3GZGA

Crystal structure of the xanthomonas axonopodis pv. citri molybdate-binding protein (moda) mutant (k127s)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
232
structure length
232
Chain Sequence
TAPVTVFAAASLKESMDEAATAYEKATGTPVRVSYAASSALARQIEQGAPADVFLSADLEWMDYLQQHGLVLPAQRHNLLGNTLVLVAPASSKLRVDPRAPGAIAKALGENGRLAVGQTASVPAGSYAAAALRKLGQWDSVSNRLAESESVRAALMLVSRGEAPLGIVYGSDARADAKVRVVATFPDDSHDAIVYPVAALKNSNNPATAAFVSWLGSKPAKAIFARRGFSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdate-binding periplasmic protein; permease
publication title Crystal structure of the Xanthomonas axonopodis pv. citri molybdate-binding protein (ModA) mutant (K127S)
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Metal binding protein
total genus 72
structure length 232
sequence length 232
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3gzgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3gzgA02
2R71A 4NF8B 4EXLA 4KR5A 1EH3A 1S7YA 1PB8A 1MY1A 1PC3A 3CIJA 4LATA 3G3GA 3ZKKA 3K6WA 4BLAA 4IO3A 4FIMA 1YPNA 2H9BA 2Y7PA 3CSGA 3IOUA 3IJOB 4IB2A 4XKPA 2Y7IA 4POXA 1B3GA 3W9WA 1SI1A 3N94A 2ZYMA 5I59B 2VP1A 3TZAA 4IGRA 4N07A 1AOVA 4X9TA 3SETA 4ZZEA 4KI0E 4DDDA 1FTMA 3MPKA 3PMVA 1A7LA 4F19A 1UIUA 1D4NA 2KLFA 3RN8A 2Z23A 3ILTB 1P99A 4XKNA 4GFRA 4ELQA 4LP2B 2GFEA 4JSOA 5CRYA 3T9VA 3MP1A 4P0GA 1NH7A 1IXHA 4F39A 4F3PA 3EHUA 3TPAA 4H67A 4OHNA 1NNKA 4R6YA 4PE5B 1ZJLA 3HSTA 3CFXA 1EZPA 2DVZA 1SW4A 4NF4B 1JNFA 3MQ9A 4OYVA 4LQ5A 4R74A 4YZZA 1JVYA 2P1SA 3MJNA 3GZGA 2B3BA 4YKJA 3TTRA 2HEUA 3W9VA 2D3IA 2A5TB 3KJ7A 1S9TA 4HS7A 4U1OA 1NNTA 2CMOA 4IO7A 1NNFA 2I3VA 1JVXA 3WAFA 4EDPA 2DWJA 3ECRA 3SEVA 3OSQA 4LZ7A 2UYFA 1ZKBA 2ZYNA 2V3TA 1ZIUA 1NNPA 3RTFB 1PBQA 3PMXA 1XVXA 3Q27A 4NF6B 3KZGA 3QK6A 1LBBA 1KWHA 1IXIA 1MXYA 2PX1A 4H65A 3OO7A 1LGBC 1XOCA 3MVXA 4U2RA 5J1DA 1M5BA 3K00A 4OXVA 1I6BA 2D21A 3HHFA 2HAVA 4L17A 4C0RA 4F2QA 4JDFA 2V93A 1Y4CA 3V8XB 2H4IA 1MG1A 4JXIA 3PPPA 3IORA 5L9MA 3S9NC 3E4RA 5FTIA 1B6HA 4E0WA 4YMAA 4F1YA 3C31A 1NMUA 3SKPA 4F31B 1B51A 4EQ9A 3P7IA 3TQLA 5JEIA 3HO7A 3N6UA 2UVHA 4DIGA 5ITOA 2DWHA 5EHMA 1O63A 4YMBA 4F18A 3M3KA 1LAGE 1DTGA 5CMKA 1UIVA 4UA8A 2NXOA 2FYIA 4ZS9A 2ZNSA 3CR9A 2P0SA 4R9FA 1B1HA 2QS3A 1Z7NE 3G3IA 1GGGA 3B6QA 3ODBA 4OFOA 3UA8A 1LFGA 5CI5A 3OO6A 1UTHB 1USYE 3KOSA 3CFLA 1B1XA 5BUUA 4THIA 4U22A 3RT8A 3QAXA 4TOZA 1MY2A 4IGTA 4NTLA 5ITPA 2HCAA 4OEUA 4GF8A 3PUZE 3HV1A 4RA1A 4DCXA 3KN8A 3VXCA 4KQPA 5DEXA 2XXPA 2XXYA 4YB6A 3BFUA 1GR2A 2YJPA 3OSRA 4Q0CA 4GXAA 1MXVA 1EZ9A 1URGA 1IXGA 5H8FB 3TMGA 4QF9A 2XXIA 3G3FA 4LZ5A 2QS4A 3DP4A 3QSLA 2F35A 1LB8A 2Q2AA 3IB2A 1MQGA 1LSTA 1MRPA 1B5JA 1D9VA 1B2HA 1MM7A 2O68A 2I0BA 1JETA 1WDNA 2OBGA 1B7HA 4YKKA 4KFQA 3MVYA 5I56B 3K4UA 2XX9A 1XT8A 2HZLA 3G3JA 1PBPA 2XXUA 4ZE8A 2QSXA 3O29A 4YAHX 3ZSFA 1MXWA 4KCDA 4NF5A 3OXNA 1NH8A 2DQVA 3TODA 4C1UA 2DXRA 4E0XA 3UGWA 1B3FA 1AL3A 4EF1A 4EXKA 1N3XA 3KJTA 2HXWA 1AIVA 1LCTA 1B5HA 5KCJB 1H43A 5I2KB 4XXUA 3VLVA 3H6TA 4ELOA 3KEIA 1MQHA 4RK2A 2ESNA 1VFEA 2RC7A 2OLBA 1B9JA 3KBRA 2H25A 2Y84A 2F7BA 4G8HA 2NUVA 3KSJA 4XKQA 2DWIA 4NEDA 1WVJA 2DYXA 4QHQA 2QS1A 3FVOA 2ABHA 3IOWA 1IIWA 4QFKA 4R6KA 5B7DA 3SERA 5CMCA 1FQBA 3OELA 4DCYA 3FATA 4EF2A 4BDQA 4X1DA 3K6VA 3QUJA 3TYHA 3PPNA 1P1WA 3KFMA 1B40A 1Y1ZA 3MBPA 3M8UA 1ELJA 2XXXA 3I6VA 3FVNA 3V89B 1VFDA 3T93B 3ZS6A 2QMWA 3SEUA 3O9PA 5I2NA 1URSA 2RKMA 3DP8A 1SYIA 2H98A 2X26A 1B0HA 3GBAA 2QJEA 3C36A 4HW8A 2IEEA 4HCYA 1HSEA 1M5CA 2A5TA 2I4CA 4DE8A 4FEBA 2GHBA 4P11A 1D9YA 1GV8A 1F9BA 1OLAA 4I9DA 2F7AA 3L6GA 3HCQA 5TPAA 2OWTA 4AQ4A 2O7UA 3H6UA 3BKIB 3IO6A 3UORA 1Y20A 1FCKA 1M5DA 1JQFA 5F7VA 1FW0A 4NF6A 1Y3PA 5I58A 3H7MA 4NF5B 1XHYA 4ZEKA 4Q8RA 4OFJA 1L5TA 1FQDA 4DZ1A 1XS5A 2VHAA 3JV9A 4DXCA 3TTNA 2Q9TA 1PB7A 4OFLA 1M5EA 2OWSA 3TEPA 1B46A 2RC9A 4G2ZA 2I4BA 1IEJA 3I5OA 3K2DA 4Z0IA 3OENA 3VVEA 1SYHA 4YKIA 3S9MC 5ICTA 1ZTYA 1URDA 4KHZE 3CSBA 2UVGA 3IO4A 4MF3A 4WEDA 3DM0A 3E3KA 2I0CA 3OEMA 4GIZA 3UIFA 3N5LA 3UN6A 4YICA 1FTOA 4ZEDA 4NWCA 1O64A 2UXAA 2H99A 3S9EA 3T66A 3RQTA 2PYYA 5CC2A 3T22A 5H8NB 5CBSA 2OZZA 3DP6A 4U23A 1VR5A 3PGFA 3K02A 3RUMA 2HQ0A 1USYH 2O1MA 3TQWA 4M1VA 1JW5A 3RNNA 3U92A 3EN3A 3CRBA 4YB5A 1MPDA 4R72A 1OIBA 4MFIA 4WKMA 1SW5A 5I2NB 3UP9A 1N7XA 4U4SA 4C1TA 1PEBA 4G68C 3V5AA 1UTHA 3UK4A 1DTZA 3IOVA 1B7UA 1QKBA 1UQWA 1II5A 3TKDA 1YTVA 3U8QA 1BIYA 3U1OA 5LOMA 1PDAA 3IB1A 5TPAB 3TELA 3TDJA 1MY3A 5ICQA 1LFHA 3PUXE 3FUZA 4BDNA 1AH5A 5H8FA 4KD5A 4DXUA 2GRVA 5HPQA 1A99A 5I58B 3CI8A 4YB7A 1CB6A 4OMBA 1QULA 2IA4A 2PT2A 1YCJA 4X48A 1OVTA 2XD3A 4IO5A 3FXUA 3O6IA 3SEWA 4TLLB 3K6XA 4RK9A 3K6UA 5I56A 3PV0E 2Y7WA 1IITA 3G7WA 4LZ8A 4PFUA 2Y7RA 5I84A 1LB9A 2AL5A 3EHTA 1LLSA 1P1UA 2I3WA 2REJA 1MPBA 2UVIA 3K1NA 4OEVA 3M3LA 1H76A 3OMBA 3PMWA 1B52A 1GTKA 4G4PA 4KYSA 4GD5A 2W7YA 3MP8A 3VE1B 4F22A 2YLNA 4IY6A 2DWAA 1ZBMA 4ZECA 2OJTA 4U1ZA 3O28A 5KCJA 3TCHA 3B7DA 5I2KA 4QSDA 4H8JA 2HAUA 3VLUA 2XXTA 1UTBB 5I57B 3HPIA 4I1DA 2F6GA 3H06B 3SDFA 1FQFA 3RLFE 5IKBA 1OQGA 3C32A 3LR1A 4ZEFA 2F97A 2O7IA 1EU8A 4KYDA 2AL4A 3MZ9A 5IAIA 3JZJA 4R2BA 3THIA 1B32A 1MY4A 2WKYA 3GBBA 3RY3A 3VV5A 1ZU0A 5K2YA 2RF1A 2RINA 1R9QA 3MVZA 1OMPA 5DVFA 3N6TA 2RCBA 3FV2A 3B6WA 3OEKA 5AA2D 3O6HA 2V3QA 1POTA 1I69A 4IO6A 1QVSA 4QFLA 2D5WA 3CG3A 2G29A 3JYRA 1GVCA 3H6VA 1QUJA 4OENA 4ECFA 3CVGA 4K3FA 3V83A 4MLVA 2ZNTA 3TCFA 3CFZA 5FHMA 2I6EA 4OERA 3IOTA 1ZMGA 1DPEA 1B3HA 3KN7A 3RPWA 1B7ZA 1N84A 3GXAA 2VGQA 5HM4B 3IJXB 1MH3A 4G77A 4WXJA 3LUYA 4H8IA 2HZKA 3T96B 3G3HA 3FVGA 1FQEA 4EQBA 5AA2B 4I8CA 3K01A 3Q28A 1MH4A 4RPNA 3QIMA 3MZ1A 1R1NA 2QL3A 4PFWA 1LCFA 1QKAA 4F1VA 1H45A 4Q5TA 3SEYA 2DE3A 1Y9UA 3C33A 4O3AA 1TFAA 2QRYA 4FEDA 1RKMA 4FORA 3IAZA 2XXQA 2ONSA 3FASA 2Z8EA 4IO2A 5CBRA 3FIRA 1P1NA 5DVIA 4ONYA 3VLWA 5H8SA 3RGYA 1MQIA 1B05A 4H1XA 1N04A 2I49A 2AIXA 4F29A 2XXVA 4G68A 1MM6A 4KYEA 3FXQA 4R9GA 4O3BA 1PB9A 3I3VA 3PPRA 1TT1A 2YPNA 3E9XA 3LSLA 4R73A 3H3GA 3KSXA 4X1BA 4QFPA 3U93A 4JWYA 1IXCA 5K2XA 4JSDA 4F3SA 4R2FA 2I48A 1N0TA 1MXZA 4JBZA 4GL8A 4ISUA 3RT6B 1DSNA 5H8NA 4H0WA 2BJJX 1JW1A 4GQOA 5M2VA 2XHDA 2B3FA 3LC8A 2VD2A 1FTJA 2F34A 5HBCA 4MH5A 5L9SA 1O7TA 1FQCA 5F1QA 1MDQA 1ATGA 4F3BA 2V25A 3QYTA 4LONB 5CM6A 5TU0A 1OLCA 2XX8A 4U21A 3HN0A 2DOJA 1HSLA 3U94A 1BTJA 4R6HA 4R75A 5TP9A 4RXLA 1IZ1A 3PPOA 5AA4A 2O84X 3H6WA 1SDXA 4FATA 1MXUA 1LAHE 3OO9A 2Q8JA 1BLFA 5L8DA 4TLMB 4OETA 4Q30B 4YKPA 3F11A 4JB7A 4KCCA 4YU0A 3MVWA 2NOOA 5FHOA 4XIGQ 4PFTA 1P1OA 5DYHA 5H8HB 1CE2A 4XKRA 3TTLA 2ZYKA 5L9OA 3MP6A 2E1SA 5JTYB 3C34A 1WODA 5KDTB 1A8EA 4UACA 3PUWE 3TCGA 2XXWA 4KPTA 2QMXA 4RYAA 3MUQA 5A5XB 3PD8A 4GRKA 2ANJA 4ZE9A 4ELPA 3R6UA 1LBCA 4G68B 1N76A 3ILUB 1IQ7A 5H8QA 3O66A 2ZYOA 2Q89A 4NMYA 3MPLA 4LA9A 1NFTA 3AXFA 1MXXA 1BP5A 1FTKA 3QUFA 2F6PA 5CMBA 1MY0A 3U72A 4QSCA 4DXBA 1A40A 3KOTA 4OQOA 2O1LA 3MAMA 3TUSA 4QFOA 4PETA 1B0LA 2Z8FA 1UTBA 1BKAA 4OVJA 5I57A 