3SERA

Zn-mediated polymer of maltose-binding protein k26h/k30h by synthetic symmetrization
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGHKFEHDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
total genus 116
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3serA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3serA01
4AQ4A 3MJNA 4G8HA 3TMGA 3THIA 3KSXA 3CFLA 1A8FA 2A5TA 2ONKE 2Z22A 3CRBA 4RJZA 3CVGA 1MRPA 4NE4A 4TQUQ 4FORA 1XS5A 4HCYA 3SEXA 4BLAA 2V3QA 3TEPA 2P1SA 4I1DA 4F18A 1EZOA 5I58A 4PFUA 1MY2A 3FVGA 3UIFA 3GXAA 1LCTA 1O64A 2I58A 5AA2B 1JW4A 4GRKA 3Q26A 4DLDA 2Y84A 4ND9A 1OQHA 1LBBA 1LB8A 1F9BA 2QSXA 3JYRA 3KOSA 5F7VA 1AIVA 4H8IA 3TTKA 1B51A 3FJ7A 2QS4A 4ZZEA 4HW8A 3A3UA 1IEJA 1Z7ME 4P0GA 3K1PA 5AA4A 1HSJA 4ECFA 1M5EA 1WDNA 4Q0CA 1FTMA 4WEDA 2H4IA 1PDAA 1JEVA 4BDNA 3TUSA 1URGA 2AIXA 4RK9A 3SETA 4IGTA 2DYXA 3SEWA 4HTGA 1H44A 1Y3PA 1MY0A 2F6PA 2XHDA 3N6UA 4OERA 1I6BA 1YPNA 2I48A 4XKNA 4OYVA 3VXCA 1B3FA 2A5SA 3ILTB 3K6UA 4U2RA 4IO7A 1QKBA 5TP9B 3M8UA 1MM7A 3C9HA 1Q35A 3TTMA 2XXVA 3H06B 1USYH 2OWTA 3H6WA 3TPAA 5AA2D 1NKXA 3WAEA 3PMWA 5FHNA 3FATA 1B0HA 3LC8A 4LP2B 1MQHA 4XIGQ 1P1WA 1SYIA 5I57A 1FTLA 3O6IA 2ZYNA 3CG1A 3OEKA 4IO5A 2NVUB 4ZECA 3GBAA 4F19A 1UTHB 1B3GA 2OLBA 2XXPA 4QFNA 2XX8A 1LBCA 2AYSA 1VFDA 3T9XB 2XX7A 3T9VA 5ISUA 4ONYA 4R2BA 3VFJA 3R6UA 4F1VA 1IXHA 1MPBA 1D3KA 3O2AA 3SERA 1RKMA 3T93B 3D4CA 4FIMA 3CFXA 2IEEA 4GL8A 1QVSA 1RYXA 2OJTA 3KSJA 5FHMA 4NF5A 4KI0E 4FATA 1QULA 2ESNA 3W9WA 1SW4A 4DXBA 4NF8A 3EHUA 5H8HB 4ELOA 5CBRA 1JW1A 5ICQA 3FGSA 1II5A 2ABHA 2RINA 3EHSA 2Q2AA 2F78A 1IIWA 4JWYA 3RN8A 3MP6A 5KCJA 4OFOA 5CMBA 1LAXA 3FASA 3OELA 3PPRA 2F35A 3QIMA 3BFTA 3MVYA 4XXUA 4YMAA 4OTEA 2KLFA 1XVYA 4YKKA 1H45A 3RPWA 1FQAA 3S9LC 2VOZA 4U1OA 1B0LA 4KYSA 2M8CA 1FQBA 4N07A 4E0XA 2HQ0A 1B2HA 1MY4A 2YPNA 4KHZE 3DM0A 3ILUB 4QRZA 3UN6A 2Q89A 2V93A 4BDMA 1SVXB 2XD2A 4ISUA 4R75A 5CC2A 1GV8A 4PFYA 2YJPA 3S9EA 1WODA 3G3FA 3KBRA 1OLAA 4F1UA 4F39A 4I9DA 3IOUA 3U1OA 2UVHA 4BDLA 3IOVA 1MH3A 3KOTA 3FD3A 1BLFA 2I3WA 3O6HA 3PV0E 3C35A 3MZ1A 1IQ7A 3ODBA 1QUJA 4WEPA 5FTHA 1B1XA 1FQDA 4NEDA 4R74A 4BDQA 4H0WA 1IXGA 2O7UA 1A8EA 1LAGE 4PFTA 2F7BA 2DSFA 5IAIA 1A54A 4YMBA 4GVOA 4OQOA 4DDDA 2OCUA 5CM6A 4GIZA 3W15C 4P0IA 2I0CA 3HPIA 4NF8B 4RYAA 2DWIA 4GD5A 5H8HA 1FQFA 4PETA 4ZEFA 3GLBA 5DEXA 4F29A 1FW0A 3IOWA 5TPAA 3U72A 4ELRA 2W7YA 4DIGA 5ITPA 2ZYOA 4LQ5A 5CI5A 3MC2A 5HM4B 2R6GE 2Z8FA 1N04A 3KJ7A 4X1BA 2B3FA 1BIYA 1OLCA 1Y3NA 1ZJLA 4FE8A 4X48A 4YAHX 4MBPA 1Y4TA 4YKPA 4FEDA 1VE4A 4O3CA 3UK4A 2FNCA 4AB5A 1UIUA 3KJTA 1NNFA 4POXA 2O69A 4L17A 3FJMA 4F3SA 2GHAA 5KDTA 3ZKKA 2VP1A 3CG3A 2H25A 3OO9A 3EF7A 3HO7A 3IO6A 2X26A 2ZNSA 1OVBA 2ONSA 3CR9A 2I4CA 4PQJA 5JEIA 3PPOA 3MP1A 3PUYE 4KCDA 3IK6B 4G68B 4OEUA 3RGYA 3L6GA 5CMKA 4Q8RA 4OFLA 1ZU0A 5DYHA 4NMYA 3JZJA 1PBPA 3R26A 5AA3A 5AE4A 3MQ9A 3N94A 1SDXA 3L6HA 4G68C 2UXAA 4YB7A 5K2YA 3A09A 3MBPA 4OETA 5L9MA 3RNNA 4FAJA 2DP8A 3KGCA 2XXQA 1I6AA 1MQDA 1NMUA 3E9XA 1SQYA 3H6UA 3I6VA 4G77A 2RC9A 4FEBA 4TLLB 1GGGA 3H6VA 3K00A 4EQ9A 2DXYA 3V8XB 2LAOA 4O3BA 3T66A 1BP5A 3FXUA 3LUYA 3OEMA 3MUQA 3Q28A 4H6DA 1J1NA 2FA7A 1D9YA 3OO8A 4Z0IA 5I57B 5I59A 5TP9A 1FQEA 4R6YA 4ZDMA 4DE8A 1DTZA 2DOJA 1MXZA 3K6VA 4ELQA 3HN0A 4DZ1A 1P99A 3DP8A 3U93A 1R6ZA 1LSTA 1P1NA 1ZLQA 4M4GA 4WKMA 4EDPA 2Y7RA 3K1MA 4H65A 1MPDA 5TPAB 3S4UA 4F2QA 4F3PA 5I59B 1QJMA 2HEUA 3U8QA 1NNTA 2QS3A 5EHSA 1B46A 3DELB 3V83A 5FHOA 1BKAA 1MM6A 1MQIA 2XXHA 4IO4A 4ZEIA 2NOOA 4IY5A 3G3GA 4PP0A 4Z7EA 4OEVA 2VHAA 3TCFA 3G3IA 1MXXA 2F5XA 4G2ZA 4N6PA 2XXIA 3MZ9A 1SI0A 4RXLA 4RK2A 1M5BA 4RPOA 2OWSA 2WKYA 4PFWA 3GZGA 4GQOA 3OMBA 3LBSA 4XTCQ 1URSA 3C33A 2V25A 4QFLA 1LFIA 3MWBA 1H3DA 2OBGA 3MW0A 5F1QA 3PGFA 1JNFA 2Z23A 4JBZA 1Y1MA 4NWDA 1B3LA 2NWJA 3PD8A 4E0WA 1B40A 4XKPA 3ZS6A 1NH8A 3CI8A 2BJJX 3IO4A 3IOTA 3VLWA 4G8MA 4JSDA 4R9FA 1B5JA 3N5LA 4MH5A 4F2OA 2E0SA 4IO6A 1TFDA 3E4RA 4KYEA 2ANJA 4NF6B 4H5GA 4OVJA 3ZSFA 4NF6A 3IB0A 4C1UA 3S2VA 4IGRA 1Y20A 4YU0A 2O84X 5B7DA 2HFBA 4HCWA 1N76A 1CE2A 4PE5B 3KG2A 4DXUA 1POY1 3E3KA 3G7WA 4NF5B 3KN7A 4KPTA 3RLFE 5IKBA 4QSDA 1LFHA 3TTNA 3MP8A 2V3TA 3TDJA 3IJOB 3TKDA 1N3XA 2QPQA 4K3FA 2VGQA 1MG1A 3KZGA 5K2XA 1US5A 2H5YA 2PVUA 3LR1A 3I5OA 1AMFA 3FJGA 4JWXA 4MFIA 4QSCA 4U21A 5L9SA 1B1HA 4O3AA 1CB6A 4QFKA 4RY1A 3H03A 4U23A 4YKJA 3T96B 4R73A 2UVJA 4QFPA 2Y7PA 4MLVA 3K6WA 1N3WA 3MVZA 1LFGA 5HPQA 1S7YA 1B58A 4I62A 2ZMBA 3OSQA 1ZIUA 1DSNA 1JVYA 2XD3A 3PUVE 4QSEA 3EHTA 5JK4A 1ZBMA 4F3BA 1A55A 1B52A 1IITA 2V3UA 2YLNA 1D9VA 3FXRA 3K1NA 3LSLA 1DPPA 3FVNA 1B6HA 1MXWA 1SYHA 2XXUA 4GF8A 4YZZA 1PEBA 3TAJA 1YAEA 2Q88A 4X9TA 1USYE 4TOZA 2QS1A 3EPEA 5DT6A 3RUMA 1D4NA 3K6XA 3M3LA 3EQ1A 4P11A 5EYFA 2HXWA 4I8CA 5TU0A 4HS7A 5DVJA 5HBCA 4JWOA 1MQGA 3TCGA 2Z8EA 1MDQA 1MPCA 2B3BA 4KQPA 4NWCA 5AA4B 4JB7A 1UTBB 2HCAA 3AXFA 3DLNA 3WAFA 1DTGA 5A5XB 5I56B 2DS9A 2PT2A 4OESA 2P2AA 3PPPA 3C34A 2XXRA 3O97A 2PYYA 5ELVA 5A5XA 1MXUA 3H7MA 3P7IA 1DMBA 2THIA 4POWA 4ZEKA 2F6GA 3IX1A 1IXCA 1MY1A 4OHNA 1UIVA 3TFLA 3TCHA 1M5FA 1PC3A 1QW0A 3USDA 3TQWA 3FXQA 1O63A 1I69A 4LATA 1XC1A 1XHYA 3G3HA 2RCBA 1T0KA 3IL1B 1ZKBA 2DWJA 3QSLA 1S50A 3RQTA 1B3EA 3LSWA 3QXMA 3KN8A 4ZE9A 1DOTA 3OOAA 3PUXE 4G8NA 4LA9A 4DCXA 3CIJA 3KN3A 3VV5A 1DPEA 5KZTA 1SW1A 2X7PA 3U94A 3IJXB 3PMVA 1L5TA 3U92A 3B7DA 2PMSA 3O28A 2PX1A 4LVQA 2ALUA 1LGBC 3RY3A 1B5HA 1GR2A 2D5WA 3H6TA 3W9VA 4NF4A 1B9JA 3PUWE 3SDFA 2AL5A 2I6EA 1IUDA 1Y3QA 4MLQA 4H5FA 4YB5A 4GL0A 1XVXA 1TT1A 2O1LA 4LUBA 3FV2A 5BUUA 5H8NB 4IB2A 1Q1KA 3PPNA 3IORA 3V89B 1YCJA 5DVFA 1MY3A 1EU8A 1LCFA 1Y4CA 1ZTYA 1Y1ZA 1KWHA 2G93A 1S9TA 3MPLA 1LLSA 2XXTA 4OENA 1MDP1 1TXFA 2UVIA 3G3JA 4KFQA 5M2VA 3TZAA 3UP9A 2RKMA 5DTBA 3CSGA 3N6TA 1B3HA 3HV1A 3IAZA 3QUFA 5L8DA 3PD9A 3V5AA 4DXCA 3B6QA 1B05A 1HSEA 1NL5A 1SW2A 4LQ2A 2UYFA 2F7CA 3O29A 2GH9A 4LZ8A 1R9LA 3BKIB 2ONRA 1NNPA 5FTIA 2DVCA 1H76A 3RTFB 2O7IA 3MVWA 2O51A 1ANFA 4BDOA 1JW5A 1XT8A 4GLIA 4M1VA 2ZNUA 3PPQA 1O7TA 3TODA 3HHGA 1Y9UA 2H98A 5DVIA 3A3CA 3KEIA 2R9JA 2F8DA 4H8JA 4OMBA 1MXVA 5H8FB 3MVXA 4F3GA 2D3IA 1B5IA 4U1ZA 3SEUA 5CRYA 3KFMA 1M5CA 3QK6A 3UGWA 1Z7NE 3UA8A 4DCYA 1BTJA 2V84A 4GWOA 5CMCA 1VFEA 2RC8A 4EF2A 5KDTB 4Q5TA 2DQVA 1LB9A 1UQWA 4G4PA 5H8QB 2PBWA 3Q29A 1SW5A 4F1YA 3TQLA 1FTOA 2O1MA 1POTA 5JTYA 2REJA 3M3FA 1ELJA 2A5TB 4RNSA 1PB7A 4ELPA 2B65A 3O6GA 2Y7IA 3TTRA 3MPKA 3B6WA 3OO7A 3PUZE 3K2DA 4YKIA 3GBBA 4Q30B 5I2NB 3SEYA 5I2KA 1PB9A 2ZYMA 3S9MC 1JQFA 1EH3A 2UYEA 4ESWA 1A40A 1FQCA 2O6AA 3HCQA 4R6HA 4BDRA 2I49A 3BBRA 4H1XA 5AA1A 1N7XA 2DXRA 2ZYKA 4GFRA 4EQBA 1VSOA 3F11A 1MS7A 3VVEA 2DE4A 2DWHA 4FECA 3VVDA 2CZLA 3BFUA 4C0RA 5H8NA 4QHQA 1NH7A 2HZLA 4ESXA 2VD2A 4R6KA 4R2FA 3RT8A 2I0BA 2P0SA 3FZVA 5CBSA 1P1UA 3TELA 3FIRA 4UA8A 1R9QA 3T9HB 3VDFA 4IY6A 3OXNA 2DE3A 3CFZA 2QL3A 3C31A 1MXYA 2RC7A 4QFOA 1I6QA 3QUJA 1OIBA 1OVTA 2XX9A 2NXOA 1XOCA 3C4MA 4ZE8A 3RT6B 1EZ9A 5I56A 4IO3A 2XXWA 3VVFA 1N7WA 4X1DA 4EXKA 2CMOA 1FCKA 4LZ5A 4LZ7A 4EXLA 4UACA 3MZBA 2H9BA 1SD3A 2XXYA 1AL3A 3I3VA 4OWDA 5CMMA 3S9NC 4KR5A 2OZZA 2F7AA 2Y7KA 3JV9A 2QJEA 2AL4A 1MH4A 4MF3A 1B7UA 4ZEDA 4OZ9A 4H67A 1JEUA 1OMPA 5I2KB 1AOVA 2VD3A 3OSRA 5L9OA 2DE2A 3Q27A 3ZKLA 2QS2A 4U22A 3SEVA 2HZKA 1QUKA 1UTHA 4GXAA 4KD5A 4AB6A 5AA2A 2H99A 1FTJA 3DP4A 3N26A 4OFJA 3T9UA 2E1SA 4QF9A 4C1TA 2HAUA 1B7ZA 4FJPA 2Q2CA 3K01A 3O66A 1JETA 3CSBA 4THIA 3RTWB 2Q8JA 4YICA 3TTLA 2QMXA 5LOMA 1M5DA 1ATGA 3ONMA 3IB1A 3K02A 3OD7A 3EN3A 3Q25A 4NF4B 4XKRA 3R7XA 5I58B 2DVZA 1IXIA 3DP6A 3HSTA 3FVKA 4NTLA 1PB8A 1B7HA 1UTBA 1P1OA 1YTVA 2Q9TA 1IZ1A 2GRVA 4XKQA 2GFEA 3C36A 1TFAA 2OK2A 4RA1A 5DEXB 3H3GA 2F34A 5EHMA 1GVCA 4ZEBA 1NNKA 2F36A 2I4BA 1B32A 1QUIA 3K0VA 3VLUA 4RPNA 4YB6A 2G29A 3B6TA 2F97A 4R9GA 5BWJA 2DWAA 4TLMB 1JVXA 1URDA 3VXBA 1VR5A 2R71A 4GXSB 2ZXTA 3OENA 4ZS9A 2RCAA 4F31B 4EQ7A 3VLVA 1PBQA 1B4HA 2HAVA 3E13X 5KCJB 2RF1A 5ITOA 3FV1A 1H43A 2Y7WA 1R1NA 4JXIA 2Z8DA 4ZZAA 1TWYA 4OXVA 5I84A 5H8QA 3O9PA 1US4A 1P1QA 1LAHE 2ZNTA 3H4ZA 1B4ZA 2GHBA 3LSXA 1AH5A 3OO6A 3QAXA 4EUOA 1NFTA 3VE1B 2PT1A 3ECRA 1FTKA 3G3KA 1N0TA 2QRYA 1A99A 3MAMA 1OQGA 5J1DA 1SI1A 1SBPA 3FVOA 2REGA 3PU5A 4EF1A 1GTKA 2FYIA 3IR1A 5H8SA 4JDFA 4LONB 4G68A 4N13A 1RYOA 3M3KA 4R72A 2XXXA 1A7LA 5ICTA 2UVGA 2O68A 2X7QA 2QMWA 3PMXA 4U4SA 3T22A 1WVJA 3K4UA 4KYDA 1HSLA 4F22A 5I2NA 3C32A 4IO2A 4KCCA 4WXJA 2NUVA 1ZMGA 3D4GA 3FUZA 3QYTA 5JTYB 3HHFA 3UORA 4JSOA 1MQJA 3SESA 5B70A 4GOTA 1N84A 3IB2A 3TYHA 2I3VA 5H8FA 1LAFE 3SKPA 1EZPA 2D21A 2IA4A 4U4XA 3LSFB 1QKAA
