4ELPA

Ferric binding protein in apo form 2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
TLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
publication title Crystal structure of ferric binding protein A
rcsb
source organism Thermus thermophilus
molecule tags Metal transport
total genus 109
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elpA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elpA02
1SYHA 1SW5A 4JXIA 4NMYA 1B51A 2A5TA 2OCUA 4ZEKA 1A54A 2VP1A 3OO9A 5AA1A 1B9JA 4OFOA 3FATA 2RKMA 3RNNA 1D3KA 4XIGQ 3GBAA 1MY3A 3C31A 2ONRA 5DEXB 2F34A 3KSXA 1P1WA 1LFGA 4P0GA 3HHFA 3G3GA 1GVCA 3H03A 1PBQA 3I5OA 1NKXA 2FYIA 2F7BA 4HTGA 1JNFA 1UTBA 4PQJA 3EPEA 1JVYA 3MP1A 3GLBA 4QSEA 1LCTA 2ZYOA 3FXQA 3P7IA 4E0XA 1B3GA 2AIXA 3KG2A 3Q28A 4YMAA 1MH3A 4GXSB 1MG1A 3VLVA 5I2KB 1IXIA 2F8DA 1XS5A 2ONSA 4N07A 1KWHA 1IIWA 2OZZA 2XXIA 4OERA 2P0SA 4Z0IA 3VLUA 4DXCA 1WDNA 3B6WA 3ZKKA 2QS4A 4THIA 5JTYB 4ZZAA 3TQWA 1Z7ME 5ELVA 4YAHX 4KCDA 1JEUA 3JYRA 4YZZA 2DOJA 1QUIA 3LSFB 5CMMA 1OVTA 1BKAA 1Y4TA 5CBRA 1MY2A 5AA2B 1N04A 1B0LA 5CC2A 3KSJA 3S9EA 3FGSA 1TXFA 3Q25A 4Z7EA 1R9QA 2I49A 1NMUA 5H8SA 4DXBA 5ITPA 2CZLA 5CMKA 4O3AA 3ZKLA 1A7LA 1N76A 1MH4A 4PFTA 3O2AA 1CE2A 2H98A 3USDA 2XHDA 4TLLB 5HBCA 4LZ5A 3T9UA 3FJMA 3H6TA 3QIMA 3O6GA 1OIBA 3C33A 1XT8A 1D4NA 4QFOA 1MPDA 3UK4A 3M3FA 3PPRA 3KN3A 4DIGA 3CFZA 3LC8A 5EYFA 4BDQA 3HPIA 4PFWA 1IEJA 4U4SA 4U1OA 2XXTA 2THIA 5FTHA 2PT2A 4GOTA 4OEUA 1VFEA 3ZS6A 1UIVA 3RUMA 2O7IA 3PPNA 5H8NB 1I6BA 5H8HA 3THIA 3I3VA 4ELRA 3A09A 4G68B 4NF5B 3UP9A 5ICTA 1ZMGA 2Z8EA 1Y3PA 5HPQA 2Y7IA 5JEIA 4GXAA 4R74A 3S9MC 3SEVA 5KCJA 3FJGA 1DOTA 3HCQA 5HM4B 5CMCA 1SDXA 4JBZA 3SEUA 2ONKE 4F19A 4ND9A 4IO3A 1Y3QA 3OD7A 4QFNA 5KZTA 4IY5A 3MVWA 5CMBA 4F3BA 1NL5A 3QAXA 3TTMA 1SD3A 4L17A 2ANJA 1B4ZA 1R9LA 3TFLA 1DMBA 3T9VA 1IZ1A 1Y20A 4KPTA 1LFIA 1BLFA 1S9TA 3PMVA 1FQAA 1P1QA 4I62A 4X48A 1ANFA 3MZBA 2RF1A 1H3DA 2I3VA 4UA8A 1Y4CA 1IITA 3CFLA 2Y7RA 3G7WA 4OXVA 5H8FB 2GH9A 3TCFA 3HN0A 5IKBA 3TZAA 5DEXA 1US5A 4OMBA 1WVJA 3OEMA 2DWAA 4ZEDA 2RCAA 3FVNA 4PFUA 1GGGA 5DVJA 1H45A 2REJA 1YPNA 4ESWA 4U2RA 1H44A 4YMBA 3W15C 5B7DA 3V5AA 4JWOA 1B52A 4KI0E 4XTCQ 3G3JA 4ISUA 3MWBA 4XXUA 3E3KA 2PMSA 1MXUA 4LQ2A 4GIZA 5I2KA 3UN6A 3DP8A 2QS2A 2VGQA 1JVXA 5I84A 2HAUA 4H1XA 3ILTB 1FW0A 2Z23A 3O29A 5DT6A 3RN8A 5JTYA 3MPKA 1N0TA 3PUZE 3ZSFA 2WKYA 2AL5A 4RXLA 3MVYA 3DP6A 2HZLA 1A8EA 1YAEA 3LSLA 1ZLQA 5AA2A 2XD3A 1P1NA 3IOWA 3U94A 2D3IA 2OWSA 3BFUA 1QW0A 2Z8DA 3VXCA 3UGWA 5AA3A 1Y3NA 4KFQA 1MQHA 4LATA 5FHOA 3DM0A 1XVYA 1II5A 3O28A 1M5DA 4OESA 1QUKA 4WKMA 1JW4A 2F7CA 4ZEIA 1MRPA 1SI1A 3ONMA 4R9GA 3K6UA 3KEIA 4KR5A 3S9LC 3A3CA 1SYIA 2UVIA 2B3FA 1YTVA 3FXUA 1MY1A 4KQPA 1DSNA 2Y7PA 3OENA 3PV0E 1J1NA 3VLWA 3QYTA 1OQGA 1NNTA 3FXRA 2X7PA 2ESNA 1MM6A 3HHGA 4JSDA 2KLFA 1NH7A 1SBPA 5L8DA 1WODA 4FIMA 1DPEA 1B7HA 2HFBA 1N3XA 3B6TA 5H8NA 4QSCA 2UXAA 2QL3A 1N3WA 1GTKA 1R6ZA 4GRKA 2YLNA 4G68A 4NF5A 2REGA 5AA4B 1TT1A 3KFMA 1RYXA 4MBPA 4G8HA 1SW1A 2O7UA 1M5FA 2P1SA 4H67A 4DCXA 2F6GA 4F3SA 3PPQA 3T22A 4FAJA 1M5CA 2D5WA 3SERA 1RKMA 2QPQA 3ECRA 1URGA 3EF7A 2RC8A 2HCAA 4RK9A 3O66A 1B1HA 2F7AA 1Y1ZA 1FQDA 4NF8B 3TTKA 1SI0A 4XKRA 2HQ0A 4IGTA 3CRBA 1NNKA 4I8CA 3HV1A 1MM7A 3N5LA 3K02A 5TPAB 4NF4B 3RLFE 3HO7A 1OVBA 5TU0A 4JDFA 1QULA 1SW4A 3IJXB 3PPPA 1O64A 1B05A 5H8FA 4DCYA 2D21A 4XKPA 4GQOA 3S4UA 2V84A 4M4GA 2UVGA 4IGRA 1LB8A 4ZZEA 1N7WA 1PB7A 2YJPA 5L9MA 3QXMA 4GL0A 1B40A 1B1XA 3MW0A 1POTA 1B7UA 3PD8A 2HAVA 1TFAA 1XVXA 3KOTA 3B6QA 4FORA 3MUQA 2ZNTA 4OYVA 2O1LA 4KYEA 5I2NA 3MJNA 3EN3A 5EHSA 1A55A 3H06B 3IL1B 3K6VA 4JWXA 3T9XB 4DE8A 5A5XB 2FA7A 3SEXA 2Q2CA 3OEKA 1RYOA 3Q29A 3DP4A 4HW8A 5TP9B 2DYXA 5I59B 4KYSA 4ONYA 4H65A 5AA2D 2B3BA 2XD2A 3FV2A 1MS7A 5ITOA 3S9NC 3BFTA 1D9YA 2X26A 2DXRA 4RPOA 4EXKA 1OLAA 4OVJA 3TCHA 2Y7KA 4FE8A 3MQ9A 2I3WA 2NUVA 2XX9A 3MZ9A 1P1UA 3VDFA 1N84A 3IOUA 1QVSA 4R73A 5K2YA 4F1YA 2NXOA 3MVZA 3G3HA 3VXBA 3SESA 4ELQA 2OK2A 4KCCA 5I57B 1XC1A 1LBBA 2I0BA 4IO4A 4H0WA 2ZMBA 4XKQA 4F18A 2GHBA 4PP0A 4BDRA 3U1OA 3CI8A 4NWCA 3OOAA 1JEVA 2GRVA 1ZBMA 5LOMA 5H8QB 3U8QA 2GHAA 4R9FA 2OWTA 1ZKBA 3OO7A 4MF3A 4ZDMA 2XXHA 3FJ7A 3CVGA 4IY6A 3V8XB 3IB2A 2OBGA 4F22A 5FTIA 2H25A 3CIJA 2O68A 3IOTA 5I56B 4R75A 1LCFA 3LR1A 3EQ1A 4EF1A 3G3IA 2XXYA 5BWJA 4AB6A 3K01A 1ZJLA 4LZ7A 4AQ4A 4OZ9A 1AIVA 4BLAA 1L5TA 1IUDA 1EH3A 3PPOA 1POY1 1QJMA 2DWHA 1M5EA 5DVIA 3AXFA 4LQ5A 3OSRA 2PYYA 4M1VA 4Q30B 1FTLA 1XHYA 1SW2A 5AA4A 3C34A 1TFDA 2DVZA 4NEDA 4NF6B 1LAXA 2HXWA 2A5TB 4LONB 2G93A 1B2HA 4RY1A 3VFJA 2LAOA 5F1QA 3C9HA 4OEVA 3K00A 3RTFB 3SEYA 2ZXTA 3N26A 3SDFA 4TOZA 2I4CA 4WEPA 1NNPA 2VHAA 4YICA 1EZOA 4LUBA 4N6PA 4GFRA 4FECA 1AL3A 1GR2A 4XKNA 2F36A 3TCGA 2Q2AA 1PC3A 2DSFA 4POWA 3EHUA 1LSTA 3TTNA 1IQ7A 4YU0A 4MLVA 3IB1A 5FHNA 3PUVE 3IAZA 1LAGE 1M5BA 4F29A 2H4IA 1VE4A 2A5SA 3F11A 3O97A 5F7VA 4C1TA 4G2ZA 4O3CA 3W9VA 3ILUB 1B32A 1MXYA 3MP6A 4N13A 2UVJA 3T66A 1H43A 2IA4A 4Q8RA 1URDA 3MC2A 4FJPA 2FNCA 1SQYA 3C36A 4FEBA 3UORA 3TYHA 4OTEA 1MDQA 3C4MA 4IO2A 4U21A 1F9BA 3OO8A 2OLBA 3DLNA 2QS3A 2Q9TA 4U1ZA 2Q89A 3WAEA 4GL8A 4OFJA 3RT8A 1JQFA 3B7DA 4BDNA 1B6HA 1MY4A 2ZNSA 4BDLA 4U23A 4POXA 3RTWB 5TP9A 2E1SA 5KDTB 4QHQA 5I59A 4I9DA 1FTMA 3PMXA 3VV5A 3RT6B 1Z7NE 3K6XA 2ZYKA 3MP8A 3L6GA 5JK4A 2QS1A 3CFXA 3G3FA 1JETA 5CI5A 3RGYA 2ABHA 3MPLA 1SVXB 2AYSA 2I4BA 4RK2A 2VD2A 3M3KA 4BDOA 3H7MA 3CSGA 2NWJA 1HSJA 4RPNA 2O69A 1HSLA 3FVGA 4BDMA 1A99A 2V25A 2DWIA 1IXCA 4H8JA 1B5IA 4Q0CA 3SKPA 4P0IA 2M8CA 4RNSA 4DLDA 5BUUA 5CRYA 3TUSA 3LBSA 3T9HB 5H8QA 1B4HA 1B7ZA 3LSWA 3RY3A 2RINA 4ZECA 5CM6A 2QMWA 3VVEA 2G29A 4UACA 3ODBA 3CG1A 5M2VA 3L6HA 5L9OA 4HS7A 1EZPA 1B5JA 4F2QA 2PBWA 3TODA 2O51A 3T93B 5I56A 1PB9A 4H6DA 3R26A 2DP8A 3LSXA 1NNFA 2QRYA 4ZE8A 2V3TA 1D9VA 1MQGA 3FASA 1Q1KA 3KOSA 4DZ1A 2R71A 2W7YA 2NOOA 5DTBA 4OFLA 3U92A 3TMGA 5B70A 4QSDA 4EQBA 3MZ1A 1MQJA 1LBCA 2Q8JA 2XX8A 3IOVA 4NF6A 3UA8A 2XXVA 2ALUA 3PUXE 3IX1A 3GZGA 2GFEA 3KGCA 3K1MA 3BBRA 4X1DA 3JV9A 4QFKA 4G77A 4G4PA 3N94A 1H76A 2OJTA 3CG3A 3H6WA 4GVOA 2PT1A 1MPCA 1FCKA 4X1BA 1IXHA 4IO7A 2XXRA 2V93A 2DE2A 3CR9A 2F78A 1USYH 3K6WA 1LB9A 1A40A 3QSLA 1FTJA 2CMOA 4EF2A 3Q27A 1BIYA 3TAJA 3EHTA 2BJJX 1EZ9A 4R2FA 2V3QA 1DTZA 3TTLA 3QUFA 4EQ7A 4EXLA 3MAMA 3OELA 3A3UA 1CB6A 4F1VA 3E9XA 2X7QA 4AB5A 4QF9A 2F5XA 2O6AA 2Y84A 4R2BA 3TPAA 2PVUA 2RCBA 4P11A 2RC9A 4LA9A 3TQLA 5DYHA 1FQFA 5ISUA 2B65A 1UTHB 1BTJA 4IO5A 3D4GA 3EHSA 4FATA 1B3FA 4G68C 3TTRA 4X9TA 3PGFA 1MPBA 4ZE9A 1QUJA 2H5YA 1JW5A 4RJZA 4MFIA 3R6UA 4OQOA 5KDTA 1B58A 4E0WA 1I6AA 1AOVA 3N6UA 3I6VA 4YKKA 4YKPA 1PB8A 4HCWA 4YB6A 5I58B 4R72A 3HSTA 3C32A 3IB0A 4R6HA 4GLIA 1O63A 1AMFA 3OMBA 3KJ7A 4F3PA 4PETA 2ZYNA 4F31B 1XOCA 1FQCA 4KYDA 3SETA 3W9WA 4K3FA 3O6HA 2I48A 2R6GE 2QJEA 3KN7A 4YKIA 5CBSA 3R7XA 2F35A 2DE3A 4R6YA 2ZNUA 2UVHA 3O9PA 3RPWA 3GBBA 2V3UA 4LP2B 1PDAA 4DXUA 2Y7WA 4IO6A 3FVOA 4FEDA 1MXVA 3FZVA 3IORA 3S2VA 3KZGA 5ICQA 2O84X 3JZJA 1ZIUA 1URSA 1GV8A 3MBPA 4F3GA 1Y1MA 4C0RA 4TLMB 1LGBC 3E13X 2ZYMA 1MY0A 3OXNA 3MVXA 1OLCA 1DPPA 4U4XA 4IB2A 3D4CA 1MXXA 1PEBA 2VOZA 1OMPA 2QMXA 3OSQA 2YPNA 2XX7A 3G3KA 1PBPA 4ELPA 1MXZA 2DQVA 1MQIA 2Z8FA 4G8MA 3FD3A 4KD5A 3U93A 4OENA 5J1DA 5IAIA 5L9SA 4F39A 2R9JA 1US4A 3M3LA 1S50A 2I58A 3PUYE 2NVUB 2H9BA 4GD5A 3H3GA 4NF8A 4OWDA 5AE4A 2IEEA 4OHNA 1T0KA 1AH5A 5TPAA 4NF4A 5DVFA 2Z22A 3H6VA 3UIFA 4G8NA 1B3EA 4MH5A 3WAFA 1UTBB 4F1UA 3TKDA 1UQWA 4WXJA 2XXUA 1ZU0A 4RYAA 2DWJA 3QK6A 4PE5B 1VSOA 2XXWA 2I6EA 2Q88A 1YCJA 3KBRA 2P2AA 4RA1A 3BKIB 4ZEFA 1IXGA 4H8IA 1LFHA 3PD9A 4QFPA 1B3LA 4HCYA 4MLQA 4YKJA 3C35A 5I2NB 4PFYA 1Y9UA 2F6PA 1S7YA 3K0VA 4O3BA 3E4RA 3H4ZA 1B5HA 3FIRA 3VVDA 1B3HA 4OETA 1LAHE 1USYE 4EQ9A 4JSOA 4TQUQ 5A5XA 4H5FA 3FVKA 2HZKA 3VE1B 4ELOA 1UTHA 2AL4A 4GWOA 1TWYA 4KHZE 1B46A 4ZS9A 1P99A 3PMWA 4R6KA 4NTLA 1QKAA 4YB5A 3Q26A 2QSXA 2O1MA 3IK6B 3K1PA 1BP5A 2DXYA 1R1NA 2DE4A 1MQDA 3T96B 1LAFE 2UYEA 1MXWA 2DVCA 1ZTYA 2H99A 4EDPA 4GF8A 4QFLA 4LZ8A 3IJOB 1Q35A 3OO6A 2UYFA 3LUYA 3O6IA 1I6QA 1A8FA 1FQBA 5FHMA 2E0SA 5I58A 2PX1A 4Q5TA 3V83A 5I57A 2XXQA 3PU5A 1P1OA 3IO6A 1ATGA 1ELJA 3K4UA 3CSBA 3FUZA 4NWDA 4DDDA 5EHMA 3FV1A 3RQTA 2HEUA 4ESXA 4LVQA 3PUWE 3H6UA 3V89B 1I69A 4ECFA 3IO4A 3U72A 1OQHA 3M8UA 3TELA 1VFDA 2XXXA 1QKBA 4NE4A 1VR5A 1O7TA 1EU8A 4H5GA 4JB7A 2DS9A 3K1NA 1NFTA 2F97A 4QRZA 4ZEBA 1HSEA 3KN8A 1FTOA 2VD3A 1B0HA 4EUOA 4YB7A 1NH8A 4U22A 5H8HB 3IR1A 2RC7A 2XXPA 4WEDA 3DELB 3N6TA 4I1DA 3KJTA 4C1UA 1UIUA 1FQEA 3QUJA 3K2DA 3VVFA 1MDP1 3TEPA 5KCJB 5K2XA 2I0CA 1DTGA 4F2OA 3TDJA 1LLSA 3SEWA 1N7XA 1FTKA 3GXAA 1JW1A 4JWYA