2AYSA 3O2AA 2Y7KA 3LSFB 1QUKA 5ISUA 1XC1A 5AA1A 1VE4A 1Q1KA 5FHNA 4N13A 1SVXB 2P2AA 1YAEA 1A8FA 3BFTA 3OD7A 4H6DA 2VOZA 4HTGA 3MZBA 2XXRA 2F7CA 4RPOA 1MS7A 3ONMA 1QJMA 3TFLA 4OZ9A 1RYOA 2M8CA 3OOAA 5TP9B 4POWA 2OCUA 5DTBA 3FVKA 5AA4B 2FA7A 3T9UA 4ESWA 4DLDA 1Y3QA 5AE4A 3PUVE 2X7QA 4ZDMA 4BDRA 4MBPA 3A3CA 2PT1A 4AB6A 1B3LA 2XD2A 1A54A 1MQJA 3MW0A 3K1PA 2DE2A 1OVBA 1N3WA 3VDFA 3FV1A 1N7WA 2ALUA 2O51A 2I58A 3C35A 3R26A 1T0KA 1JEVA 2DXYA 1Q35A 1B5IA 3EHSA 3Q29A 4U4XA 2UYEA 1SD3A 4PFYA 5AA2A 3D4GA 2XX7A 4F2OA 2RCAA 4OTEA 1R6ZA 2THIA 3S4UA 2ZXTA 4I62A 1POY1 4Z7EA 4FJPA 1NL5A 4F3GA 1S50A 1QW0A 2VD3A 4RJZA 3MC2A 3TTMA 2DSFA 3S9LC 3L6HA 5H8QB 1B4HA 3HHGA 2F8DA 2E0SA 1HSJA 4QRZA 1FQAA 2F36A 3LSWA 4N6PA 3VXBA 2FNCA 2PMSA 1AMFA 3CG1A 3EF7A 4BDMA 4JWXA 1XVYA 3VVFA 2A5SA 3IK6B 3H4ZA 1VSOA 4WEPA 3WAEA 2B65A 1DPPA 2R9JA 3KG2A 5EHSA 4BDLA 1Z7ME 3KN3A 3VFJA 4QSEA 3TTKA 3M3FA 2GH9A 1SI0A 2QPQA 2UVJA 2X7PA 5B70A 3D4CA 4IO4A 1LAFE 1Y3NA 5FTHA 1I6AA 1D3KA 2NWJA 2PVUA 4ESXA 1RYXA 2CZLA 2ZNUA 1JEUA 3FZVA 2V3UA 4MLQA 3OO8A 2NVUB 4FE8A 3H03A 2PBWA 3FD3A 3R7XA 2QS2A 1B58A 1QUIA 5DVJA 3Q25A 3ZKLA 2Q2CA 3EPEA 1MQDA 4NWDA 4H5GA 3N26A 1TWYA 4AB5A 1Y4TA 3FXRA 3EQ1A 4QFNA 3SESA 2DE4A 4ELRA 1H44A 1EZOA 2O6AA 4GWOA 3T9XB 3PU5A 2XXHA 3Q26A 2LAOA 4H5FA 4HCWA 4ZEBA 2F5XA 1FTLA 2Z8DA 2H5YA 4GVOA 4FECA 3G3KA 4GXSB 3LBSA 3TAJA 2DS9A 4LVQA 5H8HA 4P0IA 4NF8A 1B3EA 3GLBA 2DP8A 5JTYA 1DOTA 2REGA 5KDTA 1M5FA 3T9HB 1TFDA 4O3CA 3O6GA 1H3DA 2Q88A 2HFBA 5A5XA 3IL1B 3FJMA 1SQYA 2R6GE 3SEXA 4FAJA 3DLNA 1MPCA 1US5A 5BWJA 1DMBA 3BBRA 4G8NA 5I59A 4GL0A 2ONKE 3PUYE 2ONRA 3FJGA 2Z22A 3IX1A 2V84A 4GLIA 1SW2A 1B4ZA 4IY5A 3C4MA 2G93A 3O97A 1NKXA 3K0VA 3K1MA 4TQUQ 1A55A 3KGCA 3E13X 5EYFA 2O69A 3S2VA 3MWBA 1LFIA 1I6QA 1SW1A 3LSXA 4M4GA 2F78A 4F1UA 1MDP1 1P1QA 3IB0A 4PQJA 4LQ2A 2DVCA 4OESA 4PP0A 5CMMA 2GHAA 4G8MA 4ND9A 3W15C 3RTWB 3FJ7A 2OK2A 2ZMBA 5DEXB 4BDOA 3FGSA 1R9LA 4ZZAA 3VVDA 4NF4A 5AA3A 1ANFA 5JK4A 4XTCQ 1JW4A 4EQ7A 2RC8A 1IUDA 3USDA 4OWDA 4ZEIA 1OQHA 3PD9A 1TXFA 4EUOA 3QXMA 3PPQA 3B6TA 1Y1MA 4JWOA 4LUBA 4NE4A 4GOTA 3DELB 3A3UA 4RNSA 4RY1A 1SBPA 1US4A 5DT6A 3C9HA 1LAXA 3IR1A 5ELVA 5KZTA 1ZLQA 3A09A 1J1NA
chains in the Genus database with same CATH superfamily
2R71A 2XWKA 4NF8B 1EYJA 4EXLA 4KR5A 1EH3A 1S7YA 1PB8A 1MY1A 1PC3A 3CIJA 4LATA 3G3GA 3ZKKA 3K6WA 4JVCA 4BLAA 1LBVA 4IO3A 4FIMA 1YPNA 2H9BA 2Y7PA 3CSGA 5ESYA 3IOUA 1NUWA 1LBWA 3IJOB 4IB2A 4XKPA 2Y7IA 4POXA 1B3GA 3W9WA 1SI1A 3N94A 4G61A 2ZYMA 5I59B 2VP1A 3TZAA 4IGRA 4N07A 1AOVA 4X9TA 2WBDA 3SETA 4ZZEA 4KI0E 4DDDA 1IMBA 1FTMA 3MPKA 3MYUA 1NI9A 3PMVA 1A7LA 4F19A 1UIUA 1D4NA 2KLFA 3RN8A 4GWXA 2Z23A 3ILTB 1P99A 4XKNA 4PE3A 1EYIA 4GFRA 4PBHA 4ELQA 4LP2B 5I5PA 2GFEA 4JSOA 5CRYA 3T9VA 3MP1A 4P0GA 1NH7A 2F3BA 1IXHA 3FBPA 4NHBA 4F39A 4F3PA 3EHUA 4PGNA 3TPAA 4H67A 4OHNA 1NNKA 4PF6A 4R6YA 4PE5B 2PFZA 1ZJLA 3HSTA 3CFXA 1EZPA 2DVZA 1LBYA 3B50A 1SW4A 4NF4B 1JNFA 3MQ9A 4OYVA 2FVZA 4LQ5A 3D1RA 4R74A 4YZZA 1JVYA 1SPIA 2P1SA 3MJNA 3GZGA 2B3BA 4YKJA 3TTRA 2HEUA 3W9VA 2D3IA 2A5TB 3KJ7A 1S9TA 1FPGA 4HS7A 1FPEA 4U1OA 1NNTA 2WX9A 2CMOA 4IO7A 1NNFA 2I3VA 1JVXA 3QMFA 3WAFA 4EDPA 2DWJA 3ECRA 3SEVA 3OSQA 4LZ7A 2UYFA 1ZKBA 2ZYNA 2V3TA 1ZIUA 1NNPA 3RTFB 1FTAA 1PBQA 3PMXA 1XVXA 3Q27A 4NF6B 3KZGA 3QK6A 1LBBA 1KWHA 1IXIA 1MXYA 2PX1A 4H65A 3OO7A 2WBBA 1LGBC 1XOCA 4PAFA 3MVXA 4U2RA 5J1DA 5IGAA 1M5BA 3K00A 4X04A 4OXVA 1I6BA 2D21A 4XEQA 3HHFA 2HAVA 4L17A 4C0RA 4F2QA 4JDFA 2V93A 1Y4CA 3V8XB 1KA1A 2H4IA 1MG1A 4JXIA 3PPPA 3IORA 5L9MA 3S9NC 3E4RA 5FTIA 5LTCA 1B6HA 4E0WA 4GX4A 4N8GA 4YMAA 4F1YA 3C31A 1NMUA 2V4CA 3SKPA 4F31B 1B51A 4EQ9A 4N81A 3P7IA 1KA0A 3TQLA 5JEIA 3HO7A 3N6UA 1NV0A 3HFUA 2UVHA 4DIGA 5ITOA 2DWHA 5J16A 1RDZA 5EHMA 1O63A 4YMBA 4F18A 3M3KA 1LAGE 1DTGA 5CMKA 1UIVA 4UA8A 2NXOA 1NV5A 2FYIA 4ZS9A 4O94A 2ZNSA 3CR9A 2P0SA 4R9FA 2MKZA 1B1HA 2QS3A 1Z7NE 3G3IA 1GGGA 2QVRA 3B6QA 3ODBA 4OFOA 3UA8A 1LFGA 5CI5A 3OO6A 4MIJA 1UTHB 1USYE 3ROJA 3KOSA 3CFLA 1B1XA 5BUUA 1FSAA 4THIA 4U22A 3RT8A 1IMCA 5LDZA 3QAXA 2OX3A 4TOZA 1MY2A 4IGTA 4NTLA 5ITPA 2HCAA 4OVTA 4OEUA 4GF8A 3PUZE 3HV1A 4RA1A 4DCXA 5DW8A 1DK4A 3KN8A 1FBPA 3VXCA 4KQPA 5DEXA 2XXPA 2XXYA 4NN3A 5IZ3B 4YB6A 3BFUA 1GR2A 4Q0CA 2YJPA 3OSRA 4GXAA 1MXVA 1EZ9A 1URGA 1IXGA 5H8FB 3TMGA 4QF9A 2XXIA 3G3FA 4LZ5A 4MEVA 2QS4A 3DP4A 3QSLA 2F35A 1LB8A 2Q2AA 3IB2A 2ZZWA 1MQGA 1LSTA 1MRPA 1B5JA 1D9VA 1B2HA 1MM7A 2O68A 2I0BA 1JETA 1WDNA 2OBGA 1B7HA 4MCOA 4PF8A 4YKKA 4KFQA 3MVYA 5I56B 2GQ1A 3K4UA 2XX9A 1XT8A 2HZLA 3G3JA 1PBPA 5I3SA 2XXUA 4ZE8A 2R8TA 2QSXA 1FBEA 3O29A 4JVIA 3EKIA 4YAHX 3ZSFA 1MXWA 4KCDA 4NF5A 3OXNA 1NH8A 2DQVA 3TODA 4C1UA 2DXRA 4E0XA 3UGWA 1B3FA 1AL3A 4EF1A 4EXKA 2PCRA 1N3XA 3KJTA 5EYGA 2HXWA 1AIVA 1LCTA 1B5HA 5EQAA 5KCJB 1H43A 5I2KB 4XXUA 3VLVA 3H6TA 4ELOA 3KEIA 1MQHA 4RK2A 2ESNA 4N17A 3KC0A 2FHYA 1VFEA 2RC7A 2OLBA 3RPLB 1B9JA 3KBRA 2H25A 2Y84A 2F7BA 4NGUA 4G8HA 2NUVA 3KSJA 4XKQA 2DWIA 4NEDA 1WVJA 2DYXA 4QHQA 2QS1A 3FVOA 2ABHA 3IOWA 1IIWA 4QFKA 4R6KA 5B7DA 3SERA 5CMCA 1FQBA 3OELA 4DCYA 3FATA 4NF0A 4EF2A 4BDQA 4X1DA 3K6VA 3QUJA 3TYHA 3PPNA 1P1WA 3MSTA 3KFMA 1B40A 1Y1ZA 1FJ9A 3MBPA 3M8UA 1ELJA 2KR0A 2XXXA 3I6VA 3FVNA 3V89B 1VFDA 3T93B 3ZS6A 2QMWA 3SEUA 2XXKA 3O9PA 5I2NA 1URSA 2RKMA 3DP8A 1SYIA 2H98A 1FPFA 2X26A 1B0HA 3GBAA 2QJEA 4PAIA 3C36A 4HW8A 2IEEA 4HCYA 1HSEA 1M5CA 1KZ8A 2A5TA 2I4CA 4DE8A 4FEBA 2GHBA 4GWUA 4P11A 1D9YA 1GV8A 1F9BA 1OLAA 4I9DA 4PAKA 1XI6A 2F7AA 4QXDA 3L6GA 3HCQA 5TPAA 4P9KA 2OWTA 4AQ4A 2O7UA 3H6UA 3BKIB 2OWZA 3IO6A 3UORA 1Y20A 1FCKA 1M5DA 1D9QA 1JQFA 5F7VA 1FW0A 4NF6A 1Y3PA 5I58A 3H7MA 4NF5B 1XHYA 4ZEKA 4Q8RA 4OFJA 1L5TA 3IFAA 2JJKA 1FQDA 1G0IA 4DZ1A 1XS5A 2VHAA 3JV9A 4DXCA 3TTNA 2Q9TA 1PB7A 4OFLA 1M5EA 2OWSA 3TEPA 1B46A 4DI4B 2RC9A 4G2ZA 2I4BA 4MNIA 1IEJA 3I5OA 3K2DA 4Z0IA 3OENA 3VVEA 1SYHA 4YKIA 3S9MC 5ICTA 1ZTYA 2ZZVA 1URDA 4KHZE 3CSBA 2UVGA 3IFCA 3IO4A 3PTYA 4MF3A 3E79A 4WEDA 3DM0A 3E3KA 2I0CA 1Q9DA 3OEMA 4O7IA 4GIZA 3UIFA 3N5LA 3UN6A 4YICA 2P3NA 1FTOA 4ZEDA 4NWCA 1O64A 2UXAA 5A5LA 2H99A 3S9EA 3T66A 3RQTA 2PYYA 1IMFA 5CC2A 3T22A 5H8NB 5CBSA 2OZZA 3DP6A 4U23A 1VR5A 3PGFA 3K02A 3RUMA 2HQ0A 1USYH 2O1MA 3TQWA 4M1VA 1JW5A 3RNNA 3U92A 3EN3A 3CRBA 4YB5A 1NV1A 4PCDA 1MPDA 4R72A 1OIBA 4MFIA 4WKMA 1SW5A 1NUXA 5I2NB 3UP9A 1N7XA 4U4SA 4C1TA 1PEBA 4G68C 3V5AA 1UTHA 3UK4A 4P1EA 1DTZA 3IOVA 1B7UA 1QKBA 4PGPA 1UQWA 1II5A 3TKDA 1YTVA 3U8QA 4P3LA 1BIYA 3U1OA 5IZ3A 5LOMA 1PDAA 3IB1A 5TPAB 5EQ7A 3TELA 3TDJA 1MY3A 5ICQA 1LFHA 3PUXE 3FUZA 4BDNA 1AH5A 2HPGA 5H8FA 4KD5A 4DXUA 2GRVA 5HPQA 1FRPA 1A99A 5I58B 3CI8A 4YB7A 2P3VA 1CB6A 4OMBA 2L5VA 1QULA 2IA4A 2PT2A 1YCJA 4X48A 1OVTA 2XD3A 4PBQA 1YZ0A 4IO5A 3FXUA 3O6IA 3SEWA 4TLLB 3K6XA 4RK9A 3K6UA 5I56A 3PV0E 2Y7WA 1IITA 3G7WA 4LZ8A 4PFUA 1FPJA 2Y7RA 5I84A 1LB9A 2WYKA 2AL5A 3EHTA 5IM2A 1LLSA 1P1UA 2I3WA 2REJA 2FBPA 1MPBA 2UVIA 3K1NA 4OEVA 