4ELPA

Ferric binding protein in apo form 2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
TLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
publication title Crystal structure of ferric binding protein A
rcsb
source organism Thermus thermophilus
total genus 109
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elpA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elpA02
3LSFB 1XVXA 3VVEA 2NOOA 2YJPA 5I2KA 3CFZA 3O6IA 5AA2D 5A5XA 1S7YA 2DP8A 3HPIA 1RYOA 3OMBA 4LQ5A 1PB7A 4FORA 5TPAA 5AA4B 1MPBA 3K02A 3N94A 4FJPA 2H25A 1B1XA 1P1NA 5JTYB 3H6TA 1LAFE 2I58A 3LC8A 2ANJA 4OWDA 2F7AA 5I59A 2QS4A 3RLFE 1BLFA 3LSXA 4G8HA 4F22A 3FVOA 1KWHA 2E1SA 4O3CA 3EF7A 4KYSA 1B9JA 4PFTA 5LOMA 3RQTA 5EHSA 2F6GA 2OZZA 3KN3A 4QRZA 2Q2AA 4ESXA 1H3DA 4NMYA 4GOTA 2B65A 1AH5A 5DVIA 1IXCA 2G29A 1EU8A 4N13A 1LFHA 4YKPA 4BDNA 3QYTA 1VSOA 4I62A 1YTVA 5IAIA 3PPPA 3KBRA 3PUXE 1GR2A 4GD5A 4THIA 3E3KA 4ZZEA 4FAJA 2HZKA 2ZYOA 3GBBA 2ABHA 3TTKA 4IB2A 2B3FA 5I84A 1FQBA 3S9MC 3T9UA 1MPDA 2P2AA 5H8NA 3UORA 3K01A 2UYEA 3S9LC 3I5OA 1LAGE 4C1UA 3G3FA 5CM6A 1JVYA 3EHUA 3QK6A 3U1OA 5TPAB 3K2DA 2NWJA 1RYXA 3FIRA 1B5IA 1N3WA 4R2BA 1L5TA 3AXFA 1LBCA 4XIGQ 1XT8A 1FTJA 1UIUA 3T93B 4QF9A 2V93A 1MQIA 4I1DA 3MVZA 2M8CA 4E0WA 4U21A 1AIVA 1B05A 5I59B 2H98A 3BKIB 5K2YA 4Z0IA 5I58A 2ZYNA 5CMKA 4JDFA 4LA9A 4P0IA 1JEVA 2XHDA 3OEMA 1NNFA 2DE3A 1I69A 1VE4A 4QHQA 2OLBA 2KLFA 4OFOA 1JVXA 2AIXA 2V3QA 4EF2A 4PFYA 5FHMA 3O28A 3K1MA 4WKMA 2HXWA 3MJNA 1PB8A 4QFLA 2F6PA 1QUKA 1PC3A 2QPQA 4ZE8A 4F18A 1Y3PA 3KJTA 1LFGA 3T9VA 3PMWA 1US4A 3OELA 2H5YA 4UA8A 4X9TA 3K1NA 1B3HA 3IOTA 3R7XA 3TTLA 1MM6A 1M5EA 2BJJX 5H8NB 4EXLA 4OHNA 4XKRA 3OSRA 1R9LA 2AL5A 3WAFA 1WVJA 4F1VA 2RC9A 1VFDA 2QJEA 3O66A 4AB5A 3B6TA 3RY3A 3KJ7A 4FE8A 2I6EA 2G93A 3UIFA 4XKQA 3TQLA 3UN6A 4HW8A 4JWXA 4OMBA 3S9EA 1WODA 4HCYA 5I58B 2Z22A 3FZVA 2DE2A 3RT6B 4RY1A 3S2VA 4R72A 3KG2A 3TCFA 4PETA 1B7HA 4EDPA 3FASA 3I6VA 3MPLA 1JEUA 3T22A 4QSCA 3KSXA 2ZMBA 1ZIUA 1B4HA 4FIMA 2QS3A 5BWJA 3D4CA 5CC2A 2LAOA 4E0XA 3HSTA 2REGA 1FW0A 3G3HA 1SW2A 4FEBA 3ONMA 1B2HA 2ZNUA 4ND9A 2O69A 4TLLB 4GXAA 4ZEBA 3VLWA 3JYRA 3CRBA 1OQGA 4ZEIA 3MW0A 5KDTA 3F11A 4U23A 3OO7A 3IL1B 4EF1A 3D4GA 2VD2A 3ODBA 3TODA 4OXVA 4L17A 4FEDA 2F8DA 3MZ1A 5H8QA 3TCHA 1NNPA 1H43A 4BDRA 5HBCA 2RINA 1FQEA 2ALUA 4X1BA 3IK6B 3MPKA 4OEVA 3IAZA 2FYIA 3G3GA 2XX8A 2OWSA 4YKIA 1IZ1A 3KZGA 4MLQA 2Q8JA 4U22A 1UTHA 4U1OA 2Y7WA 1XVYA 3MP1A 3PD8A 3FVGA 5KZTA 3FVNA 4G68A 2OK2A 1B51A 1RKMA 4IY6A 1URGA 2DQVA 3OSQA 1B46A 1N7XA 1GGGA 4RJZA 4YB6A 4P11A 2O1MA 4ZEFA 3DP8A 1BIYA 3TQWA 5JTYA 4Q30B 4I9DA 3FATA 3MVWA 3RTWB 5J1DA 3TMGA 1JNFA 2V3UA 3T9XB 3KOSA 4R6KA 1IUDA 3VFJA 5H8FA 3TTRA 4GVOA 4JSDA 4PFWA 1LB9A 3MZBA 1MXYA 3PMVA 2QS1A 3UGWA 1O7TA 4F3SA 2CZLA 3ILUB 1QJMA 1SQYA 1SD3A 4XXUA 3Q25A 4JWYA 3IJXB 4LP2B 1UTBA 2HAVA 4PQJA 3FVKA 1D3KA 5H8QB 4IY5A 2X7PA 5ITOA 4IGTA 4YB5A 3UA8A 4LATA 2O51A 1PEBA 4AQ4A 1OIBA 1OVBA 2VOZA 2B3BA 2F36A 1EZ9A 4RK9A 3UP9A 1UTHB 2YLNA 3T9HB 3S4UA 3MAMA 1B1HA 4G68B 2PMSA 3PUYE 1R9QA 5L9OA 1B3EA 3H6UA 3C4MA 3MQ9A 3N5LA 2O7UA 5ICQA 3G7WA 4R9FA 2Y7PA 3A3UA 1PB9A 2RCBA 3MZ9A 2CMOA 3TFLA 1B4ZA 1D9YA 3A09A 5I2NA 3C9HA 5KCJA 2O84X 3IORA 4ELRA 2UVHA 4JBZA 3RGYA 3M3LA 4H8IA 1B5JA 3TTMA 4GWOA 4ZEKA 1NH7A 5H8FB 4NEDA 2OJTA 1ZU0A 3VXCA 2PVUA 5EYFA 3SEUA 1S50A 1VFEA 1QULA 4BLAA 1B32A 1OVTA 3RTFB 1LBBA 1UTBB 5ICTA 3OO9A 3MWBA 3CR9A 1MY3A 4ELOA 4OETA 3FD3A 3KEIA 2H9BA 4KI0E 2X7QA 3A3CA 1M5DA 3LUYA 1MY4A 1NL5A 4F2OA 4Q5TA 3C31A 4POWA 2Q88A 2V3TA 1MDP1 2XXXA 4LZ7A 3EHTA 1Y4TA 2VGQA 4DXCA 3PPRA 4F3PA 5L9MA 2GH9A 4NF6A 2DVZA 1FTOA 1HSJA 1ZJLA 2PT2A 3TCGA 2Z23A 4LZ5A 2F5XA 4NF4A 5L9SA 4RK2A 4TQUQ 3CG1A 1QUJA 4GF8A 2XX9A 2QRYA 2XXIA 3OOAA 1Y3QA 4OEUA 4OQOA 1QVSA 2NXOA 4KR5A 3B7DA 3CSGA 4G8NA 5I2NB 2PT1A 4IO5A 5KCJB 3H6WA 4NTLA 3TUSA 5DVJA 3VVDA 4NWCA 4IGRA 2O6AA 5I56B 4DZ1A 4F19A 5FHOA 1BKAA 1BP5A 1F9BA 4LZ8A 4R2FA 1B6HA 3KN7A 4FATA 1DSNA 1ZKBA 1MXUA 3C34A 1SW1A 4YAHX 3QIMA 1Y20A 4FECA 3RN8A 3KOTA 2V25A 1Q1KA 4QSDA 3SEXA 5CI5A 2NVUB 1MXVA 2XXUA 2DXYA 3MP6A 4EUOA 3VLUA 2XXQA 1MQDA 4ESWA 3IB1A 2HAUA 5CRYA 3O29A 1II5A 3PV0E 1XHYA 4ZE9A 1A40A 1B3FA 1DPEA 1Y9UA 4KCCA 4MF3A 4F2QA 3ZS6A 1ZTYA 3G3JA 5H8HA 4AB6A 3PUWE 3IX1A 5AE4A 4C1TA 4RYAA 3N6TA 3FJMA 4NF6B 1POY1 1R6ZA 1SDXA 2F78A 4NF4B 3FGSA 3FJGA 4H65A 3IOVA 1TXFA 4HTGA 2I3WA 4H8JA 4Q8RA 1A99A 1TFDA 1AMFA 4F1UA 3GLBA 2FA7A 1B5HA 2Y7KA 1FQFA 4IO2A 3KN8A 2Z8DA 1Y4CA 5FTHA 3CSBA 2ONKE 2P1SA 3H6VA 4DXUA 1I6QA 1EH3A 1HSEA 4U4SA 4N07A 4WEPA 5JEIA 4H67A 2RC8A 4BDLA 1FTLA 1USYE 3DELB 2V84A 4QFNA 5AA2A 1A7LA 1VR5A 4DCXA 2XXPA 3H7MA 1A54A 2QS2A 3THIA 4QSEA 3B6QA 3PPQA 4U2RA 3E4RA 1MQGA 3R6UA 4TLMB 1MDQA 2H4IA 1QKAA 3TZAA 3O6GA 3FXUA 5JK4A 1DMBA 3O2AA 4H6DA 3U93A 3C33A 3QUFA 1B0LA 3U8QA 4BDQA 4NF5A 4R74A 1MS7A 3FUZA 2F7CA 1B0HA 1DPPA 2I49A 1GTKA 3K6UA 5H8HB 4YICA 4MFIA 1TT1A 2OCUA 2AL4A 1CE2A 1FTKA 2Y84A 1MXWA 1OQHA 5ELVA 5L8DA 4N6PA 1SI1A 2D3IA 3TAJA 2OBGA 2DSFA 3QUJA 2THIA 5FTIA 3VV5A 1MG1A 1Q35A 3K6WA 4JWOA 2QL3A 3K4UA 1PBPA 4F3GA 4OTEA 3IOUA 2HFBA 3HHFA 2A5TA 1Y3NA 1SBPA 4Z7EA 5F7VA 4YZZA 1NNTA 4MBPA 2DYXA 2UVGA 4QFOA 2DXRA 4DCYA 4UACA 4DDDA 2PBWA 5DEXB 1NMUA 2XD2A 3M8UA 5DT6A 5AA2B 1XC1A 2I4CA 1P99A 1N04A 3FV2A 4EXKA 3OO6A 1B40A 3CFXA 1EZPA 5ITPA 3Q27A 1QUIA 1MPCA 2XXHA 2ZYMA 4F1YA 4OVJA 1N84A 4MH5A 1URDA 1LCFA 1ZBMA 1MQJA 3DM0A 3GXAA 3OENA 1O63A 4ISUA 4R6YA 1JQFA 2ZNTA 1MM7A 4NF5B 4IO6A 1GVCA 4QFKA 4LUBA 1Y1ZA 4ONYA 3IOWA 5CMMA 3QSLA 3U94A 3PPOA 2H99A 1MQHA 4H1XA 3T96B 3Q26A 1B58A 4ZECA 4H0WA 1FQDA 1TWYA 4EQ9A 1B3GA 3EQ1A 3W9WA 3TELA 3TDJA 3W15C 4R6HA 3M3FA 3Q28A 1YAEA 4M4GA 2I48A 4TOZA 3H4ZA 3USDA 2A5TB 4YU0A 1T0KA 4M1VA 1B7UA 2O1LA 2F34A 1LSTA 1ATGA 1Z7ME 3HV1A 2XXYA 2DS9A 4G68C 4GL0A 2HZLA 4LQ2A 4XKNA 1A8EA 2QSXA 2GHAA 5H8SA 2ZYKA 1IEJA 1LFIA 2R6GE 1A55A 3RPWA 2PX1A 2ONSA 2RCAA 3R26A 5M2VA 4OZ9A 4ZDMA 3PUVE 1IITA 4F3BA 3ZKLA 2VP1A 3IJOB 1LLSA 4HS7A 3SESA 5I56A 3O6HA 4BDOA 4H5FA 3V89B 3TYHA 5I57A 3PU5A 3H03A 4RPNA 1H76A 3IO6A 2REJA 1IQ7A 3V83A 1D4NA 4GXSB 4IO3A 4YMBA 1XOCA 3ZKKA 1BTJA 3MUQA 3OO8A 4RPOA 5AA1A 3LR1A 4PE5B 4XKPA 1JW5A 3ECRA 4G8MA 3C35A 4KYEA 4ZEDA 2YPNA 2XXWA 4GL8A 1O64A 1SYIA 2IEEA 2Y7RA 2P0SA 3TKDA 4WXJA 2I0CA 4YKJA 4O3AA 3EN3A 4MLVA 1MY0A 2Q9TA 4OYVA 3UK4A 4G4PA 1QW0A 2Q2CA 4GRKA 3VDFA 1DTZA 1IIWA 1SYHA 2X26A 2RF1A 4JSOA 3MP8A 5CBSA 1DTGA 3N6UA 4C0RA 2DWJA 1YPNA 3MC2A 3SDFA 2GRVA 3K6VA 1JW4A 3K1PA 3O9PA 4GQOA 1NH8A 3FJ7A 3BFUA 4OESA 5I2KB 3K0VA 2ESNA 3B6WA 3FXQA 4IO7A 5A5XB 2XD3A 4R75A 2DWHA 2FNCA 1LGBC 1N76A 5I57B 1N7WA 1PDAA 4ZZAA 3HN0A 3E13X 1OLAA 2D21A 1EZOA 3SEVA 3RNNA 4NWDA 3CIJA 3LSWA 4KCDA 3C36A 4KPTA 3MVXA 4OENA 2UVIA 3BBRA 5B70A 1H44A 1P1WA 1R1NA 4I8CA 5B7DA 2DE4A 1B52A 1WDNA 3L6GA 3MBPA 1IXIA 2IA4A 3ILTB 4GFRA 3TEPA 1XS5A 1I6BA 3HCQA 1ZLQA 3PMXA 2W7YA 3KGCA 1MH4A 1NKXA 4JB7A 4NF8A 1Z7NE 3IB2A 2R71A 3SEYA 3KSJA 4IO4A 2VHAA 3L6HA 1ZMGA 3N26A 4RXLA 1H45A 1MRPA 5CMCA 4ZS9A 4LVQA 3RUMA 3E9XA 1US5A 1JW1A 1P1UA 1SW5A 2Z8EA 3M3KA 5DTBA 5TP9A 1FQCA 2VD3A 3OD7A 2I3VA 3OXNA 3IB0A 1FTMA 4KHZE 5TU0A 2GHBA 2XXVA 1MH3A 5DEXA 1PBQA 2F97A 1I6AA 1LCTA 1Y1MA 2ONRA 3U72A 3JV9A 4U4XA 3TPAA 2RC7A 4NE4A 2Q89A 3P7IA 2DVCA 4U1ZA 1B7ZA 3WAEA 3H06B 4GLIA 3CG3A 3VE1B 1QKBA 2ZXTA 1UIVA 5HPQA 2Y7IA 2DWAA 4OFLA 5BUUA 4OFJA 1USYH 1ANFA 1LAXA 2GFEA 3VXBA 3I3VA 3SETA 1M5BA 3DP6A 1UQWA 3SEWA 4RNSA 2F35A 1MXZA 4DE8A 3IR1A 4PFUA 3HHGA 2UVJA 4P0GA 3DLNA 1S9TA 4X48A 3S9NC 4NF8B 4YB7A 4YMAA 1NNKA 4KFQA 1LAHE 1YCJA 3IO4A 1A8FA 1MY2A 5EHMA 2F7BA 1TFAA 1OLCA 2D5WA 1B3LA 2XXTA 3CFLA 2QMWA 3G3IA 3QXMA 4KYDA 4YKKA 3PPNA 4PP0A 2Z8FA 2PYYA 5CMBA 4F29A 3TTNA 2O7IA 3GBAA 1HSLA 3T66A 4O3BA 4F39A 1P1QA 2A5SA 5TP9B 2XXRA 5AA3A 1J1NA 1IXGA 4ELPA 1URSA 3MVYA 3QAXA 3JZJA 4Q0CA 3O97A 3LBSA 1SW4A 4QFPA 3BFTA 2QMXA 1M5CA 3C32A 5K2XA 1P1OA 4BDMA 1CB6A 4K3FA 4H5GA 2I0BA 5DVFA 1SI0A 2DOJA 1NFTA 2NUVA 3FXRA 3U92A 4DLDA 5CBRA 3V8XB 1IXHA 4XTCQ 3KFMA 5HM4B 4JXIA 3HO7A 3Q29A 1GV8A 1DOTA 4KD5A 3VLVA 2HCAA 2I4BA 4EQBA 3GZGA 5IKBA 1SVXB 2DWIA 1FCKA 3DP4A 3K00A 2AYSA 2WKYA 4R73A 4R9GA 3V5AA 3ZSFA 5AA4A 3CI8A 2ZNSA 1ELJA 2OWTA 3PUZE 4EQ7A 3OEKA 5DYHA 1AL3A 3W9VA 4G77A 3PD9A 4DIGA 3EHSA 3G3KA 3SERA 1JETA 3PGFA 3CVGA 1MXXA 1D9VA 1POTA 1N3XA 5KDTB 2UYFA 1AOVA 5FHNA 4LONB 4WEDA 3VVFA 1FQAA 2R9JA 3K6XA 4KQPA 3LSLA 4GIZA 1N0TA 4DXBA 4F31B 1MY1A 5F1QA 4G2ZA 5ISUA 2HQ0A 3H3GA 4OERA 4X1DA 2E0SA 2XX7A 3SKPA 2RKMA 3FV1A 4RA1A 4ELQA 4HCWA 2HEUA 2O68A 1OMPA 4POXA 3EPEA 1M5FA 1LB8A 2UXAA 3RT8A 4ECFA