chains in the Genus database with same CATH superfamily
1SYHA 1SW5A 2P3VA 4JXIA 4NMYA 1B51A 2A5TA 2OCUA 4ZEKA 3MSTA 1A54A 4NN3A 2VP1A 3OO9A 5AA1A 1B9JA 4OFOA 3FATA 2RKMA 5EQ7A 1FBDA 1K9ZA 3RNNA 4P56A 1NV3A 3FBPA 1D3KA 4XIGQ 3GBAA 1MY3A 3C31A 2ONRA 5DEXB 2F34A 3KSXA 5IZ3A 1P1WA 1LFGA 4P0GA 1NUYA 3HHFA 2VPNA 3G3GA 1GVCA 3H03A 1FPFA 1PBQA 3I5OA 1NKXA 2FYIA 2F7BA 1IMBA 4PF8A 4HTGA 1JNFA 1UTBA 4PQJA 3EPEA 1JVYA 3MP1A 3GLBA 4QSEA 1LCTA 2ZYOA 3FXQA 3P7IA 2Y5KA 2WYPA 4E0XA 1B3GA 2AIXA 3KG2A 3Q28A 3RYDA 4YMAA 1MH3A 4GXSB 1MG1A 3VLVA 5I2KB 1IXIA 1YYZA 2F8DA 1XS5A 2ONSA 4N07A 1KWHA 1IIWA 2OZZA 2XXIA 4OERA 2P0SA 4Z0IA 3VLUA 4DXCA 1WDNA 3B6WA 3ZKKA 2QS4A 4THIA 5JTYB 4ZZAA 4P47A 3TQWA 1Z7ME 5ELVA 4XFEA 4YAHX 4KCDA 2Y5LA 1JEUA 3JYRA 4YZZA 2DOJA 1EYJA 1QUIA 3LSFB 5CMMA 1OVTA 1BKAA 1Y4TA 4NX1A 5CBRA 1MY2A 5AA2B 1N04A 1B0LA 5CC2A 3KSJA 3S9EA 3FGSA 2QVRA 1TXFA 4I3YA 1JP4A 1G0IA 4NAPA 3Q25A 4Z7EA 1R9QA 2I49A 1NMUA 1FPJA 1RDXA 5H8SA 4DXBA 5ITPA 2CZLA 5CMKA 4O3AA 1NV6A 3ZKLA 1A7LA 1N76A 1MH4A 4PFTA 3O2AA 4LN5A 1CE2A 2H98A 3USDA 5ET8A 2XHDA 4TLLB 5HBCA 4LZ5A 3T9UA 3FJMA 3H6TA 3QIMA 3O6GA 4XEQA 1OIBA 3C33A 1XT8A 4PFBA 1D4NA 4QFOA 1MPDA 3UK4A 3M3FA 3PPRA 3KN3A 4DIGA 3CFZA 3LC8A 5EYFA 4BDQA 3HPIA 4PFWA 1IEJA 4U4SA 4U1OA 2XXTA 2THIA 1INPA 5FTHA 2PT2A 4GOTA 4OEUA 1VFEA 3ZS6A 1UIVA 3RUMA 2O7IA 3PPNA 5H8NB 1I6BA 5H8HA 3THIA 4PGNA 1NUXA 3I3VA 4ELRA 4PAIA 5IGAA 3A09A 4G68B 4NF5B 3UP9A 4MEVA 5ICTA 1ZMGA 2Z8EA 2MKZA 1Y3PA 5HPQA 2Y7IA 2F3DA 5JEIA 4GXAA 4H46A 4R74A 3S9MC 2XWVA 3SEVA 5KCJA 3FJGA 2DDKA 1DOTA 3HCQA 5HM4B 5CMCA 1SDXA 4JBZA 3SEUA 2ONKE 4F19A 4ND9A 5EQ8A 4IO3A 1Y3QA 3OD7A 4QFNA 5KZTA 4IY5A 3MVWA 5CMBA 2KQZA 4F3BA 1NL5A 3QAXA 3TTMA 1SD3A 4L17A 2ANJA 2R8TA 1B4ZA 1R9LA 3TFLA 1DMBA 3T9VA 1IZ1A 1Y20A 1FPDA 4KPTA 1LFIA 1BLFA 2FHYA 1S9TA 3PMVA 1FQAA 1P1QA 4I62A 4X48A 2OWZA 1ANFA 3MZBA 2RF1A 1H3DA 2Q8MA 4NF0A 2I3VA 4UA8A 5EYHA 1Y4CA 1IITA 3CFLA 1NV1A 2Y7RA 3G7WA 4OXVA 5H8FB 2GH9A 3TCFA 4MNCA 4PC9A 3HN0A 5IKBA 3TZAA 5DEXA 1US5A 4OMBA 1WVJA 4G61A 3OEMA 2DWAA 4ZEDA 2RCAA 3FVNA 4PFUA 1GGGA 5DVJA 1H45A 2REJA 1YPNA 4ESWA 4U2RA 5I7IA 1H44A 4YMBA 3W15C 5B7DA 3V5AA 4JWOA 1B52A 4KI0E 4XTCQ 2FVZA 5EYGA 3G3JA 4ISUA 3MWBA 4XXUA 3B8BA 3E3KA 4GX4A 5EQ9A 2PMSA 1FPBA 1MXUA 4LQ2A 4GIZA 5I2KA 2PCRA 4NG7A 3UN6A 3DP8A 2QS2A 2VGQA 1JVXA 5I84A 2QVVA 2HAUA 4H1XA 3ILTB 1FW0A 2Z23A 3O29A 4MHFA 5DT6A 3RN8A 5JTYA 3MPKA 1N0TA 3T1BA 3PUZE 3ZSFA 2WKYA 5DW8A 2AL5A 4RXLA 1DK4A 3PTYA 3MVYA 3DP6A 2HZLA 5EQAA 1A8EA 1IMAA 1YAEA 3LSLA 2VPOA 1ZLQA 4N81A 5AA2A 2XD3A 1P1NA 3IOWA 3U94A 5LTCA 2D3IA 2OWSA 3BFUA 1QW0A 2Z8DA 3VXCA 3UGWA 5AA3A 1Y3NA 4KFQA 1MQHA 4LATA 2FBPA 5FHOA 3DM0A 1XVYA 1II5A 3U65A 4MNIA 1NV0A 3O28A 1M5DA 4OESA 1QUKA 4WKMA 1JW4A 2F7CA 4ZEIA 1MRPA 1SI1A 3ONMA 4R9GA 3K6UA 3KEIA 1LBZA 4KR5A 3S9LC 3A3CA 1SYIA 2UVIA 2B3FA 1YTVA 3FXUA 1MY1A 4KQPA 1DSNA 2Y7PA 3OENA 3PV0E 1J1NA 3VLWA 3QYTA 4NHBA 1OQGA 1NNTA 4OVRA 5IZZA 3FXRA 2X7PA 4I3EA 2ESNA 1MM6A 3HHGA 4JSDA 2KLFA 1NH7A 1SBPA 5L8DA 1WODA 4GX3A 4FIMA 1DPEA 1B7HA 2HFBA 1N3XA 3B6TA 5H8NA 4QSCA 2UXAA 2QL3A 1N3WA 1GTKA 1R6ZA 4GRKA 2YLNA 4AS5A 4G68A 4NF5A 2REGA 2WBBA 5AA4B 1TT1A 3KFMA 1RYXA 4MBPA 4MX6A 4G8HA 1SW1A 2O7UA 4O8MA 1M5FA 2P1SA 4H67A 4DCXA 2F6GA 4F3SA 3PPQA 3T22A 4FAJA 1M5CA 2D5WA 1K9YA 3SERA 1RKMA 2QPQA 3ECRA 2JJKA 1URGA 3EF7A 4GX6A 2RC8A 2CZHA 2HCAA 1EYIA 4RK9A 3O66A 1B1HA 2F7AA 1Y1ZA 1FQDA 4NF8B 3TTKA 1SI0A 4NGUA 4XKRA 2HQ0A 4IGTA 3CRBA 4MAGA 1NNKA 4I8CA 3HV1A 1MM7A 3N5LA 1FPGA 3K02A 4NF4B 5TPAB 3RLFE 3HO7A 1OVBA 5TU0A 1FPKA 4JDFA 1QULA 1SW4A 3IJXB 3PPPA 1NUZA 1O64A 1G0HA 1B05A 5H8FA 4DCYA 2D21A 4XKPA 4GQOA 4JVCA 3S4UA 2V84A 4M4GA 2UVGA 4IGRA 1LB8A 4ZZEA 1N7WA 1PB7A 2YJPA 5L9MA 3QXMA 4GL0A 1B40A 1B1XA 3EKIA 3MW0A 1POTA 1B7UA 3PD8A 4P3LA 2HAVA 1TFAA 2HXRA 1XVXA 3KOTA 3B6QA 4FORA 4PDHA 3MUQA 2ZNTA 4HE1A 4OYVA 2O1LA 4KYEA 5I2NA 3MJNA 3EN3A 5EHSA 1A55A 4JVIA 3H06B 3IL1B 3K6VA 4JWXA 1KZ8A 3T9XB 4DE8A 2QVUA 5A5XB 2FA7A 4O7MA 3SEXA 2Q2CA 3OEKA 1RYOA 3Q29A 3DP4A 4HW8A 5TP9B 2DYXA 5I59B 4KYSA 4ONYA 4H65A 5AA2D 2B3BA 2XD2A 3FV2A 1MS7A 5ITOA 3S9NC 1FJ9A 3BFTA 1IMCA 1D9YA 2X26A 2FIXA 2DXRA 5LDZA 4RPOA 4EXKA 1OLAA 4OVJA 4P8BA 1SPIA 3TCHA 2Y7KA 4FE8A 3MQ9A 2I3WA 4AS4A 2NUVA 2XX9A 3MZ9A 1P1UA 3VDFA 2HPGA 2ZZVA 2XWKA 1N84A 3IOUA 1QVSA 4R73A 5K2YA 4F1YA 2NXOA 3MVZA 3G3HA 3VXBA 3SESA 4ELQA 2OK2A 4KCCA 5I57B 1FPIA 1XC1A 4P1EA 1LBBA 2I0BA 4IO4A 4H0WA 2ZMBA 4XKQA 4F18A 2GHBA 4PP0A 4BDRA 3U1OA 3CI8A 4NWCA 3OOAA 3RPLB 1JEVA 2GRVA 1ZBMA 5LOMA 5H8QB 1LBWA 2ZZWA 1NV4A 3U8QA 4I40A 2GHAA 4R9FA 2OWTA 1ZKBA 1VDWA 3OO7A 4MF3A 4ZDMA 2XXHA 3FJ7A 4PTKA 3CVGA 4IY6A 3V8XB 3IB2A 2XWOA 2OBGA 4F22A 5F24A 5FTIA 2H25A 3CIJA 2O68A 3IOTA 5I56B 4R75A 1LCFA 3LR1A 3EQ1A 4EF1A 3G3IA 2XXYA 5BWJA 4AB6A 3K01A 1ZJLA 4LZ7A 4AQ4A 4OZ9A 1AIVA 4O7IA 3LUZA 4BLAA 1L5TA 3E79A 1IUDA 1EH3A 3PPOA 1POY1 1QJMA 2DWHA 4PFRA 1M5EA 1LEVA 5DVIA 3AXFA 4LQ5A 3OSRA 2PYYA 4OA4A 4M1VA 4Q30B 1FTLA 1XHYA 1SW2A 5AA4A 3C34A 4N8YA 4OVPA 1TFDA 2DVZA 4NEDA 4NF6B 2F3BA 1LAXA 2HXWA 2A5TB 2P3NA 4LONB 2G93A 1B2HA 4RY1A 3VFJA 2LAOA 5F1QA 3C9HA 4OEVA 3K00A 3RTFB 1FPLA 3SEYA 2ZXTA 3N26A 3SDFA 4TOZA 2I4CA 4WEPA 1NNPA 2BJIA 2VHAA 4GWXA 1EYKA 4YICA 1EZOA 2VT5A 4LUBA 4N6PA 4GFRA 5ET6A 4PE3A 4FECA 1AL3A 1GR2A 4HE0A 4XKNA 2F36A 3TCGA 2Q2AA 1PC3A 2DSFA 4POWA 3EHUA 1LSTA 4GWUA 3TTNA 1IQ7A 4YU0A 4MLVA 3IB1A 3IFAA 5T3JA 5FHNA 3PUVE 3SZPA 3IAZA 3ROJA 1LAGE 1M5BA 4F29A 2H4IA 1VE4A 2A5SA 3F11A 3O97A 5F7VA 4C1TA 4G2ZA 4O3CA 3W9VA 3ILUB 1B32A 1MXYA 3MP6A 1DCUA 4N13A 2UVJA 3T66A 1H43A 2IA4A 4Q8RA 1URDA 3MC2A 4FJPA 2FNCA 1IMFA 1IMEA 1SQYA 3C36A 4FEBA 3UORA 3TYHA 4OTEA 1MDQA 3C4MA 4IO2A 4FBPA 4U21A 1F9BA 3OO8A 1LBXA 2OLBA 3DLNA 2QS3A 2Q9TA 4U1ZA 2Q89A 3WAEA 5FBPA 4GL8A 4OFJA 5ET7A 3RT8A 1JQFA 3B7DA 4BDNA 1B6HA 4N6DA 4X8RA 1MY4A 2ZNSA 4BDLA 4U23A 4POXA 3RTWB 5TP9A 2E1SA 5KDTB 1Q9DA 2CEYA 4QHQA 5I59A 2B4MA 4QBAA 4I9DA 1YZ0A 4OANA 3D1RA 1FTMA 3PMXA 3VV5A 3RT6B 1Z7NE 3K6XA 2ZYKA 5J16A 3MP8A 3L6GA 5JK4A 2QS1A 3CFXA 3G3FA 1JETA 5CI5A 3RGYA 2ABHA 3MPLA 1SVXB 2AYSA 4GWWA 2I4BA 4RK2A 2VD2A 3M3KA 4BDOA 3H7MA 3CSGA 2NWJA 1HSJA 4OVTA 4RPNA 5I3SA 2O69A 1HSLA 3FVGA 4BDMA 1A99A 2V25A 2DWIA 1D9QA 1IXCA 4H8JA 1B5IA 4Q0CA 3SKPA 1IMDA 1RDYA 4P0IA 2M8CA 3MYUA 4RNSA 4DLDA 2FIEA 5BUUA 4O94A 5CRYA 3TUSA 3LBSA 3T9HB 5H8QA 1B4HA 1B7ZA 3LSWA 3RY3A 2RINA 4ZECA 5CM6A 2QMWA 3VVEA 2G29A 4UACA 3ODBA 3CG1A 5M2VA 3L6HA 5L9OA 4HS7A 1EZPA 1B5JA 4F2QA 2PBWA 3TODA 4XF5A 2O51A 3T93B 5I56A 2XWIA 1PB9A 1FTAA 4H6DA 3R26A 1FRPA 1FPEA 2DP8A 3LSXA 1NNFA 2V4CA 5A5LA 2QRYA 4ZE8A 2V3TA 1D9VA 1MQGA 3FASA 4N4UA 1Q1KA 3KOSA 4HE2A 4P1LA 2R71A 4DZ1A 2W7YA 2NOOA 5DTBA 4OFLA 3U92A 3TMGA 5B70A 4N91A 4QSDA 4PBQA 4EQBA 3MZ1A 1MQJA 1LBCA 1NV5A 4IR8A 2Q8JA 4GWSA 2XX8A 3IOVA 4NF6A 3UA8A 4OVSA 2B4LA 2XXVA 2ALUA 3PUXE 3IX1A 3GZGA 2GFEA 3KGCA 3K1MA 3BBRA 4X1DA 4KXPA 3JV9A 1LBVA 1RDZA 4QFKA 4G77A 4G4PA 3N94A 1H76A 2OJTA 3CG3A 3H6WA 5ET5A 4GVOA 2PT1A 1MPCA 1FCKA 4X1BA 4MJOA 1IXHA 4IO7A 2XXRA 2V93A 2DE2A 3CR9A 2F78A 1USYH 5I5PA 3K6WA 1LB9A 4H45A 1A40A 3QSLA 1FTJA 2CMOA 4EF2A 3Q27A 1BIYA 3TAJA 3EHTA 1AWBA 2BJJX 1EZ9A 4R2FA 2V3QA 2KR0A 1DTZA 3TTLA 3QUFA 4EQ7A 4EXLA 3MAMA 3OELA 3A3UA 3GYYA 1DBZA 1CB6A 4F1VA 3IFCA 3E9XA 2X7QA 4AB5A 4QF9A 2F5XA 2O6AA 2Y84A 1XI6A 4R2BA 3TPAA 2Q74A 2PVUA 2RCBA 4P11A 2RC9A 4DI4B 4LA9A 2CZIA 5IM2A 3TQLA 5DYHA 1FQFA 5ISUA 2B65A 4PBHA 1UTHB 1BTJA 4IO5A 3D4GA 3EHSA 4FATA 2PFYA 1B3FA 4G68C 3TTRA 4X9TA 3PGFA 1MPBA 4ZE9A 1QUJA 1NUWA 2H5YA 1JW5A 4GWYA 4RJZA 4MFIA 3R6UA 4OQOA 5KDTA 1B58A 4E0WA 5ESYA 1I6AA 1AOVA 3N6UA 3I6VA 4YKKA 4YKPA 1PB8A 4HCWA 4YB6A 5I58B 4R72A 3HSTA 3C32A 3IB0A 4R6HA 4GLIA 1O63A 1AMFA 3OMBA 3KJ7A 4N15A 4F3PA 4X04A 4PETA 2ZYNA 4F31B 1XOCA 1FQCA 4N8GA 4KYDA 3SETA 3W9WA 3ISPA 4K3FA 3O6HA 2I48A 2R6GE 2QJEA 3KN7A 4YKIA 3BIGA 5CBSA 3R7XA 2F35A 2DE3A 4R6YA 1FSAA 4OVQA 4P9KA 2ZNUA 3BIHA 4PAFA 3KBZA 2UVHA 3O9PA 3RPWA 3GBBA 2V3UA 4LP2B 1PDAA 4DXUA 2ZZXA 1KA0A 2Y7WA 4IO6A 3FVOA 4FEDA 1MXVA 3FZVA 3IORA 4PGPA 1FBCA 3S2VA 3KZGA 5ICQA 2O84X 3JZJA 1ZIUA 1URSA 3T0JA 1GV8A 3MBPA 4F3GA 1Y1MA 4C0RA 1CNQA 4TLMB 1LGBC 4NQ8A 3E13X 2XA5A 2ZYMA 1FBHA 1MY0A 3OXNA 4MMPA 4GBVA 3MVXA 1NV2A 1OLCA 1DPPA 4U4XA 4IB2A 1LBYA 3D4CA 1MXXA 1PEBA 2VOZA 1OMPA 2QMXA 3OSQA 2YPNA 2XX7A 3G3KA 1PBPA 4ELPA 1MXZA 4MIJA 2DQVA 1MQIA 2Z8FA 4GBWA 4G8MA 3FD3A 5IZ1A 4KD5A 3QMFA 1BK4A 4PDDA 3U93A 4OENA 5J1DA 5IAIA 4HXVA 1FBPA 5L9SA 4F39A 2R9JA 1US4A 3M3LA 1S50A 2I58A 3PUYE 2NVUB 2H9BA 4GD5A 3H3GA 4NF8A 4OWDA 5AE4A 2IEEA 4OHNA 1T0KA 5IZ3B 1AH5A 5TPAA 4NF4A 5DVFA 2Z22A 3H6VA 3A29A 3UIFA 4G8NA 2CZKA 1B3EA 3FXBA 4MH5A 1QGXA 4QXDA 3WAFA 1UTBB 4F1UA 3TKDA 4DI3D 1UQWA 4WXJA 2XXUA 1ZU0A 4RYAA 2DWJA 3QK6A 4PE5B 1VSOA 2WX9A 2XXWA 2I6EA 2Q88A 1YCJA 3KBRA 3KC0A 2P2AA 4RA1A 3BKIB 4ZEFA 1IXGA 4H8IA 1LFHA 3PD9A 4QFPA 1B3LA 1YXIA 4HCYA 4MLQA 4MNPA 4YKJA 3C35A 5I2NB 4PFYA 1Y9UA 1FJ6A 2F6PA 1S7YA 3K0VA 4O3BA 3E4RA 3H4ZA 1B5HA 2HHMA 4UABA 3FIRA 3VVDA 1B3HA 4OETA 1LAHE 3NOHA 1USYE 4EQ9A 4JSOA 4N6KA 4TQUQ 5A5XA 4H5FA 3FVKA 2HZKA 4N17A 3VE1B 4ELOA 2L5VA 1UTHA 2AL4A 4GWOA 2WBDA 1TWYA 4KHZE 1B46A 4ZS9A 1P99A 3PMWA 2GQ1A 4R6KA 4NTLA 2WEFA 1QKAA 4YB5A 3Q26A 2QSXA 2O1MA 3IK6B 3K1PA 1BP5A 2DXYA 1R1NA 2DE4A 2OX3A 3LV0A 1MQDA 3T96B 1LAFE 2UYEA 1MXWA 2DVCA 1ZTYA 2H99A 4EDPA 4GF8A 2CEXA 4QFLA 4LZ8A 3IJOB 1NV7A 1Q35A 3OO6A 2UYFA 3LUYA 3O6IA 1I6QA 2XXKA 1A8FA 1FQBA 5FHMA 2E0SA 5I58A 2PX1A 4Q5TA 1NI9A 3V83A 5I57A 2XXQA 3PU5A 1P1OA 3IO6A 1ATGA 4JVDA 1ELJA 3K4UA 3CSBA 3FUZA 4NWDA 4DDDA 5EHMA 3FV1A 3RQTA 2HEUA 3RPLA 4ESXA 4LVQA 3PUWE 3H6UA 3V89B 1I69A 4ECFA 3IO4A 3KC1A 3U72A 1OQHA 3M8UA 4PAKA 3TELA 1VFDA 2XXXA 1QKBA 4NE4A 1VR5A 4PF6A 3HFUA 1O7TA 1EU8A 4H5GA 4JB7A 2DS9A 3K1NA 2PFZA 1NFTA 3B50A 2F97A 4QRZA 4ZEBA 4PCDA 1HSEA 3KN8A 1FTOA 2VD3A 1B0HA 4EUOA 4YB7A 1NH8A 4U22A 2WYKA 5H8HB 4GWZA 1FBEA 3IR1A 2RC7A 1FBFA 2XXPA 1KA1A 3CHGA 3DELB 4WEDA 2QFLA 3N6TA 4I1DA 3KJTA 1FBGA 4MCOA 4C1UA 1UIUA 1FQEA 3QUJA 3K2DA 3VVFA 1MDP1 3E78A 3TEPA 5KCJB 5K2XA 2I0CA 1DTGA 4F2OA 3TDJA 1LLSA 4PFIA 3SEWA 1N7XA 1FTKA 3GXAA 1JW1A 4JWYA
chains in the Genus database with same CATH topology
1SYHA 1SW5A 4JXIA 4NMYA 1B51A 2A5TA 2OCUA 4ZEKA 1A54A 2VP1A 3OO9A 5AA1A 1B9JA 4OFOA 3FATA 2RKMA 3RNNA 1D3KA 4XIGQ 3GBAA 1MY3A 3C31A 2ONRA 5DEXB 2F34A 3KSXA 1P1WA 1LFGA 4P0GA 3HHFA 3G3GA 1GVCA 3H03A 1PBQA 3I5OA 1NKXA 2FYIA 2F7BA 4HTGA 1JNFA 1UTBA 4PQJA 3EPEA 1JVYA 3MP1A 3GLBA 4QSEA 1LCTA 2ZYOA 3FXQA 3P7IA 4E0XA 1B3GA 2AIXA 3KG2A 3Q28A 4YMAA 1MH3A 4GXSB 1MG1A 3VLVA 5I2KB 1IXIA 2F8DA 1XS5A 2ONSA 4N07A 1KWHA 1IIWA 2OZZA 2XXIA 4OERA 2P0SA 4Z0IA 3VLUA 4DXCA 1WDNA 3B6WA 3ZKKA 2QS4A 4THIA 5JTYB 4ZZAA 3TQWA 1Z7ME 5ELVA 4YAHX 4KCDA 1JEUA 3JYRA 4YZZA 2DOJA 1QUIA 3LSFB 5CMMA 1OVTA 1BKAA 1Y4TA 5CBRA 1MY2A 5AA2B 1N04A 1B0LA 5CC2A 3KSJA 3S9EA 3FGSA 1TXFA 3Q25A 4Z7EA 1R9QA 2I49A 1NMUA 5H8SA 4DXBA 5ITPA 2CZLA 5CMKA 4O3AA 3ZKLA 1A7LA 1N76A 1MH4A 4PFTA 3O2AA 1CE2A 2H98A 3USDA 2XHDA 4TLLB 5HBCA 4LZ5A 3T9UA 3FJMA 3H6TA 3QIMA 3O6GA 1OIBA 3C33A 1XT8A 1D4NA 4QFOA 1MPDA 3UK4A 3M3FA 3PPRA 3KN3A 4DIGA 3CFZA 3LC8A 5EYFA 4BDQA 3HPIA 4PFWA 1IEJA 4U4SA 4U1OA 2XXTA 2THIA 5FTHA 2PT2A 4GOTA 4OEUA 1VFEA 3ZS6A 1UIVA 3RUMA 2O7IA 3PPNA 5H8NB 1I6BA 5H8HA 3THIA 3I3VA 4ELRA 3A09A 4G68B 4NF5B 3UP9A 5ICTA 1ZMGA 2Z8EA 1Y3PA 5HPQA 2Y7IA 5JEIA 4GXAA 4R74A 3S9MC 3SEVA 5KCJA 3FJGA 1DOTA 3HCQA 5HM4B 5CMCA 1SDXA 4JBZA 3SEUA 2ONKE 4F19A 4ND9A 4IO3A 1Y3QA 3OD7A 4QFNA 5KZTA 4IY5A 3MVWA 5CMBA 4F3BA 1NL5A 3QAXA 3TTMA 1SD3A 4L17A 2ANJA 1B4ZA 1R9LA 3TFLA 1DMBA 3T9VA 1IZ1A 1Y20A 4KPTA 1LFIA 1BLFA 1S9TA 3PMVA 1FQAA 1P1QA 4I62A 4X48A 1ANFA 3MZBA 2RF1A 1H3DA 2I3VA 4UA8A 1Y4CA 1IITA 3CFLA 2Y7RA 3G7WA 4OXVA 5H8FB 2GH9A 3TCFA 3HN0A 5IKBA 3TZAA 5DEXA 1US5A 4OMBA 1WVJA 3OEMA 2DWAA 4ZEDA 2RCAA 3FVNA 4PFUA 1GGGA 5DVJA 1H45A 2REJA 1YPNA 4ESWA 4U2RA 1H44A 4YMBA 3W15C 5B7DA 3V5AA 4JWOA 1B52A 4KI0E 4XTCQ 3G3JA 4ISUA 3MWBA 4XXUA 3E3KA 2PMSA 1MXUA 4LQ2A 4GIZA 5I2KA 3UN6A 3DP8A 2QS2A 2VGQA 1JVXA 5I84A 2HAUA 4H1XA 3ILTB 1FW0A 2Z23A 3O29A 5DT6A 3RN8A 5JTYA 3MPKA 1N0TA 3PUZE 3ZSFA 2WKYA 2AL5A 4RXLA 3MVYA 3DP6A 2HZLA 1A8EA 1YAEA 3LSLA 1ZLQA 5AA2A 2XD3A 1P1NA 3IOWA 3U94A 2D3IA 2OWSA 3BFUA 1QW0A 2Z8DA 3VXCA 3UGWA 5AA3A 1Y3NA 4KFQA 1MQHA 4LATA 5FHOA 3DM0A 1XVYA 1II5A 3O28A 1M5DA 4OESA 1QUKA 4WKMA 1JW4A 2F7CA 4ZEIA 1MRPA 1SI1A 3ONMA 4R9GA 3K6UA 3KEIA 4KR5A 3S9LC 3A3CA 1SYIA 2UVIA 2B3FA 1YTVA 3FXUA 1MY1A 4KQPA 1DSNA 2Y7PA 3OENA 3PV0E 1J1NA 3VLWA 3QYTA 1OQGA 1NNTA 3FXRA 2X7PA 2ESNA 1MM6A 3HHGA 4JSDA 2KLFA 1NH7A 1SBPA 5L8DA 1WODA 4FIMA 1DPEA 1B7HA 2HFBA 1N3XA 3B6TA 5H8NA 4QSCA 2UXAA 2QL3A 1N3WA 1GTKA 1R6ZA 4GRKA 2YLNA 4G68A 4NF5A 2REGA 5AA4B 1TT1A 3KFMA 1RYXA 4MBPA 4G8HA 1SW1A 2O7UA 1M5FA 2P1SA 4H67A 4DCXA 2F6GA 4F3SA 3PPQA 3T22A 4FAJA 1M5CA 2D5WA 3SERA 1RKMA 2QPQA 3ECRA 1URGA 3EF7A 2RC8A 2HCAA 4RK9A 3O66A 1B1HA 2F7AA 1Y1ZA 1FQDA 4NF8B 3TTKA 1SI0A 4XKRA 2HQ0A 4IGTA 3CRBA 1NNKA 4I8CA 3HV1A 1MM7A 3N5LA 3K02A 5TPAB 4NF4B 3RLFE 3HO7A 1OVBA 5TU0A 4JDFA 1QULA 1SW4A 3IJXB 3PPPA 1O64A 1B05A 5H8FA 4DCYA 2D21A 4XKPA 4GQOA 3S4UA 2V84A 4M4GA 2UVGA 4IGRA 1LB8A 4ZZEA 1N7WA 1PB7A 2YJPA 5L9MA 3QXMA 4GL0A 1B40A 1B1XA 3MW0A 1POTA 1B7UA 3PD8A 2HAVA 1TFAA 1XVXA 3KOTA 3B6QA 4FORA 3MUQA 2ZNTA 4OYVA 2O1LA 4KYEA 5I2NA 3MJNA 3EN3A 5EHSA 1A55A 3H06B 3IL1B 3K6VA 4JWXA 3T9XB 4DE8A 5A5XB 2FA7A 3SEXA 2Q2CA 3OEKA 1RYOA 3Q29A 3DP4A 4HW8A 5TP9B 2DYXA 5I59B 4KYSA 4ONYA 4H65A 5AA2D 2B3BA 2XD2A 3FV2A 1MS7A 5ITOA 3S9NC 3BFTA 1D9YA 2X26A 2DXRA 4RPOA 4EXKA 1OLAA 4OVJA 3TCHA 2Y7KA 4FE8A 3MQ9A 2I3WA 2NUVA 2XX9A 3MZ9A 1P1UA 3VDFA 1N84A 3IOUA 1QVSA 4R73A 5K2YA 4F1YA 2NXOA 3MVZA 3G3HA 3VXBA 3SESA 4ELQA 2OK2A 4KCCA 5I57B 1XC1A 1LBBA 2I0BA 4IO4A 4H0WA 2ZMBA 4XKQA 4F18A 2GHBA 4PP0A 4BDRA 3U1OA 3CI8A 4NWCA 3OOAA 1JEVA 2GRVA 1ZBMA 5LOMA 5H8QB 3U8QA 2GHAA 4R9FA 2OWTA 1ZKBA 3OO7A 4MF3A 4ZDMA 2XXHA 3FJ7A 3CVGA 4IY6A 3V8XB 3IB2A 2OBGA 4F22A 5FTIA 2H25A 3CIJA 2O68A 3IOTA 5I56B 4R75A 1LCFA 3LR1A 3EQ1A 4EF1A 3G3IA 2XXYA 5BWJA 4AB6A 3K01A 1ZJLA 4LZ7A 4AQ4A 4OZ9A 1AIVA 4BLAA 1L5TA 1IUDA 1EH3A 3PPOA 1POY1 1QJMA 2DWHA 1M5EA 5DVIA 3AXFA 4LQ5A 3OSRA 2PYYA 4M1VA 4Q30B 1FTLA 1XHYA 1SW2A 5AA4A 3C34A 1TFDA 2DVZA 4NEDA 4NF6B 1LAXA 2HXWA 2A5TB 4LONB 2G93A 1B2HA 4RY1A 3VFJA 2LAOA 5F1QA 3C9HA 4OEVA 3K00A 3RTFB 3SEYA 2ZXTA 3N26A 3SDFA 4TOZA 2I4CA 4WEPA 1NNPA 2VHAA 4YICA 1EZOA 4LUBA 4N6PA 4GFRA 4FECA 1AL3A 1GR2A 4XKNA 2F36A 3TCGA 2Q2AA 1PC3A 2DSFA 4POWA 3EHUA 1LSTA 3TTNA 1IQ7A 4YU0A 4MLVA 3IB1A 5FHNA 3PUVE 3IAZA 1LAGE 1M5BA 4F29A 2H4IA 1VE4A 2A5SA 3F11A 3O97A 5F7VA 4C1TA 4G2ZA 4O3CA 3W9VA 3ILUB 1B32A 1MXYA 3MP6A 4N13A 2UVJA 3T66A 1H43A 2IA4A 4Q8RA 1URDA 3MC2A 4FJPA 2FNCA 1SQYA 3C36A 4FEBA 3UORA 3TYHA 4OTEA 1MDQA 3C4MA 4IO2A 4U21A 1F9BA 3OO8A 2OLBA 3DLNA 2QS3A 2Q9TA 4U1ZA 2Q89A 3WAEA 4GL8A 4OFJA 3RT8A 1JQFA 3B7DA 4BDNA 1B6HA 1MY4A 2ZNSA 4BDLA 4U23A 4POXA 3RTWB 5TP9A 2E1SA 5KDTB 4QHQA 5I59A 4I9DA 1FTMA 3PMXA 3VV5A 3RT6B 1Z7NE 3K6XA 2ZYKA 3MP8A 3L6GA 5JK4A 2QS1A 3CFXA 3G3FA 1JETA 5CI5A 3RGYA 2ABHA 3MPLA 1SVXB 2AYSA 2I4BA 4RK2A 2VD2A 3M3KA 4BDOA 3H7MA 3CSGA 2NWJA 1HSJA 4RPNA 2O69A 1HSLA 3FVGA 4BDMA 1A99A 2V25A 2DWIA 1IXCA 4H8JA 1B5IA 4Q0CA 3SKPA 4P0IA 2M8CA 4RNSA 4DLDA 5BUUA 5CRYA 3TUSA 3LBSA 3T9HB 5H8QA 1B4HA 1B7ZA 3LSWA 3RY3A 2RINA 4ZECA 5CM6A 2QMWA 3VVEA 2G29A 4UACA 3ODBA 3CG1A 5M2VA 3L6HA 5L9OA 4HS7A 1EZPA 1B5JA 4F2QA 2PBWA 3TODA 2O51A 3T93B 5I56A 1PB9A 4H6DA 3R26A 2DP8A 3LSXA 1NNFA 2QRYA 4ZE8A 2V3TA 1D9VA 1MQGA 3FASA 1Q1KA 3KOSA 4DZ1A 2R71A 2W7YA 2NOOA 5DTBA 4OFLA 3U92A 3TMGA 5B70A 4QSDA 4EQBA 3MZ1A 1MQJA 1LBCA 2Q8JA 2XX8A 3IOVA 4NF6A 3UA8A 2XXVA 2ALUA 3PUXE 3IX1A 3GZGA 2GFEA 3KGCA 3K1MA 3BBRA 4X1DA 3JV9A 4QFKA 4G77A 4G4PA 3N94A 1H76A 2OJTA 3CG3A 3H6WA 4GVOA 2PT1A 1MPCA 1FCKA 4X1BA 1IXHA 4IO7A 2XXRA 2V93A 2DE2A 3CR9A 2F78A 1USYH 3K6WA 1LB9A 1A40A 3QSLA 1FTJA 2CMOA 4EF2A 3Q27A 1BIYA 3TAJA 3EHTA 2BJJX 1EZ9A 4R2FA 2V3QA 1DTZA 3TTLA 3QUFA 4EQ7A 4EXLA 3MAMA 3OELA 3A3UA 1CB6A 4F1VA 3E9XA 2X7QA 4AB5A 4QF9A 2F5XA 2O6AA 2Y84A 4R2BA 3TPAA 2PVUA 2RCBA 4P11A 2RC9A 4LA9A 3TQLA 5DYHA 1FQFA 5ISUA 2B65A 1UTHB 1BTJA 4IO5A 3D4GA 3EHSA 4FATA 1B3FA 4G68C 3TTRA 4X9TA 3PGFA 1MPBA 4ZE9A 1QUJA 2H5YA 1JW5A 4RJZA 4MFIA 3R6UA 4OQOA 5KDTA 1B58A 4E0WA 1I6AA 1AOVA 3N6UA 3I6VA 4YKKA 4YKPA 1PB8A 4HCWA 4YB6A 5I58B 4R72A 3HSTA 3C32A 3IB0A 4R6HA 4GLIA 1O63A 