2QMWA 4ELPA 3T9XB 3TTNA 1B7UA 1P1WA 5BUUA 3CHGA 1Z7ME 1SW4A 2O68A 3MPLA 3MZ9A 4KD5A 1ZLQA 4ELRA 4ESWA 4P11A 3UP9A 4F29A 3OSRA 4JVDA 1B32A 3MYUA 3B7DA 3OO6A 3OO7A 1JW5A 2NVUB 3VXCA 1MQDA 4OWDA 4QF9A 1Y3NA 4PFIA 1M5DA 1S50A 1AWBA 2AL4A 4RK2A 2HEUA 3E3KA 1USYE 2H4IA 5I5PA 1RYOA 2KR0A 1WODA 4YICA 5ET6A 3ZSFA 2REGA 4PFBA 4NGUA 4NWCA 1M5BA 3MVWA 1MXXA 1QW0A 5J1DA 3LSXA 1TWYA 1PB7A 2GHAA 3M3LA 2RC8A 4N6DA 1Y4CA 1FQAA 2L5VA 1NV0A 2THIA 1HSEA 2YJPA 4WKMA 4QFNA 4ZEFA 4X8RA 2DVZA 1POTA 1Z7NE 3RGYA 4OFLA 3K0VA 3LBSA 5ISUA 1D9QA 1Q9DA 2QRYA 1YXIA 5CI5A 1JETA 2F5XA 4ZZAA 4ZEIA 4OTEA 2H98A 1BKAA 4JSOA 5H8QA 1EYIA 4PGNA 1GGGA 3OEKA 1LB9A 4BDMA 1VDWA 1B3LA 2HAVA 1YYZA 2E1SA 2XA5A 2I0BA 3MAMA 3FJGA 5FBPA 4RNSA 5K2YA 2WKYA 1MS7A 3UIFA 4HCYA 2ZNUA 1MPCA 3FXBA 2OCUA 4ELQA 5AA2D 1Q1KA 2G29A 2P3NA 1JW4A 2BJJX 4M4GA 2UYFA 1SYHA 2CEXA 2I3VA 4GXAA 4PAIA 3JV9A 5B70A 4N6KA 2Z22A 2CZLA 1LAHE 4ZEKA 1SQYA 1VR5A 1VE4A 5K2XA 4N6PA 3T9UA 4OENA 5H8HB 3IO4A 3HHGA 1RDXA 4YKPA 1LFIA 1MXZA 3KSJA 1N3WA 1B3EA 3K6XA 3M3KA 1O7TA 3K1PA 3SEVA 1B5HA 4TLMB 2Z8DA 2XWVA 3FV1A 3H03A 5H8FB 5CBSA 2P0SA 4TOZA 4F2OA 1XI6A 3FATA 3MUQA 4G4PA 3CSGA 1VFEA 4PE5B 3FUZA 5EYGA 2CZKA 5JTYB 4YB6A 1FJ9A 2RINA 2D21A 1IMCA 3PTYA 1FTMA 3HCQA 1YZ0A 4P1EA 4LUBA 1URDA 2RC9A 1RKMA 4Q0CA 1PDAA 1FQCA 3TCFA 1NNKA 3CFLA 4EXLA 3H6TA 1LBXA 2V3QA 1N7WA 3T22A 4FORA 3A09A 1QUKA 2CZHA 2DVCA 4PFRA 4OVQA 3OENA 4MNCA 4OQOA 4N13A 1R9LA 4KPTA 4UACA 1MDP1 4POWA 2HCAA 3PMWA 3MW0A 1OIBA 3JYRA 4G8MA 4JSDA 4PC9A 5ET8A 3B50A 2XXXA 3MBPA 2V93A 3TCHA 1JEVA 3PUZE 3LC8A 2QFLA 2Q89A 2Q74A 3KBZA 3KN7A 1AL3A 4TLLB 2UYEA 5I2NB 2XXTA 1QGXA 2R6GE 3SESA 4LP2B 4IR8A 4JDFA 1NV4A 4PETA 2P1SA 5LOMA 1Y9UA 1PC3A 4I9DA 1PB9A 3ECRA 5FTHA 5J16A 5CMKA 4U21A 2I3WA 3VLWA 1QKBA 4QBAA 1N84A 1NUXA 2QS4A 2XX7A 1LAXA 1MXVA 4MLQA 5KCJB 1N04A 3FBPA 4GX6A 3L6HA 3MWBA 3TFLA 1D3KA 4TQUQ 2MKZA 1B4ZA 4OXVA 3ZS6A 1FCKA 2Y7KA 3SERA 2X26A 2B4LA 5H8SA 1FPFA 2XD3A 3TTKA 3EHUA 1IZ1A 4O7MA 4OVPA 3G3KA 4PE3A 3ONMA 3IO6A 4KYDA 1LAGE 2I4CA 1KWHA 4RY1A 3GBBA 5A5LA 2HQ0A 3CR9A 4AB5A 4GXSB 4ELOA 1SVXB 2HPGA 1R9QA 2DDKA 3W9VA 4HXVA 3FASA 2DOJA 1LGBC 2DQVA 2VPOA 2Z8EA 1FTAA 4R2FA 1NNPA 2XXPA 4IY6A 4JWYA 1H76A 3EKIA 1GVCA 3IOVA 5EHMA 3E78A 2ONSA 5IKBA 4RJZA 4F3SA 1N0TA 5CMCA 5HBCA 3UA8A 3M3FA 4PF6A 4NAPA 4N07A 1FQDA 1NNTA 3B6QA 1DSNA 3H6VA 1N7XA 4OVSA 1WVJA 4PFWA 3C35A 1IMDA 1SW2A 1OVTA 4DXCA 1MY1A 3QUFA 1BTJA 3QK6A 2Y7WA 1USYH 4PF8A 4O94A 1SYIA 2PT2A 3FVOA 4DCXA 4QXDA 5DVIA 2QS2A 1URGA 2GQ1A 3MVXA 3SZPA 3FXQA 2F34A 3K00A 4NF8B 3MPKA 1IXCA 3KN3A 4PFTA 3MZ1A 5KDTB 1FQFA 1IXGA 1WDNA 2YLNA 3OEMA 2FIEA 3HSTA 2DSFA 3K6WA 1B4HA 4IGTA 1MQIA 2E0SA 4UA8A 3GLBA 3SEYA 4LATA 1B51A 1ZU0A 2F7BA 4MCOA 4PAKA 5B7DA 2VD3A 3HFUA 1TXFA 4G61A 1KA1A 3N5LA 1UTBA 3LSLA 2VHAA 1XS5A 3BBRA 5F1QA 4OVJA 1QUIA 3B6TA 3TPAA 2CEYA 1SW5A 5EQ7A 2UVJA 1B3GA 3H06B 3HV1A 3B6WA 1IMEA 3N6TA 1SBPA 3IB2A 4P0GA 1AMFA 1JEUA 4JVIA 5H8QB 4O3CA 1XC1A 3CFZA 5ET7A 2F7CA 3W15C 4EXKA 2H9BA 1ZJLA 5ELVA 2GHBA 1B46A 4PBHA 3PUWE 4GIZA 5I7IA 3G3IA 1FW0A 3OOAA 1CB6A 2F7AA 4JBZA 1G0IA 3MSTA 1XHYA 1IIWA 2QPQA 1I6BA 3VE1B 5ICTA 1DK4A 5IM2A 2DXYA 3DP4A 2ABHA 2XX9A 3IFCA 5I57B 4ESXA 1Y1MA 4G8NA 4LONB 3C36A 2W7YA 3IOWA 3UN6A 5AA4A 4EQBA 4PGPA 4O3AA 2VPNA 4JWOA 4RXLA 1B6HA 1IEJA 2I48A 4DDDA 4IO5A 4NTLA 4GFRA 4MFIA 5JEIA 2OBGA 2QJEA 4ZZEA 4NHBA 4EF1A 1XOCA 1EYJA 1NH7A 4H1XA 5I2KA 4RPOA 2Q2CA 1I6QA 3BFUA 1NUYA 2P3VA 3O97A 3QYTA 2H99A 1MPBA 1F9BA 3PPRA 4YAHX 5DT6A 3RY3A 3TYHA 4I62A 4KYEA 3MZBA 4GWWA 3T93B 2Y5KA 1H44A 2XWOA 2B3BA 4P9KA 2VGQA 4BDOA 1HSJA 1T0KA 4BLAA 3KC0A 4X1DA 1A54A 2V3UA 3H4ZA 3B8BA 5I59B 1OQHA 2I49A 4YB5A 1I6AA 4NG7A 4IO6A 4IO2A 3FGSA 2O1MA 1LBYA 2O1LA 3Q25A 2ZYNA 2VT5A 4NF4A 4HE0A 3VVFA 4F39A 3RTWB 4P47A 4F2QA 1M5CA 4KHZE 4H67A 3R6UA 1RDZA 1RYXA 1BIYA 4MF3A 4H46A 3Q26A 5F7VA 1TFDA 1M5EA 3EN3A 1AH5A 2O84X 1DOTA 4OA4A 3A3UA 1FTJA 4H45A 4E0XA 3RPWA 1MG1A 4H5GA 1ZTYA 3PPNA 2QVUA 1ZMGA 1R6ZA 1MY4A 1DTGA 2AIXA 4YKKA 4FBPA 1FBHA 1QVSA 4GLIA 3TZAA 2M8CA 3EF7A 2DWAA 2XXIA 2I6EA 4F3PA 1B40A 4RK9A 5CBRA 3VDFA 1MPDA 4OYVA 1LCFA 3TAJA 4XKQA 3C4MA 2AYSA 1UTHB 1LB8A 1MQHA 3C33A 1Y4TA 4JB7A 3O2AA 4KR5A 3VFJA 2UVGA 3PPQA 5LTCA 2XXUA 4ZECA 3T9HB 3LV0A 2QL3A 1MDQA 2PX1A 3FVNA 4XXUA 5CRYA 2D3IA 4LVQA 1B2HA 2Y7RA 4YKIA 3M8UA 4GQOA 2IA4A 4PDHA 1OLCA 5DEXB 4N4UA 2ZZXA 4IB2A 4HW8A 1N3XA 3GZGA 4IO3A 4MH5A 3N6UA 4GD5A 4DE8A 4F22A 4ECFA 3RYDA 3VLUA 3K6UA 2B65A 4C0RA 4F19A 1NUWA 3QMFA 4H5FA 5IZ1A 3IAZA 4DXUA 4FEDA 2QMXA 4FEBA 4NWDA 4P1LA 1A8EA 1YAEA 3EPEA 1FPJA 3D4CA 2WBBA 4GWSA 2PFYA 3C9HA 3Q28A 4Z7EA 3E79A 1NMUA 1KZ8A 2ESNA 2PYYA 4GRKA 1G0HA 2R8TA 1D9YA 1IMFA 3CFXA 5TP9A 4NE4A 3KOSA 1XT8A 4YZZA 4Q8RA 4OZ9A 2REJA 2B3FA 4GL0A 1MXYA 3TDJA 4KYSA 3KN8A 4GBWA 1HSLA 1FBFA 2QSXA 1NV7A 3HPIA 1NL5A 4KCDA 1O63A 3GXAA 4DI3D 2P2AA 4ZE9A 1UTBB 4FAJA 1YCJA 2QS3A 4OFJA 1B05A 3FVGA 5IZZA 4QSEA
chains in the Genus database with same CATH topology
3UGWA 4EUOA 4QRZA 2ZNTA 3CSBA 5I56B 4U22A 3CG3A 3FIRA 3K4UA 2Y7PA 4MBPA 1QKAA 2RF1A 1A40A 3VVDA 2DE4A 4JXIA 1B0LA 2V84A 3OO9A 2I58A 4H8IA 3K2DA 3TODA 3K01A 3S2VA 3G3FA 4F18A 2Q9TA 3IB0A 3CI8A 4G8HA 3U93A 3IK6B 4ZE8A 2NOOA 5DVJA 3V89B 2GFEA 1XVXA 4M1VA 5HM4B 4DLDA 3IORA 3V83A 4G68A 1MQGA 5CM6A 3QIMA 4NF5B 4YU0A 3DLNA 1MY2A 3KBRA 1H3DA 2XHDA 4DCYA 5AA4B 3U8QA 3AXFA 4YB7A 3TQLA 3IJXB 4F31B 1IXHA 3FXUA 4BDRA 3F11A 3MQ9A 3T66A 2V25A 3S4UA 4OFOA 1LLSA 5A5XA 3RLFE 4U4XA 5I2KB 4LQ2A 2I4BA 1P1NA 2O51A 3O6HA 4Q5TA 4EQ9A 1IQ7A 1S9TA 2ZYOA 2FYIA 4F1UA 4ZEBA 3I3VA 3DP8A 2OZZA 1EH3A 3RNNA 4GF8A 3U1OA 1NNFA 3O9PA 5FHMA 1TFAA 2XXHA 4EQ7A 5IAIA 3PMVA 3H6WA 2PMSA 2DWHA 3O6GA 1MRPA 3FXRA 2RC7A 1H45A 4F1YA 3O29A 2ANJA 3FZVA 2A5SA 3FJMA 3V8XB 1OQGA 1VSOA 3W9WA 4K3FA 1OVBA 3TUSA 3I6VA 1PBQA 2Y84A 4YMAA 3R7XA 5FHNA 2UXAA 1LCTA 1B5JA 2ZNSA 4U23A 3S9NC 4QSDA 1MY3A 4WEPA 1B1HA 5TPAA 5H8NA 3E9XA 1JW1A 2KLFA 3SEXA 3HN0A 1D9VA 3PPPA 2DS9A 3RN8A 1EZ9A 3HHFA 1LFHA 4PFUA 5M2VA 4ONYA 3TQWA 2XXQA 4I8CA 4R75A 3FV2A 2YPNA 2RKMA 4G68C 4OESA 4XIGQ 3O66A 3LUYA 1PB8A 2O7UA 2CMOA 4HS7A 3H3GA 3PUXE 4FIMA 4R73A 3KOTA 2D5WA 4QFPA 3BKIB 4LZ7A 1B1XA 5KZTA 1MXWA 3KFMA 1LBCA 5AA2A 3KZGA 3PUVE 4DIGA 2F78A 1UIVA 3ILUB 5L9SA 1NKXA 2F6PA 1GR2A 1CE2A 2NWJA 2NXOA 2R9JA 2ZXTA 4MLVA 4XKRA 5BWJA 3EHSA 1YPNA 4QSCA 2H5YA 3VXBA 4LZ5A 4EDPA 5ICQA 3JZJA 1B0HA 5CC2A 2ALUA 3TMGA 2Q8JA 3U72A 3FD3A 3K02A 4RA1A 3SEWA 3RQTA 4NF8A 4F3GA 5KDTA 4R6HA 3G3JA 1B52A 1S7YA 1PEBA 1IITA 5L9MA 3KJ7A 2GH9A 1ELJA 1AOVA 4QFOA 5AA1A 3Q29A 1MQJA 1OLAA 3EHTA 3GBAA 5TP9B 2LAOA 3K1MA 3IR1A 1P1UA 3D4GA 