3M3LA 3T0JA 1H76A 3OMBA 3PMWA 1B52A 1GTKA 4G4PA 1NV4A 4KYSA 4GD5A 2W7YA 3MP8A 3VE1B 4F22A 2YLNA 4IY6A 2DWAA 4OVRA 4P47A 1ZBMA 4ZECA 2OJTA 4U1ZA 4AS5A 3O28A 4GWSA 5KCJA 3TCHA 3B7DA 5I2KA 2PFYA 4QSDA 1FPIA 4H8JA 3A29A 1YYZA 2HAUA 3VLUA 2XXTA 1UTBB 5I57B 3HPIA 4I1DA 2F6GA 1FPLA 3H06B 3SDFA 1FQFA 3RPLA 3RLFE 5IKBA 1OQGA 3C32A 3LR1A 4ZEFA 2F97A 3FXBA 2O7IA 1EU8A 4KYDA 2AL4A 3MZ9A 4N91A 2Q74A 3JZJA 5IAIA 5IZZA 4R2BA 3THIA 1B32A 1MY4A 2WKYA 3GBBA 4MNCA 3RY3A 3VV5A 1ZU0A 5K2YA 2RF1A 2RINA 1R9QA 3MVZA 1OMPA 2ZZXA 5DVFA 3N6TA 2RCBA 3FV2A 3B6WA 3OEKA 5AA2D 3O6HA 2V3QA 3KBZA 1POTA 2CEXA 1I69A 4IO6A 1QVSA 4QFLA 2D5WA 3CG3A 2G29A 3JYRA 1GVCA 3H6VA 1QUJA 2FIXA 4OENA 4ECFA 1NV2A 3CVGA 4K3FA 3V83A 4MLVA 2ZNTA 3TCFA 3CFZA 5FHMA 2I6EA 4OERA 3IOTA 2VPNA 1DPEA 1ZMGA 1B3HA 2WYPA 4XFEA 3KN7A 4MX6A 3RPWA 5EYHA 1B7ZA 1N84A 3GXAA 2VGQA 5HM4B 3IJXB 1MH3A 4G77A 4WXJA 3LUYA 4H8IA 4NG7A 1LEVA 2HZKA 4MMPA 3T96B 2HXRA 3G3HA 3FVGA 1FQEA 4EQBA 5AA2B 4I8CA 3K01A 3Q28A 1MH4A 4RPNA 3QIMA 3MZ1A 1R1NA 2QL3A 1YXIA 4PFWA 1JP4A 1LCFA 2HHMA 1QKAA 1NV3A 4F1VA 1H45A 4Q5TA 3SEYA 2DE3A 1Y9UA 3C33A 2QVUA 4O3AA 1TFAA 4IR8A 3LV0A 4HE2A 3KC1A 2QRYA 4FEDA 1RKMA 1G0HA 4FORA 3IAZA 4PTKA 4JVDA 2XXQA 2ONSA 3FASA 2Z8EA 4IO2A 5CBRA 3FIRA 4MAGA 1P1NA 5DVIA 4ONYA 3VLWA 5H8SA 3RGYA 1MQIA 1B05A 4H1XA 1N04A 2I49A 2AIXA 4F29A 4N6KA 2XXVA 4G68A 1MM6A 4KYEA 4N15A 3FXQA 5ET8A 4R9GA 4O3BA 1PB9A 3I3VA 3PPRA 1TT1A 2YPNA 3E9XA 3LSLA 4R73A 3H3GA 3KSXA 4X1BA 4GWWA 4QFPA 3U93A 4JWYA 1IXCA 4XF5A 5K2XA 4JSDA 4F3SA 4R2FA 2I48A 1N0TA 3CHGA 1MXZA 4JBZA 4GL8A 4ISUA 3RT6B 1DSNA 4NX1A 5H8NA 4H0WA 2BJJX 1JW1A 4GQOA 5M2VA 3LUZA 2XHDA 2B3FA 3LC8A 2VD2A 1FTJA 2F34A 5HBCA 4MH5A 5L9SA 4HE1A 1O7TA 1FQCA 5F1QA 1MDQA 1ATGA 4F3BA 2V25A 3QYTA 4LONB 5CM6A 1K9ZA 5TU0A 1OLCA 2XX8A 4U21A 3HN0A 2DOJA 1HSLA 1FBGA 3U94A 1BTJA 4R6HA 4R75A 5TP9A 4RXLA 1IZ1A 3PPOA 4PC9A 5AA4A 2O84X 3H6WA 2KQZA 1SDXA 4FATA 5EQ8A 1MXUA 1LAHE 3OO9A 2Q8JA 5I7IA 4OVPA 1BLFA 5L8DA 4TLMB 2XA5A 4OETA 1FPBA 4Q30B 4YKPA 4GX3A 1RDXA 3F11A 4JB7A 4KCCA 4YU0A 3MVWA 2NOOA 5FHOA 4XIGQ 4PFTA 1P1OA 5DYHA 5H8HB 1CE2A 1EYKA 4XKRA 2XWIA 3TTLA 2ZYKA 5L9OA 3MP6A 4PFIA 2E1SA 5JTYB 3C34A 1WODA 4PFRA 5KDTB 1A8EA 4UACA 3PUWE 3TCGA 2XXWA 4KPTA 2QMXA 4RYAA 3MUQA 5A5XB 3PD8A 4GRKA 2ANJA 1LBZA 4ZE9A 2QVVA 4ELPA 3R6UA 1LBCA 4G68B 1N76A 3NOHA 5T3JA 3ILUB 1IQ7A 5H8QA 3O66A 2ZYOA 2Q89A 4NMYA 3MPLA 4LA9A 1NFTA 4GWZA 3AXFA 1FBCA 1MXXA 1BP5A 1FTKA 3QUFA 2F6PA 1NV7A 1FBHA 5CMBA 2DDKA 1MY0A 3U72A 5FBPA 4QSCA 4DXBA 1A40A 3KOTA 4OQOA 2O1LA 2Y5LA 3MAMA 3TUSA 4QFOA 4PETA 3U65A 1B0LA 2Z8FA 4I40A 1UTBA 4I3YA 1BKAA 4OVJA 5I57A 2AYSA 3O2AA 2Y7KA 3LSFB 1QUKA 3E78A 5ISUA 1XC1A 5AA1A 1VE4A 1Q1KA 4N8YA 1QGXA 4N13A 5FHNA 1SVXB 2P2AA 1A8FA 1YAEA 3BFTA 3OD7A 4H6DA 2VOZA 2BJIA 4HTGA 3MZBA 2XXRA 2F7CA 4RPOA 1MS7A 3ONMA 1QJMA 3TFLA 4OZ9A 1IMEA 1RYOA 2M8CA 3OOAA 1NV6A 5TP9B 4POWA 2OCUA 5DTBA 3FVKA 4GBVA 5AA4B 2FA7A 4P1LA 3T9UA 4ESWA 4DLDA 1K9YA 4MHFA 1Y3QA 5AE4A 3PUVE 2X7QA 4ZDMA 4BDRA 4MBPA 3SZPA 3A3CA 2PT1A 4AB6A 1B3LA 2XD2A 1A54A 1MQJA 3MW0A 3K1PA 2DE2A 1OVBA 4PDDA 1N3WA 3VDFA 2FIEA 3FV1A 1RDYA 1N7WA 2F3DA 4MJOA 2ALUA 1FPDA 2O51A 2I58A 3C35A 3R26A 1T0KA 1JEVA 2DXYA 1Q35A 1B5IA 3EHSA 3Q29A 4U4XA 2UYEA 1SD3A 1NUYA 4PFYA 5AA2A 3D4GA 4KXPA 2XX7A 4F2OA 2RCAA 4OTEA 1R6ZA 2THIA 3S4UA 4HE0A 2ZXTA 4I62A 1POY1 4Z7EA 4FJPA 4OA4A 1NL5A 4F3GA 3ISPA 1S50A 1QW0A 2VD3A 4RJZA 3MC2A 3TTMA 2DSFA 3S9LC 3L6HA 5H8QB 1B4HA 3HHGA 4I3EA 2F8DA 2E0SA 1HSJA 4LN5A 4QRZA 1FQAA 2F36A 2WEFA 3LSWA 4N6PA 5ET5A 3VXBA 2FNCA 2PMSA 1IMDA 1AMFA 3CG1A 3EF7A 4BDMA 4JWXA 1XVYA 3VVFA 2A5SA 3IK6B 3H4ZA 3BIHA 1VSOA 3T1BA 4WEPA 3WAEA 2B65A 1DPPA 2R9JA 3KG2A 3BIGA 5EHSA 5ET6A 1VDWA 4BDLA 5IZ1A 1Z7ME 3KN3A 2CZHA 3VFJA 4QSEA 3TTKA 3M3FA 1AWBA 2GH9A 1SI0A 4PFBA 2QPQA 2UVJA 2X7PA 5B70A 3D4CA 4IO4A 1LAFE 5EQ9A 2B4LA 1Y3NA 5FTHA 2XWOA 1I6AA 1D3KA 2NWJA 1FBDA 2CEYA 2PVUA 4ESXA 1RYXA 2CZLA 1NUZA 5F24A 2ZNUA 1JEUA 3FZVA 2V3UA 4MLQA 3OO8A 2NVUB 4FE8A 3H03A 2PBWA 3FD3A 4OANA 4QBAA 3R7XA 2QS2A 1B58A 1QUIA 5DVJA 3Q25A 3ZKLA 2Q2CA 3EPEA 1MQDA 4NWDA 4H5GA 4N4UA 3N26A 1TWYA 4AB5A 1Y4TA 3FXRA 3EQ1A 4QFNA 3SESA 2DE4A 4OVQA 1H44A 4ELRA 3RYDA 1EZOA 2O6AA 4GWOA 4UABA 4MNPA 1INPA 3T9XB 3PU5A 4P56A 4PDHA 2XXHA 3Q26A 4O7MA 2LAOA 1CNQA 4H5FA 4HCWA 4ZEBA 2F5XA 1FTLA 2Z8DA 2H5YA 4GVOA 4FECA 4OVSA 3G3KA 4GXSB 3LBSA 4N6DA 3TAJA 2DS9A 4LVQA 5H8HA 4NAPA 4P0IA 4NF8A 1B3EA 1FPKA 3GLBA 2DP8A 5JTYA 1DOTA 2REGA 5KDTA 1M5FA 3T9HB 1TFDA 4O3CA 3O6GA 4O8MA 1H3DA 2Q88A 2HFBA 5A5XA 3IL1B 3FJMA 4H45A 1SQYA 2R6GE 3SEXA 4FAJA 3DLNA 1MPCA 1US5A 5BWJA 1DMBA 3BBRA 4AS4A 4G8NA 5I59A 4GL0A 2Q8MA 2ONKE 5ET7A 3PUYE 2ONRA 3FJGA 2VT5A 1IMAA 2Z22A 3IX1A 2V84A 4GLIA 1SW2A 1B4ZA 4IY5A 1FBFA 3C4MA 2G93A 4HXVA 1BK4A 2CZKA 3O97A 1NKXA 3K0VA 3K1MA 4TQUQ 1A55A 3KGCA 3GYYA 3B8BA 3E13X 5EYFA 2O69A 3S2VA 3MWBA 1LFIA 4FBPA 1I6QA 2XWVA 1SW1A 2B4MA 3LSXA 4M4GA 2F78A 4F1UA 1MDP1 1P1QA 3IB0A 4PQJA 4DI3D 4LQ2A 2DVCA 2VPOA 4OESA 4P8BA 4PP0A 5CMMA 2GHAA 4G8MA 4ND9A 3W15C 3RTWB 3FJ7A 4NQ8A 2OK2A 2ZMBA 5DEXB 4BDOA 3FGSA 2QFLA 1R9LA 4ZZAA 3VVDA 2CZIA 4NF4A 4GBWA 5AA3A 1ANFA 4X8RA 5JK4A 4XTCQ 1JW4A 4EQ7A 2RC8A 1IUDA 3USDA 4OWDA 4ZEIA 1OQHA 3PD9A 4H46A 1TXFA 4EUOA 3QXMA 3PPQA 3B6TA 4GWYA 1Y1MA 4JWOA 4LUBA 4NE4A 1DCUA 4GOTA 1DBZA 3DELB 4GX6A 3A3UA 4RNSA 4RY1A 1SBPA 1US4A 5DT6A 3C9HA 1LAXA 3IR1A 1FJ6A 5ELVA 5KZTA 1LBXA 1ZLQA 2Y5KA 3A09A 1J1NA
chains in the Genus database with same CATH topology
2R71A 4NF8B 4EXLA 4KR5A 1EH3A 1S7YA 1PB8A 1MY1A 1PC3A 3CIJA 4LATA 3G3GA 3ZKKA 3K6WA 4BLAA 4IO3A 4FIMA 1YPNA 2H9BA 2Y7PA 3CSGA 3IOUA 3IJOB 4IB2A 4XKPA 2Y7IA 4POXA 1B3GA 3W9WA 1SI1A 3N94A 2ZYMA 5I59B 2VP1A 3TZAA 4IGRA 4N07A 1AOVA 4X9TA 3SETA 4ZZEA 4KI0E 4DDDA 1FTMA 3MPKA 3PMVA 1A7LA 4F19A 1UIUA 1D4NA 2KLFA 3RN8A 2Z23A 3ILTB 1P99A 4XKNA 4GFRA 4ELQA 4LP2B 2GFEA 4JSOA 5CRYA 3T9VA 3MP1A 4P0GA 1NH7A 1IXHA 4F39A 4F3PA 3EHUA 3TPAA 4H67A 4OHNA 1NNKA 4R6YA 4PE5B 1ZJLA 3HSTA 3CFXA 1EZPA 2DVZA 1SW4A 4NF4B 1JNFA 3MQ9A 4OYVA 4LQ5A 4R74A 4YZZA 1JVYA 2P1SA 3MJNA 3GZGA 2B3BA 4YKJA 3TTRA 2HEUA 3W9VA 2D3IA 2A5TB 3KJ7A 1S9TA 4HS7A 4U1OA 1NNTA 2CMOA 4IO7A 1NNFA 2I3VA 1JVXA 3WAFA 4EDPA 2DWJA 3ECRA 3SEVA 3OSQA 4LZ7A 2UYFA 1ZKBA 2ZYNA 2V3TA 1ZIUA 1NNPA 3RTFB 1PBQA 3PMXA 1XVXA 3Q27A 4NF6B 3KZGA 3QK6A 1LBBA 1KWHA 1IXIA 1MXYA 2PX1A 4H65A 3OO7A 1LGBC 1XOCA 3MVXA 4U2RA 5J1DA 1M5BA 3K00A 4OXVA 1I6BA 2D21A 3HHFA 2HAVA 4L17A 4C0RA 4F2QA 4JDFA 2V93A 1Y4CA 3V8XB 2H4IA 1MG1A 4JXIA 3PPPA 3IORA 5L9MA 3S9NC 3E4RA 5FTIA 1B6HA 4E0WA 4YMAA 4F1YA 3C31A 1NMUA 3SKPA 4F31B 1B51A 4EQ9A 3P7IA 3TQLA 5JEIA 3HO7A 3N6UA 2UVHA 4DIGA 5ITOA 2DWHA 5EHMA 1O63A 4YMBA 4F18A 3M3KA 1LAGE 1DTGA 5CMKA 1UIVA 4UA8A 2NXOA 2FYIA 4ZS9A 2ZNSA 3CR9A 2P0SA 4R9FA 1B1HA 2QS3A 1Z7NE 3G3IA 1GGGA 3B6QA 3ODBA 4OFOA 3UA8A 1LFGA 5CI5A 3OO6A 1UTHB 1USYE 3KOSA 3CFLA 1B1XA 5BUUA 