1AMFA 3OMBA 3KJ7A 4F3PA 4PETA 2ZYNA 4F31B 1XOCA 1FQCA 4KYDA 3SETA 3W9WA 4K3FA 3O6HA 2I48A 2R6GE 2QJEA 3KN7A 4YKIA 5CBSA 3R7XA 2F35A 2DE3A 4R6YA 2ZNUA 2UVHA 3O9PA 3RPWA 3GBBA 2V3UA 4LP2B 1PDAA 4DXUA 2Y7WA 4IO6A 3FVOA 4FEDA 1MXVA 3FZVA 3IORA 3S2VA 3KZGA 5ICQA 2O84X 3JZJA 1ZIUA 1URSA 1GV8A 3MBPA 4F3GA 1Y1MA 4C0RA 4TLMB 1LGBC 3E13X 2ZYMA 1MY0A 3OXNA 3MVXA 1OLCA 1DPPA 4U4XA 4IB2A 3D4CA 1MXXA 1PEBA 2VOZA 1OMPA 2QMXA 3OSQA 2YPNA 2XX7A 3G3KA 1PBPA 4ELPA 1MXZA 2DQVA 1MQIA 2Z8FA 4G8MA 3FD3A 4KD5A 3U93A 4OENA 5J1DA 5IAIA 5L9SA 4F39A 2R9JA 1US4A 3M3LA 1S50A 2I58A 3PUYE 2NVUB 2H9BA 4GD5A 3H3GA 4NF8A 4OWDA 5AE4A 2IEEA 4OHNA 1T0KA 1AH5A 5TPAA 4NF4A 5DVFA 2Z22A 3H6VA 3UIFA 4G8NA 1B3EA 4MH5A 3WAFA 1UTBB 4F1UA 3TKDA 1UQWA 4WXJA 2XXUA 1ZU0A 4RYAA 2DWJA 3QK6A 4PE5B 1VSOA 2XXWA 2I6EA 2Q88A 1YCJA 3KBRA 2P2AA 4RA1A 3BKIB 4ZEFA 1IXGA 4H8IA 1LFHA 3PD9A 4QFPA 1B3LA 4HCYA 4MLQA 4YKJA 3C35A 5I2NB 4PFYA 1Y9UA 2F6PA 1S7YA 3K0VA 4O3BA 3E4RA 3H4ZA 1B5HA 3FIRA 3VVDA 1B3HA 4OETA 1LAHE 1USYE 4EQ9A 4JSOA 4TQUQ 5A5XA 4H5FA 3FVKA 2HZKA 3VE1B 4ELOA 1UTHA 2AL4A 4GWOA 1TWYA 4KHZE 1B46A 4ZS9A 1P99A 3PMWA 4R6KA 4NTLA 1QKAA 4YB5A 3Q26A 2QSXA 2O1MA 3IK6B 3K1PA 1BP5A 2DXYA 1R1NA 2DE4A 1MQDA 3T96B 1LAFE 2UYEA 1MXWA 2DVCA 1ZTYA 2H99A 4EDPA 4GF8A 4QFLA 4LZ8A 3IJOB 1Q35A 3OO6A 2UYFA 3LUYA 3O6IA 1I6QA 1A8FA 1FQBA 5FHMA 2E0SA 5I58A 2PX1A 4Q5TA 3V83A 5I57A 2XXQA 3PU5A 1P1OA 3IO6A 1ATGA 1ELJA 3K4UA 3CSBA 3FUZA 4NWDA 4DDDA 5EHMA 3FV1A 3RQTA 2HEUA 4ESXA 4LVQA 3PUWE 3H6UA 3V89B 1I69A 4ECFA 3IO4A 3U72A 1OQHA 3M8UA 3TELA 1VFDA 2XXXA 1QKBA 4NE4A 1VR5A 1O7TA 1EU8A 4H5GA 4JB7A 2DS9A 3K1NA 1NFTA 2F97A 4QRZA 4ZEBA 1HSEA 3KN8A 1FTOA 2VD3A 1B0HA 4EUOA 4YB7A 1NH8A 4U22A 5H8HB 3IR1A 2RC7A 2XXPA 4WEDA 3DELB 3N6TA 4I1DA 3KJTA 4C1UA 1UIUA 1FQEA 3QUJA 3K2DA 3VVFA 1MDP1 3TEPA 5KCJB 5K2XA 2I0CA 1DTGA 4F2OA 3TDJA 1LLSA 3SEWA 1N7XA 1FTKA 3GXAA 1JW1A 4JWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYH A;  1SW5 A;  4JXI A;  4NMY A;  1B51 A;  2A5T A;  2OCU A;  4ZEK A;  1A54 A;  2VP1 A;  3OO9 A;  5AA1 A;  1B9J A;  4OFO A;  3FAT A;  2RKM A;  3RNN A;  1D3K A;  4XIG Q;  3GBA A;  1MY3 A;  3C31 A;  2ONR A;  5DEX B;  2F34 A;  3KSX A;  1P1W A;  1LFG A;  4P0G A;  3HHF A;  3G3G A;  1GVC A;  3H03 A;  1PBQ A;  3I5O A;  1NKX A;  2FYI A;  2F7B A;  4HTG A;  1JNF A;  1UTB A;  4PQJ A;  3EPE A;  1JVY A;  3MP1 A;  3GLB A;  4QSE A;  1LCT A;  2ZYO A;  3FXQ A;  3P7I A;  4E0X A;  1B3G A;  2AIX A;  3KG2 A;  3Q28 A;  4YMA A;  1MH3 A;  4GXS B;  1MG1 A;  3VLV A;  5I2K B;  1IXI A;  2F8D A;  1XS5 A;  2ONS A;  4N07 A;  1KWH A;  1IIW A;  2OZZ A;  2XXI A;  4OER A;  2P0S A;  4Z0I A;  3VLU A;  4DXC A;  1WDN A;  3B6W A;  3ZKK A;  2QS4 A;  4THI A;  5JTY B;  4ZZA A;  3TQW A;  1Z7M E;  5ELV A;  4YAH X;  4KCD A;  1JEU A;  3JYR A;  4YZZ A;  2DOJ A;  1QUI A;  3LSF B;  5CMM A;  1OVT A;  1BKA A;  1Y4T A;  5CBR A;  1MY2 A;  5AA2 B;  1N04 A;  1B0L A;  5CC2 A;  3KSJ A;  3S9E A;  3FGS A;  1TXF A;  3Q25 A;  4Z7E A;  1R9Q A;  2I49 A;  1NMU A;  5H8S A;  4DXB A;  5ITP A;  2CZL A;  5CMK A;  4O3A A;  3ZKL A;  1A7L A;  1N76 A;  1MH4 A;  4PFT A;  3O2A A;  1CE2 A;  2H98 A;  3USD A;  2XHD A;  4TLL B;  5HBC A;  4LZ5 A;  3T9U A;  3FJM A;  3H6T A;  3QIM A;  3O6G A;  1OIB A;  3C33 A;  1XT8 A;  1D4N A;  4QFO A;  1MPD A;  3UK4 A;  3M3F A;  3PPR A;  3KN3 A;  4DIG A;  3CFZ A;  3LC8 A;  5EYF A;  4BDQ A;  3HPI A;  4PFW A;  1IEJ A;  4U4S A;  4U1O A;  2XXT A;  2THI A;  5FTH A;  2PT2 A;  4GOT A;  4OEU A;  1VFE A;  3ZS6 A;  1UIV A;  3RUM A;  2O7I A;  3PPN A;  5H8N B;  1I6B A;  5H8H A;  3THI A;  3I3V A;  4ELR A;  3A09 A;  4G68 B;  4NF5 B;  3UP9 A;  5ICT A;  1ZMG A;  2Z8E A;  1Y3P A;  5HPQ A;  2Y7I A;  5JEI A;  4GXA A;  4R74 A;  3S9M C;  3SEV A;  5KCJ A;  3FJG A;  1DOT A;  3HCQ A;  5HM4 B;  5CMC A;  1SDX A;  4JBZ A;  3SEU A;  2ONK E;  4F19 A;  4ND9 A;  4IO3 A;  1Y3Q A;  3OD7 A;  4QFN A;  5KZT A;  4IY5 A;  3MVW A;  5CMB A;  4F3B A;  1NL5 A;  3QAX A;  3TTM A;  1SD3 A;  4L17 A;  2ANJ A;  1B4Z A;  1R9L A;  3TFL A;  1DMB A;  3T9V A;  1IZ1 A;  1Y20 A;  4KPT A;  1LFI A;  1BLF A;  1S9T A;  3PMV A;  1FQA A;  1P1Q A;  4I62 A;  4X48 A;  1ANF A;  3MZB A;  2RF1 A;  1H3D A;  2I3V A;  4UA8 A;  1Y4C A;  1IIT A;  3CFL A;  2Y7R A;  3G7W A;  4OXV A;  5H8F B;  2GH9 A;  3TCF A;  3HN0 A;  5IKB A;  3TZA A;  5DEX A;  1US5 A;  4OMB A;  1WVJ A;  3OEM A;  2DWA A;  4ZED A;  2RCA A;  3FVN A;  4PFU A;  1GGG A;  5DVJ A;  1H45 A;  2REJ A;  1YPN A;  4ESW A;  4U2R A;  1H44 A;  4YMB A;  3W15 C;  5B7D A;  3V5A A;  4JWO A;  1B52 A;  4KI0 E;  4XTC Q;  3G3J A;  4ISU A;  3MWB A;  4XXU A;  3E3K A;  2PMS A;  1MXU A;  4LQ2 A;  4GIZ A;  5I2K A;  3UN6 A;  3DP8 A;  2QS2 A;  2VGQ A;  1JVX A;  5I84 A;  2HAU A;  4H1X A;  3ILT B;  1FW0 A;  2Z23 A;  3O29 A;  5DT6 A;  3RN8 A;  5JTY A;  3MPK A;  1N0T A;  3PUZ E;  3ZSF A;  2WKY A;  2AL5 A;  4RXL A;  3MVY A;  3DP6 A;  2HZL A;  1A8E A;  1YAE A;  3LSL A;  1ZLQ A;  5AA2 A;  2XD3 A;  1P1N A;  3IOW A;  3U94 A;  2D3I A;  2OWS A;  3BFU A;  1QW0 A;  2Z8D A;  3VXC A;  3UGW A;  5AA3 A;  1Y3N A;  4KFQ A;  1MQH A;  4LAT A;  5FHO A;  3DM0 A;  1XVY A;  1II5 A;  3O28 A;  1M5D A;  4OES A;  1QUK A;  4WKM A;  1JW4 A;  2F7C A;  4ZEI A;  1MRP A;  1SI1 A;  3ONM A;  4R9G A;  3K6U A;  3KEI A;  4KR5 A;  3S9L C;  3A3C A;  1SYI A;  2UVI A;  2B3F A;  1YTV A;  3FXU A;  1MY1 A;  4KQP A;  1DSN A;  2Y7P A;  3OEN A;  3PV0 E;  1J1N A;  3VLW A;  3QYT A;  1OQG A;  1NNT A;  3FXR A;  2X7P A;  2ESN A;  1MM6 A;  3HHG A;  4JSD A;  2KLF A;  1NH7 A;  1SBP A;  5L8D A;  1WOD A;  4FIM A;  1DPE A;  1B7H A;  2HFB A;  1N3X A;  3B6T A;  5H8N A;  4QSC A;  2UXA A;  2QL3 A;  1N3W A;  1GTK A;  1R6Z A;  4GRK A;  2YLN A;  4G68 A;  4NF5 A;  2REG A;  5AA4 B;  1TT1 A;  3KFM A;  1RYX A;  4MBP A;  4G8H A;  1SW1 A;  2O7U A;  1M5F A;  2P1S A;  4H67 A;  4DCX A;  2F6G A;  4F3S A;  3PPQ A;  3T22 A;  4FAJ A;  1M5C A;  2D5W A;  3SER A;  1RKM A;  2QPQ A;  3ECR A;  1URG A;  3EF7 A;  2RC8 A;  2HCA A;  4RK9 A;  3O66 A;  1B1H A;  2F7A A;  1Y1Z A;  1FQD A;  4NF8 B;  3TTK A;  1SI0 A;  4XKR A;  2HQ0 A;  4IGT A;  3CRB A;  1NNK A;  4I8C A;  3HV1 A;  1MM7 A;  3N5L A;  3K02 A;  5TPA B;  4NF4 B;  3RLF E;  3HO7 A;  1OVB A;  5TU0 A;  4JDF A;  1QUL A;  1SW4 A;  3IJX B;  3PPP A;  1O64 A;  1B05 A;  5H8F A;  4DCY A;  2D21 A;  4XKP A;  4GQO A;  3S4U A;  2V84 A;  4M4G A;  2UVG A;  4IGR A;  1LB8 A;  4ZZE A;  1N7W A;  1PB7 A;  2YJP A;  5L9M A;  3QXM A;  4GL0 A;  1B40 A;  1B1X A;  3MW0 A;  1POT A;  1B7U A;  3PD8 A;  2HAV A;  1TFA A;  1XVX A;  3KOT A;  3B6Q A;  4FOR A;  3MUQ A;  2ZNT A;  4OYV A;  2O1L A;  4KYE A;  5I2N A;  3MJN A;  3EN3 A;  5EHS A;  1A55 A;  3H06 B;  3IL1 B;  3K6V A;  4JWX A;  3T9X B;  4DE8 A;  5A5X B;  2FA7 A;  3SEX A;  2Q2C A;  3OEK A;  1RYO A;  3Q29 A;  3DP4 A;  4HW8 A;  5TP9 B;  2DYX A;  5I59 B;  4KYS A;  4ONY A;  4H65 A;  5AA2 D;  2B3B A;  2XD2 A;  3FV2 A;  1MS7 A;  5ITO A;  3S9N C;  3BFT A;  1D9Y A;  2X26 A;  2DXR A;  4RPO A;  4EXK A;  1OLA A;  4OVJ A;  3TCH A;  2Y7K A;  4FE8 A;  3MQ9 A;  2I3W A;  2NUV A;  2XX9 A;  3MZ9 A;  1P1U A;  3VDF A;  1N84 A;  3IOU A;  1QVS A;  4R73 A;  5K2Y A;  4F1Y A;  2NXO A;  3MVZ A;  3G3H A;  3VXB A;  3SES A;  4ELQ A;  2OK2 A;  4KCC A;  5I57 B;  1XC1 A;  1LBB A;  2I0B A;  4IO4 A;  4H0W A;  2ZMB A;  4XKQ A;  4F18 A;  2GHB A;  4PP0 A;  4BDR A;  3U1O A;  3CI8 A;  4NWC A;  3OOA A;  1JEV A;  2GRV A;  1ZBM A;  5LOM A;  5H8Q B;  3U8Q A;  2GHA A;  4R9F A;  2OWT A;  1ZKB A;  3OO7 A;  4MF3 A;  4ZDM A;  2XXH A;  3FJ7 A;  3CVG A;  4IY6 A;  3V8X B;  3IB2 A;  2OBG A;  4F22 A;  5FTI A;  2H25 A;  3CIJ A;  2O68 A;  3IOT A;  5I56 B;  4R75 A;  1LCF A;  3LR1 A;  3EQ1 A;  4EF1 A;  3G3I A;  2XXY A;  5BWJ A;  4AB6 A;  3K01 A;  1ZJL A;  4LZ7 A;  4AQ4 A;  4OZ9 A;  1AIV A;  4BLA A;  1L5T A;  1IUD A;  1EH3 A;  3PPO A;  1POY 1;  1QJM A;  2DWH A;  1M5E A;  5DVI A;  3AXF A;  4LQ5 A;  3OSR A;  2PYY A;  4M1V A;  4Q30 B;  1FTL A;  1XHY A;  1SW2 A;  5AA4 A;  3C34 A;  1TFD A;  2DVZ A;  4NED A;  4NF6 B;  1LAX A;  2HXW A;  2A5T B;  4LON B;  2G93 A;  1B2H A;  4RY1 A;  3VFJ A;  2LAO A;  5F1Q A;  3C9H A;  4OEV A;  3K00 A;  3RTF B;  3SEY A;  2ZXT A;  3N26 A;  3SDF A;  4TOZ A;  2I4C A;  4WEP A;  1NNP A;  2VHA A;  4YIC A;  1EZO A;  4LUB A;  4N6P A;  