3UORA 3KJTA 2ZYKA 3E13X 3QUJA 2VOZA 2VD2A 4ND9A 4NF6A 4OMBA 2OK2A 1B7HA 4KI0E 1SI0A 4U1OA 1B7ZA 1A7LA 1L5TA 2Y7IA 1FQBA 3CRBA 2F35A 4LA9A 3G7WA 5I58A 3G3GA 3MJNA 1IUDA 3FJ7A 3UK4A 3L6GA 4RYAA 3OELA 4LQ5A 3OXNA 3U94A 3H7MA 4AQ4A 1UQWA 1MH4A 3MC2A 4H65A 1ATGA 1MY0A 3S9EA 2IEEA 3IL1B 1FQEA 3LSFB 1FTKA 4WEDA 4FE8A 2RCAA 4GVOA 4QFLA 1IXIA 3CIJA 2A5TA 3OSQA 2DWIA 4YMBA 2QS1A 2O7IA 3IOTA 2PT1A 1QUJA 5I57A 3OMBA 4H6DA 3PV0E 3KEIA 3K1NA 2XXVA 3VLVA 2ZYMA 4IGRA 3U92A 1P1OA 4X1BA 4G68B 3QAXA 4THIA 4PQJA 4GL8A 1JQFA 1SI1A 4JWXA 5HPQA 1JVYA 5AE4A 3FVKA 3IJOB 5DTBA 3TKDA 1P1QA 1GTKA 3DP6A 1LBBA 1YTVA 4U4SA 3TTMA 1JVXA 1B3HA 1NFTA 5A5XB 2G93A 4AB6A 3N26A 1TT1A 1MH3A 2VP1A 4DXBA 4XTCQ 1N76A 4FECA 5CMMA 2F8DA 1SD3A 1JNFA 1A55A 2O69A 4ZS9A 5I59A 4G77A 4PP0A 4NMYA 5EHSA 2X7QA 3PPOA 4BDLA 1BP5A 4ZDMA 1M5FA 4X48A 4OEVA 3IB1A 3SEUA 3S9LC 1FTOA 3O28A 3PD8A 1DMBA 1QULA 3WAFA 1FTLA 2GRVA 4NEDA 2XXWA 3DM0A 1ZKBA 2H25A 3TTLA 3WAEA 4EF2A 4C1UA 3QSLA 2HXWA 1LAFE 3C34A 3TELA 2PVUA 4R6YA 3H6UA 2Z23A 4IO4A 3PD9A 5JK4A 1H43A 4H0WA 4QHQA 2RCBA 2HFBA 1ZBMA 3ODBA 1SW1A 5TPAB 3PGFA 3DELB 5H8NB 2NUVA 1A8FA 1LFGA 4IY5A 3P7IA 4HCWA 1UTHA 2FNCA 3ILTB 3Q27A 3MP6A 4IO7A 3IX1A 3EQ1A 3E4RA 4F1VA 2DE3A 1DTZA 2OWTA 3OO8A 3RUMA 1ZIUA 4KQPA 3T9VA 2DWJA 1US5A 1DPPA 2PBWA 1VFDA 1UIUA 5DEXA 4Z0IA 3OD7A 3SDFA 4XKPA 3ZKLA 3C31A 3LR1A 4XKNA 5DYHA 3KG2A 2HAUA 5H8HA 4R9GA 2OLBA 2DE2A 4O3BA 3VV5A 4H8JA 3VVEA 4QFKA 2X7PA 4YKJA 2DYXA 3PUYE 4ZEDA 5AA2B 1B5IA 3THIA 5H8FA 2F6GA 5EYFA 3QXMA 3TTRA 3A3CA 1OMPA 4R2BA 3TCGA 2FA7A 2DP8A 3TEPA 3LSWA 4FATA 4L17A 4U2RA 5JTYA 1US4A 1B9JA 4DZ1A 3RTFB 1URSA 1NH8A 1Y1ZA 4R72A 3V5AA 1AIVA 3KGCA 4BDQA 2UVIA 2ONRA 1MXUA 5CMBA 4C1TA 4U1ZA 1Y20A 4GWOA 2I0CA 4R9FA 3I5OA 1A99A 2XD2A 5ITPA 4NF4B 4X9TA 4ISUA 2Z8FA 1MM7A 1GV8A 1I69A 3MP1A 2Q2AA 5TU0A 4KCCA 3S9MC 2F36A 4OHNA 1O64A 5FTIA 1SDXA 3T96B 5I2NA 1ANFA 4KFQA 3RT8A 1PBPA 4G2ZA 1EU8A 4NF6B 1R1NA 2O6AA 2OJTA 3USDA 3MVZA 3MVYA 3IOUA 3CG1A 1II5A 1XVYA 2XXYA 1B58A 3O6IA 4WXJA 5L8DA 1B3FA 1EZPA 2AL5A 5I56A 1Y3QA 5I58B 5KCJA 2ONKE 4Q30B 5ITOA 3ZKKA 3C32A 5FHOA 4F3BA 2UVHA 1MM6A 5I84A 3PMXA 3K6VA 3SKPA 4POXA 2HZLA 3CVGA 4R74A 1QJMA 1J1NA 4HTGA 4BDNA 3BFTA 1POY1 4OEUA 2OWSA 4FJPA 2F97A 3RT6B 1D4NA 3N94A 3R26A 5L9OA 1Q35A 2A5TB 2XXRA 3PU5A 1Y3PA 2R71A 2V3TA 2XX8A 3SETA 4E0WA 1DPEA 3MP8A 4NF5A 4GOTA 2Q88A 5DVFA 3KSXA 4R6KA 4P0IA 1LSTA 4OERA 4I1DA 4RPNA 4OETA 4LZ8A 3HO7A 1BLFA 5AA3A 2HZKA 1EZOA 2DXRA 3G3HA 1P99A 2ZMBA 4PFYA 2QMWA 4ELPA 3T9XB 3TTNA 1B7UA 1P1WA 5BUUA 1Z7ME 1SW4A 2O68A 3MPLA 3MZ9A 4KD5A 1ZLQA 4ELRA 4ESWA 4P11A 3UP9A 4F29A 3OSRA 1B32A 3B7DA 3OO6A 3OO7A 1JW5A 2NVUB 3VXCA 1MQDA 4OWDA 4QF9A 1Y3NA 1M5DA 1S50A 2AL4A 4RK2A 2HEUA 3E3KA 1USYE 2H4IA 1RYOA 1WODA 4YICA 3ZSFA 2REGA 4NWCA 1M5BA 3MVWA 1MXXA 1QW0A 5J1DA 3LSXA 1TWYA 1PB7A 2GHAA 3M3LA 2RC8A 1Y4CA 1FQAA 2THIA 1HSEA 2YJPA 4WKMA 4QFNA 4ZEFA 2DVZA 1POTA 1Z7NE 3RGYA 4OFLA 3K0VA 3LBSA 5ISUA 2QRYA 5CI5A 1JETA 2F5XA 4ZZAA 4ZEIA 4OTEA 2H98A 1BKAA 4JSOA 5H8QA 1GGGA 3OEKA 1LB9A 4BDMA 1B3LA 2HAVA 2E1SA 2I0BA 3MAMA 3FJGA 4RNSA 5K2YA 2WKYA 1MS7A 3UIFA 4HCYA 2ZNUA 1MPCA 2OCUA 4ELQA 5AA2D 1Q1KA 2G29A 1JW4A 2BJJX 4M4GA 2UYFA 1SYHA 2I3VA 4GXAA 3JV9A 5B70A 2Z22A 2CZLA 1LAHE 4ZEKA 1SQYA 1VR5A 1VE4A 5K2XA 4N6PA 3T9UA 4OENA 5H8HB 3IO4A 3HHGA 4YKPA 1LFIA 1MXZA 3KSJA 1N3WA 1B3EA 3K6XA 3M3KA 1O7TA 3K1PA 3SEVA 1B5HA 4TLMB 2Z8DA 3FV1A 3H03A 5H8FB 5CBSA 2P0SA 4TOZA 4F2OA 3FATA 3MUQA 4G4PA 3CSGA 1VFEA 4PE5B 3FUZA 5JTYB 4YB6A 2RINA 2D21A 1FTMA 3HCQA 4LUBA 1URDA 2RC9A 1RKMA 4Q0CA 1PDAA 1FQCA 3TCFA 1NNKA 3CFLA 4EXLA 3H6TA 2V3QA 1N7WA 3T22A 4FORA 3A09A 1QUKA 2DVCA 3OENA 4OQOA 4N13A 1R9LA 4KPTA 4UACA 1MDP1 4POWA 2HCAA 3PMWA 3MW0A 1OIBA 3JYRA 4G8MA 4JSDA 2XXXA 3MBPA 2V93A 3TCHA 1JEVA 3PUZE 3LC8A 2Q89A 3KN7A 1AL3A 4TLLB 2UYEA 5I2NB 2XXTA 2R6GE 3SESA 4LP2B 4JDFA 4PETA 2P1SA 5LOMA 1Y9UA 1PC3A 4I9DA 1PB9A 3ECRA 5FTHA 5CMKA 4U21A 2I3WA 3VLWA 1QKBA 1N84A 2QS4A 2XX7A 1LAXA 1MXVA 4MLQA 5KCJB 1N04A 3TFLA 3L6HA 3MWBA 1D3KA 4TQUQ 1B4ZA 4OXVA 3ZS6A 1FCKA 2Y7KA 3SERA 2X26A 5H8SA 2XD3A 3TTKA 3EHUA 1IZ1A 3G3KA 3ONMA 3IO6A 4KYDA 1LAGE 2I4CA 1KWHA 4RY1A 3GBBA 2HQ0A 3CR9A 4AB5A 4GXSB 4ELOA 1SVXB 1R9QA 3W9VA 3FASA 2DOJA 1LGBC 2DQVA 2Z8EA 4R2FA 1NNPA 2XXPA 4IY6A 4JWYA 1H76A 1GVCA 3IOVA 5EHMA 2ONSA 5IKBA 4RJZA 4F3SA 1N0TA 5CMCA 5HBCA 3UA8A 3M3FA 4N07A 1FQDA 1NNTA 3B6QA 1DSNA 3H6VA 1N7XA 1WVJA 3C35A 4PFWA 1SW2A 1OVTA 4DXCA 1MY1A 3QUFA 1BTJA 3QK6A 2Y7WA 1USYH 1SYIA 2PT2A 3FVOA 4DCXA 5DVIA 2QS2A 1URGA 3MVXA 3FXQA 2F34A 3K00A 4NF8B 3MPKA 1IXCA 3KN3A 4PFTA 3MZ1A 5KDTB 1FQFA 1IXGA 1WDNA 2YLNA 3OEMA 3HSTA 2DSFA 3K6WA 1B4HA 4IGTA 1MQIA 2E0SA 4UA8A 3GLBA 3SEYA 4LATA 1B51A 1ZU0A 2F7BA 5B7DA 2VD3A 1TXFA 3N5LA 1UTBA 3LSLA 2VHAA 1XS5A 3BBRA 5F1QA 4OVJA 1QUIA 3B6TA 3TPAA 1SW5A 2UVJA 1B3GA 3H06B 3HV1A 3B6WA 3N6TA 1SBPA 3IB2A 4P0GA 1AMFA 1JEUA 5H8QB 4O3CA 1XC1A 3CFZA 2F7CA 3W15C 4EXKA 2H9BA 1ZJLA 5ELVA 2GHBA 1B46A 3PUWE 4GIZA 3G3IA 1FW0A 3OOAA 1CB6A 2F7AA 4JBZA 1XHYA 1IIWA 2QPQA 1I6BA 3VE1B 5ICTA 2DXYA 3DP4A 2ABHA 2XX9A 5I57B 4ESXA 1Y1MA 4G8NA 4LONB 3C36A 2W7YA 3IOWA 3UN6A 5AA4A 4EQBA 4O3AA 4JWOA 4RXLA 1B6HA 1IEJA 2I48A 4DDDA 4IO5A 4NTLA 4GFRA 4MFIA 5JEIA 2OBGA 2QJEA 4ZZEA 4EF1A 1XOCA 1NH7A 4H1XA 5I2KA 4RPOA 2Q2CA 1I6QA 3BFUA 3O97A 3QYTA 2H99A 1MPBA 1F9BA 3PPRA 4YAHX 5DT6A 3RY3A 3TYHA 4I62A 4KYEA 3MZBA 3T93B 1H44A 2B3BA 2VGQA 4BDOA 1HSJA 1T0KA 4BLAA 4X1DA 1A54A 2V3UA 3H4ZA 5I59B 1OQHA 2I49A 4YB5A 1I6AA 4IO6A 4IO2A 3FGSA 2O1MA 2O1LA 3Q25A 2ZYNA 4NF4A 3VVFA 4F39A 3RTWB 4F2QA 1M5CA 4KHZE 4H67A 3R6UA 1RYXA 1BIYA 4MF3A 3Q26A 5F7VA 1TFDA 1M5EA 3EN3A 1AH5A 2O84X 1DOTA 3A3UA 1FTJA 4E0XA 3RPWA 1MG1A 4H5GA 1ZTYA 3PPNA 1ZMGA 1R6ZA 1MY4A 1DTGA 2AIXA 4YKKA 1QVSA 4GLIA 3TZAA 2M8CA 3EF7A 2DWAA 2XXIA 2I6EA 4F3PA 1B40A 4RK9A 5CBRA 3VDFA 1MPDA 4OYVA 1LCFA 3TAJA 4XKQA 3C4MA 2AYSA 1UTHB 1LB8A 1MQHA 3C33A 1Y4TA 4JB7A 3O2AA 4KR5A 3VFJA 2UVGA 3PPQA 2XXUA 4ZECA 3T9HB 2QL3A 1MDQA 2PX1A 3FVNA 4XXUA 5CRYA 2D3IA 4LVQA 1B2HA 2Y7RA 4YKIA 3M8UA 4GQOA 2IA4A 5DEXB 1OLCA 4IB2A 4HW8A 1N3XA 3GZGA 4IO3A 4MH5A 3N6UA 4GD5A 4DE8A 4F22A 4ECFA 3VLUA 3K6UA 2B65A 4C0RA 4F19A 4H5FA 3IAZA 4DXUA 4FEDA 2QMXA 4FEBA 4NWDA 1A8EA 1YAEA 3EPEA 3D4CA 3C9HA 3Q28A 4Z7EA 1NMUA 2ESNA 2PYYA 4GRKA 1D9YA 3CFXA 5TP9A 4NE4A 3KOSA 1XT8A 4YZZA 4Q8RA 4OZ9A 2REJA 2B3FA 4GL0A 1MXYA 3TDJA 4KYSA 3KN8A 1HSLA 2QSXA 3HPIA 1NL5A 4KCDA 1O63A 3GXAA 2P2AA 4ZE9A 1UTBB 4FAJA 1YCJA 2QS3A 4OFJA 1B05A 3FVGA 4QSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGW A;  4EUO A;  4QRZ A;  2ZNT A;  3CSB