4ELPA

Ferric binding protein in apo form 2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
TLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
publication title Crystal structure of ferric binding protein A
rcsb
source organism Thermus thermophilus
molecule tags Metal transport
total genus 109
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elpA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elpA02
2PX1A 2NXOA 3O6IA 4LUBA 3B6WA 3D4GA 3PGFA 1A7LA 2DWHA 2I3VA 2OJTA 4ELQA 1QULA 2ZYNA 4N07A 1NNFA 1H43A 1LBCA 1DPEA 3HCQA 2QS4A 3RT8A 3M3FA 2V3TA 3B6TA 1YTVA 5K2YA 5KZTA 4YKKA 4BDLA 5ITPA 4R75A 4ZZAA 4RYAA 1H3DA 4F3SA 1B4HA 1Q35A 3V5AA 1N76A 2E0SA 5I2KA 3FVNA 3K4UA 3PUVE 4OENA 3DP8A 3OO8A 3TEPA 4ZDMA 1Y4TA 4KQPA 2OWSA 1MM7A 3KBRA 4GF8A 3Q28A 1BKAA 3OEKA 5F1QA 3KN3A 1IZ1A 4R6KA 3ZKLA 4R9FA 2XHDA 2DWJA 1MQJA 3A3CA 3E13X 5JTYA 3Q27A 3CFLA 1QKAA 3CSBA 4XKRA 4RY1A 2V25A 2ONSA 1UIVA 4GD5A 5I2NB 4F1YA 3KSXA 1PDAA 4R2BA 3MC2A 3USDA 2H5YA 3CIJA 5KCJA 2HCAA 4QSDA 4I1DA 1B2HA 3IOWA 4EXKA 1B5HA 5BUUA 1QVSA 2AYSA 3I3VA 2RCAA 5CBSA 4ESWA 2XD2A 4YKJA 3BFTA 3FJGA 4AB5A 3MVWA 3E3KA 1OMPA 3G3GA 1B3HA 4P0GA 1UQWA 1MS7A 3VE1B 3VFJA 3O29A 3SKPA 4OEUA 3SESA 2Y7KA 1LAHE 4OXVA 2I48A 1FCKA 4H67A 3DM0A 1US5A 3M8UA 3ILTB 1JW4A 4H0WA 1AH5A 4H65A 4YB5A 1QJMA 3K00A 1B05A 2B65A 4E0WA 5FTIA 2I49A 3RTFB 4OYVA 1AOVA 4N6PA 1HSEA 5CMMA 4Q8RA 2GH9A 2DXYA 4Z0IA 1TXFA 2F7BA 2VHAA 5DEXA 4TLLB 2IEEA 1MQGA 1ZKBA 3O6GA 4KFQA 4G8MA 3FGSA 3LSWA 4JB7A 5AA3A 2ZYKA 4QFNA 4C0RA 3DLNA 5H8NA 1B0HA 5HM4B 1F9BA 3THIA 3LSXA 3EPEA 2ZYOA 1IQ7A 3MVXA 1EU8A 5EHMA 2RF1A 1GVCA 1SW2A 3IOVA 1B32A 3K6UA 2XXHA 1FTJA 4G77A 2RINA 1H76A 5CMKA 1JVXA 2XXIA 2HXWA 1B9JA 1B40A 1B0LA 4F1VA 4R74A 1JETA 3K0VA 4H5FA 4TLMB 3M3LA 4JSOA 4OHNA 1B58A 4EQBA 3PD9A 2O7UA 3PUXE 3L6HA 4ZEDA 1R9LA 1GTKA 3TAJA 4R6HA 4UACA 4JWXA 3TTKA 2PMSA 3RT6B 1UTBA 3ODBA 3UP9A 5EYFA 4ZZEA 4OTEA 2DWIA 4LATA 3R26A 1LGBC 5DVJA 4H8JA 4EQ7A 1USYE 4Q5TA 2Q2CA 5FTHA 3T9VA 1PB9A 1A8EA 3TYHA 3HN0A 3W9VA 4JBZA 2YLNA 3KSJA 5F7VA 3MZBA 4IO4A 1TT1A 3TPAA 1RYOA 3JV9A 3TTNA 4IB2A 2QJEA 2YPNA 4N13A 2F6GA 1LCTA 2QSXA 1D9VA 3O9PA 2HAVA 4FECA 4FAJA 1PBPA 4LZ5A 4JDFA 3KFMA 4BLAA 4ZEKA 1A40A 1MY1A 3QAXA 4OFOA 2UVIA 3TDJA 3W9WA 2AL4A 5A5XA 2Q2AA 2Y7PA 1QUJA 3ZSFA 4KD5A 5LOMA 3ZS6A 2OBGA 3FASA 3LSFB 1HSLA 2O51A 3C9HA 3QYTA 3P7IA 3K2DA 3BFUA 4C1TA 2OCUA 4OERA 5I56A 2A5TA 1JVYA 3MPKA 3R7XA 3W15C 5AE4A 4WEPA 2X7QA 3PPQA 4ELOA 1MH3A 2Z23A 4F39A 3GBBA 4DCXA 3PUYE 1N7WA 4AQ4A 4O3AA 2I0BA 3G3FA 1WDNA 4PFYA 3N26A 2REJA 2E1SA 1HSJA 1SW1A 5H8HA 3FXRA 4G2ZA 4KHZE 1SI1A 1US4A 2OZZA 2DWAA 2D5WA 1DTZA 1SBPA 3EHUA 5L9SA 3N5LA 3C32A 3MAMA 1URGA 4X9TA 1TWYA 3KJ7A 3H7MA 3VDFA 2HZKA 3MBPA 2AL5A 5L9MA 4R72A 1B7HA 4O3CA 3UIFA 5I58B 4H8IA 3QIMA 3EN3A 2B3FA 1QUKA 4G8HA 4KCCA 2V93A 3FZVA 2XXPA 1SYIA 3U94A 5TP9B 3RN8A 2XX9A 2R9JA 3JZJA 1B4ZA 4MFIA 5H8FB 2O7IA 4X48A 1P1NA 3V89B 4GOTA 3V8XB 1Y1ZA 3DP6A 1JEUA 4X1DA 1MY2A 1KWHA 3QUJA 4OFLA 5ICQA 4XKQA 1URDA 4HTGA 3S4UA 1Z7NE 1FQAA 3H03A 1I6QA 1MG1A 3HSTA 3E9XA 1LLSA 1MRPA 2FYIA 1EZOA 5HBCA 3SEXA 4YMAA 4RJZA 4U4XA 4KCDA 3MZ1A 1SW4A 1N3WA 4KYSA 2THIA 1AIVA 1SYHA 1NH7A 4BDNA 1I6BA 2P0SA 3BKIB 3KN7A 1A99A 3VXBA 4I8CA 3RPWA 2QRYA 3IOTA 4NWDA 4F3BA 1DSNA 3LR1A 5AA1A 2ZNTA 1R1NA 3MZ9A 4QFLA 4FJPA 3T9XB 1O63A 1CE2A 1MXWA 3U92A 1MQHA 4IO2A 1PB8A 2A5SA 3GLBA 4IGRA 2F78A 3DP4A 1SDXA 3UGWA 2Q88A 1PB7A 1BP5A 1P1WA 4BDRA 3T66A 1D9YA 3TQWA 1B3FA 3VLUA 3VLWA 4NF6A 2WKYA 3IB2A 2Q9TA 4ONYA 4FORA 1JEVA 1OVBA 3S9LC 5CBRA 3IO6A 3TCFA 1WODA 4YU0A 4NF4B 3OD7A 4GLIA 1SW5A 3HV1A 4U4SA 1YPNA 4QSEA 2HFBA 4P11A 3G7WA 4FATA 2Z22A 4OVJA 1XT8A 2REGA 3MP8A 4ZECA 2XXWA 5TPAA 4AB6A 5I57B 2VD3A 4OMBA 5FHOA 3QK6A 3K1MA 1GR2A 1IUDA 5J1DA 4QFKA 2I3WA 4HW8A 3C33A 2I4CA 4DCYA 5JEIA 2IA4A 2NUVA 1ATGA 3MVYA 2I4BA 4KR5A 3IR1A 1FW0A 3S9NC 3SDFA 1JW5A 4U21A 1J1NA 2DS9A 1VR5A 1R6ZA 1IEJA 4JWOA 2Y84A 2QMWA 3H6UA 3PU5A 3RY3A 3WAEA 4YZZA 4OWDA 2DQVA 2XXQA 5IKBA 4H1XA 5BWJA 4F31B 4JWYA 3SERA 1T0KA 2DVCA 2XD3A 1IXCA 3D4CA 4MLQA 3CG1A 1FQDA 3N94A 2O1LA 5I2KB 4G4PA 1NH8A 1B51A 1EH3A 2F5XA 1LBBA 3C4MA 5AA2A 3HPIA 4NF8A 1B1HA 5AA4B 4E0XA 1IXIA 4DXCA 4PETA 2VOZA 3TQLA 5DVFA 4QF9A 2Q89A 3LUYA 1A8FA 2NOOA 3FATA 3PUZE 3I5OA 4PP0A 3SETA 1FTOA 3R6UA 3FVKA 2DE3A 1OVTA 3CVGA 4RXLA 1DPPA 1LSTA 4UA8A 3SEUA 4BDOA 3KG2A 1JW1A 5ISUA 2QMXA 5ITOA 3B6QA 2V3UA 4BDQA 3TTMA 3T9UA 4RK2A 2D21A 4HCWA 5KCJB 2F36A 3LC8A 2PVUA 3KEIA 3TMGA 4GL8A 1P99A 3O28A 3DELB 4F19A 2F7CA 1LAXA 2UYEA 1MPCA 1B5JA 2I6EA 1MPBA 4Q0CA 3MUQA 4ESXA 1POTA 3OMBA 3GBAA 4ELRA 3VVEA 4ISUA 1XOCA 3CSGA 3FV2A 3PMVA 4HS7A 1MDQA 1O64A 5TU0A 4POXA 1DOTA 1ZJLA 2ZNUA 4NE4A 2PT1A 2DP8A 4XXUA 3H06B 4POWA 3KJTA 5CI5A 2RC8A 1IXGA 4DDDA 1FQFA 3SEYA 3QUFA 1VFEA 3TFLA 4U1OA 4F3GA 2F8DA 3IORA 2QPQA 3CFZA 3C35A 2DE4A 4TOZA 2XXVA 3TCGA 5I84A 3VVFA 3OSQA 1Y9UA 3KN8A 4DLDA 2H98A 3M3KA 1FQEA 4OESA 2XXRA 3CRBA 1Y20A 1PEBA 3QSLA 5I58A 4LZ8A 3O97A 2O69A 3KZGA 2Z8FA 3OO7A 4RA1A 5CMBA 5IAIA 1UTHA 1LFGA 1NMUA 4YB7A 2HZLA 5FHNA 2F6PA 5KDTA 4KYDA 4NEDA 2AIXA 2F34A 5H8QA 1P1UA 1FTMA 5TP9A 1I69A 4O3BA 3FVOA 4GFRA 4GRKA 5H8FA 3O2AA 3E4RA 3H4ZA 2Q8JA 1LFHA 4YMBA 2V84A 3N6TA 3Q25A 3G3JA 3RGYA 3H3GA 4MLVA 1SQYA 4XKPA 4QFPA 3OXNA 3VV5A 4F3PA 1ANFA 2HQ0A 1DTGA 3ZKKA 2R6GE 4DXBA 4EQ9A 2QS1A 4Q30B 4F2QA 2RKMA 1M5DA 1B5IA 2V3QA 1O7TA 1QW0A 3FXUA 2GFEA 3K6VA 1Y4CA 2W7YA 4GQOA 2BJJX 3CFXA 4R2FA 3Q26A 2DSFA 3GXAA 4GXAA 2VD2A 1II5A 1LAGE 1JNFA 3IB1A 3IOUA 2XXYA 3N6UA 1UTBB 4IO5A 4R6YA 1NNTA 1XHYA 4GL0A 4LA9A 4DXUA 4MF3A 2F7AA 1M5FA 4ZS9A 1H45A 1UIUA 4QSCA 5AA2D 2H4IA 4EF1A 1WVJA 4FEDA 3U93A 3PPPA 3KGCA 3V83A 3MW0A 5I2NA 1S50A 4GVOA 1MY0A 4NF4A 2XXUA 2DYXA 2G93A 3MP6A 1VFDA 4RK9A 1EZPA 4G8NA 3EF7A 5ELVA 3K6WA 4ND9A 4WEDA 4LZ7A 2QS2A 1XVYA 4F29A 1Y3NA 4LVQA 5I57A 5K2XA 3CI8A 4BDMA 4THIA 1PC3A 1LFIA 1FTLA 2ONRA 2OWTA 3PMXA 2YJPA 1H44A 4PFUA 3VVDA 2O1MA 2QL3A 4ZE9A 2O6AA 3ILUB 3PD8A 5A5XB 5L8DA 4YKIA 2LAOA 2Z8EA 4FIMA 2ANJA 3OO6A 4EXLA 4EDPA 2R71A 1Y3PA 2KLFA 1SVXB 2XXXA 1N3XA 3RLFE 5I56B 1NKXA 2A5TB 4MH5A 3K01A 4JXIA 4X1BA 4R9GA 3BBRA 3OSRA 1BIYA 4IO3A 3B7DA 1MY3A 1ZLQA 3A3UA 3EQ1A 4PFWA 4IY5A 4IO6A 2ZNSA 1LAFE 1P1OA 3ECRA 4QHQA 1XVXA 3TUSA 5H8HB 1Q1KA 3U8QA 1YAEA 3O6HA 2F97A 1LB8A 1MXYA 2DVZA 4XTCQ 5AA4A 2ONKE 1SI0A 1XC1A 1AMFA 5H8SA 2GHAA 5I59B 2H99A 1MQDA 4U22A 1MXVA 3SEVA 3IL1B 3RTWB 3FVGA 2ZMBA 2FNCA 3H6WA 1NNPA 4MBPA 5HPQA 3T96B 4IGTA 2M8CA 5B70A 1MQIA 1NL5A 1OQGA 3JYRA 1R9QA 3LSLA 3OOAA 4G68B 4U2RA 3OELA 4YAHX 1Z7ME 4NF5B 4DIGA 3C34A 3HHFA 1MPDA 2PT2A 1ZMGA 1Y3QA 3S9MC 1N84A 1B3EA 4KYEA 3IO4A 2ZYMA 1TFAA 3IB0A 4NTLA 1B3LA 3T22A 2RC9A 2OK2A 5CRYA 3PMWA 4ZEIA 3IJXB 1CB6A 4LONB 1ZBMA 2B3BA 2UVJA 3MQ9A 4ELPA 1B46A 4WKMA 3MWBA 2ESNA 4LP2B 4ZEFA 4M1VA 3T9HB 2RC7A 1B1XA 1N04A 3K1NA 2HEUA 1SD3A 1B7ZA 4K3FA 3PUWE 2X7PA 2Y7IA 4FEBA 1GGGA 1QKBA 4F2OA 1AL3A 3OO9A 3MVZA 4YB6A 1B6HA 4OQOA 4P0IA 2ALUA 4RPOA 3FUZA 1EZ9A 2UVHA 3H6VA 2X26A 2NWJA 4G68C 3RNNA 2CZLA 1IXHA 1M5EA 4NF6B 2D3IA 5JTYB 1RKMA 2XXTA 3EHSA 2Y7WA 2G29A 4F1UA 3SEWA 3EHTA 1TFDA 1GV8A 5B7DA 1FQBA 4QRZA 4EF2A 1M5BA 4XKNA 1OQHA 3FV1A 2PYYA 4XIGQ 1LB9A 3PPOA 1NNKA 3TELA 2Y7RA 5DVIA 4C1UA 3TZAA 3AXFA 3F11A 1B52A 2UYFA 5TPAB 3IAZA 4Z7EA 4M4GA 1MH4A 3S9EA 3LBSA 4LQ2A 2VP1A 3VLVA 5M2VA 3UORA 1D4NA 3G3KA 3UN6A 1I6AA 4NWCA 4OZ9A 1YCJA 3HO7A 3IK6B 1OIBA 4U1ZA 2P2AA 4ECFA 4I9DA 2I0CA 2OLBA 1POY1 2UXAA 3RQTA 5DT6A 3ONMA 4IY6A 2P1SA 5EHSA 1BLFA 4JSDA 1MY4A 4H6DA 2GRVA 1MXXA 3U72A 3K1PA 2Z8DA 2ZXTA 2NVUB 4OETA 1FQCA 1IIWA 3G3HA 4DZ1A 3T93B 4DE8A 4OEVA 1L5TA 5AA2B 4NF8B 3MPLA 2PBWA 3FJ7A 2VGQA 4U23A 3FD3A 3RUMA 3GZGA 2GHBA 2XX8A 4FE8A 1Y1MA 5JK4A 2ABHA 5DEXB 1B7UA 4PQJA 1D3KA 1P1QA 3U1OA 3FXQA 5CM6A 1S9TA 1QUIA 1MDP1 3KOSA 2H25A 3OEMA 3PPNA 5H8NB 3MJNA 4ZE8A 3I6VA 1JQFA 5L9OA 4QFOA 3TODA 2XX7A 2O68A 3TKDA 4YICA 1IITA 2RCBA 1OLAA 3IX1A 2DXRA 3IJOB 2H9BA 3PPRA 2UVGA 5CMCA 3O66A 3QXMA 2I58A 3S2VA 4GWOA 3L6GA 4TQUQ 3OENA 1MXZA 4I62A 4L17A 3H6TA 1B3GA 3CG3A 1XS5A 3G3IA 2QS3A 5CC2A 1A54A 4H5GA 4LQ5A 1OLCA 4WXJA 3C36A 3FJMA 3Q29A 4GIZA 1ZTYA 2DOJA 3K02A 3A09A 4YKPA 3TTLA 4F22A 4PFTA 3HHGA 3KOTA 3MP1A 5I59A 3TCHA 3UA8A 1ELJA 5ICTA 2CMOA 2HAUA 4R73A 1N0TA 1USYH 1S7YA 1N7XA 3CR9A 5DTBA 1A55A 1MM6A 1PBQA 5FHMA 1MXUA 4F18A 4RNSA 2FA7A 2F35A 5DYHA 1VE4A 4EUOA 4PE5B 3VXCA 3PV0E 1RYXA 4IO7A 3C31A 4G68A 3UK4A 2DE2A 4NMYA 1BTJA 4NF5A 3WAFA 1ZU0A 4GXSB 1ZIUA 1DMBA 1UTHB 3K6XA 3FIRA 1NFTA 4HCYA 4ZEBA 1LCFA 4KPTA 1URSA 5KDTB 4KI0E 4RPNA 1VSOA 5H8QB 3TTRA 1M5CA 4OFJA 1FTKA 2O84X