4THIA 4U22A 3RT8A 3QAXA 4TOZA 1MY2A 4IGTA 4NTLA 5ITPA 2HCAA 4OEUA 4GF8A 3PUZE 3HV1A 4RA1A 4DCXA 3KN8A 3VXCA 4KQPA 5DEXA 2XXPA 2XXYA 4YB6A 3BFUA 1GR2A 2YJPA 3OSRA 4Q0CA 4GXAA 1MXVA 1EZ9A 1URGA 1IXGA 5H8FB 3TMGA 4QF9A 2XXIA 3G3FA 4LZ5A 2QS4A 3DP4A 3QSLA 2F35A 1LB8A 2Q2AA 3IB2A 1MQGA 1LSTA 1MRPA 1B5JA 1D9VA 1B2HA 1MM7A 2O68A 2I0BA 1JETA 1WDNA 2OBGA 1B7HA 4YKKA 4KFQA 3MVYA 5I56B 3K4UA 2XX9A 1XT8A 2HZLA 3G3JA 1PBPA 2XXUA 4ZE8A 2QSXA 3O29A 4YAHX 3ZSFA 1MXWA 4KCDA 4NF5A 3OXNA 1NH8A 2DQVA 3TODA 4C1UA 2DXRA 4E0XA 3UGWA 1B3FA 1AL3A 4EF1A 4EXKA 1N3XA 3KJTA 2HXWA 1AIVA 1LCTA 1B5HA 5KCJB 1H43A 5I2KB 4XXUA 3VLVA 3H6TA 4ELOA 3KEIA 1MQHA 4RK2A 2ESNA 1VFEA 2RC7A 2OLBA 1B9JA 3KBRA 2H25A 2Y84A 2F7BA 4G8HA 2NUVA 3KSJA 4XKQA 2DWIA 4NEDA 1WVJA 2DYXA 4QHQA 2QS1A 3FVOA 2ABHA 3IOWA 1IIWA 4QFKA 4R6KA 5B7DA 3SERA 5CMCA 1FQBA 3OELA 4DCYA 3FATA 4EF2A 4BDQA 4X1DA 3K6VA 3QUJA 3TYHA 3PPNA 1P1WA 3KFMA 1B40A 1Y1ZA 3MBPA 3M8UA 1ELJA 2XXXA 3I6VA 3FVNA 3V89B 1VFDA 3T93B 3ZS6A 2QMWA 3SEUA 3O9PA 5I2NA 1URSA 2RKMA 3DP8A 1SYIA 2H98A 2X26A 1B0HA 3GBAA 2QJEA 3C36A 4HW8A 2IEEA 4HCYA 1HSEA 1M5CA 2A5TA 2I4CA 4DE8A 4FEBA 2GHBA 4P11A 1D9YA 1GV8A 1F9BA 1OLAA 4I9DA 2F7AA 3L6GA 3HCQA 5TPAA 2OWTA 4AQ4A 2O7UA 3H6UA 3BKIB 3IO6A 3UORA 1Y20A 1FCKA 1M5DA 1JQFA 5F7VA 1FW0A 4NF6A 1Y3PA 5I58A 3H7MA 4NF5B 1XHYA 4ZEKA 4Q8RA 4OFJA 1L5TA 1FQDA 4DZ1A 1XS5A 2VHAA 3JV9A 4DXCA 3TTNA 2Q9TA 1PB7A 4OFLA 1M5EA 2OWSA 3TEPA 1B46A 2RC9A 4G2ZA 2I4BA 1IEJA 3I5OA 3K2DA 4Z0IA 3OENA 3VVEA 1SYHA 4YKIA 3S9MC 5ICTA 1ZTYA 1URDA 4KHZE 3CSBA 2UVGA 3IO4A 4MF3A 4WEDA 3DM0A 3E3KA 2I0CA 3OEMA 4GIZA 3UIFA 3N5LA 3UN6A 4YICA 1FTOA 4ZEDA 4NWCA 1O64A 2UXAA 2H99A 3S9EA 3T66A 3RQTA 2PYYA 5CC2A 3T22A 5H8NB 5CBSA 2OZZA 3DP6A 4U23A 1VR5A 3PGFA 3K02A 3RUMA 2HQ0A 1USYH 2O1MA 3TQWA 4M1VA 1JW5A 3RNNA 3U92A 3EN3A 3CRBA 4YB5A 1MPDA 4R72A 1OIBA 4MFIA 4WKMA 1SW5A 5I2NB 3UP9A 1N7XA 4U4SA 4C1TA 1PEBA 4G68C 3V5AA 1UTHA 3UK4A 1DTZA 3IOVA 1B7UA 1QKBA 1UQWA 1II5A 3TKDA 1YTVA 3U8QA 1BIYA 3U1OA 5LOMA 1PDAA 3IB1A 5TPAB 3TELA 3TDJA 1MY3A 5ICQA 1LFHA 3PUXE 3FUZA 4BDNA 1AH5A 5H8FA 4KD5A 4DXUA 2GRVA 5HPQA 1A99A 5I58B 3CI8A 4YB7A 1CB6A 4OMBA 1QULA 2IA4A 2PT2A 1YCJA 4X48A 1OVTA 2XD3A 4IO5A 3FXUA 3O6IA 3SEWA 4TLLB 3K6XA 4RK9A 3K6UA 5I56A 3PV0E 2Y7WA 1IITA 3G7WA 4LZ8A 4PFUA 2Y7RA 5I84A 1LB9A 2AL5A 3EHTA 1LLSA 1P1UA 2I3WA 2REJA 1MPBA 2UVIA 3K1NA 4OEVA 3M3LA 1H76A 3OMBA 3PMWA 1B52A 1GTKA 4G4PA 4KYSA 4GD5A 2W7YA 3MP8A 3VE1B 4F22A 2YLNA 4IY6A 2DWAA 1ZBMA 4ZECA 2OJTA 4U1ZA 3O28A 5KCJA 3TCHA 3B7DA 5I2KA 4QSDA 4H8JA 2HAUA 3VLUA 2XXTA 1UTBB 5I57B 3HPIA 4I1DA 2F6GA 3H06B 3SDFA 1FQFA 3RLFE 5IKBA 1OQGA 3C32A 3LR1A 4ZEFA 2F97A 2O7IA 1EU8A 4KYDA 2AL4A 3MZ9A 5IAIA 3JZJA 4R2BA 3THIA 1B32A 1MY4A 2WKYA 3GBBA 3RY3A 3VV5A 1ZU0A 5K2YA 2RF1A 2RINA 1R9QA 3MVZA 1OMPA 5DVFA 3N6TA 2RCBA 3FV2A 3B6WA 3OEKA 5AA2D 3O6HA 2V3QA 1POTA 1I69A 4IO6A 1QVSA 4QFLA 2D5WA 3CG3A 2G29A 3JYRA 1GVCA 3H6VA 1QUJA 4OENA 4ECFA 3CVGA 4K3FA 3V83A 4MLVA 2ZNTA 3TCFA 3CFZA 5FHMA 2I6EA 4OERA 3IOTA 1ZMGA 1DPEA 1B3HA 3KN7A 3RPWA 1B7ZA 1N84A 3GXAA 2VGQA 5HM4B 3IJXB 1MH3A 4G77A 4WXJA 3LUYA 4H8IA 2HZKA 3T96B 3G3HA 3FVGA 1FQEA 4EQBA 5AA2B 4I8CA 3K01A 3Q28A 1MH4A 4RPNA 3QIMA 3MZ1A 1R1NA 2QL3A 4PFWA 1LCFA 1QKAA 4F1VA 1H45A 4Q5TA 3SEYA 2DE3A 1Y9UA 3C33A 4O3AA 1TFAA 2QRYA 4FEDA 1RKMA 4FORA 3IAZA 2XXQA 2ONSA 3FASA 2Z8EA 4IO2A 5CBRA 3FIRA 1P1NA 5DVIA 4ONYA 3VLWA 5H8SA 3RGYA 1MQIA 1B05A 4H1XA 1N04A 2I49A 2AIXA 4F29A 2XXVA 4G68A 1MM6A 4KYEA 3FXQA 4R9GA 4O3BA 1PB9A 3I3VA 3PPRA 1TT1A 2YPNA 3E9XA 3LSLA 4R73A 3H3GA 3KSXA 4X1BA 4QFPA 3U93A 4JWYA 1IXCA 5K2XA 4JSDA 4F3SA 4R2FA 2I48A 1N0TA 1MXZA 4JBZA 4GL8A 4ISUA 3RT6B 1DSNA 5H8NA 4H0WA 2BJJX 1JW1A 4GQOA 5M2VA 2XHDA 2B3FA 3LC8A 2VD2A 1FTJA 2F34A 5HBCA 4MH5A 5L9SA 1O7TA 1FQCA 5F1QA 1MDQA 1ATGA 4F3BA 2V25A 3QYTA 4LONB 5CM6A 5TU0A 1OLCA 2XX8A 4U21A 3HN0A 2DOJA 1HSLA 3U94A 1BTJA 4R6HA 4R75A 5TP9A 4RXLA 1IZ1A 3PPOA 5AA4A 2O84X 3H6WA 1SDXA 4FATA 1MXUA 1LAHE 3OO9A 2Q8JA 1BLFA 5L8DA 4TLMB 4OETA 4Q30B 4YKPA 3F11A 4JB7A 4KCCA 4YU0A 3MVWA 2NOOA 5FHOA 4XIGQ 4PFTA 1P1OA 5DYHA 5H8HB 1CE2A 4XKRA 3TTLA 2ZYKA 5L9OA 3MP6A 2E1SA 5JTYB 3C34A 1WODA 5KDTB 1A8EA 4UACA 3PUWE 3TCGA 2XXWA 4KPTA 2QMXA 4RYAA 3MUQA 5A5XB 3PD8A 4GRKA 2ANJA 4ZE9A 4ELPA 3R6UA 1LBCA 4G68B 1N76A 3ILUB 1IQ7A 5H8QA 3O66A 2ZYOA 2Q89A 4NMYA 3MPLA 4LA9A 1NFTA 3AXFA 1MXXA 1BP5A 1FTKA 3QUFA 2F6PA 5CMBA 1MY0A 3U72A 4QSCA 4DXBA 1A40A 3KOTA 4OQOA 2O1LA 3MAMA 3TUSA 4QFOA 4PETA 1B0LA 2Z8FA 1UTBA 1BKAA 4OVJA 5I57A 2AYSA 3O2AA 2Y7KA 3LSFB 1QUKA 5ISUA 1XC1A 5AA1A 1VE4A 1Q1KA 5FHNA 4N13A 1SVXB 2P2AA 1YAEA 1A8FA 3BFTA 3OD7A 4H6DA 2VOZA 4HTGA 3MZBA 2XXRA 2F7CA 4RPOA 1MS7A 3ONMA 1QJMA 3TFLA 4OZ9A 1RYOA 2M8CA 3OOAA 5TP9B 4POWA 2OCUA 5DTBA 3FVKA 5AA4B 2FA7A 3T9UA 4ESWA 4DLDA 1Y3QA 5AE4A 3PUVE 2X7QA 4ZDMA 4BDRA 4MBPA 3A3CA 2PT1A 4AB6A 1B3LA 2XD2A 1A54A 1MQJA 3MW0A 3K1PA 2DE2A 1OVBA 1N3WA 3VDFA 3FV1A 1N7WA 2ALUA 2O51A 2I58A 3C35A 3R26A 1T0KA 1JEVA 2DXYA 1Q35A 1B5IA 3EHSA 3Q29A 4U4XA 2UYEA 1SD3A 4PFYA 5AA2A 3D4GA 2XX7A 4F2OA 2RCAA 4OTEA 1R6ZA 2THIA 3S4UA 2ZXTA 4I62A 1POY1 4Z7EA 4FJPA 1NL5A 4F3GA 1S50A 1QW0A 2VD3A 4RJZA 3MC2A 3TTMA 2DSFA 3S9LC 3L6HA 5H8QB 1B4HA 3HHGA 2F8DA 2E0SA 1HSJA 4QRZA 1FQAA 2F36A 3LSWA 4N6PA 3VXBA 2FNCA 2PMSA 1AMFA 3CG1A 3EF7A 4BDMA 4JWXA 1XVYA 3VVFA 2A5SA 3IK6B 3H4ZA 1VSOA 4WEPA 3WAEA 2B65A 1DPPA 2R9JA 3KG2A 5EHSA 4BDLA 1Z7ME 3KN3A 3VFJA 4QSEA 3TTKA 3M3FA 2GH9A 1SI0A 2QPQA 2UVJA 2X7PA 5B70A 3D4CA 4IO4A 1LAFE 1Y3NA 5FTHA 1I6AA 1D3KA 2NWJA 2PVUA 4ESXA 1RYXA 2CZLA 2ZNUA 1JEUA 3FZVA 2V3UA 4MLQA 3OO8A 2NVUB 4FE8A 3H03A 2PBWA 3FD3A 3R7XA 2QS2A 1B58A 1QUIA 5DVJA 3Q25A 3ZKLA 2Q2CA 3EPEA 1MQDA 4NWDA 4H5GA 3N26A 1TWYA 4AB5A 1Y4TA 3FXRA 3EQ1A 4QFNA 3SESA 2DE4A 4ELRA 1H44A 1EZOA 2O6AA 4GWOA 3T9XB 3PU5A 2XXHA 3Q26A 2LAOA 4H5FA 4HCWA 4ZEBA 2F5XA 1FTLA 2Z8DA 2H5YA 4GVOA 4FECA 3G3KA 4GXSB 3LBSA 3TAJA 2DS9A 4LVQA 5H8HA 4P0IA 4NF8A 1B3EA 3GLBA 2DP8A 5JTYA 1DOTA 2REGA 5KDTA 1M5FA 3T9HB 1TFDA 4O3CA 3O6GA 1H3DA 2Q88A 2HFBA 5A5XA 3IL1B 3FJMA 1SQYA 2R6GE 3SEXA 4FAJA 3DLNA 1MPCA 1US5A 5BWJA 1DMBA 3BBRA 4G8NA 5I59A 4GL0A 2ONKE 3PUYE 2ONRA 3FJGA 2Z22A 3IX1A 2V84A 4GLIA 1SW2A 1B4ZA 4IY5A 3C4MA 2G93A 3O97A 1NKXA 3K0VA 3K1MA 4TQUQ 1A55A 3KGCA 3E13X 5EYFA 2O69A 3S2VA 3MWBA 1LFIA 1I6QA 1SW1A 3LSXA 4M4GA 2F78A 4F1UA 1MDP1 1P1QA 3IB0A 4PQJA 4LQ2A 2DVCA 4OESA 4PP0A 5CMMA 2GHAA 4G8MA 4ND9A 3W15C 3RTWB 3FJ7A 2OK2A 2ZMBA 5DEXB 4BDOA 3FGSA 1R9LA 4ZZAA 3VVDA 4NF4A 5AA3A 1ANFA 5JK4A 4XTCQ 1JW4A 4EQ7A 2RC8A 1IUDA 3USDA 4OWDA 4ZEIA 1OQHA 3PD9A 1TXFA 4EUOA 3QXMA 3PPQA 3B6TA 1Y1MA 4JWOA 4LUBA 4NE4A 4GOTA 3DELB 3A3UA 4RNSA 4RY1A 1SBPA 1US4A 5DT6A 3C9HA 1LAXA 3IR1A 5ELVA 5KZTA 1ZLQA 3A09A 1J1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R71 A;  4NF8 B;  4EXL A;  4KR5 A;  1EH3 A;  1S7Y A;  1PB8 A;  1MY1 A;  1PC3 A;  3CIJ A;  