A;  5I56 B;  4U22 A;  3CG3 A;  3FIR A;  3K4U A;  2Y7P A;  4MBP A;  1QKA A;  2RF1 A;  1A40 A;  3VVD A;  2DE4 A;  4JXI A;  1B0L A;  2V84 A;  3OO9 A;  2I58 A;  4H8I A;  3K2D A;  3TOD A;  3K01 A;  3S2V A;  3G3F A;  4F18 A;  2Q9T A;  3IB0 A;  3CI8 A;  4G8H A;  3U93 A;  3IK6 B;  4ZE8 A;  2NOO A;  5DVJ A;  3V89 B;  2GFE A;  1XVX A;  4M1V A;  5HM4 B;  4DLD A;  3IOR A;  3V83 A;  4G68 A;  1MQG A;  5CM6 A;  3QIM A;  4NF5 B;  4YU0 A;  3DLN A;  1MY2 A;  3KBR A;  1H3D A;  2XHD A;  4DCY A;  5AA4 B;  3U8Q A;  3AXF A;  4YB7 A;  3TQL A;  3IJX B;  4F31 B;  1IXH A;  3FXU A;  4BDR A;  3F11 A;  3MQ9 A;  3T66 A;  2V25 A;  3S4U A;  4OFO A;  1LLS A;  5A5X A;  3RLF E;  4U4X A;  5I2K B;  4LQ2 A;  2I4B A;  1P1N A;  2O51 A;  3O6H A;  4Q5T A;  4EQ9 A;  1IQ7 A;  1S9T A;  2ZYO A;  2FYI A;  4F1U A;  4ZEB A;  3I3V A;  3DP8 A;  2OZZ A;  1EH3 A;  3RNN A;  4GF8 A;  3U1O A;  1NNF A;  3O9P A;  5FHM A;  1TFA A;  2XXH A;  4EQ7 A;  5IAI A;  3PMV A;  3H6W A;  2PMS A;  2DWH A;  3O6G A;  1MRP A;  3FXR A;  2RC7 A;  1H45 A;  4F1Y A;  3O29 A;  2ANJ A;  3FZV A;  2A5S A;  3FJM A;  3V8X B;  1OQG A;  1VSO A;  3W9W A;  4K3F A;  1OVB A;  3TUS A;  3I6V A;  1PBQ A;  2Y84 A;  4YMA A;  3R7X A;  5FHN A;  2UXA A;  1LCT A;  1B5J A;  2ZNS A;  4U23 A;  3S9N C;  4QSD A;  1MY3 A;  4WEP A;  1B1H A;  5TPA A;  5H8N A;  3E9X A;  1JW1 A;  2KLF A;  3SEX A;  3HN0 A;  1D9V A;  3PPP A;  2DS9 A;  3RN8 A;  1EZ9 A;  3HHF A;  1LFH A;  4PFU A;  5M2V A;  4ONY A;  3TQW A;  2XXQ A;  4I8C A;  4R75 A;  3FV2 A;  2YPN A;  2RKM A;  4G68 C;  4OES A;  4XIG Q;  3O66 A;  3LUY A;  1PB8 A;  2O7U A;  2CMO A;  4HS7 A;  3H3G A;  3PUX E;  4FIM A;  4R73 A;  3KOT A;  2D5W A;  4QFP A;  3BKI B;  4LZ7 A;  1B1X A;  5KZT A;  1MXW A;  3KFM A;  1LBC A;  5AA2 A;  3KZG A;  3PUV E;  4DIG A;  2F78 A;  1UIV A;  3ILU B;  5L9S A;  1NKX A;  2F6P A;  1GR2 A;  1CE2 A;  2NWJ A;  2NXO A;  2R9J A;  2ZXT A;  4MLV A;  4XKR A;  5BWJ A;  3EHS A;  1YPN A;  4QSC A;  2H5Y A;  3VXB A;  4LZ5 A;  4EDP A;  5ICQ A;  3JZJ A;  1B0H A;  5CC2 A;  2ALU A;  3TMG A;  2Q8J A;  3U72 A;  3FD3 A;  3K02 A;  4RA1 A;  3SEW A;  3RQT A;  4NF8 A;  4F3G A;  5KDT A;  4R6H A;  3G3J A;  1B52 A;  1S7Y A;  1PEB A;  1IIT A;  5L9M A;  3KJ7 A;  2GH9 A;  1ELJ A;  1AOV A;  4QFO A;  5AA1 A;  3Q29 A;  1MQJ A;  1OLA A;  3EHT A;  3GBA A;  5TP9 B;  2LAO A;  3K1M A;  3IR1 A;  1P1U A;  3D4G A;  3UOR A;  3KJT A;  2ZYK A;  3E13 X;  3QUJ A;  2VOZ A;  2VD2 A;  4ND9 A;  4NF6 A;  4OMB A;  2OK2 A;  1B7H A;  4KI0 E;  1SI0 A;  4U1O A;  1B7Z A;  1A7L A;  1L5T A;  2Y7I A;  1FQB A;  3CRB A;  2F35 A;  4LA9 A;  3G7W A;  5I58 A;  3G3G A;  3MJN A;  1IUD A;  3FJ7 A;  3UK4 A;  3L6G A;  4RYA A;  3OEL A;  4LQ5 A;  3OXN A;  3U94 A;  3H7M A;  4AQ4 A;  1UQW A;  1MH4 A;  3MC2 A;  4H65 A;  1ATG A;  1MY0 A;  3S9E A;  2IEE A;  3IL1 B;  1FQE A;  3LSF B;  1FTK A;  4WED A;  4FE8 A;  2RCA A;  4GVO A;  4QFL A;  1IXI A;  3CIJ A;  2A5T A;  3OSQ A;  2DWI A;  4YMB A;  2QS1 A;  2O7I A;  3IOT A;  2PT1 A;  1QUJ A;  5I57 A;  3OMB A;  4H6D A;  3PV0 E;  3KEI A;  3K1N A;  2XXV A;  3VLV A;  2ZYM A;  4IGR A;  3U92 A;  1P1O A;  4X1B A;  4G68 B;  3QAX A;  4THI A;  4PQJ A;  4GL8 A;  1JQF A;  1SI1 A;  4JWX A;  5HPQ A;  1JVY A;  5AE4 A;  3FVK A;  3IJO B;  5DTB A;  3TKD A;  1P1Q A;  1GTK A;  3DP6 A;  1LBB A;  1YTV A;  4U4S A;  3TTM A;  1JVX A;  1B3H A;  1NFT A;  5A5X B;  2G93 A;  4AB6 A;  3N26 A;  1TT1 A;  1MH3 A;  2VP1 A;  4DXB A;  4XTC Q;  1N76 A;  4FEC A;  5CMM A;  2F8D A;  1SD3 A;  1JNF A;  1A55 A;  2O69 A;  4ZS9 A;  5I59 A;  4G77 A;  4PP0 A;  4NMY A;  5EHS A;  2X7Q A;  3PPO A;  4BDL A;  1BP5 A;  4ZDM A;  1M5F A;  4X48 A;  4OEV A;  3IB1 A;  3SEU A;  3S9L C;  1FTO A;  3O28 A;  3PD8 A;  1DMB A;  1QUL A;  3WAF A;  1FTL A;  2GRV A;  4NED A;  2XXW A;  3DM0 A;  1ZKB A;  2H25 A;  3TTL A;  3WAE A;  4EF2 A;  4C1U A;  3QSL A;  2HXW A;  1LAF E;  3C34 A;  3TEL A;  2PVU A;  4R6Y A;  3H6U A;  2Z23 A;  4IO4 A;  3PD9 A;  5JK4 A;  1H43 A;  4H0W A;  4QHQ A;  2RCB A;  2HFB A;  1ZBM A;  3ODB A;  1SW1 A;  5TPA B;  3PGF A;  3DEL B;  5H8N B;  2NUV A;  1A8F A;  1LFG A;  4IY5 A;  3P7I A;  4HCW A;  1UTH A;  2FNC A;  3ILT B;  3Q27 A;  3MP6 A;  4IO7 A;  3IX1 A;  3EQ1 A;  3E4R A;  4F1V A;  2DE3 A;  1DTZ A;  2OWT A;  3OO8 A;  3RUM A;  1ZIU A;  4KQP A;  3T9V A;  2DWJ A;  1US5 A;  1DPP A;  2PBW A;  1VFD A;  1UIU A;  5DEX A;  4Z0I A;  3OD7 A;  3SDF A;  4XKP A;  3ZKL A;  3C31 A;  3LR1 A;  4XKN A;  5DYH A;  3KG2 A;  2HAU A;  5H8H A;  4R9G A;  2OLB A;  2DE2 A;  4O3B A;  3VV5 A;  4H8J A;  3VVE A;  4QFK A;  2X7P A;  4YKJ A;  2DYX A;  3PUY E;  4ZED A;  5AA2 B;  1B5I A;  3THI A;  5H8F A;  2F6G A;  5EYF A;  3QXM A;  3TTR A;  3A3C A;  1OMP A;  4R2B A;  3TCG A;  2FA7 A;  2DP8 A;  3TEP A;  3LSW A;  4FAT A;  4L17 A;  4U2R A;  5JTY A;  1US4 A;  1B9J A;  4DZ1 A;  3RTF B;  1URS A;  1NH8 A;  1Y1Z A;  4R72 A;  3V5A A;  1AIV A;  3KGC A;  4BDQ A;  2UVI A;  2ONR A;  1MXU A;  5CMB A;  4C1T A;  4U1Z A;  1Y20 A;  4GWO A;  2I0C A;  4R9F A;  3I5O A;  1A99 A;  2XD2 A;  5ITP A;  4NF4 B;  4X9T A;  4ISU A;  2Z8F A;  1MM7 A;  1GV8 A;  1I69 A;  3MP1 A;  2Q2A A;  5TU0 A;  4KCC A;  3S9M C;  2F36 A;  4OHN A;  1O64 A;  5FTI A;  1SDX A;  3T96 B;  5I2N A;  1ANF A;  4KFQ A;  3RT8 A;  1PBP A;  4G2Z A;  1EU8 A;  4NF6 B;  1R1N A;  2O6A A;  2OJT A;  3USD A;  3MVZ A;  3MVY A;  3IOU A;  3CG1 A;  1II5 A;  1XVY A;  2XXY A;  1B58 A;  3O6I A;  4WXJ A;  5L8D A;  1B3F A;  1EZP A;  2AL5 A;  5I56 A;  1Y3Q A;  5I58 B;  5KCJ A;  2ONK E;  4Q30 B;  5ITO A;  3ZKK A;  3C32 A;  5FHO A;  4F3B A;  2UVH A;  1MM6 A;  5I84 A;  3PMX A;  3K6V A;  3SKP A;  4POX A;  2HZL A;  3CVG A;  4R74 A;  1QJM A;  1J1N A;  4HTG A;  4BDN A;  3BFT A;  1POY 1;  4OEU A;  2OWS A;  4FJP A;  2F97 A;  3RT6 B;  1D4N A;  3N94 A;  3R26 A;  5L9O A;  1Q35 A;  2A5T B;  2XXR A;  3PU5 A;  1Y3P A;  2R71 A;  2V3T A;  2XX8 A;  3SET A;  4E0W A;  1DPE A;  3MP8 A;  4NF5 A;  4GOT A;  2Q88 A;  5DVF A;  3KSX A;  4R6K A;  4P0I A;  1LST A;  4OER A;  4I1D A;  4RPN A;  4OET A;  4LZ8 A;  3HO7 A;  1BLF A;  5AA3 A;  2HZK A;  1EZO A;  2DXR A;  3G3H A;  1P99 A;  2ZMB A;  4PFY A;  2QMW A;  4ELP A;  3T9X B;  3TTN A;  1B7U A;  1P1W A;  5BUU A;  1Z7M E;  1SW4 A;  2O68 A;  3MPL A;  3MZ9 A;  4KD5 A;  1ZLQ A;  4ELR A;  4ESW A;  4P11 A;  3UP9 A;  4F29 A;  3OSR A;  1B32 A;  3B7D A;  3OO6 A;  3OO7 A;  1JW5 A;  2NVU B;  3VXC A;  1MQD A;  4OWD A;  4QF9 A;  1Y3N A;  1M5D A;  1S50 A;  2AL4 A;  4RK2 A;  2HEU A;  3E3K A;  1USY E;  2H4I A;  1RYO A;  1WOD A;  4YIC A;  3ZSF A;  2REG A;  4NWC A;  1M5B