chains in the Genus database with same CATH superfamily
3THIA 3KSXA 3CFLA 1A8FA 2A5TA 4RJZA 3CRBA 1MRPA 2V3QA 5I58A 4PFUA 3UIFA 3GXAA 2I58A 3Q26A 2DDKA 1AIVA 1LB8A 5F7VA 3TTKA 1B51A 5AA4A 2H4IA 2AIXA 3SETA 4HTGA 1H44A 2XHDA 4GX6A 1I6BA 4HE0A 4U2RA 2XXVA 3H06B 3H6WA 3TPAA 4NF0A 4H46A 5FHNA 3FATA 4GWZA 3OEKA 2XX8A 2AYSA 5ISUA 2XX7A 4R2BA 1IXHA 1MPBA 3O2AA 1RKMA 2OJTA 4KI0E 1SW4A 4DXBA 4JVDA 3RYDA 3RN8A 1EYKA 4OFOA 4MCOA 5CMBA 3BFTA 4OTEA 2KLFA 1H45A 4N15A 2M8CA 1FQBA 4E0XA 1MY4A 2V93A 2XD2A 4ISUA 4I3EA 3KBRA 1OLAA 4F39A 3KBZA 4I9DA 4BDLA 3KOTA 3FD3A 3VDFA 1QUJA 1FQDA 4NEDA 4R74A 4BDQA 2VPNA 4H0WA 2F7BA 2DSFA 4YMBA 4GVOA 4OQOA 4DDDA 3HPIA 4NF8B 4GD5A 5DEXA 5ITPA 5HM4B 2R6GE 2Z8FA 2B3FA 4FE8A 4X8RA 4O3CA 2P3VA 3FJMA 3ZKKA 3CG3A 2ONSA 3CR9A 4PQJA 3MP1A 3IK6B 1ZU0A 4N8GA 4NMYA 3JZJA 2XWIA 3MQ9A 3N94A 1SDXA 3A09A 3MBPA 2DP8A 1I6AA 4FEBA 4TLLB 3H6VA 3K00A 2LAOA 2FA7A 4R6YA 4ELQA 1LSTA 1YXIA 4M4GA 3K1MA 4F2QA 5TPAB 3U8QA 4GWYA 1NNTA 2QS3A 1BKAA 2NOOA 2F5XA 1G0IA 2XXIA 3MZ9A 1M5BA 1URSA 3C33A 4P8BA 1RDYA 3MWBA 4P9KA 1H3DA 3PGFA 4MX6A 5EQ7A 1B3LA 5EYHA 4JSDA 4OVJA 1TFDA 3E4RA 4GWXA 2ANJA 4NF6B 4NF6A 3S2VA 4YU0A 4PE5B 3E3KA 5IKBA 2V3TA 2VGQA 2H5YA 4U21A 5L9SA 1CB6A 4P47A 2UVJA 1N3WA 5IGAA 3OSQA 4P1EA 1ZIUA 1DSNA 2XD3A 5JK4A 3EHTA 4F3BA 4MIJA 1B52A 2V3UA 3NOHA 3K1NA 1B6HA 1SYHA 4PFRA 4X9TA 4TOZA 3EPEA 5DVJA 4JWOA 1MPCA 4KQPA 2PT2A 2XXRA 2PYYA 1IMAA 1MXUA 3H7MA 3IX1A 1UIVA 1PC3A 2BJIA 3TQWA 1O63A 4LATA 1XC1A 1T0KA 4OVQA 5ET7A 3VV5A 3RY3A 3B7DA 3O28A 2PX1A 4PGNA 4P3LA 2AL5A 4GL0A 1XVXA 1TT1A 2MKZA 1Q1KA 1MY3A 2XA5A 1LCFA 4GWUA 1LLSA 4OENA 1FBGA 1B3HA 3QUFA 1NV2A 1HSEA 1NL5A 3O29A 3BKIB 1H76A 3MVWA 1ANFA 4BDOA 1VDWA 2VT5A 2H98A 4F3GA 2R9JA 2F8DA 4OMBA 2D3IA 5EYGA 2V84A 2DQVA 4G4PA 1UQWA 2CZIA 5JTYA 4RNSA 1PB7A 3B6WA 1FBPA 3GBBA 4Q30B 3SEYA 1NV7A 2ZYMA 1A40A 1FQCA 4R6HA 3BBRA 5AA1A 4FECA 2CZLA 5H8NA 2VD2A 2I0BA 3T9HB 2DE3A 2QL3A 2RC7A 3QUJA 1OVTA 1FJ9A 1EZ9A 4LZ5A 4UACA 2H9BA 2XXYA 3I3VA 2F7AA 2AL4A 1MH4A 4ZEDA 4NQ8A 3LV0A 1AOVA 4OANA 3OSRA 3ZKLA 2QS2A 4U22A 1FBHA 4C1TA 4QF9A 4PAKA 1B7ZA 3K01A 3TTLA 2Q8JA 4XKRA 3K02A 3OD7A 3EN3A 5I58B 1IXIA 2QVRA 1B7HA 5DW8A 5H8NB 2GRVA 3H3GA 2HHMA 1QUIA 1YZ0A 3B6TA 1JVXA 5ICQA 1PBQA 1B4HA 2FHYA 2Y7WA 1R1NA 5H8QA 3PMXA 1P1QA 2ZNTA 3LSXA 2GHBA 2PT1A 3B8BA 1N0TA 2JJKA 1SBPA 4JDFA 4N13A 3M3KA 4R72A 2XXXA 2X7QA 3T22A 4U4SA 1WVJA 3K4UA 4KYDA 4F22A 4IO2A 3SESA 3IB2A 5CBRA 2D21A 2IA4A 3LSFB 1QKAA 4G8HA 4N81A 1FPGA 4TQUQ 4I1DA 4F18A 4DLDA 1NV5A 2Y84A 1OQHA 1F9BA 3KOSA 4HW8A 3A3UA 1HSJA 4ECFA 1M5EA 1PDAA 4BDNA 3TUSA 4IGTA 2DYXA 2F6PA 1MY0A 4OERA 3E78A 1YPNA 4XKNA 3ILTB 2PFZA 5TP9B 3M8UA 3C9HA 1Q35A 2OWTA 3SZPA 1NKXA 1P1WA 4DI4B 2NVUB 2ZYNA 3CG1A 4IO5A 3GBAA 4N6DA 3T9XB 1Q9DA 4ONYA 4F1VA 3R6UA 5IZZA 1FRPA 5EQ8A 4FIMA 2IEEA 3KSJA 1RYXA 5FHMA 2ESNA 4ELOA 4NF8A 3EHUA 5IM2A 3FBPA 5ET5A 2ABHA 5J16A 2RINA 2Q2AA 2F78A 1IIWA 3QIMA 4FBPA 3PTYA 1B2HA 4KHZE 3DM0A 3ILUB 4BDMA 4R75A 5CC2A 3S9EA 1WODA 2WX9A 3IOUA 3O6HA 1BLFA 4HXVA 3MZ1A 5FTHA 4WEPA 1IXGA 2O7UA 1A8EA 4PFTA 5IAIA 3W15C 4N4UA 5H8HA 4P1LA 4ELRA 2W7YA 2F3BA 4LQ5A 5CI5A 3KJ7A 1BIYA 1Y3NA 1ZJLA 4X48A 4MBPA 4AB5A 1VE4A 2FNCA 1NNFA 4L17A 4F3SA 2GHAA 2VP1A 3EF7A 4NN3A 3IO6A 2X26A 3PUYE 1FPLA 4KCDA 4NHBA 3B50A 5AE4A 5K2YA 2UXAA 4OETA 2FIXA 1MQDA 3E9XA 3H6UA 1FBFA 2RC9A 3V8XB 2XWKA 3BIHA 3MUQA 3OO8A 5TP9A 1FQEA 1MXZA 3HN0A 4DZ1A 3DP8A 1R6ZA 1P1NA 4WKMA 4EDPA 2Y7RA 1MPDA 4N91A 4ZEIA 2XXHA 4IY5A 3G3GA 2VHAA 3TCFA 2FVZA 4N6PA 1SI0A 4RPOA 2WKYA 2V25A 4XF5A 4QFLA 5F1QA 4JBZA 1Y1MA 3PD8A 4XKPA 3IO4A 3IOTA 1NV4A 4R9FA 1B5JA 3N5LA 2E0SA 4IO6A 3IB0A 1Y20A 2HFBA 4DXUA 4MJOA 3U65A 4QBAA 3KN7A 4KPTA 4QSDA 3TTNA 3MP8A 3ROJA 3TKDA 2QPQA 4MNCA 2GQ1A 5K2XA 2PVUA 3I5OA 4QFKA 5HPQA 3K6WA 3MVZA 1LFGA 1S7YA 4PF8A 1DK4A 1FBEA 5ESYA 1A55A 4PC9A 4I3YA 1MXWA 3TAJA 3RUMA 2QS1A 3D1RA 4P11A 2HXWA 5HBCA 1MQGA 2HCAA 3AXFA 5A5XB 5I56B 4I40A 5ELVA 4POWA 1IXCA 3FXQA 1I69A 1ZKBA 4PBQA 3QXMA 4LA9A 3CIJA 5KZTA 2ZZWA 2D5WA 3W9VA 4NF4A 2P3NA 1FPIA 3SDFA 2I6EA 1Y3QA 4MLQA 4YB5A 2O1LA 3V89B 4QXDA 1YCJA 1Y4CA 1S9TA 3MPLA 1TXFA 3GYYA 3G3JA 4JVIA 2RKMA 3HV1A 3V5AA 1SW2A 2UYFA 4LZ8A 1R9LA 1NNPA 5FTIA 2O51A 4GLIA 4M1VA 5A5LA 3A3CA 1B5IA 4U1ZA 3SEUA 1M5CA 4GWOA 5KDTB 1SW5A 4O94A 4ELPA 2B65A 4NAPA 3OO7A 4YKIA 5I2NB 1PB9A 4PBHA 4ESWA 2O6AA 4BDRA 2ZYKA 4GFRA 3KC0A 3LUZA 3VVDA 3BFUA 1D9QA 4ESXA 4PAFA 4R6KA 3RT8A 1CNQA 4HE2A 3TELA 4PTKA 4UA8A 1R9QA 1NUWA 3RPLA 3C4MA 4PAIA 5I56A 3VVFA 1N7WA 4X1DA 1FCKA 4LZ7A 4OWDA 1AL3A 2Y7KA 1B7UA 4JVCA 2CZHA 3IFAA 2HZKA 1UTHA 4KD5A 5AA2A 4OFJA 3N26A 3T9UA 3RTWB 2ZZVA 4OVRA 1ATGA 4NF4B 1DBZA 3FVKA 1PB8A 2B4MA 1P1OA 1GVCA 4RA1A 3IFCA 2OK2A 2WEFA 4ZEBA 2F36A 3K0VA 4RPNA 4R9GA 5I3SA 5BWJA 2DWAA 2QVUA 1URDA 1FPEA 1VR5A 5IZ3A 2RCAA 5KCJB 3VLVA 2RF1A 4JXIA 2Z8DA 1TWYA 2XXKA 3H4ZA 1LAHE 3ECRA 3MAMA 2QRYA 5J1DA 4EF1A 1FPFA 1GTKA 4G68A 1FSAA 1HSLA 3C32A 4WXJA 1ZMGA 3D4GA 3QYTA 5JTYB 3HHFA 4JSOA 1IMEA 1N84A 1LAFE 3SKPA 4U4XA 4E0WA 3MJNA 2ONKE 3CVGA 4BLAA 3SEXA 4HCYA 1XS5A 3CHGA 1MY2A 4ND9A 1LBBA 2QSXA 3JYRA 2KQZA 1IEJA 4P0GA 3K1PA 3MSTA 4Q0CA 4WEDA 1FTMA 1JEVA 1URGA 4RK9A 3TTRA 3SEWA 1NV1A 1Y3PA 3N6UA 4OYVA 1B3FA 3K6UA 4IO7A 4AS5A 1QKBA 3TTMA 5ICTA 1MM7A 5LDZA 4OVSA 4LP2B 5IZ1A 3LC8A 1SYIA 5I57A 1EYJA 3O6IA 4F19A 1UTHB 2OLBA 1VFDA 1D3KA 3T93B 4GL8A 1QULA 1RDZA 5H8HB 1II5A 4PF6A 3OELA 2F35A 1FBDA 3MVYA 1EYIA 4YMAA 4YKKA 1FQAA 3S9LC 2VOZA 1B0LA 4KYSA 5ET6A 3KC1A 2HQ0A 2YPNA 3FXBA 2Q89A 3UN6A 1SVXB 1GV8A 2YJPA 3G3FA 4GWSA 3U1OA 2UVHA 4OA4A 1MH3A 5IZ3B 5F24A 2I3WA 3ODBA 3T0JA 1B1XA 1LAGE 1FTAA 5CM6A 4GIZA 4P0IA 4RYAA 1FQFA 1QGXA 4PETA 3GLBA 5TPAA 3IOWA 2Y5KA 4DIGA 2ZYOA 4X1BA 1N04A 4YAHX 1OLCA 4ZECA 4YKPA 3UK4A 4FEDA 1FPKA 1UIUA 4POXA 2H25A 2F3DA 3HO7A 2VPOA 2I4CA 4G68B 4IR8A 5CMKA 3R26A 5AA3A 4G68C 3L6HA 3RNNA 3KGCA 2XXQA 4EQ9A 3A29A 2DXYA 3T66A 1BP5A 3FXUA 3LUYA 3Q28A 1J1NA 1D9YA 5I57B 2DOJA 3K6VA 1KA0A 3S4UA 1QJMA 5EHSA 1MM6A 1MQIA 4IO4A 1YYZA 1DCUA 4ZDMA 4RXLA 4RK2A 2OWSA 4PFWA 5EQ9A 4GQOA 4O7IA 4XTCQ 3ISPA 1LFIA 4MNPA 1JNFA 1NUXA 2NWJA 2BJJX 3VLWA 4G8MA 4N17A 4KYEA 1G0HA 4C1UA 2Y5LA 5B7DA 4DI3D 4HCWA 3KG2A 1LFHA 3TDJA 3IJOB 1N3XA 2FIEA 4K3FA 3KZGA 4QSCA 1B1HA 4RY1A 3T96B 4MLVA 1B58A 2ZMBA 1JVYA 4QSEA 1ZBMA 2YLNA 3FXRA 4PGPA 3LSLA 3FVNA 4HE1A 2Q88A 5DT6A 1USYE 1D4NA 3K6XA 3EQ1A 4I8CA 5TU0A 3TCGA 2Z8EA 1MDQA 5AA4B 1FPBA 4JB7A 3DLNA 3WAFA 1DTGA 2P2AA 3C34A 3O97A 5A5XA 3P7IA 2THIA 3RT6B 5LTCA 2F6GA 4OHNA 3TCHA 1M5FA 1QW0A 3USDA 1FBCA 1LEVA 1XHYA 2RCBA 2DWJA 3QSLA 1S50A 1B3EA 1KA1A 1DOTA 4G8NA 3KN3A 1DPEA 1L5TA 3PMVA 3U92A 2PMSA 4LVQA 2WYKA 1B5HA 3H6TA 1B9JA 3PUWE 4AS4A 1IUDA 4LUBA 3FV2A 4IB2A 3PPNA 3IORA 5DVFA 1EU8A 1Y1ZA 2G93A 1MDP1 2UVIA 4KFQA 2OX3A 3IAZA 3E79A 3PD9A 4DXCA 3B6QA 1B05A 4PDDA 4MEVA 2ONRA 1XI6A 3RTFB 2O7IA 1JW5A 3PPQA 1O7TA 3TODA 5DVIA 1Y9UA 3KEIA 4H8JA 1MXVA 3MVXA 3KFMA 3QK6A 3UGWA 1Z7NE 3UA8A 4EF2A 5CMCA 1VFEA 2RC8A 2R8TA 4Q5TA 5H8QB 4OVTA 2PBWA 1POTA 4GX4A 1ELJA 2A5TB 3O6GA 3MPKA 3PUZE 3K2DA 1BK4A 4G61A 1NI9A 1EH3A 2UYEA 3HCQA 4H1XA 3F11A 1MS7A 4PCDA 3VVEA 2DE4A 2DWHA 4QHQA 1LBVA 1NH7A 4GWWA 3FZVA 5CBSA 4P56A 4PFIA 3HFUA 3OXNA 3C31A 1I6QA 1OIBA 2XX9A 1XOCA 4ZE8A 2PFYA 2L5VA 2XXWA 2Q74A 4EXKA 2CMOA 4EXLA 3MZBA 2CEXA 3JV9A 4O7MA 4MF3A 4H67A 1JEUA 3MYUA 3QMFA 5I2KB 2VD3A 1LBXA 3Q27A 4LN5A 4GXAA 4MAGA 1FTJA 3DP4A 2E1SA 2KR0A 2HAUA 4H45A 3O66A 4THIA 3CSBA 4YICA 3ONMA 3IB1A 3Q25A 3DP6A 4NTLA 1UTBA 4XKQA 2Q9TA 3WAEA 1TFAA 2I4BA 4N6KA 2CEYA 3VXBA 4ZS9A 2ZXTA 3OENA 4EQ7A 3E13X 5ITOA 3FV1A 1H43A 1IMCA 4ZZAA 4OVPA 1K9ZA 4C0RA 1US4A 3QAXA 3OO6A 1B4ZA 1AH5A 1NFTA 1NUZA 3VE1B 2QFLA 1FTKA 3G3KA 3T1BA 1SI1A 3FVOA 3PU5A 2FYIA 3IR1A 4LONB 1RYOA 1A7LA 5I2NA 4UABA 4KCCA 2NUVA 3FUZA 1NUYA 1MQJA 1IMDA 5B70A 4GOTA 3TYHA 2I3VA 1EZPA 4AQ4A 3TMGA 4O8MA 2Z22A 1LBYA 4NE4A 3TEPA 4FORA 2P1SA 1EZOA 3FVGA 1LCTA 1O64A 5AA2B 1JW4A 4GRKA 4H8IA 3FJ7A 2QS4A 4ZZEA 1Z7ME 1WDNA 4PDHA 2XWVA 2I48A 4N8YA 3VXCA 2A5SA 1USYH 5AA2D 3PMWA 1B0HA 1MQHA 4XIGQ 1FTLA 1B3GA 2XXPA 4QFNA 1LBCA 3T9VA 3VFJA 3SERA 3D4CA 1INPA 3CFXA 1QVSA 4NF5A 4FATA 2PCRA 3W9WA 