chains in the Genus database with same CATH superfamily
2PX1A 2NXOA 3O6IA 4LUBA 1FPDA 3B6WA 3D4GA 3PGFA 1A7LA 2DWHA 2FIXA 2I3VA 2OJTA 4ELQA 1QULA 2ZYNA 4N07A 1NNFA 1H43A 1LBCA 2P3VA 1DPEA 3HCQA 2QS4A 3LV0A 3RT8A 3M3FA 4O94A 2V3TA 1DK4A 3B6TA 1YTVA 5K2YA 5KZTA 4YKKA 4BDLA 5ITPA 4R75A 4ZZAA 4RYAA 1H3DA 4F3SA 1B4HA 1Q35A 3V5AA 1LEVA 1N76A 2E0SA 5I2KA 3B8BA 5DW8A 3FVNA 3K4UA 5ET7A 3PUVE 4OENA 4NAPA 3DP8A 3OO8A 1VDWA 3TEPA 4ZDMA 1Y4TA 4KQPA 2OWSA 1MM7A 3KBRA 4GF8A 3Q28A 2XWOA 4FBPA 1BKAA 3OEKA 5F1QA 3KN3A 4XF5A 1IZ1A 4R6KA 4GX3A 3ZKLA 4R9FA 4GBVA 1NV1A 2XHDA 2DWJA 2P3NA 1MQJA 3A3CA 1FBEA 3E13X 5JTYA 3Q27A 3RPLB 3CFLA 1QKAA 3CSBA 4XKRA 4RY1A 2V25A 2ONSA 1D9QA 1UIVA 4GD5A 5I2NB 4F1YA 3KSXA 1PDAA 4R2BA 5ESYA 3MC2A 3USDA 4H45A 2H5YA 3CIJA 5KCJA 2HCAA 4QSDA 4I1DA 4GWZA 1B2HA 3IOWA 4EXKA 2B4LA 1B5HA 5BUUA 1QVSA 2AYSA 3I3VA 2PFYA 2RCAA 5CBSA 4ESWA 2XD2A 4H46A 4YKJA 3BFTA 3FJGA 4AB5A 3MVWA 3E3KA 1OMPA 3G3GA 1B3HA 4P0GA 1EYIA 1UQWA 1MS7A 3VE1B 3VFJA 1Q9DA 3O29A 3SKPA 5IGAA 4OEUA 3SESA 2Y7KA 1LAHE 4OXVA 2I48A 1FCKA 4H67A 4P1EA 4MNPA 3DM0A 1LBVA 1US5A 3M8UA 2FBPA 1NUXA 3ILTB 1JW4A 4H0WA 1G0IA 1AH5A 4H65A 4YB5A 1QJMA 3K00A 1B05A 2B65A 2Q74A 3LUZA 4E0WA 5FTIA 1NUYA 2I49A 1EYKA 3RTFB 4OYVA 1AOVA 4N6PA 1HSEA 4NQ8A 5CMMA 4Q8RA 2GH9A 2DXYA 4Z0IA 2XWIA 1TXFA 2F7BA 2VHAA 1KA1A 5DEXA 4TLLB 2IEEA 1MQGA 1ZKBA 3O6GA 4KFQA 4G8MA 3FGSA 3LSWA 3ISPA 4JB7A 5AA3A 2ZYKA 4QBAA 4QFNA 3DLNA 4C0RA 5H8NA 1B0HA 2CZKA 5HM4B 1F9BA 3THIA 3LSXA 3EPEA 2ZYOA 1IQ7A 1YYZA 4PAIA 3MVXA 1EU8A 5EHMA 2RF1A 1GVCA 1SW2A 3IOVA 1B32A 4GBWA 3K6UA 2XXHA 1CNQA 1FTJA 4G77A 2RINA 2ZZWA 1H76A 5CMKA 1JVXA 2XXIA 2HXWA 4PBQA 1B9JA 1B40A 1B0LA 4F1VA 4R74A 1JETA 3K0VA 4H5FA 4TLMB 1FJ9A 3M3LA 5EQ9A 4JSOA 4OHNA 1B58A 4EQBA 3PD9A 2O7UA 3HFUA 3PUXE 3L6HA 1FBPA 4ZEDA 1R9LA 1GTKA 1IMBA 3TAJA 4N8YA 4R6HA 4PFRA 4UACA 4JWXA 3TTKA 2PMSA 3RT6B 1UTBA 4N6DA 3ODBA 3UP9A 5EYFA 4ZZEA 4OTEA 2DWIA 4LATA 3R26A 1LGBC 5EYGA 5DVJA 4H8JA 4EQ7A 1USYE 4Q5TA 1G0HA 2Q2CA 2WYPA 5FTHA 3T9VA 1PB9A 1A8EA 4PGNA 3TYHA 1NUZA 3HN0A 3W9VA 4GWYA 4JBZA 2YLNA 3KSJA 5F7VA 3MZBA 4I3EA 4IO4A 1TT1A 3TPAA 1RYOA 3JV9A 3TTNA 4IB2A 2QJEA 2YPNA 4N13A 2F6GA 1LCTA 2OWZA 2QSXA 1D9VA 3O9PA 2HAVA 4FECA 2QVUA 2R8TA 4FAJA 1PBPA 4LZ5A 4JDFA 3KFMA 4BLAA 4ZEKA 1A40A 1MY1A 3QAXA 4OFOA 2UVIA 3TDJA 4AS4A 3W9WA 2AL4A 2B4MA 5A5XA 2Q2AA 2PCRA 2Y7PA 1QUJA 3ZSFA 4KD5A 5LOMA 2HPGA 3ZS6A 2XWKA 2OBGA 4N17A 3FASA 3LSFB 1HSLA 2O51A 3C9HA 3QYTA 3P7IA 3K2DA 2V4CA 3BFUA 4C1TA 2OCUA 4OERA 5I56A 2A5TA 1JVYA 3MPKA 3R7XA 5I3SA 3W15C 1IMEA 5AE4A 4PAFA 4WEPA 2X7QA 3PPQA 4ELOA 1MH3A 4NG7A 2Z23A 4F39A 3GBBA 4DCXA 3PUYE 1N7WA 4AQ4A 4NX1A 4O3AA 2I0BA 1IMAA 3G3FA 1WDNA 4PFYA 3N26A 4PCDA 1LBZA 2REJA 2E1SA 1HSJA 1RDYA 1SW1A 5H8HA 4QXDA 3FXRA 4G2ZA 4KHZE 5A5LA 1SI1A 1US4A 2OZZA 2DWAA 2D5WA 1DTZA 1SBPA 3EHUA 5L9SA 3N5LA 3C32A 2FIEA 4PTKA 4GWSA 4AS5A 3MAMA 1URGA 4X9TA 1TWYA 3KJ7A 3H7MA 3VDFA 2HZKA 2Y5LA 3MBPA 2AL5A 5L9MA 4R72A 3RPLA 1B7HA 4O3CA 3UIFA 1NV6A 5I58B 4H8IA 3BIGA 3QIMA 3KBZA 4HXVA 2BJIA 3EN3A 2B3FA 4MNIA 1QUKA 4G8HA 4P47A 3E78A 4KCCA 2V93A 3FZVA 2XXPA 1SYIA 3U94A 5TP9B 3RN8A 2XX9A 2R9JA 3JZJA 1B4ZA 4MFIA 1LBXA 5H8FB 2O7IA 4X48A 1P1NA 3V89B 4PBHA 4GOTA 3V8XB 1Y1ZA 3DP6A 4MJOA 4XFEA 1JEUA 4XEQA 4X1DA 1MY2A 1KWHA 3QUJA 4OFLA 5ICQA 4NGUA 2WX9A 4XKQA 1URDA 4HTGA 3S4UA 1Z7NE 1FQAA 3H03A 5EYHA 2WEFA 1I6QA 1MG1A 3HSTA 3E9XA 2MKZA 5IZZA 1LLSA 1MRPA 2FYIA 1EZOA 5HBCA 3SEXA 4YMAA 4RJZA 4U4XA 4KCDA 4N91A 3MZ1A 1SW4A 1N3WA 4KYSA 2THIA 1AIVA 4HE2A 1SYHA 1NH7A 4BDNA 1I6BA 2P0SA 3BKIB 3KN7A 1A99A 3VXBA 4I8CA 3RPWA 2QRYA 3IOTA 5T3JA 4NWDA 4F3BA 1DSNA 3LR1A 1DBZA 5AA1A 2ZNTA 1R1NA 3MZ9A 4QFLA 4FJPA 3T9XB 1O63A 1CE2A 1MXWA 3U92A 1MQHA 4IO2A 1PB8A 2A5SA 3GLBA 4IGRA 2F78A 3DP4A 3U65A 1SDXA 3UGWA 1FTAA 2Q88A 1PB7A 1BP5A 1P1WA 1FPIA 4BDRA 3T66A 1D9YA 3TQWA 1B3FA 3VLUA 3VLWA 4NF6A 2WKYA 3IB2A 2Q9TA 4ONYA 4FORA 2FVZA 1JEVA 2CEYA 3A29A 1OVBA 3S9LC 5CBRA 3IO6A 3TCFA 1WODA 4YU0A 4NF4B 1FRPA 2ZZXA 3OD7A 4GLIA 1SW5A 3HV1A 4U4SA 1YPNA 4QSEA 1FPGA 2HFBA 4P11A 4PE3A 3G7WA 2Z22A 4FATA 3IFAA 1XT8A 4OVJA 4P8BA 2REGA 3MP8A 4ZECA 5IZ3A 2XXWA 5TPAA 4AB6A 5I57B 2QFLA 2VD3A 4OMBA 5FHOA 4PFBA 3QK6A 2HXRA 3K1MA 2L5VA 1GR2A 1IUDA 5J1DA 4QFKA 2I3WA 4HW8A 3C33A 2I4CA 4DCYA 5JEIA 2IA4A 2NUVA 4PAKA 1ATGA 3MVYA 2I4BA 4KR5A 3IR1A 1FW0A 2PFZA 3S9NC 3SDFA 1JW5A 4U21A 1J1NA 2DS9A 1VR5A 1R6ZA 1IEJA 4O7MA 4X04A 4JWOA 2Y84A 2QMWA 3H6UA 4G61A 3PU5A 3RY3A 3WAEA 4MEVA 4YZZA 4OWDA 1SPIA 2DQVA 2XXQA 3KC0A 5IKBA 4H1XA 4JVDA 5BWJA 4F31B 4JWYA 3SERA 1NV5A 1T0KA 2DVCA 2XD3A 1IXCA 3D4CA 4MLQA 2Y5KA 1QGXA 3CG1A 1FQDA 3N94A 2O1LA 4GX4A 5I2KB 4G4PA 1NH8A 1B51A 1EH3A 1NV7A 2F5XA 1LBBA 3KC1A 1NV2A 3C4MA 3GYYA 2VPNA 5AA2A 3HPIA 4NF8A 1B1HA 5AA4B 4E0XA 2OX3A 1IXIA 4DXCA 4PETA 2VOZA 3TQLA 5DVFA 4QF9A 2WYKA 2Q89A 3LUYA 1A8FA 2NOOA 2XXKA 3FATA 3PUZE 3I5OA 4PP0A 3SETA 1FTOA 3R6UA 3FVKA 2DE3A 4JVIA 1OVTA 3CVGA 4RXLA 1DPPA 1LSTA 4UA8A 3SEUA 4BDOA 3KG2A 1JW1A 1KA0A 5ISUA 2QMXA 5ITOA 3B6QA 2V3UA 4BDQA 3SZPA 3TTMA 3T9UA 4RK2A 2D21A 3FBPA 5IM2A 4HCWA 5KCJB 2F36A 3LC8A 2PVUA 3KEIA 3TMGA 4GL8A 1P99A 3NOHA 4OA4A 4N6KA 1K9ZA 3O28A 3DELB 4F19A 2F7CA 1LAXA 2UYEA 3MSTA 1MPCA 1B5JA 2I6EA 1MPBA 3QMFA 4Q0CA 4X8RA 3MUQA 4ESXA 1POTA 3OMBA 3GBAA 4ELRA 3VVEA 4GWWA 1XI6A 4I40A 4ISUA 5I7IA 3B50A 1XOCA 4MCOA 3CSGA 3FV2A 3PMVA 4HS7A 1MDQA 1O64A 4P9KA 5TU0A 4POXA 1DOTA 1ZJLA 2ZNUA 3PTYA 4NE4A 4O7IA 2QVRA 2PT1A 2DP8A 4XXUA 3H06B 4POWA 3KJTA 5CI5A 2RC8A 1IXGA 4DDDA 1FQFA 3SEYA 3QUFA 1VFEA 3TFLA 4U1OA 4F3GA 2F8DA 3IORA 2QPQA 3CFZA 3C35A 2DE4A 4TOZA 2XXVA 1NUWA 3TCGA 5I84A 4JVCA 3CHGA 3VVFA 3OSQA 1Y9UA 3KN8A 4DLDA 1RDZA 2H98A 2XA5A 3M3KA 4OVSA 1FQEA 1IMDA 4OESA 2XXRA 3CRBA 1Y20A 1PEBA 3QSLA 1FBGA 5I58A 4LZ8A 3O97A 2O69A 3KZGA 2Z8FA 1FBCA 3OO7A 4MX6A 5I5PA 4GX6A 4RA1A 5CMBA 5IAIA 1UTHA 1LFGA 1NMUA 4YB7A 4I3YA 2HZLA 5FHNA 2F6PA 5KDTA 4KYDA 4NEDA 1NV0A 2AIXA 2F34A 4N81A 5H8QA 1P1UA 1FTMA 5TP9A 1I69A 4O3BA 3FVOA 5EQ7A 4GFRA 4GRKA 5H8FA 3O2AA 3E4RA 3H4ZA 2Q8JA 1LFHA 4YMBA 2V84A 3N6TA 3Q25A 3G3JA 3RGYA 4LN5A 3H3GA 4MLVA 5ET8A 1FPFA 1DCUA 1SQYA 4XKPA 4QFPA 3OXNA 3VV5A 4F3PA 1ANFA 2HQ0A 1DTGA 1IMFA 3ZKKA 2R6GE 4DXBA 4EQ9A 2QS1A 4Q30B 4F2QA 2RKMA 2ZZVA 1FPEA 1M5DA 1B5IA 2V3QA 1O7TA 1QW0A 3FXUA 2GFEA 4UABA 1Y4CA 1LBYA 2W7YA 3K6VA 4N4UA 4GQOA 2BJJX 3CFXA 5ET6A 4R2FA 3Q26A 2DSFA 3GXAA 4GXAA 2VD2A 1II5A 1LAGE 1JNFA 3IB1A 3IOUA 1YXIA 2XXYA 3N6UA 1UTBB 4IO5A 4R6YA 1NNTA 1XHYA 4GL0A 4LA9A 2DDKA 4DXUA 1NI9A 4MF3A 2F7AA 1M5FA 4ZS9A 1H45A 1UIUA 4QSCA 1FPBA 2KR0A 5AA2D 4DI4B 3E79A 2H4IA 1FBFA 4EF1A 1WVJA 4PGPA 4FEDA 3U93A 3PPPA 3KGCA 3V83A 3MW0A 1FBDA 5I2NA 2WBBA 1S50A 4GVOA 1MY0A 4NF4A 2XXUA 2DYXA 2G93A 3MP6A 1VFDA 4RK9A 1EZPA 4G8NA 3EF7A 5ELVA 5J16A 3K6WA 4ND9A 4WEDA 4LZ7A 3RYDA 4IR8A 2QS2A 2XWVA 2Q8MA 1XVYA 4F29A 1Y3NA 4LVQA 5I57A 5K2XA 3CI8A 4PDHA 4BDMA 4THIA 4P1LA 1PC3A 1LFIA 1FTLA 1NV4A 2ONRA 2OWTA 3PMXA 2YJPA 1H44A 4PFUA 3VVDA 2O1MA 2QL3A 4ZE9A 2O6AA 3ILUB 3PD8A 5A5XB 5L8DA 4YKIA 2LAOA 2Z8EA 4FIMA 2ANJA 3OO6A 4MNCA 1NV3A 4EXLA 4EDPA 2R71A 1Y3PA 2KLFA 1SVXB 2XXXA 1N3XA 3RLFE 5I56B 1NKXA 2A5TB 4MH5A 3K01A 4JXIA 4X1BA 4R9GA 3BBRA 3OSRA 1BIYA 4IO3A 3B7DA 1MY3A 1ZLQA 3A3UA 3EQ1A 4PFWA 4IY5A 4IO6A 2ZNSA 4P56A 1LAFE 1P1OA 3ECRA 4QHQA 1YZ0A 1XVXA 2KQZA 4MIJA 2F3DA 3TUSA 5H8HB 1Q1KA 3U8QA 1YAEA 3O6HA 4PC9A 2F97A 2CZHA 1LB8A 1MXYA 2DVZA 4GWXA 4XTCQ 5AA4A 2ONKE 1SI0A 1FJ6A 1XC1A 3FXBA 1AMFA 5H8SA 2GHAA 5I59B 4OVPA 2H99A 1MQDA 4U22A 2CZIA 1MXVA 3SEVA 3IL1B 3RTWB 3FVGA 2ZMBA 2FNCA 3H6WA 1NNPA 4MBPA 5HPQA 3T96B 4IGTA 2M8CA 1INPA 5B70A 4NN3A 1MQIA 1NL5A 1OQGA 3ROJA 3JYRA 1JP4A 1R9QA 3LSLA 3OOAA 1RDXA 1LBWA 4G68B 2GQ1A 4U2RA 3OELA 3IFCA 4YAHX 1Z7ME 4NF5B 4DIGA 3C34A 3HHFA 1MPDA 2PT2A 1ZMGA 3T1BA 1Y3QA 3S9MC 1N84A 1B3EA 2VPOA 4KYEA 3IO4A 4OVTA 2ZYMA 1TFAA 5EQAA 3IB0A 4NTLA 1B3LA 3T22A 2RC9A 2OK2A 5CRYA 3PMWA 4O8MA 4ZEIA 3IJXB 1CB6A 4OVRA 4LONB 1ZBMA 2B3BA 2UVJA 3MQ9A 4ELPA 1B46A 1IMCA 4WKMA 3MWBA 2ESNA 4HE1A 5LDZA 4P3LA 4LP2B 4ZEFA 4PFIA 4MHFA 4M1VA 1FSAA 3T9HB 