A;  3MVW A;  1MXX A;  1QW0 A;  5J1D A;  3LSX A;  1TWY A;  1PB7 A;  2GHA A;  3M3L A;  2RC8 A;  1Y4C A;  1FQA A;  2THI A;  1HSE A;  2YJP A;  4WKM A;  4QFN A;  4ZEF A;  2DVZ A;  1POT A;  1Z7N E;  3RGY A;  4OFL A;  3K0V A;  3LBS A;  5ISU A;  2QRY A;  5CI5 A;  1JET A;  2F5X A;  4ZZA A;  4ZEI A;  4OTE A;  2H98 A;  1BKA A;  4JSO A;  5H8Q A;  1GGG A;  3OEK A;  1LB9 A;  4BDM A;  1B3L A;  2HAV A;  2E1S A;  2I0B A;  3MAM A;  3FJG A;  4RNS A;  5K2Y A;  2WKY A;  1MS7 A;  3UIF A;  4HCY A;  2ZNU A;  1MPC A;  2OCU A;  4ELQ A;  5AA2 D;  1Q1K A;  2G29 A;  1JW4 A;  2BJJ X;  4M4G A;  2UYF A;  1SYH A;  2I3V A;  4GXA A;  3JV9 A;  5B70 A;  2Z22 A;  2CZL A;  1LAH E;  4ZEK A;  1SQY A;  1VR5 A;  1VE4 A;  5K2X A;  4N6P A;  3T9U A;  4OEN A;  5H8H B;  3IO4 A;  3HHG A;  4YKP A;  1LFI A;  1MXZ A;  3KSJ A;  1N3W A;  1B3E A;  3K6X A;  3M3K A;  1O7T A;  3K1P A;  3SEV A;  1B5H A;  4TLM B;  2Z8D A;  3FV1 A;  3H03 A;  5H8F B;  5CBS A;  2P0S A;  4TOZ A;  4F2O A;  3FAT A;  3MUQ A;  4G4P A;  3CSG A;  1VFE A;  4PE5 B;  3FUZ A;  5JTY B;  4YB6 A;  2RIN A;  2D21 A;  1FTM A;  3HCQ A;  4LUB A;  1URD A;  2RC9 A;  1RKM A;  4Q0C A;  1PDA A;  1FQC A;  3TCF A;  1NNK A;  3CFL A;  4EXL A;  3H6T A;  2V3Q A;  1N7W A;  3T22 A;  4FOR A;  3A09 A;  1QUK A;  2DVC A;  3OEN A;  4OQO A;  4N13 A;  1R9L A;  4KPT A;  4UAC A;  1MDP 1;  4POW A;  2HCA A;  3PMW A;  3MW0 A;  1OIB A;  3JYR A;  4G8M A;  4JSD A;  2XXX A;  3MBP A;  2V93 A;  3TCH A;  1JEV A;  3PUZ E;  3LC8 A;  2Q89 A;  3KN7 A;  1AL3 A;  4TLL B;  2UYE A;  5I2N B;  2XXT A;  2R6G E;  3SES A;  4LP2 B;  4JDF A;  4PET A;  2P1S A;  5LOM A;  1Y9U A;  1PC3 A;  4I9D A;  1PB9 A;  3ECR A;  5FTH A;  5CMK A;  4U21 A;  2I3W A;  3VLW A;  1QKB A;  1N84 A;  2QS4 A;  2XX7 A;  1LAX A;  1MXV A;  4MLQ A;  5KCJ B;  1N04 A;  3TFL A;  3L6H A;  3MWB A;  1D3K A;  4TQU Q;  1B4Z A;  4OXV A;  3ZS6 A;  1FCK A;  2Y7K A;  3SER A;  2X26 A;  5H8S A;  2XD3 A;  3TTK A;  3EHU A;  1IZ1 A;  3G3K A;  3ONM A;  3IO6 A;  4KYD A;  1LAG E;  2I4C A;  1KWH A;  4RY1 A;  3GBB A;  2HQ0 A;  3CR9 A;  4AB5 A;  4GXS B;  4ELO A;  1SVX B;  1R9Q A;  3W9V A;  3FAS A;  2DOJ A;  1LGB C;  2DQV A;  2Z8E A;  4R2F A;  1NNP A;  2XXP A;  4IY6 A;  4JWY A;  1H76 A;  1GVC A;  3IOV A;  5EHM A;  2ONS A;  5IKB A;  4RJZ A;  4F3S A;  1N0T A;  5CMC A;  5HBC A;  3UA8 A;  3M3F A;  4N07 A;  1FQD A;  1NNT A;  3B6Q A;  1DSN A;  3H6V A;  1N7X A;  1WVJ A;  3C35 A;  4PFW A;  1SW2 A;  1OVT A;  4DXC A;  1MY1 A;  3QUF A;  1BTJ A;  3QK6 A;  2Y7W A;  1USY H;  1SYI A;  2PT2 A;  3FVO A;  4DCX A;  5DVI A;  2QS2 A;  1URG A;  3MVX A;  3FXQ A;  2F34 A;  3K00 A;  4NF8 B;  3MPK A;  1IXC A;  3KN3 A;  4PFT A;  3MZ1 A;  5KDT B;  1FQF A;  1IXG A;  1WDN A;  2YLN A;  3OEM A;  3HST A;  2DSF A;  3K6W A;  1B4H A;  4IGT A;  1MQI A;  2E0S A;  4UA8 A;  3GLB A;  3SEY A;  4LAT A;  1B51 A;  1ZU0 A;  2F7B A;  5B7D A;  2VD3 A;  1TXF A;  3N5L A;  1UTB A;  3LSL A;  2VHA A;  1XS5 A;  3BBR A;  5F1Q A;  4OVJ A;  1QUI A;  3B6T A;  3TPA A;  1SW5 A;  2UVJ A;  1B3G A;  3H06 B;  3HV1 A;  3B6W A;  3N6T A;  1SBP A;  3IB2 A;  4P0G A;  1AMF A;  1JEU A;  5H8Q B;  4O3C A;  1XC1 A;  3CFZ A;  2F7C A;  3W15 C;  4EXK A;  2H9B A;  1ZJL A;  5ELV A;  2GHB A;  1B46 A;  3PUW E;  4GIZ A;  3G3I A;  1FW0 A;  3OOA A;  1CB6 A;  2F7A A;  4JBZ A;  1XHY A;  1IIW A;  2QPQ A;  1I6B A;  3VE1 B;  5ICT A;  2DXY A;  3DP4 A;  2ABH A;  2XX9 A;  5I57 B;  4ESX A;  1Y1M A;  4G8N A;  4LON B;  3C36 A;  2W7Y A;  3IOW A;  3UN6 A;  5AA4 A;  4EQB A;  4O3A A;  4JWO A;  4RXL A;  1B6H A;  1IEJ A;  2I48 A;  4DDD A;  4IO5 A;  4NTL A;  4GFR A;  4MFI A;  5JEI A;  2OBG A;  2QJE A;  4ZZE A;  4EF1 A;  1XOC A;  1NH7 A;  4H1X A;  5I2K A;  4RPO A;  2Q2C A;  1I6Q A;  3BFU A;  3O97 A;  3QYT A;  2H99 A;  1MPB A;  1F9B A;  3PPR A;  4YAH X;  5DT6 A;  3RY3 A;  3TYH A;  4I62 A;  4KYE A;  3MZB A;  3T93 B;  1H44 A;  2B3B A;  2VGQ A;  4BDO A;  1HSJ A;  1T0K A;  4BLA A;  4X1D A;  1A54 A;  2V3U A;  3H4Z A;  5I59 B;  1OQH A;  2I49 A;  4YB5 A;  1I6A A;  4IO6 A;  4IO2 A;  3FGS A;  2O1M A;  2O1L A;  3Q25 A;  2ZYN A;  4NF4 A;  3VVF A;  4F39 A;  3RTW B;  4F2Q A;  1M5C A;  4KHZ E;  4H67 A;  3R6U A;  1RYX A;  1BIY A;  4MF3 A;  3Q26 A;  5F7V A;  1TFD A;  1M5E A;  3EN3 A;  1AH5 A;  2O84 X;  1DOT A;  3A3U A;  1FTJ A;  4E0X A;  3RPW A;  1MG1 A;  4H5G A;  1ZTY A;  3PPN A;  1ZMG A;  1R6Z A;  1MY4 A;  1DTG A;  2AIX A;  4YKK A;  1QVS A;  4GLI A;  3TZA A;  2M8C A;  3EF7 A;  2DWA A;  2XXI A;  2I6E A;  4F3P A;  1B40 A;  4RK9 A;  5CBR A;  3VDF A;  1MPD A;  4OYV A;  1LCF A;  3TAJ A;  4XKQ A;  3C4M A;  2AYS A;  1UTH B;  1LB8 A;  1MQH A;  3C33 A;  1Y4T A;  4JB7 A;  3O2A A;  4KR5 A;  3VFJ A;  2UVG A;  3PPQ A;  2XXU A;  4ZEC A;  3T9H B;  2QL3 A;  1MDQ A;  2PX1 A;  3FVN A;  4XXU A;  5CRY A;  2D3I A;  4LVQ A;  1B2H A;  2Y7R A;  4YKI A;  3M8U A;  4GQO A;  2IA4 A;  5DEX B;  1OLC A;  4IB2 A;  4HW8 A;  1N3X A;  3GZG A;  4IO3 A;  4MH5 A;  3N6U A;  4GD5 A;  4DE8 A;  4F22 A;  4ECF A;  3VLU A;  3K6U A;  2B65 A;  4C0R A;  4F19 A;  4H5F A;  3IAZ A;  4DXU A;  4FED A;  2QMX A;  4FEB A;  4NWD A;  1A8E A;  1YAE A;  3EPE A;  3D4C A;  3C9H A;  3Q28 A;  4Z7E A;  1NMU A;  2ESN A;  2PYY A;  4GRK A;  1D9Y A;  3CFX A;  5TP9 A;  4NE4 A;  3KOS A;  1XT8 A;  4YZZ A;  4Q8R A;  4OZ9 A;  2REJ A;  2B3F A;  4GL0 A;  1MXY A;  3TDJ A;  4KYS A;  3KN8 A;  1HSL A;  2QSX A;  3HPI A;  1NL5 A;  4KCD A;  1O63 A;  3GXA A;  2P2A A;  4ZE9 A;  1UTB B;  4FAJ A;  1YCJ A;  2QS3 A;  4OFJ A;  1B05 A;  3FVG A;  4QSE A; 
#chains in the Genus database with same CATH topology
 2FVZ A;  3UGW A;  4EUO A;  4QRZ A;  1CNQ A;  5DW8 A;  2ZNT A;  3CSB A;  5I56 B;  4U22 A;  1LBZ A;  3CG3 A;  3FIR A;  3K4U A;  2Y7P A;  4MBP A;  1QKA A;  2RF1 A;  1A40 A;  3VVD A;  2DE4 A;  1K9Y A;  4JXI A;  1B0L A;  2V84 A;  3OO9 A;  2FIX A;  2I58 A;  4GWX A;  3K2D A;  4H8I A;  1FBG A;  3TOD A;  3K01 A;  3S2V A;  3G3F A;  4F18 A;  2Q9T A;  3IB0 A;  3CI8 A;  4G8H A;  3U93 A;  3IK6 B;  4ZE8 A;  2NOO A;  4MNP A;  5DVJ A;  3V89 B;  2GFE A;  3IFA A;  1XVX A;  4M1V A;  5HM4 B;  4DLD A;  3IOR A;  3V83 A;  1FBD A;  4G68 A;  1MQG A;  1NV5 A;  5CM6 A;  3QIM A;  2Q8M A;  4NF5 B;  4YU0 A;  3DLN A;  1MY2 A;  3KBR A;  1H3D A;  2XHD A;  4DCY A;  5AA4 B;  3U8Q A;  3AXF A;  4YB7 A;  3TQL A;  3IJX B;  3RPL B;  4F31 B;  1IXH A;  3FXU A;  5ET5 A;  4BDR A;  2PFZ A;  3F11 A;  3MQ9 A;  3T66 A;  1FPI A;  2V25 A;  3U65 A;  3S4U A;  4OFO A;  1LLS A;  5A5X A;  3RLF E;  1NUZ A;  5EQ8 A;  3KC1 A;  4U4X A;  5I2K B;  4LQ2 A;  2I4B A;  4XFE A;  2HHM A;  