1JW1A 3FGSA 3EHSA 4JWYA 3MP6A 5KCJA 1LAXA 3FASA 3PPRA 4XXUA 1XVYA 3RPWA 4U1OA 5ET8A 4N07A 4QRZA 1AWBA 4PFYA 1LBWA 4F1UA 3IOVA 5KDTA 3PV0E 3C35A 1IQ7A 1A54A 2OCUA 2I0CA 2DWIA 4ZEFA 4F29A 4KXPA 1FW0A 3U72A 2ZZXA 3MC2A 1Y4TA 4PFBA 3KJTA 2O69A 1LBZA 3OO9A 2QVVA 2ZNSA 1OVBA 5JEIA 3PPOA 4OEUA 3RGYA 3L6GA 4NGUA 4Q8RA 4OFLA 5DYHA 1PBPA 4YB7A 4FAJA 5L9MA 1NMUA 1SQYA 3I6VA 4G77A 1GGGA 4O3BA 2B4LA 4H6DA 3OEMA 1JP4A 4Z0IA 4DE8A 1DTZA 2CZKA 1P99A 3U93A 1ZLQA 4GX3A 4MMPA 4F3PA 5I59B 4H65A 2HEUA 1B46A 3DELB 3V83A 5FHOA 4PP0A 4Z7EA 4OEVA 3G3IA 1MXXA 4G2ZA 3GZGA 3OMBA 3LBSA 1NV0A 4MHFA 2OBGA 3MW0A 2HPGA 2Z23A 4NWDA 1B40A 2Q8MA 3ZS6A 1NH8A 3CI8A 4MH5A 4F2OA 4H5GA 3ZSFA 4IGRA 2O84X 2WBDA 1N76A 1CE2A 5FBPA 1POY1 3G7WA 4NF5B 3RLFE 1MG1A 1US5A 3LR1A 4JWXA 1AMFA 3FJGA 4MFIA 4O3AA 4U23A 3H03A 4YKJA 4R73A 4QFPA 2Y7PA 4I62A 3PUVE 5EQAA 1IITA 1D9VA 1DPPA 2HXRA 2XXUA 4YZZA 4GF8A 1PEBA 4MNIA 1YAEA 5T3JA 3M3LA 5EYFA 4HS7A 2B3BA 4NWCA 4XFEA 1UTBB 1K9YA 2XWOA 2DS9A 4OESA 3PPPA 1FPDA 1DMBA 4ZEKA 3TFLA 1MY1A 3RPLB 3G3HA 3IL1B 2WYPA 3RQTA 3LSWA 4ZE9A 3KN8A 3OOAA 3PUXE 5I5PA 4DCXA 1SW1A 2X7PA 3U94A 3IJXB 2ALUA 1LGBC 1RDXA 1GR2A 4H5FA 5BUUA 4GBWA 1ZTYA 1KWHA 1NV6A 2XXTA 5M2VA 3TZAA 3UP9A 2FBPA 5DTBA 3CSGA 3N6TA 5L8DA 5LOMA 4LQ2A 2F7CA 4PE3A 2GH9A 2DVCA 1XT8A 2ZNUA 3HHGA 1FJ6A 5H8FB 2V4CA 5CRYA 4DCYA 1BTJA 1LB9A 3Q29A 4F1YA 3TQLA 1FTOA 2O1MA 2REJA 3M3FA 2Y7IA 1FPJA 5I2KA 4NX1A 3BIGA 3S9MC 1JQFA 2I49A 1N7XA 2DXRA 4EQBA 1VSOA 1SPIA 2HZLA 4R2FA 4GBVA 2P0SA 1P1UA 3FIRA 4IY6A 3CFZA 1MXYA 4QFOA 2NXOA 4IO3A 3EKIA 2OWZA 1SD3A 5CMMA 3S9NC 4KR5A 2OZZA 2WBBA 2QJEA 4OZ9A 1OMPA 5L9OA 2DE2A 3SEVA 4AB6A 1QUKA 2H99A 1NV3A 4FJPA 2Q2CA 1JETA 2QMXA 1M5DA 3R7XA 2DVZA 3HSTA 4XEQA 1IMBA 1KZ8A 1YTVA 1IZ1A 2GFEA 3C36A 5EHMA 5DEXB 2F34A 1NNKA 1B32A 3VLUA 4YB6A 2G29A 2F97A 4TLMB 2R71A 4GXSB 4F31B 2HAVA 4OXVA 5I84A 3O9PA 1IMFA 4EUOA 1A99A 1OQGA 4NG7A 2REGA 5H8SA 2UVGA 2O68A 2QMWA 4X04A 3UORA 5I7IA 5H8FA 5I59A
chains in the Genus database with same CATH topology
4AQ4A 3MJNA 4G8HA 3TMGA 3THIA 3KSXA 3CFLA 1A8FA 2A5TA 2ONKE 2Z22A 3CRBA 4RJZA 3CVGA 1MRPA 4NE4A 4TQUQ 4FORA 1XS5A 4HCYA 3SEXA 4BLAA 2V3QA 3TEPA 2P1SA 4I1DA 4F18A 1EZOA 5I58A 4PFUA 1MY2A 3FVGA 3UIFA 3GXAA 1LCTA 1O64A 2I58A 5AA2B 1JW4A 4GRKA 3Q26A 4DLDA 2Y84A 4ND9A 1OQHA 1LBBA 1LB8A 1F9BA 2QSXA 3JYRA 3KOSA 5F7VA 1AIVA 4H8IA 3TTKA 1B51A 3FJ7A 2QS4A 4ZZEA 4HW8A 3A3UA 1IEJA 1Z7ME 4P0GA 3K1PA 5AA4A 1HSJA 4ECFA 1M5EA 1WDNA 4Q0CA 1FTMA 4WEDA 2H4IA 1PDAA 1JEVA 4BDNA 3TUSA 1URGA 2AIXA 4RK9A 3SETA 4IGTA 2DYXA 3SEWA 4HTGA 1H44A 1Y3PA 1MY0A 2F6PA 2XHDA 3N6UA 4OERA 1I6BA 1YPNA 2I48A 4XKNA 4OYVA 3VXCA 1B3FA 2A5SA 3ILTB 3K6UA 4U2RA 4IO7A 1QKBA 5TP9B 3M8UA 1MM7A 3C9HA 1Q35A 3TTMA 2XXVA 3H06B 1USYH 2OWTA 3H6WA 3TPAA 5AA2D 1NKXA 3WAEA 3PMWA 5FHNA 3FATA 1B0HA 3LC8A 4LP2B 1MQHA 4XIGQ 1P1WA 1SYIA 5I57A 1FTLA 3O6IA 2ZYNA 3CG1A 3OEKA 4IO5A 2NVUB 4ZECA 3GBAA 4F19A 1UTHB 1B3GA 2OLBA 2XXPA 4QFNA 2XX8A 1LBCA 2AYSA 1VFDA 3T9XB 2XX7A 3T9VA 5ISUA 4ONYA 4R2BA 3VFJA 3R6UA 4F1VA 1IXHA 1MPBA 1D3KA 3O2AA 3SERA 1RKMA 3T93B 3D4CA 4FIMA 3CFXA 2IEEA 4GL8A 1QVSA 1RYXA 2OJTA 3KSJA 5FHMA 4NF5A 4KI0E 4FATA 1QULA 2ESNA 3W9WA 1SW4A 4DXBA 4NF8A 3EHUA 5H8HB 4ELOA 5CBRA 1JW1A 5ICQA 3FGSA 1II5A 2ABHA 2RINA 3EHSA 2Q2AA 2F78A 1IIWA 4JWYA 3RN8A 3MP6A 5KCJA 4OFOA 5CMBA 1LAXA 3FASA 3OELA 3PPRA 2F35A 3QIMA 3BFTA 3MVYA 4XXUA 4YMAA 4OTEA 2KLFA 1XVYA 4YKKA 1H45A 3RPWA 1FQAA 3S9LC 2VOZA 4U1OA 1B0LA 4KYSA 2M8CA 1FQBA 4N07A 4E0XA 2HQ0A 1B2HA 1MY4A 2YPNA 4KHZE 3DM0A 3ILUB 4QRZA 3UN6A 2Q89A 2V93A 4BDMA 1SVXB 2XD2A 4ISUA 4R75A 5CC2A 1GV8A 4PFYA 2YJPA 3S9EA 1WODA 3G3FA 3KBRA 1OLAA 4F1UA 4F39A 4I9DA 3IOUA 3U1OA 2UVHA 4BDLA 3IOVA 1MH3A 3KOTA 3FD3A 1BLFA 2I3WA 3O6HA 3PV0E 3C35A 3MZ1A 1IQ7A 3ODBA 1QUJA 4WEPA 5FTHA 1B1XA 1FQDA 4NEDA 4R74A 4BDQA 4H0WA 1IXGA 2O7UA 1A8EA 1LAGE 4PFTA 2F7BA 2DSFA 5IAIA 1A54A 4YMBA 4GVOA 4OQOA 4DDDA 2OCUA 5CM6A 4GIZA 3W15C 4P0IA 2I0CA 3HPIA 4NF8B 4RYAA 2DWIA 4GD5A 5H8HA 1FQFA 4PETA 4ZEFA 3GLBA 5DEXA 4F29A 1FW0A 3IOWA 5TPAA 3U72A 4ELRA 2W7YA 4DIGA 5ITPA 2ZYOA 4LQ5A 5CI5A 3MC2A 5HM4B 2R6GE 2Z8FA 1N04A 3KJ7A 4X1BA 2B3FA 1BIYA 1OLCA 1Y3NA 1ZJLA 4FE8A 4X48A 4YAHX 4MBPA 1Y4TA 4YKPA 4FEDA 1VE4A 4O3CA 3UK4A 2FNCA 4AB5A 1UIUA 3KJTA 1NNFA 4POXA 2O69A 4L17A 3FJMA 4F3SA 2GHAA 5KDTA 3ZKKA 2VP1A 3CG3A 2H25A 3OO9A 3EF7A 3HO7A 3IO6A 2X26A 2ZNSA 1OVBA 2ONSA 3CR9A 2I4CA 4PQJA 5JEIA 3PPOA 3MP1A 3PUYE 4KCDA 3IK6B 4G68B 4OEUA 3RGYA 3L6GA 5CMKA 4Q8RA 4OFLA 1ZU0A 5DYHA 4NMYA 3JZJA 1PBPA 3R26A 5AA3A 5AE4A 3MQ9A 3N94A 1SDXA 3L6HA 4G68C 2UXAA 4YB7A 5K2YA 3A09A 3MBPA 4OETA 5L9MA 3RNNA 4FAJA 2DP8A 3KGCA 2XXQA 1I6AA 1MQDA 1NMUA 3E9XA 1SQYA 3H6UA 3I6VA 4G77A 2RC9A 4FEBA 4TLLB 1GGGA 3H6VA 3K00A 4EQ9A 2DXYA 3V8XB 2LAOA 4O3BA 3T66A 1BP5A 3FXUA 3LUYA 3OEMA 3MUQA 3Q28A 4H6DA 1J1NA 2FA7A 1D9YA 3OO8A 4Z0IA 5I57B 5I59A 5TP9A 1FQEA 4R6YA 4ZDMA 4DE8A 1DTZA 2DOJA 1MXZA 3K6VA 4ELQA 3HN0A 4DZ1A 1P99A 3DP8A 3U93A 1R6ZA 1LSTA 1P1NA 1ZLQA 4M4GA 4WKMA 4EDPA 2Y7RA 3K1MA 4H65A 1MPDA 5TPAB 3S4UA 4F2QA 4F3PA 5I59B 1QJMA 2HEUA 3U8QA 1NNTA 2QS3A 5EHSA 1B46A 3DELB 3V83A 5FHOA 1BKAA 1MM6A 1MQIA 2XXHA 4IO4A 4ZEIA 2NOOA 4IY5A 3G3GA 4PP0A 4Z7EA 4OEVA 2VHAA 3TCFA 3G3IA 1MXXA 2F5XA 4G2ZA 4N6PA 2XXIA 3MZ9A 1SI0A 4RXLA 4RK2A 1M5BA 4RPOA 2OWSA 2WKYA 4PFWA 3GZGA 4GQOA 3OMBA 3LBSA 4XTCQ 1URSA 3C33A 2V25A 4QFLA 1LFIA 3MWBA 1H3DA 2OBGA 3MW0A 5F1QA 3PGFA 1JNFA 2Z23A 4JBZA 1Y1MA 4NWDA 1B3LA 2NWJA 3PD8A 4E0WA 1B40A 4XKPA 3ZS6A 1NH8A 3CI8A 2BJJX 3IO4A 3IOTA 3VLWA 4G8MA 4JSDA 4R9FA 1B5JA 3N5LA 4MH5A 4F2OA 2E0SA 4IO6A 1TFDA 3E4RA 4KYEA 2ANJA 4NF6B 4H5GA 4OVJA 3ZSFA 4NF6A 3IB0A 4C1UA 3S2VA 4IGRA 1Y20A 4YU0A 2O84X 5B7DA 2HFBA 4HCWA 1N76A 1CE2A 4PE5B 3KG2A 4DXUA 1POY1 3E3KA 3G7WA 4NF5B 3KN7A 4KPTA 3RLFE 5IKBA 4QSDA 1LFHA 3TTNA 3MP8A 2V3TA 3TDJA 3IJOB 3TKDA 1N3XA 2QPQA 4K3FA 2VGQA 1MG1A 3KZGA 5K2XA 1US5A 2H5YA 2PVUA 3LR1A 3I5OA 1AMFA 3FJGA 4JWXA 4MFIA 4QSCA 4U21A 5L9SA 1B1HA 4O3AA 1CB6A 4QFKA 4RY1A 3H03A 4U23A 4YKJA 3T96B 4R73A 2UVJA 4QFPA 2Y7PA 4MLVA 3K6WA 1N3WA 3MVZA 1LFGA 5HPQA 1S7YA 1B58A 4I62A 2ZMBA 3OSQA 1ZIUA 1DSNA 1JVYA 2XD3A 3PUVE 4QSEA 3EHTA 5JK4A 1ZBMA 4F3BA 1A55A 1B52A 1IITA 2V3UA 2YLNA 1D9VA 3FXRA 3K1NA 3LSLA 1DPPA 3FVNA 1B6HA 1MXWA 1SYHA 2XXUA 4GF8A 4YZZA 1PEBA 3TAJA 1YAEA 2Q88A 4X9TA 1USYE 4TOZA 2QS1A 3EPEA 5DT6A 3RUMA 1D4NA 3K6XA 3M3LA 3EQ1A 4P11A 5EYFA 2HXWA 4I8CA 5TU0A 4HS7A 5DVJA 5HBCA 4JWOA 1MQGA 3TCGA 2Z8EA 1MDQA 1MPCA 2B3BA 4KQPA 4NWCA 5AA4B 4JB7A 1UTBB 2HCAA 3AXFA 3DLNA 3WAFA 1DTGA 5A5XB 5I56B 2DS9A 2PT2A 4OESA 2P2AA 3PPPA 3C34A 2XXRA 3O97A 2PYYA 5ELVA 5A5XA 1MXUA 3H7MA 3P7IA 1DMBA 2THIA 4POWA 4ZEKA 2F6GA 3IX1A 1IXCA 1MY1A 4OHNA 1UIVA 3TFLA 3TCHA 1M5FA 1PC3A 1QW0A 3USDA 3TQWA 3FXQA 1O63A 1I69A 4LATA 1XC1A 1XHYA 3G3HA 2RCBA 1T0KA 3IL1B 1ZKBA 2DWJA 3QSLA 1S50A 3RQTA 1B3EA 3LSWA 3QXMA 3KN8A 4ZE9A 1DOTA 3OOAA 3PUXE 4G8NA 4LA9A 4DCXA 3CIJA 3KN3A 3VV5A 1DPEA 5KZTA 1SW1A 2X7PA 3U94A 3IJXB 3PMVA 1L5TA 3U92A 3B7DA 2PMSA 3O28A 2PX1A 4LVQA 2ALUA 1LGBC 3RY3A 1B5HA 1GR2A 2D5WA 3H6TA 3W9VA 4NF4A 1B9JA 3PUWE 3SDFA 2AL5A 2I6EA 1IUDA 1Y3QA 4MLQA 4H5FA 4YB5A 4GL0A 1XVXA 1TT1A 2O1LA 4LUBA 3FV2A 5BUUA 5H8NB 4IB2A 1Q1KA 3PPNA 3IORA 3V89B 1YCJA 5DVFA 1MY3A 1EU8A 1LCFA 1Y4CA 1ZTYA 1Y1ZA 1KWHA 2G93A 1S9TA 3MPLA 1LLSA 2XXTA 4OENA 1MDP1 1TXFA 2UVIA 3G3JA 4KFQA 5M2VA 3TZAA 3UP9A 2RKMA 5DTBA 3CSGA 3N6TA 1B3HA 3HV1A 3IAZA 3QUFA 5L8DA 3PD9A 3V5AA 4DXCA 3B6QA 1B05A 1HSEA 1NL5A 1SW2A 4LQ2A 2UYFA 2F7CA 3O29A 2GH9A 4LZ8A 1R9LA 3BKIB 2ONRA 1NNPA 5FTIA 2DVCA 1H76A 3RTFB 2O7IA 3MVWA 2O51A 1ANFA 4BDOA 1JW5A 1XT8A 4GLIA 4M1VA 2ZNUA 3PPQA 1O7TA 3TODA 3HHGA 1Y9UA 2H98A 5DVIA 3A3CA 3KEIA 2R9JA 2F8DA 4H8JA 4OMBA 1MXVA 5H8FB 3MVXA 4F3GA 2D3IA 1B5IA 4U1ZA 3SEUA 5CRYA 3KFMA 1M5CA 3QK6A 3UGWA 1Z7NE 3UA8A 4DCYA 1BTJA 2V84A 4GWOA 5CMCA 1VFEA 2RC8A 4EF2A 5KDTB 4Q5TA 2DQVA 1LB9A 1UQWA 4G4PA 5H8QB 2PBWA 3Q29A 1SW5A 4F1YA 3TQLA 1FTOA 2O1MA 1POTA 5JTYA 2REJA 3M3FA 1ELJA 2A5TB 4RNSA 1PB7A 4ELPA 2B65A 3O6GA 2Y7IA 3TTRA 3MPKA 3B6WA 3OO7A 3PUZE 3K2DA 4YKIA 3GBBA 4Q30B 5I2NB 3SEYA 5I2KA 1PB9A 2ZYMA 3S9MC 1JQFA 1EH3A 2UYEA 4ESWA 1A40A 1FQCA 2O6AA 3HCQA 4R6HA 4BDRA 2I49A 3BBRA 4H1XA 5AA1A 1N7XA 2DXRA 2ZYKA 4GFRA 4EQBA 1VSOA 3F11A 1MS7A 3VVEA 2DE4A 2DWHA 4FECA 3VVDA 2CZLA 3BFUA 