2RC7A 1B1XA 4MAGA 4KXPA 1N04A 3K1NA 2HEUA 1SD3A 1B7ZA 4K3FA 3PUWE 2X7PA 2Y7IA 4FEBA 1GGGA 1QKBA 4F2OA 1AL3A 3OO9A 2CEXA 3MVZA 4YB6A 1B6HA 4OQOA 4P0IA 2ALUA 4RPOA 3FUZA 1EZ9A 2UVHA 3H6VA 2X26A 2NWJA 4G68C 3RNNA 2CZLA 1IXHA 1M5EA 4NF6B 2D3IA 5JTYB 1RKMA 2XXTA 3EHSA 2Y7WA 3BIHA 5IZ1A 2JJKA 2G29A 4F1UA 5FBPA 4PF6A 3SEWA 3EHTA 1TFDA 1GV8A 4NHBA 5B7DA 1FQBA 4QRZA 4EF2A 1M5BA 4XKNA 1OQHA 3FV1A 2PYYA 4XIGQ 1LB9A 3PPOA 1NNKA 3TELA 2Y7RA 2FHYA 5DVIA 4C1UA 1K9YA 3TZAA 3AXFA 3D1RA 3F11A 5IZ3B 1B52A 2UYFA 5TPAB 3IAZA 4Z7EA 4M4GA 1MH4A 3S9EA 3LBSA 5ET5A 4LQ2A 2VP1A 3VLVA 5M2VA 3UORA 1D4NA 3G3KA 3UN6A 3EKIA 4GWUA 1I6AA 4NWCA 4OZ9A 1YCJA 3HO7A 3IK6B 5EQ8A 1OIBA 4U1ZA 2P2AA 4ECFA 4I9DA 5LTCA 2I0CA 2OLBA 1POY1 2UXAA 3RQTA 5DT6A 3ONMA 4IY6A 2P1SA 5EHSA 1BLFA 4JSDA 1MY4A 4H6DA 5F24A 2GRVA 1MXXA 3U72A 3K1PA 2Z8DA 2ZXTA 2NVUB 4OETA 1FQCA 1IIWA 3G3HA 1KZ8A 4DZ1A 3T93B 4DE8A 4OEVA 1L5TA 5AA2B 4NF8B 3MPLA 2PBWA 3FJ7A 2VGQA 4U23A 3FD3A 3RUMA 3GZGA 2GHBA 2XX8A 4FE8A 2WBDA 1Y1MA 4PF8A 5JK4A 2ABHA 4OVQA 5DEXB 1B7UA 4PQJA 1D3KA 1FPKA 1P1QA 3U1OA 3T0JA 3FXQA 4MMPA 5CM6A 1S9TA 1QUIA 1MDP1 3KOSA 2H25A 3OEMA 3PPNA 5H8NB 3MJNA 1BK4A 4ZE8A 3I6VA 4HE0A 1JQFA 5L9OA 4NF0A 4QFOA 2VT5A 3TODA 2HHMA 2XX7A 2O68A 3TKDA 1FPJA 4YICA 1IITA 2RCBA 2QVVA 1OLAA 3IX1A 2DXRA 3IJOB 2H9BA 3PPRA 4N8GA 2UVGA 5CMCA 3O66A 3QXMA 3MYUA 4PDDA 2I58A 3S2VA 4N15A 4GWOA 3L6GA 4TQUQ 3OENA 1MXZA 1EYJA 4I62A 4L17A 1FPLA 3H6TA 1B3GA 3CG3A 1XS5A 3G3IA 2QS3A 5CC2A 1A54A 4H5GA 1FBHA 4LQ5A 1OLCA 4WXJA 3C36A 3FJMA 3Q29A 4GIZA 1ZTYA 2DOJA 3K02A 3A09A 4YKPA 3TTLA 4F22A 4PFTA 3HHGA 3KOTA 4OANA 3MP1A 5I59A 3TCHA 3UA8A 1ELJA 5ICTA 2CMOA 2HAUA 4R73A 1N0TA 1USYH 4DI3D 1S7YA 1N7XA 3CR9A 5DTBA 1A55A 1MM6A 1PBQA 5FHMA 1MXUA 4RNSA 4F18A 2FA7A 2F35A 5DYHA 1VE4A 4EUOA 4PE5B 3VXCA 3PV0E 1RYXA 4IO7A 3C31A 4G68A 3UK4A 2DE2A 4NMYA 1BTJA 4NF5A 3WAFA 1ZU0A 4GXSB 1ZIUA 1DMBA 1UTHB 3K6XA 3FIRA 1NFTA 4HCYA 4ZEBA 1LCFA 4KPTA 1URSA 5KDTB 1AWBA 4KI0E 4RPNA 1VSOA 5H8QB 3TTRA 2F3BA 1M5CA 4OFJA 1FTKA 2O84X
chains in the Genus database with same CATH topology
2PX1A 2NXOA 3O6IA 4LUBA 3B6WA 3D4GA 3PGFA 1A7LA 2DWHA 2I3VA 2OJTA 4ELQA 1QULA 2ZYNA 4N07A 1NNFA 1H43A 1LBCA 1DPEA 3HCQA 2QS4A 3RT8A 3M3FA 2V3TA 3B6TA 1YTVA 5K2YA 5KZTA 4YKKA 4BDLA 5ITPA 4R75A 4ZZAA 4RYAA 1H3DA 4F3SA 1B4HA 1Q35A 3V5AA 1N76A 2E0SA 5I2KA 3FVNA 3K4UA 3PUVE 4OENA 3DP8A 3OO8A 3TEPA 4ZDMA 1Y4TA 4KQPA 2OWSA 1MM7A 3KBRA 4GF8A 3Q28A 1BKAA 3OEKA 5F1QA 3KN3A 1IZ1A 4R6KA 3ZKLA 4R9FA 2XHDA 2DWJA 1MQJA 3A3CA 3E13X 5JTYA 3Q27A 3CFLA 1QKAA 3CSBA 4XKRA 4RY1A 2V25A 2ONSA 1UIVA 4GD5A 5I2NB 4F1YA 3KSXA 1PDAA 4R2BA 3MC2A 3USDA 2H5YA 3CIJA 5KCJA 2HCAA 4QSDA 4I1DA 1B2HA 3IOWA 4EXKA 1B5HA 5BUUA 1QVSA 2AYSA 3I3VA 2RCAA 5CBSA 4ESWA 2XD2A 4YKJA 3BFTA 3FJGA 4AB5A 3MVWA 3E3KA 1OMPA 3G3GA 1B3HA 4P0GA 1UQWA 1MS7A 3VE1B 3VFJA 3O29A 3SKPA 4OEUA 3SESA 2Y7KA 1LAHE 4OXVA 2I48A 1FCKA 4H67A 3DM0A 1US5A 3M8UA 3ILTB 1JW4A 4H0WA 1AH5A 4H65A 4YB5A 1QJMA 3K00A 1B05A 2B65A 4E0WA 5FTIA 2I49A 3RTFB 4OYVA 1AOVA 4N6PA 1HSEA 5CMMA 4Q8RA 2GH9A 2DXYA 4Z0IA 1TXFA 2F7BA 2VHAA 5DEXA 4TLLB 2IEEA 1MQGA 1ZKBA 3O6GA 4KFQA 4G8MA 3FGSA 3LSWA 4JB7A 5AA3A 2ZYKA 4QFNA 4C0RA 3DLNA 5H8NA 1B0HA 5HM4B 1F9BA 3THIA 3LSXA 3EPEA 2ZYOA 1IQ7A 3MVXA 1EU8A 5EHMA 2RF1A 1GVCA 1SW2A 3IOVA 1B32A 3K6UA 2XXHA 1FTJA 4G77A 2RINA 1H76A 5CMKA 1JVXA 2XXIA 2HXWA 1B9JA 1B40A 1B0LA 4F1VA 4R74A 1JETA 3K0VA 4H5FA 4TLMB 3M3LA 4JSOA 4OHNA 1B58A 4EQBA 3PD9A 2O7UA 3PUXE 3L6HA 4ZEDA 1R9LA 1GTKA 3TAJA 4R6HA 4UACA 4JWXA 3TTKA 2PMSA 3RT6B 1UTBA 3ODBA 3UP9A 5EYFA 4ZZEA 4OTEA 2DWIA 4LATA 3R26A 1LGBC 5DVJA 4H8JA 4EQ7A 1USYE 4Q5TA 2Q2CA 5FTHA 3T9VA 1PB9A 1A8EA 3TYHA 3HN0A 3W9VA 4JBZA 2YLNA 3KSJA 5F7VA 3MZBA 4IO4A 1TT1A 3TPAA 1RYOA 3JV9A 3TTNA 4IB2A 2QJEA 2YPNA 4N13A 2F6GA 1LCTA 2QSXA 1D9VA 3O9PA 2HAVA 4FECA 4FAJA 1PBPA 4LZ5A 4JDFA 3KFMA 4BLAA 4ZEKA 1A40A 1MY1A 3QAXA 4OFOA 2UVIA 3TDJA 3W9WA 2AL4A 5A5XA 2Q2AA 2Y7PA 1QUJA 3ZSFA 4KD5A 5LOMA 3ZS6A 2OBGA 3FASA 3LSFB 1HSLA 2O51A 3C9HA 3QYTA 3P7IA 3K2DA 3BFUA 4C1TA 2OCUA 4OERA 5I56A 2A5TA 1JVYA 3MPKA 3R7XA 3W15C 5AE4A 4WEPA 2X7QA 3PPQA 4ELOA 1MH3A 2Z23A 4F39A 3GBBA 4DCXA 3PUYE 1N7WA 4AQ4A 4O3AA 2I0BA 3G3FA 1WDNA 4PFYA 3N26A 2REJA 2E1SA 1HSJA 1SW1A 5H8HA 3FXRA 4G2ZA 4KHZE 1SI1A 1US4A 2OZZA 2DWAA 2D5WA 1DTZA 1SBPA 3EHUA 5L9SA 3N5LA 3C32A 3MAMA 1URGA 4X9TA 1TWYA 3KJ7A 3H7MA 3VDFA 2HZKA 3MBPA 2AL5A 5L9MA 4R72A 1B7HA 4O3CA 3UIFA 5I58B 4H8IA 3QIMA 3EN3A 2B3FA 1QUKA 4G8HA 4KCCA 2V93A 3FZVA 2XXPA 1SYIA 3U94A 5TP9B 3RN8A 2XX9A 2R9JA 3JZJA 1B4ZA 4MFIA 5H8FB 2O7IA 4X48A 1P1NA 3V89B 4GOTA 3V8XB 1Y1ZA 3DP6A 1JEUA 4X1DA 1MY2A 1KWHA 3QUJA 4OFLA 5ICQA 4XKQA 1URDA 4HTGA 3S4UA 1Z7NE 1FQAA 3H03A 1I6QA 1MG1A 3HSTA 3E9XA 1LLSA 1MRPA 2FYIA 1EZOA 5HBCA 3SEXA 4YMAA 4RJZA 4U4XA 4KCDA 3MZ1A 1SW4A 1N3WA 4KYSA 2THIA 1AIVA 1SYHA 1NH7A 4BDNA 1I6BA 2P0SA 3BKIB 3KN7A 1A99A 3VXBA 4I8CA 3RPWA 2QRYA 3IOTA 4NWDA 4F3BA 1DSNA 3LR1A 5AA1A 2ZNTA 1R1NA 3MZ9A 4QFLA 4FJPA 3T9XB 1O63A 1CE2A 1MXWA 3U92A 1MQHA 4IO2A 1PB8A 2A5SA 3GLBA 4IGRA 2F78A 3DP4A 1SDXA 3UGWA 2Q88A 1PB7A 1BP5A 1P1WA 4BDRA 3T66A 1D9YA 3TQWA 1B3FA 3VLUA 3VLWA 4NF6A 2WKYA 3IB2A 2Q9TA 4ONYA 4FORA 1JEVA 1OVBA 3S9LC 5CBRA 3IO6A 3TCFA 1WODA 4YU0A 4NF4B 3OD7A 4GLIA 1SW5A 3HV1A 4U4SA 1YPNA 4QSEA 2HFBA 4P11A 3G7WA 4FATA 2Z22A 4OVJA 1XT8A 2REGA 3MP8A 4ZECA 2XXWA 5TPAA 4AB6A 5I57B 2VD3A 4OMBA 5FHOA 3QK6A 3K1MA 1GR2A 1IUDA 5J1DA 4QFKA 2I3WA 4HW8A 3C33A 2I4CA 4DCYA 5JEIA 2IA4A 2NUVA 1ATGA 3MVYA 2I4BA 4KR5A 3IR1A 1FW0A 3S9NC 3SDFA 1JW5A 4U21A 1J1NA 2DS9A 1VR5A 1R6ZA 1IEJA 4JWOA 2Y84A 2QMWA 3H6UA 3PU5A 3RY3A 3WAEA 4YZZA 4OWDA 2DQVA 2XXQA 5IKBA 4H1XA 5BWJA 4F31B 4JWYA 3SERA 1T0KA 2DVCA 2XD3A 1IXCA 3D4CA 4MLQA 3CG1A 1FQDA 3N94A 2O1LA 5I2KB 4G4PA 1NH8A 1B51A 1EH3A 2F5XA 1LBBA 3C4MA 5AA2A 3HPIA 4NF8A 1B1HA 5AA4B 4E0XA 1IXIA 4DXCA 4PETA 2VOZA 3TQLA 5DVFA 4QF9A 2Q89A 3LUYA 1A8FA 2NOOA 3FATA 3PUZE 3I5OA 4PP0A 3SETA 1FTOA 3R6UA 3FVKA 2DE3A 1OVTA 3CVGA 4RXLA 1DPPA 1LSTA 4UA8A 3SEUA 4BDOA 3KG2A 1JW1A 5ISUA 2QMXA 5ITOA 3B6QA 2V3UA 4BDQA 3TTMA 3T9UA 4RK2A 2D21A 4HCWA 5KCJB 2F36A 3LC8A 2PVUA 3KEIA 3TMGA 4GL8A 1P99A 3O28A 3DELB 4F19A 2F7CA 1LAXA 2UYEA 1MPCA 1B5JA 2I6EA 1MPBA 4Q0CA 3MUQA 4ESXA 1POTA 3OMBA 3GBAA 4ELRA 3VVEA 4ISUA 1XOCA 3CSGA 3FV2A 3PMVA 4HS7A 1MDQA 1O64A 5TU0A 4POXA 1DOTA 1ZJLA 2ZNUA 4NE4A 2PT1A 2DP8A 4XXUA 3H06B 4POWA 3KJTA 5CI5A 2RC8A 1IXGA 4DDDA 1FQFA 3SEYA 3QUFA 1VFEA 3TFLA 4U1OA 4F3GA 2F8DA 3IORA 2QPQA 3CFZA 3C35A 2DE4A 4TOZA 2XXVA 3TCGA 5I84A 3VVFA 3OSQA 1Y9UA 3KN8A 4DLDA 2H98A 3M3KA 1FQEA 4OESA 2XXRA 3CRBA 1Y20A 1PEBA 3QSLA 5I58A 4LZ8A 3O97A 2O69A 3KZGA 2Z8FA 3OO7A 4RA1A 5CMBA 5IAIA 1UTHA 1LFGA 1NMUA 4YB7A 2HZLA 5FHNA 2F6PA 5KDTA 4KYDA 4NEDA 2AIXA 2F34A 5H8QA 1P1UA 1FTMA 5TP9A 1I69A 4O3BA 3FVOA 4GFRA 4GRKA 5H8FA 3O2AA 3E4RA 3H4ZA 2Q8JA 1LFHA 4YMBA 2V84A 3N6TA 3Q25A 3G3JA 3RGYA 3H3GA 4MLVA 1SQYA 4XKPA 4QFPA 3OXNA 3VV5A 4F3PA 1ANFA 2HQ0A 1DTGA 3ZKKA 2R6GE 4DXBA 4EQ9A 2QS1A 4Q30B 4F2QA 2RKMA 1M5DA 1B5IA 2V3QA 1O7TA 1QW0A 3FXUA 2GFEA 3K6VA 1Y4CA 2W7YA 4GQOA 2BJJX 3CFXA 4R2FA 3Q26A 2DSFA 3GXAA 4GXAA 2VD2A 1II5A 1LAGE 1JNFA 3IB1A 3IOUA 2XXYA 3N6UA 1UTBB 4IO5A 4R6YA 1NNTA 1XHYA 4GL0A 4LA9A 4DXUA 4MF3A 2F7AA 1M5FA 4ZS9A 1H45A 1UIUA 4QSCA 5AA2D 2H4IA 4EF1A 1WVJA 4FEDA 3U93A 3PPPA 3KGCA 3V83A 3MW0A 5I2NA 1S50A 4GVOA 1MY0A 4NF4A 2XXUA 2DYXA 2G93A 3MP6A 1VFDA 4RK9A 1EZPA 4G8NA 3EF7A 5ELVA 3K6WA 4ND9A 4WEDA 4LZ7A 2QS2A 1XVYA 4F29A 1Y3NA 4LVQA 5I57A 5K2XA 3CI8A 4BDMA 4THIA 1PC3A 1LFIA 1FTLA 2ONRA 2OWTA 3PMXA 2YJPA 1H44A 4PFUA 3VVDA 2O1MA 2QL3A 4ZE9A 2O6AA 3ILUB 3PD8A 5A5XB 5L8DA 4YKIA 2LAOA 2Z8EA 4FIMA 2ANJA 3OO6A 4EXLA 4EDPA 2R71A 1Y3PA 2KLFA 1SVXB 2XXXA 1N3XA 3RLFE 5I56B 1NKXA 2A5TB 4MH5A 3K01A 4JXIA 4X1BA 4R9GA 3BBRA 3OSRA 1BIYA 4IO3A 3B7DA 1MY3A 1ZLQA 3A3UA 3EQ1A 4PFWA 4IY5A 4IO6A 2ZNSA 1LAFE 1P1OA 3ECRA 4QHQA 1XVXA 3TUSA 5H8HB 1Q1KA 3U8QA 1YAEA 3O6HA 2F97A 1LB8A 1MXYA 2DVZA 4XTCQ 5AA4A 2ONKE 1SI0A 1XC1A 1AMFA 5H8SA 2GHAA 5I59B 2H99A 1MQDA 4U22A 1MXVA 3SEVA 3IL1B 3RTWB 3FVGA 2ZMBA 2FNCA 3H6WA 1NNPA 4MBPA 5HPQA 3T96B 4IGTA 2M8CA 5B70A 1MQIA 1NL5A 1OQGA 3JYRA 1R9QA 3LSLA 3OOAA 4G68B 4U2RA 3OELA 4YAHX 1Z7ME 4NF5B 4DIGA 3C34A 3HHFA 1MPDA 2PT2A 1ZMGA 1Y3QA 3S9MC 1N84A 1B3EA 4KYEA 3IO4A 2ZYMA 1TFAA 3IB0A 4NTLA 1B3LA 