1P1N A;  2O51 A;  3O6H A;  4Q5T A;  4EQ9 A;  1IQ7 A;  1S9T A;  2ZYO A;  4AS5 A;  2FYI A;  1LBV A;  4F1U A;  4ZEB A;  3I3V A;  5EQ9 A;  3DP8 A;  2OZZ A;  1EH3 A;  2JJK A;  5LDZ A;  3RNN A;  4GF8 A;  3U1O A;  1NNF A;  3O9P A;  3ISP A;  3LUZ A;  5FHM A;  4I3E A;  1TFA A;  2XXH A;  4EQ7 A;  5IAI A;  3PMV A;  3H6W A;  2PMS A;  2DWH A;  3O6G A;  2ZZV A;  1MRP A;  3FXR A;  2XXK A;  2RC7 A;  1H45 A;  2PCR A;  4F1Y A;  3O29 A;  2ANJ A;  2F3B A;  2A5S A;  3FZV A;  3FJM A;  3V8X B;  1OQG A;  1VSO A;  1SPI A;  3W9W A;  4K3F A;  1OVB A;  4NN3 A;  3TUS A;  3I6V A;  1PBQ A;  2Y84 A;  4YMA A;  4NX1 A;  3R7X A;  5FHN A;  2WYK A;  2UXA A;  1LCT A;  1B5J A;  2ZNS A;  4U23 A;  3S9N C;  4QSD A;  1MY3 A;  4WEP A;  1B1H A;  5TPA A;  2ZZW A;  5H8N A;  3E9X A;  1JW1 A;  2KLF A;  3SEX A;  3HN0 A;  1D9V A;  2KQZ A;  3PPP A;  2DS9 A;  2QVR A;  3RN8 A;  1EZ9 A;  3HHF A;  1LFH A;  5IZ3 A;  4PFU A;  5M2V A;  4ONY A;  2QVV A;  2XXQ A;  3TQW A;  1NV3 A;  4I8C A;  4R75 A;  3FV2 A;  2YPN A;  2RKM A;  4MIJ A;  4G68 C;  1KA0 A;  4GWZ A;  4OES A;  4XIG Q;  3O66 A;  3LUY A;  1PB8 A;  1INP A;  2O7U A;  1EYK A;  2CMO A;  4HS7 A;  3H3G A;  3PUX E;  4FIM A;  4R73 A;  3KOT A;  2D5W A;  4QFP A;  3BKI B;  4LZ7 A;  1B1X A;  5KZT A;  1MXW A;  3KFM A;  1LBC A;  5AA2 A;  3KZG A;  3PUV E;  4DIG A;  1FBE A;  2F78 A;  1UIV A;  3ILU B;  5L9S A;  1NKX A;  3BIH A;  2F6P A;  1GR2 A;  1CE2 A;  2NWJ A;  2NXO A;  2R9J A;  2ZXT A;  4MLV A;  4XKR A;  5BWJ A;  3EHS A;  4PCD A;  1YPN A;  4QSC A;  2H5Y A;  3VXB A;  4LZ5 A;  4EDP A;  5ICQ A;  3JZJ A;  1B0H A;  5CC2 A;  2ALU A;  3TMG A;  2Q8J A;  3U72 A;  3FD3 A;  3K02 A;  4RA1 A;  3SEW A;  3RQT A;  1NV6 A;  4NF8 A;  4F3G A;  2WEF A;  5KDT A;  4R6H A;  3G3J A;  1B52 A;  1S7Y A;  1PEB A;  1IIT A;  5L9M A;  4PTK A;  3KJ7 A;  2GH9 A;  1ELJ A;  1AOV A;  4QFO A;  5T3J A;  5AA1 A;  5EYH A;  3Q29 A;  1MQJ A;  1OLA A;  3EHT A;  3GBA A;  5TP9 B;  4P3L A;  5ESY A;  2LAO A;  3K1M A;  3IR1 A;  1P1U A;  3D4G A;  3UOR A;  3KJT A;  1FPE A;  2ZYK A;  3E13 X;  3QUJ A;  4N81 A;  2VOZ A;  2VD2 A;  4ND9 A;  4NF6 A;  4OMB A;  2OK2 A;  1B7H A;  4KI0 E;  1SI0 A;  4U1O A;  1B7Z A;  4N15 A;  2V4C A;  1A7L A;  1L5T A;  2Y7I A;  4N8G A;  1FQB A;  3CRB A;  2F35 A;  4LA9 A;  3G7W A;  5I58 A;  3G3G A;  3MJN A;  1FPG A;  1IUD A;  1FBP A;  3FJ7 A;  3UK4 A;  3L6G A;  4RYA A;  3OEL A;  4LQ5 A;  3OXN A;  3U94 A;  2FBP A;  3H7M A;  4AQ4 A;  1UQW A;  1MH4 A;  3MC2 A;  4H65 A;  1ATG A;  5IGA A;  1MY0 A;  4OVT A;  3S9E A;  1LEV A;  2IEE A;  4GX4 A;  3IL1 B;  1FQE A;  3LSF B;  4MEV A;  4GWU A;  1FTK A;  4WED A;  4FE8 A;  1FSA A;  2RCA A;  4GVO A;  4QFL A;  1IXI A;  1DCU A;  3CIJ A;  2A5T A;  3OSQ A;  2DWI A;  3ROJ A;  4YMB A;  2QS1 A;  2Y5L A;  4XEQ A;  4MJO A;  2O7I A;  3IOT A;  2PT1 A;  1QUJ A;  5I57 A;  3OMB A;  4H6D A;  2FHY A;  3GYY A;  1LBW A;  1FPB A;  3PV0 E;  5EQA A;  3KEI A;  3K1N A;  2XXV A;  1DBZ A;  3BIG A;  4NF0 A;  1IMA A;  3VLV A;  2ZYM A;  4IGR A;  3U92 A;  1P1O A;  4X1B A;  4G68 B;  3QAX A;  4OVR A;  4THI A;  4N8Y A;  4PQJ A;  4GL8 A;  1JQF A;  1SI1 A;  4JWX A;  4O7I A;  5HPQ A;  1JVY A;  5AE4 A;  3FVK A;  3IJO B;  1NV2 A;  5DTB A;  3TKD A;  4I40 A;  1P1Q A;  3T1B A;  1GTK A;  1IMB A;  3DP6 A;  1LBB A;  1YTV A;  4U4S A;  3TTM A;  1JVX A;  1B3H A;  1NFT A;  5A5X B;  2G93 A;  4JVC A;  4P8B A;  4AB6 A;  3N26 A;  1TT1 A;  1MH3 A;  2VP1 A;  4DXB A;  4XTC Q;  1BK4 A;  4DI4 B;  1N76 A;  4FEC A;  5CMM A;  2F8D A;  1SD3 A;  1JNF A;  1A55 A;  2O69 A;  4ZS9 A;  5I59 A;  4O8M A;  4G77 A;  4PP0 A;  4NMY A;  4P56 A;  1NI9 A;  5EHS A;  2X7Q A;  3PPO A;  4BDL A;  1BP5 A;  4ZDM A;  1M5F A;  4X48 A;  4OEV A;  3IB1 A;  2BJI A;  4MNI A;  3SEU A;  3S9L C;  4OAN A;  1FTO A;  3O28 A;  3PD8 A;  1DMB A;  1FPD A;  1QUL A;  3WAF A;  1FTL A;  2XWI A;  2GRV A;  4NED A;  4PBQ A;  2XXW A;  3DM0 A;  1ZKB A;  2H25 A;  4LN5 A;  3TTL A;  4UAB A;  3WAE A;  4EF2 A;  4C1U A;  3QSL A;  2HXW A;  1LAF E;  3C34 A;  3TEL A;  2PVU A;  4R6Y A;  3H6U A;  2Z23 A;  4IO4 A;  3PD9 A;  5JK4 A;  1H43 A;  4H0W A;  4QHQ A;  2RCB A;  2HFB A;  1ZBM A;  3ODB A;  1SW1 A;  5TPA B;  3PGF A;  3DEL B;  5H8N B;  1FRP A;  2NUV A;  1A8F A;  1LFG A;  4IY5 A;  3P7I A;  4HCW A;  2B4M A;  4MMP A;  1UTH A;  2FNC A;  3ILT B;  5IZ3 B;  3Q27 A;  3MP6 A;  4IO7 A;  3IX1 A;  1FPK A;  3EQ1 A;  3E4R A;  4F1V A;  2DE3 A;  1DTZ A;  2OWT A;  3OO8 A;  3RUM A;  1ZIU A;  4N91 A;  4KQP A;  2CZI A;  3T9V A;  2DWJ A;  1FPL A;  1US5 A;  1DPP A;  2WYP A;  2PBW A;  1VFD A;  1UIU A;  4KXP A;  3D1R A;  5DEX A;  4Z0I A;  3OD7 A;  2F3D A;  3SDF A;  4MAG A;  4XKP A;  3ZKL A;  3C31 A;  3LR1 A;  4XKN A;  5DYH A;  3KG2 A;  2HAU A;  5H8H A;  4R9G A;  2OLB A;  2DE2 A;  4O3B A;  2OX3 A;  3VV5 A;  4H8J A;  3VVE A;  4QFK A;  2X7P A;  4YKJ A;  2DYX A;  3PUY E;  4HE2 A;  4X04 A;  4ZED A;  5AA2 B;  1B5I A;  3THI A;  5I3S A;  5H8F A;  2F6G A;  5EYF A;  3QXM A;  3TTR A;  4GWY A;  3A3C A;  1OMP A;  4R2B A;  3TCG A;  4I3Y A;  3T0J A;  2FA7 A;  2DP8 A;  2HXR A;  3TEP A;  3LSW A;  4FAT A;  4L17 A;  4U2R A;  5JTY A;  1US4 A;  4PAF A;  1B9J A;  2OWZ A;  4DZ1 A;  3RTF B;  1URS A;  4XF5 A;  1NH8 A;  1Y1Z A;  4R72 A;  3V5A A;  1AIV A;  4AS4 A;  3KGC A;  4BDQ A;  2UVI A;  2ONR A;  1MXU A;  5CMB A;  4C1T A;  1FBC A;  4U1Z A;  1Y20 A;  4GWO A;  2I0C A;  1NV1 A;  4R9F A;  3I5O A;  1A99 A;  2XD2 A;  5ITP A;  4NF4 B;  4X9T A;  4ISU A;  2Z8F A;  1MM7 A;  1GV8 A;  2WX9 A;  4GBV A;  1I69 A;  3MP1 A;  2Q2A A;  5TU0 A;  4KCC A;  3S9M C;  5F24 A;  2F36 A;  4OHN A;  1O64 A;  5FTI A;  1SDX A;  3T96 B;  5I2N A;  1ANF A;  4KFQ A;  3RT8 A;  1PBP A;  4G2Z A;  1EU8 A;  4NF6 B;  1R1N A;  2O6A A;  2OJT A;  3USD A;  1K9Z A;  3MVZ A;  3MVY A;  3IOU A;  3NOH A;  3CG1 A;  1II5 A;  1XVY A;  3A29 A;  4PDD A;  2XXY A;  1B58 A;  3O6I A;  4WXJ A;  5L8D A;  1B3F A;  1EZP A;  2AL5 A;  2WBD A;  5I56 A;  1Y3Q A;  4MHF A;  5I58 B;  5KCJ A;  2ONK E;  4MX6 A;  4Q30 B;  5ITO A;  3ZKK A;  3C32 A;  5FHO A;  4GX3 A;  4F3B A;  2UVH A;  1MM6 A;  5I84 A;  3PMX A;  3K6V A;  3SKP A;  4POX A;  2HZL A;  3CVG A;  4R74 A;  1QJM A;  1J1N A;  4HTG A;  4BDN A;  3BFT A;  1POY 1;  1RDY A;  4OEU A;  2OWS A;  4FJP A;  2F97 A;  3RT6 B;  1D4N A;  3N94 A;  3R26 A;  5L9O A;  1Q35 A;  2A5T B;  2XXR A;  3PU5 A;  1Y3P A;  2R71 A;  2V3T A;  2XX8 A;  3SET A;  4E0W A;  1DPE A;  3MP8 A;  4NF5 A;  4GOT A;  2Q88 A;  5DVF A;  3KSX A;  1JP4 A;  4R6K A;  2XWK A;  1FJ6 A;  4P0I A;  1LST A;  4OER A;  4I1D A;  4RPN A;  3RPL A;  4OET A;  4HE1 A;  4LZ8 