4C0RA 5H8NA 4QHQA 1NH7A 2HZLA 4ESXA 2VD2A 4R6KA 4R2FA 3RT8A 2I0BA 2P0SA 3FZVA 5CBSA 1P1UA 3TELA 3FIRA 4UA8A 1R9QA 3T9HB 3VDFA 4IY6A 3OXNA 2DE3A 3CFZA 2QL3A 3C31A 1MXYA 2RC7A 4QFOA 1I6QA 3QUJA 1OIBA 1OVTA 2XX9A 2NXOA 1XOCA 3C4MA 4ZE8A 3RT6B 1EZ9A 5I56A 4IO3A 2XXWA 3VVFA 1N7WA 4X1DA 4EXKA 2CMOA 1FCKA 4LZ5A 4LZ7A 4EXLA 4UACA 3MZBA 2H9BA 1SD3A 2XXYA 1AL3A 3I3VA 4OWDA 5CMMA 3S9NC 4KR5A 2OZZA 2F7AA 2Y7KA 3JV9A 2QJEA 2AL4A 1MH4A 4MF3A 1B7UA 4ZEDA 4OZ9A 4H67A 1JEUA 1OMPA 5I2KB 1AOVA 2VD3A 3OSRA 5L9OA 2DE2A 3Q27A 3ZKLA 2QS2A 4U22A 3SEVA 2HZKA 1QUKA 1UTHA 4GXAA 4KD5A 4AB6A 5AA2A 2H99A 1FTJA 3DP4A 3N26A 4OFJA 3T9UA 2E1SA 4QF9A 4C1TA 2HAUA 1B7ZA 4FJPA 2Q2CA 3K01A 3O66A 1JETA 3CSBA 4THIA 3RTWB 2Q8JA 4YICA 3TTLA 2QMXA 5LOMA 1M5DA 1ATGA 3ONMA 3IB1A 3K02A 3OD7A 3EN3A 3Q25A 4NF4B 4XKRA 3R7XA 5I58B 2DVZA 1IXIA 3DP6A 3HSTA 3FVKA 4NTLA 1PB8A 1B7HA 1UTBA 1P1OA 1YTVA 2Q9TA 1IZ1A 2GRVA 4XKQA 2GFEA 3C36A 1TFAA 2OK2A 4RA1A 5DEXB 3H3GA 2F34A 5EHMA 1GVCA 4ZEBA 1NNKA 2F36A 2I4BA 1B32A 1QUIA 3K0VA 3VLUA 4RPNA 4YB6A 2G29A 3B6TA 2F97A 4R9GA 5BWJA 2DWAA 4TLMB 1JVXA 1URDA 3VXBA 1VR5A 2R71A 4GXSB 2ZXTA 3OENA 4ZS9A 2RCAA 4F31B 4EQ7A 3VLVA 1PBQA 1B4HA 2HAVA 3E13X 5KCJB 2RF1A 5ITOA 3FV1A 1H43A 2Y7WA 1R1NA 4JXIA 2Z8DA 4ZZAA 1TWYA 4OXVA 5I84A 5H8QA 3O9PA 1US4A 1P1QA 1LAHE 2ZNTA 3H4ZA 1B4ZA 2GHBA 3LSXA 1AH5A 3OO6A 3QAXA 4EUOA 1NFTA 3VE1B 2PT1A 3ECRA 1FTKA 3G3KA 1N0TA 2QRYA 1A99A 3MAMA 1OQGA 5J1DA 1SI1A 1SBPA 3FVOA 2REGA 3PU5A 4EF1A 1GTKA 2FYIA 3IR1A 5H8SA 4JDFA 4LONB 4G68A 4N13A 1RYOA 3M3KA 4R72A 2XXXA 1A7LA 5ICTA 2UVGA 2O68A 2X7QA 2QMWA 3PMXA 4U4SA 3T22A 1WVJA 3K4UA 4KYDA 1HSLA 4F22A 5I2NA 3C32A 4IO2A 4KCCA 4WXJA 2NUVA 1ZMGA 3D4GA 3FUZA 3QYTA 5JTYB 3HHFA 3UORA 4JSOA 1MQJA 3SESA 5B70A 4GOTA 1N84A 3IB2A 3TYHA 2I3VA 5H8FA 1LAFE 3SKPA 1EZPA 2D21A 2IA4A 4U4XA 3LSFB 1QKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQ4 A;  3MJN A;  4G8H A;  3TMG A;  3THI A;  3KSX A;  3CFL A;  1A8F A;  2A5T A;  2ONK E;  2Z22 A;  3CRB A;  4RJZ A;  3CVG A;  1MRP A;  4NE4 A;  4TQU Q;  4FOR A;  1XS5 A;  4HCY A;  3SEX A;  4BLA A;  2V3Q A;  3TEP A;  2P1S A;  4I1D A;  4F18 A;  1EZO A;  5I58 A;  4PFU A;  1MY2 A;  3FVG A;  3UIF A;  3GXA A;  1LCT A;  1O64 A;  2I58 A;  5AA2 B;  1JW4 A;  4GRK A;  3Q26 A;  4DLD A;  2Y84 A;  4ND9 A;  1OQH A;  1LBB A;  1LB8 A;  1F9B A;  2QSX A;  3JYR A;  3KOS A;  5F7V A;  1AIV A;  4H8I A;  3TTK A;  1B51 A;  3FJ7 A;  2QS4 A;  4ZZE A;  4HW8 A;  3A3U A;  1IEJ A;  1Z7M E;  4P0G A;  3K1P A;  5AA4 A;  1HSJ A;  4ECF A;  1M5E A;  1WDN A;  4Q0C A;  1FTM A;  4WED A;  2H4I A;  1PDA A;  1JEV A;  4BDN A;  3TUS A;  1URG A;  2AIX A;  4RK9 A;  3SET A;  4IGT A;  2DYX A;  3SEW A;  4HTG A;  1H44 A;  1Y3P A;  1MY0 A;  2F6P A;  2XHD A;  3N6U A;  4OER A;  1I6B A;  1YPN A;  2I48 A;  4XKN A;  4OYV A;  3VXC A;  1B3F A;  2A5S A;  3ILT B;  3K6U A;  4U2R A;  4IO7 A;  1QKB A;  5TP9 B;  3M8U A;  1MM7 A;  3C9H A;  1Q35 A;  3TTM A;  2XXV A;  3H06 B;  1USY H;  2OWT A;  3H6W A;  3TPA A;  5AA2 D;  1NKX A;  3WAE A;  3PMW A;  5FHN A;  3FAT A;  1B0H A;  3LC8 A;  4LP2 B;  1MQH A;  4XIG Q;  1P1W A;  1SYI A;  5I57 A;  1FTL A;  3O6I A;  2ZYN A;  3CG1 A;  3OEK A;  4IO5 A;  2NVU B;  4ZEC A;  3GBA A;  4F19 A;  1UTH B;  1B3G A;  2OLB A;  2XXP A;  4QFN A;  2XX8 A;  1LBC A;  2AYS A;  1VFD A;  3T9X B;  2XX7 A;  3T9V A;  5ISU A;  4ONY A;  4R2B A;  3VFJ A;  3R6U A;  4F1V A;  1IXH A;  1MPB A;  1D3K A;  3O2A A;  3SER A;  1RKM A;  3T93 B;  3D4C A;  4FIM A;  3CFX A;  2IEE A;  4GL8 A;  1QVS A;  1RYX A;  2OJT A;  3KSJ A;  5FHM A;  4NF5 A;  4KI0 E;  4FAT A;  1QUL A;  2ESN A;  3W9W A;  1SW4 A;  4DXB A;  4NF8 A;  3EHU A;  5H8H B;  4ELO A;  5CBR A;  1JW1 A;  5ICQ A;  3FGS A;  1II5 A;  2ABH A;  2RIN A;  3EHS A;  2Q2A A;  2F78 A;  1IIW A;  4JWY A;  3RN8 A;  3MP6 A;  5KCJ A;  4OFO A;  5CMB A;  1LAX A;  3FAS A;  3OEL A;  3PPR A;  2F35 A;  3QIM A;  3BFT A;  3MVY A;  4XXU A;  4YMA A;  4OTE A;  2KLF A;  1XVY A;  4YKK A;  1H45 A;  3RPW A;  1FQA A;  3S9L C;  2VOZ A;  4U1O A;  1B0L A;  4KYS A;  2M8C A;  1FQB A;  4N07 A;  4E0X A;  2HQ0 A;  1B2H A;  1MY4 A;  2YPN A;  4KHZ E;  3DM0 A;  3ILU B;  4QRZ A;  3UN6 A;  2Q89 A;  2V93 A;  4BDM A;  1SVX B;  2XD2 A;  4ISU A;  4R75 A;  5CC2 A;  1GV8 A;  4PFY A;  2YJP A;  3S9E A;  1WOD A;  3G3F A;  3KBR A;  1OLA A;  4F1U A;  4F39 A;  4I9D A;  3IOU A;  3U1O A;  2UVH A;  4BDL A;  3IOV A;  1MH3 A;  3KOT A;  3FD3 A;  1BLF A;  2I3W A;  3O6H A;  3PV0 E;  3C35 A;  3MZ1 A;  1IQ7 A;  3ODB A;  1QUJ A;  4WEP A;  5FTH A;  1B1X A;  1FQD A;  4NED A;  4R74 A;  4BDQ A;  4H0W A;  1IXG A;  2O7U A;  1A8E A;  1LAG E;  4PFT A;  2F7B A;  2DSF A;  5IAI A;  1A54 A;  4YMB A;  4GVO A;  4OQO A;  4DDD A;  2OCU A;  5CM6 A;  4GIZ A;  3W15 C;  4P0I A;  2I0C A;  3HPI A;  4NF8 B;  4RYA A;  2DWI A;  4GD5 A;  5H8H A;  1FQF A;  4PET A;  4ZEF A;  3GLB A;  5DEX A;  4F29 A;  1FW0 A;  3IOW A;  5TPA A;  3U72 A;  4ELR A;  2W7Y A;  4DIG A;  5ITP A;  2ZYO A;  4LQ5 A;  5CI5 A;  3MC2 A;  5HM4 B;  2R6G E;  2Z8F A;  1N04 A;  3KJ7 A;  4X1B A;  2B3F A;  1BIY A;  1OLC A;  1Y3N A;  1ZJL A;  4FE8 A;  4X48 A;  4YAH X;  4MBP A;  1Y4T A;  4YKP A;  4FED A;  1VE4 A;  4O3C A;  3UK4 A;  2FNC A;  4AB5 A;  1UIU A;  3KJT A;  1NNF A;  4POX A;  2O69 A;  4L17 A;  3FJM A;  4F3S A;  2GHA A;  5KDT A;  3ZKK A;  2VP1 A;  3CG3 A;  2H25 A;  3OO9 A;  3EF7 A;  3HO7 A;  3IO6 A;  2X26 A;  2ZNS A;  1OVB A;  2ONS A;  3CR9 A;  2I4C A;  4PQJ A;  5JEI A;  3PPO A;  3MP1 A;  3PUY E;  4KCD A;  3IK6 B;  4G68 B;  4OEU A;  3RGY A;  3L6G A;  5CMK A;  4Q8R A;  4OFL A;  1ZU0 A;  5DYH A;  4NMY A;  3JZJ A;  1PBP A;  3R26 A;  5AA3 A;  5AE4 A;  3MQ9 A;  3N94 A;  1SDX A;  3L6H A;  4G68 C;  2UXA A;  4YB7 A;  5K2Y A;  3A09 A;  3MBP A;  4OET A;  5L9M A;  3RNN A;  4FAJ A;  2DP8 A;  3KGC A;  2XXQ A;  1I6A A;  1MQD A;  1NMU A;  3E9X A;  1SQY A;  3H6U A;  3I6V A;  4G77 A;  2RC9 A;  4FEB A;  4TLL B;  1GGG A;  3H6V A;  3K00 A;  4EQ9 A;  2DXY A;  3V8X B;  2LAO A;  4O3B A;  3T66 A;  1BP5 A;  3FXU A;  3LUY A;  3OEM A;  3MUQ A;  3Q28 A;  4H6D A;  1J1N A;  2FA7 A;  1D9Y A;  3OO8 A;  4Z0I A;  5I57 B;  5I59 A;  5TP9 A;  1FQE A;  4R6Y A;  4ZDM A;  4DE8 A;  1DTZ A;  2DOJ A;  1MXZ A;  3K6V A;  4ELQ A;  3HN0 A;  4DZ1 A;  1P99 A;  3DP8 A;  3U93 A;  1R6Z A;  1LST A;  1P1N A;  1ZLQ A;  4M4G A;  4WKM A;  4EDP A;  2Y7R A;  3K1M A;  4H65 A;  1MPD A;  5TPA B;  3S4U A;  4F2Q A;  4F3P A;  5I59 B;  1QJM A;  2HEU A;  3U8Q A;  1NNT A;  2QS3 A;  5EHS A;  1B46 A;  3DEL B;  3V83 A;  5FHO A;  1BKA A;  1MM6 A;  1MQI A;  2XXH A;  4IO4 A;  4ZEI A;  2NOO A;  4IY5 A;  3G3G A;  4PP0 A;  4Z7E A;  4OEV A;  2VHA A;  3TCF A;  3G3I A;  1MXX A;  2F5X A;  4G2Z A;  4N6P A;  2XXI A;  3MZ9 A;  1SI0 A;  4RXL A;  4RK2 A;  1M5B A;  4RPO A;  2OWS A;  2WKY A;  4PFW A;  3GZG A;  4GQO A;  3OMB A;  3LBS A;  4XTC Q;  1URS A;  3C33 A;  2V25 A;  4QFL A;  1LFI A;  3MWB A;  1H3D A;  2OBG A;  3MW0 A;  5F1Q A;  3PGF A;  1JNF A;  2Z23 A;  4JBZ A;  1Y1M A;  4NWD A;  1B3L A;  2NWJ A;  3PD8 A;  4E0W A;  1B40 A;  4XKP A;  3ZS6 A;  1NH8 A;  3CI8 A;  2BJJ X;  3IO4 A;  3IOT A;  3VLW A;  4G8M A;  4JSD A;  4R9F A;  1B5J A;  3N5L A;  4MH5 A;  4F2O A;  2E0S A;  4IO6 A;  1TFD A;  3E4R A;  4KYE A;  2ANJ A;  4NF6 B;  4H5G A;  4OVJ A;  3ZSF A;  4NF6 A;  3IB0 A;  4C1U A;  3S2V A;  4IGR A;  1Y20 A;  4YU0 A;  2O84 X;  5B7D A;  2HFB A;  4HCW A;  1N76 A;  1CE2 A;  4PE5 B;  3KG2 A;  4DXU A;  1POY 1;  3E3K A;  3G7W A;  4NF5 B;  3KN7 A;  4KPT A;  3RLF E;  5IKB A;  4QSD A;  1LFH A;  3TTN A;  3MP8 A;  2V3T A;  3TDJ A;  3IJO B;  3TKD A;  1N3X A;  2QPQ A;  4K3F A;  2VGQ A;  1MG1 A;  3KZG A;  5K2X A;  1US5 A;  2H5Y A;  2PVU A;  3LR1 A;  3I5O A;  1AMF A;  3FJG A;  4JWX A;  4MFI A;  4QSC A;  4U21 A;  5L9S A;  1B1H A;  4O3A A;  1CB6 A;  4QFK A;  4RY1 A;  3H03 A;  4U23 A;  4YKJ A;  3T96 B;  4R73 A;  2UVJ A;  4QFP A;  2Y7P A;  4MLV A;  3K6W A;  1N3W A;  3MVZ A;  1LFG A;  5HPQ A;  1S7Y A;  1B58 A;  4I62 A;  2ZMB A;  3OSQ A;  1ZIU A;  1DSN A;  1JVY A;  2XD3 A;  3PUV E;  4QSE A;  3EHT A;  5JK4 A;  1ZBM A;  4F3B A;  1A55 A;  1B52 A;  1IIT A;  2V3U A;  2YLN A;  1D9V A;  3FXR A;  3K1N A;  3LSL A;  1DPP A;  3FVN A;  1B6H A;  1MXW A;  1SYH A;  2XXU A;  4GF8 A;  4YZZ A;  1PEB A;  3TAJ A;  1YAE A;  2Q88 A;  4X9T A;  1USY E;  4TOZ A;  2QS1 A;  3EPE A;  5DT6 A;  3RUM A;  1D4N A;  3K6X A;  3M3L A;  3EQ1 A;  4P11 A;  5EYF A;  2HXW A;  4I8C A;  5TU0 A;  4HS7 A;  5DVJ A;  5HBC A;  4JWO A;  1MQG A;  3TCG A;  2Z8E A;  1MDQ A;  1MPC A;  2B3B A;  4KQP A;  4NWC A;  5AA4 B;  4JB7 A;  1UTB B;  2HCA A;  3AXF A;  3DLN A;  3WAF A;  1DTG A;  5A5X B;  5I56 B;  2DS9 A;  2PT2 A;  4OES A;  2P2A A;  3PPP A;  3C34 A;  2XXR A;  3O97 A;  2PYY A;  5ELV A;  5A5X A;  1MXU A;  3H7M A;  3P7I A;  1DMB A;  2THI A;  4POW A;  4ZEK A;  2F6G A;  3IX1 A;  1IXC A;  1MY1 A;  4OHN A;  1UIV A;  3TFL A;  3TCH A;  1M5F A;  1PC3 A;  1QW0 A;  3USD A;  3TQW A;  3FXQ A;  1O63 A;  1I69 A;  4LAT A;  1XC1 A;  1XHY A;  3G3H A;  2RCB A;  1T0K A;  3IL1 B;  1ZKB A;  2DWJ A;  3QSL A;  1S50 A;  3RQT A;  1B3E A;  3LSW A;  3QXM A;  3KN8 A;  4ZE9 A;  1DOT A;  3OOA A;  3PUX E;  4G8N A;  4LA9 A;  4DCX A;  3CIJ A;  3KN3 A;  3VV5 A;  1DPE A;  5KZT A;  1SW1 A;  2X7P A;  3U94 A;  3IJX B;  3PMV A;  1L5T A;  3U92 A;  3B7D A;  2PMS A;  3O28 A;  2PX1 A;  4LVQ A;  2ALU A;  1LGB C;  3RY3 A;  1B5H A;  1GR2 A;  2D5W A;  3H6T A;  3W9V A;  4NF4 A;  1B9J A;  3PUW E;  3SDF A;  2AL5 A;  2I6E A;  1IUD A;  1Y3Q A;  4MLQ A;  4H5F A;  4YB5 A;  4GL0 A;  1XVX A;  1TT1 A;  2O1L A;  4LUB A;  3FV2 A;  5BUU A;  5H8N B;  4IB2 A;  1Q1K A;  3PPN A;  3IOR A;  3V89 B;  1YCJ A;  5DVF A;  1MY3 A;  1EU8 A;  1LCF A;  1Y4C A;  1ZTY A;  1Y1Z A;  1KWH A;  2G93 A;  1S9T A;  3MPL A;  1LLS A;  2XXT A;  4OEN A;  1MDP 1;  1TXF A;  2UVI A;  3G3J A;  4KFQ A;  5M2V A;  3TZA A;  3UP9 A;  2RKM A;  5DTB A;  3CSG A;  3N6T A;  1B3H A;  3HV1 A;  3IAZ A;  3QUF A;  5L8D A;  3PD9 A;  3V5A A;  4DXC A;  3B6Q A;  1B05 A;  1HSE A;  1NL5 A;  1SW2 A;  4LQ2 A;  2UYF A;  2F7C A;  3O29 A;  2GH9 A;  4LZ8 A;  1R9L A;  3BKI B;  2ONR A;  1NNP A;  5FTI A;  2DVC A;  1H76 A;  3RTF B;  2O7I A;  3MVW A;  2O51 A;  1ANF A;  4BDO A;  1JW5 A;  1XT8 A;  4GLI A;  4M1V A;  2ZNU A;  3PPQ A;  1O7T A;  3TOD A;  3HHG A;  1Y9U A;  2H98 A;  5DVI A;  3A3C A;  3KEI A;  2R9J A;  2F8D A;  4H8J A;  4OMB A;  1MXV A;  5H8F B;  3MVX A;  4F3G A;  2D3I A;  1B5I A;  4U1Z A;  3SEU A;  5CRY A;  3KFM A;  1M5C A;  3QK6 A;  3UGW A;  1Z7N E;  3UA8 A;  4DCY A;  1BTJ A;  2V84 A;  4GWO A;  5CMC A;  1VFE A;  2RC8 A;  4EF2 A;  5KDT B;  4Q5T A;  2DQV A;  1LB9 A;  1UQW A;  4G4P A;  5H8Q B;  2PBW A;  3Q29 A;  1SW5 A;  4F1Y A;  3TQL A;  1FTO A;  2O1M A;  1POT A;  5JTY A;  2REJ A;  3M3F A;  1ELJ A;  2A5T B;  4RNS A;  1PB7 A;  4ELP A;  2B65 A;  3O6G A;  2Y7I A;  3TTR A;  3MPK A;  3B6W A;  3OO7 A;  3PUZ E;  3K2D A;  4YKI A;  3GBB A;  4Q30 B;  5I2N B;  3SEY A;  5I2K A;  1PB9 A;  2ZYM A;  3S9M C;  1JQF A;  1EH3 A;  2UYE A;  4ESW A;  1A40 A;  1FQC A;  2O6A A;  3HCQ A;  4R6H A;  4BDR A;  2I49 A;  3BBR A;  4H1X A;  5AA1 A;  1N7X A;  2DXR A;  2ZYK A;  4GFR A;  4EQB A;  1VSO A;  3F11 A;  1MS7 A;  3VVE A;  2DE4 A;  2DWH A;  4FEC A;  3VVD A;  2CZL A;  3BFU A;  4C0R A;  5H8N A;  4QHQ A;  1NH7 A;  2HZL A;  4ESX A;  2VD2 A;  4R6K A;  4R2F A;  3RT8 A;  2I0B A;  2P0S A;  3FZV A;  5CBS A;  1P1U A;  3TEL A;  3FIR A;  4UA8 A;  1R9Q A;  3T9H B;  3VDF A;  4IY6 A;  3OXN A;  2DE3 A;  3CFZ A;  2QL3 A;  3C31 A;  1MXY A;  2RC7 A;  4QFO A;  1I6Q A;  3QUJ A;  1OIB A;  1OVT A;  2XX9 A;  2NXO A;  1XOC A;  3C4M A;  4ZE8 A;  3RT6 B;  1EZ9 A;  5I56 A;  4IO3 A;  2XXW A;  3VVF A;  1N7W A;  4X1D A;  4EXK A;  2CMO A;  1FCK A;  4LZ5 A;  4LZ7 A;  4EXL A;  4UAC A;  3MZB A;  2H9B A;  1SD3 A;  2XXY A;  1AL3 A;  3I3V A;  4OWD A;  5CMM A;  3S9N C;  4KR5 A;  2OZZ A;  2F7A A;  2Y7K A;  3JV9 A;  2QJE A;  2AL4 A;  1MH4 A;  4MF3 A;  1B7U A;  4ZED A;  4OZ9 A;  4H67 A;  1JEU A;  1OMP A;  5I2K B;  1AOV A;  2VD3 A;  3OSR A;  5L9O A;  2DE2 A;  3Q27 A;  3ZKL A;  2QS2 A;  4U22 A;  3SEV A;  2HZK A;  1QUK A;  1UTH A;  4GXA A;  4KD5 A;  4AB6 A;  5AA2 A;  2H99 A;  1FTJ A;  3DP4 A;  3N26 A;  4OFJ A;  3T9U A;  2E1S A;  4QF9 A;  4C1T A;  2HAU A;  1B7Z A;  4FJP A;  2Q2C A;  3K01 A;  3O66 A;  1JET A;  3CSB A;  4THI A;  3RTW B;  2Q8J A;  4YIC A;  3TTL A;  2QMX A;  5LOM A;  1M5D A;  1ATG A;  3ONM A;  3IB1 A;  3K02 A;  3OD7 A;  3EN3 A;  3Q25 A;  4NF4 B;  4XKR A;  3R7X A;  5I58 B;  2DVZ A;  1IXI A;  3DP6 A;  3HST A;  3FVK A;  4NTL A;  1PB8 A;  1B7H A;  1UTB A;  1P1O A;  1YTV A;  2Q9T A;  1IZ1 A;  2GRV A;  4XKQ A;  2GFE A;  3C36 A;  1TFA A;  2OK2 A;  4RA1 A;  5DEX B;  3H3G A;  2F34 A;  5EHM A;  1GVC A;  4ZEB A;  1NNK A;  2F36 A;  2I4B A;  1B32 A;  1QUI A;  3K0V A;  3VLU A;  4RPN A;  4YB6 A;  2G29 A;  3B6T A;  2F97 A;  4R9G A;  5BWJ A;  2DWA A;  4TLM B;  1JVX A;  1URD A;  3VXB A;  1VR5 A;  2R71 A;  4GXS B;  2ZXT A;  3OEN A;  4ZS9 A;  2RCA A;  4F31 B;  4EQ7 A;  3VLV A;  1PBQ A;  1B4H A;  2HAV A;  3E13 X;  5KCJ B;  2RF1 A;  5ITO A;  3FV1 A;  1H43 A;  2Y7W A;  1R1N A;  4JXI A;  2Z8D A;  4ZZA A;  1TWY A;  4OXV A;  5I84 A;  5H8Q A;  3O9P A;  1US4 A;  1P1Q A;  1LAH E;  2ZNT A;  3H4Z A;  1B4Z A;  2GHB A;  3LSX A;  1AH5 A;  3OO6 A;  3QAX A;  4EUO A;  1NFT A;  3VE1 B;  2PT1 A;  3ECR A;  1FTK A;  3G3K A;  1N0T A;  2QRY A;  1A99 A;  3MAM A;  1OQG A;  5J1D A;  1SI1 A;  1SBP A;  3FVO A;  2REG A;  3PU5 A;  4EF1 A;  1GTK A;  2FYI A;  3IR1 A;  5H8S A;  4JDF A;  4LON B;  4G68 A;  4N13 A;  1RYO A;  3M3K A;  4R72 A;  2XXX A;  1A7L A;  5ICT A;  2UVG A;  2O68 A;  2X7Q A;  2QMW A;  3PMX A;  4U4S A;  3T22 A;  1WVJ A;  3K4U A;  4KYD A;  1HSL A;  4F22 A;  5I2N A;  3C32 A;  4IO2 A;  4KCC A;  4WXJ A;  2NUV A;  1ZMG A;  3D4G A;  3FUZ A;  3QYT A;  5JTY B;  3HHF A;  3UOR A;  4JSO A;  1MQJ A;  3SES A;  5B70 A;  4GOT A;  1N84 A;  3IB2 A;  3TYH A;  2I3V A;  5H8F A;  1LAF E;  3SKP A;  1EZP A;  2D21 A;  2IA4 A;  4U4X A;  3LSF B;  1QKA A; 
#chains in the Genus database with same CATH topology
 3THI A;  3KSX A;  3CFL A;  1A8F A;  2A5T A;  4RJZ A;  3CRB A;  1MRP A;  2V3Q A;  5I58 A;  4PFU A;  3UIF A;  3GXA A;  2I58 A;  3Q26 A;  2DDK A;  1AIV A;  1LB8 A;  5F7V A;  3TTK A;  1B51 A;  5AA4 A;  2H4I A;  2AIX A;  3SET A;  4HTG A;  1H44 A;  2XHD A;  4GX6 A;  1I6B A;  4HE0 A;  4U2R A;  2XXV A;  3H06 B;  3H6W A;  3TPA A;  4NF0 A;  4H46 A;  5FHN A;  3FAT A;  4GWZ A;  3OEK A;  2XX8 A;  2AYS A;  5ISU A;  2XX7 A;  4R2B A;  1IXH A;  1MPB A;  3O2A A;  1RKM A;  2OJT A;  4KI0 E;  1SW4 A;  4DXB A;  4JVD A;  3RYD A;  3RN8 A;  1EYK A;  4OFO A;  4MCO A;  5CMB A;  3BFT A;  4OTE A;  2KLF A;  1H45 A;  4N15 A;  2M8C A;  1FQB A;  4E0X A;  1MY4 A;  2V93 A;  2XD2 A;  4ISU A;  4I3E A;  3KBR A;  1OLA A;  4F39 A;  3KBZ A;  4I9D A;  4BDL A;  3KOT A;  3FD3 A;  3VDF A;  1QUJ A;  1FQD A;  4NED A;  4R74 A;  4BDQ A;  2VPN A;  4H0W A;  2F7B A;  2DSF A;  4YMB A;  4GVO A;  4OQO A;  4DDD A;  3HPI A;  4NF8 B;  4GD5 A;  5DEX A;  5ITP A;  5HM4 B;  2R6G E;  2Z8F A;  2B3F A;  4FE8 A;  4X8R A;  4O3C A;  2P3V A;  3FJM A;  3ZKK A;  3CG3 A;  2ONS A;  3CR9 A;  4PQJ A;  3MP1 A;  3IK6 B;  1ZU0 A;  4N8G A;  4NMY A;  3JZJ A;  2XWI A;  3MQ9 A;  3N94 A;  1SDX A;  3A09 A;  3MBP A;  2DP8 A;  1I6A A;  4FEB A;  4TLL B;  3H6V A;  3K00 A;  2LAO A;  2FA7 A;  4R6Y A;  4ELQ A;  1LST A;  1YXI A;  4M4G A;  3K1M A;  4F2Q A;  5TPA B;  3U8Q A;  4GWY A;  1NNT A;  2QS3 A;  1BKA A;  2NOO A;  2F5X A;  1G0I A;  2XXI A;  3MZ9 A;  1M5B A;  1URS A;  3C33 A;  4P8B A;  1RDY A;  3MWB A;  4P9K A;  1H3D A;  3PGF A;  4MX6 A;  5EQ7 A;  1B3L A;  5EYH A;  4JSD A;  4OVJ A;  1TFD A;  3E4R A;  4GWX A;  2ANJ A;  4NF6 B;  4NF6 A;  3S2V A;  4YU0 A;  4PE5 B;  3E3K A;  5IKB A;  2V3T A;  2VGQ A;  2H5Y A;  4U21 A;  5L9S A;  1CB6 A;  4P47 A;  2UVJ A;  1N3W A;  5IGA A;  3OSQ A;  4P1E A;  1ZIU A;  1DSN A;  2XD3 A;  5JK4 A;  3EHT A;  4F3B A;  4MIJ A;  1B52 A;  2V3U A;  3NOH A;  3K1N A;  1B6H A;  1SYH A;  4PFR A;  4X9T A;  4TOZ A;  3EPE A;  5DVJ A;  4JWO A;  1MPC A;  4KQP A;  2PT2 A;  2XXR A;  2PYY A;  1IMA A;  1MXU A;  3H7M A;  3IX1 A;  1UIV A;  1PC3 A;  2BJI A;  3TQW A;  1O63 A;  4LAT A;  1XC1 A;  1T0K A;  4OVQ A;  5ET7 A;  3VV5 A;  3RY3 A;  3B7D A;  3O28 A;  2PX1 A;  4PGN A;  4P3L A;  2AL5 A;  4GL0 A;  1XVX A;  1TT1 A;  2MKZ A;  1Q1K A;  1MY3 A;  2XA5 A;  1LCF A;  4GWU A;  1LLS A;  4OEN A;  1FBG A;  1B3H A;  3QUF A;  1NV2 A;  1HSE A;  1NL5 A;  3O29 A;  3BKI B;  1H76 A;  