chains in the Genus database with same CATH superfamily
3LSFB 1XVXA 3VVEA 2NOOA 2YJPA 5I2KA 3CFZA 3O6IA 5AA2D 5A5XA 1S7YA 2DP8A 3HPIA 1RYOA 3OMBA 4LQ5A 3T0JA 1PB7A 4FORA 5TPAA 5AA4B 1MPBA 3K02A 3N94A 4FJPA 2H25A 1B1XA 1P1NA 5JTYB 3H6TA 1LAFE 2I58A 3LC8A 1FBEA 2ANJA 4OWDA 2F7AA 3KC0A 5I59A 3MSTA 2QS4A 3RLFE 1BLFA 3LSXA 4G8HA 4F22A 3FVOA 1KWHA 2E1SA 4O3CA 3EF7A 2BJIA 4KYSA 4O8MA 1FTAA 1B9JA 4GX3A 1FBFA 4PFTA 5LOMA 1FJ9A 3RQTA 5EHSA 2F6GA 1FPGA 2OZZA 3KN3A 4QRZA 2Q2AA 2QFLA 4ESXA 1H3DA 4NMYA 4GOTA 2B65A 4PFIA 1NV0A 1AH5A 5DVIA 1IXCA 2G29A 1EU8A 4N13A 1LFHA 4YKPA 4BDNA 3QYTA 1VSOA 4MX6A 4I62A 1YTVA 5IAIA 3PPPA 3KBRA 3PUXE 1GR2A 4GD5A 4THIA 1KA0A 3E3KA 4ZZEA 4FAJA 2HZKA 2ZYOA 3GBBA 2ABHA 4MJOA 3TTKA 4IB2A 2B3FA 2R8TA 5I84A 1LBWA 1FQBA 3S9MC 3T9UA 1MPDA 2P2AA 5H8NA 3UORA 3K01A 4AS4A 2UYEA 3S9LC 3I5OA 1NV2A 1LAGE 4C1UA 3G3FA 4JVDA 5CM6A 1JVYA 3EHUA 3QK6A 3U1OA 5TPAB 3K2DA 2NWJA 1RYXA 3FIRA 1B5IA 1N3WA 3FXBA 4R2BA 1L5TA 3AXFA 1LBCA 2VT5A 4XIGQ 1XT8A 1FTJA 1FBHA 1UIUA 3T93B 4QF9A 2V93A 1MQIA 4I1DA 3MVZA 2M8CA 4E0WA 4U21A 1AIVA 1B05A 5I59B 4HE1A 2H98A 3BKIB 5K2YA 4Z0IA 5I58A 2ZYNA 5CMKA 3A29A 1RDYA 4JDFA 4LA9A 4P0IA 4JVCA 1JEVA 2XHDA 3OEMA 1NNFA 2DE3A 2PFYA 1I69A 1VE4A 4XEQA 4QHQA 2OLBA 2KLFA 4OFOA 2HPGA 1JVXA 4GX6A 2AIXA 2V3QA 4EF2A 4PFYA 5FHMA 3O28A 3K1MA 4WKMA 2HXWA 3MJNA 1PB8A 4QFLA 2F6PA 1QUKA 1PC3A 2QPQA 4ZE8A 4F18A 1Y3PA 1KA1A 1LFGA 3KJTA 3T9VA 3PMWA 1US4A 3OELA 2H5YA 4UA8A 4X9TA 4N4UA 3K1NA 1B3HA 3GYYA 3IOTA 3R7XA 3TTLA 1MM6A 4MMPA 1M5EA 2BJJX 5H8NB 4NHBA 4EXLA 4OHNA 4XKRA 2VPOA 3OSRA 1R9LA 2AL5A 3WAFA 1WVJA 4F1VA 2KQZA 5EYHA 1IMDA 2RC9A 1VDWA 1VFDA 1FBGA 2QJEA 3O66A 4AB5A 3B6TA 3RY3A 3KJ7A 4FE8A 2FVZA 2I6EA 2G93A 3UIFA 4XKQA 3TQLA 3UN6A 4HW8A 4JWXA 4OMBA 3S9EA 1WODA 4HCYA 1FPDA 5I58B 2Z22A 3FZVA 2DE2A 3RT6B 4RY1A 3S2VA 2Y5LA 5IZ3A 4R72A 3KG2A 3TCFA 4PETA 1B7HA 4EDPA 3FASA 3I6VA 3MPLA 1JEUA 2V4CA 3T22A 4QSCA 3KSXA 3QMFA 2ZMBA 1ZIUA 4PE3A 1B4HA 2FHYA 4FIMA 2QS3A 5BWJA 4KXPA 3D4CA 5CC2A 2LAOA 4PC9A 4E0XA 3HSTA 2REGA 1FW0A 3G3HA 1SW2A 4FEBA 3ONMA 1NV5A 1IMAA 2ZZVA 2XWKA 1B2HA 2ZNUA 4ND9A 2O69A 4TLLB 4GXAA 1K9YA 4ZEBA 3VLWA 3JYRA 3CRBA 1OQGA 5ESYA 4ZEIA 3MW0A 5KDTA 3F11A 4U23A 3OO7A 3IL1B 4EF1A 3D4GA 1RDZA 2VD2A 3ODBA 4N81A 3TODA 4OXVA 4L17A 4FEDA 1FPBA 2F8DA 3MZ1A 5H8QA 2HHMA 3TCHA 1NNPA 1H43A 2CEYA 4BDRA 4PDHA 2RINA 1FQEA 5HBCA 2ALUA 4X1BA 3IK6B 5IZ1A 3MPKA 3HFUA 4OEVA 3IAZA 2FYIA 3G3GA 2XX8A 2OWSA 4YKIA 1IZ1A 3KZGA 4GWZA 4MLQA 2Q8JA 4U22A 1UTHA 4U1OA 2Y7WA 1XVYA 4MHFA 3MP1A 3PD8A 3FVGA 5IZ3B 4N8GA 5KZTA 3FVNA 4G68A 2OWZA 4N17A 2OK2A 1B51A 1RKMA 3PTYA 4IY6A 2QVUA 1URGA 2DQVA 3OSQA 1B46A 1N7XA 5ET7A 1GGGA 4RJZA 4YB6A 4P11A 2O1MA 4ZEFA 2FBPA 3DP8A 1BIYA 3TQWA 5JTYA 4Q30B 4I9DA 3FATA 4GWXA 3MVWA 5EQ9A 3RTWB 5J1DA 3TMGA 1JNFA 4PFRA 2XXKA 2V3UA 3T9XB 3KOSA 2FIEA 4R6KA 1IUDA 1FPJA 3VFJA 5H8FA 3TTRA 4GVOA 4JSDA 4GWWA 4PFWA 1LB9A 3MZBA 1MXYA 3PMVA 2QS1A 3UGWA 1O7TA 4F3SA 3ISPA 2KR0A 2CZLA 3ILUB 1QJMA 1AWBA 1SQYA 1SD3A 4XXUA 3Q25A 4JWYA 4GWUA 3IJXB 4LP2B 1UTBA 2HAVA 4PQJA 3FVKA 1D3KA 5H8QB 4IY5A 2X7PA 5ITOA 4PTKA 4IGTA 4YB5A 1EYJA 3UA8A 4LATA 4I40A 2O51A 1PEBA 4AQ4A 1OIBA 1OVBA 3MYUA 2VOZA 2B3BA 1LBZA 2F36A 1EZ9A 4RK9A 3UP9A 1UTHB 2WYPA 2VPNA 4H45A 2YLNA 3T9HB 3S4UA 3MAMA 1B1HA 4G68B 4X8RA 2PMSA 3PUYE 1R9QA 5L9OA 1FSAA 1B3EA 3H6UA 3C4MA 3MQ9A 3N5LA 4O7MA 2O7UA 4I3YA 5ICQA 4PAFA 3G7WA 1SPIA 4R9FA 2Y7PA 3A3UA 1PB9A 3U65A 2RCBA 3MZ9A 2CMOA 3TFLA 1B4ZA 1D9YA 3A09A 5I2NA 4MEVA 3C9HA 5KCJA 2O84X 4HE0A 3IORA 4ELRA 3SZPA 3EKIA 2UVHA 4JBZA 3RGYA 3M3LA 4H8IA 3ROJA 1B5JA 3TTMA 4GWOA 4ZEKA 1NH7A 4GBWA 5H8FB 4NEDA 2OJTA 1ZU0A 3VXCA 2PVUA 5EYFA 3SEUA 1S50A 1VFEA 1QULA 4BLAA 1B32A 1G0IA 1OVTA 3RTFB 1LBBA 1UTBB 5ICTA 3OO9A 3MWBA 3CR9A 1MY3A 4ELOA 4OETA 3FD3A 3KEIA 2H9BA 4KI0E 1NV6A 2X7QA 3A3CA 1M5DA 3LUYA 1MY4A 1NL5A 4F2OA 4NG7A 4Q5TA 3C31A 4POWA 2Q88A 2V3TA 1MDP1 2XXXA 4LZ7A 3EHTA 1Y4TA 2VGQA 4DXCA 3PPRA 4F3PA 5L9MA 2GH9A 4NF6A 2DVZA 1FTOA 1HSJA 1ZJLA 2PT2A 3TCGA 2Z23A 4LZ5A 2F5XA 4NF4A 5L9SA 1G0HA 4RK2A 4TQUQ 3CG1A 1QUJA 4GF8A 2XX9A 2QRYA 2XXIA 3OOAA 1Y3QA 4OEUA 1FPEA 4OQOA 1QVSA 2NXOA 4KR5A 3B7DA 3CSGA 4G8NA 5ET5A 4P1LA 5I2NB 2PT1A 4IO5A 5KCJB 3H6WA 2B4MA 4NTLA 3TUSA 5DVJA 3VVDA 4NWCA 4IGRA 2O6AA 5I56B 4DZ1A 1NV4A 4F19A 5FHOA 1BKAA 1BP5A 1F9BA 4LZ8A 4R2FA 2WBDA 1B6HA 3KN7A 4FATA 1DSNA 1ZKBA 1MXUA 3C34A 4PDDA 1SW1A 4N15A 4YAHX 3QIMA 1Y20A 4FECA 3RN8A 1NV7A 3T1BA 3KOTA 2V25A 4PAIA 1Q1KA 4QSDA 3SEXA 5CI5A 2NVUB 1MXVA 2XXUA 2DXYA 3MP6A 4EUOA 3VLUA 2XXQA 1MQDA 4ESWA 4LN5A 3IB1A 2HAUA 5CRYA 3O29A 1II5A 1NUYA 3PV0E 1DK4A 1XHYA 4ZE9A 1A40A 1B3FA 4PF6A 1DPEA 1Y9UA 4KCCA 4MF3A 4PGNA 4F2QA 3ZS6A 1ZTYA 3G3JA 5H8HA 4AB6A 2F3DA 4NN3A 3PUWE 3IX1A 5AE4A 4C1TA 4RYAA 3N6TA 3FJMA 4PGPA 4NF6B 2XWVA 4QXDA 1POY1 1R6ZA 1SDXA 2F78A 4NF4B 3FGSA 3FJGA 4H65A 3IOVA 1TXFA 2ZZXA 4HTGA 2I3WA 4H8JA 1A99A 4Q8RA 1TFDA 1AMFA 4F1UA 5I3SA 3GLBA 2FA7A 2P3NA 1B5HA 2Y7KA 1FQFA 4IO2A 3KN8A 2Z8DA 1Y4CA 5FTHA 3CSBA 2ONKE 2P1SA 3H6VA 4DXUA 1I6QA 1EH3A 1HSEA 4U4SA 1JP4A 4N07A 4WEPA 5JEIA 4H67A 2RC8A 4BDLA 2CZKA 1FTLA 1USYE 3DELB 2V84A 4MNIA 4QFNA 5AA2A 1A7LA 1VR5A 4DCXA 2XXPA 3H7MA 1A54A 2QS2A 3THIA 4QSEA 3B6QA 3PPQA 4U2RA 3E4RA 1MQGA 3R6UA 4TLMB 1MDQA 2H4IA 1QKAA 3TZAA 3O6GA 3FXUA 5JK4A 1DMBA 3O2AA 4H6DA 5IZZA 3U93A 3D1RA 4DI4B 3C33A 3QUFA 1B0LA 3U8QA 4BDQA 4NF5A 4R74A 1MS7A 3FUZA 2F7CA 1B0HA 1DPPA 2I49A 1GTKA 3K6UA 5H8HB 4NGUA 4YICA 4MFIA 1TT1A 2OCUA 2Q74A 3B50A 2AL4A 5EQAA 4MAGA 1CE2A 2OX3A 3BIGA 1FTKA 2Y84A 5ET8A 1MXWA 1OQHA 5ELVA 5L8DA 4N6PA 1SI1A 2D3IA 3TAJA 2OBGA 2DSFA 3QUJA 2THIA 5FTIA 3VV5A 1MG1A 1Q35A 3K6WA 4JWOA 1FRPA 2QL3A 3K4UA 1PBPA 4F3GA 4OTEA 4HE2A 1FPIA 2XWIA 5A5LA 3IOUA 2HFBA 1FPLA 3HHFA 3IFCA 2A5TA 4GWYA 1Y3NA 5LDZA 1SBPA 4Z7EA 5F7VA 4YZZA 1NNTA 4MBPA 2DYXA 2UVGA 4QFOA 2XA5A 2DXRA 1DCUA 5EQ8A 4DCYA 4UACA 4DDDA 1FBPA 2PBWA 5I7IA 5DEXB 1NMUA 2XD2A 4P8BA 1KZ8A 3M8UA 5DT6A 5AA2B 1XC1A 2I4CA 1P99A 1N04A 3FV2A 4EXKA 3OO6A 1NUZA 3FBPA 1B40A 3CFXA 1EZPA 5ITPA 3Q27A 1QUIA 1NI9A 3E79A 1MPCA 2XXHA 2ZYMA 4F1YA 4PF8A 4OVJA 1N84A 4MH5A 1URDA 3LV0A 1LCFA 1ZBMA 1YYZA 1MQJA 3DM0A 3GXAA 3OENA 1O63A 4ISUA 4R6YA 1JQFA 2ZNTA 1MM7A 4NF5B 4IO6A 1GVCA 4QFKA 4LUBA 2WEFA 1Y1ZA 4ONYA 3IOWA 5CMMA 4MNPA 3QSLA 3U94A 3PPOA 2H99A 1MQHA 2Q8MA 4O7IA 4H1XA 3T96B 3Q26A 1B58A 4ZECA 4H0WA 1FQDA 1EYKA 1TWYA 4EQ9A 1B3GA 3EQ1A 3W9WA 3TELA 3TDJA 1LBYA 3W15C 3KC1A 4R6HA 3M3FA 3Q28A 1YAEA 4M4GA 2I48A 4GX4A 4TOZA 3H4ZA 3USDA 2A5TB 4DI3D 4YU0A 1T0KA 4M1VA 1B7UA 2O1LA 2F34A 1LSTA 1ATGA 1Z7ME 3HV1A 2XXYA 2DS9A 1FBDA 4G68C 4GL0A 2HZLA 4LQ2A 4XKNA 4MCOA 1A8EA 2QSXA 2GHAA 5H8SA 5LTCA 2ZYKA 1IEJA 1LFIA 2R6GE 4QBAA 1A55A 4O94A 3RPWA 2PX1A 3NOHA 2WX9A 2ONSA 2RCAA 3R26A 4OVPA 5M2VA 4OZ9A 5DW8A 4NX1A 4ZDMA 3PUVE 4PAKA 1IITA 4F3BA 3ZKLA 2VP1A 2CZHA 3E78A 3IJOB 1LLSA 4HS7A 2GQ1A 3SESA 5EQ7A 5I56A 3O6HA 4BDOA 4H5FA 3V89B 3TYHA 5I57A 3PU5A 2FIXA 3H03A 4RPNA 4PBQA 1H76A 3IO6A 2REJA 1IQ7A 3V83A 1D4NA 4GXSB 4IO3A 4YMBA 1XOCA 3ZKKA 1BTJA 3MUQA 3OO8A 4RPOA 5AA1A 3LR1A 4PE5B 1D9QA 4XKPA 1JW5A 1IMBA 3ECRA 4G8MA 4OVTA 3C35A 4KYEA 4ZEDA 2YPNA 2L5VA 2XXWA 4PCDA 4GL8A 1O64A 1SYIA 2IEEA 2Y7RA 4HXVA 5ET6A 4G61A 2P0SA 3TKDA 4WXJA 2I0CA 4YKJA 4O3AA 4NF0A 3EN3A 4MLVA 1MY0A 2Q9TA 5I5PA 2WBBA 4OYVA 3UK4A 4H46A 4G4PA 1QW0A 1NV3A 3IFAA 2Q2CA 4GRKA 3VDFA 4OVQA 4GWSA 1DTZA 1IIWA 1SYHA 2X26A 2RF1A 1DBZA 4JSOA 3MP8A 5CBSA 4MNCA 4N6KA 4NQ8A 1DTGA 3N6UA 4C0RA 2DWJA 1YPNA 1INPA 3MC2A 3SDFA 2GRVA 3K6VA 1JW4A 3K1PA 3O9PA 4GQOA 1NH8A 3FJ7A 3BFUA 4OESA 5I2KB 3K0VA 2ESNA 3B6WA 3FXQA 4IO7A 2XD3A 5A5XB 4R75A 2XWOA 2DWHA 2FNCA 1LGBC 1N76A 4XFEA 1IMEA 5I57B 1N7WA 1PDAA 4ZZAA 3HN0A 3E13X 5J16A 1OLAA 2D21A 1EZOA 1LBVA 3SEVA 3RNNA 1NV1A 4NWDA 1QGXA 3CIJA 3LSWA 4KCDA 3C36A 4KPTA 2CEXA 3MVXA 4OENA 2UVIA 3BBRA 5B70A 1H44A 1P1WA 1R1NA 3B8BA 4I8CA 5B7DA 2DE4A 5IGAA 1B52A 1WDNA 3L6GA 3MBPA 1IXIA 2F3BA 2IA4A 4OVSA 3ILTB 1LBXA 2QVVA 4GFRA 3TEPA 1XS5A 1I6BA 3HCQA 1ZLQA 3PMXA 2W7YA 3KGCA 1MH4A 1EYIA 1NKXA 1FPKA 5F24A 4JB7A 4NF8A 1Z7NE 3IB2A 2R71A 4AS5A 2QVRA 3SEYA 