3T22A 2RC9A 2OK2A 5CRYA 3PMWA 4ZEIA 3IJXB 1CB6A 4LONB 1ZBMA 2B3BA 2UVJA 3MQ9A 4ELPA 1B46A 4WKMA 3MWBA 2ESNA 4LP2B 4ZEFA 4M1VA 3T9HB 2RC7A 1B1XA 1N04A 3K1NA 2HEUA 1SD3A 1B7ZA 4K3FA 3PUWE 2X7PA 2Y7IA 4FEBA 1GGGA 1QKBA 4F2OA 1AL3A 3OO9A 3MVZA 4YB6A 1B6HA 4OQOA 4P0IA 2ALUA 4RPOA 3FUZA 1EZ9A 2UVHA 3H6VA 2X26A 2NWJA 4G68C 3RNNA 2CZLA 1IXHA 1M5EA 4NF6B 2D3IA 5JTYB 1RKMA 2XXTA 3EHSA 2Y7WA 2G29A 4F1UA 3SEWA 3EHTA 1TFDA 1GV8A 5B7DA 1FQBA 4QRZA 4EF2A 1M5BA 4XKNA 1OQHA 3FV1A 2PYYA 4XIGQ 1LB9A 3PPOA 1NNKA 3TELA 2Y7RA 5DVIA 4C1UA 3TZAA 3AXFA 3F11A 1B52A 2UYFA 5TPAB 3IAZA 4Z7EA 4M4GA 1MH4A 3S9EA 3LBSA 4LQ2A 2VP1A 3VLVA 5M2VA 3UORA 1D4NA 3G3KA 3UN6A 1I6AA 4NWCA 4OZ9A 1YCJA 3HO7A 3IK6B 1OIBA 4U1ZA 2P2AA 4ECFA 4I9DA 2I0CA 2OLBA 1POY1 2UXAA 3RQTA 5DT6A 3ONMA 4IY6A 2P1SA 5EHSA 1BLFA 4JSDA 1MY4A 4H6DA 2GRVA 1MXXA 3U72A 3K1PA 2Z8DA 2ZXTA 2NVUB 4OETA 1FQCA 1IIWA 3G3HA 4DZ1A 3T93B 4DE8A 4OEVA 1L5TA 5AA2B 4NF8B 3MPLA 2PBWA 3FJ7A 2VGQA 4U23A 3FD3A 3RUMA 3GZGA 2GHBA 2XX8A 4FE8A 1Y1MA 5JK4A 2ABHA 5DEXB 1B7UA 4PQJA 1D3KA 1P1QA 3U1OA 3FXQA 5CM6A 1S9TA 1QUIA 1MDP1 3KOSA 2H25A 3OEMA 3PPNA 5H8NB 3MJNA 4ZE8A 3I6VA 1JQFA 5L9OA 4QFOA 3TODA 2XX7A 2O68A 3TKDA 4YICA 1IITA 2RCBA 1OLAA 3IX1A 2DXRA 3IJOB 2H9BA 3PPRA 2UVGA 5CMCA 3O66A 3QXMA 2I58A 3S2VA 4GWOA 3L6GA 4TQUQ 3OENA 1MXZA 4I62A 4L17A 3H6TA 1B3GA 3CG3A 1XS5A 3G3IA 2QS3A 5CC2A 1A54A 4H5GA 4LQ5A 1OLCA 4WXJA 3C36A 3FJMA 3Q29A 4GIZA 1ZTYA 2DOJA 3K02A 3A09A 4YKPA 3TTLA 4F22A 4PFTA 3HHGA 3KOTA 3MP1A 5I59A 3TCHA 3UA8A 1ELJA 5ICTA 2CMOA 2HAUA 4R73A 1N0TA 1USYH 1S7YA 1N7XA 3CR9A 5DTBA 1A55A 1MM6A 1PBQA 5FHMA 1MXUA 4F18A 4RNSA 2FA7A 2F35A 5DYHA 1VE4A 4EUOA 4PE5B 3VXCA 3PV0E 1RYXA 4IO7A 3C31A 4G68A 3UK4A 2DE2A 4NMYA 1BTJA 4NF5A 3WAFA 1ZU0A 4GXSB 1ZIUA 1DMBA 1UTHB 3K6XA 3FIRA 1NFTA 4HCYA 4ZEBA 1LCFA 4KPTA 1URSA 5KDTB 4KI0E 4RPNA 1VSOA 5H8QB 3TTRA 1M5CA 4OFJA 1FTKA 2O84X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PX1 A;  2NXO A;  3O6I A;  4LUB A;  3B6W A;  3D4G A;  3PGF A;  1A7L A;  2DWH A;  2I3V A;  2OJT A;  4ELQ A;  1QUL A;  2ZYN A;  4N07 A;  1NNF A;  1H43 A;  1LBC A;  1DPE A;  3HCQ A;  2QS4 A;  3RT8 A;  3M3F A;  2V3T A;  3B6T A;  1YTV A;  5K2Y A;  5KZT A;  4YKK A;  4BDL A;  5ITP A;  4R75 A;  4ZZA A;  4RYA A;  1H3D A;  4F3S A;  1B4H A;  1Q35 A;  3V5A A;  1N76 A;  2E0S A;  5I2K A;  3FVN A;  3K4U A;  3PUV E;  4OEN A;  3DP8 A;  3OO8 A;  3TEP A;  4ZDM A;  1Y4T A;  4KQP A;  2OWS A;  1MM7 A;  3KBR A;  4GF8 A;  3Q28 A;  1BKA A;  3OEK A;  5F1Q A;  3KN3 A;  1IZ1 A;  4R6K A;  3ZKL A;  4R9F A;  2XHD A;  2DWJ A;  1MQJ A;  3A3C A;  3E13 X;  5JTY A;  3Q27 A;  3CFL A;  1QKA A;  3CSB A;  4XKR A;  4RY1 A;  2V25 A;  2ONS A;  1UIV A;  4GD5 A;  5I2N B;  4F1Y A;  3KSX A;  1PDA A;  4R2B A;  3MC2 A;  3USD A;  2H5Y A;  3CIJ A;  5KCJ A;  2HCA A;  4QSD A;  4I1D A;  1B2H A;  3IOW A;  4EXK A;  1B5H A;  5BUU A;  1QVS A;  2AYS A;  3I3V A;  2RCA A;  5CBS A;  4ESW A;  2XD2 A;  4YKJ A;  3BFT A;  3FJG A;  4AB5 A;  3MVW A;  3E3K A;  1OMP A;  3G3G A;  1B3H A;  4P0G A;  1UQW A;  1MS7 A;  3VE1 B;  3VFJ A;  3O29 A;  3SKP A;  4OEU A;  3SES A;  2Y7K A;  1LAH E;  4OXV A;  2I48 A;  1FCK A;  4H67 A;  3DM0 A;  1US5 A;  3M8U A;  3ILT B;  1JW4 A;  4H0W A;  1AH5 A;  4H65 A;  4YB5 A;  1QJM A;  3K00 A;  1B05 A;  2B65 A;  4E0W A;  5FTI A;  2I49 A;  3RTF B;  4OYV A;  1AOV A;  4N6P A;  1HSE A;  5CMM A;  4Q8R A;  2GH9 A;  2DXY A;  4Z0I A;  1TXF A;  2F7B A;  2VHA A;  5DEX A;  4TLL B;  2IEE A;  1MQG A;  1ZKB A;  3O6G A;  4KFQ A;  4G8M A;  3FGS A;  3LSW A;  4JB7 A;  5AA3 A;  2ZYK A;  4QFN A;  4C0R A;  3DLN A;  5H8N A;  1B0H A;  5HM4 B;  1F9B A;  3THI A;  3LSX A;  3EPE A;  2ZYO A;  1IQ7 A;  3MVX A;  1EU8 A;  5EHM A;  2RF1 A;  1GVC A;  1SW2 A;  3IOV A;  1B32 A;  3K6U A;  2XXH A;  1FTJ A;  4G77 A;  2RIN A;  1H76 A;  5CMK A;  1JVX A;  2XXI A;  2HXW A;  1B9J A;  1B40 A;  1B0L A;  4F1V A;  4R74 A;  1JET A;  3K0V A;  4H5F A;  4TLM B;  3M3L A;  4JSO A;  4OHN A;  1B58 A;  4EQB A;  3PD9 A;  2O7U A;  3PUX E;  3L6H A;  4ZED A;  1R9L A;  1GTK A;  3TAJ A;  4R6H A;  4UAC A;  4JWX A;  3TTK A;  2PMS A;  3RT6 B;  1UTB A;  3ODB A;  3UP9 A;  5EYF A;  4ZZE A;  4OTE A;  2DWI A;  4LAT A;  3R26 A;  1LGB C;  5DVJ A;  4H8J A;  4EQ7 A;  1USY E;  4Q5T A;  2Q2C A;  5FTH A;  3T9V A;  1PB9 A;  1A8E A;  3TYH A;  3HN0 A;  3W9V A;  4JBZ A;  2YLN A;  3KSJ A;  5F7V A;  3MZB A;  4IO4 A;  1TT1 A;  3TPA A;  1RYO A;  3JV9 A;  3TTN A;  4IB2 A;  2QJE A;  2YPN A;  4N13 A;  2F6G A;  1LCT A;  2QSX A;  1D9V A;  3O9P A;  2HAV A;  4FEC A;  4FAJ A;  1PBP A;  4LZ5 A;  4JDF A;  3KFM A;  4BLA A;  4ZEK A;  1A40 A;  1MY1 A;  3QAX A;  4OFO A;  2UVI A;  3TDJ A;  3W9W A;  2AL4 A;  5A5X A;  2Q2A A;  2Y7P A;  1QUJ A;  3ZSF A;  4KD5 A;  5LOM A;  3ZS6 A;  2OBG A;  3FAS A;  3LSF B;  1HSL A;  2O51 A;  3C9H A;  3QYT A;  3P7I A;  3K2D A;  3BFU A;  4C1T A;  2OCU A;  4OER A;  5I56 A;  2A5T A;  1JVY A;  3MPK A;  3R7X A;  3W15 C;  5AE4 A;  4WEP A;  2X7Q A;  3PPQ A;  4ELO A;  1MH3 A;  2Z23 A;  4F39 A;  3GBB A;  4DCX A;  3PUY E;  1N7W A;  4AQ4 A;  4O3A A;  2I0B A;  3G3F A;  1WDN A;  4PFY A;  3N26 A;  2REJ A;  2E1S A;  1HSJ A;  1SW1 A;  5H8H A;  3FXR A;  4G2Z A;  4KHZ E;  1SI1 A;  1US4 A;  2OZZ A;  2DWA A;  2D5W A;  1DTZ A;  1SBP A;  3EHU A;  5L9S A;  3N5L A;  3C32 A;  3MAM A;  1URG A;  4X9T A;  1TWY A;  3KJ7 A;  3H7M A;  3VDF A;  2HZK A;  3MBP A;  2AL5 A;  5L9M A;  4R72 A;  1B7H A;  4O3C A;  3UIF A;  5I58 B;  4H8I A;  3QIM A;  3EN3 A;  2B3F A;  1QUK A;  4G8H A;  4KCC A;  2V93 A;  3FZV A;  2XXP A;  1SYI A;  3U94 A;  5TP9 B;  3RN8 A;  2XX9 A;  2R9J A;  3JZJ A;  1B4Z A;  4MFI A;  5H8F B;  2O7I A;  4X48 A;  1P1N A;  3V89 B;  4GOT A;  3V8X B;  1Y1Z A;  3DP6 A;  1JEU A;  4X1D A;  1MY2 A;  1KWH A;  3QUJ A;  4OFL A;  5ICQ A;  4XKQ A;  1URD A;  4HTG A;  3S4U A;  1Z7N E;  1FQA A;  3H03 A;  1I6Q A;  1MG1 A;  3HST A;  3E9X A;  1LLS A;  1MRP A;  2FYI A;  1EZO A;  5HBC A;  3SEX A;  4YMA A;  4RJZ A;  4U4X A;  4KCD A;  3MZ1 A;  1SW4 A;  1N3W A;  4KYS A;  2THI A;  1AIV A;  1SYH A;  1NH7 A;  4BDN A;  1I6B A;  2P0S A;  3BKI B;  3KN7 A;  1A99 A;  3VXB A;  4I8C A;  3RPW A;  2QRY A;  3IOT A;  4NWD A;  4F3B A;  1DSN A;  3LR1 A;  5AA1 A;  2ZNT A;  1R1N A;  3MZ9 A;  4QFL A;  4FJP A;  3T9X B;  1O63 A;  1CE2 A;  1MXW A;  3U92 A;  1MQH A;  4IO2 A;  1PB8 A;  2A5S A;  3GLB A;  4IGR A;  2F78 A;  3DP4 A;  1SDX A;  3UGW A;  2Q88 A;  1PB7 A;  1BP5 A;  1P1W A;  4BDR A;  3T66 A;  1D9Y A;  3TQW A;  1B3F A;  3VLU A;  3VLW A;  4NF6 A;  2WKY A;  3IB2 A;  2Q9T A;  4ONY A;  4FOR A;  1JEV A;  1OVB A;  3S9L C;  5CBR A;  3IO6 A;  3TCF A;  1WOD A;  4YU0 A;  4NF4 B;  3OD7 A;  4GLI A;  1SW5 A;  3HV1 A;  4U4S A;  1YPN A;  4QSE A;  2HFB A;  4P11 A;  3G7W A;  4FAT A;  2Z22 A;  4OVJ A;  1XT8 A;  2REG A;  3MP8 A;  4ZEC A;  2XXW A;  5TPA A;  4AB6 A;  5I57 B;  2VD3 A;  4OMB A;  5FHO A;  3QK6 A;  3K1M A;  1GR2 A;  1IUD A;  5J1D A;  4QFK A;  2I3W A;  4HW8 A;  3C33 A;  2I4C A;  4DCY A;  5JEI A;  2IA4 A;  2NUV A;  1ATG A;  3MVY A;  2I4B A;  4KR5 A;  3IR1 A;  1FW0 A;  3S9N C;  3SDF A;  1JW5 A;  4U21 A;  1J1N A;  2DS9 A;  1VR5 A;  1R6Z A;  1IEJ A;  4JWO A;  2Y84 A;  2QMW A;  3H6U A;  3PU5 A;  3RY3 A;  3WAE A;  4YZZ A;  4OWD A;  2DQV A;  2XXQ A;  5IKB A;  4H1X A;  5BWJ A;  4F31 B;  4JWY A;  3SER A;  1T0K A;  2DVC A;  2XD3 A;  1IXC A;  3D4C A;  4MLQ A;  3CG1 A;  1FQD A;  3N94 A;  2O1L A;  5I2K B;  4G4P A;  1NH8 A;  1B51 A;  1EH3 A;  2F5X A;  1LBB A;  3C4M A;  5AA2 A;  3HPI A;  4NF8 A;  1B1H A;  5AA4 B;  4E0X A;  1IXI A;  4DXC A;  4PET A;  2VOZ A;  3TQL A;  5DVF A;  4QF9 A;  2Q89 A;  3LUY A;  1A8F A;  2NOO A;  3FAT A;  3PUZ E;  3I5O A;  4PP0 A;  3SET A;  1FTO A;  3R6U A;  3FVK A;  2DE3 A;  1OVT A;  3CVG A;  4RXL A;  1DPP A;  1LST A;  4UA8 A;  3SEU A;  4BDO A;  3KG2 A;  1JW1 A;  5ISU A;  2QMX A;  5ITO A;  3B6Q A;  2V3U A;  4BDQ A;  3TTM A;  3T9U A;  4RK2 A;  2D21 A;  4HCW A;  5KCJ B;  2F36 A;  3LC8 A;  2PVU A;  3KEI A;  3TMG A;  4GL8 A;  1P99 A;  3O28 A;  3DEL B;  4F19 A;  2F7C A;  1LAX A;  2UYE A;  1MPC A;  1B5J A;  2I6E A;  1MPB A;  4Q0C A;  3MUQ A;  4ESX A;  1POT A;  3OMB A;  3GBA A;  4ELR A;  3VVE A;  4ISU A;  1XOC A;  3CSG A;  3FV2 A;  3PMV A;  4HS7 A;  1MDQ A;  1O64 A;  5TU0 A;  4POX A;  