4LAT A;  3G3G A;  3ZKK A;  3K6W A;  4BLA A;  4IO3 A;  4FIM A;  1YPN A;  2H9B A;  2Y7P A;  3CSG A;  3IOU A;  3IJO B;  4IB2 A;  4XKP A;  2Y7I A;  4POX A;  1B3G A;  3W9W A;  1SI1 A;  3N94 A;  2ZYM A;  5I59 B;  2VP1 A;  3TZA A;  4IGR A;  4N07 A;  1AOV A;  4X9T A;  3SET A;  4ZZE A;  4KI0 E;  4DDD A;  1FTM A;  3MPK A;  3PMV A;  1A7L A;  4F19 A;  1UIU A;  1D4N A;  2KLF A;  3RN8 A;  2Z23 A;  3ILT B;  1P99 A;  4XKN A;  4GFR A;  4ELQ A;  4LP2 B;  2GFE A;  4JSO A;  5CRY A;  3T9V A;  3MP1 A;  4P0G A;  1NH7 A;  1IXH A;  4F39 A;  4F3P A;  3EHU A;  3TPA A;  4H67 A;  4OHN A;  1NNK A;  4R6Y A;  4PE5 B;  1ZJL A;  3HST A;  3CFX A;  1EZP A;  2DVZ A;  1SW4 A;  4NF4 B;  1JNF A;  3MQ9 A;  4OYV A;  4LQ5 A;  4R74 A;  4YZZ A;  1JVY A;  2P1S A;  3MJN A;  3GZG A;  2B3B A;  4YKJ A;  3TTR A;  2HEU A;  3W9V A;  2D3I A;  2A5T B;  3KJ7 A;  1S9T A;  4HS7 A;  4U1O A;  1NNT A;  2CMO A;  4IO7 A;  1NNF A;  2I3V A;  1JVX A;  3WAF A;  4EDP A;  2DWJ A;  3ECR A;  3SEV A;  3OSQ A;  4LZ7 A;  2UYF A;  1ZKB A;  2ZYN A;  2V3T A;  1ZIU A;  1NNP A;  3RTF B;  1PBQ A;  3PMX A;  1XVX A;  3Q27 A;  4NF6 B;  3KZG A;  3QK6 A;  1LBB A;  1KWH A;  1IXI A;  1MXY A;  2PX1 A;  4H65 A;  3OO7 A;  1LGB C;  1XOC A;  3MVX A;  4U2R A;  5J1D A;  1M5B A;  3K00 A;  4OXV A;  1I6B A;  2D21 A;  3HHF A;  2HAV A;  4L17 A;  4C0R A;  4F2Q A;  4JDF A;  2V93 A;  1Y4C A;  3V8X B;  2H4I A;  1MG1 A;  4JXI A;  3PPP A;  3IOR A;  5L9M A;  3S9N C;  3E4R A;  5FTI A;  1B6H A;  4E0W A;  4YMA A;  4F1Y A;  3C31 A;  1NMU A;  3SKP A;  4F31 B;  1B51 A;  4EQ9 A;  3P7I A;  3TQL A;  5JEI A;  3HO7 A;  3N6U A;  2UVH A;  4DIG A;  5ITO A;  2DWH A;  5EHM A;  1O63 A;  4YMB A;  4F18 A;  3M3K A;  1LAG E;  1DTG A;  5CMK A;  1UIV A;  4UA8 A;  2NXO A;  2FYI A;  4ZS9 A;  2ZNS A;  3CR9 A;  2P0S A;  4R9F A;  1B1H A;  2QS3 A;  1Z7N E;  3G3I A;  1GGG A;  3B6Q A;  3ODB A;  4OFO A;  3UA8 A;  1LFG A;  5CI5 A;  3OO6 A;  1UTH B;  1USY E;  3KOS A;  3CFL A;  1B1X A;  5BUU A;  4THI A;  4U22 A;  3RT8 A;  3QAX A;  4TOZ A;  1MY2 A;  4IGT A;  4NTL A;  5ITP A;  2HCA A;  4OEU A;  4GF8 A;  3PUZ E;  3HV1 A;  4RA1 A;  4DCX A;  3KN8 A;  3VXC A;  4KQP A;  5DEX A;  2XXP A;  2XXY A;  4YB6 A;  3BFU A;  1GR2 A;  2YJP A;  3OSR A;  4Q0C A;  4GXA A;  1MXV A;  1EZ9 A;  1URG A;  1IXG A;  5H8F B;  3TMG A;  4QF9 A;  2XXI A;  3G3F A;  4LZ5 A;  2QS4 A;  3DP4 A;  3QSL A;  2F35 A;  1LB8 A;  2Q2A A;  3IB2 A;  1MQG A;  1LST A;  1MRP A;  1B5J A;  1D9V A;  1B2H A;  1MM7 A;  2O68 A;  2I0B A;  1JET A;  1WDN A;  2OBG A;  1B7H A;  4YKK A;  4KFQ A;  3MVY A;  5I56 B;  3K4U A;  2XX9 A;  1XT8 A;  2HZL A;  3G3J A;  1PBP A;  2XXU A;  4ZE8 A;  2QSX A;  3O29 A;  4YAH X;  3ZSF A;  1MXW A;  4KCD A;  4NF5 A;  3OXN A;  1NH8 A;  2DQV A;  3TOD A;  4C1U A;  2DXR A;  4E0X A;  3UGW A;  1B3F A;  1AL3 A;  4EF1 A;  4EXK A;  1N3X A;  3KJT A;  2HXW A;  1AIV A;  1LCT A;  1B5H A;  5KCJ B;  1H43 A;  5I2K B;  4XXU A;  3VLV A;  3H6T A;  4ELO A;  3KEI A;  1MQH A;  4RK2 A;  2ESN A;  1VFE A;  2RC7 A;  2OLB A;  1B9J A;  3KBR A;  2H25 A;  2Y84 A;  2F7B A;  4G8H A;  2NUV A;  3KSJ A;  4XKQ A;  2DWI A;  4NED A;  1WVJ A;  2DYX A;  4QHQ A;  2QS1 A;  3FVO A;  2ABH A;  3IOW A;  1IIW A;  4QFK A;  4R6K A;  5B7D A;  3SER A;  5CMC A;  1FQB A;  3OEL A;  4DCY A;  3FAT A;  4EF2 A;  4BDQ A;  4X1D A;  3K6V A;  3QUJ A;  3TYH A;  3PPN A;  1P1W A;  3KFM A;  1B40 A;  1Y1Z A;  3MBP A;  3M8U A;  1ELJ A;  2XXX A;  3I6V A;  3FVN A;  3V89 B;  1VFD A;  3T93 B;  3ZS6 A;  2QMW A;  3SEU A;  3O9P A;  5I2N A;  1URS A;  2RKM A;  3DP8 A;  1SYI A;  2H98 A;  2X26 A;  1B0H A;  3GBA A;  2QJE A;  3C36 A;  4HW8 A;  2IEE A;  4HCY A;  1HSE A;  1M5C A;  2A5T A;  2I4C A;  4DE8 A;  4FEB A;  2GHB A;  4P11 A;  1D9Y A;  1GV8 A;  1F9B A;  1OLA A;  4I9D A;  2F7A A;  3L6G A;  3HCQ A;  5TPA A;  2OWT A;  4AQ4 A;  2O7U A;  3H6U A;  3BKI B;  3IO6 A;  3UOR A;  1Y20 A;  1FCK A;  1M5D A;  1JQF A;  5F7V A;  1FW0 A;  4NF6 A;  1Y3P A;  5I58 A;  3H7M A;  4NF5 B;  1XHY A;  4ZEK A;  4Q8R A;  4OFJ A;  1L5T A;  1FQD A;  4DZ1 A;  1XS5 A;  2VHA A;  3JV9 A;  4DXC A;  3TTN A;  2Q9T A;  1PB7 A;  4OFL A;  1M5E A;  2OWS A;  3TEP A;  1B46 A;  2RC9 A;  4G2Z A;  2I4B A;  1IEJ A;  3I5O A;  3K2D A;  4Z0I A;  3OEN A;  3VVE A;  1SYH A;  4YKI A;  3S9M C;  5ICT A;  1ZTY A;  1URD A;  4KHZ E;  3CSB A;  2UVG A;  3IO4 A;  4MF3 A;  4WED A;  3DM0 A;  3E3K A;  2I0C A;  3OEM A;  4GIZ A;  3UIF A;  3N5L A;  3UN6 A;  4YIC A;  1FTO A;  4ZED A;  4NWC A;  1O64 A;  2UXA A;  2H99 A;  3S9E A;  3T66 A;  3RQT A;  2PYY A;  5CC2 A;  3T22 A;  5H8N B;  5CBS A;  2OZZ A;  3DP6 A;  4U23 A;  1VR5 A;  3PGF A;  3K02 A;  3RUM A;  2HQ0 A;  1USY H;  2O1M A;  3TQW A;  4M1V A;  1JW5 A;  3RNN A;  3U92 A;  3EN3 A;  3CRB A;  4YB5 A;  1MPD A;  4R72 A;  1OIB A;  4MFI A;  4WKM A;  1SW5 A;  5I2N B;  3UP9 A;  1N7X A;  4U4S A;  4C1T A;  1PEB A;  4G68 C;  3V5A A;  1UTH A;  3UK4 A;  1DTZ A;  3IOV A;  1B7U A;  1QKB A;  1UQW A;  1II5 A;  3TKD A;  1YTV A;  3U8Q A;  1BIY A;  3U1O A;  5LOM A;  1PDA A;  3IB1 A;  5TPA B;  3TEL A;  3TDJ A;  1MY3 A;  5ICQ A;  1LFH A;  3PUX E;  3FUZ A;  4BDN A;  1AH5 A;  5H8F A;  4KD5 A;  4DXU A;  2GRV A;  5HPQ A;  1A99 A;  5I58 B;  3CI8 A;  4YB7 A;  1CB6 A;  4OMB A;  1QUL A;  2IA4 A;  2PT2 A;  1YCJ A;  4X48 A;  1OVT A;  2XD3 A;  4IO5 A;  3FXU A;  3O6I A;  3SEW A;  4TLL B;  3K6X A;  4RK9 A;  3K6U A;  5I56 A;  3PV0 E;  2Y7W A;  1IIT A;  3G7W A;  4LZ8 A;  4PFU A;  2Y7R A;  5I84 A;  1LB9 A;  2AL5 A;  3EHT A;  1LLS A;  1P1U A;  2I3W A;  2REJ A;  1MPB A;  2UVI A;  3K1N A;  4OEV A;  3M3L A;  1H76 A;  3OMB A;  3PMW A;  1B52 A;  1GTK A;  4G4P A;  4KYS A;  4GD5 A;  2W7Y A;  3MP8 A;  3VE1 B;  4F22 A;  2YLN A;  4IY6 A;  2DWA A;  1ZBM A;  4ZEC A;  2OJT A;  4U1Z A;  3O28 A;  5KCJ A;  3TCH A;  3B7D A;  5I2K A;  4QSD A;  4H8J A;  2HAU A;  3VLU A;  2XXT A;  1UTB B;  5I57 B;  3HPI A;  4I1D A;  2F6G A;  3H06 B;  3SDF A;  1FQF A;  3RLF E;  5IKB A;  1OQG A;  3C32 A;  3LR1 A;  4ZEF A;  2F97 A;  2O7I A;  1EU8 A;  4KYD A;  2AL4 A;  3MZ9 A;  5IAI A;  3JZJ A;  4R2B A;  3THI A;  1B32 A;  1MY4 A;  2WKY A;  3GBB A;  3RY3 A;  3VV5 A;  1ZU0 A;  5K2Y A;  2RF1 A;  2RIN A;  1R9Q A;  3MVZ A;  1OMP A;  5DVF A;  3N6T A;  2RCB A;  3FV2 A;  3B6W A;  3OEK A;  5AA2 D;  3O6H A;  2V3Q A;  1POT A;  1I69 A;  4IO6 A;  1QVS A;  4QFL A;  2D5W A;  3CG3 A;  2G29 A;  3JYR A;  1GVC A;  3H6V A;  1QUJ A;  4OEN A;  4ECF A;  3CVG A;  4K3F A;  3V83 A;  4MLV A;  2ZNT A;  3TCF A;  3CFZ A;  5FHM A;  2I6E A;  4OER A;  3IOT A;  1ZMG A;  1DPE A;  1B3H A;  3KN7 A;  3RPW A;  1B7Z A;  1N84 A;  3GXA A;  2VGQ A;  5HM4 B;  3IJX B;  1MH3 A;  4G77 A;  4WXJ A;  3LUY A;  4H8I A;  2HZK A;  3T96 B;  3G3H A;  3FVG A;  1FQE A;  4EQB A;  5AA2 B;  4I8C A;  3K01 A;  3Q28 A;  1MH4 A;  4RPN A;  3QIM A;  3MZ1 A;  1R1N A;  2QL3 A;  4PFW A;  1LCF A;  1QKA