3KSJA 4IO4A 2VHAA 3L6HA 4N6DA 1ZMGA 3N26A 4RXLA 1H45A 1MRPA 5T3JA 5CMCA 4ZS9A 4LVQA 3RUMA 3E9XA 1US5A 1JW1A 1P1UA 1SW5A 2Z8EA 3M3KA 5DTBA 5TP9A 1FQCA 2VD3A 3OD7A 2I3VA 3OXNA 5FBPA 3IB0A 1FTMA 4KHZE 5TU0A 2GHBA 2XXVA 1MH3A 4PBHA 5IM2A 5DEXA 1PBQA 2F97A 1I6AA 4P3LA 4MIJA 1LEVA 3BIHA 5EYGA 1LCTA 1Y1MA 1K9ZA 2ONRA 3U72A 2MKZA 3JV9A 4U4XA 4UABA 2PCRA 3TPAA 4NE4A 2RC7A 4N91A 2Q89A 4P9KA 3P7IA 1Q9DA 2DVCA 4N8YA 4U1ZA 1B7ZA 1NUXA 1FBCA 3WAEA 3H06B 3RYDA 4GLIA 3CG3A 3VE1B 1QKBA 2ZXTA 1UIVA 4OA4A 5HPQA 2Y7IA 1IMCA 2DWAA 4OFLA 5BUUA 4OFJA 1USYH 1ANFA 1LAXA 2GFEA 3VXBA 3I3VA 3SETA 1M5BA 3DP6A 1UQWA 3SEWA 4RNSA 2F35A 1MXZA 4DE8A 3IR1A 4PFUA 3HHGA 2UVJA 4P47A 4P0GA 3DLNA 1S9TA 4X48A 3S9NC 4NF8B 4YB7A 4YMAA 1NNKA 4KFQA 1LAHE 1YCJA 3IO4A 1A8FA 1MY2A 2CZIA 2F7BA 5EHMA 1TFAA 1OLCA 2D5WA 1B3LA 2XXTA 4X04A 3CFLA 2QMWA 3G3IA 3QXMA 4KYDA 4YKKA 2HXRA 3PPNA 4P1EA 4PFBA 4PP0A 2Z8FA 2PYYA 5CMBA 1FJ6A 4F29A 3TTNA 2O7IA 3GBAA 1HSLA 3T66A 4O3BA 4FBPA 4F39A 1P1QA 4OVRA 2A5SA 5TP9B 2XXRA 2P3VA 5AA3A 1J1NA 1IXGA 4ELPA 1URSA 3MVYA 3QAXA 3JZJA 2JJKA 4Q0CA 3O97A 3LBSA 1SW4A 4P56A 4QFPA 3BFTA 2QMXA 1M5CA 3C32A 5K2XA 1P1OA 4BDMA 1CB6A 4K3FA 4H5GA 2I0BA 5DVFA 1SI0A 2DOJA 1NFTA 2NUVA 3FXRA 3U92A 1NUWA 4DLDA 5CBRA 3V8XB 1IXHA 4XTCQ 3KFMA 5HM4B 4JXIA 3HO7A 3Q29A 1GV8A 1DOTA 4KD5A 3VLVA 2HCAA 2I4BA 3RPLA 3LUZA 4EQBA 3GZGA 5IKBA 1SVXB 2B4LA 2DWIA 2WYKA 4IR8A 4JVIA 1FCKA 3DP4A 3K00A 2AYSA 2WKYA 4R73A 4R9GA 3V5AA 3ZSFA 4I3EA 5AA4A 1RDXA 3CI8A 2ZNSA 3CHGA 4OANA 1ELJA 2OWTA 2Y5KA 3PUZE 1BK4A 4EQ7A 3OEKA 1XI6A 5DYHA 1AL3A 4GBVA 3W9VA 1YXIA 4G77A 3PD9A 4DIGA 3EHSA 3G3KA 3SERA 1JETA 3PGFA 3CVGA 1MXXA 1D9VA 1POTA 1N3XA 1CNQA 5KDTB 2UYFA 1AOVA 5FHNA 4LONB 4WEDA 3VVFA 1FQAA 2R9JA 3K6XA 4KQPA 3LSLA 4GIZA 1N0TA 4DXBA 4F31B 1MY1A 1YZ0A 1FPFA 2PFZA 5F1QA 1IMFA 4XF5A 4G2ZA 5ISUA 2ZZWA 2HQ0A 3H3GA 4OERA 4X1DA 2E0SA 2XX7A 3SKPA 2RKMA 3FV1A 4RA1A 4ELQA 4HCWA 2HEUA 2O68A 1OMPA 2DDKA 4POXA 3EPEA 1M5FA 4NAPA 1LB8A 3RPLB 2UXAA 3RT8A 4ECFA 3KBZA
chains in the Genus database with same CATH topology
3LSFB 1XVXA 3VVEA 2NOOA 2YJPA 5I2KA 3CFZA 3O6IA 5AA2D 5A5XA 1S7YA 2DP8A 3HPIA 1RYOA 3OMBA 4LQ5A 1PB7A 4FORA 5TPAA 5AA4B 1MPBA 3K02A 3N94A 4FJPA 2H25A 1B1XA 1P1NA 5JTYB 3H6TA 1LAFE 2I58A 3LC8A 2ANJA 4OWDA 2F7AA 5I59A 2QS4A 3RLFE 1BLFA 3LSXA 4G8HA 4F22A 3FVOA 1KWHA 2E1SA 4O3CA 3EF7A 4KYSA 1B9JA 4PFTA 5LOMA 3RQTA 5EHSA 2F6GA 2OZZA 3KN3A 4QRZA 2Q2AA 4ESXA 1H3DA 4NMYA 4GOTA 2B65A 1AH5A 5DVIA 1IXCA 2G29A 1EU8A 4N13A 1LFHA 4YKPA 4BDNA 3QYTA 1VSOA 4I62A 1YTVA 5IAIA 3PPPA 3KBRA 3PUXE 1GR2A 4GD5A 4THIA 3E3KA 4ZZEA 4FAJA 2HZKA 2ZYOA 3GBBA 2ABHA 3TTKA 4IB2A 2B3FA 5I84A 1FQBA 3S9MC 3T9UA 1MPDA 2P2AA 5H8NA 3UORA 3K01A 2UYEA 3S9LC 3I5OA 1LAGE 4C1UA 3G3FA 5CM6A 1JVYA 3EHUA 3QK6A 3U1OA 5TPAB 3K2DA 2NWJA 1RYXA 3FIRA 1B5IA 1N3WA 4R2BA 1L5TA 3AXFA 1LBCA 4XIGQ 1XT8A 1FTJA 1UIUA 3T93B 4QF9A 2V93A 1MQIA 4I1DA 3MVZA 2M8CA 4E0WA 4U21A 1AIVA 1B05A 5I59B 2H98A 3BKIB 5K2YA 4Z0IA 5I58A 2ZYNA 5CMKA 4JDFA 4LA9A 4P0IA 1JEVA 2XHDA 3OEMA 1NNFA 2DE3A 1I69A 1VE4A 4QHQA 2OLBA 2KLFA 4OFOA 1JVXA 2AIXA 2V3QA 4EF2A 4PFYA 5FHMA 3O28A 3K1MA 4WKMA 2HXWA 3MJNA 1PB8A 4QFLA 2F6PA 1QUKA 1PC3A 2QPQA 4ZE8A 4F18A 1Y3PA 3KJTA 1LFGA 3T9VA 3PMWA 1US4A 3OELA 2H5YA 4UA8A 4X9TA 3K1NA 1B3HA 3IOTA 3R7XA 3TTLA 1MM6A 1M5EA 2BJJX 5H8NB 4EXLA 4OHNA 4XKRA 3OSRA 1R9LA 2AL5A 3WAFA 1WVJA 4F1VA 2RC9A 1VFDA 2QJEA 3O66A 4AB5A 3B6TA 3RY3A 3KJ7A 4FE8A 2I6EA 2G93A 3UIFA 4XKQA 3TQLA 3UN6A 4HW8A 4JWXA 4OMBA 3S9EA 1WODA 4HCYA 5I58B 2Z22A 3FZVA 2DE2A 3RT6B 4RY1A 3S2VA 4R72A 3KG2A 3TCFA 4PETA 1B7HA 4EDPA 3FASA 3I6VA 3MPLA 1JEUA 3T22A 4QSCA 3KSXA 2ZMBA 1ZIUA 1B4HA 4FIMA 2QS3A 5BWJA 3D4CA 5CC2A 2LAOA 4E0XA 3HSTA 2REGA 1FW0A 3G3HA 1SW2A 4FEBA 3ONMA 1B2HA 2ZNUA 4ND9A 2O69A 4TLLB 4GXAA 4ZEBA 3VLWA 3JYRA 3CRBA 1OQGA 4ZEIA 3MW0A 5KDTA 3F11A 4U23A 3OO7A 3IL1B 4EF1A 3D4GA 2VD2A 3ODBA 3TODA 4OXVA 4L17A 4FEDA 2F8DA 3MZ1A 5H8QA 3TCHA 1NNPA 1H43A 4BDRA 5HBCA 2RINA 1FQEA 2ALUA 4X1BA 3IK6B 3MPKA 4OEVA 3IAZA 2FYIA 3G3GA 2XX8A 2OWSA 4YKIA 1IZ1A 3KZGA 4MLQA 2Q8JA 4U22A 1UTHA 4U1OA 2Y7WA 1XVYA 3MP1A 3PD8A 3FVGA 5KZTA 3FVNA 4G68A 2OK2A 1B51A 1RKMA 4IY6A 1URGA 2DQVA 3OSQA 1B46A 1N7XA 1GGGA 4RJZA 4YB6A 4P11A 2O1MA 4ZEFA 3DP8A 1BIYA 3TQWA 5JTYA 4Q30B 4I9DA 3FATA 3MVWA 3RTWB 5J1DA 3TMGA 1JNFA 2V3UA 3T9XB 3KOSA 4R6KA 1IUDA 3VFJA 5H8FA 3TTRA 4GVOA 4JSDA 4PFWA 1LB9A 3MZBA 1MXYA 3PMVA 2QS1A 3UGWA 1O7TA 4F3SA 2CZLA 3ILUB 1QJMA 1SQYA 1SD3A 4XXUA 3Q25A 4JWYA 3IJXB 4LP2B 1UTBA 2HAVA 4PQJA 3FVKA 1D3KA 5H8QB 4IY5A 2X7PA 5ITOA 4IGTA 4YB5A 3UA8A 4LATA 2O51A 1PEBA 4AQ4A 1OIBA 1OVBA 2VOZA 2B3BA 2F36A 1EZ9A 4RK9A 3UP9A 1UTHB 2YLNA 3T9HB 3S4UA 3MAMA 1B1HA 4G68B 2PMSA 3PUYE 1R9QA 5L9OA 1B3EA 3H6UA 3C4MA 3MQ9A 3N5LA 2O7UA 5ICQA 3G7WA 4R9FA 2Y7PA 3A3UA 1PB9A 2RCBA 3MZ9A 2CMOA 3TFLA 1B4ZA 1D9YA 3A09A 5I2NA 3C9HA 5KCJA 2O84X 3IORA 4ELRA 2UVHA 4JBZA 3RGYA 3M3LA 4H8IA 1B5JA 3TTMA 4GWOA 4ZEKA 1NH7A 5H8FB 4NEDA 2OJTA 1ZU0A 3VXCA 2PVUA 5EYFA 3SEUA 1S50A 1VFEA 1QULA 4BLAA 1B32A 1OVTA 3RTFB 1LBBA 1UTBB 5ICTA 3OO9A 3MWBA 3CR9A 1MY3A 4ELOA 4OETA 3FD3A 3KEIA 2H9BA 4KI0E 2X7QA 3A3CA 1M5DA 3LUYA 1MY4A 1NL5A 4F2OA 4Q5TA 3C31A 4POWA 2Q88A 2V3TA 1MDP1 2XXXA 4LZ7A 3EHTA 1Y4TA 2VGQA 4DXCA 3PPRA 4F3PA 5L9MA 2GH9A 4NF6A 2DVZA 1FTOA 1HSJA 1ZJLA 2PT2A 3TCGA 2Z23A 4LZ5A 2F5XA 4NF4A 5L9SA 4RK2A 4TQUQ 3CG1A 1QUJA 4GF8A 2XX9A 2QRYA 2XXIA 3OOAA 1Y3QA 4OEUA 4OQOA 1QVSA 2NXOA 4KR5A 3B7DA 3CSGA 4G8NA 5I2NB 2PT1A 4IO5A 5KCJB 3H6WA 4NTLA 3TUSA 5DVJA 3VVDA 4NWCA 4IGRA 2O6AA 5I56B 4DZ1A 4F19A 5FHOA 1BKAA 1BP5A 1F9BA 4LZ8A 4R2FA 1B6HA 3KN7A 4FATA 1DSNA 1ZKBA 1MXUA 3C34A 1SW1A 4YAHX 3QIMA 1Y20A 4FECA 3RN8A 3KOTA 2V25A 1Q1KA 4QSDA 3SEXA 5CI5A 2NVUB 1MXVA 2XXUA 2DXYA 3MP6A 4EUOA 3VLUA 2XXQA 1MQDA 4ESWA 3IB1A 2HAUA 5CRYA 3O29A 1II5A 3PV0E 1XHYA 4ZE9A 1A40A 1B3FA 1DPEA 1Y9UA 4KCCA 4MF3A 4F2QA 3ZS6A 1ZTYA 3G3JA 5H8HA 4AB6A 3PUWE 3IX1A 5AE4A 4C1TA 4RYAA 3N6TA 3FJMA 4NF6B 1POY1 1R6ZA 1SDXA 2F78A 4NF4B 3FGSA 3FJGA 4H65A 3IOVA 1TXFA 4HTGA 2I3WA 4H8JA 4Q8RA 1A99A 1TFDA 1AMFA 4F1UA 3GLBA 2FA7A 1B5HA 2Y7KA 1FQFA 4IO2A 3KN8A 2Z8DA 1Y4CA 5FTHA 3CSBA 2ONKE 2P1SA 3H6VA 4DXUA 1I6QA 1EH3A 1HSEA 4U4SA 4N07A 4WEPA 5JEIA 4H67A 2RC8A 4BDLA 1FTLA 1USYE 3DELB 2V84A 4QFNA 5AA2A 1A7LA 1VR5A 4DCXA 2XXPA 3H7MA 1A54A 2QS2A 3THIA 4QSEA 3B6QA 3PPQA 4U2RA 3E4RA 1MQGA 3R6UA 4TLMB 1MDQA 2H4IA 1QKAA 3TZAA 3O6GA 3FXUA 5JK4A 1DMBA 3O2AA 4H6DA 3U93A 3C33A 3QUFA 1B0LA 3U8QA 4BDQA 4NF5A 4R74A 1MS7A 3FUZA 2F7CA 1B0HA 1DPPA 2I49A 1GTKA 3K6UA 5H8HB 4YICA 4MFIA 1TT1A 2OCUA 2AL4A 1CE2A 1FTKA 2Y84A 1MXWA 1OQHA 5ELVA 5L8DA 4N6PA 1SI1A 2D3IA 3TAJA 2OBGA 2DSFA 3QUJA 2THIA 5FTIA 3VV5A 1MG1A 1Q35A 3K6WA 4JWOA 2QL3A 3K4UA 1PBPA 4F3GA 4OTEA 3IOUA 2HFBA 3HHFA 2A5TA 1Y3NA 1SBPA 4Z7EA 5F7VA 4YZZA 1NNTA 4MBPA 2DYXA 2UVGA 4QFOA 2DXRA 4DCYA 4UACA 4DDDA 2PBWA 5DEXB 1NMUA 2XD2A 3M8UA 5DT6A 5AA2B 1XC1A 2I4CA 1P99A 1N04A 3FV2A 4EXKA 3OO6A 1B40A 3CFXA 1EZPA 5ITPA 3Q27A 1QUIA 1MPCA 2XXHA 2ZYMA 4F1YA 4OVJA 1N84A 4MH5A 1URDA 1LCFA 1ZBMA 1MQJA 3DM0A 3GXAA 3OENA 1O63A 4ISUA 4R6YA 1JQFA 2ZNTA 1MM7A 4NF5B 4IO6A 1GVCA 4QFKA 4LUBA 1Y1ZA 4ONYA 3IOWA 5CMMA 3QSLA 3U94A 3PPOA 2H99A 1MQHA 4H1XA 3T96B 3Q26A 1B58A 4ZECA 4H0WA 1FQDA 1TWYA 4EQ9A 1B3GA 3EQ1A 3W9WA 3TELA 3TDJA 3W15C 4R6HA 3M3FA 3Q28A 1YAEA 4M4GA 2I48A 4TOZA 3H4ZA 3USDA 2A5TB 4YU0A 1T0KA 4M1VA 1B7UA 2O1LA 2F34A 1LSTA 1ATGA 1Z7ME 3HV1A 2XXYA 2DS9A 4G68C 4GL0A 2HZLA 4LQ2A 4XKNA 1A8EA 2QSXA 2GHAA 5H8SA 2ZYKA 1IEJA 1LFIA 2R6GE 1A55A 3RPWA 2PX1A 2ONSA 2RCAA 3R26A 5M2VA 4OZ9A 4ZDMA 3PUVE 1IITA 4F3BA 3ZKLA 2VP1A 3IJOB 1LLSA 4HS7A 3SESA 5I56A 3O6HA 4BDOA 4H5FA 3V89B 3TYHA 5I57A 3PU5A 3H03A 4RPNA 1H76A 3IO6A 2REJA 1IQ7A 3V83A 1D4NA 4GXSB 4IO3A 4YMBA 1XOCA 3ZKKA 1BTJA 3MUQA 3OO8A 4RPOA 5AA1A 3LR1A 4PE5B 4XKPA 1JW5A 3ECRA 4G8MA 3C35A 4KYEA 4ZEDA 2YPNA 2XXWA 4GL8A 1O64A 1SYIA 2IEEA 2Y7RA 2P0SA 3TKDA 4WXJA 2I0CA 4YKJA 4O3AA 3EN3A 4MLVA 1MY0A 2Q9TA 4OYVA 3UK4A 4G4PA 1QW0A 2Q2CA 4GRKA 3VDFA 1DTZA 1IIWA 1SYHA 2X26A 2RF1A 4JSOA 3MP8A 5CBSA 1DTGA 3N6UA 4C0RA 2DWJA 1YPNA 3MC2A 3SDFA 2GRVA 3K6VA 1JW4A 3K1PA 3O9PA 4GQOA 1NH8A 3FJ7A 3BFUA 4OESA 5I2KB 3K0VA 2ESNA 3B6WA 3FXQA 4IO7A 5A5XB 2XD3A 4R75A 2DWHA 2FNCA 1LGBC 1N76A 5I57B 1N7WA 1PDAA 4ZZAA 3HN0A 3E13X 1OLAA 2D21A 1EZOA 3SEVA 3RNNA 