A;  3HO7 A;  1BLF A;  4NQ8 A;  4N17 A;  5AA3 A;  2HZK A;  1EZO A;  2DXR A;  3G3H A;  1P99 A;  2ZMB A;  4PFY A;  2QMW A;  4ELP A;  3T9X B;  3TTN A;  1B7U A;  1P1W A;  5BUU A;  3CHG A;  1Z7M E;  1SW4 A;  2O68 A;  3MPL A;  3MZ9 A;  4KD5 A;  1ZLQ A;  4ELR A;  4ESW A;  4P11 A;  3UP9 A;  4F29 A;  3OSR A;  4JVD A;  1B32 A;  3MYU A;  3B7D A;  3OO6 A;  3OO7 A;  1JW5 A;  2NVU B;  3VXC A;  1MQD A;  4OWD A;  4QF9 A;  1Y3N A;  4PFI A;  1M5D A;  1S50 A;  1AWB A;  2AL4 A;  4RK2 A;  2HEU A;  3E3K A;  1USY E;  2H4I A;  5I5P A;  1RYO A;  2KR0 A;  1WOD A;  4YIC A;  5ET6 A;  3ZSF A;  2REG A;  4PFB A;  4NGU A;  4NWC A;  1M5B A;  3MVW A;  1MXX A;  1QW0 A;  5J1D A;  3LSX A;  1TWY A;  1PB7 A;  2GHA A;  3M3L A;  2RC8 A;  4N6D A;  1Y4C A;  1FQA A;  2L5V A;  1NV0 A;  2THI A;  1HSE A;  2YJP A;  4WKM A;  4QFN A;  4ZEF A;  4X8R A;  2DVZ A;  1POT A;  1Z7N E;  3RGY A;  4OFL A;  3K0V A;  3LBS A;  5ISU A;  1D9Q A;  1Q9D A;  2QRY A;  1YXI A;  5CI5 A;  1JET A;  2F5X A;  4ZZA A;  4ZEI A;  4OTE A;  2H98 A;  1BKA A;  4JSO A;  5H8Q A;  1EYI A;  4PGN A;  1GGG A;  3OEK A;  1LB9 A;  4BDM A;  1VDW A;  1B3L A;  2HAV A;  1YYZ A;  2E1S A;  2XA5 A;  2I0B A;  3MAM A;  3FJG A;  5FBP A;  4RNS A;  5K2Y A;  2WKY A;  1MS7 A;  3UIF A;  4HCY A;  2ZNU A;  1MPC A;  3FXB A;  2OCU A;  4ELQ A;  5AA2 D;  1Q1K A;  2G29 A;  2P3N A;  1JW4 A;  2BJJ X;  4M4G A;  2UYF A;  1SYH A;  2CEX A;  2I3V A;  4GXA A;  4PAI A;  3JV9 A;  5B70 A;  4N6K A;  2Z22 A;  2CZL A;  1LAH E;  4ZEK A;  1SQY A;  1VR5 A;  1VE4 A;  5K2X A;  4N6P A;  3T9U A;  4OEN A;  5H8H B;  3IO4 A;  3HHG A;  1RDX A;  4YKP A;  1LFI A;  1MXZ A;  3KSJ A;  1N3W A;  1B3E A;  3K6X A;  3M3K A;  1O7T A;  3K1P A;  3SEV A;  1B5H A;  4TLM B;  2Z8D A;  2XWV A;  3FV1 A;  3H03 A;  5H8F B;  5CBS A;  2P0S A;  4TOZ A;  4F2O A;  1XI6 A;  3FAT A;  3MUQ A;  4G4P A;  3CSG A;  1VFE A;  4PE5 B;  3FUZ A;  5EYG A;  2CZK A;  5JTY B;  4YB6 A;  1FJ9 A;  2RIN A;  2D21 A;  1IMC A;  3PTY A;  1FTM A;  3HCQ A;  1YZ0 A;  4P1E A;  4LUB A;  1URD A;  2RC9 A;  1RKM A;  4Q0C A;  1PDA A;  1FQC A;  3TCF A;  1NNK A;  3CFL A;  4EXL A;  3H6T A;  1LBX A;  2V3Q A;  1N7W A;  3T22 A;  4FOR A;  3A09 A;  1QUK A;  2CZH A;  2DVC A;  4PFR A;  4OVQ A;  3OEN A;  4MNC A;  4OQO A;  4N13 A;  1R9L A;  4KPT A;  4UAC A;  1MDP 1;  4POW A;  2HCA A;  3PMW A;  3MW0 A;  1OIB A;  3JYR A;  4G8M A;  4JSD A;  4PC9 A;  5ET8 A;  3B50 A;  2XXX A;  3MBP A;  2V93 A;  3TCH A;  1JEV A;  3PUZ E;  3LC8 A;  2QFL A;  2Q89 A;  2Q74 A;  3KBZ A;  3KN7 A;  1AL3 A;  4TLL B;  2UYE A;  5I2N B;  2XXT A;  1QGX A;  2R6G E;  3SES A;  4LP2 B;  4IR8 A;  4JDF A;  1NV4 A;  4PET A;  2P1S A;  5LOM A;  1Y9U A;  1PC3 A;  4I9D A;  1PB9 A;  3ECR A;  5FTH A;  5J16 A;  5CMK A;  4U21 A;  2I3W A;  3VLW A;  1QKB A;  4QBA A;  1N84 A;  1NUX A;  2QS4 A;  2XX7 A;  1LAX A;  1MXV A;  4MLQ A;  5KCJ B;  1N04 A;  3FBP A;  4GX6 A;  3L6H A;  3MWB A;  3TFL A;  1D3K A;  4TQU Q;  2MKZ A;  1B4Z A;  4OXV A;  3ZS6 A;  1FCK A;  2Y7K A;  3SER A;  2X26 A;  2B4L A;  5H8S A;  1FPF A;  2XD3 A;  3TTK A;  3EHU A;  1IZ1 A;  4O7M A;  4OVP A;  3G3K A;  4PE3 A;  3ONM A;  3IO6 A;  4KYD A;  1LAG E;  2I4C A;  1KWH A;  4RY1 A;  3GBB A;  5A5L A;  2HQ0 A;  3CR9 A;  4AB5 A;  4GXS B;  4ELO A;  1SVX B;  2HPG A;  1R9Q A;  2DDK A;  3W9V A;  4HXV A;  3FAS A;  2DOJ A;  1LGB C;  2DQV A;  2VPO A;  2Z8E A;  1FTA A;  4R2F A;  1NNP A;  2XXP A;  4IY6 A;  4JWY A;  1H76 A;  3EKI A;  1GVC A;  3IOV A;  5EHM A;  3E78 A;  2ONS A;  5IKB A;  4RJZ A;  4F3S A;  1N0T A;  5CMC A;  5HBC A;  3UA8 A;  3M3F A;  4PF6 A;  4NAP A;  4N07 A;  1FQD A;  1NNT A;  3B6Q A;  1DSN A;  3H6V A;  1N7X A;  4OVS A;  1WVJ A;  4PFW A;  3C35 A;  1IMD A;  1SW2 A;  1OVT A;  4DXC A;  1MY1 A;  3QUF A;  1BTJ A;  3QK6 A;  2Y7W A;  1USY H;  4PF8 A;  4O94 A;  1SYI A;  2PT2 A;  3FVO A;  4DCX A;  4QXD A;  5DVI A;  2QS2 A;  1URG A;  2GQ1 A;  3MVX A;  3SZP A;  3FXQ A;  2F34 A;  3K00 A;  4NF8 B;  3MPK A;  1IXC A;  3KN3 A;  4PFT A;  3MZ1 A;  5KDT B;  1FQF A;  1IXG A;  1WDN A;  2YLN A;  3OEM A;  2FIE A;  3HST A;  2DSF A;  3K6W A;  1B4H A;  4IGT A;  1MQI A;  2E0S A;  4UA8 A;  3GLB A;  3SEY A;  4LAT A;  1B51 A;  1ZU0 A;  2F7B A;  4MCO A;  4PAK A;  5B7D A;  2VD3 A;  3HFU A;  1TXF A;  4G61 A;  1KA1 A;  3N5L A;  1UTB A;  3LSL A;  2VHA A;  1XS5 A;  3BBR A;  5F1Q A;  4OVJ A;  1QUI A;  3B6T A;  3TPA A;  2CEY A;  1SW5 A;  5EQ7 A;  2UVJ A;  1B3G A;  3H06 B;  3HV1 A;  3B6W A;  1IME A;  3N6T A;  1SBP A;  3IB2 A;  4P0G A;  1AMF A;  1JEU A;  4JVI A;  5H8Q B;  4O3C A;  1XC1 A;  3CFZ A;  5ET7 A;  2F7C A;  3W15 C;  4EXK A;  2H9B A;  1ZJL A;  5ELV A;  2GHB A;  1B46 A;  4PBH A;  3PUW E;  4GIZ A;  5I7I A;  3G3I A;  1FW0 A;  3OOA A;  1CB6 A;  2F7A A;  4JBZ A;  1G0I A;  3MST A;  1XHY A;  1IIW A;  2QPQ A;  1I6B A;  3VE1 B;  5ICT A;  1DK4 A;  5IM2 A;  2DXY A;  3DP4 A;  2ABH A;  2XX9 A;  3IFC A;  5I57 B;  4ESX A;  1Y1M A;  4G8N A;  4LON B;  3C36 A;  2W7Y A;  3IOW A;  3UN6 A;  5AA4 A;  4EQB A;  4PGP A;  4O3A A;  2VPN A;  4JWO A;  4RXL A;  1B6H A;  1IEJ A;  2I48 A;  4DDD A;  4IO5 A;  4NTL A;  4GFR A;  4MFI A;  5JEI A;  2OBG A;  2QJE A;  4ZZE A;  4NHB A;  4EF1 A;  1XOC A;  1EYJ A;  1NH7 A;  4H1X A;  5I2K A;  4RPO A;  2Q2C A;  1I6Q A;  3BFU A;  1NUY A;  2P3V A;  3O97 A;  3QYT A;  2H99 A;  1MPB A;  1F9B A;  3PPR A;  4YAH X;  5DT6 A;  3RY3 A;  3TYH A;  4I62 A;  4KYE A;  3MZB A;  4GWW A;  3T93 B;  2Y5K A;  1H44 A;  2XWO A;  2B3B A;  4P9K A;  2VGQ A;  4BDO A;  1HSJ A;  1T0K A;  4BLA A;  3KC0 A;  4X1D A;  1A54 A;  2V3U A;  3H4Z A;  3B8B A;  5I59 B;  1OQH A;  2I49 A;  4YB5 A;  1I6A A;  4NG7 A;  4IO6 A;  4IO2 A;  3FGS A;  2O1M A;  1LBY A;  2O1L A;  3Q25 A;  2ZYN A;  2VT5 A;  4NF4 A;  4HE0 A;  3VVF A;  4F39 A;  3RTW B;  4P47 A;  4F2Q A;  1M5C A;  4KHZ E;  4H67 A;  3R6U A;  1RDZ A;  1RYX A;  1BIY A;  4MF3 A;  4H46 A;  3Q26 A;  5F7V A;  1TFD A;  1M5E A;  3EN3 A;  1AH5 A;  2O84 X;  1DOT A;  4OA4 A;  3A3U A;  1FTJ A;  4H45 A;  4E0X A;  3RPW A;  1MG1 A;  4H5G A;  1ZTY A;  3PPN A;  2QVU A;  1ZMG A;  1R6Z A;  1MY4 A;  1DTG A;  2AIX A;  4YKK A;  4FBP A;  1FBH A;  1QVS A;  4GLI A;  3TZA A;  2M8C A;  3EF7 A;  2DWA A;  2XXI A;  2I6E A;  4F3P A;  1B40 A;  4RK9 A;  5CBR A;  3VDF A;  1MPD A;  4OYV A;  1LCF A;  3TAJ A;  4XKQ A;  3C4M A;  2AYS A;  1UTH B;  1LB8 A;  1MQH A;  3C33 A;  1Y4T A;  4JB7 A;  3O2A A;  4KR5 A;  3VFJ A;  2UVG A;  3PPQ A;  5LTC A;  2XXU A;  4ZEC A;  3T9H B;  3LV0 A;  2QL3 A;  1MDQ A;  2PX1 A;  3FVN A;  4XXU A;  5CRY A;  2D3I A;  4LVQ A;  1B2H A;  2Y7R A;  4YKI A;  3M8U A;  4GQO A;  2IA4 A;  4PDH A;  1OLC A;  5DEX B;  4N4U A;  2ZZX A;  4IB2 A;  4HW8 A;  1N3X A;  3GZG A;  4IO3 A;  4MH5 A;  3N6U A;  4GD5 A;  4DE8 A;  4F22 A;  4ECF A;  3RYD A;  3VLU A;  3K6U A;  2B65 A;  4C0R A;  4F19 A;  1NUW A;  3QMF A;  4H5F A;  5IZ1 A;  3IAZ A;  4DXU A;  4FED A;  2QMX A;  4FEB A;  4NWD A;  4P1L A;  1A8E A;  1YAE A;  3EPE A;  1FPJ A;  3D4C A;  2WBB A;  4GWS A;  2PFY A;  3C9H A;  3Q28 A;  4Z7E A;  3E79 A;  1NMU A;  1KZ8 A;  2ESN A;  2PYY A;  4GRK A;  1G0H A;  2R8T A;  1D9Y A;  1IMF A;  3CFX A;  5TP9 A;  4NE4 A;  3KOS A;  1XT8 A;  4YZZ A;  4Q8R A;  4OZ9 A;  2REJ A;  2B3F A;  4GL0 A;  1MXY A;  3TDJ A;  4KYS A;  3KN8 A;  4GBW A;  1HSL A;  1FBF A;  2QSX A;  1NV7 A;  3HPI A;  1NL5 A;  4KCD A;  1O63 A;  3GXA A;  4DI3 D;  2P2A A;  4ZE9 A;  1UTB B;  4FAJ A;  1YCJ A;  2QS3 A;  4OFJ A;  1B05 A;  3FVG A;  5IZZ A;  4QSE A; 