1DOT A;  1ZJL A;  2ZNU A;  4NE4 A;  2PT1 A;  2DP8 A;  4XXU A;  3H06 B;  4POW A;  3KJT A;  5CI5 A;  2RC8 A;  1IXG A;  4DDD A;  1FQF A;  3SEY A;  3QUF A;  1VFE A;  3TFL A;  4U1O A;  4F3G A;  2F8D A;  3IOR A;  2QPQ A;  3CFZ A;  3C35 A;  2DE4 A;  4TOZ A;  2XXV A;  3TCG A;  5I84 A;  3VVF A;  3OSQ A;  1Y9U A;  3KN8 A;  4DLD A;  2H98 A;  3M3K A;  1FQE A;  4OES A;  2XXR A;  3CRB A;  1Y20 A;  1PEB A;  3QSL A;  5I58 A;  4LZ8 A;  3O97 A;  2O69 A;  3KZG A;  2Z8F A;  3OO7 A;  4RA1 A;  5CMB A;  5IAI A;  1UTH A;  1LFG A;  1NMU A;  4YB7 A;  2HZL A;  5FHN A;  2F6P A;  5KDT A;  4KYD A;  4NED A;  2AIX A;  2F34 A;  5H8Q A;  1P1U A;  1FTM A;  5TP9 A;  1I69 A;  4O3B A;  3FVO A;  4GFR A;  4GRK A;  5H8F A;  3O2A A;  3E4R A;  3H4Z A;  2Q8J A;  1LFH A;  4YMB A;  2V84 A;  3N6T A;  3Q25 A;  3G3J A;  3RGY A;  3H3G A;  4MLV A;  1SQY A;  4XKP A;  4QFP A;  3OXN A;  3VV5 A;  4F3P A;  1ANF A;  2HQ0 A;  1DTG A;  3ZKK A;  2R6G E;  4DXB A;  4EQ9 A;  2QS1 A;  4Q30 B;  4F2Q A;  2RKM A;  1M5D A;  1B5I A;  2V3Q A;  1O7T A;  1QW0 A;  3FXU A;  2GFE A;  3K6V A;  1Y4C A;  2W7Y A;  4GQO A;  2BJJ X;  3CFX A;  4R2F A;  3Q26 A;  2DSF A;  3GXA A;  4GXA A;  2VD2 A;  1II5 A;  1LAG E;  1JNF A;  3IB1 A;  3IOU A;  2XXY A;  3N6U A;  1UTB B;  4IO5 A;  4R6Y A;  1NNT A;  1XHY A;  4GL0 A;  4LA9 A;  4DXU A;  4MF3 A;  2F7A A;  1M5F A;  4ZS9 A;  1H45 A;  1UIU A;  4QSC A;  5AA2 D;  2H4I A;  4EF1 A;  1WVJ A;  4FED A;  3U93 A;  3PPP A;  3KGC A;  3V83 A;  3MW0 A;  5I2N A;  1S50 A;  4GVO A;  1MY0 A;  4NF4 A;  2XXU A;  2DYX A;  2G93 A;  3MP6 A;  1VFD A;  4RK9 A;  1EZP A;  4G8N A;  3EF7 A;  5ELV A;  3K6W A;  4ND9 A;  4WED A;  4LZ7 A;  2QS2 A;  1XVY A;  4F29 A;  1Y3N A;  4LVQ A;  5I57 A;  5K2X A;  3CI8 A;  4BDM A;  4THI A;  1PC3 A;  1LFI A;  1FTL A;  2ONR A;  2OWT A;  3PMX A;  2YJP A;  1H44 A;  4PFU A;  3VVD A;  2O1M A;  2QL3 A;  4ZE9 A;  2O6A A;  3ILU B;  3PD8 A;  5A5X B;  5L8D A;  4YKI A;  2LAO A;  2Z8E A;  4FIM A;  2ANJ A;  3OO6 A;  4EXL A;  4EDP A;  2R71 A;  1Y3P A;  2KLF A;  1SVX B;  2XXX A;  1N3X A;  3RLF E;  5I56 B;  1NKX A;  2A5T B;  4MH5 A;  3K01 A;  4JXI A;  4X1B A;  4R9G A;  3BBR A;  3OSR A;  1BIY A;  4IO3 A;  3B7D A;  1MY3 A;  1ZLQ A;  3A3U A;  3EQ1 A;  4PFW A;  4IY5 A;  4IO6 A;  2ZNS A;  1LAF E;  1P1O A;  3ECR A;  4QHQ A;  1XVX A;  3TUS A;  5H8H B;  1Q1K A;  3U8Q A;  1YAE A;  3O6H A;  2F97 A;  1LB8 A;  1MXY A;  2DVZ A;  4XTC Q;  5AA4 A;  2ONK E;  1SI0 A;  1XC1 A;  1AMF A;  5H8S A;  2GHA A;  5I59 B;  2H99 A;  1MQD A;  4U22 A;  1MXV A;  3SEV A;  3IL1 B;  3RTW B;  3FVG A;  2ZMB A;  2FNC A;  3H6W A;  1NNP A;  4MBP A;  5HPQ A;  3T96 B;  4IGT A;  2M8C A;  5B70 A;  1MQI A;  1NL5 A;  1OQG A;  3JYR A;  1R9Q A;  3LSL A;  3OOA A;  4G68 B;  4U2R A;  3OEL A;  4YAH X;  1Z7M E;  4NF5 B;  4DIG A;  3C34 A;  3HHF A;  1MPD A;  2PT2 A;  1ZMG A;  1Y3Q A;  3S9M C;  1N84 A;  1B3E A;  4KYE A;  3IO4 A;  2ZYM A;  1TFA A;  3IB0 A;  4NTL A;  1B3L A;  3T22 A;  2RC9 A;  2OK2 A;  5CRY A;  3PMW A;  4ZEI A;  3IJX B;  1CB6 A;  4LON B;  1ZBM A;  2B3B A;  2UVJ A;  3MQ9 A;  4ELP A;  1B46 A;  4WKM A;  3MWB A;  2ESN A;  4LP2 B;  4ZEF A;  4M1V A;  3T9H B;  2RC7 A;  1B1X A;  1N04 A;  3K1N A;  2HEU A;  1SD3 A;  1B7Z A;  4K3F A;  3PUW E;  2X7P A;  2Y7I A;  4FEB A;  1GGG A;  1QKB A;  4F2O A;  1AL3 A;  3OO9 A;  3MVZ A;  4YB6 A;  1B6H A;  4OQO A;  4P0I A;  2ALU A;  4RPO A;  3FUZ A;  1EZ9 A;  2UVH A;  3H6V A;  2X26 A;  2NWJ A;  4G68 C;  3RNN A;  2CZL A;  1IXH A;  1M5E A;  4NF6 B;  2D3I A;  5JTY B;  1RKM A;  2XXT A;  3EHS A;  2Y7W A;  2G29 A;  4F1U A;  3SEW A;  3EHT A;  1TFD A;  1GV8 A;  5B7D A;  1FQB A;  4QRZ A;  4EF2 A;  1M5B A;  4XKN A;  1OQH A;  3FV1 A;  2PYY A;  4XIG Q;  1LB9 A;  3PPO A;  1NNK A;  3TEL A;  2Y7R A;  5DVI A;  4C1U A;  3TZA A;  3AXF A;  3F11 A;  1B52 A;  2UYF A;  5TPA B;  3IAZ A;  4Z7E A;  4M4G A;  1MH4 A;  3S9E A;  3LBS A;  4LQ2 A;  2VP1 A;  3VLV A;  5M2V A;  3UOR A;  1D4N A;  3G3K A;  3UN6 A;  1I6A A;  4NWC A;  4OZ9 A;  1YCJ A;  3HO7 A;  3IK6 B;  1OIB A;  4U1Z A;  2P2A A;  4ECF A;  4I9D A;  2I0C A;  2OLB A;  1POY 1;  2UXA A;  3RQT A;  5DT6 A;  3ONM A;  4IY6 A;  2P1S A;  5EHS A;  1BLF A;  4JSD A;  1MY4 A;  4H6D A;  2GRV A;  1MXX A;  3U72 A;  3K1P A;  2Z8D A;  2ZXT A;  2NVU B;  4OET A;  1FQC A;  1IIW A;  3G3H A;  4DZ1 A;  3T93 B;  4DE8 A;  4OEV A;  1L5T A;  5AA2 B;  4NF8 B;  3MPL A;  2PBW A;  3FJ7 A;  2VGQ A;  4U23 A;  3FD3 A;  3RUM A;  3GZG A;  2GHB A;  2XX8 A;  4FE8 A;  1Y1M A;  5JK4 A;  2ABH A;  5DEX B;  1B7U A;  4PQJ A;  1D3K A;  1P1Q A;  3U1O A;  3FXQ A;  5CM6 A;  1S9T A;  1QUI A;  1MDP 1;  3KOS A;  2H25 A;  3OEM A;  3PPN A;  5H8N B;  3MJN A;  4ZE8 A;  3I6V A;  1JQF A;  5L9O A;  4QFO A;  3TOD A;  2XX7 A;  2O68 A;  3TKD A;  4YIC A;  1IIT A;  2RCB A;  1OLA A;  3IX1 A;  2DXR A;  3IJO B;  2H9B A;  3PPR A;  2UVG A;  5CMC A;  3O66 A;  3QXM A;  2I58 A;  3S2V A;  4GWO A;  3L6G A;  4TQU Q;  3OEN A;  1MXZ A;  4I62 A;  4L17 A;  3H6T A;  1B3G A;  3CG3 A;  1XS5 A;  3G3I A;  2QS3 A;  5CC2 A;  1A54 A;  4H5G A;  4LQ5 A;  1OLC A;  4WXJ A;  3C36 A;  3FJM A;  3Q29 A;  4GIZ A;  1ZTY A;  2DOJ A;  3K02 A;  3A09 A;  4YKP A;  3TTL A;  4F22 A;  4PFT A;  3HHG A;  3KOT A;  3MP1 A;  5I59 A;  3TCH A;  3UA8 A;  1ELJ A;  5ICT A;  2CMO A;  2HAU A;  4R73 A;  1N0T A;  1USY H;  1S7Y A;  1N7X A;  3CR9 A;  5DTB A;  1A55 A;  1MM6 A;  1PBQ A;  5FHM A;  1MXU A;  4F18 A;  4RNS A;  2FA7 A;  2F35 A;  5DYH A;  1VE4 A;  4EUO A;  4PE5 B;  3VXC A;  3PV0 E;  1RYX A;  4IO7 A;  3C31 A;  4G68 A;  3UK4 A;  2DE2 A;  4NMY A;  1BTJ A;  4NF5 A;  3WAF A;  1ZU0 A;  4GXS B;  1ZIU A;  1DMB A;  1UTH B;  3K6X A;  3FIR A;  1NFT A;  4HCY A;  4ZEB A;  1LCF A;  4KPT A;  1URS A;  5KDT B;  4KI0 E;  4RPN A;  1VSO A;  5H8Q B;  3TTR A;  1M5C A;  4OFJ A;  1FTK A;  2O84 X; 
#chains in the Genus database with same CATH topology
 2PX1 A;  2NXO A;  3O6I A;  4LUB A;  1FPD A;  3B6W A;  3D4G A;  3PGF A;  1A7L A;  2DWH A;  2FIX A;  2I3V A;  2OJT A;  4ELQ A;  1QUL A;  2ZYN A;  4N07 A;  1NNF A;  1H43 A;  1LBC A;  2P3V A;  1DPE A;  3HCQ A;  2QS4 A;  3LV0 A;  3RT8 A;  3M3F A;  4O94 A;  2V3T A;  1DK4 A;  3B6T A;  1YTV A;  5K2Y A;  5KZT A;  4YKK A;  4BDL A;  5ITP A;  4R75 A;  4ZZA A;  4RYA A;  1H3D A;  4F3S A;  1B4H A;  1Q35 A;  3V5A A;  1LEV A;  1N76 A;  2E0S A;  5I2K A;  3B8B A;  5DW8 A;  3FVN A;  3K4U A;  5ET7 A;  3PUV E;  4OEN A;  4NAP A;  3DP8 A;  3OO8 A;  1VDW A;  3TEP A;  4ZDM A;  1Y4T A;  4KQP A;  2OWS A;  1MM7 A;  3KBR A;  4GF8 A;  3Q28 A;  2XWO A;  4FBP A;  1BKA A;  3OEK A;  5F1Q A;  3KN3 A;  4XF5 A;  1IZ1 A;  4R6K A;  4GX3 A;  3ZKL A;  4R9F A;  4GBV A;  1NV1 A;  2XHD A;  2DWJ A;  2P3N A;  1MQJ A;  3A3C A;  1FBE A;  3E13 X;  5JTY A;  3Q27 A;  3RPL B;  3CFL A;  1QKA A;  3CSB A;  4XKR A;  4RY1 A;  2V25 A;  2ONS A;  1D9Q A;  1UIV A;  4GD5 A;  5I2N B;  4F1Y A;  3KSX A;  1PDA A;  4R2B A;  5ESY A;  3MC2 A;  3USD A;  4H45 A;  2H5Y A;  3CIJ A;  5KCJ A;  2HCA A;  4QSD A;  4I1D A;  4GWZ A;  1B2H A;  3IOW A;  4EXK A;  2B4L A;  1B5H A;  5BUU A;  1QVS A;  2AYS A;  3I3V A;  2PFY A;  2RCA A;  5CBS A;  4ESW A;  2XD2 A;  4H46 A;  4YKJ A;  3BFT A;  3FJG A;  4AB5 A;  3MVW A;  3E3K A;  1OMP A;  3G3G A;  1B3H A;  4P0G A;  1EYI A;  1UQW A;  1MS7 A;  3VE1 B;  3VFJ A;  1Q9D A;  3O29 A;  3SKP A;  5IGA A;  4OEU A;  3SES A;  2Y7K A;  1LAH E;  4OXV A;  2I48 A;  1FCK A;  4H67 A;  4P1E A;  4MNP A;  3DM0 A;  1LBV A;  1US5 A;  3M8U A;  2FBP A;  1NUX A;  3ILT B;  1JW4 A;  4H0W A;  1G0I A;  1AH5 A;  4H65 A;  4YB5 A;  1QJM A;  3K00 A;  1B05 A;  2B65 A;  2Q74 A;  3LUZ A;  4E0W A;  5FTI A;  1NUY A;  2I49 A;  1EYK A;  3RTF B;  4OYV A;  1AOV A;  4N6P A;  1HSE A;  4NQ8 A;  5CMM A;  4Q8R A;  2GH9 A;  2DXY A;  4Z0I A;  2XWI A;  1TXF A;  2F7B A;  2VHA A;  1KA1 A;  5DEX A;  4TLL B;  2IEE A;  1MQG A;  1ZKB A;  3O6G A;  4KFQ A;  4G8M A;  3FGS A;  3LSW A;  3ISP A;  4JB7 A;  5AA3 A;  2ZYK A;  4QBA A;  4QFN A;  3DLN A;  4C0R A;  5H8N A;  1B0H A;  2CZK A;  5HM4 B;  1F9B A;  3THI A;  3LSX A;  3EPE A;  2ZYO A;  1IQ7 A;  1YYZ A;  4PAI A;  3MVX A;  1EU8 A;  5EHM A;  2RF1 A;  1GVC A;  1SW2 A;  3IOV A;  1B32 A;  4GBW A;  3K6U A;  2XXH A;  1CNQ A;  1FTJ A;  4G77 A;  2RIN A;  2ZZW A;  1H76 A;  5CMK A;  1JVX A;  2XXI A;  2HXW A;  4PBQ A;  1B9J A;  1B40 A;  1B0L A;  4F1V A;  4R74 A;  1JET A;  3K0V A;  4H5F A;  4TLM B;  1FJ9 A;  3M3L A;  5EQ9 A;  4JSO A;  4OHN A;  1B58 A;  4EQB A;  3PD9 A;  2O7U A;  3HFU A;  3PUX E;  3L6H A;  1FBP A;  4ZED A;  1R9L A;  1GTK A;  1IMB A;  3TAJ A;  4N8Y A;  4R6H A;  4PFR A;  4UAC A;  4JWX A;  3TTK A;  2PMS A;  3RT6 B;  1UTB A;  4N6D A;  3ODB A;  3UP9 A;  5EYF A;  4ZZE A;  4OTE A;  2DWI A;  4LAT A;  3R26 A;  1LGB C;  5EYG A;  5DVJ A;  4H8J A;  4EQ7 A;  1USY E;  4Q5T A;  1G0H A;  2Q2C A;  2WYP A;  5FTH A;  3T9V A;  1PB9 A;  1A8E A;  4PGN A;  3TYH A;  1NUZ A;  3HN0 A;  3W9V A;  4GWY A;  4JBZ A;  2YLN A;  3KSJ A;  5F7V A;  3MZB A;  4I3E A;  4IO4 A;  1TT1 A;  3TPA A;  1RYO A;  3JV9 A;  3TTN A;  4IB2 A;  2QJE A;  2YPN A;  4N13 A;  2F6G A;  1LCT A;  2OWZ A;  2QSX A;  1D9V A;  3O9P A;  2HAV A;  4FEC A;  2QVU A;  2R8T A;  4FAJ A;  1PBP A;  4LZ5 A;  4JDF A;  3KFM A;  4BLA A;  4ZEK A;  1A40 A;  1MY1 A;  3QAX A;  4OFO A;  2UVI A;  3TDJ A;  4AS4 A;  3W9W A;  2AL4 A;  2B4M A;  5A5X A;  2Q2A A;  2PCR A;  2Y7P A;  1QUJ A;  3ZSF A;  4KD5 A;  5LOM A;  2HPG A;  3ZS6 A;  2XWK A;  2OBG A;  4N17 A;  3FAS A;  3LSF B;  1HSL A;  2O51 A;  3C9H A;  3QYT A;  3P7I A;  3K2D A;  2V4C A;  3BFU A;  4C1T A;  2OCU A;  4OER A;  5I56 A;  2A5T A;  1JVY A;  3MPK A;  3R7X A;  5I3S A;  3W15 C;  1IME A;  5AE4 A;  4PAF A;  4WEP A;  2X7Q A;  3PPQ A;  4ELO A;  1MH3 A;  4NG7 A;  2Z23 A;  4F39 A;  3GBB A;  4DCX A;  3PUY E;  1N7W A;  4AQ4 A;  4NX1 A;  4O3A A;  2I0B A;  1IMA A;  3G3F A;  1WDN A;  4PFY A;  3N26 A;  4PCD A;  1LBZ A;  2REJ A;  2E1S A;  1HSJ A;  1RDY A;  1SW1 A;  5H8H A;  4QXD A;  3FXR A;  4G2Z A;  4KHZ E;  5A5L A;  1SI1 A;  1US4 A;  2OZZ A;  2DWA A;  2D5W A;  1DTZ A;  1SBP A;  3EHU A;  5L9S A;  3N5L A;  3C32 A;  2FIE A;  4PTK A;  4GWS A;  4AS5 A;  3MAM A;  1URG A;  4X9T A;  1TWY A;  3KJ7 A;  3H7M A;  3VDF A;  2HZK A;  2Y5L A;  3MBP A;  2AL5 A;  5L9M A;  4R72 A;  3RPL A;  1B7H A;  4O3C A;  3UIF A;  1NV6 A;  5I58 B;  4H8I A;  3BIG A;  3QIM A;  3KBZ A;  4HXV A;  2BJI A;  3EN3 A;  2B3F A;  4MNI A;  1QUK A;  4G8H A;  4P47 A;  3E78 A;  4KCC A;  2V93 A;  3FZV A;  2XXP A;  1SYI A;  3U94 A;  5TP9 B;  3RN8 A;  2XX9 A;  2R9J A;  3JZJ A;  1B4Z A;  4MFI A;  1LBX A;  5H8F B;  2O7I A;  4X48 A;  1P1N A;  3V89 B;  4PBH A;  4GOT A;  3V8X B;  1Y1Z A;  3DP6 A;  4MJO A;  4XFE A;  1JEU A;  4XEQ A;  4X1D A;  1MY2 A;  1KWH A;  3QUJ A;  4OFL A;  5ICQ A;  4NGU A;  2WX9 A;  4XKQ A;  1URD A;  4HTG A;  3S4U A;  1Z7N E;  1FQA A;  3H03 A;  5EYH A;  2WEF A;  1I6Q A;  1MG1 A;  3HST A;  3E9X A;  2MKZ A;  5IZZ A;  1LLS A;  1MRP A;  2FYI A;  1EZO A;  5HBC A;  3SEX A;  4YMA A;  4RJZ A;  4U4X A;  4KCD A;  4N91 A;  3MZ1 A;  1SW4 A;  1N3W A;  4KYS A;  2THI A;  1AIV A;  4HE2 A;  1SYH A;  1NH7 A;  4BDN A;  1I6B A;  2P0S A;  3BKI B;  3KN7 A;  1A99 A;  3VXB A;  4I8C A;  3RPW A;  2QRY A;  3IOT A;  5T3J A;  4NWD A;  4F3B A;  1DSN A;  3LR1 A;  1DBZ A;  5AA1 A;  2ZNT A;  1R1N A;  3MZ9 A;  4QFL A;  4FJP A;  3T9X B;  1O63 A;  1CE2 A;  1MXW A;  3U92 A;  1MQH A;  4IO2 A;  1PB8 A;  2A5S A;  3GLB A;  4IGR A;  2F78 A;  3DP4 A;  3U65 A;  1SDX A;  3UGW A;  1FTA A;  2Q88 A;  1PB7 A;  1BP5 A;  1P1W A;  1FPI A;  4BDR A;  3T66 A;  1D9Y A;  3TQW A;  1B3F A;  3VLU A;  3VLW A;  4NF6 A;  2WKY A;  3IB2 A;  2Q9T A;  4ONY A;  4FOR A;  2FVZ A;  1JEV A;  2CEY A;  3A29 A;  1OVB A;  3S9L C;  5CBR A;  3IO6 A;  3TCF A;  1WOD A;  4YU0 A;  4NF4 B;  1FRP A;  2ZZX A;  3OD7 A;  4GLI A;  1SW5 A;  3HV1 A;  4U4S A;  1YPN A;  4QSE A;  1FPG A;  2HFB A;  4P11 A;  4PE3 A;  3G7W A;  2Z22 A;  4FAT A;  3IFA A;  1XT8 A;  4OVJ A;  4P8B A;  2REG A;  3MP8 A;  4ZEC A;  5IZ3 A;  2XXW A;  5TPA A;  4AB6 A;  5I57 B;  2QFL A;  2VD3 A;  4OMB A;  5FHO A;  4PFB A;  3QK6 A;  2HXR A;  3K1M A;  2L5V A;  1GR2 A;  1IUD A;  5J1D A;  4QFK A;  2I3W A;  4HW8 A;  3C33 A;  2I4C A;  4DCY A;  5JEI A;  2IA4 A;  2NUV A;  4PAK A;  1ATG A;  3MVY A;  2I4B A;  4KR5 A;  3IR1 A;  1FW0 A;  2PFZ A;  3S9N C;  3SDF A;  1JW5 A;  4U21 A;  1J1N A;  2DS9 A;  1VR5 A;  1R6Z A;  1IEJ A;  4O7M A;  4X04 A;  4JWO A;  2Y84 A;  2QMW A;  3H6U A;  4G61 A;  3PU5 A;  3RY3 A;  3WAE A;  4MEV A;  4YZZ A;  4OWD A;  1SPI A;  2DQV A;  2XXQ A;  3KC0 A;  5IKB A;  4H1X A;  4JVD A;  5BWJ A;  4F31 B;  4JWY A;  3SER A;  1NV5 A;  1T0K A;  2DVC A;  2XD3 A;  1IXC A;  3D4C A;  4MLQ A;  2Y5K A;  1QGX A;  3CG1 A;  1FQD A;  3N94 A;  2O1L A;  4GX4 A;  5I2K B;  4G4P A;  1NH8 A;  1B51 A;  1EH3 A;  1NV7 A;  2F5X A;  1LBB A;  3KC1 A;  1NV2 A;  3C4M A;  3GYY A;  2VPN A;  5AA2 A;  3HPI A;  4NF8 A;  1B1H A;  5AA4 B;  4E0X A;  2OX3 A;  1IXI A;  4DXC A;  4PET A;  2VOZ A;  3TQL A;  5DVF A;  4QF9 A;  2WYK A;  2Q89 A;  3LUY A;  1A8F A;  2NOO A;  2XXK A;  3FAT A;  3PUZ E;  3I5O A;  4PP0 A;  3SET A;  1FTO A;  3R6U A;  3FVK A;  2DE3 A;  4JVI A;  1OVT A;  3CVG A;  4RXL A;  1DPP A;  1LST A;  4UA8 A;  3SEU A;  4BDO A;  3KG2 A;  1JW1 A;  1KA0 A;  5ISU A;  2QMX A;  5ITO A;  3B6Q A;  2V3U A;  4BDQ A;  3SZP A;  3TTM A;  3T9U A;  4RK2 A;  2D21 A;  3FBP A;  5IM2 A;  4HCW A;  5KCJ B;  2F36 A;  3LC8 A;  2PVU A;  3KEI A;  3TMG A;  4GL8 A;  1P99 A;  3NOH A;  4OA4 A;  4N6K A;  1K9Z A;  3O28 A;  3DEL B;  4F19 A;  2F7C A;  1LAX A;  2UYE A;  3MST A;  1MPC A;  1B5J A;  2I6E A;  1MPB A;  3QMF A;  4Q0C A;  4X8R A;  3MUQ A;  4ESX A;  1POT A;  3OMB A;  3GBA A;  4ELR A;  3VVE A;  4GWW A;  1XI6 A;  4I40 A;  4ISU A;  5I7I A;  3B50 A;  1XOC A;  4MCO A;  3CSG A;  3FV2 A;  3PMV A;  4HS7 A;  1MDQ A;  1O64 A;  4P9K A;  5TU0 A;  4POX A;  1DOT A;  1ZJL A;  2ZNU A;  3PTY A;  4NE4 A;  4O7I A;  2QVR A;  2PT1 A;  2DP8 A;  4XXU A;  3H06 B;  4POW A;  3KJT A;  5CI5 A;  2RC8 A;  1IXG A;  4DDD A;  1FQF A;  3SEY A;  3QUF A;  1VFE A;  3TFL A;  4U1O A;  4F3G A;  2F8D A;  3IOR A;  2QPQ A;  3CFZ A;  3C35 A;  2DE4 A;  4TOZ A;  2XXV A;  1NUW A;  3TCG A;  5I84 A;  4JVC A;  3CHG A;  3VVF A;  3OSQ A;  1Y9U A;  3KN8 A;  4DLD A;  1RDZ A;  2H98 A;  2XA5 A;  3M3K A;  4OVS A;  1FQE A;  1IMD A;  4OES A;  2XXR A;  3CRB A;  1Y20 A;  1PEB A;  3QSL A;  1FBG A;  5I58 A;  4LZ8 A;  3O97 A;  2O69 A;  3KZG A;  2Z8F A;  1FBC A;  3OO7 A;  4MX6 A;  5I5P A;  4GX6 A;  4RA1 A;  5CMB A;  5IAI A;  1UTH A;  1LFG A;  1NMU A;  4YB7 A;  4I3Y A;  2HZL A;  5FHN A;  2F6P A;  5KDT A;  4KYD A;  4NED A;  1NV0 A;  2AIX A;  2F34 A;  4N81 A;  5H8Q A;  1P1U A;  1FTM A;  5TP9 A;  1I69 A;  4O3B A;  3FVO A;  5EQ7 A;  4GFR A;  4GRK A;  5H8F A;  3O2A A;  3E4R A;  3H4Z A;  2Q8J A;  1LFH A;  4YMB A;  2V84 A;  3N6T A;  3Q25 A;  3G3J A;  3RGY A;  4LN5 A;  3H3G A;  4MLV A;  5ET8 A;  1FPF A;  1DCU A;  1SQY A;  4XKP A;  4QFP A;  3OXN A;  3VV5 A;  4F3P A;  1ANF A;  2HQ0 A;  1DTG A;  1IMF A;  3ZKK A;  2R6G E;  4DXB A;  4EQ9 A;  2QS1 A;  4Q30 B;  4F2Q A;  2RKM A;  2ZZV A;  1FPE A;  1M5D A;  1B5I A;  2V3Q A;  1O7T A;  1QW0 A;  3FXU A;  2GFE A;  4UAB A;  1Y4C A;  1LBY A;  2W7Y A;  3K6V A;  4N4U A;  4GQO A;  2BJJ X;  3CFX A;  5ET6 A;  4R2F A;  3Q26 A;  2DSF A;  3GXA A;  4GXA A;  2VD2 A;  1II5 A;  1LAG E;  1JNF A;  3IB1 A;  3IOU A;  1YXI A;  2XXY A;  3N6U A;  1UTB B;  4IO5 A;  4R6Y A;  1NNT A;  1XHY A;  4GL0 A;  4LA9 A;  2DDK A;  4DXU A;  1NI9 A;  4MF3 A;  2F7A A;  1M5F A;  4ZS9 A;  1H45 A;  1UIU A;  4QSC A;  1FPB A;  2KR0 A;  5AA2 D;  4DI4 B;  3E79 A;  2H4I A;  1FBF A;  4EF1 A;  1WVJ A;  4PGP A;  4FED A;  3U93 A;  3PPP A;  3KGC A;  3V83 A;  3MW0 A;  1FBD A;  5I2N A;  2WBB A;  1S50 A;  4GVO A;  1MY0 A;  4NF4 A;  2XXU A;  2DYX A;  2G93 A;  3MP6 A;  1VFD A;  4RK9 A;  1EZP A;  4G8N A;  3EF7 A;  5ELV A;  5J16 A;  3K6W A;  4ND9 A;  4WED A;  4LZ7 A;  3RYD A;  4IR8 A;  2QS2 A;  2XWV A;  2Q8M A;  1XVY A;  4F29 A;  1Y3N A;  4LVQ A;  5I57 A;  5K2X A;  3CI8 A;  4PDH A;  4BDM A;  4THI A;  4P1L A;  1PC3 A;  1LFI A;  1FTL A;  1NV4 A;  2ONR A;  2OWT A;  3PMX A;  2YJP A;  1H44 A;  4PFU A;  3VVD A;  2O1M A;  2QL3 A;  4ZE9 A;  2O6A A;  3ILU B;  3PD8 A;  5A5X B;  5L8D A;  4YKI A;  2LAO A;  2Z8E A;  4FIM A;  2ANJ A;  3OO6 A;  4MNC A;  1NV3 A;  4EXL A;  4EDP A;  2R71 A;  1Y3P A;  2KLF A;  1SVX B;  2XXX A;  1N3X A;  3RLF E;  5I56 B;  1NKX A;  2A5T B;  4MH5 A;  3K01 A;  4JXI A;  4X1B A;  4R9G A;  3BBR A;  3OSR A;  1BIY A;  4IO3 A;  3B7D A;  1MY3 A;  1ZLQ A;  3A3U A;  3EQ1 A;  4PFW A;  4IY5 A;  4IO6 A;  2ZNS A;  4P56 A;  1LAF E;  1P1O A;  3ECR A;  4QHQ A;  1YZ0 A;  1XVX A;  2KQZ A;  4MIJ A;  2F3D A;  3TUS A;  5H8H B;  1Q1K A;  3U8Q A;  1YAE A;  3O6H A;  4PC9 A;  2F97 A;  2CZH A;  1LB8 A;  1MXY A;  2DVZ A;  4GWX A;  4XTC Q;  5AA4 A;  2ONK E;  1SI0 A;  1FJ6 A;  1XC1 A;  3FXB A;  1AMF A;  5H8S A;  2GHA A;  5I59 B;  4OVP A;  2H99 A;  1MQD A;  4U22 A;  2CZI A;  1MXV A;  3SEV A;  3IL1 B;  3RTW B;  3FVG A;  2ZMB A;  2FNC A;  3H6W A;  1NNP A;  4MBP A;  5HPQ A;  3T96 B;  4IGT A;  2M8C A;  1INP A;  5B70 A;  4NN3 A;  1MQI A;  1NL5 A;  1OQG A;  3ROJ A;  3JYR A;  1JP4 A;  1R9Q A;  3LSL A;  3OOA A;  1RDX A;  1LBW A;  4G68 B;  2GQ1 A;  4U2R A;  3OEL A;  3IFC A;  4YAH X;  1Z7M E;  4NF5 B;  4DIG A;  3C34 A;  3HHF A;  1MPD A;  2PT2 A;  1ZMG A;  3T1B A;  1Y3Q A;  3S9M C;  1N84 A;  1B3E A;  2VPO A;  4KYE A;  3IO4 A;  4OVT A;  2ZYM A;  1TFA A;  5EQA A;  3IB0 A;  4NTL A;  1B3L A;  3T22 A;  2RC9 A;  2OK2 A;  5CRY A;  3PMW A;  4O8M A;  4ZEI A;  3IJX B;  1CB6 A;  4OVR A;  4LON B;  1ZBM A;  2B3B A;  2UVJ A;  3MQ9 A;  4ELP A;  1B46 A;  1IMC A;  4WKM A;  3MWB A;  2ESN A;  4HE1 A;  5LDZ A;  4P3L A;  4LP2 B;  4ZEF A;  4PFI A;  4MHF A;  4M1V A;  1FSA A;  3T9H B;  2RC7 A;  1B1X A;  4MAG A;  4KXP A;  1N04 A;  3K1N A;  2HEU A;  1SD3 A;  1B7Z A;  4K3F A;  3PUW E;  2X7P A;  2Y7I A;  4FEB A;  1GGG A;  1QKB A;  4F2O A;  1AL3 A;  3OO9 A;  2CEX A;  3MVZ A;  4YB6 A;  1B6H A;  4OQO A;  4P0I A;  2ALU A;  4RPO A;  3FUZ A;  1EZ9 A;  2UVH A;  3H6V A;  2X26 A;  2NWJ A;  4G68 C;  3RNN A;  2CZL A;  1IXH A;  1M5E A;  4NF6 B;  2D3I A;  5JTY B;  1RKM A;  2XXT A;  3EHS A;  2Y7W A;  3BIH A;  5IZ1 A;  2JJK A;  2G29 A;  4F1U A;  5FBP A;  4PF6 A;  3SEW A;  3EHT A;  1TFD A;  1GV8 A;  4NHB A;  5B7D A;  1FQB A;  4QRZ A;  4EF2 A;  1M5B A;  4XKN A;  1OQH A;  3FV1 A;  2PYY A;  4XIG Q;  1LB9 A;  3PPO A;  1NNK A;  3TEL A;  2Y7R A;  2FHY A;  5DVI A;  4C1U A;  1K9Y A;  3TZA A;  3AXF A;  3D1R A;  3F11 A;  5IZ3 B;  1B52 A;  2UYF A;  5TPA B;  3IAZ A;  4Z7E A;  4M4G A;  1MH4 A;  3S9E A;  3LBS A;  5ET5 A;  4LQ2 A;  2VP1 A;  3VLV A;  5M2V A;  3UOR A;  1D4N A;  3G3K A;  3UN6 A;  3EKI A;  4GWU A;  1I6A A;  4NWC A;  4OZ9 A;  1YCJ A;  3HO7 A;  3IK6 B;  5EQ8 A;  1OIB A;  4U1Z A;  2P2A A;  4ECF A;  4I9D A;  5LTC A;  2I0C A;  2OLB A;  1POY 1;  2UXA A;  3RQT A;  5DT6 A;  3ONM A;  4IY6 A;  2P1S A;  5EHS A;  1BLF A;  4JSD A;  1MY4 A;  4H6D A;  5F24 A;  2GRV A;  1MXX A;  3U72 A;  3K1P A;  2Z8D A;  2ZXT A;  2NVU B;  4OET A;  1FQC A;  1IIW A;  3G3H A;  1KZ8 A;  4DZ1 A;  3T93 B;  4DE8 A;  4OEV A;  1L5T A;  5AA2 B;  4NF8 B;  3MPL A;  2PBW A;  3FJ7 A;  2VGQ A;  4U23 A;  3FD3 A;  3RUM A;  3GZG A;  2GHB A;  2XX8 A;  4FE8 A;  2WBD A;  1Y1M A;  4PF8 A;  5JK4 A;  2ABH A;  4OVQ A;  5DEX B;  1B7U A;  4PQJ A;  1D3K A;  1FPK A;  1P1Q A;  3U1O A;  3T0J A;  3FXQ A;  4MMP A;  5CM6 A;  1S9T A;  1QUI A;  1MDP 1;  3KOS A;  2H25 A;  3OEM A;  3PPN A;  5H8N B;  3MJN A;  1BK4 A;  4ZE8 A;  3I6V A;  4HE0 A;  1JQF A;  5L9O A;  4NF0 A;  4QFO A;  2VT5 A;  3TOD A;  2HHM A;  2XX7 A;  2O68 A;  3TKD A;  1FPJ A;  4YIC A;  1IIT A;  2RCB A;  2QVV A;  1OLA A;  3IX1 A;  2DXR A;  3IJO B;  2H9B A;  3PPR A;  4N8G A;  2UVG A;  5CMC A;  3O66 A;  3QXM A;  3MYU A;  4PDD A;  2I58 A;  3S2V A;  4N15 A;  4GWO A;  3L6G A;  4TQU Q;  3OEN A;  1MXZ A;  1EYJ A;  4I62 A;  4L17 A;  1FPL A;  3H6T A;  1B3G A;  3CG3 A;  1XS5 A;  3G3I A;  2QS3 A;  5CC2 A;  1A54 A;  4H5G A;  1FBH A;  4LQ5 A;  1OLC A;  4WXJ A;  3C36 A;  3FJM A;  3Q29 A;  4GIZ A;  1ZTY A;  2DOJ A;  3K02 A;  3A09 A;  4YKP A;  3TTL A;  4F22 A;  4PFT A;  3HHG A;  3KOT A;  4OAN A;  3MP1 A;  5I59 A;  3TCH A;  3UA8 A;  1ELJ A;  5ICT A;  2CMO A;  2HAU A;  4R73 A;  1N0T A;  1USY H;  4DI3 D;  1S7Y A;  1N7X A;  3CR9 A;  5DTB A;  1A55 A;  1MM6 A;  1PBQ A;  5FHM A;  1MXU A;  4RNS A;  4F18 A;  2FA7 A;  2F35 A;  5DYH A;  1VE4 A;  4EUO A;  4PE5 B;  3VXC A;  3PV0 E;  1RYX A;  4IO7 A;  3C31 A;  4G68 A;  3UK4 A;  2DE2 A;  4NMY A;  1BTJ A;  4NF5 A;  3WAF A;  1ZU0 A;  4GXS B;  1ZIU A;  1DMB A;  1UTH B;  3K6X A;  3FIR A;  1NFT A;  4HCY A;  4ZEB A;  1LCF A;  4KPT A;  1URS A;  5KDT B;  1AWB A;  4KI0 E;  4RPN A;  1VSO A;  5H8Q B;  3TTR A;  2F3B A;  1M5C A;  4OFJ A;  1FTK A;  2O84 X; 
#chains in the Genus database with same CATH homology
 2PX1 A;  2NXO A;  3O6I A;  4LUB A;  3B6W A;  3D4G A;  3PGF A;  1A7L A;  2DWH A;  2I3V A;  2OJT A;  4ELQ A;  1QUL A;  2ZYN A;  4N07 A;  1NNF A;  1H43 A;  1LBC A;  1DPE A;  3HCQ A;  2QS4 A;  3RT8 A;  3M3F A;  2V3T A;  3B6T A;  1YTV A;  5K2Y A;  5KZT A;  4YKK A;  4BDL A;  5ITP A;  4R75 A;  4ZZA A;  4RYA A;  1H3D A;  4F3S A;  1B4H A;  1Q35 A;  3V5A A;  1N76 A;  2E0S A;  5I2K A;  3FVN A;  3K4U A;  3PUV E;  4OEN A;  3DP8 A;  3OO8 A;  3TEP A;  4ZDM A;  1Y4T A;  4KQP A;  2OWS A;  1MM7 A;  3KBR A;  4GF8 A;  3Q28 A;  1BKA A;  3OEK A;  5F1Q A;  3KN3 A;  1IZ1 A;  4R6K A;  3ZKL A;  4R9F A;  2XHD A;  2DWJ A;  1MQJ A;  3A3C A;  3E13 X;  5JTY A;  3Q27 A;  3CFL A;  1QKA A;  3CSB A;  4XKR A;  4RY1 A;  2V25 A;  2ONS A;  1UIV A;  4GD5 A;  5I2N B;  4F1Y A;  3KSX A;  1PDA A;  4R2B A;  3MC2 A;  3USD A;  2H5Y A;  3CIJ A;  5KCJ A;  2HCA A;  4QSD A;  4I1D A;  1B2H A;  3IOW A;  4EXK A;  1B5H A;  5BUU A;  1QVS A;  2AYS A;  3I3V A;  2RCA A;  5CBS A;  4ESW A;  2XD2 A;  4YKJ A;  3BFT A;  3FJG A;  4AB5 A;  3MVW A;  3E3K A;  1OMP A;  3G3G A;  1B3H A;  4P0G A;  1UQW A;  1MS7 A;  3VE1 B;  3VFJ A;  3O29 A;  3SKP A;  4OEU A;  3SES A;  2Y7K A;  1LAH E;  4OXV A;  2I48 A;  1FCK A;  4H67 A;  3DM0 A;  1US5 A;  3M8U A;  3ILT B;  1JW4 A;  4H0W A;  1AH5 A;  4H65 A;  4YB5 A;  1QJM A;  3K00 A;  1B05 A;  2B65 A;  4E0W A;  5FTI A;  2I49 A;  3RTF B;  4OYV A;  1AOV A;  4N6P A;  1HSE A;  5CMM A;  4Q8R A;  2GH9 A;  2DXY A;  4Z0I A;  1TXF A;  2F7B A;  2VHA A;  5DEX A;  4TLL B;  2IEE A;  1MQG A;  1ZKB A;  3O6G A;  4KFQ A;  4G8M A;  3FGS A;  3LSW A;  4JB7 A;  5AA3 A;  2ZYK A;  4QFN A;  4C0R A;  3DLN A;  5H8N A;  1B0H A;  5HM4 B;  1F9B A;  3THI A;  3LSX A;  3EPE A;  2ZYO A;  1IQ7 A;  3MVX A;  1EU8 A;  5EHM A;  2RF1 A;  1GVC A;  1SW2 A;  3IOV A;  1B32 A;  3K6U A;  2XXH A;  1FTJ A;  4G77 A;  2RIN A;  1H76 A;  5CMK A;  1JVX A;  2XXI A;  2HXW A;  1B9J A;  1B40 A;  1B0L A;  4F1V A;  4R74 A;  1JET A;  3K0V A;  4H5F A;  4TLM B;  3M3L A;  4JSO A;  4OHN A;  1B58 A;  4EQB A;  3PD9 A;  2O7U A;  3PUX E;  3L6H A;  4ZED A;  1R9L A;  1GTK A;  3TAJ A;  4R6H A;  4UAC A;  4JWX A;  3TTK A;  2PMS A;  3RT6 B;  1UTB A;  3ODB A;  3UP9 A;  5EYF A;  4ZZE A;  4OTE A;  2DWI A;  4LAT A;  3R26 A;  1LGB C;  5DVJ A;  4H8J A;  4EQ7 A;  1USY E;  4Q5T A;  2Q2C A;  5FTH A;  3T9V A;  1PB9 A;  1A8E A;  3TYH A;  3HN0 A;  3W9V A;  4JBZ A;  2YLN A;  3KSJ A;  5F7V A;  3MZB A;  4IO4 A;  1TT1 A;  3TPA A;  1RYO A;  3JV9 A;  3TTN A;  4IB2 A;  2QJE A;  2YPN A;  4N13 A;  2F6G A;  1LCT A;  2QSX A;  1D9V A;  3O9P A;  2HAV A;  4FEC A;  4FAJ A;  1PBP A;  4LZ5 A;  4JDF A;  3KFM A;  4BLA A;  4ZEK A;  1A40 A;  1MY1 A;  3QAX A;  4OFO A;  2UVI A;  3TDJ A;  3W9W A;  2AL4 A;  5A5X A;  2Q2A A;  2Y7P A;  1QUJ A;  3ZSF A;  4KD5 A;  5LOM A;  3ZS6 A;  2OBG A;  3FAS A;  3LSF B;  1HSL A;  2O51 A;  3C9H A;  3QYT A;  3P7I A;  3K2D A;  3BFU A;  4C1T A;  2OCU A;  4OER A;  5I56 A;  2A5T A;  1JVY A;  3MPK A;  3R7X A;  3W15 C;  5AE4 A;  4WEP A;  2X7Q A;  3PPQ A;  4ELO A;  1MH3 A;  2Z23 A;  4F39 A;  3GBB A;  4DCX A;  3PUY E;  1N7W A;  4AQ4 A;  4O3A A;  2I0B A;  3G3F A;  1WDN A;  4PFY A;  3N26 A;  2REJ A;  2E1S A;  1HSJ A;  1SW1 A;  5H8H A;  3FXR A;  4G2Z A;  4KHZ E;  1SI1 A;  1US4 A;  2OZZ A;  2DWA A;  2D5W A;  1DTZ A;  1SBP A;  3EHU A;  5L9S A;  3N5L A;  3C32 A;  3MAM A;  1URG A;  4X9T A;  1TWY A;  3KJ7 A;  3H7M A;  3VDF A;  2HZK A;  3MBP A;  2AL5 A;  5L9M A;  4R72 A;  1B7H A;  4O3C A;  3UIF A;  5I58 B;  4H8I A;  3QIM A;  3EN3 A;  2B3F A;  1QUK A;  4G8H A;  4KCC A;  2V93 A;  3FZV A;  2XXP A;  1SYI A;  3U94 A;  5TP9 B;  3RN8 A;  2XX9 A;  2R9J A;  3JZJ A;  1B4Z A;  4MFI A;  5H8F B;  2O7I A;  4X48 A;  1P1N A;  3V89 B;  4GOT A;  3V8X B;  1Y1Z A;  3DP6 A;  1JEU A;  4X1D A;  1MY2 A;  1KWH A;  3QUJ A;  4OFL A;  5ICQ A;  4XKQ A;  1URD A;  4HTG A;  3S4U A;  1Z7N E;  1FQA A;  3H03 A;  