4GFR A;  4FEC A;  1AL3 A;  1GR2 A;  4XKN A;  2F36 A;  3TCG A;  2Q2A A;  1PC3 A;  2DSF A;  4POW A;  3EHU A;  1LST A;  3TTN A;  1IQ7 A;  4YU0 A;  4MLV A;  3IB1 A;  5FHN A;  3PUV E;  3IAZ A;  1LAG E;  1M5B A;  4F29 A;  2H4I A;  1VE4 A;  2A5S A;  3F11 A;  3O97 A;  5F7V A;  4C1T A;  4G2Z A;  4O3C A;  3W9V A;  3ILU B;  1B32 A;  1MXY A;  3MP6 A;  4N13 A;  2UVJ A;  3T66 A;  1H43 A;  2IA4 A;  4Q8R A;  1URD A;  3MC2 A;  4FJP A;  2FNC A;  1SQY A;  3C36 A;  4FEB A;  3UOR A;  3TYH A;  4OTE A;  1MDQ A;  3C4M A;  4IO2 A;  4U21 A;  1F9B A;  3OO8 A;  2OLB A;  3DLN A;  2QS3 A;  2Q9T A;  4U1Z A;  2Q89 A;  3WAE A;  4GL8 A;  4OFJ A;  3RT8 A;  1JQF A;  3B7D A;  4BDN A;  1B6H A;  1MY4 A;  2ZNS A;  4BDL A;  4U23 A;  4POX A;  3RTW B;  5TP9 A;  2E1S A;  5KDT B;  4QHQ A;  5I59 A;  4I9D A;  1FTM A;  3PMX A;  3VV5 A;  3RT6 B;  1Z7N E;  3K6X A;  2ZYK A;  3MP8 A;  3L6G A;  5JK4 A;  2QS1 A;  3CFX A;  3G3F A;  1JET A;  5CI5 A;  3RGY A;  2ABH A;  3MPL A;  1SVX B;  2AYS A;  2I4B A;  4RK2 A;  2VD2 A;  3M3K A;  4BDO A;  3H7M A;  3CSG A;  2NWJ A;  1HSJ A;  4RPN A;  2O69 A;  1HSL A;  3FVG A;  4BDM A;  1A99 A;  2V25 A;  2DWI A;  1IXC A;  4H8J A;  1B5I A;  4Q0C A;  3SKP A;  4P0I A;  2M8C A;  4RNS A;  4DLD A;  5BUU A;  5CRY A;  3TUS A;  3LBS A;  3T9H B;  5H8Q A;  1B4H A;  1B7Z A;  3LSW A;  3RY3 A;  2RIN A;  4ZEC A;  5CM6 A;  2QMW A;  3VVE A;  2G29 A;  4UAC A;  3ODB A;  3CG1 A;  5M2V A;  3L6H A;  5L9O A;  4HS7 A;  1EZP A;  1B5J A;  4F2Q A;  2PBW A;  3TOD A;  2O51 A;  3T93 B;  5I56 A;  1PB9 A;  4H6D A;  3R26 A;  2DP8 A;  3LSX A;  1NNF A;  2QRY A;  4ZE8 A;  2V3T A;  1D9V A;  1MQG A;  3FAS A;  1Q1K A;  3KOS A;  4DZ1 A;  2R71 A;  2W7Y A;  2NOO A;  5DTB A;  4OFL A;  3U92 A;  3TMG A;  5B70 A;  4QSD A;  4EQB A;  3MZ1 A;  1MQJ A;  1LBC A;  2Q8J A;  2XX8 A;  3IOV A;  4NF6 A;  3UA8 A;  2XXV A;  2ALU A;  3PUX E;  3IX1 A;  3GZG A;  2GFE A;  3KGC A;  3K1M A;  3BBR A;  4X1D A;  3JV9 A;  4QFK A;  4G77 A;  4G4P A;  3N94 A;  1H76 A;  2OJT A;  3CG3 A;  3H6W A;  4GVO A;  2PT1 A;  1MPC A;  1FCK A;  4X1B A;  1IXH A;  4IO7 A;  2XXR A;  2V93 A;  2DE2 A;  3CR9 A;  2F78 A;  1USY H;  3K6W A;  1LB9 A;  1A40 A;  3QSL A;  1FTJ A;  2CMO A;  4EF2 A;  3Q27 A;  1BIY A;  3TAJ A;  3EHT A;  2BJJ X;  1EZ9 A;  4R2F A;  2V3Q A;  1DTZ A;  3TTL A;  3QUF A;  4EQ7 A;  4EXL A;  3MAM A;  3OEL A;  3A3U A;  1CB6 A;  4F1V A;  3E9X A;  2X7Q A;  4AB5 A;  4QF9 A;  2F5X A;  2O6A A;  2Y84 A;  4R2B A;  3TPA A;  2PVU A;  2RCB A;  4P11 A;  2RC9 A;  4LA9 A;  3TQL A;  5DYH A;  1FQF A;  5ISU A;  2B65 A;  1UTH B;  1BTJ A;  4IO5 A;  3D4G A;  3EHS A;  4FAT A;  1B3F A;  4G68 C;  3TTR A;  4X9T A;  3PGF A;  1MPB A;  4ZE9 A;  1QUJ A;  2H5Y A;  1JW5 A;  4RJZ A;  4MFI A;  3R6U A;  4OQO A;  5KDT A;  1B58 A;  4E0W A;  1I6A A;  1AOV A;  3N6U A;  3I6V A;  4YKK A;  4YKP A;  1PB8 A;  4HCW A;  4YB6 A;  5I58 B;  4R72 A;  3HST A;  3C32 A;  3IB0 A;  4R6H A;  4GLI A;  1O63 A;  1AMF A;  3OMB A;  3KJ7 A;  4F3P A;  4PET A;  2ZYN A;  4F31 B;  1XOC A;  1FQC A;  4KYD A;  3SET A;  3W9W A;  4K3F A;  3O6H A;  2I48 A;  2R6G E;  2QJE A;  3KN7 A;  4YKI A;  5CBS A;  3R7X A;  2F35 A;  2DE3 A;  4R6Y A;  2ZNU A;  2UVH A;  3O9P A;  3RPW A;  3GBB A;  2V3U A;  4LP2 B;  1PDA A;  4DXU A;  2Y7W A;  4IO6 A;  3FVO A;  4FED A;  1MXV A;  3FZV A;  3IOR A;  3S2V A;  3KZG A;  5ICQ A;  2O84 X;  3JZJ A;  1ZIU A;  1URS A;  1GV8 A;  3MBP A;  4F3G A;  1Y1M A;  4C0R A;  4TLM B;  1LGB C;  3E13 X;  2ZYM A;  1MY0 A;  3OXN A;  3MVX A;  1OLC A;  1DPP A;  4U4X A;  4IB2 A;  3D4C A;  1MXX A;  1PEB A;  2VOZ A;  1OMP A;  2QMX A;  3OSQ A;  2YPN A;  2XX7 A;  3G3K A;  1PBP A;  4ELP A;  1MXZ A;  2DQV A;  1MQI A;  2Z8F A;  4G8M A;  3FD3 A;  4KD5 A;  3U93 A;  4OEN A;  5J1D A;  5IAI A;  5L9S A;  4F39 A;  2R9J A;  1US4 A;  3M3L A;  1S50 A;  2I58 A;  3PUY E;  2NVU B;  2H9B A;  4GD5 A;  3H3G A;  4NF8 A;  4OWD A;  5AE4 A;  2IEE A;  4OHN A;  1T0K A;  1AH5 A;  5TPA A;  4NF4 A;  5DVF A;  2Z22 A;  3H6V A;  3UIF A;  4G8N A;  1B3E A;  4MH5 A;  3WAF A;  1UTB B;  4F1U A;  3TKD A;  1UQW A;  4WXJ A;  2XXU A;  1ZU0 A;  4RYA A;  2DWJ A;  3QK6 A;  4PE5 B;  1VSO A;  2XXW A;  2I6E A;  2Q88 A;  1YCJ A;  3KBR A;  2P2A A;  4RA1 A;  3BKI B;  4ZEF A;  1IXG A;  4H8I A;  1LFH A;  3PD9 A;  4QFP A;  1B3L A;  4HCY A;  4MLQ A;  4YKJ A;  3C35 A;  5I2N B;  4PFY A;  1Y9U A;  2F6P A;  1S7Y A;  3K0V A;  4O3B A;  3E4R A;  3H4Z A;  1B5H A;  3FIR A;  3VVD A;  1B3H A;  4OET A;  1LAH E;  1USY E;  4EQ9 A;  4JSO A;  4TQU Q;  5A5X A;  4H5F A;  3FVK A;  2HZK A;  3VE1 B;  4ELO A;  1UTH A;  2AL4 A;  4GWO A;  1TWY A;  4KHZ E;  1B46 A;  4ZS9 A;  1P99 A;  3PMW A;  4R6K A;  4NTL A;  1QKA A;  4YB5 A;  3Q26 A;  2QSX A;  2O1M A;  3IK6 B;  3K1P A;  1BP5 A;  2DXY A;  1R1N A;  2DE4 A;  1MQD A;  3T96 B;  1LAF E;  2UYE A;  1MXW A;  2DVC A;  1ZTY A;  2H99 A;  4EDP A;  4GF8 A;  4QFL A;  4LZ8 A;  3IJO B;  1Q35 A;  3OO6 A;  2UYF A;  3LUY A;  3O6I A;  1I6Q A;  1A8F A;  1FQB A;  5FHM A;  2E0S A;  5I58 A;  2PX1 A;  4Q5T A;  3V83 A;  5I57 A;  2XXQ A;  3PU5 A;  1P1O A;  3IO6 A;  1ATG A;  1ELJ A;  3K4U A;  3CSB A;  3FUZ A;  4NWD A;  4DDD A;  5EHM A;  3FV1 A;  3RQT A;  2HEU A;  4ESX A;  4LVQ A;  3PUW E;  3H6U A;  3V89 B;  1I69 A;  4ECF A;  3IO4 A;  3U72 A;  1OQH A;  3M8U A;  3TEL A;  1VFD A;  2XXX A;  1QKB A;  4NE4 A;  1VR5 A;  1O7T A;  1EU8 A;  4H5G A;  4JB7 A;  2DS9 A;  3K1N A;  1NFT A;  2F97 A;  4QRZ A;  4ZEB A;  1HSE A;  3KN8 A;  1FTO A;  2VD3 A;  1B0H A;  4EUO A;  4YB7 A;  1NH8 A;  4U22 A;  5H8H B;  3IR1 A;  2RC7 A;  2XXP A;  4WED A;  3DEL B;  3N6T A;  4I1D A;  3KJT A;  4C1U A;  1UIU A;  1FQE A;  3QUJ A;  3K2D A;  3VVF A;  1MDP 1;  3TEP A;  5KCJ B;  5K2X A;  2I0C A;  1DTG A;  4F2O A;  3TDJ A;  1LLS A;  3SEW A;  1N7X A;  1FTK A;  3GXA A;  1JW1 A;  4JWY A; 
#chains in the Genus database with same CATH topology
 1SYH A;  1SW5 A;  2P3V A;  4JXI A;  4NMY A;  1B51 A;  2A5T A;  2OCU A;  4ZEK A;  3MST A;  1A54 A;  4NN3 A;  2VP1 A;  3OO9 A;  5AA1 A;  1B9J A;  4OFO A;  3FAT A;  2RKM A;  5EQ7 A;  1FBD A;  1K9Z A;  3RNN A;  4P56 A;  1NV3 A;  3FBP A;  1D3K A;  4XIG Q;  3GBA A;  1MY3 A;  3C31 A;  2ONR A;  5DEX B;  2F34 A;  3KSX A;  5IZ3 A;  1P1W A;  1LFG A;  4P0G A;  1NUY A;  3HHF A;  2VPN A;  3G3G A;  1GVC A;  3H03 A;  1FPF A;  1PBQ A;  3I5O A;  1NKX A;  2FYI A;  2F7B A;  1IMB A;  4PF8 A;  4HTG A;  1JNF A;  1UTB A;  4PQJ A;  3EPE A;  1JVY A;  3MP1 A;  3GLB A;  4QSE A;  1LCT A;  2ZYO A;  3FXQ A;  3P7I A;  2Y5K A;  2WYP A;  4E0X A;  1B3G A;  2AIX A;  3KG2 A;  3Q28 A;  3RYD A;  4YMA A;  1MH3 A;  4GXS B;  1MG1 A;  3VLV A;  5I2K B;  1IXI A;  1YYZ A;  2F8D A;  1XS5 A;  2ONS A;  4N07 A;  1KWH A;  1IIW A;  2OZZ A;  2XXI A;  4OER A;  2P0S A;  4Z0I A;  3VLU A;  4DXC A;  1WDN A;  3B6W A;  3ZKK A;  2QS4 A;  4THI A;  5JTY B;  4ZZA A;  4P47 A;  3TQW A;  1Z7M E;  5ELV A;  4XFE A;  4YAH X;  4KCD A;  2Y5L A;  1JEU A;  3JYR A;  4YZZ A;  2DOJ A;  1EYJ A;  1QUI A;  3LSF B;  5CMM A;  1OVT A;  1BKA A;  1Y4T A;  4NX1 A;  5CBR A;  1MY2 A;  5AA2 B;  1N04 A;  1B0L A;  5CC2 A;  3KSJ A;  3S9E A;  3FGS A;  2QVR A;  1TXF A;  4I3Y A;  1JP4 A;  1G0I A;  4NAP A;  3Q25 A;  4Z7E A;  1R9Q A;  2I49 A;  1NMU A;  1FPJ A;  1RDX A;  5H8S A;  4DXB A;  5ITP A;  2CZL A;  5CMK A;  4O3A A;  1NV6 A;  3ZKL A;  1A7L A;  1N76 A;  1MH4 A;  4PFT A;  3O2A A;  4LN5 A;  1CE2 A;  2H98 A;  3USD A;  5ET8 A;  2XHD A;  4TLL B;  5HBC A;  4LZ5 A;  3T9U A;  3FJM A;  3H6T A;  3QIM A;  3O6G A;  4XEQ A;  1OIB A;  3C33 A;  1XT8 A;  4PFB A;  1D4N A;  4QFO A;  1MPD A;  3UK4 A;  3M3F A;  3PPR A;  3KN3 A;  4DIG A;  3CFZ A;  3LC8 A;  5EYF A;  4BDQ A;  3HPI A;  4PFW A;  1IEJ A;  4U4S A;  4U1O A;  2XXT A;  2THI A;  1INP A;  5FTH A;  2PT2 A;  4GOT A;  4OEU A;  1VFE A;  3ZS6 A;  1UIV A;  3RUM A;  2O7I A;  3PPN A;  5H8N B;  1I6B A;  5H8H A;  3THI A;  4PGN A;  1NUX A;  3I3V A;  4ELR A;  4PAI A;  5IGA A;  3A09 A;  4G68 B;  4NF5 B;  3UP9 A;  4MEV A;  5ICT A;  1ZMG A;  2Z8E A;  2MKZ A;  1Y3P A;  5HPQ A;  2Y7I A;  2F3D A;  5JEI A;  4GXA A;  4H46 A;  4R74 A;  3S9M C;  2XWV A;  3SEV A;  5KCJ A;  3FJG A;  2DDK A;  1DOT A;  3HCQ A;  5HM4 B;  5CMC A;  1SDX A;  4JBZ A;  3SEU A;  2ONK E;  4F19 A;  4ND9 A;  5EQ8 A;  4IO3 A;  1Y3Q A;  3OD7 A;  4QFN A;  5KZT