#chains in the Genus database with same CATH homology
 3UGW A;  4EUO A;  4QRZ A;  2ZNT A;  3CSB A;  5I56 B;  4U22 A;  3CG3 A;  3FIR A;  3K4U A;  2Y7P A;  4MBP A;  1QKA A;  2RF1 A;  1A40 A;  3VVD A;  2DE4 A;  4JXI A;  1B0L A;  2V84 A;  3OO9 A;  2I58 A;  4H8I A;  3K2D A;  3TOD A;  3K01 A;  3S2V A;  3G3F A;  4F18 A;  2Q9T A;  3IB0 A;  3CI8 A;  4G8H A;  3U93 A;  3IK6 B;  4ZE8 A;  2NOO A;  5DVJ A;  3V89 B;  2GFE A;  1XVX A;  4M1V A;  5HM4 B;  4DLD A;  3IOR A;  3V83 A;  4G68 A;  1MQG A;  5CM6 A;  3QIM A;  4NF5 B;  4YU0 A;  3DLN A;  1MY2 A;  3KBR A;  1H3D A;  2XHD A;  4DCY A;  5AA4 B;  3U8Q A;  3AXF A;  4YB7 A;  3TQL A;  3IJX B;  4F31 B;  1IXH A;  3FXU A;  4BDR A;  3F11 A;  3MQ9 A;  3T66 A;  2V25 A;  3S4U A;  4OFO A;  1LLS A;  5A5X A;  3RLF E;  4U4X A;  5I2K B;  4LQ2 A;  2I4B A;  1P1N A;  2O51 A;  3O6H A;  4Q5T A;  4EQ9 A;  1IQ7 A;  1S9T A;  2ZYO A;  2FYI A;  4F1U A;  4ZEB A;  3I3V A;  3DP8 A;  2OZZ A;  1EH3 A;  3RNN A;  4GF8 A;  3U1O A;  1NNF A;  3O9P A;  5FHM A;  1TFA A;  2XXH A;  4EQ7 A;  5IAI A;  3PMV A;  3H6W A;  2PMS A;  2DWH A;  3O6G A;  1MRP A;  3FXR A;  2RC7 A;  1H45 A;  4F1Y A;  3O29 A;  2ANJ A;  3FZV A;  2A5S A;  3FJM A;  3V8X B;  1OQG A;  1VSO A;  3W9W A;  4K3F A;  1OVB A;  3TUS A;  3I6V A;  1PBQ A;  2Y84 A;  4YMA A;  3R7X A;  5FHN A;  2UXA A;  1LCT A;  1B5J A;  2ZNS A;  4U23 A;  3S9N C;  4QSD A;  1MY3 A;  4WEP A;  1B1H A;  5TPA A;  5H8N A;  3E9X A;  1JW1 A;  2KLF A;  3SEX A;  3HN0 A;  1D9V A;  3PPP A;  2DS9 A;  3RN8 A;  1EZ9 A;  3HHF A;  1LFH A;  4PFU A;  5M2V A;  4ONY A;  3TQW A;  2XXQ A;  4I8C A;  4R75 A;  3FV2 A;  2YPN A;  2RKM A;  4G68 C;  4OES A;  4XIG Q;  3O66 A;  3LUY A;  1PB8 A;  2O7U A;  2CMO A;  4HS7 A;  3H3G A;  3PUX E;  4FIM A;  4R73 A;  3KOT A;  2D5W A;  4QFP A;  3BKI B;  4LZ7 A;  1B1X A;  5KZT A;  1MXW A;  3KFM A;  1LBC A;  5AA2 A;  3KZG A;  3PUV E;  4DIG A;  2F78 A;  1UIV A;  3ILU B;  5L9S A;  1NKX A;  2F6P A;  1GR2 A;  1CE2 A;  2NWJ A;  2NXO A;  2R9J A;  2ZXT A;  4MLV A;  4XKR A;  5BWJ A;  3EHS A;  1YPN A;  4QSC A;  2H5Y A;  3VXB A;  4LZ5 A;  4EDP A;  5ICQ A;  3JZJ A;  1B0H A;  5CC2 A;  2ALU A;  3TMG A;  2Q8J A;  3U72 A;  3FD3 A;  3K02 A;  4RA1 A;  3SEW A;  3RQT A;  4NF8 A;  4F3G A;  5KDT A;  4R6H A;  3G3J A;  1B52 A;  1S7Y A;  1PEB A;  1IIT A;  5L9M A;  3KJ7 A;  2GH9 A;  1ELJ A;  1AOV A;  4QFO A;  5AA1 A;  3Q29 A;  1MQJ A;  1OLA A;  3EHT A;  3GBA A;  5TP9 B;  2LAO A;  3K1M A;  3IR1 A;  1P1U A;  3D4G A;  3UOR A;  3KJT A;  2ZYK A;  3E13 X;  3QUJ A;  2VOZ A;  2VD2 A;  4ND9 A;  4NF6 A;  4OMB A;  2OK2 A;  1B7H A;  4KI0 E;  1SI0 A;  4U1O A;  1B7Z A;  1A7L A;  1L5T A;  2Y7I A;  1FQB A;  3CRB A;  2F35 A;  4LA9 A;  3G7W A;  5I58 A;  3G3G A;  3MJN A;  1IUD A;  3FJ7 A;  3UK4 A;  3L6G A;  4RYA A;  3OEL A;  4LQ5 A;  3OXN A;  3U94 A;  3H7M A;  4AQ4 A;  1UQW A;  1MH4 A;  3MC2 A;  4H65 A;  1ATG A;  1MY0 A;  3S9E A;  2IEE A;  3IL1 B;  1FQE A;  3LSF B;  1FTK A;  4WED A;  4FE8 A;  2RCA A;  4GVO A;  4QFL A;  1IXI A;  3CIJ A;  2A5T A;  3OSQ A;  2DWI A;  4YMB A;  2QS1 A;  2O7I A;  3IOT A;  2PT1 A;  1QUJ A;  5I57 A;  3OMB A;  4H6D A;  3PV0 E;  3KEI A;  3K1N A;  2XXV A;  3VLV A;  2ZYM A;  4IGR A;  3U92 A;  1P1O A;  4X1B A;  4G68 B;  3QAX A;  4THI A;  4PQJ A;  4GL8 A;  1JQF A;  1SI1 A;  4JWX A;  5HPQ A;  1JVY A;  5AE4 A;  3FVK A;  3IJO B;  5DTB A;  3TKD A;  1P1Q A;  1GTK A;  3DP6 A;  1LBB A;  1YTV A;  4U4S A;  3TTM A;  1JVX A;  1B3H A;  1NFT A;  5A5X B;  2G93 A;  4AB6 A;  3N26 A;  1TT1 A;  1MH3 A;  2VP1 A;  4DXB A;  4XTC Q;  1N76 A;  4FEC A;  5CMM A;  2F8D A;  1SD3 A;  1JNF A;  1A55 A;  2O69 A;  4ZS9 A;  5I59 A;  4G77 A;  4PP0 A;  4NMY A;  5EHS A;  2X7Q A;  3PPO A;  4BDL A;  1BP5 A;  4ZDM A;  1M5F A;  4X48 A;  4OEV A;  3IB1 A;  3SEU A;  3S9L C;  1FTO A;  3O28 A;  3PD8 A;  1DMB A;  1QUL A;  3WAF A;  1FTL A;  2GRV A;  4NED A;  2XXW A;  3DM0 A;  1ZKB A;  2H25 A;  3TTL A;  3WAE A;  4EF2 A;  4C1U A;  3QSL A;  2HXW A;  1LAF E;  3C34 A;  3TEL A;  2PVU A;  4R6Y A;  3H6U A;  2Z23 A;  4IO4 A;  3PD9 A;  5JK4 A;  1H43 A;  4H0W A;  4QHQ A;  2RCB A;  2HFB A;  1ZBM A;  3ODB A;  1SW1 A;  5TPA B;  3PGF A;  3DEL B;  5H8N B;  2NUV A;  1A8F A;  1LFG A;  4IY5 A;  3P7I A;  4HCW A;  1UTH A;  2FNC A;  3ILT B;  3Q27 A;  3MP6 A;  4IO7 A;  3IX1 A;  3EQ1 A;  3E4R A;  4F1V A;  2DE3 A;  1DTZ A;  2OWT A;  3OO8 A;  3RUM A;  1ZIU A;  4KQP A;  3T9V A;  2DWJ A;  1US5 A;  1DPP A;  2PBW A;  1VFD A;  1UIU A;  5DEX A;  4Z0I A;  3OD7 A;  3SDF A;  4XKP A;  3ZKL A;  3C31 A;  3LR1 A;  4XKN A;  5DYH A;  3KG2 A;  2HAU A;  5H8H A;  4R9G A;  2OLB A;  2DE2 A;  4O3B A;  3VV5 A;  4H8J A;  3VVE A;  4QFK A;  2X7P A;  4YKJ A;  2DYX A;  3PUY E;  4ZED A;  5AA2 B;  1B5I A;  3THI A;  5H8F A;  2F6G A;  5EYF A;  3QXM A;  3TTR A;  3A3C A;  1OMP A;  4R2B A;  3TCG A;  2FA7 A;  2DP8 A;  3TEP A;  3LSW A;  4FAT A;  4L17 A;  4U2R A;  5JTY A;  1US4 A;  1B9J A;  4DZ1 A;  3RTF B;  1URS A;  1NH8 A;  1Y1Z A;  4R72 A;  3V5A A;  1AIV A;  3KGC A;  4BDQ A;  2UVI A;  2ONR A;  1MXU A;  5CMB A;  4C1T A;  4U1Z A;  1Y20 A;  4GWO A;  2I0C A;  4R9F A;  3I5O A;  1A99 A;  2XD2 A;  5ITP A;  4NF4 B;  4X9T A;  4ISU A;  2Z8F A;  1MM7 A;  1GV8 A;  1I69 A;  3MP1 A;  2Q2A A;  5TU0 A;  4KCC A;  3S9M C;  2F36 A;  4OHN A;  1O64 A;  5FTI A;  1SDX A;  3T96 B;  5I2N A;  1ANF A;  4KFQ A;  3RT8 A;  1PBP A;  4G2Z A;  1EU8 A;  4NF6 B;  1R1N A;  2O6A A;  2OJT A;  3USD A;  3MVZ A;  3MVY A;  3IOU A;  3CG1 A;  1II5 A;  1XVY A;  2XXY A;  1B58 A;  3O6I A;  4WXJ A;  5L8D A;  1B3F A;  1EZP A;  2AL5 A;  5I56 A;  1Y3Q A;  5I58 B;  5KCJ A;  2ONK E;  4Q30 B;  5ITO A;  3ZKK A;  3C32 A;  5FHO A;  4F3B A;  2UVH A;  