1I6Q A;  1MG1 A;  3HST A;  3E9X A;  1LLS A;  1MRP A;  2FYI A;  1EZO A;  5HBC A;  3SEX A;  4YMA A;  4RJZ A;  4U4X A;  4KCD A;  3MZ1 A;  1SW4 A;  1N3W A;  4KYS A;  2THI A;  1AIV A;  1SYH A;  1NH7 A;  4BDN A;  1I6B A;  2P0S A;  3BKI B;  3KN7 A;  1A99 A;  3VXB A;  4I8C A;  3RPW A;  2QRY A;  3IOT A;  4NWD A;  4F3B A;  1DSN A;  3LR1 A;  5AA1 A;  2ZNT A;  1R1N A;  3MZ9 A;  4QFL A;  4FJP A;  3T9X B;  1O63 A;  1CE2 A;  1MXW A;  3U92 A;  1MQH A;  4IO2 A;  1PB8 A;  2A5S A;  3GLB A;  4IGR A;  2F78 A;  3DP4 A;  1SDX A;  3UGW A;  2Q88 A;  1PB7 A;  1BP5 A;  1P1W A;  4BDR A;  3T66 A;  1D9Y A;  3TQW A;  1B3F A;  3VLU A;  3VLW A;  4NF6 A;  2WKY A;  3IB2 A;  2Q9T A;  4ONY A;  4FOR A;  1JEV A;  1OVB A;  3S9L C;  5CBR A;  3IO6 A;  3TCF A;  1WOD A;  4YU0 A;  4NF4 B;  3OD7 A;  4GLI A;  1SW5 A;  3HV1 A;  4U4S A;  1YPN A;  4QSE A;  2HFB A;  4P11 A;  3G7W A;  4FAT A;  2Z22 A;  4OVJ A;  1XT8 A;  2REG A;  3MP8 A;  4ZEC A;  2XXW A;  5TPA A;  4AB6 A;  5I57 B;  2VD3 A;  4OMB A;  5FHO A;  3QK6 A;  3K1M A;  1GR2 A;  1IUD A;  5J1D A;  4QFK A;  2I3W A;  4HW8 A;  3C33 A;  2I4C A;  4DCY A;  5JEI A;  2IA4 A;  2NUV A;  1ATG A;  3MVY A;  2I4B A;  4KR5 A;  3IR1 A;  1FW0 A;  3S9N C;  3SDF A;  1JW5 A;  4U21 A;  1J1N A;  2DS9 A;  1VR5 A;  1R6Z A;  1IEJ A;  4JWO A;  2Y84 A;  2QMW A;  3H6U A;  3PU5 A;  3RY3 A;  3WAE A;  4YZZ A;  4OWD A;  2DQV A;  2XXQ A;  5IKB A;  4H1X A;  5BWJ A;  4F31 B;  4JWY A;  3SER A;  1T0K A;  2DVC A;  2XD3 A;  1IXC A;  3D4C A;  4MLQ A;  3CG1 A;  1FQD A;  3N94 A;  2O1L A;  5I2K B;  4G4P A;  1NH8 A;  1B51 A;  1EH3 A;  2F5X A;  1LBB A;  3C4M A;  5AA2 A;  3HPI A;  4NF8 A;  1B1H A;  5AA4 B;  4E0X A;  1IXI A;  4DXC A;  4PET A;  2VOZ A;  3TQL A;  5DVF A;  4QF9 A;  2Q89 A;  3LUY A;  1A8F A;  2NOO A;  3FAT A;  3PUZ E;  3I5O A;  4PP0 A;  3SET A;  1FTO A;  3R6U A;  3FVK A;  2DE3 A;  1OVT A;  3CVG A;  4RXL A;  1DPP A;  1LST A;  4UA8 A;  3SEU A;  4BDO A;  3KG2 A;  1JW1 A;  5ISU A;  2QMX A;  5ITO A;  3B6Q A;  2V3U A;  4BDQ A;  3TTM A;  3T9U A;  4RK2 A;  2D21 A;  4HCW A;  5KCJ B;  2F36 A;  3LC8 A;  2PVU A;  3KEI A;  3TMG A;  4GL8 A;  1P99 A;  3O28 A;  3DEL B;  4F19 A;  2F7C A;  1LAX A;  2UYE A;  1MPC A;  1B5J A;  2I6E A;  1MPB A;  4Q0C A;  3MUQ A;  4ESX A;  1POT A;  3OMB A;  3GBA A;  4ELR A;  3VVE A;  4ISU A;  1XOC A;  3CSG A;  3FV2 A;  3PMV A;  4HS7 A;  1MDQ A;  1O64 A;  5TU0 A;  4POX A;  1DOT A;  1ZJL A;  2ZNU A;  4NE4 A;  2PT1 A;  2DP8 A;  4XXU A;  3H06 B;  4POW A;  3KJT A;  5CI5 A;  2RC8 A;  1IXG A;  4DDD A;  1FQF A;  3SEY A;  3QUF A;  1VFE A;  3TFL A;  4U1O A;  4F3G A;  2F8D A;  3IOR A;  2QPQ A;  3CFZ A;  3C35 A;  2DE4 A;  4TOZ A;  2XXV A;  3TCG A;  5I84 A;  3VVF A;  3OSQ A;  1Y9U A;  3KN8 A;  4DLD A;  2H98 A;  3M3K A;  1FQE A;  4OES A;  2XXR A;  3CRB A;  1Y20 A;  1PEB A;  3QSL A;  5I58 A;  4LZ8 A;  3O97 A;  2O69 A;  3KZG A;  2Z8F A;  3OO7 A;  4RA1 A;  5CMB A;  5IAI A;  1UTH A;  1LFG A;  1NMU A;  4YB7 A;  2HZL A;  5FHN A;  2F6P A;  5KDT A;  4KYD A;  4NED A;  2AIX A;  2F34 A;  5H8Q A;  1P1U A;  1FTM A;  5TP9 A;  1I69 A;  4O3B A;  3FVO A;  4GFR A;  4GRK A;  5H8F A;  3O2A A;  3E4R A;  3H4Z A;  2Q8J A;  1LFH A;  4YMB A;  2V84 A;  3N6T A;  3Q25 A;  3G3J A;  3RGY A;  3H3G A;  4MLV A;  1SQY A;  4XKP A;  4QFP A;  3OXN A;  3VV5 A;  4F3P A;  1ANF A;  2HQ0 A;  1DTG A;  3ZKK A;  2R6G E;  4DXB A;  4EQ9 A;  2QS1 A;  4Q30 B;  4F2Q A;  2RKM A;  1M5D A;  1B5I A;  2V3Q A;  1O7T A;  1QW0 A;  3FXU A;  2GFE A;  3K6V A;  1Y4C A;  2W7Y A;  4GQO A;  2BJJ X;  3CFX A;  4R2F A;  3Q26 A;  2DSF A;  3GXA A;  4GXA A;  2VD2 A;  1II5 A;  1LAG E;  1JNF A;  3IB1 A;  3IOU A;  2XXY A;  3N6U A;  1UTB B;  4IO5 A;  4R6Y A;  1NNT A;  1XHY A;  4GL0 A;  4LA9 A;  4DXU A;  4MF3 A;  2F7A A;  1M5F A;  4ZS9 A;  1H45 A;  1UIU A;  4QSC A;  5AA2 D;  2H4I A;  4EF1 A;  1WVJ A;  4FED A;  3U93 A;  3PPP A;  3KGC A;  3V83 A;  3MW0 A;  5I2N A;  1S50 A;  4GVO A;  1MY0 A;  4NF4 A;  2XXU A;  2DYX A;  2G93 A;  3MP6 A;  1VFD A;  4RK9 A;  1EZP A;  4G8N A;  3EF7 A;  5ELV A;  3K6W A;  4ND9 A;  4WED A;  4LZ7 A;  2QS2 A;  1XVY A;  4F29 A;  1Y3N A;  4LVQ A;  5I57 A;  5K2X A;  3CI8 A;  4BDM A;  4THI A;  1PC3 A;  1LFI A;  1FTL A;  2ONR A;  2OWT A;  3PMX A;  2YJP A;  1H44 A;  4PFU A;  3VVD A;  2O1M A;  2QL3 A;  4ZE9 A;  2O6A A;  3ILU B;  3PD8 A;  5A5X B;  5L8D A;  4YKI A;  2LAO A;  2Z8E A;  4FIM A;  2ANJ A;  3OO6 A;  4EXL A;  4EDP A;  2R71 A;  1Y3P A;  2KLF A;  1SVX B;  2XXX A;  1N3X A;  3RLF E;  5I56 B;  1NKX A;  2A5T B;  4MH5 A;  3K01 A;  4JXI A;  4X1B A;  4R9G A;  3BBR A;  3OSR A;  1BIY A;  4IO3 A;  3B7D A;  1MY3 A;  1ZLQ A;  3A3U A;  3EQ1 A;  4PFW A;  4IY5 A;  4IO6 A;  2ZNS A;  1LAF E;  1P1O A;  3ECR A;  4QHQ A;  1XVX A;  3TUS A;  5H8H B;  1Q1K A;  3U8Q A;  1YAE A;  3O6H A;  2F97 A;  1LB8 A;  1MXY A;  2DVZ A;  4XTC Q;  5AA4 A;  2ONK E;  1SI0 A;  1XC1 A;  1AMF A;  5H8S A;  2GHA A;  5I59 B;  2H99 A;  1MQD A;  4U22 A;  1MXV A;  3SEV A;  3IL1 B;  3RTW B;  3FVG A;  2ZMB A;  2FNC A;  3H6W A;  1NNP A;  4MBP A;  5HPQ A;  3T96 B;  4IGT A;  2M8C A;  5B70 A;  1MQI A;  1NL5 A;  1OQG A;  3JYR A;  1R9Q A;  3LSL A;  3OOA A;  4G68 B;  4U2R A;  3OEL A;  4YAH X;  1Z7M E;  4NF5 B;  4DIG A;  3C34 A;  3HHF A;  1MPD A;  2PT2 A;  1ZMG A;  1Y3Q A;  3S9M C;  1N84 A;  1B3E A;  4KYE A;  3IO4 A;  2ZYM A;  1TFA A;  3IB0 A;  4NTL A;  1B3L A;  3T22 A;  2RC9 A;  2OK2 A;  5CRY A;  3PMW A;  4ZEI A;  3IJX B;  1CB6 A;  4LON B;  1ZBM A;  2B3B A;  2UVJ A;  3MQ9 A;  4ELP A;  1B46 A;  4WKM A;  3MWB A;  2ESN A;  4LP2 B;  4ZEF A;  4M1V A;  3T9H B;  2RC7 A;  1B1X A;  1N04 A;  3K1N A;  2HEU A;  1SD3 A;  1B7Z A;  4K3F A;  3PUW E;  2X7P A;  2Y7I A;  4FEB A;  1GGG A;  1QKB A;  4F2O A;  1AL3 A;  3OO9 A;  3MVZ A;  4YB6 A;  1B6H A;  4OQO A;  4P0I A;  2ALU A;  4RPO A;  3FUZ A;  1EZ9 A;  2UVH A;  3H6V A;  2X26 A;  2NWJ A;  4G68 C;  3RNN A;  2CZL A;  1IXH A;  1M5E A;  4NF6 B;  2D3I A;  5JTY B;  1RKM A;  2XXT A;  3EHS A;  2Y7W A;  2G29 A;  4F1U A;  3SEW A;  3EHT A;  1TFD A;  1GV8 A;  5B7D A;  1FQB A;  4QRZ A;  4EF2 A;  1M5B A;  4XKN A;  1OQH A;  3FV1 A;  2PYY A;  4XIG Q;  1LB9 A;  3PPO A;  1NNK A;  3TEL A;  2Y7R A;  5DVI A;  4C1U A;  3TZA A;  3AXF A;  3F11 A;  1B52 A;  2UYF A;  5TPA B;  3IAZ A;  4Z7E A;  4M4G A;  1MH4 A;  3S9E A;  3LBS A;  4LQ2 A;  2VP1 A;  3VLV A;  5M2V A;  3UOR A;  1D4N A;  3G3K A;  3UN6 A;  1I6A A;  4NWC A;  4OZ9 A;  1YCJ A;  3HO7 A;  3IK6 B;  1OIB A;  4U1Z A;  2P2A A;  4ECF A;  4I9D A;  2I0C A;  2OLB A;  1POY 1;  2UXA A;  3RQT A;  5DT6 A;  3ONM A;  4IY6 A;  2P1S A;  5EHS A;  1BLF A;  4JSD A;  1MY4 A;  4H6D A;  2GRV A;  1MXX A;  3U72 A;  3K1P A;  2Z8D A;  2ZXT A;  2NVU B;  4OET A;  1FQC A;  1IIW A;  3G3H A;  4DZ1 A;  3T93 B;  4DE8 A;  4OEV A;  1L5T A;  5AA2 B;  4NF8 B;  3MPL A;  2PBW A;  3FJ7 A;  2VGQ A;  4U23 A;  3FD3 A;  3RUM A;  3GZG A;  2GHB A;  2XX8 A;  4FE8 A;  1Y1M A;  5JK4 A;  2ABH A;  5DEX B;  1B7U A;  4PQJ A;  1D3K A;  1P1Q A;  3U1O A;  3FXQ A;  5CM6 A;  1S9T A;  1QUI A;  1MDP 1;  3KOS A;  2H25 A;  3OEM A;  3PPN A;  5H8N B;  3MJN A;  4ZE8 A;  3I6V A;  1JQF A;  5L9O A;  4QFO A;  3TOD A;  2XX7 A;  2O68 A;  3TKD A;  4YIC A;  1IIT A;  2RCB A;  1OLA A;  3IX1 A;  2DXR A;  3IJO B;  2H9B A;  3PPR A;  2UVG A;  5CMC A;  3O66 A;  3QXM A;  2I58 A;  3S2V A;  4GWO A;  3L6G A;  4TQU Q;  3OEN A;  1MXZ A;  4I62 A;  4L17 A;  3H6T A;  1B3G A;  3CG3 A;  1XS5 A;  3G3I A;  2QS3 A;  5CC2 A;  1A54 A;  4H5G A;  4LQ5 A;  1OLC A;  4WXJ A;  3C36 A;  3FJM A;  3Q29 A;  4GIZ A;  1ZTY A;  2DOJ A;  3K02 A;  3A09 A;  4YKP A;  3TTL A;  4F22 A;  4PFT A;  3HHG A;  3KOT A;  3MP1 A;  5I59 A;  3TCH A;  3UA8 A;  1ELJ A;  5ICT A;  2CMO A;  2HAU A;  4R73 A;  1N0T A;  1USY H;  1S7Y A;  1N7X A;  3CR9 A;  5DTB A;  1A55 A;  1MM6 A;  1PBQ A;  5FHM A;  1MXU A;  4F18 A;  4RNS A;  2FA7 A;  2F35 A;  5DYH A;  1VE4 A;  4EUO A;  4PE5 B;  3VXC A;  3PV0 E;  1RYX A;  4IO7 A;  3C31 A;  4G68 A;  3UK4 A;  2DE2 A;  4NMY A;  1BTJ A;  4NF5 A;  3WAF A;  1ZU0 A;  4GXS B;  1ZIU A;  1DMB A;  1UTH B;  3K6X A;  3FIR A;  1NFT A;  4HCY A;  4ZEB A;  1LCF A;  4KPT A;  1URS A;  5KDT B;  4KI0 E;  4RPN A;  1VSO A;  5H8Q B;  3TTR A;  1M5C A;  4OFJ A;  1FTK A;  2O84 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...