4NWDA 3CIJA 3LSWA 4KCDA 3C36A 4KPTA 3MVXA 4OENA 2UVIA 3BBRA 5B70A 1H44A 1P1WA 1R1NA 4I8CA 5B7DA 2DE4A 1B52A 1WDNA 3L6GA 3MBPA 1IXIA 2IA4A 3ILTB 4GFRA 3TEPA 1XS5A 1I6BA 3HCQA 1ZLQA 3PMXA 2W7YA 3KGCA 1MH4A 1NKXA 4JB7A 4NF8A 1Z7NE 3IB2A 2R71A 3SEYA 3KSJA 4IO4A 2VHAA 3L6HA 1ZMGA 3N26A 4RXLA 1H45A 1MRPA 5CMCA 4ZS9A 4LVQA 3RUMA 3E9XA 1US5A 1JW1A 1P1UA 1SW5A 2Z8EA 3M3KA 5DTBA 5TP9A 1FQCA 2VD3A 3OD7A 2I3VA 3OXNA 3IB0A 1FTMA 4KHZE 5TU0A 2GHBA 2XXVA 1MH3A 5DEXA 1PBQA 2F97A 1I6AA 1LCTA 1Y1MA 2ONRA 3U72A 3JV9A 4U4XA 3TPAA 2RC7A 4NE4A 2Q89A 3P7IA 2DVCA 4U1ZA 1B7ZA 3WAEA 3H06B 4GLIA 3CG3A 3VE1B 1QKBA 2ZXTA 1UIVA 5HPQA 2Y7IA 2DWAA 4OFLA 5BUUA 4OFJA 1USYH 1ANFA 1LAXA 2GFEA 3VXBA 3I3VA 3SETA 1M5BA 3DP6A 1UQWA 3SEWA 4RNSA 2F35A 1MXZA 4DE8A 3IR1A 4PFUA 3HHGA 2UVJA 4P0GA 3DLNA 1S9TA 4X48A 3S9NC 4NF8B 4YB7A 4YMAA 1NNKA 4KFQA 1LAHE 1YCJA 3IO4A 1A8FA 1MY2A 5EHMA 2F7BA 1TFAA 1OLCA 2D5WA 1B3LA 2XXTA 3CFLA 2QMWA 3G3IA 3QXMA 4KYDA 4YKKA 3PPNA 4PP0A 2Z8FA 2PYYA 5CMBA 4F29A 3TTNA 2O7IA 3GBAA 1HSLA 3T66A 4O3BA 4F39A 1P1QA 2A5SA 5TP9B 2XXRA 5AA3A 1J1NA 1IXGA 4ELPA 1URSA 3MVYA 3QAXA 3JZJA 4Q0CA 3O97A 3LBSA 1SW4A 4QFPA 3BFTA 2QMXA 1M5CA 3C32A 5K2XA 1P1OA 4BDMA 1CB6A 4K3FA 4H5GA 2I0BA 5DVFA 1SI0A 2DOJA 1NFTA 2NUVA 3FXRA 3U92A 4DLDA 5CBRA 3V8XB 1IXHA 4XTCQ 3KFMA 5HM4B 4JXIA 3HO7A 3Q29A 1GV8A 1DOTA 4KD5A 3VLVA 2HCAA 2I4BA 4EQBA 3GZGA 5IKBA 1SVXB 2DWIA 1FCKA 3DP4A 3K00A 2AYSA 2WKYA 4R73A 4R9GA 3V5AA 3ZSFA 5AA4A 3CI8A 2ZNSA 1ELJA 2OWTA 3PUZE 4EQ7A 3OEKA 5DYHA 1AL3A 3W9VA 4G77A 3PD9A 4DIGA 3EHSA 3G3KA 3SERA 1JETA 3PGFA 3CVGA 1MXXA 1D9VA 1POTA 1N3XA 5KDTB 2UYFA 1AOVA 5FHNA 4LONB 4WEDA 3VVFA 1FQAA 2R9JA 3K6XA 4KQPA 3LSLA 4GIZA 1N0TA 4DXBA 4F31B 1MY1A 5F1QA 4G2ZA 5ISUA 2HQ0A 3H3GA 4OERA 4X1DA 2E0SA 2XX7A 3SKPA 2RKMA 3FV1A 4RA1A 4ELQA 4HCWA 2HEUA 2O68A 1OMPA 4POXA 3EPEA 1M5FA 1LB8A 2UXAA 3RT8A 4ECFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LSF B;  1XVX A;  3VVE A;  2NOO A;  2YJP A;  5I2K A;  3CFZ A;  3O6I A;  5AA2 D;  5A5X A;  1S7Y A;  2DP8 A;  3HPI A;  1RYO A;  3OMB A;  4LQ5 A;  1PB7 A;  4FOR A;  5TPA A;  5AA4 B;  1MPB A;  3K02 A;  3N94 A;  4FJP A;  2H25 A;  1B1X A;  1P1N A;  5JTY B;  3H6T A;  1LAF E;  2I58 A;  3LC8 A;  2ANJ A;  4OWD A;  2F7A A;  5I59 A;  2QS4 A;  3RLF E;  1BLF A;  3LSX A;  4G8H A;  4F22 A;  3FVO A;  1KWH A;  2E1S A;  4O3C A;  3EF7 A;  4KYS A;  1B9J A;  4PFT A;  5LOM A;  3RQT A;  5EHS A;  2F6G A;  2OZZ A;  3KN3 A;  4QRZ A;  2Q2A A;  4ESX A;  1H3D A;  4NMY A;  4GOT A;  2B65 A;  1AH5 A;  5DVI A;  1IXC A;  2G29 A;  1EU8 A;  4N13 A;  1LFH A;  4YKP A;  4BDN A;  3QYT A;  1VSO A;  4I62 A;  1YTV A;  5IAI A;  3PPP A;  3KBR A;  3PUX E;  1GR2 A;  4GD5 A;  4THI A;  3E3K A;  4ZZE A;  4FAJ A;  2HZK A;  2ZYO A;  3GBB A;  2ABH A;  3TTK A;  4IB2 A;  2B3F A;  5I84 A;  1FQB A;  3S9M C;  3T9U A;  1MPD A;  2P2A A;  5H8N A;  3UOR A;  3K01 A;  2UYE A;  3S9L C;  3I5O A;  1LAG E;  4C1U A;  3G3F A;  5CM6 A;  1JVY A;  3EHU A;  3QK6 A;  3U1O A;  5TPA B;  3K2D A;  2NWJ A;  1RYX A;  3FIR A;  1B5I A;  1N3W A;  4R2B A;  1L5T A;  3AXF A;  1LBC A;  4XIG Q;  1XT8 A;  1FTJ A;  1UIU A;  3T93 B;  4QF9 A;  2V93 A;  1MQI A;  4I1D A;  3MVZ A;  2M8C A;  4E0W A;  4U21 A;  1AIV A;  1B05 A;  5I59 B;  2H98 A;  3BKI B;  5K2Y A;  4Z0I A;  5I58 A;  2ZYN A;  5CMK A;  4JDF A;  4LA9 A;  4P0I A;  1JEV A;  2XHD A;  3OEM A;  1NNF A;  2DE3 A;  1I69 A;  1VE4 A;  4QHQ A;  2OLB A;  2KLF A;  4OFO A;  1JVX A;  2AIX A;  2V3Q A;  4EF2 A;  4PFY A;  5FHM A;  3O28 A;  3K1M A;  4WKM A;  2HXW A;  3MJN A;  1PB8 A;  4QFL A;  2F6P A;  1QUK A;  1PC3 A;  2QPQ A;  4ZE8 A;  4F18 A;  1Y3P A;  3KJT A;  1LFG A;  3T9V A;  3PMW A;  1US4 A;  3OEL A;  2H5Y A;  4UA8 A;  4X9T A;  3K1N A;  1B3H A;  3IOT A;  3R7X A;  3TTL A;  1MM6 A;  1M5E A;  2BJJ X;  5H8N B;  4EXL A;  4OHN A;  4XKR A;  3OSR A;  1R9L A;  2AL5 A;  3WAF A;  1WVJ A;  4F1V A;  2RC9 A;  1VFD A;  2QJE A;  3O66 A;  4AB5 A;  3B6T A;  3RY3 A;  3KJ7 A;  4FE8 A;  2I6E A;  2G93 A;  3UIF A;  4XKQ A;  3TQL A;  3UN6 A;  4HW8 A;  4JWX A;  4OMB A;  3S9E A;  1WOD A;  4HCY A;  5I58 B;  2Z22 A;  3FZV A;  2DE2 A;  3RT6 B;  4RY1 A;  3S2V A;  4R72 A;  3KG2 A;  3TCF A;  4PET A;  1B7H A;  4EDP A;  3FAS A;  3I6V A;  3MPL A;  1JEU A;  3T22 A;  4QSC A;  3KSX A;  2ZMB A;  1ZIU A;  1B4H A;  4FIM A;  2QS3 A;  5BWJ A;  3D4C A;  5CC2 A;  2LAO A;  4E0X A;  3HST A;  2REG A;  1FW0 A;  3G3H A;  1SW2 A;  4FEB A;  3ONM A;  1B2H A;  2ZNU A;  4ND9 A;  2O69 A;  4TLL B;  4GXA A;  4ZEB A;  3VLW A;  3JYR A;  3CRB A;  1OQG A;  4ZEI A;  3MW0 A;  5KDT A;  3F11 A;  4U23 A;  3OO7 A;  3IL1 B;  4EF1 A;  3D4G A;  2VD2 A;  3ODB A;  3TOD A;  4OXV A;  4L17 A;  4FED A;  2F8D A;  3MZ1 A;  5H8Q A;  3TCH A;  1NNP A;  1H43 A;  4BDR A;  5HBC A;  2RIN A;  1FQE A;  2ALU A;  4X1B A;  3IK6 B;  3MPK A;  4OEV A;  3IAZ A;  2FYI A;  3G3G A;  2XX8 A;  2OWS A;  4YKI A;  1IZ1 A;  3KZG A;  4MLQ A;  2Q8J A;  4U22 A;  1UTH A;  4U1O A;  2Y7W A;  1XVY A;  3MP1 A;  3PD8 A;  3FVG A;  5KZT A;  3FVN A;  4G68 A;  2OK2 A;  1B51 A;  1RKM A;  4IY6 A;  1URG A;  2DQV A;  3OSQ A;  1B46 A;  1N7X A;  1GGG A;  4RJZ A;  4YB6 A;  4P11 A;  2O1M A;  4ZEF A;  3DP8 A;  1BIY A;  3TQW A;  5JTY A;  4Q30 B;  4I9D A;  3FAT A;  3MVW A;  3RTW B;  5J1D A;  3TMG A;  1JNF A;  2V3U A;  3T9X B;  3KOS A;  4R6K A;  1IUD A;  3VFJ A;  5H8F A;  3TTR A;  4GVO A;  4JSD A;  4PFW A;  1LB9 A;  3MZB A;  1MXY A;  3PMV A;  2QS1 A;  3UGW A;  1O7T A;  4F3S A;  2CZL A;  3ILU B;  1QJM A;  1SQY A;  1SD3 A;  4XXU A;  3Q25 A;  4JWY A;  3IJX B;  4LP2 B;  1UTB A;  2HAV A;  4PQJ A;  3FVK A;  1D3K A;  5H8Q B;  4IY5 A;  2X7P A;  5ITO A;  4IGT A;  4YB5 A;  3UA8 A;  4LAT A;  2O51 A;  1PEB A;  4AQ4 A;  1OIB A;  1OVB A;  2VOZ A;  2B3B A;  2F36 A;  1EZ9 A;  4RK9 A;  3UP9 A;  1UTH B;  2YLN A;  3T9H B;  3S4U A;  3MAM A;  1B1H A;  4G68 B;  2PMS A;  3PUY E;  1R9Q A;  5L9O A;  1B3E A;  3H6U A;  3C4M A;  3MQ9 A;  3N5L A;  2O7U A;  5ICQ A;  3G7W A;  4R9F A;  2Y7P A;  3A3U A;  1PB9 A;  2RCB A;  3MZ9 A;  2CMO A;  3TFL A;  1B4Z A;  1D9Y A;  3A09 A;  5I2N A;  3C9H A;  5KCJ A;  2O84 X;  3IOR A;  4ELR A;  2UVH A;  4JBZ A;  3RGY A;  3M3L A;  4H8I A;  1B5J A;  3TTM A;  4GWO A;  4ZEK A;  1NH7 A;  5H8F B;  4NED A;  2OJT A;  1ZU0 A;  3VXC A;  2PVU A;  5EYF A;  3SEU A;  1S50 A;  1VFE A;  1QUL A;  4BLA A;  1B32 A;  1OVT A;  3RTF B;  1LBB A;  1UTB B;  5ICT A;  3OO9 A;  3MWB A;  3CR9 A;  1MY3 A;  4ELO A;  4OET A;  3FD3 A;  3KEI A;  2H9B A;  4KI0 E;  2X7Q A;  3A3C A;  1M5D A;  3LUY A;  1MY4 A;  1NL5 A;  4F2O A;  4Q5T A;  3C31 A;  4POW A;  2Q88 A;  2V3T A;  1MDP 1;  2XXX A;  4LZ7 A;  3EHT A;  1Y4T A;  2VGQ A;  4DXC A;  3PPR A;  4F3P A;  5L9M A;  2GH9 A;  4NF6 A;  2DVZ A;  1FTO A;  1HSJ A;  1ZJL A;  2PT2 A;  3TCG A;  2Z23 A;  4LZ5 A;  2F5X A;  4NF4 A;  5L9S A;  4RK2 A;  4TQU Q;  3CG1 A;  1QUJ A;  4GF8 A;  2XX9 A;  2QRY A;  2XXI A;  3OOA A;  1Y3Q A;  4OEU A;  4OQO A;  1QVS A;  2NXO A;  4KR5 A;  3B7D A;  3CSG A;  4G8N A;  5I2N B;  2PT1 A;  4IO5 A;  5KCJ B;  3H6W A;  4NTL A;  3TUS A;  5DVJ A;  3VVD A;  4NWC A;  4IGR A;  2O6A A;  5I56 B;  4DZ1 A;  4F19 A;  5FHO A;  1BKA A;  1BP5 A;  1F9B A;  4LZ8 A;  4R2F A;  1B6H A;  3KN7 A;  4FAT A;  1DSN A;  1ZKB A;  1MXU A;  3C34 A;  1SW1 A;  4YAH X;  3QIM A;  1Y20 A;  4FEC A;  3RN8 A;  3KOT A;  2V25 A;  1Q1K A;  4QSD A;  3SEX A;  5CI5 A;  2NVU B;  1MXV A;  2XXU A;  2DXY A;  3MP6 A;  4EUO A;  3VLU A;  2XXQ A;  1MQD A;  4ESW A;  3IB1 A;  2HAU A;  5CRY A;  3O29 A;  1II5 A;  3PV0 E;  1XHY A;  4ZE9 A;  1A40 A;  1B3F A;  1DPE A;  1Y9U A;  4KCC A;  4MF3 A;  4F2Q A;  3ZS6 A;  1ZTY A;  3G3J A;  5H8H A;  4AB6 A;  3PUW E;  3IX1 A;  5AE4 A;  4C1T A;  4RYA A;  3N6T A;  3FJM A;  4NF6 B;  1POY 1;  1R6Z A;  1SDX A;  2F78 A;  4NF4 B;  3FGS A;  3FJG A;  4H65 A;  3IOV A;  1TXF A;  4HTG A;  2I3W A;  4H8J A;  4Q8R A;  1A99 A;  1TFD A;  1AMF A;  4F1U A;  3GLB A;  2FA7 A;  1B5H A;  2Y7K A;  1FQF A;  4IO2 A;  3KN8 A;  2Z8D A;  1Y4C A;  5FTH A;  3CSB A;  2ONK E;  2P1S A;  3H6V A;  4DXU A;  1I6Q A;  1EH3 A;  1HSE A;  4U4S A;  4N07 A;  4WEP A;  5JEI A;  4H67 A;  2RC8 A;  4BDL A;  1FTL A;  1USY E;  3DEL B;  2V84 A;  4QFN A;  5AA2 A;  1A7L A;  1VR5 A;  4DCX A;  2XXP A;  3H7M A;  1A54 A;  2QS2 A;  3THI A;  