A;  4IY5 A;  3MVW A;  5CMB A;  2KQZ A;  4F3B A;  1NL5 A;  3QAX A;  3TTM A;  1SD3 A;  4L17 A;  2ANJ A;  2R8T A;  1B4Z A;  1R9L A;  3TFL A;  1DMB A;  3T9V A;  1IZ1 A;  1Y20 A;  1FPD A;  4KPT A;  1LFI A;  1BLF A;  2FHY A;  1S9T A;  3PMV A;  1FQA A;  1P1Q A;  4I62 A;  4X48 A;  2OWZ A;  1ANF A;  3MZB A;  2RF1 A;  1H3D A;  2Q8M A;  4NF0 A;  2I3V A;  4UA8 A;  5EYH A;  1Y4C A;  1IIT A;  3CFL A;  1NV1 A;  2Y7R A;  3G7W A;  4OXV A;  5H8F B;  2GH9 A;  3TCF A;  4MNC A;  4PC9 A;  3HN0 A;  5IKB A;  3TZA A;  5DEX A;  1US5 A;  4OMB A;  1WVJ A;  4G61 A;  3OEM A;  2DWA A;  4ZED A;  2RCA A;  3FVN A;  4PFU A;  1GGG A;  5DVJ A;  1H45 A;  2REJ A;  1YPN A;  4ESW A;  4U2R A;  5I7I A;  1H44 A;  4YMB A;  3W15 C;  5B7D A;  3V5A A;  4JWO A;  1B52 A;  4KI0 E;  4XTC Q;  2FVZ A;  5EYG A;  3G3J A;  4ISU A;  3MWB A;  4XXU A;  3B8B A;  3E3K A;  4GX4 A;  5EQ9 A;  2PMS A;  1FPB A;  1MXU A;  4LQ2 A;  4GIZ A;  5I2K A;  2PCR A;  4NG7 A;  3UN6 A;  3DP8 A;  2QS2 A;  2VGQ A;  1JVX A;  5I84 A;  2QVV A;  2HAU A;  4H1X A;  3ILT B;  1FW0 A;  2Z23 A;  3O29 A;  4MHF A;  5DT6 A;  3RN8 A;  5JTY A;  3MPK A;  1N0T A;  3T1B A;  3PUZ E;  3ZSF A;  2WKY A;  5DW8 A;  2AL5 A;  4RXL A;  1DK4 A;  3PTY A;  3MVY A;  3DP6 A;  2HZL A;  5EQA A;  1A8E A;  1IMA A;  1YAE A;  3LSL A;  2VPO A;  1ZLQ A;  4N81 A;  5AA2 A;  2XD3 A;  1P1N A;  3IOW A;  3U94 A;  5LTC A;  2D3I A;  2OWS A;  3BFU A;  1QW0 A;  2Z8D A;  3VXC A;  3UGW A;  5AA3 A;  1Y3N A;  4KFQ A;  1MQH A;  4LAT A;  2FBP A;  5FHO A;  3DM0 A;  1XVY A;  1II5 A;  3U65 A;  4MNI A;  1NV0 A;  3O28 A;  1M5D A;  4OES A;  1QUK A;  4WKM A;  1JW4 A;  2F7C A;  4ZEI A;  1MRP A;  1SI1 A;  3ONM A;  4R9G A;  3K6U A;  3KEI A;  1LBZ A;  4KR5 A;  3S9L C;  3A3C A;  1SYI A;  2UVI A;  2B3F A;  1YTV A;  3FXU A;  1MY1 A;  4KQP A;  1DSN A;  2Y7P A;  3OEN A;  3PV0 E;  1J1N A;  3VLW A;  3QYT A;  4NHB A;  1OQG A;  1NNT A;  4OVR A;  5IZZ A;  3FXR A;  2X7P A;  4I3E A;  2ESN A;  1MM6 A;  3HHG A;  4JSD A;  2KLF A;  1NH7 A;  1SBP A;  5L8D A;  1WOD A;  4GX3 A;  4FIM A;  1DPE A;  1B7H A;  2HFB A;  1N3X A;  3B6T A;  5H8N A;  4QSC A;  2UXA A;  2QL3 A;  1N3W A;  1GTK A;  1R6Z A;  4GRK A;  2YLN A;  4AS5 A;  4G68 A;  4NF5 A;  2REG A;  2WBB A;  5AA4 B;  1TT1 A;  3KFM A;  1RYX A;  4MBP A;  4MX6 A;  4G8H A;  1SW1 A;  2O7U A;  4O8M A;  1M5F A;  2P1S A;  4H67 A;  4DCX A;  2F6G A;  4F3S A;  3PPQ A;  3T22 A;  4FAJ A;  1M5C A;  2D5W A;  1K9Y A;  3SER A;  1RKM A;  2QPQ A;  3ECR A;  2JJK A;  1URG A;  3EF7 A;  4GX6 A;  2RC8 A;  2CZH A;  2HCA A;  1EYI A;  4RK9 A;  3O66 A;  1B1H A;  2F7A A;  1Y1Z A;  1FQD A;  4NF8 B;  3TTK A;  1SI0 A;  4NGU A;  4XKR A;  2HQ0 A;  4IGT A;  3CRB A;  4MAG A;  1NNK A;  4I8C A;  3HV1 A;  1MM7 A;  3N5L A;  1FPG A;  3K02 A;  4NF4 B;  5TPA B;  3RLF E;  3HO7 A;  1OVB A;  5TU0 A;  1FPK A;  4JDF A;  1QUL A;  1SW4 A;  3IJX B;  3PPP A;  1NUZ A;  1O64 A;  1G0H A;  1B05 A;  5H8F A;  4DCY A;  2D21 A;  4XKP A;  4GQO A;  4JVC A;  3S4U A;  2V84 A;  4M4G A;  2UVG A;  4IGR A;  1LB8 A;  4ZZE A;  1N7W A;  1PB7 A;  2YJP A;  5L9M A;  3QXM A;  4GL0 A;  1B40 A;  1B1X A;  3EKI A;  3MW0 A;  1POT A;  1B7U A;  3PD8 A;  4P3L A;  2HAV A;  1TFA A;  2HXR A;  1XVX A;  3KOT A;  3B6Q A;  4FOR A;  4PDH A;  3MUQ A;  2ZNT A;  4HE1 A;  4OYV A;  2O1L A;  4KYE A;  5I2N A;  3MJN A;  3EN3 A;  5EHS A;  1A55 A;  4JVI A;  3H06 B;  3IL1 B;  3K6V A;  4JWX A;  1KZ8 A;  3T9X B;  4DE8 A;  2QVU A;  5A5X B;  2FA7 A;  4O7M A;  3SEX A;  2Q2C A;  3OEK A;  1RYO A;  3Q29 A;  3DP4 A;  4HW8 A;  5TP9 B;  2DYX A;  5I59 B;  4KYS A;  4ONY A;  4H65 A;  5AA2 D;  2B3B A;  2XD2 A;  3FV2 A;  1MS7 A;  5ITO A;  3S9N C;  1FJ9 A;  3BFT A;  1IMC A;  1D9Y A;  2X26 A;  2FIX A;  2DXR A;  5LDZ A;  4RPO A;  4EXK A;  1OLA A;  4OVJ A;  4P8B A;  1SPI A;  3TCH A;  2Y7K A;  4FE8 A;  3MQ9 A;  2I3W A;  4AS4 A;  2NUV A;  2XX9 A;  3MZ9 A;  1P1U A;  3VDF A;  2HPG A;  2ZZV A;  2XWK A;  1N84 A;  3IOU A;  1QVS A;  4R73 A;  5K2Y A;  4F1Y A;  2NXO A;  3MVZ A;  3G3H A;  3VXB A;  3SES A;  4ELQ A;  2OK2 A;  4KCC A;  5I57 B;  1FPI A;  1XC1 A;  4P1E A;  1LBB A;  2I0B A;  4IO4 A;  4H0W A;  2ZMB A;  4XKQ A;  4F18 A;  2GHB A;  4PP0 A;  4BDR A;  3U1O A;  3CI8 A;  4NWC A;  3OOA A;  3RPL B;  1JEV A;  2GRV A;  1ZBM A;  5LOM A;  5H8Q B;  1LBW A;  2ZZW A;  1NV4 A;  3U8Q A;  4I40 A;  2GHA A;  4R9F A;  2OWT A;  1ZKB A;  1VDW A;  3OO7 A;  4MF3 A;  4ZDM A;  2XXH A;  3FJ7 A;  4PTK A;  3CVG A;  4IY6 A;  3V8X B;  3IB2 A;  2XWO A;  2OBG A;  4F22 A;  5F24 A;  5FTI A;  2H25 A;  3CIJ A;  2O68 A;  3IOT A;  5I56 B;  4R75 A;  1LCF A;  3LR1 A;  3EQ1 A;  4EF1 A;  3G3I A;  2XXY A;  5BWJ A;  4AB6 A;  3K01 A;  1ZJL A;  4LZ7 A;  4AQ4 A;  4OZ9 A;  1AIV A;  4O7I A;  3LUZ A;  4BLA A;  1L5T A;  3E79 A;  1IUD A;  1EH3 A;  3PPO A;  1POY 1;  1QJM A;  2DWH A;  4PFR A;  1M5E A;  1LEV A;  5DVI A;  3AXF A;  4LQ5 A;  3OSR A;  2PYY A;  4OA4 A;  4M1V A;  4Q30 B;  1FTL A;  1XHY A;  1SW2 A;  5AA4 A;  3C34 A;  4N8Y A;  4OVP A;  1TFD A;  2DVZ A;  4NED A;  4NF6 B;  2F3B A;  1LAX A;  2HXW A;  2A5T B;  2P3N A;  4LON B;  2G93 A;  1B2H A;  4RY1 A;  3VFJ A;  2LAO A;  5F1Q A;  3C9H A;  4OEV A;  3K00 A;  3RTF B;  1FPL A;  3SEY A;  2ZXT A;  3N26 A;  3SDF A;  4TOZ A;  2I4C A;  4WEP A;  1NNP A;  2BJI A;  2VHA A;  4GWX A;  1EYK A;  4YIC A;  1EZO A;  2VT5 A;  4LUB A;  4N6P A;  4GFR A;  5ET6 A;  4PE3 A;  4FEC A;  1AL3 A;  1GR2 A;  4HE0 A;  4XKN A;  2F36 A;  3TCG A;  2Q2A A;  1PC3 A;  2DSF A;  4POW A;  3EHU A;  1LST A;  4GWU A;  3TTN A;  1IQ7 A;  4YU0 A;  4MLV A;  3IB1 A;  3IFA A;  5T3J A;  5FHN A;  3PUV E;  3SZP A;  3IAZ A;  3ROJ A;  1LAG E;  1M5B A;  4F29 A;  2H4I A;  1VE4 A;  2A5S A;  3F11 A;  3O97 A;  5F7V A;  4C1T A;  4G2Z A;  4O3C A;  3W9V A;  3ILU B;  1B32 A;  1MXY A;  3MP6 A;  1DCU A;  4N13 A;  2UVJ A;  3T66 A;  1H43 A;  2IA4 A;  4Q8R A;  1URD A;  3MC2 A;  4FJP A;  2FNC A;  1IMF A;  1IME A;  1SQY A;  3C36 A;  4FEB A;  3UOR A;  3TYH A;  4OTE A;  1MDQ A;  3C4M A;  4IO2 A;  4FBP A;  4U21 A;  1F9B A;  3OO8 A;  1LBX A;  2OLB A;  3DLN A;  2QS3 A;  2Q9T A;  4U1Z A;  2Q89 A;  3WAE A;  5FBP A;  4GL8 A;  4OFJ A;  5ET7 A;  3RT8 A;  1JQF A;  3B7D A;  4BDN A;  1B6H A;  4N6D A;  4X8R A;  1MY4 A;  2ZNS A;  4BDL A;  4U23 A;  4POX A;  3RTW B;  5TP9 A;  2E1S A;  5KDT B;  1Q9D A;  2CEY A;  4QHQ A;  5I59 A;  2B4M A;  4QBA A;  4I9D A;  1YZ0 A;  4OAN A;  3D1R A;  1FTM A;  3PMX A;  3VV5 A;  3RT6 B;  1Z7N E;  3K6X A;  2ZYK A;  5J16 A;  3MP8 A;  3L6G A;  5JK4 A;  2QS1 A;  3CFX A;  3G3F A;  1JET A;  5CI5 A;  3RGY A;  2ABH A;  3MPL A;  1SVX B;  2AYS A;  4GWW A;  2I4B A;  4RK2 A;  2VD2 A;  3M3K A;  4BDO A;  3H7M A;  3CSG A;  2NWJ A;  1HSJ A;  4OVT A;  4RPN A;  5I3S A;  2O69 A;  1HSL A;  3FVG A;  4BDM A;  1A99 A;  2V25 A;  2DWI A;  1D9Q A;  1IXC A;  4H8J A;  1B5I A;  4Q0C A;  3SKP A;  1IMD A;  1RDY A;  4P0I A;  2M8C A;  3MYU A;  4RNS A;  4DLD A;  2FIE A;  5BUU A;  4O94 A;  5CRY A;  3TUS A;  3LBS A;  3T9H B;  5H8Q A;  1B4H A;  1B7Z A;  3LSW A;  3RY3 A;  2RIN A;  4ZEC A;  5CM6 A;  2QMW A;  3VVE A;  2G29 A;  4UAC A;  3ODB A;  3CG1 A;  5M2V A;  3L6H A;  5L9O A;  4HS7 A;  1EZP A;  1B5J A;  4F2Q A;  2PBW A;  3TOD A;  4XF5 A;  2O51 A;  3T93 B;  5I56 A;  2XWI A;  1PB9 A;  1FTA A;  4H6D A;  3R26 A;  1FRP A;  1FPE A;  2DP8 A;  3LSX A;  1NNF A;  2V4C A;  5A5L A;  2QRY A;  4ZE8 A;  2V3T A;  1D9V A;  1MQG A;  3FAS A;  4N4U A;  1Q1K A;  3KOS A;  4HE2 A;  4P1L A;  2R71 A;  4DZ1 A;  2W7Y A;  2NOO A;  5DTB A;  4OFL A;  3U92 A;  3TMG A;  5B70 A;  4N91 A;  4QSD A;  4PBQ A;  4EQB A;  3MZ1 A;  1MQJ A;  1LBC A;  1NV5 A;  4IR8 A;  2Q8J A;  4GWS A;  2XX8 A;  3IOV A;  4NF6 A;  3UA8 A;  4OVS A;  2B4L A;  2XXV A;  2ALU A;  3PUX E;  3IX1 A;  3GZG A;  2GFE A;  3KGC A;  3K1M A;  3BBR A;  4X1D A;  4KXP A;  3JV9 A;  1LBV A;  1RDZ A;  4QFK A;  4G77 A;  4G4P A;  3N94 A;  1H76 A;  2OJT A;  3CG3 A;  3H6W A;  5ET5 A;  4GVO A;  2PT1 A;  1MPC A;  1FCK A;  4X1B A;  4MJO A;  1IXH A;  4IO7 A;  2XXR A;  2V93 A;  2DE2 A;  3CR9 A;  2F78 A;  1USY H;  5I5P A;  3K6W A;  1LB9 A;  4H45 A;  1A40 A;  3QSL A;  1FTJ A;  2CMO A;  4EF2 A;  3Q27 A;  1BIY A;  3TAJ A;  3EHT A;  1AWB A;  2BJJ X;  1EZ9 A;  4R2F A;  2V3Q A;  2KR0 A;  1DTZ A;  3TTL A;  3QUF A;  4EQ7 A;  4EXL A;  3MAM A;  3OEL A;  3A3U