1MM6 A;  5I84 A;  3PMX A;  3K6V A;  3SKP A;  4POX A;  2HZL A;  3CVG A;  4R74 A;  1QJM A;  1J1N A;  4HTG A;  4BDN A;  3BFT A;  1POY 1;  4OEU A;  2OWS A;  4FJP A;  2F97 A;  3RT6 B;  1D4N A;  3N94 A;  3R26 A;  5L9O A;  1Q35 A;  2A5T B;  2XXR A;  3PU5 A;  1Y3P A;  2R71 A;  2V3T A;  2XX8 A;  3SET A;  4E0W A;  1DPE A;  3MP8 A;  4NF5 A;  4GOT A;  2Q88 A;  5DVF A;  3KSX A;  4R6K A;  4P0I A;  1LST A;  4OER A;  4I1D A;  4RPN A;  4OET A;  4LZ8 A;  3HO7 A;  1BLF A;  5AA3 A;  2HZK A;  1EZO A;  2DXR A;  3G3H A;  1P99 A;  2ZMB A;  4PFY A;  2QMW A;  4ELP A;  3T9X B;  3TTN A;  1B7U A;  1P1W A;  5BUU A;  1Z7M E;  1SW4 A;  2O68 A;  3MPL A;  3MZ9 A;  4KD5 A;  1ZLQ A;  4ELR A;  4ESW A;  4P11 A;  3UP9 A;  4F29 A;  3OSR A;  1B32 A;  3B7D A;  3OO6 A;  3OO7 A;  1JW5 A;  2NVU B;  3VXC A;  1MQD A;  4OWD A;  4QF9 A;  1Y3N A;  1M5D A;  1S50 A;  2AL4 A;  4RK2 A;  2HEU A;  3E3K A;  1USY E;  2H4I A;  1RYO A;  1WOD A;  4YIC A;  3ZSF A;  2REG A;  4NWC A;  1M5B A;  3MVW A;  1MXX A;  1QW0 A;  5J1D A;  3LSX A;  1TWY A;  1PB7 A;  2GHA A;  3M3L A;  2RC8 A;  1Y4C A;  1FQA A;  2THI A;  1HSE A;  2YJP A;  4WKM A;  4QFN A;  4ZEF A;  2DVZ A;  1POT A;  1Z7N E;  3RGY A;  4OFL A;  3K0V A;  3LBS A;  5ISU A;  2QRY A;  5CI5 A;  1JET A;  2F5X A;  4ZZA A;  4ZEI A;  4OTE A;  2H98 A;  1BKA A;  4JSO A;  5H8Q A;  1GGG A;  3OEK A;  1LB9 A;  4BDM A;  1B3L A;  2HAV A;  2E1S A;  2I0B A;  3MAM A;  3FJG A;  4RNS A;  5K2Y A;  2WKY A;  1MS7 A;  3UIF A;  4HCY A;  2ZNU A;  1MPC A;  2OCU A;  4ELQ A;  5AA2 D;  1Q1K A;  2G29 A;  1JW4 A;  2BJJ X;  4M4G A;  2UYF A;  1SYH A;  2I3V A;  4GXA A;  3JV9 A;  5B70 A;  2Z22 A;  2CZL A;  1LAH E;  4ZEK A;  1SQY A;  1VR5 A;  1VE4 A;  5K2X A;  4N6P A;  3T9U A;  4OEN A;  5H8H B;  3IO4 A;  3HHG A;  4YKP A;  1LFI A;  1MXZ A;  3KSJ A;  1N3W A;  1B3E A;  3K6X A;  3M3K A;  1O7T A;  3K1P A;  3SEV A;  1B5H A;  4TLM B;  2Z8D A;  3FV1 A;  3H03 A;  5H8F B;  5CBS A;  2P0S A;  4TOZ A;  4F2O A;  3FAT A;  3MUQ A;  4G4P A;  3CSG A;  1VFE A;  4PE5 B;  3FUZ A;  5JTY B;  4YB6 A;  2RIN A;  2D21 A;  1FTM A;  3HCQ A;  4LUB A;  1URD A;  2RC9 A;  1RKM A;  4Q0C A;  1PDA A;  1FQC A;  3TCF A;  1NNK A;  3CFL A;  4EXL A;  3H6T A;  2V3Q A;  1N7W A;  3T22 A;  4FOR A;  3A09 A;  1QUK A;  2DVC A;  3OEN A;  4OQO A;  4N13 A;  1R9L A;  4KPT A;  4UAC A;  1MDP 1;  4POW A;  2HCA A;  3PMW A;  3MW0 A;  1OIB A;  3JYR A;  4G8M A;  4JSD A;  2XXX A;  3MBP A;  2V93 A;  3TCH A;  1JEV A;  3PUZ E;  3LC8 A;  2Q89 A;  3KN7 A;  1AL3 A;  4TLL B;  2UYE A;  5I2N B;  2XXT A;  2R6G E;  3SES A;  4LP2 B;  4JDF A;  4PET A;  2P1S A;  5LOM A;  1Y9U A;  1PC3 A;  4I9D A;  1PB9 A;  3ECR A;  5FTH A;  5CMK A;  4U21 A;  2I3W A;  3VLW A;  1QKB A;  1N84 A;  2QS4 A;  2XX7 A;  1LAX A;  1MXV A;  4MLQ A;  5KCJ B;  1N04 A;  3TFL A;  3L6H A;  3MWB A;  1D3K A;  4TQU Q;  1B4Z A;  4OXV A;  3ZS6 A;  1FCK A;  2Y7K A;  3SER A;  2X26 A;  5H8S A;  2XD3 A;  3TTK A;  3EHU A;  1IZ1 A;  3G3K A;  3ONM A;  3IO6 A;  4KYD A;  1LAG E;  2I4C A;  1KWH A;  4RY1 A;  3GBB A;  2HQ0 A;  3CR9 A;  4AB5 A;  4GXS B;  4ELO A;  1SVX B;  1R9Q A;  3W9V A;  3FAS A;  2DOJ A;  1LGB C;  2DQV A;  2Z8E A;  4R2F A;  1NNP A;  2XXP A;  4IY6 A;  4JWY A;  1H76 A;  1GVC A;  3IOV A;  5EHM A;  2ONS A;  5IKB A;  4RJZ A;  4F3S A;  1N0T A;  5CMC A;  5HBC A;  3UA8 A;  3M3F A;  4N07 A;  1FQD A;  1NNT A;  3B6Q A;  1DSN A;  3H6V A;  1N7X A;  1WVJ A;  3C35 A;  4PFW A;  1SW2 A;  1OVT A;  4DXC A;  1MY1 A;  3QUF A;  1BTJ A;  3QK6 A;  2Y7W A;  1USY H;  1SYI A;  2PT2 A;  3FVO A;  4DCX A;  5DVI A;  2QS2 A;  1URG A;  3MVX A;  3FXQ A;  2F34 A;  3K00 A;  4NF8 B;  3MPK A;  1IXC A;  3KN3 A;  4PFT A;  3MZ1 A;  5KDT B;  1FQF A;  1IXG A;  1WDN A;  2YLN A;  3OEM A;  3HST A;  2DSF A;  3K6W A;  1B4H A;  4IGT A;  1MQI A;  2E0S A;  4UA8 A;  3GLB A;  3SEY A;  4LAT A;  1B51 A;  1ZU0 A;  2F7B A;  5B7D A;  2VD3 A;  1TXF A;  3N5L A;  1UTB A;  3LSL A;  2VHA A;  1XS5 A;  3BBR A;  5F1Q A;  4OVJ A;  1QUI A;  3B6T A;  3TPA A;  1SW5 A;  2UVJ A;  1B3G A;  3H06 B;  3HV1 A;  3B6W A;  3N6T A;  1SBP A;  3IB2 A;  4P0G A;  1AMF A;  1JEU A;  5H8Q B;  4O3C A;  1XC1 A;  3CFZ A;  2F7C A;  3W15 C;  4EXK A;  2H9B A;  1ZJL A;  5ELV A;  2GHB A;  1B46 A;  3PUW E;  4GIZ A;  3G3I A;  1FW0 A;  3OOA A;  1CB6 A;  2F7A A;  4JBZ A;  1XHY A;  1IIW A;  2QPQ A;  1I6B A;  3VE1 B;  5ICT A;  2DXY A;  3DP4 A;  2ABH A;  2XX9 A;  5I57 B;  4ESX A;  1Y1M A;  4G8N A;  4LON B;  3C36 A;  2W7Y A;  3IOW A;  3UN6 A;  5AA4 A;  4EQB A;  4O3A A;  4JWO A;  4RXL A;  1B6H A;  1IEJ A;  2I48 A;  4DDD A;  4IO5 A;  4NTL A;  4GFR A;  4MFI A;  5JEI A;  2OBG A;  2QJE A;  4ZZE A;  4EF1 A;  1XOC A;  1NH7 A;  4H1X A;  5I2K A;  4RPO A;  2Q2C A;  1I6Q A;  3BFU A;  3O97 A;  3QYT A;  2H99 A;  1MPB A;  1F9B A;  3PPR A;  4YAH X;  5DT6 A;  3RY3 A;  3TYH A;  4I62 A;  4KYE A;  3MZB A;  3T93 B;  1H44 A;  2B3B A;  2VGQ A;  4BDO A;  1HSJ A;  1T0K A;  4BLA A;  4X1D A;  1A54 A;  2V3U A;  3H4Z A;  5I59 B;  1OQH A;  2I49 A;  4YB5 A;  1I6A A;  4IO6 A;  4IO2 A;  3FGS A;  2O1M A;  2O1L A;  3Q25 A;  2ZYN A;  4NF4 A;  3VVF A;  4F39 A;  3RTW B;  4F2Q A;  1M5C A;  4KHZ E;  4H67 A;  3R6U A;  1RYX A;  1BIY A;  4MF3 A;  3Q26 A;  5F7V A;  1TFD A;  1M5E A;  3EN3 A;  1AH5 A;  2O84 X;  1DOT A;  3A3U A;  1FTJ A;  4E0X A;  3RPW A;  1MG1 A;  4H5G A;  1ZTY A;  3PPN A;  1ZMG A;  1R6Z A;  1MY4 A;  1DTG A;  2AIX A;  4YKK A;  1QVS A;  4GLI A;  3TZA A;  2M8C A;  3EF7 A;  2DWA A;  2XXI A;  2I6E A;  4F3P A;  1B40 A;  4RK9 A;  5CBR A;  3VDF A;  1MPD A;  4OYV A;  1LCF A;  3TAJ A;  4XKQ A;  3C4M A;  2AYS A;  1UTH B;  1LB8 A;  1MQH A;  3C33 A;  1Y4T A;  4JB7 A;  3O2A A;  4KR5 A;  3VFJ A;  2UVG A;  3PPQ A;  2XXU A;  4ZEC A;  3T9H B;  2QL3 A;  1MDQ A;  2PX1 A;  3FVN A;  4XXU A;  5CRY A;  2D3I A;  4LVQ A;  1B2H A;  2Y7R A;  4YKI A;  3M8U A;  4GQO A;  2IA4 A;  5DEX B;  1OLC A;  4IB2 A;  4HW8 A;  1N3X A;  3GZG A;  4IO3 A;  4MH5 A;  3N6U A;  4GD5 A;  4DE8 A;  4F22 A;  4ECF A;  3VLU A;  3K6U A;  2B65 A;  4C0R A;  4F19 A;  4H5F A;  3IAZ A;  4DXU A;  4FED A;  2QMX A;  4FEB A;  4NWD A;  1A8E A;  1YAE A;  3EPE A;  3D4C A;  3C9H A;  3Q28 A;  4Z7E A;  1NMU A;  2ESN A;  2PYY A;  4GRK A;  1D9Y A;  3CFX A;  5TP9 A;  4NE4 A;  3KOS A;  1XT8 A;  4YZZ A;  4Q8R A;  4OZ9 A;  2REJ A;  2B3F A;  4GL0 A;  1MXY A;  3TDJ A;  4KYS A;  3KN8 A;  1HSL A;  2QSX A;  3HPI A;  1NL5 A;  4KCD A;  1O63 A;  3GXA A;  2P2A A;  4ZE9 A;  1UTB B;  4FAJ A;  1YCJ A;  2QS3 A;  4OFJ A;  1B05 A;  3FVG A;  4QSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...