4QSE A;  3B6Q A;  3PPQ A;  4U2R A;  3E4R A;  1MQG A;  3R6U A;  4TLM B;  1MDQ A;  2H4I A;  1QKA A;  3TZA A;  3O6G A;  3FXU A;  5JK4 A;  1DMB A;  3O2A A;  4H6D A;  3U93 A;  3C33 A;  3QUF A;  1B0L A;  3U8Q A;  4BDQ A;  4NF5 A;  4R74 A;  1MS7 A;  3FUZ A;  2F7C A;  1B0H A;  1DPP A;  2I49 A;  1GTK A;  3K6U A;  5H8H B;  4YIC A;  4MFI A;  1TT1 A;  2OCU A;  2AL4 A;  1CE2 A;  1FTK A;  2Y84 A;  1MXW A;  1OQH A;  5ELV A;  5L8D A;  4N6P A;  1SI1 A;  2D3I A;  3TAJ A;  2OBG A;  2DSF A;  3QUJ A;  2THI A;  5FTI A;  3VV5 A;  1MG1 A;  1Q35 A;  3K6W A;  4JWO A;  2QL3 A;  3K4U A;  1PBP A;  4F3G A;  4OTE A;  3IOU A;  2HFB A;  3HHF A;  2A5T A;  1Y3N A;  1SBP A;  4Z7E A;  5F7V A;  4YZZ A;  1NNT A;  4MBP A;  2DYX A;  2UVG A;  4QFO A;  2DXR A;  4DCY A;  4UAC A;  4DDD A;  2PBW A;  5DEX B;  1NMU A;  2XD2 A;  3M8U A;  5DT6 A;  5AA2 B;  1XC1 A;  2I4C A;  1P99 A;  1N04 A;  3FV2 A;  4EXK A;  3OO6 A;  1B40 A;  3CFX A;  1EZP A;  5ITP A;  3Q27 A;  1QUI A;  1MPC A;  2XXH A;  2ZYM A;  4F1Y A;  4OVJ A;  1N84 A;  4MH5 A;  1URD A;  1LCF A;  1ZBM A;  1MQJ A;  3DM0 A;  3GXA A;  3OEN A;  1O63 A;  4ISU A;  4R6Y A;  1JQF A;  2ZNT A;  1MM7 A;  4NF5 B;  4IO6 A;  1GVC A;  4QFK A;  4LUB A;  1Y1Z A;  4ONY A;  3IOW A;  5CMM A;  3QSL A;  3U94 A;  3PPO A;  2H99 A;  1MQH A;  4H1X A;  3T96 B;  3Q26 A;  1B58 A;  4ZEC A;  4H0W A;  1FQD A;  1TWY A;  4EQ9 A;  1B3G A;  3EQ1 A;  3W9W A;  3TEL A;  3TDJ A;  3W15 C;  4R6H A;  3M3F A;  3Q28 A;  1YAE A;  4M4G A;  2I48 A;  4TOZ A;  3H4Z A;  3USD A;  2A5T B;  4YU0 A;  1T0K A;  4M1V A;  1B7U A;  2O1L A;  2F34 A;  1LST A;  1ATG A;  1Z7M E;  3HV1 A;  2XXY A;  2DS9 A;  4G68 C;  4GL0 A;  2HZL A;  4LQ2 A;  4XKN A;  1A8E A;  2QSX A;  2GHA A;  5H8S A;  2ZYK A;  1IEJ A;  1LFI A;  2R6G E;  1A55 A;  3RPW A;  2PX1 A;  2ONS A;  2RCA A;  3R26 A;  5M2V A;  4OZ9 A;  4ZDM A;  3PUV E;  1IIT A;  4F3B A;  3ZKL A;  2VP1 A;  3IJO B;  1LLS A;  4HS7 A;  3SES A;  5I56 A;  3O6H A;  4BDO A;  4H5F A;  3V89 B;  3TYH A;  5I57 A;  3PU5 A;  3H03 A;  4RPN A;  1H76 A;  3IO6 A;  2REJ A;  1IQ7 A;  3V83 A;  1D4N A;  4GXS B;  4IO3 A;  4YMB A;  1XOC A;  3ZKK A;  1BTJ A;  3MUQ A;  3OO8 A;  4RPO A;  5AA1 A;  3LR1 A;  4PE5 B;  4XKP A;  1JW5 A;  3ECR A;  4G8M A;  3C35 A;  4KYE A;  4ZED A;  2YPN A;  2XXW A;  4GL8 A;  1O64 A;  1SYI A;  2IEE A;  2Y7R A;  2P0S A;  3TKD A;  4WXJ A;  2I0C A;  4YKJ A;  4O3A A;  3EN3 A;  4MLV A;  1MY0 A;  2Q9T A;  4OYV A;  3UK4 A;  4G4P A;  1QW0 A;  2Q2C A;  4GRK A;  3VDF A;  1DTZ A;  1IIW A;  1SYH A;  2X26 A;  2RF1 A;  4JSO A;  3MP8 A;  5CBS A;  1DTG A;  3N6U A;  4C0R A;  2DWJ A;  1YPN A;  3MC2 A;  3SDF A;  2GRV A;  3K6V A;  1JW4 A;  3K1P A;  3O9P A;  4GQO A;  1NH8 A;  3FJ7 A;  3BFU A;  4OES A;  5I2K B;  3K0V A;  2ESN A;  3B6W A;  3FXQ A;  4IO7 A;  5A5X B;  2XD3 A;  4R75 A;  2DWH A;  2FNC A;  1LGB C;  1N76 A;  5I57 B;  1N7W A;  1PDA A;  4ZZA A;  3HN0 A;  3E13 X;  1OLA A;  2D21 A;  1EZO A;  3SEV A;  3RNN A;  4NWD A;  3CIJ A;  3LSW A;  4KCD A;  3C36 A;  4KPT A;  3MVX A;  4OEN A;  2UVI A;  3BBR A;  5B70 A;  1H44 A;  1P1W A;  1R1N A;  4I8C A;  5B7D A;  2DE4 A;  1B52 A;  1WDN A;  3L6G A;  3MBP A;  1IXI A;  2IA4 A;  3ILT B;  4GFR A;  3TEP A;  1XS5 A;  1I6B A;  3HCQ A;  1ZLQ A;  3PMX A;  2W7Y A;  3KGC A;  1MH4 A;  1NKX A;  4JB7 A;  4NF8 A;  1Z7N E;  3IB2 A;  2R71 A;  3SEY A;  3KSJ A;  4IO4 A;  2VHA A;  3L6H A;  1ZMG A;  3N26 A;  4RXL A;  1H45 A;  1MRP A;  5CMC A;  4ZS9 A;  4LVQ A;  3RUM A;  3E9X A;  1US5 A;  1JW1 A;  1P1U A;  1SW5 A;  2Z8E A;  3M3K A;  5DTB A;  5TP9 A;  1FQC A;  2VD3 A;  3OD7 A;  2I3V A;  3OXN A;  3IB0 A;  1FTM A;  4KHZ E;  5TU0 A;  2GHB A;  2XXV A;  1MH3 A;  5DEX A;  1PBQ A;  2F97 A;  1I6A A;  1LCT A;  1Y1M A;  2ONR A;  3U72 A;  3JV9 A;  4U4X A;  3TPA A;  2RC7 A;  4NE4 A;  2Q89 A;  3P7I A;  2DVC A;  4U1Z A;  1B7Z A;  3WAE A;  3H06 B;  4GLI A;  3CG3 A;  3VE1 B;  1QKB A;  2ZXT A;  1UIV A;  5HPQ A;  2Y7I A;  2DWA A;  4OFL A;  5BUU A;  4OFJ A;  1USY H;  1ANF A;  1LAX A;  2GFE A;  3VXB A;  3I3V A;  3SET A;  1M5B A;  3DP6 A;  1UQW A;  3SEW A;  4RNS A;  2F35 A;  1MXZ A;  4DE8 A;  3IR1 A;  4PFU A;  3HHG A;  2UVJ A;  4P0G A;  3DLN A;  1S9T A;  4X48 A;  3S9N C;  4NF8 B;  4YB7 A;  4YMA A;  1NNK A;  4KFQ A;  1LAH E;  1YCJ A;  3IO4 A;  1A8F A;  1MY2 A;  5EHM A;  2F7B A;  1TFA A;  1OLC A;  2D5W A;  1B3L A;  2XXT A;  3CFL A;  2QMW A;  3G3I A;  3QXM A;  4KYD A;  4YKK A;  3PPN A;  4PP0 A;  2Z8F A;  2PYY A;  5CMB A;  4F29 A;  3TTN A;  2O7I A;  3GBA A;  1HSL A;  3T66 A;  4O3B A;  4F39 A;  1P1Q A;  2A5S A;  5TP9 B;  2XXR A;  5AA3 A;  1J1N A;  1IXG A;  4ELP A;  1URS A;  3MVY A;  3QAX A;  3JZJ A;  4Q0C A;  3O97 A;  3LBS A;  1SW4 A;  4QFP A;  3BFT A;  2QMX A;  1M5C A;  3C32 A;  5K2X A;  1P1O A;  4BDM A;  1CB6 A;  4K3F A;  4H5G A;  2I0B A;  5DVF A;  1SI0 A;  2DOJ A;  1NFT A;  2NUV A;  3FXR A;  3U92 A;  4DLD A;  5CBR A;  3V8X B;  1IXH A;  4XTC Q;  3KFM A;  5HM4 B;  4JXI A;  3HO7 A;  3Q29 A;  1GV8 A;  1DOT A;  4KD5 A;  3VLV A;  2HCA A;  2I4B A;  4EQB A;  3GZG A;  5IKB A;  1SVX B;  2DWI A;  1FCK A;  3DP4 A;  3K00 A;  2AYS A;  2WKY A;  4R73 A;  4R9G A;  3V5A A;  3ZSF A;  5AA4 A;  3CI8 A;  2ZNS A;  1ELJ A;  2OWT A;  3PUZ E;  4EQ7 A;  3OEK A;  5DYH A;  1AL3 A;  3W9V A;  4G77 A;  3PD9 A;  4DIG A;  3EHS A;  3G3K A;  3SER A;  1JET A;  3PGF A;  3CVG A;  1MXX A;  1D9V A;  1POT A;  1N3X A;  5KDT B;  2UYF A;  1AOV A;  5FHN A;  4LON B;  4WED A;  3VVF A;  1FQA A;  2R9J A;  3K6X A;  4KQP A;  3LSL A;  4GIZ A;  1N0T A;  4DXB A;  4F31 B;  1MY1 A;  5F1Q A;  4G2Z A;  5ISU A;  2HQ0 A;  3H3G A;  4OER A;  4X1D A;  2E0S A;  2XX7 A;  3SKP A;  2RKM A;  3FV1 A;  4RA1 A;  4ELQ A;  4HCW A;  2HEU A;  2O68 A;  1OMP A;  4POX A;  3EPE A;  1M5F A;  1LB8 A;  2UXA A;  3RT8 A;  4ECF A; 
#chains in the Genus database with same CATH topology
 3LSF B;  1XVX A;  3VVE A;  2NOO A;  2YJP A;  5I2K A;  3CFZ A;  3O6I A;  5AA2 D;  5A5X A;  1S7Y A;  2DP8 A;  3HPI A;  1RYO A;  3OMB A;  4LQ5 A;  3T0J A;  1PB7 A;  4FOR A;  5TPA A;  5AA4 B;  1MPB A;  3K02 A;  3N94 A;  4FJP A;  2H25 A;  1B1X A;  1P1N A;  5JTY B;  3H6T A;  1LAF E;  2I58 A;  3LC8 A;  1FBE A;  2ANJ A;  4OWD A;  2F7A A;  3KC0 A;  5I59 A;  3MST A;  2QS4 A;  3RLF E;  1BLF A;  3LSX A;  4G8H A;  4F22 A;  3FVO A;  1KWH A;  2E1S A;  4O3C A;  3EF7 A;  2BJI A;  4KYS A;  4O8M A;  1FTA A;  1B9J A;  4GX3 A;  1FBF A;  4PFT A;  5LOM A;  1FJ9 A;  3RQT A;  5EHS A;  2F6G A;  1FPG A;  2OZZ A;  3KN3 A;  4QRZ A;  2Q2A A;  2QFL A;  4ESX A;  1H3D A;  4NMY A;  4GOT A;  2B65 A;  4PFI A;  1NV0 A;  1AH5 A;  5DVI A;  1IXC A;  2G29 A;  1EU8 A;  4N13 A;  1LFH A;  4YKP A;  4BDN A;  3QYT A;  1VSO A;  4MX6 A;  4I62 A;  1YTV A;  5IAI A;  3PPP A;  3KBR A;  3PUX E;  1GR2 A;  4GD5 A;  4THI A;  1KA0 A;  3E3K A;  4ZZE A;  4FAJ A;  2HZK A;  2ZYO A;  3GBB A;  2ABH A;  4MJO A;  3TTK A;  4IB2 A;  2B3F A;  2R8T A;  5I84 A;  1LBW A;  1FQB A;  3S9M C;  3T9U A;  1MPD A;  2P2A A;  5H8N A;  3UOR A;  3K01 A;  4AS4 A;  2UYE A;  3S9L C;  3I5O A;  1NV2 A;  1LAG E;  4C1U A;  3G3F A;  4JVD A;  5CM6 A;  1JVY A;  3EHU A;  3QK6 A;  3U1O A;  5TPA B;  3K2D A;  2NWJ A;  1RYX A;  3FIR A;  1B5I A;  1N3W A;  3FXB A;  4R2B A;  1L5T A;  3AXF A;  1LBC A;  2VT5 A;  4XIG Q;  1XT8 A;  1FTJ A;  1FBH A;  1UIU A;  3T93 B;  4QF9 A;  2V93 A;  1MQI A;  4I1D A;  3MVZ A;  2M8C A;  4E0W A;  4U21 A;  1AIV A;  1B05 A;  5I59 B;  4HE1 A;  2H98 A;  3BKI B;  5K2Y A;  4Z0I A;  5I58 A;  2ZYN A;  5CMK A;  3A29 A;  1RDY A;  4JDF A;  4LA9 A;  4P0I A;  4JVC A;  1JEV A;  2XHD A;  3OEM A;  1NNF A;  2DE3 A;  2PFY A;  1I69 A;  1VE4 A;  4XEQ A;  4QHQ A;  2OLB A;  2KLF A;  4OFO A;  2HPG A;  1JVX A;  4GX6 A;  2AIX A;  2V3Q A;  4EF2 A;  4PFY A;  5FHM A;  3O28 A;  3K1M A;  4WKM A;  2HXW A;  3MJN A;  1PB8 A;  4QFL A;  2F6P A;  1QUK A;  1PC3 A;  2QPQ A;  4ZE8 A;  4F18 A;  1Y3P A;  1KA1 A;  1LFG A;  3KJT A;  3T9V A;  3PMW A;  1US4 A;  3OEL A;  2H5Y A;  4UA8 A;  4X9T A;  4N4U A;  3K1N A;  1B3H A;  3GYY A;  3IOT A;  3R7X A;  3TTL A;  1MM6 A;  4MMP A;  1M5E A;  2BJJ X;  5H8N B;  4NHB A;  4EXL A;  4OHN A;  4XKR A;  2VPO A;  3OSR A;  1R9L A;  2AL5 A;  3WAF A;  1WVJ A;  4F1V A;  2KQZ A;  5EYH A;  1IMD A;  2RC9 A;  1VDW A;  1VFD A;  1FBG A;  2QJE A;  3O66 A;  