A;  3GYY A;  1DBZ A;  1CB6 A;  4F1V A;  3IFC A;  3E9X A;  2X7Q A;  4AB5 A;  4QF9 A;  2F5X A;  2O6A A;  2Y84 A;  1XI6 A;  4R2B A;  3TPA A;  2Q74 A;  2PVU A;  2RCB A;  4P11 A;  2RC9 A;  4DI4 B;  4LA9 A;  2CZI A;  5IM2 A;  3TQL A;  5DYH A;  1FQF A;  5ISU A;  2B65 A;  4PBH A;  1UTH B;  1BTJ A;  4IO5 A;  3D4G A;  3EHS A;  4FAT A;  2PFY A;  1B3F A;  4G68 C;  3TTR A;  4X9T A;  3PGF A;  1MPB A;  4ZE9 A;  1QUJ A;  1NUW A;  2H5Y A;  1JW5 A;  4GWY A;  4RJZ A;  4MFI A;  3R6U A;  4OQO A;  5KDT A;  1B58 A;  4E0W A;  5ESY A;  1I6A A;  1AOV A;  3N6U A;  3I6V A;  4YKK A;  4YKP A;  1PB8 A;  4HCW A;  4YB6 A;  5I58 B;  4R72 A;  3HST A;  3C32 A;  3IB0 A;  4R6H A;  4GLI A;  1O63 A;  1AMF A;  3OMB A;  3KJ7 A;  4N15 A;  4F3P A;  4X04 A;  4PET A;  2ZYN A;  4F31 B;  1XOC A;  1FQC A;  4N8G A;  4KYD A;  3SET A;  3W9W A;  3ISP A;  4K3F A;  3O6H A;  2I48 A;  2R6G E;  2QJE A;  3KN7 A;  4YKI A;  3BIG A;  5CBS A;  3R7X A;  2F35 A;  2DE3 A;  4R6Y A;  1FSA A;  4OVQ A;  4P9K A;  2ZNU A;  3BIH A;  4PAF A;  3KBZ A;  2UVH A;  3O9P A;  3RPW A;  3GBB A;  2V3U A;  4LP2 B;  1PDA A;  4DXU A;  2ZZX A;  1KA0 A;  2Y7W A;  4IO6 A;  3FVO A;  4FED A;  1MXV A;  3FZV A;  3IOR A;  4PGP A;  1FBC A;  3S2V A;  3KZG A;  5ICQ A;  2O84 X;  3JZJ A;  1ZIU A;  1URS A;  3T0J A;  1GV8 A;  3MBP A;  4F3G A;  1Y1M A;  4C0R A;  1CNQ A;  4TLM B;  1LGB C;  4NQ8 A;  3E13 X;  2XA5 A;  2ZYM A;  1FBH A;  1MY0 A;  3OXN A;  4MMP A;  4GBV A;  3MVX A;  1NV2 A;  1OLC A;  1DPP A;  4U4X A;  4IB2 A;  1LBY A;  3D4C A;  1MXX A;  1PEB A;  2VOZ A;  1OMP A;  2QMX A;  3OSQ A;  2YPN A;  2XX7 A;  3G3K A;  1PBP A;  4ELP A;  1MXZ A;  4MIJ A;  2DQV A;  1MQI A;  2Z8F A;  4GBW A;  4G8M A;  3FD3 A;  5IZ1 A;  4KD5 A;  3QMF A;  1BK4 A;  4PDD A;  3U93 A;  4OEN A;  5J1D A;  5IAI A;  4HXV A;  1FBP A;  5L9S A;  4F39 A;  2R9J A;  1US4 A;  3M3L A;  1S50 A;  2I58 A;  3PUY E;  2NVU B;  2H9B A;  4GD5 A;  3H3G A;  4NF8 A;  4OWD A;  5AE4 A;  2IEE A;  4OHN A;  1T0K A;  5IZ3 B;  1AH5 A;  5TPA A;  4NF4 A;  5DVF A;  2Z22 A;  3H6V A;  3A29 A;  3UIF A;  4G8N A;  2CZK A;  1B3E A;  3FXB A;  4MH5 A;  1QGX A;  4QXD A;  3WAF A;  1UTB B;  4F1U A;  3TKD A;  4DI3 D;  1UQW A;  4WXJ A;  2XXU A;  1ZU0 A;  4RYA A;  2DWJ A;  3QK6 A;  4PE5 B;  1VSO A;  2WX9 A;  2XXW A;  2I6E A;  2Q88 A;  1YCJ A;  3KBR A;  3KC0 A;  2P2A A;  4RA1 A;  3BKI B;  4ZEF A;  1IXG A;  4H8I A;  1LFH A;  3PD9 A;  4QFP A;  1B3L A;  1YXI A;  4HCY A;  4MLQ A;  4MNP A;  4YKJ A;  3C35 A;  5I2N B;  4PFY A;  1Y9U A;  1FJ6 A;  2F6P A;  1S7Y A;  3K0V A;  4O3B A;  3E4R A;  3H4Z A;  1B5H A;  2HHM A;  4UAB A;  3FIR A;  3VVD A;  1B3H A;  4OET A;  1LAH E;  3NOH A;  1USY E;  4EQ9 A;  4JSO A;  4N6K A;  4TQU Q;  5A5X A;  4H5F A;  3FVK A;  2HZK A;  4N17 A;  3VE1 B;  4ELO A;  2L5V A;  1UTH A;  2AL4 A;  4GWO A;  2WBD A;  1TWY A;  4KHZ E;  1B46 A;  4ZS9 A;  1P99 A;  3PMW A;  2GQ1 A;  4R6K A;  4NTL A;  2WEF A;  1QKA A;  4YB5 A;  3Q26 A;  2QSX A;  2O1M A;  3IK6 B;  3K1P A;  1BP5 A;  2DXY A;  1R1N A;  2DE4 A;  2OX3 A;  3LV0 A;  1MQD A;  3T96 B;  1LAF E;  2UYE A;  1MXW A;  2DVC A;  1ZTY A;  2H99 A;  4EDP A;  4GF8 A;  2CEX A;  4QFL A;  4LZ8 A;  3IJO B;  1NV7 A;  1Q35 A;  3OO6 A;  2UYF A;  3LUY A;  3O6I A;  1I6Q A;  2XXK A;  1A8F A;  1FQB A;  5FHM A;  2E0S A;  5I58 A;  2PX1 A;  4Q5T A;  1NI9 A;  3V83 A;  5I57 A;  2XXQ A;  3PU5 A;  1P1O A;  3IO6 A;  1ATG A;  4JVD A;  1ELJ A;  3K4U A;  3CSB A;  3FUZ A;  4NWD A;  4DDD A;  5EHM A;  3FV1 A;  3RQT A;  2HEU A;  3RPL A;  4ESX A;  4LVQ A;  3PUW E;  3H6U A;  3V89 B;  1I69 A;  4ECF A;  3IO4 A;  3KC1 A;  3U72 A;  1OQH A;  3M8U A;  4PAK A;  3TEL A;  1VFD A;  2XXX A;  1QKB A;  4NE4 A;  1VR5 A;  4PF6 A;  3HFU A;  1O7T A;  1EU8 A;  4H5G A;  4JB7 A;  2DS9 A;  3K1N A;  2PFZ A;  1NFT A;  3B50 A;  2F97 A;  4QRZ A;  4ZEB A;  4PCD A;  1HSE A;  3KN8 A;  1FTO A;  2VD3 A;  1B0H A;  4EUO A;  4YB7 A;  1NH8 A;  4U22 A;  2WYK A;  5H8H B;  4GWZ A;  1FBE A;  3IR1 A;  2RC7 A;  1FBF A;  2XXP A;  1KA1 A;  3CHG A;  3DEL B;  4WED A;  2QFL A;  3N6T A;  4I1D A;  3KJT A;  1FBG A;  4MCO A;  4C1U A;  1UIU A;  1FQE A;  3QUJ A;  3K2D A;  3VVF A;  1MDP 1;  3E78 A;  3TEP A;  5KCJ B;  5K2X A;  2I0C A;  1DTG A;  4F2O A;  3TDJ A;  1LLS A;  4PFI A;  3SEW A;  1N7X A;  1FTK A;  3GXA A;  1JW1 A;  4JWY A; 
#chains in the Genus database with same CATH homology
 1SYH A;  1SW5 A;  4JXI A;  4NMY A;  1B51 A;  2A5T A;  2OCU A;  4ZEK A;  1A54 A;  2VP1 A;  3OO9 A;  5AA1 A;  1B9J A;  4OFO A;  3FAT A;  2RKM A;  3RNN A;  1D3K A;  4XIG Q;  3GBA A;  1MY3 A;  3C31 A;  2ONR A;  5DEX B;  2F34 A;  3KSX A;  1P1W A;  1LFG A;  4P0G A;  3HHF A;  3G3G A;  1GVC A;  3H03 A;  1PBQ A;  3I5O A;  1NKX A;  2FYI A;  2F7B A;  4HTG A;  1JNF A;  1UTB A;  4PQJ A;  3EPE A;  1JVY A;  3MP1 A;  3GLB A;  4QSE A;  1LCT A;  2ZYO A;  3FXQ A;  3P7I A;  4E0X A;  1B3G A;  2AIX A;  3KG2 A;  3Q28 A;  4YMA A;  1MH3 A;  4GXS B;  1MG1 A;  3VLV A;  5I2K B;  1IXI A;  2F8D A;  1XS5 A;  2ONS A;  4N07 A;  1KWH A;  1IIW A;  2OZZ A;  2XXI A;  4OER A;  2P0S A;  4Z0I A;  3VLU A;  4DXC A;  1WDN A;  3B6W A;  3ZKK A;  2QS4 A;  4THI A;  5JTY B;  4ZZA A;  3TQW A;  1Z7M E;  5ELV A;  4YAH X;  4KCD A;  1JEU A;  3JYR A;  4YZZ A;  2DOJ A;  1QUI A;  3LSF B;  5CMM A;  1OVT A;  1BKA A;  1Y4T A;  5CBR A;  1MY2 A;  5AA2 B;  1N04 A;  1B0L A;  5CC2 A;  3KSJ A;  3S9E A;  3FGS A;  1TXF A;  3Q25 A;  4Z7E A;  1R9Q A;  2I49 A;  1NMU A;  5H8S A;  4DXB A;  5ITP A;  2CZL A;  5CMK A;  4O3A A;  3ZKL A;  1A7L A;  1N76 A;  1MH4 A;  4PFT A;  3O2A A;  1CE2 A;  2H98 A;  3USD A;  2XHD A;  4TLL B;  5HBC A;  4LZ5 A;  3T9U A;  3FJM A;  3H6T A;  3QIM A;  3O6G A;  1OIB A;  3C33 A;  1XT8 A;  1D4N A;  4QFO A;  1MPD A;  3UK4 A;  3M3F A;  3PPR A;  3KN3 A;  4DIG A;  3CFZ A;  3LC8 A;  5EYF A;  4BDQ A;  3HPI A;  4PFW A;  1IEJ A;  4U4S A;  4U1O A;  2XXT A;  2THI A;  5FTH A;  2PT2 A;  4GOT A;  4OEU A;  1VFE A;  3ZS6 A;  1UIV A;  3RUM A;  2O7I A;  3PPN A;  5H8N B;  1I6B A;  5H8H A;  3THI A;  3I3V A;  4ELR A;  3A09 A;  4G68 B;  4NF5 B;  3UP9 A;  5ICT A;  1ZMG A;  2Z8E A;  1Y3P A;  5HPQ A;  2Y7I A;  5JEI A;  4GXA A;  4R74 A;  3S9M C;  3SEV A;  5KCJ A;  3FJG A;  1DOT A;  3HCQ A;  5HM4 B;  5CMC A;  1SDX A;  4JBZ A;  3SEU A;  2ONK E;  4F19 A;  4ND9 A;  4IO3 A;  1Y3Q A;  3OD7 A;  4QFN A;  5KZT A;  4IY5 A;  3MVW A;  5CMB A;  4F3B A;  1NL5 A;  3QAX A;  3TTM A;  1SD3 A;  4L17 A;  2ANJ A;  1B4Z A;  1R9L A;  3TFL A;  1DMB A;  3T9V A;  1IZ1 A;  1Y20 A;  4KPT A;  1LFI A;  1BLF A;  1S9T A;  3PMV A;  1FQA A;  1P1Q A;  4I62 A;  4X48 A;  1ANF A;  3MZB A;  2RF1 A;  1H3D A;  2I3V A;  4UA8 A;  1Y4C A;  1IIT A;  3CFL A;  2Y7R A;  3G7W A;  4OXV A;  5H8F B;  2GH9 A;  3TCF A;  3HN0 A;  5IKB A;  3TZA A;  5DEX A;  1US5 A;  4OMB A;  1WVJ A;  3OEM A;  2DWA A;  4ZED A;  2RCA A;  3FVN A;  4PFU A;  1GGG A;  5DVJ A;  1H45 A;  2REJ A;  1YPN A;  4ESW A;  4U2R A;  1H44 A;  4YMB A;  3W15 C;  5B7D A;  3V5A A;  4JWO A;  1B52 A;  4KI0 E;  4XTC Q;  3G3J A;  4ISU A;  3MWB A;  4XXU A;  3E3K A;  2PMS A;  1MXU A;  4LQ2 A;  4GIZ A;  5I2K A;  3UN6 A;  3DP8 A;  2QS2 A;  2VGQ A;  1JVX A;  5I84 A;  2HAU A;  4H1X A;  3ILT B;  1FW0 A;  2Z23 A;  3O29 A;  5DT6 A;  3RN8 A;  5JTY A;  3MPK A;  1N0T A;  3PUZ E;  3ZSF A;  2WKY A;  2AL5 A;  4RXL A;  3MVY A;  3DP6 A;  2HZL A;  1A8E A;  1YAE A;  3LSL A;  1ZLQ A;  5AA2 A;  2XD3 A;  1P1N A;  3IOW A;  3U94 A;  2D3I A;  2OWS A;  3BFU A;  1QW0 A;  2Z8D A;  3VXC A;  3UGW A;  5AA3 A;  1Y3N A;  4KFQ A;  1MQH A;  4LAT A;  5FHO A;  3DM0 A;  1XVY A;  1II5 A;  3O28 A;  1M5D A;  4OES A;  1QUK A;  4WKM A;  1JW4 A;  2F7C A;  4ZEI A;  1MRP A;  1SI1 A;  3ONM A;  4R9G A;  3K6U A;  3KEI A;  4KR5 A;  3S9L C;  3A3C A;  1SYI A;  2UVI A;  2B3F A;  1YTV A;  3FXU A;  1MY1 A;  4KQP A;  1DSN A;  2Y7P A;  3OEN A;  3PV0 E;  1J1N A;  3VLW A;  3QYT A;  1OQG A;  1NNT A;  3FXR A;  2X7P A;  2ESN A;  1MM6 A;  3HHG A;  4JSD A;  2KLF A;  1NH7 A;  1SBP A;  5L8D A;  1WOD A;  4FIM A;  1DPE A;  1B7H A;  2HFB A;  1N3X A;  3B6T A;  5H8N A;  4QSC A;  2UXA A;  2QL3 A;  1N3W A;  1GTK A;  1R6Z A;  4GRK A;  2YLN A;  4G68 A;  4NF5 A;  2REG A;  5AA4 B;  1TT1 A;  3KFM A;  1RYX A;  4MBP A;  4G8H A;  1SW1 A;  2O7U A;  1M5F A;  2P1S A;  4H67 A;  4DCX A;  2F6G A;  4F3S A;  