A;  4F1V A;  1H45 A;  4Q5T A;  3SEY A;  2DE3 A;  1Y9U A;  3C33 A;  4O3A A;  1TFA A;  2QRY A;  4FED A;  1RKM A;  4FOR A;  3IAZ A;  2XXQ A;  2ONS A;  3FAS A;  2Z8E A;  4IO2 A;  5CBR A;  3FIR A;  1P1N A;  5DVI A;  4ONY A;  3VLW A;  5H8S A;  3RGY A;  1MQI A;  1B05 A;  4H1X A;  1N04 A;  2I49 A;  2AIX A;  4F29 A;  2XXV A;  4G68 A;  1MM6 A;  4KYE A;  3FXQ A;  4R9G A;  4O3B A;  1PB9 A;  3I3V A;  3PPR A;  1TT1 A;  2YPN A;  3E9X A;  3LSL A;  4R73 A;  3H3G A;  3KSX A;  4X1B A;  4QFP A;  3U93 A;  4JWY A;  1IXC A;  5K2X A;  4JSD A;  4F3S A;  4R2F A;  2I48 A;  1N0T A;  1MXZ A;  4JBZ A;  4GL8 A;  4ISU A;  3RT6 B;  1DSN A;  5H8N A;  4H0W A;  2BJJ X;  1JW1 A;  4GQO A;  5M2V A;  2XHD A;  2B3F A;  3LC8 A;  2VD2 A;  1FTJ A;  2F34 A;  5HBC A;  4MH5 A;  5L9S A;  1O7T A;  1FQC A;  5F1Q A;  1MDQ A;  1ATG A;  4F3B A;  2V25 A;  3QYT A;  4LON B;  5CM6 A;  5TU0 A;  1OLC A;  2XX8 A;  4U21 A;  3HN0 A;  2DOJ A;  1HSL A;  3U94 A;  1BTJ A;  4R6H A;  4R75 A;  5TP9 A;  4RXL A;  1IZ1 A;  3PPO A;  5AA4 A;  2O84 X;  3H6W A;  1SDX A;  4FAT A;  1MXU A;  1LAH E;  3OO9 A;  2Q8J A;  1BLF A;  5L8D A;  4TLM B;  4OET A;  4Q30 B;  4YKP A;  3F11 A;  4JB7 A;  4KCC A;  4YU0 A;  3MVW A;  2NOO A;  5FHO A;  4XIG Q;  4PFT A;  1P1O A;  5DYH A;  5H8H B;  1CE2 A;  4XKR A;  3TTL A;  2ZYK A;  5L9O A;  3MP6 A;  2E1S A;  5JTY B;  3C34 A;  1WOD A;  5KDT B;  1A8E A;  4UAC A;  3PUW E;  3TCG A;  2XXW A;  4KPT A;  2QMX A;  4RYA A;  3MUQ A;  5A5X B;  3PD8 A;  4GRK A;  2ANJ A;  4ZE9 A;  4ELP A;  3R6U A;  1LBC A;  4G68 B;  1N76 A;  3ILU B;  1IQ7 A;  5H8Q A;  3O66 A;  2ZYO A;  2Q89 A;  4NMY A;  3MPL A;  4LA9 A;  1NFT A;  3AXF A;  1MXX A;  1BP5 A;  1FTK A;  3QUF A;  2F6P A;  5CMB A;  1MY0 A;  3U72 A;  4QSC A;  4DXB A;  1A40 A;  3KOT A;  4OQO A;  2O1L A;  3MAM A;  3TUS A;  4QFO A;  4PET A;  1B0L A;  2Z8F A;  1UTB A;  1BKA A;  4OVJ A;  5I57 A;  2AYS A;  3O2A A;  2Y7K A;  3LSF B;  1QUK A;  5ISU A;  1XC1 A;  5AA1 A;  1VE4 A;  1Q1K A;  5FHN A;  4N13 A;  1SVX B;  2P2A A;  1YAE A;  1A8F A;  3BFT A;  3OD7 A;  4H6D A;  2VOZ A;  4HTG A;  3MZB A;  2XXR A;  2F7C A;  4RPO A;  1MS7 A;  3ONM A;  1QJM A;  3TFL A;  4OZ9 A;  1RYO A;  2M8C A;  3OOA A;  5TP9 B;  4POW A;  2OCU A;  5DTB A;  3FVK A;  5AA4 B;  2FA7 A;  3T9U A;  4ESW A;  4DLD A;  1Y3Q A;  5AE4 A;  3PUV E;  2X7Q A;  4ZDM A;  4BDR A;  4MBP A;  3A3C A;  2PT1 A;  4AB6 A;  1B3L A;  2XD2 A;  1A54 A;  1MQJ A;  3MW0 A;  3K1P A;  2DE2 A;  1OVB A;  1N3W A;  3VDF A;  3FV1 A;  1N7W A;  2ALU A;  2O51 A;  2I58 A;  3C35 A;  3R26 A;  1T0K A;  1JEV A;  2DXY A;  1Q35 A;  1B5I A;  3EHS A;  3Q29 A;  4U4X A;  2UYE A;  1SD3 A;  4PFY A;  5AA2 A;  3D4G A;  2XX7 A;  4F2O A;  2RCA A;  4OTE A;  1R6Z A;  2THI A;  3S4U A;  2ZXT A;  4I62 A;  1POY 1;  4Z7E A;  4FJP A;  1NL5 A;  4F3G A;  1S50 A;  1QW0 A;  2VD3 A;  4RJZ A;  3MC2 A;  3TTM A;  2DSF A;  3S9L C;  3L6H A;  5H8Q B;  1B4H A;  3HHG A;  2F8D A;  2E0S A;  1HSJ A;  4QRZ A;  1FQA A;  2F36 A;  3LSW A;  4N6P A;  3VXB A;  2FNC A;  2PMS A;  1AMF A;  3CG1 A;  3EF7 A;  4BDM A;  4JWX A;  1XVY A;  3VVF A;  2A5S A;  3IK6 B;  3H4Z A;  1VSO A;  4WEP A;  3WAE A;  2B65 A;  1DPP A;  2R9J A;  3KG2 A;  5EHS A;  4BDL A;  1Z7M E;  3KN3 A;  3VFJ A;  4QSE A;  3TTK A;  3M3F A;  2GH9 A;  1SI0 A;  2QPQ A;  2UVJ A;  2X7P A;  5B70 A;  3D4C A;  4IO4 A;  1LAF E;  1Y3N A;  5FTH A;  1I6A A;  1D3K A;  2NWJ A;  2PVU A;  4ESX A;  1RYX A;  2CZL A;  2ZNU A;  1JEU A;  3FZV A;  2V3U A;  4MLQ A;  3OO8 A;  2NVU B;  4FE8 A;  3H03 A;  2PBW A;  3FD3 A;  3R7X A;  2QS2 A;  1B58 A;  1QUI A;  5DVJ A;  3Q25 A;  3ZKL A;  2Q2C A;  3EPE A;  1MQD A;  4NWD A;  4H5G A;  3N26 A;  1TWY A;  4AB5 A;  1Y4T A;  3FXR A;  3EQ1 A;  4QFN A;  3SES A;  2DE4 A;  4ELR A;  1H44 A;  1EZO A;  2O6A A;  4GWO A;  3T9X B;  3PU5 A;  2XXH A;  3Q26 A;  2LAO A;  4H5F A;  4HCW A;  4ZEB A;  2F5X A;  1FTL A;  2Z8D A;  2H5Y A;  4GVO A;  4FEC A;  3G3K A;  4GXS B;  3LBS A;  3TAJ A;  2DS9 A;  4LVQ A;  5H8H A;  4P0I A;  4NF8 A;  1B3E A;  3GLB A;  2DP8 A;  5JTY A;  1DOT A;  2REG A;  5KDT A;  1M5F A;  3T9H B;  1TFD A;  4O3C A;  3O6G A;  1H3D A;  2Q88 A;  2HFB A;  5A5X A;  3IL1 B;  3FJM A;  1SQY A;  2R6G E;  3SEX A;  4FAJ A;  3DLN A;  1MPC A;  1US5 A;  5BWJ A;  1DMB A;  3BBR A;  4G8N A;  5I59 A;  4GL0 A;  2ONK E;  3PUY E;  2ONR A;  3FJG A;  2Z22 A;  3IX1 A;  2V84 A;  4GLI A;  1SW2 A;  1B4Z A;  4IY5 A;  3C4M A;  2G93 A;  3O97 A;  1NKX A;  3K0V A;  3K1M A;  4TQU Q;  1A55 A;  3KGC A;  3E13 X;  5EYF A;  2O69 A;  3S2V A;  3MWB A;  1LFI A;  1I6Q A;  1SW1 A;  3LSX A;  4M4G A;  2F78 A;  4F1U A;  1MDP 1;  1P1Q A;  3IB0 A;  4PQJ A;  4LQ2 A;  2DVC A;  4OES A;  4PP0 A;  5CMM A;  2GHA A;  4G8M A;  4ND9 A;  3W15 C;  3RTW B;  3FJ7 A;  2OK2 A;  2ZMB A;  5DEX B;  4BDO A;  3FGS A;  1R9L A;  4ZZA A;  3VVD A;  4NF4 A;  5AA3 A;  1ANF A;  5JK4 A;  4XTC Q;  1JW4 A;  4EQ7 A;  2RC8 A;  1IUD A;  3USD A;  4OWD A;  4ZEI A;  1OQH A;  3PD9 A;  1TXF A;  4EUO A;  3QXM A;  3PPQ A;  3B6T A;  1Y1M A;  4JWO A;  4LUB A;  4NE4 A;  4GOT A;  3DEL B;  3A3U A;  4RNS A;  4RY1 A;  1SBP A;  1US4 A;  5DT6 A;  3C9H A;  1LAX A;  3IR1 A;  5ELV A;  5KZT A;  1ZLQ A;  3A09 A;  1J1N A; 
#chains in the Genus database with same CATH topology
 2R71 A;  2XWK A;  4NF8 B;  1EYJ A;  4EXL A;  4KR5 A;  1EH3 A;  1S7Y A;  1PB8 A;  1MY1 A;  1PC3 A;  3CIJ A;  4LAT A;  3G3G A;  3ZKK A;  3K6W A;  4JVC A;  4BLA A;  1LBV A;  4IO3 A;  4FIM A;  1YPN A;  2H9B A;  2Y7P A;  3CSG A;  5ESY A;  3IOU A;  1NUW A;  1LBW A;  3IJO B;  4IB2 A;  4XKP A;  2Y7I A;  4POX A;  1B3G A;  3W9W A;  1SI1 A;  3N94 A;  4G61 A;  2ZYM A;  5I59 B;  2VP1 A;  3TZA A;  4IGR A;  4N07 A;  1AOV A;  4X9T A;  2WBD A;  3SET A;  4ZZE A;  4KI0 E;  4DDD A;  1IMB A;  1FTM A;  3MPK A;  3MYU A;  1NI9 A;  3PMV A;  1A7L A;  4F19 A;  1UIU A;  1D4N A;  2KLF A;  3RN8 A;  4GWX A;  2Z23 A;  3ILT B;  1P99 A;  4XKN A;  4PE3 A;  1EYI A;  4GFR A;  4PBH A;  4ELQ A;  4LP2 B;  5I5P A;  2GFE A;  4JSO A;  5CRY A;  3T9V A;  3MP1 A;  4P0G A;  1NH7 A;  2F3B A;  1IXH A;  3FBP A;  4NHB A;  4F39 A;  4F3P A;  3EHU A;  4PGN A;  3TPA A;  4H67 A;  4OHN A;  1NNK A;  4PF6 A;  4R6Y A;  4PE5 B;  2PFZ A;  1ZJL A;  3HST A;  3CFX A;  1EZP A;  2DVZ A;  1LBY A;  3B50 A;  1SW4 A;  4NF4 B;  1JNF A;  3MQ9 A;  4OYV A;  2FVZ A;  4LQ5 A;  3D1R A;  4R74 A;  4YZZ A;  1JVY A;  1SPI A;  2P1S A;  3MJN A;  3GZG A;  2B3B A;  4YKJ A;  3TTR A;  2HEU A;  3W9V A;  2D3I A;  2A5T B;  3KJ7 A;  1S9T A;  1FPG A;  4HS7 A;  1FPE A;  4U1O A;  1NNT A;  2WX9 A;  2CMO A;  4IO7 A;  1NNF A;  2I3V A;  1JVX A;  3QMF A;  3WAF A;  4EDP A;  2DWJ A;  3ECR A;  3SEV A;  3OSQ A;  4LZ7 A;  2UYF A;  1ZKB A;  2ZYN A;  2V3T A;  1ZIU A;  1NNP A;  3RTF B;  1FTA A;  1PBQ A;  3PMX A;  1XVX A;  3Q27 A;  4NF6 B;  3KZG A;  3QK6 A;  1LBB A;  1KWH A;  1IXI A;  1MXY A;  2PX1 