4AB5 A;  3B6T A;  3RY3 A;  3KJ7 A;  4FE8 A;  2FVZ A;  2I6E A;  2G93 A;  3UIF A;  4XKQ A;  3TQL A;  3UN6 A;  4HW8 A;  4JWX A;  4OMB A;  3S9E A;  1WOD A;  4HCY A;  1FPD A;  5I58 B;  2Z22 A;  3FZV A;  2DE2 A;  3RT6 B;  4RY1 A;  3S2V A;  2Y5L A;  5IZ3 A;  4R72 A;  3KG2 A;  3TCF A;  4PET A;  1B7H A;  4EDP A;  3FAS A;  3I6V A;  3MPL A;  1JEU A;  2V4C A;  3T22 A;  4QSC A;  3KSX A;  3QMF A;  2ZMB A;  1ZIU A;  4PE3 A;  1B4H A;  2FHY A;  4FIM A;  2QS3 A;  5BWJ A;  4KXP A;  3D4C A;  5CC2 A;  2LAO A;  4PC9 A;  4E0X A;  3HST A;  2REG A;  1FW0 A;  3G3H A;  1SW2 A;  4FEB A;  3ONM A;  1NV5 A;  1IMA A;  2ZZV A;  2XWK A;  1B2H A;  2ZNU A;  4ND9 A;  2O69 A;  4TLL B;  4GXA A;  1K9Y A;  4ZEB A;  3VLW A;  3JYR A;  3CRB A;  1OQG A;  5ESY A;  4ZEI A;  3MW0 A;  5KDT A;  3F11 A;  4U23 A;  3OO7 A;  3IL1 B;  4EF1 A;  3D4G A;  1RDZ A;  2VD2 A;  3ODB A;  4N81 A;  3TOD A;  4OXV A;  4L17 A;  4FED A;  1FPB A;  2F8D A;  3MZ1 A;  5H8Q A;  2HHM A;  3TCH A;  1NNP A;  1H43 A;  2CEY A;  4BDR A;  4PDH A;  2RIN A;  1FQE A;  5HBC A;  2ALU A;  4X1B A;  3IK6 B;  5IZ1 A;  3MPK A;  3HFU A;  4OEV A;  3IAZ A;  2FYI A;  3G3G A;  2XX8 A;  2OWS A;  4YKI A;  1IZ1 A;  3KZG A;  4GWZ A;  4MLQ A;  2Q8J A;  4U22 A;  1UTH A;  4U1O A;  2Y7W A;  1XVY A;  4MHF A;  3MP1 A;  3PD8 A;  3FVG A;  5IZ3 B;  4N8G A;  5KZT A;  3FVN A;  4G68 A;  2OWZ A;  4N17 A;  2OK2 A;  1B51 A;  1RKM A;  3PTY A;  4IY6 A;  2QVU A;  1URG A;  2DQV A;  3OSQ A;  1B46 A;  1N7X A;  5ET7 A;  1GGG A;  4RJZ A;  4YB6 A;  4P11 A;  2O1M A;  4ZEF A;  2FBP A;  3DP8 A;  1BIY A;  3TQW A;  5JTY A;  4Q30 B;  4I9D A;  3FAT A;  4GWX A;  3MVW A;  5EQ9 A;  3RTW B;  5J1D A;  3TMG A;  1JNF A;  4PFR A;  2XXK A;  2V3U A;  3T9X B;  3KOS A;  2FIE A;  4R6K A;  1IUD A;  1FPJ A;  3VFJ A;  5H8F A;  3TTR A;  4GVO A;  4JSD A;  4GWW A;  4PFW A;  1LB9 A;  3MZB A;  1MXY A;  3PMV A;  2QS1 A;  3UGW A;  1O7T A;  4F3S A;  3ISP A;  2KR0 A;  2CZL A;  3ILU B;  1QJM A;  1AWB A;  1SQY A;  1SD3 A;  4XXU A;  3Q25 A;  4JWY A;  4GWU A;  3IJX B;  4LP2 B;  1UTB A;  2HAV A;  4PQJ A;  3FVK A;  1D3K A;  5H8Q B;  4IY5 A;  2X7P A;  5ITO A;  4PTK A;  4IGT A;  4YB5 A;  1EYJ A;  3UA8 A;  4LAT A;  4I40 A;  2O51 A;  1PEB A;  4AQ4 A;  1OIB A;  1OVB A;  3MYU A;  2VOZ A;  2B3B A;  1LBZ A;  2F36 A;  1EZ9 A;  4RK9 A;  3UP9 A;  1UTH B;  2WYP A;  2VPN A;  4H45 A;  2YLN A;  3T9H B;  3S4U A;  3MAM A;  1B1H A;  4G68 B;  4X8R A;  2PMS A;  3PUY E;  1R9Q A;  5L9O A;  1FSA A;  1B3E A;  3H6U A;  3C4M A;  3MQ9 A;  3N5L A;  4O7M A;  2O7U A;  4I3Y A;  5ICQ A;  4PAF A;  3G7W A;  1SPI A;  4R9F A;  2Y7P A;  3A3U A;  1PB9 A;  3U65 A;  2RCB A;  3MZ9 A;  2CMO A;  3TFL A;  1B4Z A;  1D9Y A;  3A09 A;  5I2N A;  4MEV A;  3C9H A;  5KCJ A;  2O84 X;  4HE0 A;  3IOR A;  4ELR A;  3SZP A;  3EKI A;  2UVH A;  4JBZ A;  3RGY A;  3M3L A;  4H8I A;  3ROJ A;  1B5J A;  3TTM A;  4GWO A;  4ZEK A;  1NH7 A;  4GBW A;  5H8F B;  4NED A;  2OJT A;  1ZU0 A;  3VXC A;  2PVU A;  5EYF A;  3SEU A;  1S50 A;  1VFE A;  1QUL A;  4BLA A;  1B32 A;  1G0I A;  1OVT A;  3RTF B;  1LBB A;  1UTB B;  5ICT A;  3OO9 A;  3MWB A;  3CR9 A;  1MY3 A;  4ELO A;  4OET A;  3FD3 A;  3KEI A;  2H9B A;  4KI0 E;  1NV6 A;  2X7Q A;  3A3C A;  1M5D A;  3LUY A;  1MY4 A;  1NL5 A;  4F2O A;  4NG7 A;  4Q5T A;  3C31 A;  4POW A;  2Q88 A;  2V3T A;  1MDP 1;  2XXX A;  4LZ7 A;  3EHT A;  1Y4T A;  2VGQ A;  4DXC A;  3PPR A;  4F3P A;  5L9M A;  2GH9 A;  4NF6 A;  2DVZ A;  1FTO A;  1HSJ A;  1ZJL A;  2PT2 A;  3TCG A;  2Z23 A;  4LZ5 A;  2F5X A;  4NF4 A;  5L9S A;  1G0H A;  4RK2 A;  4TQU Q;  3CG1 A;  1QUJ A;  4GF8 A;  2XX9 A;  2QRY A;  2XXI A;  3OOA A;  1Y3Q A;  4OEU A;  1FPE A;  4OQO A;  1QVS A;  2NXO A;  4KR5 A;  3B7D A;  3CSG A;  4G8N A;  5ET5 A;  4P1L A;  5I2N B;  2PT1 A;  4IO5 A;  5KCJ B;  3H6W A;  2B4M A;  4NTL A;  3TUS A;  5DVJ A;  3VVD A;  4NWC A;  4IGR A;  2O6A A;  5I56 B;  4DZ1 A;  1NV4 A;  4F19 A;  5FHO A;  1BKA A;  1BP5 A;  1F9B A;  4LZ8 A;  4R2F A;  2WBD A;  1B6H A;  3KN7 A;  4FAT A;  1DSN A;  1ZKB A;  1MXU A;  3C34 A;  4PDD A;  1SW1 A;  4N15 A;  4YAH X;  3QIM A;  1Y20 A;  4FEC A;  3RN8 A;  1NV7 A;  3T1B A;  3KOT A;  2V25 A;  4PAI A;  1Q1K A;  4QSD A;  3SEX A;  5CI5 A;  2NVU B;  1MXV A;  2XXU A;  2DXY A;  3MP6 A;  4EUO A;  3VLU A;  2XXQ A;  1MQD A;  4ESW A;  4LN5 A;  3IB1 A;  2HAU A;  5CRY A;  3O29 A;  1II5 A;  1NUY A;  3PV0 E;  1DK4 A;  1XHY A;  4ZE9 A;  1A40 A;  1B3F A;  4PF6 A;  1DPE A;  1Y9U A;  4KCC A;  4MF3 A;  4PGN A;  4F2Q A;  3ZS6 A;  1ZTY A;  3G3J A;  5H8H A;  4AB6 A;  2F3D A;  4NN3 A;  3PUW E;  3IX1 A;  5AE4 A;  4C1T A;  4RYA A;  3N6T A;  3FJM A;  4PGP A;  4NF6 B;  2XWV A;  4QXD A;  1POY 1;  1R6Z A;  1SDX A;  2F78 A;  4NF4 B;  3FGS A;  3FJG A;  4H65 A;  3IOV A;  1TXF A;  2ZZX A;  4HTG A;  2I3W A;  4H8J A;  1A99 A;  4Q8R A;  1TFD A;  1AMF A;  4F1U A;  5I3S A;  3GLB A;  2FA7 A;  2P3N A;  1B5H A;  2Y7K A;  1FQF A;  4IO2 A;  3KN8 A;  2Z8D A;  1Y4C A;  5FTH A;  3CSB A;  2ONK E;  2P1S A;  3H6V A;  4DXU A;  1I6Q A;  1EH3 A;  1HSE A;  4U4S A;  1JP4 A;  4N07 A;  4WEP A;  5JEI A;  4H67 A;  2RC8 A;  4BDL A;  2CZK A;  1FTL A;  1USY E;  3DEL B;  2V84 A;  4MNI A;  4QFN A;  5AA2 A;  1A7L A;  1VR5 A;  4DCX A;  2XXP A;  3H7M A;  1A54 A;  2QS2 A;  3THI A;  4QSE A;  3B6Q A;  3PPQ A;  4U2R A;  3E4R A;  1MQG A;  3R6U A;  4TLM B;  1MDQ A;  2H4I A;  1QKA A;  3TZA A;  3O6G A;  3FXU A;  5JK4 A;  1DMB A;  3O2A A;  4H6D A;  5IZZ A;  3U93 A;  3D1R A;  4DI4 B;  3C33 A;  3QUF A;  1B0L A;  3U8Q A;  4BDQ A;  4NF5 A;  4R74 A;  1MS7 A;  3FUZ A;  2F7C A;  1B0H A;  1DPP A;  2I49 A;  1GTK A;  3K6U A;  5H8H B;  4NGU A;  4YIC A;  4MFI A;  1TT1 A;  2OCU A;  2Q74 A;  3B50 A;  2AL4 A;  5EQA A;  4MAG A;  1CE2 A;  2OX3 A;  3BIG A;  1FTK A;  2Y84 A;  5ET8 A;  1MXW A;  1OQH A;  5ELV A;  5L8D A;  4N6P A;  1SI1 A;  2D3I A;  3TAJ A;  2OBG A;  2DSF A;  3QUJ A;  2THI A;  5FTI A;  3VV5 A;  1MG1 A;  1Q35 A;  3K6W A;  4JWO A;  1FRP A;  2QL3 A;  3K4U A;  1PBP A;  4F3G A;  4OTE A;  4HE2 A;  1FPI A;  2XWI A;  5A5L A;  3IOU A;  2HFB A;  1FPL A;  3HHF A;  3IFC A;  2A5T A;  4GWY A;  1Y3N A;  5LDZ A;  1SBP A;  4Z7E A;  5F7V A;  4YZZ A;  1NNT A;  4MBP A;  2DYX A;  2UVG A;  4QFO A;  2XA5 A;  2DXR A;  1DCU A;  5EQ8 A;  4DCY A;  4UAC A;  4DDD A;  1FBP A;  2PBW A;  5I7I A;  5DEX B;  1NMU A;  2XD2 A;  4P8B A;  1KZ8 A;  3M8U A;  5DT6 A;  5AA2 B;  1XC1 A;  2I4C A;  1P99 A;  1N04 A;  3FV2 A;  4EXK A;  3OO6 A;  1NUZ A;  3FBP A;  1B40 A;  3CFX A;  1EZP A;  5ITP A;  3Q27 A;  1QUI A;  1NI9 A;  3E79 A;  1MPC A;  2XXH A;  2ZYM A;  4F1Y A;  4PF8 A;  4OVJ A;  1N84 A;  4MH5 A;  1URD A;  3LV0 A;  1LCF A;  1ZBM A;  1YYZ A;  1MQJ A;  3DM0 A;  3GXA A;  3OEN A;  1O63 A;  4ISU A;  4R6Y A;  1JQF A;  2ZNT A;  1MM7 A;  4NF5 B;  4IO6 A;  1GVC A;  4QFK A;  4LUB A;  2WEF A;  1Y1Z A;  4ONY A;  3IOW A;  5CMM A;  4MNP A;  3QSL A;  3U94 A;  3PPO A;  2H99 A;  1MQH A;  2Q8M A;  4O7I A;  4H1X A;  3T96 B;  3Q26 A;  1B58 A;  4ZEC A;  4H0W A;  1FQD A;  1EYK A;  1TWY A;  4EQ9 A;  1B3G A;  3EQ1 A;  3W9W A;  3TEL A;  3TDJ A;  1LBY A;  3W15 C;  3KC1 A;  4R6H A;  3M3F A;  3Q28 A;  1YAE A;  4M4G A;  2I48 A;  4GX4 A;  4TOZ A;  3H4Z A;  3USD A;  2A5T B;  4DI3 D;  4YU0 A;  1T0K A;  4M1V A;  1B7U A;  2O1L A;  2F34 A;  1LST A;  1ATG A;  1Z7M E;  3HV1 A;  2XXY A;  2DS9 A;  1FBD A;  4G68 C;  4GL0 A;  2HZL A;  4LQ2 A;  4XKN A;  4MCO A;  1A8E A;  2QSX A;  2GHA A;  5H8S A;  5LTC A;  2ZYK A;  1IEJ A;  1LFI A;  2R6G E;  4QBA A;  1A55 A;  4O94 A;  3RPW A;  2PX1 A;  3NOH A;  2WX9 A;  2ONS A;  2RCA A;  3R26 A;  4OVP A;  5M2V A;  4OZ9 A;  5DW8 A;  4NX1 A;  4ZDM A;  3PUV E;  4PAK A;  1IIT A;  4F3B A;  3ZKL A;  2VP1 A;  2CZH A;  3E78 A;  3IJO B;  1LLS A;  4HS7 A;  2GQ1 A;  3SES A;  5EQ7 A;  5I56 A;  3O6H A;  4BDO A;  4H5F A;  3V89 B;  3TYH A;  5I57 A;  3PU5 A;  2FIX A;  3H03 A;  4RPN A;  4PBQ A;  1H76 A;  3IO6 A;  2REJ A;  1IQ7 A;  3V83 A;  1D4N A;  4GXS B;  4IO3 A;  4YMB A;  1XOC A;  3ZKK A;  1BTJ A;  3MUQ A;  3OO8 A;  4RPO A;  5AA1 A;  3LR1 A;  4PE5 B;  1D9Q A;  4XKP A;  1JW5 A;  1IMB A;  3ECR A;  4G8M A;  4OVT A;  3C35 A;  4KYE A;  4ZED A;  2YPN A;  2L5V A;  2XXW A;  4PCD A;  4GL8 A;  1O64 A;  1SYI A;  2IEE A;  2Y7R A;  4HXV A;  5ET6 A;  4G61 A;  2P0S A;  3TKD A;  4WXJ A;  