3MVW A;  1ANF A;  4BDO A;  1VDW A;  2VT5 A;  2H98 A;  4F3G A;  2R9J A;  2F8D A;  4OMB A;  2D3I A;  5EYG A;  2V84 A;  2DQV A;  4G4P A;  1UQW A;  2CZI A;  5JTY A;  4RNS A;  1PB7 A;  3B6W A;  1FBP A;  3GBB A;  4Q30 B;  3SEY A;  1NV7 A;  2ZYM A;  1A40 A;  1FQC A;  4R6H A;  3BBR A;  5AA1 A;  4FEC A;  2CZL A;  5H8N A;  2VD2 A;  2I0B A;  3T9H B;  2DE3 A;  2QL3 A;  2RC7 A;  3QUJ A;  1OVT A;  1FJ9 A;  1EZ9 A;  4LZ5 A;  4UAC A;  2H9B A;  2XXY A;  3I3V A;  2F7A A;  2AL4 A;  1MH4 A;  4ZED A;  4NQ8 A;  3LV0 A;  1AOV A;  4OAN A;  3OSR A;  3ZKL A;  2QS2 A;  4U22 A;  1FBH A;  4C1T A;  4QF9 A;  4PAK A;  1B7Z A;  3K01 A;  3TTL A;  2Q8J A;  4XKR A;  3K02 A;  3OD7 A;  3EN3 A;  5I58 B;  1IXI A;  2QVR A;  1B7H A;  5DW8 A;  5H8N B;  2GRV A;  3H3G A;  2HHM A;  1QUI A;  1YZ0 A;  3B6T A;  1JVX A;  5ICQ A;  1PBQ A;  1B4H A;  2FHY A;  2Y7W A;  1R1N A;  5H8Q A;  3PMX A;  1P1Q A;  2ZNT A;  3LSX A;  2GHB A;  2PT1 A;  3B8B A;  1N0T A;  2JJK A;  1SBP A;  4JDF A;  4N13 A;  3M3K A;  4R72 A;  2XXX A;  2X7Q A;  3T22 A;  4U4S A;  1WVJ A;  3K4U A;  4KYD A;  4F22 A;  4IO2 A;  3SES A;  3IB2 A;  5CBR A;  2D21 A;  2IA4 A;  3LSF B;  1QKA A;  4G8H A;  4N81 A;  1FPG A;  4TQU Q;  4I1D A;  4F18 A;  4DLD A;  1NV5 A;  2Y84 A;  1OQH A;  1F9B A;  3KOS A;  4HW8 A;  3A3U A;  1HSJ A;  4ECF A;  1M5E A;  1PDA A;  4BDN A;  3TUS A;  4IGT A;  2DYX A;  2F6P A;  1MY0 A;  4OER A;  3E78 A;  1YPN A;  4XKN A;  3ILT B;  2PFZ A;  5TP9 B;  3M8U A;  3C9H A;  1Q35 A;  2OWT A;  3SZP A;  1NKX A;  1P1W A;  4DI4 B;  2NVU B;  2ZYN A;  3CG1 A;  4IO5 A;  3GBA A;  4N6D A;  3T9X B;  1Q9D A;  4ONY A;  4F1V A;  3R6U A;  5IZZ A;  1FRP A;  5EQ8 A;  4FIM A;  2IEE A;  3KSJ A;  1RYX A;  5FHM A;  2ESN A;  4ELO A;  4NF8 A;  3EHU A;  5IM2 A;  3FBP A;  5ET5 A;  2ABH A;  5J16 A;  2RIN A;  2Q2A A;  2F78 A;  1IIW A;  3QIM A;  4FBP A;  3PTY A;  1B2H A;  4KHZ E;  3DM0 A;  3ILU B;  4BDM A;  4R75 A;  5CC2 A;  3S9E A;  1WOD A;  2WX9 A;  3IOU A;  3O6H A;  1BLF A;  4HXV A;  3MZ1 A;  5FTH A;  4WEP A;  1IXG A;  2O7U A;  1A8E A;  4PFT A;  5IAI A;  3W15 C;  4N4U A;  5H8H A;  4P1L A;  4ELR A;  2W7Y A;  2F3B A;  4LQ5 A;  5CI5 A;  3KJ7 A;  1BIY A;  1Y3N A;  1ZJL A;  4X48 A;  4MBP A;  4AB5 A;  1VE4 A;  2FNC A;  1NNF A;  4L17 A;  4F3S A;  2GHA A;  2VP1 A;  3EF7 A;  4NN3 A;  3IO6 A;  2X26 A;  3PUY E;  1FPL A;  4KCD A;  4NHB A;  3B50 A;  5AE4 A;  5K2Y A;  2UXA A;  4OET A;  2FIX A;  1MQD A;  3E9X A;  3H6U A;  1FBF A;  2RC9 A;  3V8X B;  2XWK A;  3BIH A;  3MUQ A;  3OO8 A;  5TP9 A;  1FQE A;  1MXZ A;  3HN0 A;  4DZ1 A;  3DP8 A;  1R6Z A;  1P1N A;  4WKM A;  4EDP A;  2Y7R A;  1MPD A;  4N91 A;  4ZEI A;  2XXH A;  4IY5 A;  3G3G A;  2VHA A;  3TCF A;  2FVZ A;  4N6P A;  1SI0 A;  4RPO A;  2WKY A;  2V25 A;  4XF5 A;  4QFL A;  5F1Q A;  4JBZ A;  1Y1M A;  3PD8 A;  4XKP A;  3IO4 A;  3IOT A;  1NV4 A;  4R9F A;  1B5J A;  3N5L A;  2E0S A;  4IO6 A;  3IB0 A;  1Y20 A;  2HFB A;  4DXU A;  4MJO A;  3U65 A;  4QBA A;  3KN7 A;  4KPT A;  4QSD A;  3TTN A;  3MP8 A;  3ROJ A;  3TKD A;  2QPQ A;  4MNC A;  2GQ1 A;  5K2X A;  2PVU A;  3I5O A;  4QFK A;  5HPQ A;  3K6W A;  3MVZ A;  1LFG A;  1S7Y A;  4PF8 A;  1DK4 A;  1FBE A;  5ESY A;  1A55 A;  4PC9 A;  4I3Y A;  1MXW A;  3TAJ A;  3RUM A;  2QS1 A;  3D1R A;  4P11 A;  2HXW A;  5HBC A;  1MQG A;  2HCA A;  3AXF A;  5A5X B;  5I56 B;  4I40 A;  5ELV A;  4POW A;  1IXC A;  3FXQ A;  1I69 A;  1ZKB A;  4PBQ A;  3QXM A;  4LA9 A;  3CIJ A;  5KZT A;  2ZZW A;  2D5W A;  3W9V A;  4NF4 A;  2P3N A;  1FPI A;  3SDF A;  2I6E A;  1Y3Q A;  4MLQ A;  4YB5 A;  2O1L A;  3V89 B;  4QXD A;  1YCJ A;  1Y4C A;  1S9T A;  3MPL A;  1TXF A;  3GYY A;  3G3J A;  4JVI A;  2RKM A;  3HV1 A;  3V5A A;  1SW2 A;  2UYF A;  4LZ8 A;  1R9L A;  1NNP A;  5FTI A;  2O51 A;  4GLI A;  4M1V A;  5A5L A;  3A3C A;  1B5I A;  4U1Z A;  3SEU A;  1M5C A;  4GWO A;  5KDT B;  1SW5 A;  4O94 A;  4ELP A;  2B65 A;  4NAP A;  3OO7 A;  4YKI A;  5I2N B;  1PB9 A;  4PBH A;  4ESW A;  2O6A A;  4BDR A;  2ZYK A;  4GFR A;  3KC0 A;  3LUZ A;  3VVD A;  3BFU A;  1D9Q A;  4ESX A;  4PAF A;  4R6K A;  3RT8 A;  1CNQ A;  4HE2 A;  3TEL A;  4PTK A;  4UA8 A;  1R9Q A;  1NUW A;  3RPL A;  3C4M A;  4PAI A;  5I56 A;  3VVF A;  1N7W A;  4X1D A;  1FCK A;  4LZ7 A;  4OWD A;  1AL3 A;  2Y7K A;  1B7U A;  4JVC A;  2CZH A;  3IFA A;  2HZK A;  1UTH A;  4KD5 A;  5AA2 A;  4OFJ A;  3N26 A;  3T9U A;  3RTW B;  2ZZV A;  4OVR A;  1ATG A;  4NF4 B;  1DBZ A;  3FVK A;  1PB8 A;  2B4M A;  1P1O A;  1GVC A;  4RA1 A;  3IFC A;  2OK2 A;  2WEF A;  4ZEB A;  2F36 A;  3K0V A;  4RPN A;  4R9G A;  5I3S A;  5BWJ A;  2DWA A;  2QVU A;  1URD A;  1FPE A;  1VR5 A;  5IZ3 A;  2RCA A;  5KCJ B;  3VLV A;  2RF1 A;  4JXI A;  2Z8D A;  1TWY A;  2XXK A;  3H4Z A;  1LAH E;  3ECR A;  3MAM A;  2QRY A;  5J1D A;  4EF1 A;  1FPF A;  1GTK A;  4G68 A;  1FSA A;  1HSL A;  3C32 A;  4WXJ A;  1ZMG A;  3D4G A;  3QYT A;  5JTY B;  3HHF A;  4JSO A;  1IME A;  1N84 A;  1LAF E;  3SKP A;  4U4X A;  4E0W A;  3MJN A;  2ONK E;  3CVG A;  4BLA A;  3SEX A;  4HCY A;  1XS5 A;  3CHG A;  1MY2 A;  4ND9 A;  1LBB A;  2QSX A;  3JYR A;  2KQZ A;  1IEJ A;  4P0G A;  3K1P A;  3MST A;  4Q0C A;  4WED A;  1FTM A;  1JEV A;  1URG A;  4RK9 A;  3TTR A;  3SEW A;  1NV1 A;  1Y3P A;  3N6U A;  4OYV A;  1B3F A;  3K6U A;  4IO7 A;  4AS5 A;  1QKB A;  3TTM A;  5ICT A;  1MM7 A;  5LDZ A;  4OVS A;  4LP2 B;  5IZ1 A;  3LC8 A;  1SYI A;  5I57 A;  1EYJ A;  3O6I A;  4F19 A;  1UTH B;  2OLB A;  1VFD A;  1D3K A;  3T93 B;  4GL8 A;  1QUL A;  1RDZ A;  5H8H B;  1II5 A;  4PF6 A;  3OEL A;  2F35 A;  1FBD A;  3MVY A;  1EYI A;  4YMA A;  4YKK A;  1FQA A;  3S9L C;  2VOZ A;  1B0L A;  4KYS A;  5ET6 A;  3KC1 A;  2HQ0 A;  2YPN A;  3FXB A;  2Q89 A;  3UN6 A;  1SVX B;  1GV8 A;  2YJP A;  3G3F A;  4GWS A;  3U1O A;  2UVH A;  4OA4 A;  1MH3 A;  5IZ3 B;  5F24 A;  2I3W A;  3ODB A;  3T0J A;  1B1X A;  1LAG E;  1FTA A;  5CM6 A;  4GIZ A;  4P0I A;  4RYA A;  1FQF A;  1QGX A;  4PET A;  3GLB A;  5TPA A;  3IOW A;  2Y5K A;  4DIG A;  2ZYO A;  4X1B A;  1N04 A;  4YAH X;  1OLC A;  4ZEC A;  4YKP A;  3UK4 A;  4FED A;  1FPK A;  1UIU A;  4POX A;  2H25 A;  2F3D A;  3HO7 A;  2VPO A;  2I4C A;  4G68 B;  4IR8 A;  5CMK A;  3R26 A;  5AA3 A;  4G68 C;  3L6H A;  3RNN A;  3KGC A;  2XXQ A;  4EQ9 A;  3A29 A;  2DXY A;  3T66 A;  1BP5 A;  3FXU A;  3LUY A;  3Q28 A;  1J1N A;  1D9Y A;  5I57 B;  2DOJ A;  3K6V A;  1KA0 A;  3S4U A;  1QJM A;  5EHS A;  1MM6 A;  1MQI A;  4IO4 A;  1YYZ A;  1DCU A;  4ZDM A;  4RXL A;  4RK2 A;  2OWS A;  4PFW A;  5EQ9 A;  4GQO A;  4O7I A;  4XTC Q;  3ISP A;  1LFI A;  4MNP A;  1JNF A;  1NUX A;  2NWJ A;  2BJJ X;  3VLW A;  4G8M A;  4N17 A;  4KYE A;  1G0H A;  4C1U A;  2Y5L A;  5B7D A;  4DI3 D;  4HCW A;  3KG2 A;  1LFH A;  3TDJ A;  3IJO B;  1N3X A;  2FIE A;  4K3F A;  3KZG A;  4QSC A;  1B1H A;  4RY1 A;  3T96 B;  4MLV A;  1B58 A;  2ZMB A;  1JVY A;  4QSE A;  1ZBM A;  2YLN A;  3FXR A;  4PGP A;  3LSL A;  3FVN A;  4HE1 A;  2Q88 A;  5DT6 A;  1USY E;  1D4N A;  3K6X A;  3EQ1 A;  4I8C A;  5TU0 A;  3TCG A;  2Z8E A;  1MDQ A;  5AA4 B;  1FPB A;  4JB7 A;  3DLN A;  3WAF A;  1DTG A;  2P2A A;  3C34 A;  3O97 A;  5A5X A;  3P7I A;  2THI A;  3RT6 B;  5LTC A;  2F6G A;  4OHN A;  3TCH A;  1M5F A;  1QW0 A;  3USD A;  1FBC A;  1LEV A;  1XHY A;  2RCB A;  2DWJ A;  3QSL A;  1S50 A;  1B3E A;  1KA1 A;  1DOT A;  4G8N A;  3KN3 A;  1DPE A;  1L5T A;  3PMV A;  3U92 A;  2PMS A;  4LVQ A;  2WYK A;  1B5H A;  3H6T A;  1B9J A;  3PUW E;  4AS4 A;  1IUD A;  4LUB A;  3FV2 A;  4IB2 A;  3PPN A;  3IOR A;  5DVF A;  1EU8 A;  1Y1Z A;  2G93 A;  1MDP 1;  2UVI A;  4KFQ A;  2OX3 A;  3IAZ A;  3E79 A;  3PD9 A;  4DXC A;  3B6Q A;  1B05 A;  4PDD A;  4MEV A;  2ONR A;  1XI6 A;  3RTF B;  2O7I A;  1JW5 A;  3PPQ A;  1O7T A;  3TOD A;  5DVI A;  1Y9U A;  3KEI A;  4H8J A;  1MXV A;  3MVX A;  3KFM A;  3QK6 A;  3UGW A;  1Z7N E;  3UA8 A;  4EF2 A;  5CMC A;  1VFE A;  2RC8 A;  2R8T A;  4Q5T A;  5H8Q B;  4OVT A;  2PBW A;  1POT A;  4GX4 A;  1ELJ A;  2A5T B;  3O6G A;  3MPK A;  3PUZ E;  3K2D A;  1BK4 A;  4G61 A;  1NI9 A;  1EH3 A;  2UYE A;  3HCQ A;  4H1X A;  3F11 A;  1MS7 A;  4PCD A;  3VVE A;  2DE4 A;  2DWH A;  4QHQ A;  1LBV A;  1NH7 A;  4GWW A;  3FZV A;  5CBS A;  4P56 A;  4PFI A;  3HFU A;  3OXN A;  3C31 A;  1I6Q A;  1OIB A;  2XX9 A;  1XOC A;  4ZE8 A;  2PFY A;  2L5V A;  2XXW