3PPQ A;  3T22 A;  4FAJ A;  1M5C A;  2D5W A;  3SER A;  1RKM A;  2QPQ A;  3ECR A;  1URG A;  3EF7 A;  2RC8 A;  2HCA A;  4RK9 A;  3O66 A;  1B1H A;  2F7A A;  1Y1Z A;  1FQD A;  4NF8 B;  3TTK A;  1SI0 A;  4XKR A;  2HQ0 A;  4IGT A;  3CRB A;  1NNK A;  4I8C A;  3HV1 A;  1MM7 A;  3N5L A;  3K02 A;  5TPA B;  4NF4 B;  3RLF E;  3HO7 A;  1OVB A;  5TU0 A;  4JDF A;  1QUL A;  1SW4 A;  3IJX B;  3PPP A;  1O64 A;  1B05 A;  5H8F A;  4DCY A;  2D21 A;  4XKP A;  4GQO A;  3S4U A;  2V84 A;  4M4G A;  2UVG A;  4IGR A;  1LB8 A;  4ZZE A;  1N7W A;  1PB7 A;  2YJP A;  5L9M A;  3QXM A;  4GL0 A;  1B40 A;  1B1X A;  3MW0 A;  1POT A;  1B7U A;  3PD8 A;  2HAV A;  1TFA A;  1XVX A;  3KOT A;  3B6Q A;  4FOR A;  3MUQ A;  2ZNT A;  4OYV A;  2O1L A;  4KYE A;  5I2N A;  3MJN A;  3EN3 A;  5EHS A;  1A55 A;  3H06 B;  3IL1 B;  3K6V A;  4JWX A;  3T9X B;  4DE8 A;  5A5X B;  2FA7 A;  3SEX A;  2Q2C A;  3OEK A;  1RYO A;  3Q29 A;  3DP4 A;  4HW8 A;  5TP9 B;  2DYX A;  5I59 B;  4KYS A;  4ONY A;  4H65 A;  5AA2 D;  2B3B A;  2XD2 A;  3FV2 A;  1MS7 A;  5ITO A;  3S9N C;  3BFT A;  1D9Y A;  2X26 A;  2DXR A;  4RPO A;  4EXK A;  1OLA A;  4OVJ A;  3TCH A;  2Y7K A;  4FE8 A;  3MQ9 A;  2I3W A;  2NUV A;  2XX9 A;  3MZ9 A;  1P1U A;  3VDF A;  1N84 A;  3IOU A;  1QVS A;  4R73 A;  5K2Y A;  4F1Y A;  2NXO A;  3MVZ A;  3G3H A;  3VXB A;  3SES A;  4ELQ A;  2OK2 A;  4KCC A;  5I57 B;  1XC1 A;  1LBB A;  2I0B A;  4IO4 A;  4H0W A;  2ZMB A;  4XKQ A;  4F18 A;  2GHB A;  4PP0 A;  4BDR A;  3U1O A;  3CI8 A;  4NWC A;  3OOA A;  1JEV A;  2GRV A;  1ZBM A;  5LOM A;  5H8Q B;  3U8Q A;  2GHA A;  4R9F A;  2OWT A;  1ZKB A;  3OO7 A;  4MF3 A;  4ZDM A;  2XXH A;  3FJ7 A;  3CVG A;  4IY6 A;  3V8X B;  3IB2 A;  2OBG A;  4F22 A;  5FTI A;  2H25 A;  3CIJ A;  2O68 A;  3IOT A;  5I56 B;  4R75 A;  1LCF A;  3LR1 A;  3EQ1 A;  4EF1 A;  3G3I A;  2XXY A;  5BWJ A;  4AB6 A;  3K01 A;  1ZJL A;  4LZ7 A;  4AQ4 A;  4OZ9 A;  1AIV A;  4BLA A;  1L5T A;  1IUD A;  1EH3 A;  3PPO A;  1POY 1;  1QJM A;  2DWH A;  1M5E A;  5DVI A;  3AXF A;  4LQ5 A;  3OSR A;  2PYY A;  4M1V A;  4Q30 B;  1FTL A;  1XHY A;  1SW2 A;  5AA4 A;  3C34 A;  1TFD A;  2DVZ A;  4NED A;  4NF6 B;  1LAX A;  2HXW A;  2A5T B;  4LON B;  2G93 A;  1B2H A;  4RY1 A;  3VFJ A;  2LAO A;  5F1Q A;  3C9H A;  4OEV A;  3K00 A;  3RTF B;  3SEY A;  2ZXT A;  3N26 A;  3SDF A;  4TOZ A;  2I4C A;  4WEP A;  1NNP A;  2VHA A;  4YIC A;  1EZO A;  4LUB A;  4N6P A;  4GFR A;  4FEC A;  1AL3 A;  1GR2 A;  4XKN A;  2F36 A;  3TCG A;  2Q2A A;  1PC3 A;  2DSF A;  4POW A;  3EHU A;  1LST A;  3TTN A;  1IQ7 A;  4YU0 A;  4MLV A;  3IB1 A;  5FHN A;  3PUV E;  3IAZ A;  1LAG E;  1M5B A;  4F29 A;  2H4I A;  1VE4 A;  2A5S A;  3F11 A;  3O97 A;  5F7V A;  4C1T A;  4G2Z A;  4O3C A;  3W9V A;  3ILU B;  1B32 A;  1MXY A;  3MP6 A;  4N13 A;  2UVJ A;  3T66 A;  1H43 A;  2IA4 A;  4Q8R A;  1URD A;  3MC2 A;  4FJP A;  2FNC A;  1SQY A;  3C36 A;  4FEB A;  3UOR A;  3TYH A;  4OTE A;  1MDQ A;  3C4M A;  4IO2 A;  4U21 A;  1F9B A;  3OO8 A;  2OLB A;  3DLN A;  2QS3 A;  2Q9T A;  4U1Z A;  2Q89 A;  3WAE A;  4GL8 A;  4OFJ A;  3RT8 A;  1JQF A;  3B7D A;  4BDN A;  1B6H A;  1MY4 A;  2ZNS A;  4BDL A;  4U23 A;  4POX A;  3RTW B;  5TP9 A;  2E1S A;  5KDT B;  4QHQ A;  5I59 A;  4I9D A;  1FTM A;  3PMX A;  3VV5 A;  3RT6 B;  1Z7N E;  3K6X A;  2ZYK A;  3MP8 A;  3L6G A;  5JK4 A;  2QS1 A;  3CFX A;  3G3F A;  1JET A;  5CI5 A;  3RGY A;  2ABH A;  3MPL A;  1SVX B;  2AYS A;  2I4B A;  4RK2 A;  2VD2 A;  3M3K A;  4BDO A;  3H7M A;  3CSG A;  2NWJ A;  1HSJ A;  4RPN A;  2O69 A;  1HSL A;  3FVG A;  4BDM A;  1A99 A;  2V25 A;  2DWI A;  1IXC A;  4H8J A;  1B5I A;  4Q0C A;  3SKP A;  4P0I A;  2M8C A;  4RNS A;  4DLD A;  5BUU A;  5CRY A;  3TUS A;  3LBS A;  3T9H B;  5H8Q A;  1B4H A;  1B7Z A;  3LSW A;  3RY3 A;  2RIN A;  4ZEC A;  5CM6 A;  2QMW A;  3VVE A;  2G29 A;  4UAC A;  3ODB A;  3CG1 A;  5M2V A;  3L6H A;  5L9O A;  4HS7 A;  1EZP A;  1B5J A;  4F2Q A;  2PBW A;  3TOD A;  2O51 A;  3T93 B;  5I56 A;  1PB9 A;  4H6D A;  3R26 A;  2DP8 A;  3LSX A;  1NNF A;  2QRY A;  4ZE8 A;  2V3T A;  1D9V A;  1MQG A;  3FAS A;  1Q1K A;  3KOS A;  4DZ1 A;  2R71 A;  2W7Y A;  2NOO A;  5DTB A;  4OFL A;  3U92 A;  3TMG A;  5B70 A;  4QSD A;  4EQB A;  3MZ1 A;  1MQJ A;  1LBC A;  2Q8J A;  2XX8 A;  3IOV A;  4NF6 A;  3UA8 A;  2XXV A;  2ALU A;  3PUX E;  3IX1 A;  3GZG A;  2GFE A;  3KGC A;  3K1M A;  3BBR A;  4X1D A;  3JV9 A;  4QFK A;  4G77 A;  4G4P A;  3N94 A;  1H76 A;  2OJT A;  3CG3 A;  3H6W A;  4GVO A;  2PT1 A;  1MPC A;  1FCK A;  4X1B A;  1IXH A;  4IO7 A;  2XXR A;  2V93 A;  2DE2 A;  3CR9 A;  2F78 A;  1USY H;  3K6W A;  1LB9 A;  1A40 A;  3QSL A;  1FTJ A;  2CMO A;  4EF2 A;  3Q27 A;  1BIY A;  3TAJ A;  3EHT A;  2BJJ X;  1EZ9 A;  4R2F A;  2V3Q A;  1DTZ A;  3TTL A;  3QUF A;  4EQ7 A;  4EXL A;  3MAM A;  3OEL A;  3A3U A;  1CB6 A;  4F1V A;  3E9X A;  2X7Q A;  4AB5 A;  4QF9 A;  2F5X A;  2O6A A;  2Y84 A;  4R2B A;  3TPA A;  2PVU A;  2RCB A;  4P11 A;  2RC9 A;  4LA9 A;  3TQL A;  5DYH A;  1FQF A;  5ISU A;  2B65 A;  1UTH B;  1BTJ A;  4IO5 A;  3D4G A;  3EHS A;  4FAT A;  1B3F A;  4G68 C;  3TTR A;  4X9T A;  3PGF A;  1MPB A;  4ZE9 A;  1QUJ A;  2H5Y A;  1JW5 A;  4RJZ A;  4MFI A;  3R6U A;  4OQO A;  5KDT A;  1B58 A;  4E0W A;  1I6A A;  1AOV A;  3N6U A;  3I6V A;  4YKK A;  4YKP A;  1PB8 A;  4HCW A;  4YB6 A;  5I58 B;  4R72 A;  3HST A;  3C32 A;  3IB0 A;  4R6H A;  4GLI A;  1O63 A;  1AMF A;  3OMB A;  3KJ7 A;  4F3P A;  4PET A;  2ZYN A;  4F31 B;  1XOC A;  1FQC A;  4KYD A;  3SET A;  3W9W A;  4K3F A;  3O6H A;  2I48 A;  2R6G E;  2QJE A;  3KN7 A;  4YKI A;  5CBS A;  3R7X A;  2F35 A;  2DE3 A;  4R6Y A;  2ZNU A;  2UVH A;  3O9P A;  3RPW A;  3GBB A;  2V3U A;  4LP2 B;  1PDA A;  4DXU A;  2Y7W A;  4IO6 A;  3FVO A;  4FED A;  1MXV A;  3FZV A;  3IOR A;  3S2V A;  3KZG A;  5ICQ A;  2O84 X;  3JZJ A;  1ZIU A;  1URS A;  1GV8 A;  3MBP A;  4F3G A;  1Y1M A;  4C0R A;  4TLM B;  1LGB C;  3E13 X;  2ZYM A;  1MY0 A;  3OXN A;  3MVX A;  1OLC A;  1DPP A;  4U4X A;  4IB2 A;  3D4C A;  1MXX A;  1PEB A;  2VOZ A;  1OMP A;  2QMX A;  3OSQ A;  2YPN A;  2XX7 A;  3G3K A;  1PBP A;  4ELP A;  1MXZ A;  2DQV A;  1MQI A;  2Z8F A;  4G8M A;  3FD3 A;  4KD5 A;  3U93 A;  4OEN A;  5J1D A;  5IAI A;  5L9S A;  4F39 A;  2R9J A;  1US4 A;  3M3L A;  1S50 A;  2I58 A;  3PUY E;  2NVU B;  2H9B A;  4GD5 A;  3H3G A;  4NF8 A;  4OWD A;  5AE4 A;  2IEE A;  4OHN A;  1T0K A;  1AH5 A;  5TPA A;  4NF4 A;  5DVF A;  2Z22 A;  3H6V A;  3UIF A;  4G8N A;  1B3E A;  4MH5 A;  3WAF A;  1UTB B;  4F1U A;  3TKD A;  1UQW A;  4WXJ A;  2XXU A;  1ZU0 A;  4RYA A;  2DWJ A;  3QK6 A;  4PE5 B;  1VSO A;  2XXW A;  2I6E A;  2Q88 A;  1YCJ A;  3KBR A;  2P2A A;  4RA1 A;  3BKI B;  4ZEF A;  1IXG A;  4H8I A;  1LFH A;  3PD9 A;  4QFP A;  1B3L A;  4HCY A;  4MLQ A;  4YKJ A;  3C35 A;  5I2N B;  4PFY A;  1Y9U A;  2F6P A;  1S7Y A;  3K0V A;  4O3B A;  3E4R A;  3H4Z A;  1B5H A;  3FIR A;  3VVD A;  1B3H A;  4OET A;  1LAH E;  1USY E;  4EQ9 A;  4JSO A;  4TQU Q;  5A5X A;  4H5F A;  3FVK A;  2HZK A;  3VE1 B;  4ELO A;  1UTH A;  2AL4 A;  4GWO A;  1TWY A;  4KHZ E;  1B46 A;  4ZS9 A;  1P99 A;  3PMW A;  4R6K A;  4NTL A;  1QKA A;  4YB5 A;  3Q26 A;  2QSX A;  2O1M A;  3IK6 B;  3K1P A;  1BP5 A;  2DXY A;  1R1N A;  2DE4 A;  1MQD A;  3T96 B;  1LAF E;  2UYE A;  1MXW A;  2DVC A;  1ZTY A;  2H99 A;  4EDP A;  4GF8 A;  4QFL A;  4LZ8 A;  3IJO B;  1Q35 A;  3OO6 A;  2UYF A;  3LUY A;  3O6I A;  1I6Q A;  1A8F A;  1FQB A;  5FHM A;  2E0S A;  5I58 A;  2PX1 A;  4Q5T A;  3V83 A;  5I57 A;  2XXQ A;  3PU5 A;  1P1O A;  3IO6 A;  1ATG A;  1ELJ A;  3K4U A;  3CSB A;  3FUZ A;  4NWD A;  4DDD A;  5EHM A;  3FV1 A;  3RQT A;  2HEU A;  4ESX A;  4LVQ A;  3PUW E;  3H6U A;  3V89 B;  1I69 A;  4ECF A;  3IO4 A;  3U72 A;  1OQH A;  3M8U A;  3TEL A;  1VFD A;  2XXX A;  1QKB A;  4NE4 A;  1VR5 A;  1O7T A;  1EU8 A;  4H5G A;  4JB7 A;  2DS9 A;  3K1N A;  1NFT A;  2F97 A;  4QRZ A;  4ZEB A;  1HSE A;  3KN8 A;  1FTO A;  2VD3 A;  1B0H A;  4EUO A;  4YB7 A;  1NH8 A;  4U22 A;  5H8H B;  3IR1 A;  2RC7 A;  2XXP A;  4WED A;  3DEL B;  3N6T A;  4I1D A;  3KJT A;  4C1U A;  1UIU A;  1FQE A;  3QUJ A;  3K2D A;  3VVF A;  1MDP 1;  3TEP A;  5KCJ B;  5K2X A;  2I0C A;  1DTG A;  4F2O A;  3TDJ A;  1LLS A;  3SEW A;  1N7X A;  1FTK A;  3GXA A;  1JW1 A;  4JWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...