2I0C A;  4YKJ A;  4O3A A;  4NF0 A;  3EN3 A;  4MLV A;  1MY0 A;  2Q9T A;  5I5P A;  2WBB A;  4OYV A;  3UK4 A;  4H46 A;  4G4P A;  1QW0 A;  1NV3 A;  3IFA A;  2Q2C A;  4GRK A;  3VDF A;  4OVQ A;  4GWS A;  1DTZ A;  1IIW A;  1SYH A;  2X26 A;  2RF1 A;  1DBZ A;  4JSO A;  3MP8 A;  5CBS A;  4MNC A;  4N6K A;  4NQ8 A;  1DTG A;  3N6U A;  4C0R A;  2DWJ A;  1YPN A;  1INP A;  3MC2 A;  3SDF A;  2GRV A;  3K6V A;  1JW4 A;  3K1P A;  3O9P A;  4GQO A;  1NH8 A;  3FJ7 A;  3BFU A;  4OES A;  5I2K B;  3K0V A;  2ESN A;  3B6W A;  3FXQ A;  4IO7 A;  2XD3 A;  5A5X B;  4R75 A;  2XWO A;  2DWH A;  2FNC A;  1LGB C;  1N76 A;  4XFE A;  1IME A;  5I57 B;  1N7W A;  1PDA A;  4ZZA A;  3HN0 A;  3E13 X;  5J16 A;  1OLA A;  2D21 A;  1EZO A;  1LBV A;  3SEV A;  3RNN A;  1NV1 A;  4NWD A;  1QGX A;  3CIJ A;  3LSW A;  4KCD A;  3C36 A;  4KPT A;  2CEX A;  3MVX A;  4OEN A;  2UVI A;  3BBR A;  5B70 A;  1H44 A;  1P1W A;  1R1N A;  3B8B A;  4I8C A;  5B7D A;  2DE4 A;  5IGA A;  1B52 A;  1WDN A;  3L6G A;  3MBP A;  1IXI A;  2F3B A;  2IA4 A;  4OVS A;  3ILT B;  1LBX A;  2QVV A;  4GFR A;  3TEP A;  1XS5 A;  1I6B A;  3HCQ A;  1ZLQ A;  3PMX A;  2W7Y A;  3KGC A;  1MH4 A;  1EYI A;  1NKX A;  1FPK A;  5F24 A;  4JB7 A;  4NF8 A;  1Z7N E;  3IB2 A;  2R71 A;  4AS5 A;  2QVR A;  3SEY A;  3KSJ A;  4IO4 A;  2VHA A;  3L6H A;  4N6D A;  1ZMG A;  3N26 A;  4RXL A;  1H45 A;  1MRP A;  5T3J A;  5CMC A;  4ZS9 A;  4LVQ A;  3RUM A;  3E9X A;  1US5 A;  1JW1 A;  1P1U A;  1SW5 A;  2Z8E A;  3M3K A;  5DTB A;  5TP9 A;  1FQC A;  2VD3 A;  3OD7 A;  2I3V A;  3OXN A;  5FBP A;  3IB0 A;  1FTM A;  4KHZ E;  5TU0 A;  2GHB A;  2XXV A;  1MH3 A;  4PBH A;  5IM2 A;  5DEX A;  1PBQ A;  2F97 A;  1I6A A;  4P3L A;  4MIJ A;  1LEV A;  3BIH A;  5EYG A;  1LCT A;  1Y1M A;  1K9Z A;  2ONR A;  3U72 A;  2MKZ A;  3JV9 A;  4U4X A;  4UAB A;  2PCR A;  3TPA A;  4NE4 A;  2RC7 A;  4N91 A;  2Q89 A;  4P9K A;  3P7I A;  1Q9D A;  2DVC A;  4N8Y A;  4U1Z A;  1B7Z A;  1NUX A;  1FBC A;  3WAE A;  3H06 B;  3RYD A;  4GLI A;  3CG3 A;  3VE1 B;  1QKB A;  2ZXT A;  1UIV A;  4OA4 A;  5HPQ A;  2Y7I A;  1IMC A;  2DWA A;  4OFL A;  5BUU A;  4OFJ A;  1USY H;  1ANF A;  1LAX A;  2GFE A;  3VXB A;  3I3V A;  3SET A;  1M5B A;  3DP6 A;  1UQW A;  3SEW A;  4RNS A;  2F35 A;  1MXZ A;  4DE8 A;  3IR1 A;  4PFU A;  3HHG A;  2UVJ A;  4P47 A;  4P0G A;  3DLN A;  1S9T A;  4X48 A;  3S9N C;  4NF8 B;  4YB7 A;  4YMA A;  1NNK A;  4KFQ A;  1LAH E;  1YCJ A;  3IO4 A;  1A8F A;  1MY2 A;  2CZI A;  2F7B A;  5EHM A;  1TFA A;  1OLC A;  2D5W A;  1B3L A;  2XXT A;  4X04 A;  3CFL A;  2QMW A;  3G3I A;  3QXM A;  4KYD A;  4YKK A;  2HXR A;  3PPN A;  4P1E A;  4PFB A;  4PP0 A;  2Z8F A;  2PYY A;  5CMB A;  1FJ6 A;  4F29 A;  3TTN A;  2O7I A;  3GBA A;  1HSL A;  3T66 A;  4O3B A;  4FBP A;  4F39 A;  1P1Q A;  4OVR A;  2A5S A;  5TP9 B;  2XXR A;  2P3V A;  5AA3 A;  1J1N A;  1IXG A;  4ELP A;  1URS A;  3MVY A;  3QAX A;  3JZJ A;  2JJK A;  4Q0C A;  3O97 A;  3LBS A;  1SW4 A;  4P56 A;  4QFP A;  3BFT A;  2QMX A;  1M5C A;  3C32 A;  5K2X A;  1P1O A;  4BDM A;  1CB6 A;  4K3F A;  4H5G A;  2I0B A;  5DVF A;  1SI0 A;  2DOJ A;  1NFT A;  2NUV A;  3FXR A;  3U92 A;  1NUW A;  4DLD A;  5CBR A;  3V8X B;  1IXH A;  4XTC Q;  3KFM A;  5HM4 B;  4JXI A;  3HO7 A;  3Q29 A;  1GV8 A;  1DOT A;  4KD5 A;  3VLV A;  2HCA A;  2I4B A;  3RPL A;  3LUZ A;  4EQB A;  3GZG A;  5IKB A;  1SVX B;  2B4L A;  2DWI A;  2WYK A;  4IR8 A;  4JVI A;  1FCK A;  3DP4 A;  3K00 A;  2AYS A;  2WKY A;  4R73 A;  4R9G A;  3V5A A;  3ZSF A;  4I3E A;  5AA4 A;  1RDX A;  3CI8 A;  2ZNS A;  3CHG A;  4OAN A;  1ELJ A;  2OWT A;  2Y5K A;  3PUZ E;  1BK4 A;  4EQ7 A;  3OEK A;  1XI6 A;  5DYH A;  1AL3 A;  4GBV A;  3W9V A;  1YXI A;  4G77 A;  3PD9 A;  4DIG A;  3EHS A;  3G3K A;  3SER A;  1JET A;  3PGF A;  3CVG A;  1MXX A;  1D9V A;  1POT A;  1N3X A;  1CNQ A;  5KDT B;  2UYF A;  1AOV A;  5FHN A;  4LON B;  4WED A;  3VVF A;  1FQA A;  2R9J A;  3K6X A;  4KQP A;  3LSL A;  4GIZ A;  1N0T A;  4DXB A;  4F31 B;  1MY1 A;  1YZ0 A;  1FPF A;  2PFZ A;  5F1Q A;  1IMF A;  4XF5 A;  4G2Z A;  5ISU A;  2ZZW A;  2HQ0 A;  3H3G A;  4OER A;  4X1D A;  2E0S A;  2XX7 A;  3SKP A;  2RKM A;  3FV1 A;  4RA1 A;  4ELQ A;  4HCW A;  2HEU A;  2O68 A;  1OMP A;  2DDK A;  4POX A;  3EPE A;  1M5F A;  4NAP A;  1LB8 A;  3RPL B;  2UXA A;  3RT8 A;  4ECF A;  3KBZ A; 
#chains in the Genus database with same CATH homology
 3LSF B;  1XVX A;  3VVE A;  2NOO A;  2YJP A;  5I2K A;  3CFZ A;  3O6I A;  5AA2 D;  5A5X A;  1S7Y A;  2DP8 A;  3HPI A;  1RYO A;  3OMB A;  4LQ5 A;  1PB7 A;  4FOR A;  5TPA A;  5AA4 B;  1MPB A;  3K02 A;  3N94 A;  4FJP A;  2H25 A;  1B1X A;  1P1N A;  5JTY B;  3H6T A;  1LAF E;  2I58 A;  3LC8 A;  2ANJ A;  4OWD A;  2F7A A;  5I59 A;  2QS4 A;  3RLF E;  1BLF A;  3LSX A;  4G8H A;  4F22 A;  3FVO A;  1KWH A;  2E1S A;  4O3C A;  3EF7 A;  4KYS A;  1B9J A;  4PFT A;  5LOM A;  3RQT A;  5EHS A;  2F6G A;  2OZZ A;  3KN3 A;  4QRZ A;  2Q2A A;  4ESX A;  1H3D A;  4NMY A;  4GOT A;  2B65 A;  1AH5 A;  5DVI A;  1IXC A;  2G29 A;  1EU8 A;  4N13 A;  1LFH A;  4YKP A;  4BDN A;  3QYT A;  1VSO A;  4I62 A;  1YTV A;  5IAI A;  3PPP A;  3KBR A;  3PUX E;  1GR2 A;  4GD5 A;  4THI A;  3E3K A;  4ZZE A;  4FAJ A;  2HZK A;  2ZYO A;  3GBB A;  2ABH A;  3TTK A;  4IB2 A;  2B3F A;  5I84 A;  1FQB A;  3S9M C;  3T9U A;  1MPD A;  2P2A A;  5H8N A;  3UOR A;  3K01 A;  2UYE A;  3S9L C;  3I5O A;  1LAG E;  4C1U A;  3G3F A;  5CM6 A;  1JVY A;  3EHU A;  3QK6 A;  3U1O A;  5TPA B;  3K2D A;  2NWJ A;  1RYX A;  3FIR A;  1B5I A;  1N3W A;  4R2B A;  1L5T A;  3AXF A;  1LBC A;  4XIG Q;  1XT8 A;  1FTJ A;  1UIU A;  3T93 B;  4QF9 A;  2V93 A;  1MQI A;  4I1D A;  3MVZ A;  2M8C A;  4E0W A;  4U21 A;  1AIV A;  1B05 A;  5I59 B;  2H98 A;  3BKI B;  5K2Y A;  4Z0I A;  5I58 A;  2ZYN A;  5CMK A;  4JDF A;  4LA9 A;  4P0I A;  1JEV A;  2XHD A;  3OEM A;  1NNF A;  2DE3 A;  1I69 A;  1VE4 A;  4QHQ A;  2OLB A;  2KLF A;  4OFO A;  1JVX A;  2AIX A;  2V3Q A;  4EF2 A;  4PFY A;  5FHM A;  3O28 A;  3K1M A;  4WKM A;  2HXW A;  3MJN A;  1PB8 A;  4QFL A;  2F6P A;  1QUK A;  1PC3 A;  2QPQ A;  4ZE8 A;  4F18 A;  1Y3P A;  3KJT A;  1LFG A;  3T9V A;  3PMW A;  1US4 A;  3OEL A;  2H5Y A;  4UA8 A;  4X9T A;  3K1N A;  1B3H A;  3IOT A;  3R7X A;  3TTL A;  1MM6 A;  1M5E A;  2BJJ X;  5H8N B;  4EXL A;  4OHN A;  4XKR A;  3OSR A;  1R9L A;  2AL5 A;  3WAF A;  1WVJ A;  4F1V A;  2RC9 A;  1VFD A;  2QJE A;  3O66 A;  4AB5 A;  3B6T A;  3RY3 A;  3KJ7 A;  4FE8 A;  2I6E A;  2G93 A;  3UIF A;  4XKQ A;  3TQL A;  3UN6 A;  4HW8 A;  4JWX A;  4OMB A;  3S9E A;  1WOD A;  4HCY A;  5I58 B;  2Z22 A;  3FZV A;  2DE2 A;  3RT6 B;  4RY1 A;  3S2V A;  4R72 A;  3KG2 A;  3TCF A;  4PET A;  1B7H A;  4EDP A;  3FAS A;  3I6V A;  3MPL A;  1JEU A;  3T22 A;  4QSC A;  3KSX A;  2ZMB A;  1ZIU A;  1B4H A;  4FIM A;  2QS3 A;  5BWJ A;  3D4C A;  5CC2 A;  2LAO A;  4E0X A;  3HST A;  2REG A;  1FW0 A;  3G3H A;  1SW2 A;  4FEB A;  3ONM A;  1B2H A;  2ZNU A;  4ND9 A;  2O69 A;  4TLL B;  4GXA A;  4ZEB A;  3VLW A;  3JYR A;  3CRB A;  1OQG A;  4ZEI A;  3MW0 A;  5KDT A;  3F11 A;  4U23 A;  3OO7 A;  3IL1 B;  4EF1 A;  3D4G A;  2VD2 A;  3ODB A;  3TOD A;  4OXV A;  4L17 A;  4FED A;  2F8D A;  3MZ1 A;  5H8Q A;  3TCH A;  1NNP A;  1H43 A;  4BDR A;  5HBC A;  2RIN A;  1FQE A;  2ALU A;  4X1B A;  3IK6 B;  3MPK A;  4OEV A;  3IAZ A;  2FYI A;  3G3G A;  2XX8 A;  2OWS A;  4YKI A;  1IZ1 A;  3KZG A;  4MLQ A;  2Q8J A;  4U22 A;  1UTH A;  4U1O A;  2Y7W A;  1XVY A;  3MP1 A;  3PD8 A;  3FVG A;  5KZT A;  3FVN A;  4G68 A;  2OK2 A;  1B51 A;  1RKM A;  4IY6 A;  1URG A;  2DQV A;  3OSQ A;  1B46 A;  1N7X A;  1GGG A;  4RJZ A;  4YB6 A;  4P11 A;  2O1M A;  4ZEF A;  3DP8 A;  1BIY A;  3TQW A;  5JTY A;  4Q30 B;  4I9D A;  3FAT A;  3MVW A;  3RTW B;  5J1D A;  3TMG A;  1JNF A;  2V3U A;  3T9X B;  3KOS A;  4R6K A;  1IUD A;  3VFJ A;  5H8F A;  3TTR A;  4GVO A;  4JSD A;  4PFW A;  1LB9 A;  3MZB A;  1MXY A;  3PMV A;  2QS1 A;  3UGW A;  1O7T A;  4F3S A;  2CZL A;  3ILU B;  1QJM A;  1SQY A;  1SD3 A;  4XXU A;  3Q25 A;  4JWY A;  3IJX B;  4LP2 B;  1UTB A;  2HAV A;  4PQJ A;  3FVK A;  1D3K A;  5H8Q B;  4IY5 A;  2X7P A;  5ITO A;  4IGT A;  4YB5 A;  3UA8 A;  4LAT A;  2O51 A;  1PEB A;  4AQ4 A;  1OIB A;  1OVB A;  2VOZ A;  2B3B A;  2F36 A;  1EZ9 A;  4RK9 A;  3UP9 A;  1UTH B;  2YLN A;  3T9H B;  3S4U A;  3MAM A;  1B1H