A;  2Q74 A;  4EXK A;  2CMO A;  4EXL A;  3MZB A;  2CEX A;  3JV9 A;  4O7M A;  4MF3 A;  4H67 A;  1JEU A;  3MYU A;  3QMF A;  5I2K B;  2VD3 A;  1LBX A;  3Q27 A;  4LN5 A;  4GXA A;  4MAG A;  1FTJ A;  3DP4 A;  2E1S A;  2KR0 A;  2HAU A;  4H45 A;  3O66 A;  4THI A;  3CSB A;  4YIC A;  3ONM A;  3IB1 A;  3Q25 A;  3DP6 A;  4NTL A;  1UTB A;  4XKQ A;  2Q9T A;  3WAE A;  1TFA A;  2I4B A;  4N6K A;  2CEY A;  3VXB A;  4ZS9 A;  2ZXT A;  3OEN A;  4EQ7 A;  3E13 X;  5ITO A;  3FV1 A;  1H43 A;  1IMC A;  4ZZA A;  4OVP A;  1K9Z A;  4C0R A;  1US4 A;  3QAX A;  3OO6 A;  1B4Z A;  1AH5 A;  1NFT A;  1NUZ A;  3VE1 B;  2QFL A;  1FTK A;  3G3K A;  3T1B A;  1SI1 A;  3FVO A;  3PU5 A;  2FYI A;  3IR1 A;  4LON B;  1RYO A;  1A7L A;  5I2N A;  4UAB A;  4KCC A;  2NUV A;  3FUZ A;  1NUY A;  1MQJ A;  1IMD A;  5B70 A;  4GOT A;  3TYH A;  2I3V A;  1EZP A;  4AQ4 A;  3TMG A;  4O8M A;  2Z22 A;  1LBY A;  4NE4 A;  3TEP A;  4FOR A;  2P1S A;  1EZO A;  3FVG A;  1LCT A;  1O64 A;  5AA2 B;  1JW4 A;  4GRK A;  4H8I A;  3FJ7 A;  2QS4 A;  4ZZE A;  1Z7M E;  1WDN A;  4PDH A;  2XWV A;  2I48 A;  4N8Y A;  3VXC A;  2A5S A;  1USY H;  5AA2 D;  3PMW A;  1B0H A;  1MQH A;  4XIG Q;  1FTL A;  1B3G A;  2XXP A;  4QFN A;  1LBC A;  3T9V A;  3VFJ A;  3SER A;  3D4C A;  1INP A;  3CFX A;  1QVS A;  4NF5 A;  4FAT A;  2PCR A;  3W9W A;  1JW1 A;  3FGS A;  3EHS A;  4JWY A;  3MP6 A;  5KCJ A;  1LAX A;  3FAS A;  3PPR A;  4XXU A;  1XVY A;  3RPW A;  4U1O A;  5ET8 A;  4N07 A;  4QRZ A;  1AWB A;  4PFY A;  1LBW A;  4F1U A;  3IOV A;  5KDT A;  3PV0 E;  3C35 A;  1IQ7 A;  1A54 A;  2OCU A;  2I0C A;  2DWI A;  4ZEF A;  4F29 A;  4KXP A;  1FW0 A;  3U72 A;  2ZZX A;  3MC2 A;  1Y4T A;  4PFB A;  3KJT A;  2O69 A;  1LBZ A;  3OO9 A;  2QVV A;  2ZNS A;  1OVB A;  5JEI A;  3PPO A;  4OEU A;  3RGY A;  3L6G A;  4NGU A;  4Q8R A;  4OFL A;  5DYH A;  1PBP A;  4YB7 A;  4FAJ A;  5L9M A;  1NMU A;  1SQY A;  3I6V A;  4G77 A;  1GGG A;  4O3B A;  2B4L A;  4H6D A;  3OEM A;  1JP4 A;  4Z0I A;  4DE8 A;  1DTZ A;  2CZK A;  1P99 A;  3U93 A;  1ZLQ A;  4GX3 A;  4MMP A;  4F3P A;  5I59 B;  4H65 A;  2HEU A;  1B46 A;  3DEL B;  3V83 A;  5FHO A;  4PP0 A;  4Z7E A;  4OEV A;  3G3I A;  1MXX A;  4G2Z A;  3GZG A;  3OMB A;  3LBS A;  1NV0 A;  4MHF A;  2OBG A;  3MW0 A;  2HPG A;  2Z23 A;  4NWD A;  1B40 A;  2Q8M A;  3ZS6 A;  1NH8 A;  3CI8 A;  4MH5 A;  4F2O A;  4H5G A;  3ZSF A;  4IGR A;  2O84 X;  2WBD A;  1N76 A;  1CE2 A;  5FBP A;  1POY 1;  3G7W A;  4NF5 B;  3RLF E;  1MG1 A;  1US5 A;  3LR1 A;  4JWX A;  1AMF A;  3FJG A;  4MFI A;  4O3A A;  4U23 A;  3H03 A;  4YKJ A;  4R73 A;  4QFP A;  2Y7P A;  4I62 A;  3PUV E;  5EQA A;  1IIT A;  1D9V A;  1DPP A;  2HXR A;  2XXU A;  4YZZ A;  4GF8 A;  1PEB A;  4MNI A;  1YAE A;  5T3J A;  3M3L A;  5EYF A;  4HS7 A;  2B3B A;  4NWC A;  4XFE A;  1UTB B;  1K9Y A;  2XWO A;  2DS9 A;  4OES A;  3PPP A;  1FPD A;  1DMB A;  4ZEK A;  3TFL A;  1MY1 A;  3RPL B;  3G3H A;  3IL1 B;  2WYP A;  3RQT A;  3LSW A;  4ZE9 A;  3KN8 A;  3OOA A;  3PUX E;  5I5P A;  4DCX A;  1SW1 A;  2X7P A;  3U94 A;  3IJX B;  2ALU A;  1LGB C;  1RDX A;  1GR2 A;  4H5F A;  5BUU A;  4GBW A;  1ZTY A;  1KWH A;  1NV6 A;  2XXT A;  5M2V A;  3TZA A;  3UP9 A;  2FBP A;  5DTB A;  3CSG A;  3N6T A;  5L8D A;  5LOM A;  4LQ2 A;  2F7C A;  4PE3 A;  2GH9 A;  2DVC A;  1XT8 A;  2ZNU A;  3HHG A;  1FJ6 A;  5H8F B;  2V4C A;  5CRY A;  4DCY A;  1BTJ A;  1LB9 A;  3Q29 A;  4F1Y A;  3TQL A;  1FTO A;  2O1M A;  2REJ A;  3M3F A;  2Y7I A;  1FPJ A;  5I2K A;  4NX1 A;  3BIG A;  3S9M C;  1JQF A;  2I49 A;  1N7X A;  2DXR A;  4EQB A;  1VSO A;  1SPI A;  2HZL A;  4R2F A;  4GBV A;  2P0S A;  1P1U A;  3FIR A;  4IY6 A;  3CFZ A;  1MXY A;  4QFO A;  2NXO A;  4IO3 A;  3EKI A;  2OWZ A;  1SD3 A;  5CMM A;  3S9N C;  4KR5 A;  2OZZ A;  2WBB A;  2QJE A;  4OZ9 A;  1OMP A;  5L9O A;  2DE2 A;  3SEV A;  4AB6 A;  1QUK A;  2H99 A;  1NV3 A;  4FJP A;  2Q2C A;  1JET A;  2QMX A;  1M5D A;  3R7X A;  2DVZ A;  3HST A;  4XEQ A;  1IMB A;  1KZ8 A;  1YTV A;  1IZ1 A;  2GFE A;  3C36 A;  5EHM A;  5DEX B;  2F34 A;  1NNK A;  1B32 A;  3VLU A;  4YB6 A;  2G29 A;  2F97 A;  4TLM B;  2R71 A;  4GXS B;  4F31 B;  2HAV A;  4OXV A;  5I84 A;  3O9P A;  1IMF A;  4EUO A;  1A99 A;  1OQG A;  4NG7 A;  2REG A;  5H8S A;  2UVG A;  2O68 A;  2QMW A;  4X04 A;  3UOR A;  5I7I A;  5H8F A;  5I59 A; 
#chains in the Genus database with same CATH homology
 4AQ4 A;  3MJN A;  4G8H A;  3TMG A;  3THI A;  3KSX A;  3CFL A;  1A8F A;  2A5T A;  2ONK E;  2Z22 A;  3CRB A;  4RJZ A;  3CVG A;  1MRP A;  4NE4 A;  4TQU Q;  4FOR A;  1XS5 A;  4HCY A;  3SEX A;  4BLA A;  2V3Q A;  3TEP A;  2P1S A;  4I1D A;  4F18 A;  1EZO A;  5I58 A;  4PFU A;  1MY2 A;  3FVG A;  3UIF A;  3GXA A;  1LCT A;  1O64 A;  2I58 A;  5AA2 B;  1JW4 A;  4GRK A;  3Q26 A;  4DLD A;  2Y84 A;  4ND9 A;  1OQH A;  1LBB A;  1LB8 A;  1F9B A;  2QSX A;  3JYR A;  3KOS A;  5F7V A;  1AIV A;  4H8I A;  3TTK A;  1B51 A;  3FJ7 A;  2QS4 A;  4ZZE A;  4HW8 A;  3A3U A;  1IEJ A;  1Z7M E;  4P0G A;  3K1P A;  5AA4 A;  1HSJ A;  4ECF A;  1M5E A;  1WDN A;  4Q0C A;  1FTM A;  4WED A;  2H4I A;  1PDA A;  1JEV A;  4BDN A;  3TUS A;  1URG A;  2AIX A;  4RK9 A;  3SET A;  4IGT A;  2DYX A;  3SEW A;  4HTG A;  1H44 A;  1Y3P A;  1MY0 A;  2F6P A;  2XHD A;  3N6U A;  4OER A;  1I6B A;  1YPN A;  2I48 A;  4XKN A;  4OYV A;  3VXC A;  1B3F A;  2A5S A;  3ILT B;  3K6U A;  4U2R A;  4IO7 A;  1QKB A;  5TP9 B;  3M8U A;  1MM7 A;  3C9H A;  1Q35 A;  3TTM A;  2XXV A;  3H06 B;  1USY H;  2OWT A;  3H6W A;  3TPA A;  5AA2 D;  1NKX A;  3WAE A;  3PMW A;  5FHN A;  3FAT A;  1B0H A;  3LC8 A;  4LP2 B;  1MQH A;  4XIG Q;  1P1W A;  1SYI A;  5I57 A;  1FTL A;  3O6I A;  2ZYN A;  3CG1 A;  3OEK A;  4IO5 A;  2NVU B;  4ZEC A;  3GBA A;  4F19 A;  1UTH B;  1B3G A;  2OLB A;  2XXP A;  4QFN A;  2XX8 A;  1LBC A;  2AYS A;  1VFD A;  3T9X B;  2XX7 A;  3T9V A;  5ISU A;  4ONY A;  4R2B A;  3VFJ A;  3R6U A;  4F1V A;  1IXH A;  1MPB A;  1D3K A;  3O2A A;  3SER A;  1RKM A;  3T93 B;  3D4C A;  4FIM A;  3CFX A;  2IEE A;  4GL8 A;  1QVS A;  1RYX A;  2OJT A;  3KSJ A;  5FHM A;  4NF5 A;  4KI0 E;  4FAT A;  1QUL A;  2ESN A;  3W9W A;  1SW4 A;  4DXB A;  4NF8 A;  3EHU A;  5H8H B;  4ELO A;  5CBR A;  1JW1 A;  5ICQ A;  3FGS A;  1II5 A;  2ABH A;  2RIN A;  3EHS A;  2Q2A A;  2F78 A;  1IIW A;  4JWY A;  3RN8 A;  3MP6 A;  5KCJ A;  4OFO A;  5CMB A;  1LAX A;  3FAS A;  3OEL A;  3PPR A;  2F35 A;  3QIM A;  3BFT A;  3MVY A;  4XXU A;  4YMA A;  4OTE A;  2KLF A;  1XVY A;  4YKK A;  1H45 A;  3RPW A;  1FQA A;  3S9L C;  2VOZ A;  4U1O A;  1B0L A;  4KYS A;  2M8C A;  1FQB A;  4N07 A;  4E0X A;  2HQ0 A;  1B2H A;  1MY4 A;  2YPN A;  4KHZ E;  3DM0 A;  3ILU B;  4QRZ A;  3UN6 A;  2Q89 A;  2V93 A;  4BDM A;  1SVX B;  2XD2 A;  4ISU A;  4R75 A;  5CC2 A;  1GV8 A;  4PFY A;  2YJP A;  3S9E A;  1WOD A;  3G3F A;  3KBR A;  1OLA A;  4F1U A;  4F39 A;  4I9D A;  3IOU A;  3U1O A;  2UVH A;  4BDL A;  3IOV A;  1MH3 A;  3KOT A;  3FD3 A;  1BLF A;  2I3W A;  3O6H A;  3PV0 E;  3C35 A;  3MZ1 A;  1IQ7 A;  3ODB A;  1QUJ A;  4WEP A;  5FTH A;  1B1X A;  1FQD A;  4NED A;  4R74 A;  4BDQ A;  4H0W A;  1IXG A;  2O7U A;  1A8E A;  1LAG E;  4PFT A;  2F7B A;  2DSF A;  5IAI A;  1A54 A;  4YMB A;  4GVO A;  4OQO A;  4DDD A;  2OCU A;  5CM6 A;  4GIZ A;  3W15 C;  4P0I A;  2I0C A;  3HPI A;  4NF8 B;  4RYA A;  2DWI A;  4GD5 A;  5H8H A;  1FQF A;  4PET A;  4ZEF A;  3GLB A;  5DEX A;  4F29 A;  1FW0 A;  3IOW A;  5TPA A;  3U72 A;  4ELR A;  2W7Y A;  4DIG A;  5ITP A;  2ZYO A;  4LQ5 A;  5CI5 A;  3MC2 A;  5HM4 B;  2R6G E;  2Z8F A;  1N04 A;  3KJ7 A;  4X1B A;  2B3F A;  1BIY A;  1OLC A;  1Y3N A;  1ZJL A;  4FE8 A;  4X48 A;  4YAH X;  4MBP A;  1Y4T A;  4YKP A;  4FED A;  1VE4 A;  4O3C A;  3UK4 A;  2FNC A;  4AB5 A;  1UIU A;  3KJT A;  1NNF A;  4POX A;  2O69 A;  4L17 A;  3FJM A;  4F3S A;  2GHA A;  5KDT A;  3ZKK A;  2VP1 A;  3CG3 A;  2H25 A;  3OO9 A;  3EF7 A;  3HO7 A;  3IO6 A;  2X26 A;  2ZNS A;  1OVB A;  2ONS A;  3CR9 A;  2I4C A;  4PQJ A;  5JEI A;  3PPO A;  3MP1 A;  3PUY E;  4KCD A;  3IK6 B;  4G68 B;  4OEU A;  3RGY A;  3L6G A;  5CMK A;  4Q8R A;  4OFL A;  1ZU0 A;  5DYH A;  4NMY A;  3JZJ A;  1PBP A;  3R26 A;  5AA3 A;  5AE4 A;  3MQ9 A;  3N94 A;  1SDX A;  3L6H A;  4G68 C;  2UXA A;  4YB7 A;  5K2Y A;  3A09 A;  3MBP A;  4OET A;  5L9M A;  3RNN A;  4FAJ A;  2DP8 A;  3KGC A;  2XXQ A;  