A;  4H65 A;  3OO7 A;  2WBB A;  1LGB C;  1XOC A;  4PAF A;  3MVX A;  4U2R A;  5J1D A;  5IGA A;  1M5B A;  3K00 A;  4X04 A;  4OXV A;  1I6B A;  2D21 A;  4XEQ A;  3HHF A;  2HAV A;  4L17 A;  4C0R A;  4F2Q A;  4JDF A;  2V93 A;  1Y4C A;  3V8X B;  1KA1 A;  2H4I A;  1MG1 A;  4JXI A;  3PPP A;  3IOR A;  5L9M A;  3S9N C;  3E4R A;  5FTI A;  5LTC A;  1B6H A;  4E0W A;  4GX4 A;  4N8G A;  4YMA A;  4F1Y A;  3C31 A;  1NMU A;  2V4C A;  3SKP A;  4F31 B;  1B51 A;  4EQ9 A;  4N81 A;  3P7I A;  1KA0 A;  3TQL A;  5JEI A;  3HO7 A;  3N6U A;  1NV0 A;  3HFU A;  2UVH A;  4DIG A;  5ITO A;  2DWH A;  5J16 A;  1RDZ A;  5EHM A;  1O63 A;  4YMB A;  4F18 A;  3M3K A;  1LAG E;  1DTG A;  5CMK A;  1UIV A;  4UA8 A;  2NXO A;  1NV5 A;  2FYI A;  4ZS9 A;  4O94 A;  2ZNS A;  3CR9 A;  2P0S A;  4R9F A;  2MKZ A;  1B1H A;  2QS3 A;  1Z7N E;  3G3I A;  1GGG A;  2QVR A;  3B6Q A;  3ODB A;  4OFO A;  3UA8 A;  1LFG A;  5CI5 A;  3OO6 A;  4MIJ A;  1UTH B;  1USY E;  3ROJ A;  3KOS A;  3CFL A;  1B1X A;  5BUU A;  1FSA A;  4THI A;  4U22 A;  3RT8 A;  1IMC A;  5LDZ A;  3QAX A;  2OX3 A;  4TOZ A;  1MY2 A;  4IGT A;  4NTL A;  5ITP A;  2HCA A;  4OVT A;  4OEU A;  4GF8 A;  3PUZ E;  3HV1 A;  4RA1 A;  4DCX A;  5DW8 A;  1DK4 A;  3KN8 A;  1FBP A;  3VXC A;  4KQP A;  5DEX A;  2XXP A;  2XXY A;  4NN3 A;  5IZ3 B;  4YB6 A;  3BFU A;  1GR2 A;  4Q0C A;  2YJP A;  3OSR A;  4GXA A;  1MXV A;  1EZ9 A;  1URG A;  1IXG A;  5H8F B;  3TMG A;  4QF9 A;  2XXI A;  3G3F A;  4LZ5 A;  4MEV A;  2QS4 A;  3DP4 A;  3QSL A;  2F35 A;  1LB8 A;  2Q2A A;  3IB2 A;  2ZZW A;  1MQG A;  1LST A;  1MRP A;  1B5J A;  1D9V A;  1B2H A;  1MM7 A;  2O68 A;  2I0B A;  1JET A;  1WDN A;  2OBG A;  1B7H A;  4MCO A;  4PF8 A;  4YKK A;  4KFQ A;  3MVY A;  5I56 B;  2GQ1 A;  3K4U A;  2XX9 A;  1XT8 A;  2HZL A;  3G3J A;  1PBP A;  5I3S A;  2XXU A;  4ZE8 A;  2R8T A;  2QSX A;  1FBE A;  3O29 A;  4JVI A;  3EKI A;  4YAH X;  3ZSF A;  1MXW A;  4KCD A;  4NF5 A;  3OXN A;  1NH8 A;  2DQV A;  3TOD A;  4C1U A;  2DXR A;  4E0X A;  3UGW A;  1B3F A;  1AL3 A;  4EF1 A;  4EXK A;  2PCR A;  1N3X A;  3KJT A;  5EYG A;  2HXW A;  1AIV A;  1LCT A;  1B5H A;  5EQA A;  5KCJ B;  1H43 A;  5I2K B;  4XXU A;  3VLV A;  3H6T A;  4ELO A;  3KEI A;  1MQH A;  4RK2 A;  2ESN A;  4N17 A;  3KC0 A;  2FHY A;  1VFE A;  2RC7 A;  2OLB A;  3RPL B;  1B9J A;  3KBR A;  2H25 A;  2Y84 A;  2F7B A;  4NGU A;  4G8H A;  2NUV A;  3KSJ A;  4XKQ A;  2DWI A;  4NED A;  1WVJ A;  2DYX A;  4QHQ A;  2QS1 A;  3FVO A;  2ABH A;  3IOW A;  1IIW A;  4QFK A;  4R6K A;  5B7D A;  3SER A;  5CMC A;  1FQB A;  3OEL A;  4DCY A;  3FAT A;  4NF0 A;  4EF2 A;  4BDQ A;  4X1D A;  3K6V A;  3QUJ A;  3TYH A;  3PPN A;  1P1W A;  3MST A;  3KFM A;  1B40 A;  1Y1Z A;  1FJ9 A;  3MBP A;  3M8U A;  1ELJ A;  2KR0 A;  2XXX A;  3I6V A;  3FVN A;  3V89 B;  1VFD A;  3T93 B;  3ZS6 A;  2QMW A;  3SEU A;  2XXK A;  3O9P A;  5I2N A;  1URS A;  2RKM A;  3DP8 A;  1SYI A;  2H98 A;  1FPF A;  2X26 A;  1B0H A;  3GBA A;  2QJE A;  4PAI A;  3C36 A;  4HW8 A;  2IEE A;  4HCY A;  1HSE A;  1M5C A;  1KZ8 A;  2A5T A;  2I4C A;  4DE8 A;  4FEB A;  2GHB A;  4GWU A;  4P11 A;  1D9Y A;  1GV8 A;  1F9B A;  1OLA A;  4I9D A;  4PAK A;  1XI6 A;  2F7A A;  4QXD A;  3L6G A;  3HCQ A;  5TPA A;  4P9K A;  2OWT A;  4AQ4 A;  2O7U A;  3H6U A;  3BKI B;  2OWZ A;  3IO6 A;  3UOR A;  1Y20 A;  1FCK A;  1M5D A;  1D9Q A;  1JQF A;  5F7V A;  1FW0 A;  4NF6 A;  1Y3P A;  5I58 A;  3H7M A;  4NF5 B;  1XHY A;  4ZEK A;  4Q8R A;  4OFJ A;  1L5T A;  3IFA A;  2JJK A;  1FQD A;  1G0I A;  4DZ1 A;  1XS5 A;  2VHA A;  3JV9 A;  4DXC A;  3TTN A;  2Q9T A;  1PB7 A;  4OFL A;  1M5E A;  2OWS A;  3TEP A;  1B46 A;  4DI4 B;  2RC9 A;  4G2Z A;  2I4B A;  4MNI A;  1IEJ A;  3I5O A;  3K2D A;  4Z0I A;  3OEN A;  3VVE A;  1SYH A;  4YKI A;  3S9M C;  5ICT A;  1ZTY A;  2ZZV A;  1URD A;  4KHZ E;  3CSB A;  2UVG A;  3IFC A;  3IO4 A;  3PTY A;  4MF3 A;  3E79 A;  4WED A;  3DM0 A;  3E3K A;  2I0C A;  1Q9D A;  3OEM A;  4O7I A;  4GIZ A;  3UIF A;  3N5L A;  3UN6 A;  4YIC A;  2P3N A;  1FTO A;  4ZED A;  4NWC A;  1O64 A;  2UXA A;  5A5L A;  2H99 A;  3S9E A;  3T66 A;  3RQT A;  2PYY A;  1IMF A;  5CC2 A;  3T22 A;  5H8N B;  5CBS A;  2OZZ A;  3DP6 A;  4U23 A;  1VR5 A;  3PGF A;  3K02 A;  3RUM A;  2HQ0 A;  1USY H;  2O1M A;  3TQW A;  4M1V A;  1JW5 A;  3RNN A;  3U92 A;  3EN3 A;  3CRB A;  4YB5 A;  1NV1 A;  4PCD A;  1MPD A;  4R72 A;  1OIB A;  4MFI A;  4WKM A;  1SW5 A;  1NUX A;  5I2N B;  3UP9 A;  1N7X A;  4U4S A;  4C1T A;  1PEB A;  4G68 C;  3V5A A;  1UTH A;  3UK4 A;  4P1E A;  1DTZ A;  3IOV A;  1B7U A;  1QKB A;  4PGP A;  1UQW A;  1II5 A;  3TKD A;  1YTV A;  3U8Q A;  4P3L A;  1BIY A;  3U1O A;  5IZ3 A;  5LOM A;  1PDA A;  3IB1 A;  5TPA B;  5EQ7 A;  3TEL A;  3TDJ A;  1MY3 A;  5ICQ A;  1LFH A;  3PUX E;  3FUZ A;  4BDN A;  1AH5 A;  2HPG A;  5H8F A;  4KD5 A;  4DXU A;  2GRV A;  5HPQ A;  1FRP A;  1A99 A;  5I58 B;  3CI8 A;  4YB7 A;  2P3V A;  1CB6 A;  4OMB A;  2L5V A;  1QUL A;  2IA4 A;  2PT2 A;  1YCJ A;  4X48 A;  1OVT A;  2XD3 A;  4PBQ A;  1YZ0 A;  4IO5 A;  3FXU A;  3O6I A;  3SEW A;  4TLL B;  3K6X A;  4RK9 A;  3K6U A;  5I56 A;  3PV0 E;  2Y7W A;  1IIT A;  3G7W A;  4LZ8 A;  4PFU A;  1FPJ A;  2Y7R A;  5I84 A;  1LB9 A;  2WYK A;  2AL5 A;  3EHT A;  5IM2 A;  1LLS A;  1P1U A;  2I3W A;  2REJ A;  2FBP A;  1MPB A;  2UVI A;  3K1N A;  4OEV A;  3M3L A;  3T0J A;  1H76 A;  3OMB A;  3PMW A;  1B52 A;  1GTK A;  4G4P A;  1NV4 A;  4KYS A;  4GD5 A;  2W7Y A;  3MP8 A;  3VE1 B;  4F22 A;  2YLN A;  4IY6 A;  2DWA A;  4OVR A;  4P47 A;  1ZBM A;  4ZEC A;  2OJT A;  4U1Z A;  4AS5 A;  3O28 A;  4GWS A;  5KCJ A;  3TCH A;  3B7D A;  5I2K A;  2PFY A;  4QSD A;  1FPI A;  4H8J A;  3A29 A;  1YYZ A;  2HAU A;  3VLU A;  2XXT A;  1UTB B;  5I57 B;  3HPI A;  4I1D A;  2F6G A;  1FPL A;  3H06 B;  3SDF A;  1FQF A;  3RPL A;  3RLF E;  5IKB A;  1OQG A;  3C32 A;  3LR1 A;  4ZEF A;  2F97 A;  3FXB A;  2O7I A;  1EU8 A;  4KYD A;  2AL4 A;  3MZ9 A;  4N91 A;  2Q74 A;  3JZJ A;  5IAI A;  5IZZ A;  4R2B A;  3THI A;  1B32 A;  1MY4 A;  2WKY A;  3GBB A;  4MNC A;  3RY3 A;  3VV5 A;  1ZU0 A;  5K2Y A;  2RF1 A;  2RIN A;  1R9Q A;  3MVZ A;  1OMP A;  2ZZX A;  5DVF A;  3N6T A;  2RCB A;  3FV2 A;  3B6W A;  3OEK A;  5AA2 D;  3O6H A;  2V3Q A;  3KBZ A;  1POT A;  2CEX A;  1I69 A;  4IO6 A;  1QVS A;  4QFL A;  2D5W A;  3CG3 A;  2G29 A;  3JYR A;  1GVC A;  3H6V A;  1QUJ A;  2FIX A;  4OEN A;  4ECF A;  1NV2 A;  3CVG A;  4K3F A;  3V83 A;  4MLV A;  2ZNT A;  3TCF A;  3CFZ A;  5FHM A;  2I6E A;  4OER A;  3IOT A;  2VPN A;  1DPE A;  1ZMG A;  1B3H A;  2WYP A;  4XFE A;  3KN7 A;  4MX6 A;  3RPW A;  5EYH A;  1B7Z A;  1N84 A;  3GXA A;  2VGQ A;  5HM4 B;  3IJX B;  1MH3 A;  4G77 A;  4WXJ A;  3LUY A;  4H8I A;  4NG7 A;  1LEV A;  2HZK A;  4MMP A;  3T96 B;  2HXR A;  3G3H A;  3FVG A;  1FQE A;  4EQB A;  5AA2 B;  4I8C A;  3K01 A;  3Q28 A;  1MH4 A;  4RPN A;  3QIM A;  3MZ1 A;  1R1N A;  2QL3 A;  