A;  4G68 B;  2PMS A;  3PUY E;  1R9Q A;  5L9O A;  1B3E A;  3H6U A;  3C4M A;  3MQ9 A;  3N5L A;  2O7U A;  5ICQ A;  3G7W A;  4R9F A;  2Y7P A;  3A3U A;  1PB9 A;  2RCB A;  3MZ9 A;  2CMO A;  3TFL A;  1B4Z A;  1D9Y A;  3A09 A;  5I2N A;  3C9H A;  5KCJ A;  2O84 X;  3IOR A;  4ELR A;  2UVH A;  4JBZ A;  3RGY A;  3M3L A;  4H8I A;  1B5J A;  3TTM A;  4GWO A;  4ZEK A;  1NH7 A;  5H8F B;  4NED A;  2OJT A;  1ZU0 A;  3VXC A;  2PVU A;  5EYF A;  3SEU A;  1S50 A;  1VFE A;  1QUL A;  4BLA A;  1B32 A;  1OVT A;  3RTF B;  1LBB A;  1UTB B;  5ICT A;  3OO9 A;  3MWB A;  3CR9 A;  1MY3 A;  4ELO A;  4OET A;  3FD3 A;  3KEI A;  2H9B A;  4KI0 E;  2X7Q A;  3A3C A;  1M5D A;  3LUY A;  1MY4 A;  1NL5 A;  4F2O A;  4Q5T A;  3C31 A;  4POW A;  2Q88 A;  2V3T A;  1MDP 1;  2XXX A;  4LZ7 A;  3EHT A;  1Y4T A;  2VGQ A;  4DXC A;  3PPR A;  4F3P A;  5L9M A;  2GH9 A;  4NF6 A;  2DVZ A;  1FTO A;  1HSJ A;  1ZJL A;  2PT2 A;  3TCG A;  2Z23 A;  4LZ5 A;  2F5X A;  4NF4 A;  5L9S A;  4RK2 A;  4TQU Q;  3CG1 A;  1QUJ A;  4GF8 A;  2XX9 A;  2QRY A;  2XXI A;  3OOA A;  1Y3Q A;  4OEU A;  4OQO A;  1QVS A;  2NXO A;  4KR5 A;  3B7D A;  3CSG A;  4G8N A;  5I2N B;  2PT1 A;  4IO5 A;  5KCJ B;  3H6W A;  4NTL A;  3TUS A;  5DVJ A;  3VVD A;  4NWC A;  4IGR A;  2O6A A;  5I56 B;  4DZ1 A;  4F19 A;  5FHO A;  1BKA A;  1BP5 A;  1F9B A;  4LZ8 A;  4R2F A;  1B6H A;  3KN7 A;  4FAT A;  1DSN A;  1ZKB A;  1MXU A;  3C34 A;  1SW1 A;  4YAH X;  3QIM A;  1Y20 A;  4FEC A;  3RN8 A;  3KOT A;  2V25 A;  1Q1K A;  4QSD A;  3SEX A;  5CI5 A;  2NVU B;  1MXV A;  2XXU A;  2DXY A;  3MP6 A;  4EUO A;  3VLU A;  2XXQ A;  1MQD A;  4ESW A;  3IB1 A;  2HAU A;  5CRY A;  3O29 A;  1II5 A;  3PV0 E;  1XHY A;  4ZE9 A;  1A40 A;  1B3F A;  1DPE A;  1Y9U A;  4KCC A;  4MF3 A;  4F2Q A;  3ZS6 A;  1ZTY A;  3G3J A;  5H8H A;  4AB6 A;  3PUW E;  3IX1 A;  5AE4 A;  4C1T A;  4RYA A;  3N6T A;  3FJM A;  4NF6 B;  1POY 1;  1R6Z A;  1SDX A;  2F78 A;  4NF4 B;  3FGS A;  3FJG A;  4H65 A;  3IOV A;  1TXF A;  4HTG A;  2I3W A;  4H8J A;  4Q8R A;  1A99 A;  1TFD A;  1AMF A;  4F1U A;  3GLB A;  2FA7 A;  1B5H A;  2Y7K A;  1FQF A;  4IO2 A;  3KN8 A;  2Z8D A;  1Y4C A;  5FTH A;  3CSB A;  2ONK E;  2P1S A;  3H6V A;  4DXU A;  1I6Q A;  1EH3 A;  1HSE A;  4U4S A;  4N07 A;  4WEP A;  5JEI A;  4H67 A;  2RC8 A;  4BDL A;  1FTL A;  1USY E;  3DEL B;  2V84 A;  4QFN A;  5AA2 A;  1A7L A;  1VR5 A;  4DCX A;  2XXP A;  3H7M A;  1A54 A;  2QS2 A;  3THI A;  4QSE A;  3B6Q A;  3PPQ A;  4U2R A;  3E4R A;  1MQG A;  3R6U A;  4TLM B;  1MDQ A;  2H4I A;  1QKA A;  3TZA A;  3O6G A;  3FXU A;  5JK4 A;  1DMB A;  3O2A A;  4H6D A;  3U93 A;  3C33 A;  3QUF A;  1B0L A;  3U8Q A;  4BDQ A;  4NF5 A;  4R74 A;  1MS7 A;  3FUZ A;  2F7C A;  1B0H A;  1DPP A;  2I49 A;  1GTK A;  3K6U A;  5H8H B;  4YIC A;  4MFI A;  1TT1 A;  2OCU A;  2AL4 A;  1CE2 A;  1FTK A;  2Y84 A;  1MXW A;  1OQH A;  5ELV A;  5L8D A;  4N6P A;  1SI1 A;  2D3I A;  3TAJ A;  2OBG A;  2DSF A;  3QUJ A;  2THI A;  5FTI A;  3VV5 A;  1MG1 A;  1Q35 A;  3K6W A;  4JWO A;  2QL3 A;  3K4U A;  1PBP A;  4F3G A;  4OTE A;  3IOU A;  2HFB A;  3HHF A;  2A5T A;  1Y3N A;  1SBP A;  4Z7E A;  5F7V A;  4YZZ A;  1NNT A;  4MBP A;  2DYX A;  2UVG A;  4QFO A;  2DXR A;  4DCY A;  4UAC A;  4DDD A;  2PBW A;  5DEX B;  1NMU A;  2XD2 A;  3M8U A;  5DT6 A;  5AA2 B;  1XC1 A;  2I4C A;  1P99 A;  1N04 A;  3FV2 A;  4EXK A;  3OO6 A;  1B40 A;  3CFX A;  1EZP A;  5ITP A;  3Q27 A;  1QUI A;  1MPC A;  2XXH A;  2ZYM A;  4F1Y A;  4OVJ A;  1N84 A;  4MH5 A;  1URD A;  1LCF A;  1ZBM A;  1MQJ A;  3DM0 A;  3GXA A;  3OEN A;  1O63 A;  4ISU A;  4R6Y A;  1JQF A;  2ZNT A;  1MM7 A;  4NF5 B;  4IO6 A;  1GVC A;  4QFK A;  4LUB A;  1Y1Z A;  4ONY A;  3IOW A;  5CMM A;  3QSL A;  3U94 A;  3PPO A;  2H99 A;  1MQH A;  4H1X A;  3T96 B;  3Q26 A;  1B58 A;  4ZEC A;  4H0W A;  1FQD A;  1TWY A;  4EQ9 A;  1B3G A;  3EQ1 A;  3W9W A;  3TEL A;  3TDJ A;  3W15 C;  4R6H A;  3M3F A;  3Q28 A;  1YAE A;  4M4G A;  2I48 A;  4TOZ A;  3H4Z A;  3USD A;  2A5T B;  4YU0 A;  1T0K A;  4M1V A;  1B7U A;  2O1L A;  2F34 A;  1LST A;  1ATG A;  1Z7M E;  3HV1 A;  2XXY A;  2DS9 A;  4G68 C;  4GL0 A;  2HZL A;  4LQ2 A;  4XKN A;  1A8E A;  2QSX A;  2GHA A;  5H8S A;  2ZYK A;  1IEJ A;  1LFI A;  2R6G E;  1A55 A;  3RPW A;  2PX1 A;  2ONS A;  2RCA A;  3R26 A;  5M2V A;  4OZ9 A;  4ZDM A;  3PUV E;  1IIT A;  4F3B A;  3ZKL A;  2VP1 A;  3IJO B;  1LLS A;  4HS7 A;  3SES A;  5I56 A;  3O6H A;  4BDO A;  4H5F A;  3V89 B;  3TYH A;  5I57 A;  3PU5 A;  3H03 A;  4RPN A;  1H76 A;  3IO6 A;  2REJ A;  1IQ7 A;  3V83 A;  1D4N A;  4GXS B;  4IO3 A;  4YMB A;  1XOC A;  3ZKK A;  1BTJ A;  3MUQ A;  3OO8 A;  4RPO A;  5AA1 A;  3LR1 A;  4PE5 B;  4XKP A;  1JW5 A;  3ECR A;  4G8M A;  3C35 A;  4KYE A;  4ZED A;  2YPN A;  2XXW A;  4GL8 A;  1O64 A;  1SYI A;  2IEE A;  2Y7R A;  2P0S A;  3TKD A;  4WXJ A;  2I0C A;  4YKJ A;  4O3A A;  3EN3 A;  4MLV A;  1MY0 A;  2Q9T A;  4OYV A;  3UK4 A;  4G4P A;  1QW0 A;  2Q2C A;  4GRK A;  3VDF A;  1DTZ A;  1IIW A;  1SYH A;  2X26 A;  2RF1 A;  4JSO A;  3MP8 A;  5CBS A;  1DTG A;  3N6U A;  4C0R A;  2DWJ A;  1YPN A;  3MC2 A;  3SDF A;  2GRV A;  3K6V A;  1JW4 A;  3K1P A;  3O9P A;  4GQO A;  1NH8 A;  3FJ7 A;  3BFU A;  4OES A;  5I2K B;  3K0V A;  2ESN A;  3B6W A;  3FXQ A;  4IO7 A;  5A5X B;  2XD3 A;  4R75 A;  2DWH A;  2FNC A;  1LGB C;  1N76 A;  5I57 B;  1N7W A;  1PDA A;  4ZZA A;  3HN0 A;  3E13 X;  1OLA A;  2D21 A;  1EZO A;  3SEV A;  3RNN A;  4NWD A;  3CIJ A;  3LSW A;  4KCD A;  3C36 A;  4KPT A;  3MVX A;  4OEN A;  2UVI A;  3BBR A;  5B70 A;  1H44 A;  1P1W A;  1R1N A;  4I8C A;  5B7D A;  2DE4 A;  1B52 A;  1WDN A;  3L6G A;  3MBP A;  1IXI A;  2IA4 A;  3ILT B;  4GFR A;  3TEP A;  1XS5 A;  1I6B A;  3HCQ A;  1ZLQ A;  3PMX A;  2W7Y A;  3KGC A;  1MH4 A;  1NKX A;  4JB7 A;  4NF8 A;  1Z7N E;  3IB2 A;  2R71 A;  3SEY A;  3KSJ A;  4IO4 A;  2VHA A;  3L6H A;  1ZMG A;  3N26 A;  4RXL A;  1H45 A;  1MRP A;  5CMC A;  4ZS9 A;  4LVQ A;  3RUM A;  3E9X A;  1US5 A;  1JW1 A;  1P1U A;  1SW5 A;  2Z8E A;  3M3K A;  5DTB A;  5TP9 A;  1FQC A;  2VD3 A;  3OD7 A;  2I3V A;  3OXN A;  3IB0 A;  1FTM A;  4KHZ E;  5TU0 A;  2GHB A;  2XXV A;  1MH3 A;  5DEX A;  1PBQ A;  2F97 A;  1I6A A;  1LCT A;  1Y1M A;  2ONR A;  3U72 A;  3JV9 A;  4U4X A;  3TPA A;  2RC7 A;  4NE4 A;  2Q89 A;  3P7I A;  2DVC A;  4U1Z A;  1B7Z A;  3WAE A;  3H06 B;  4GLI A;  3CG3 A;  3VE1 B;  1QKB A;  2ZXT A;  1UIV A;  5HPQ A;  2Y7I A;  2DWA A;  4OFL A;  5BUU A;  4OFJ A;  1USY H;  1ANF A;  1LAX A;  2GFE A;  3VXB A;  3I3V A;  3SET A;  1M5B A;  3DP6 A;  1UQW A;  3SEW A;  4RNS A;  2F35 A;  1MXZ A;  4DE8 A;  3IR1 A;  4PFU A;  3HHG A;  2UVJ A;  4P0G A;  3DLN A;  1S9T A;  4X48 A;  3S9N C;  4NF8 B;  4YB7 A;  4YMA A;  1NNK A;  4KFQ A;  1LAH E;  1YCJ A;  3IO4 A;  1A8F A;  1MY2 A;  5EHM A;  2F7B A;  1TFA A;  1OLC A;  2D5W A;  1B3L A;  2XXT A;  3CFL A;  2QMW A;  3G3I A;  3QXM A;  4KYD A;  4YKK A;  3PPN A;  4PP0 A;  2Z8F A;  2PYY A;  5CMB A;  4F29 A;  3TTN A;  2O7I A;  3GBA A;  1HSL A;  3T66 A;  4O3B A;  4F39 A;  1P1Q A;  2A5S A;  5TP9 B;  2XXR A;  5AA3 A;  1J1N A;  1IXG A;  4ELP A;  1URS A;  3MVY A;  3QAX A;  3JZJ A;  4Q0C A;  3O97 A;  3LBS A;  1SW4 A;  4QFP A;  3BFT A;  2QMX A;  1M5C A;  3C32 A;  5K2X A;  1P1O A;  4BDM A;  1CB6 A;  4K3F A;  4H5G A;  2I0B A;  5DVF A;  1SI0 A;  2DOJ A;  1NFT A;  2NUV A;  3FXR A;  3U92 A;  4DLD A;  5CBR A;  3V8X B;  1IXH A;  4XTC Q;  3KFM A;  5HM4 B;  4JXI A;  3HO7 A;  3Q29 A;  1GV8 A;  1DOT A;  4KD5 A;  3VLV A;  2HCA A;  2I4B A;  4EQB A;  3GZG A;  5IKB A;  1SVX B;  2DWI A;  1FCK A;  3DP4 A;  3K00 A;  2AYS A;  2WKY A;  4R73 A;  4R9G A;  3V5A A;  3ZSF A;  5AA4 A;  3CI8 A;  2ZNS A;  1ELJ A;  2OWT A;  3PUZ E;  4EQ7 A;  3OEK A;  5DYH A;  1AL3 A;  3W9V A;  4G77 A;  3PD9 A;  4DIG A;  3EHS A;  3G3K A;  3SER A;  1JET A;  3PGF A;  3CVG A;  1MXX A;  1D9V A;  1POT A;  1N3X A;  5KDT B;  2UYF A;  1AOV A;  5FHN A;  4LON B;  4WED A;  3VVF A;  1FQA A;  2R9J A;  3K6X A;  4KQP A;  3LSL A;  4GIZ A;  1N0T A;  4DXB A;  4F31 B;  1MY1 A;  5F1Q A;  4G2Z A;  5ISU A;  2HQ0 A;  3H3G A;  4OER A;  4X1D A;  2E0S A;  2XX7 A;  3SKP A;  2RKM A;  3FV1 A;  4RA1 A;  4ELQ A;  4HCW A;  2HEU A;  2O68 A;  1OMP A;  4POX A;  3EPE A;  1M5F A;  1LB8 A;  2UXA A;  3RT8 A;  4ECF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...