1I6A A;  1MQD A;  1NMU A;  3E9X A;  1SQY A;  3H6U A;  3I6V A;  4G77 A;  2RC9 A;  4FEB A;  4TLL B;  1GGG A;  3H6V A;  3K00 A;  4EQ9 A;  2DXY A;  3V8X B;  2LAO A;  4O3B A;  3T66 A;  1BP5 A;  3FXU A;  3LUY A;  3OEM A;  3MUQ A;  3Q28 A;  4H6D A;  1J1N A;  2FA7 A;  1D9Y A;  3OO8 A;  4Z0I A;  5I57 B;  5I59 A;  5TP9 A;  1FQE A;  4R6Y A;  4ZDM A;  4DE8 A;  1DTZ A;  2DOJ A;  1MXZ A;  3K6V A;  4ELQ A;  3HN0 A;  4DZ1 A;  1P99 A;  3DP8 A;  3U93 A;  1R6Z A;  1LST A;  1P1N A;  1ZLQ A;  4M4G A;  4WKM A;  4EDP A;  2Y7R A;  3K1M A;  4H65 A;  1MPD A;  5TPA B;  3S4U A;  4F2Q A;  4F3P A;  5I59 B;  1QJM A;  2HEU A;  3U8Q A;  1NNT A;  2QS3 A;  5EHS A;  1B46 A;  3DEL B;  3V83 A;  5FHO A;  1BKA A;  1MM6 A;  1MQI A;  2XXH A;  4IO4 A;  4ZEI A;  2NOO A;  4IY5 A;  3G3G A;  4PP0 A;  4Z7E A;  4OEV A;  2VHA A;  3TCF A;  3G3I A;  1MXX A;  2F5X A;  4G2Z A;  4N6P A;  2XXI A;  3MZ9 A;  1SI0 A;  4RXL A;  4RK2 A;  1M5B A;  4RPO A;  2OWS A;  2WKY A;  4PFW A;  3GZG A;  4GQO A;  3OMB A;  3LBS A;  4XTC Q;  1URS A;  3C33 A;  2V25 A;  4QFL A;  1LFI A;  3MWB A;  1H3D A;  2OBG A;  3MW0 A;  5F1Q A;  3PGF A;  1JNF A;  2Z23 A;  4JBZ A;  1Y1M A;  4NWD A;  1B3L A;  2NWJ A;  3PD8 A;  4E0W A;  1B40 A;  4XKP A;  3ZS6 A;  1NH8 A;  3CI8 A;  2BJJ X;  3IO4 A;  3IOT A;  3VLW A;  4G8M A;  4JSD A;  4R9F A;  1B5J A;  3N5L A;  4MH5 A;  4F2O A;  2E0S A;  4IO6 A;  1TFD A;  3E4R A;  4KYE A;  2ANJ A;  4NF6 B;  4H5G A;  4OVJ A;  3ZSF A;  4NF6 A;  3IB0 A;  4C1U A;  3S2V A;  4IGR A;  1Y20 A;  4YU0 A;  2O84 X;  5B7D A;  2HFB A;  4HCW A;  1N76 A;  1CE2 A;  4PE5 B;  3KG2 A;  4DXU A;  1POY 1;  3E3K A;  3G7W A;  4NF5 B;  3KN7 A;  4KPT A;  3RLF E;  5IKB A;  4QSD A;  1LFH A;  3TTN A;  3MP8 A;  2V3T A;  3TDJ A;  3IJO B;  3TKD A;  1N3X A;  2QPQ A;  4K3F A;  2VGQ A;  1MG1 A;  3KZG A;  5K2X A;  1US5 A;  2H5Y A;  2PVU A;  3LR1 A;  3I5O A;  1AMF A;  3FJG A;  4JWX A;  4MFI A;  4QSC A;  4U21 A;  5L9S A;  1B1H A;  4O3A A;  1CB6 A;  4QFK A;  4RY1 A;  3H03 A;  4U23 A;  4YKJ A;  3T96 B;  4R73 A;  2UVJ A;  4QFP A;  2Y7P A;  4MLV A;  3K6W A;  1N3W A;  3MVZ A;  1LFG A;  5HPQ A;  1S7Y A;  1B58 A;  4I62 A;  2ZMB A;  3OSQ A;  1ZIU A;  1DSN A;  1JVY A;  2XD3 A;  3PUV E;  4QSE A;  3EHT A;  5JK4 A;  1ZBM A;  4F3B A;  1A55 A;  1B52 A;  1IIT A;  2V3U A;  2YLN A;  1D9V A;  3FXR A;  3K1N A;  3LSL A;  1DPP A;  3FVN A;  1B6H A;  1MXW A;  1SYH A;  2XXU A;  4GF8 A;  4YZZ A;  1PEB A;  3TAJ A;  1YAE A;  2Q88 A;  4X9T A;  1USY E;  4TOZ A;  2QS1 A;  3EPE A;  5DT6 A;  3RUM A;  1D4N A;  3K6X A;  3M3L A;  3EQ1 A;  4P11 A;  5EYF A;  2HXW A;  4I8C A;  5TU0 A;  4HS7 A;  5DVJ A;  5HBC A;  4JWO A;  1MQG A;  3TCG A;  2Z8E A;  1MDQ A;  1MPC A;  2B3B A;  4KQP A;  4NWC A;  5AA4 B;  4JB7 A;  1UTB B;  2HCA A;  3AXF A;  3DLN A;  3WAF A;  1DTG A;  5A5X B;  5I56 B;  2DS9 A;  2PT2 A;  4OES A;  2P2A A;  3PPP A;  3C34 A;  2XXR A;  3O97 A;  2PYY A;  5ELV A;  5A5X A;  1MXU A;  3H7M A;  3P7I A;  1DMB A;  2THI A;  4POW A;  4ZEK A;  2F6G A;  3IX1 A;  1IXC A;  1MY1 A;  4OHN A;  1UIV A;  3TFL A;  3TCH A;  1M5F A;  1PC3 A;  1QW0 A;  3USD A;  3TQW A;  3FXQ A;  1O63 A;  1I69 A;  4LAT A;  1XC1 A;  1XHY A;  3G3H A;  2RCB A;  1T0K A;  3IL1 B;  1ZKB A;  2DWJ A;  3QSL A;  1S50 A;  3RQT A;  1B3E A;  3LSW A;  3QXM A;  3KN8 A;  4ZE9 A;  1DOT A;  3OOA A;  3PUX E;  4G8N A;  4LA9 A;  4DCX A;  3CIJ A;  3KN3 A;  3VV5 A;  1DPE A;  5KZT A;  1SW1 A;  2X7P A;  3U94 A;  3IJX B;  3PMV A;  1L5T A;  3U92 A;  3B7D A;  2PMS A;  3O28 A;  2PX1 A;  4LVQ A;  2ALU A;  1LGB C;  3RY3 A;  1B5H A;  1GR2 A;  2D5W A;  3H6T A;  3W9V A;  4NF4 A;  1B9J A;  3PUW E;  3SDF A;  2AL5 A;  2I6E A;  1IUD A;  1Y3Q A;  4MLQ A;  4H5F A;  4YB5 A;  4GL0 A;  1XVX A;  1TT1 A;  2O1L A;  4LUB A;  3FV2 A;  5BUU A;  5H8N B;  4IB2 A;  1Q1K A;  3PPN A;  3IOR A;  3V89 B;  1YCJ A;  5DVF A;  1MY3 A;  1EU8 A;  1LCF A;  1Y4C A;  1ZTY A;  1Y1Z A;  1KWH A;  2G93 A;  1S9T A;  3MPL A;  1LLS A;  2XXT A;  4OEN A;  1MDP 1;  1TXF A;  2UVI A;  3G3J A;  4KFQ A;  5M2V A;  3TZA A;  3UP9 A;  2RKM A;  5DTB A;  3CSG A;  3N6T A;  1B3H A;  3HV1 A;  3IAZ A;  3QUF A;  5L8D A;  3PD9 A;  3V5A A;  4DXC A;  3B6Q A;  1B05 A;  1HSE A;  1NL5 A;  1SW2 A;  4LQ2 A;  2UYF A;  2F7C A;  3O29 A;  2GH9 A;  4LZ8 A;  1R9L A;  3BKI B;  2ONR A;  1NNP A;  5FTI A;  2DVC A;  1H76 A;  3RTF B;  2O7I A;  3MVW A;  2O51 A;  1ANF A;  4BDO A;  1JW5 A;  1XT8 A;  4GLI A;  4M1V A;  2ZNU A;  3PPQ A;  1O7T A;  3TOD A;  3HHG A;  1Y9U A;  2H98 A;  5DVI A;  3A3C A;  3KEI A;  2R9J A;  2F8D A;  4H8J A;  4OMB A;  1MXV A;  5H8F B;  3MVX A;  4F3G A;  2D3I A;  1B5I A;  4U1Z A;  3SEU A;  5CRY A;  3KFM A;  1M5C A;  3QK6 A;  3UGW A;  1Z7N E;  3UA8 A;  4DCY A;  1BTJ A;  2V84 A;  4GWO A;  5CMC A;  1VFE A;  2RC8 A;  4EF2 A;  5KDT B;  4Q5T A;  2DQV A;  1LB9 A;  1UQW A;  4G4P A;  5H8Q B;  2PBW A;  3Q29 A;  1SW5 A;  4F1Y A;  3TQL A;  1FTO A;  2O1M A;  1POT A;  5JTY A;  2REJ A;  3M3F A;  1ELJ A;  2A5T B;  4RNS A;  1PB7 A;  4ELP A;  2B65 A;  3O6G A;  2Y7I A;  3TTR A;  3MPK A;  3B6W A;  3OO7 A;  3PUZ E;  3K2D A;  4YKI A;  3GBB A;  4Q30 B;  5I2N B;  3SEY A;  5I2K A;  1PB9 A;  2ZYM A;  3S9M C;  1JQF A;  1EH3 A;  2UYE A;  4ESW A;  1A40 A;  1FQC A;  2O6A A;  3HCQ A;  4R6H A;  4BDR A;  2I49 A;  3BBR A;  4H1X A;  5AA1 A;  1N7X A;  2DXR A;  2ZYK A;  4GFR A;  4EQB A;  1VSO A;  3F11 A;  1MS7 A;  3VVE A;  2DE4 A;  2DWH A;  4FEC A;  3VVD A;  2CZL A;  3BFU A;  4C0R A;  5H8N A;  4QHQ A;  1NH7 A;  2HZL A;  4ESX A;  2VD2 A;  4R6K A;  4R2F A;  3RT8 A;  2I0B A;  2P0S A;  3FZV A;  5CBS A;  1P1U A;  3TEL A;  3FIR A;  4UA8 A;  1R9Q A;  3T9H B;  3VDF A;  4IY6 A;  3OXN A;  2DE3 A;  3CFZ A;  2QL3 A;  3C31 A;  1MXY A;  2RC7 A;  4QFO A;  1I6Q A;  3QUJ A;  1OIB A;  1OVT A;  2XX9 A;  2NXO A;  1XOC A;  3C4M A;  4ZE8 A;  3RT6 B;  1EZ9 A;  5I56 A;  4IO3 A;  2XXW A;  3VVF A;  1N7W A;  4X1D A;  4EXK A;  2CMO A;  1FCK A;  4LZ5 A;  4LZ7 A;  4EXL A;  4UAC A;  3MZB A;  2H9B A;  1SD3 A;  2XXY A;  1AL3 A;  3I3V A;  4OWD A;  5CMM A;  3S9N C;  4KR5 A;  2OZZ A;  2F7A A;  2Y7K A;  3JV9 A;  2QJE A;  2AL4 A;  1MH4 A;  4MF3 A;  1B7U A;  4ZED A;  4OZ9 A;  4H67 A;  1JEU A;  1OMP A;  5I2K B;  1AOV A;  2VD3 A;  3OSR A;  5L9O A;  2DE2 A;  3Q27 A;  3ZKL A;  2QS2 A;  4U22 A;  3SEV A;  2HZK A;  1QUK A;  1UTH A;  4GXA A;  4KD5 A;  4AB6 A;  5AA2 A;  2H99 A;  1FTJ A;  3DP4 A;  3N26 A;  4OFJ A;  3T9U A;  2E1S A;  4QF9 A;  4C1T A;  2HAU A;  1B7Z A;  4FJP A;  2Q2C A;  3K01 A;  3O66 A;  1JET A;  3CSB A;  4THI A;  3RTW B;  2Q8J A;  4YIC A;  3TTL A;  2QMX A;  5LOM A;  1M5D A;  1ATG A;  3ONM A;  3IB1 A;  3K02 A;  3OD7 A;  3EN3 A;  3Q25 A;  4NF4 B;  4XKR A;  3R7X A;  5I58 B;  2DVZ A;  1IXI A;  3DP6 A;  3HST A;  3FVK A;  4NTL A;  1PB8 A;  1B7H A;  1UTB A;  1P1O A;  1YTV A;  2Q9T A;  1IZ1 A;  2GRV A;  4XKQ A;  2GFE A;  3C36 A;  1TFA A;  2OK2 A;  4RA1 A;  5DEX B;  3H3G A;  2F34 A;  5EHM A;  1GVC A;  4ZEB A;  1NNK A;  2F36 A;  2I4B A;  1B32 A;  1QUI A;  3K0V A;  3VLU A;  4RPN A;  4YB6 A;  2G29 A;  3B6T A;  2F97 A;  4R9G A;  5BWJ A;  2DWA A;  4TLM B;  1JVX A;  1URD A;  3VXB A;  1VR5 A;  2R71 A;  4GXS B;  2ZXT A;  3OEN A;  4ZS9 A;  2RCA A;  4F31 B;  4EQ7 A;  3VLV A;  1PBQ A;  1B4H A;  2HAV A;  3E13 X;  5KCJ B;  2RF1 A;  5ITO A;  3FV1 A;  1H43 A;  2Y7W A;  1R1N A;  4JXI A;  2Z8D A;  4ZZA A;  1TWY A;  4OXV A;  5I84 A;  5H8Q A;  3O9P A;  1US4 A;  1P1Q A;  1LAH E;  2ZNT A;  3H4Z A;  1B4Z A;  2GHB A;  3LSX A;  1AH5 A;  3OO6 A;  3QAX A;  4EUO A;  1NFT A;  3VE1 B;  2PT1 A;  3ECR A;  1FTK A;  3G3K A;  1N0T A;  2QRY A;  1A99 A;  3MAM A;  1OQG A;  5J1D A;  1SI1 A;  1SBP A;  3FVO A;  2REG A;  3PU5 A;  4EF1 A;  1GTK A;  2FYI A;  3IR1 A;  5H8S A;  4JDF A;  4LON B;  4G68 A;  4N13 A;  1RYO A;  3M3K A;  4R72 A;  2XXX A;  1A7L A;  5ICT A;  2UVG A;  2O68 A;  2X7Q A;  2QMW A;  3PMX A;  4U4S A;  3T22 A;  1WVJ A;  3K4U A;  4KYD A;  1HSL A;  4F22 A;  5I2N A;  3C32 A;  4IO2 A;  4KCC A;  4WXJ A;  2NUV A;  1ZMG A;  3D4G A;  3FUZ A;  3QYT A;  5JTY B;  3HHF A;  3UOR A;  4JSO A;  1MQJ A;  3SES A;  5B70 A;  4GOT A;  1N84 A;  3IB2 A;  3TYH A;  2I3V A;  5H8F A;  1LAF E;  3SKP A;  1EZP A;  2D21 A;  2IA4 A;  4U4X A;  3LSF B;  1QKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...