1YXI A;  4PFW A;  1JP4 A;  1LCF A;  2HHM A;  1QKA A;  1NV3 A;  4F1V A;  1H45 A;  4Q5T A;  3SEY A;  2DE3 A;  1Y9U A;  3C33 A;  2QVU A;  4O3A A;  1TFA A;  4IR8 A;  3LV0 A;  4HE2 A;  3KC1 A;  2QRY A;  4FED A;  1RKM A;  1G0H A;  4FOR A;  3IAZ A;  4PTK A;  4JVD A;  2XXQ A;  2ONS A;  3FAS A;  2Z8E A;  4IO2 A;  5CBR A;  3FIR A;  4MAG A;  1P1N A;  5DVI A;  4ONY A;  3VLW A;  5H8S A;  3RGY A;  1MQI A;  1B05 A;  4H1X A;  1N04 A;  2I49 A;  2AIX A;  4F29 A;  4N6K A;  2XXV A;  4G68 A;  1MM6 A;  4KYE A;  4N15 A;  3FXQ A;  5ET8 A;  4R9G A;  4O3B A;  1PB9 A;  3I3V A;  3PPR A;  1TT1 A;  2YPN A;  3E9X A;  3LSL A;  4R73 A;  3H3G A;  3KSX A;  4X1B A;  4GWW A;  4QFP A;  3U93 A;  4JWY A;  1IXC A;  4XF5 A;  5K2X A;  4JSD A;  4F3S A;  4R2F A;  2I48 A;  1N0T A;  3CHG A;  1MXZ A;  4JBZ A;  4GL8 A;  4ISU A;  3RT6 B;  1DSN A;  4NX1 A;  5H8N A;  4H0W A;  2BJJ X;  1JW1 A;  4GQO A;  5M2V A;  3LUZ A;  2XHD A;  2B3F A;  3LC8 A;  2VD2 A;  1FTJ A;  2F34 A;  5HBC A;  4MH5 A;  5L9S A;  4HE1 A;  1O7T A;  1FQC A;  5F1Q A;  1MDQ A;  1ATG A;  4F3B A;  2V25 A;  3QYT A;  4LON B;  5CM6 A;  1K9Z A;  5TU0 A;  1OLC A;  2XX8 A;  4U21 A;  3HN0 A;  2DOJ A;  1HSL A;  1FBG A;  3U94 A;  1BTJ A;  4R6H A;  4R75 A;  5TP9 A;  4RXL A;  1IZ1 A;  3PPO A;  4PC9 A;  5AA4 A;  2O84 X;  3H6W A;  2KQZ A;  1SDX A;  4FAT A;  5EQ8 A;  1MXU A;  1LAH E;  3OO9 A;  2Q8J A;  5I7I A;  4OVP A;  1BLF A;  5L8D A;  4TLM B;  2XA5 A;  4OET A;  1FPB A;  4Q30 B;  4YKP A;  4GX3 A;  1RDX A;  3F11 A;  4JB7 A;  4KCC A;  4YU0 A;  3MVW A;  2NOO A;  5FHO A;  4XIG Q;  4PFT A;  1P1O A;  5DYH A;  5H8H B;  1CE2 A;  1EYK A;  4XKR A;  2XWI A;  3TTL A;  2ZYK A;  5L9O A;  3MP6 A;  4PFI A;  2E1S A;  5JTY B;  3C34 A;  1WOD A;  4PFR A;  5KDT B;  1A8E A;  4UAC A;  3PUW E;  3TCG A;  2XXW A;  4KPT A;  2QMX A;  4RYA A;  3MUQ A;  5A5X B;  3PD8 A;  4GRK A;  2ANJ A;  1LBZ A;  4ZE9 A;  2QVV A;  4ELP A;  3R6U A;  1LBC A;  4G68 B;  1N76 A;  3NOH A;  5T3J A;  3ILU B;  1IQ7 A;  5H8Q A;  3O66 A;  2ZYO A;  2Q89 A;  4NMY A;  3MPL A;  4LA9 A;  1NFT A;  4GWZ A;  3AXF A;  1FBC A;  1MXX A;  1BP5 A;  1FTK A;  3QUF A;  2F6P A;  1NV7 A;  1FBH A;  5CMB A;  2DDK A;  1MY0 A;  3U72 A;  5FBP A;  4QSC A;  4DXB A;  1A40 A;  3KOT A;  4OQO A;  2O1L A;  2Y5L A;  3MAM A;  3TUS A;  4QFO A;  4PET A;  3U65 A;  1B0L A;  2Z8F A;  4I40 A;  1UTB A;  4I3Y A;  1BKA A;  4OVJ A;  5I57 A;  2AYS A;  3O2A A;  2Y7K A;  3LSF B;  1QUK A;  3E78 A;  5ISU A;  1XC1 A;  5AA1 A;  1VE4 A;  1Q1K A;  4N8Y A;  1QGX A;  4N13 A;  5FHN A;  1SVX B;  2P2A A;  1A8F A;  1YAE A;  3BFT A;  3OD7 A;  4H6D A;  2VOZ A;  2BJI A;  4HTG A;  3MZB A;  2XXR A;  2F7C A;  4RPO A;  1MS7 A;  3ONM A;  1QJM A;  3TFL A;  4OZ9 A;  1IME A;  1RYO A;  2M8C A;  3OOA A;  1NV6 A;  5TP9 B;  4POW A;  2OCU A;  5DTB A;  3FVK A;  4GBV A;  5AA4 B;  2FA7 A;  4P1L A;  3T9U A;  4ESW A;  4DLD A;  1K9Y A;  4MHF A;  1Y3Q A;  5AE4 A;  3PUV E;  2X7Q A;  4ZDM A;  4BDR A;  4MBP A;  3SZP A;  3A3C A;  2PT1 A;  4AB6 A;  1B3L A;  2XD2 A;  1A54 A;  1MQJ A;  3MW0 A;  3K1P A;  2DE2 A;  1OVB A;  4PDD A;  1N3W A;  3VDF A;  2FIE A;  3FV1 A;  1RDY A;  1N7W A;  2F3D A;  4MJO A;  2ALU A;  1FPD A;  2O51 A;  2I58 A;  3C35 A;  3R26 A;  1T0K A;  1JEV A;  2DXY A;  1Q35 A;  1B5I A;  3EHS A;  3Q29 A;  4U4X A;  2UYE A;  1SD3 A;  1NUY A;  4PFY A;  5AA2 A;  3D4G A;  4KXP A;  2XX7 A;  4F2O A;  2RCA A;  4OTE A;  1R6Z A;  2THI A;  3S4U A;  4HE0 A;  2ZXT A;  4I62 A;  1POY 1;  4Z7E A;  4FJP A;  4OA4 A;  1NL5 A;  4F3G A;  3ISP A;  1S50 A;  1QW0 A;  2VD3 A;  4RJZ A;  3MC2 A;  3TTM A;  2DSF A;  3S9L C;  3L6H A;  5H8Q B;  1B4H A;  3HHG A;  4I3E A;  2F8D A;  2E0S A;  1HSJ A;  4LN5 A;  4QRZ A;  1FQA A;  2F36 A;  2WEF A;  3LSW A;  4N6P A;  5ET5 A;  3VXB A;  2FNC A;  2PMS A;  1IMD A;  1AMF A;  3CG1 A;  3EF7 A;  4BDM A;  4JWX A;  1XVY A;  3VVF A;  2A5S A;  3IK6 B;  3H4Z A;  3BIH A;  1VSO A;  3T1B A;  4WEP A;  3WAE A;  2B65 A;  1DPP A;  2R9J A;  3KG2 A;  3BIG A;  5EHS A;  5ET6 A;  1VDW A;  4BDL A;  5IZ1 A;  1Z7M E;  3KN3 A;  2CZH A;  3VFJ A;  4QSE A;  3TTK A;  3M3F A;  1AWB A;  2GH9 A;  1SI0 A;  4PFB A;  2QPQ A;  2UVJ A;  2X7P A;  5B70 A;  3D4C A;  4IO4 A;  1LAF E;  5EQ9 A;  2B4L A;  1Y3N A;  5FTH A;  2XWO A;  1I6A A;  1D3K A;  2NWJ A;  1FBD A;  2CEY A;  2PVU A;  4ESX A;  1RYX A;  2CZL A;  1NUZ A;  5F24 A;  2ZNU A;  1JEU A;  3FZV A;  2V3U A;  4MLQ A;  3OO8 A;  2NVU B;  4FE8 A;  3H03 A;  2PBW A;  3FD3 A;  4OAN A;  4QBA A;  3R7X A;  2QS2 A;  1B58 A;  1QUI A;  5DVJ A;  3Q25 A;  3ZKL A;  2Q2C A;  3EPE A;  1MQD A;  4NWD A;  4H5G A;  4N4U A;  3N26 A;  1TWY A;  4AB5 A;  1Y4T A;  3FXR A;  3EQ1 A;  4QFN A;  3SES A;  2DE4 A;  4OVQ A;  1H44 A;  4ELR A;  3RYD A;  1EZO A;  2O6A A;  4GWO A;  4UAB A;  4MNP A;  1INP A;  3T9X B;  3PU5 A;  4P56 A;  4PDH A;  2XXH A;  3Q26 A;  4O7M A;  2LAO A;  1CNQ A;  4H5F A;  4HCW A;  4ZEB A;  2F5X A;  1FTL A;  2Z8D A;  2H5Y A;  4GVO A;  4FEC A;  4OVS A;  3G3K A;  4GXS B;  3LBS A;  4N6D A;  3TAJ A;  2DS9 A;  4LVQ A;  5H8H A;  4NAP A;  4P0I A;  4NF8 A;  1B3E A;  1FPK A;  3GLB A;  2DP8 A;  5JTY A;  1DOT A;  2REG A;  5KDT A;  1M5F A;  3T9H B;  1TFD A;  4O3C A;  3O6G A;  4O8M A;  1H3D A;  2Q88 A;  2HFB A;  5A5X A;  3IL1 B;  3FJM A;  4H45 A;  1SQY A;  2R6G E;  3SEX A;  4FAJ A;  3DLN A;  1MPC A;  1US5 A;  5BWJ A;  1DMB A;  3BBR A;  4AS4 A;  4G8N A;  5I59 A;  4GL0 A;  2Q8M A;  2ONK E;  5ET7 A;  3PUY E;  2ONR A;  3FJG A;  2VT5 A;  1IMA A;  2Z22 A;  3IX1 A;  2V84 A;  4GLI A;  1SW2 A;  1B4Z A;  4IY5 A;  1FBF A;  3C4M A;  2G93 A;  4HXV A;  1BK4 A;  2CZK A;  3O97 A;  1NKX A;  3K0V A;  3K1M A;  4TQU Q;  1A55 A;  3KGC A;  3GYY A;  3B8B A;  3E13 X;  5EYF A;  2O69 A;  3S2V A;  3MWB A;  1LFI A;  4FBP A;  1I6Q A;  2XWV A;  1SW1 A;  2B4M A;  3LSX A;  4M4G A;  2F78 A;  4F1U A;  1MDP 1;  1P1Q A;  3IB0 A;  4PQJ A;  4DI3 D;  4LQ2 A;  2DVC A;  2VPO A;  4OES A;  4P8B A;  4PP0 A;  5CMM A;  2GHA A;  4G8M A;  4ND9 A;  3W15 C;  3RTW B;  3FJ7 A;  4NQ8 A;  2OK2 A;  2ZMB A;  5DEX B;  4BDO A;  3FGS A;  2QFL A;  1R9L A;  4ZZA A;  3VVD A;  2CZI A;  4NF4 A;  4GBW A;  5AA3 A;  1ANF A;  4X8R A;  5JK4 A;  4XTC Q;  1JW4 A;  4EQ7 A;  2RC8 A;  1IUD A;  3USD A;  4OWD A;  4ZEI A;  1OQH A;  3PD9 A;  4H46 A;  1TXF A;  4EUO A;  3QXM A;  3PPQ A;  3B6T A;  4GWY A;  1Y1M A;  4JWO A;  4LUB A;  4NE4 A;  1DCU A;  4GOT A;  1DBZ A;  3DEL B;  4GX6 A;  3A3U A;  4RNS A;  4RY1 A;  1SBP A;  1US4 A;  5DT6 A;  3C9H A;  1LAX A;  3IR1 A;  1FJ6 A;  5ELV A;  5KZT A;  1LBX A;  1ZLQ A;  2Y5K A;  3A09 A;  1J1N A; 
#chains in the Genus database with same CATH homology
 2R71 A;  4NF8 B;  4EXL A;  4KR5 A;  1EH3 A;  1S7Y A;  1PB8 A;  1MY1 A;  1PC3 A;  3CIJ A;  4LAT A;  3G3G A;  3ZKK A;  3K6W A;  4BLA A;  4IO3 A;  4FIM A;  1YPN A;  2H9B A;  2Y7P A;  3CSG A;  3IOU A;  3IJO B;  4IB2 A;  4XKP A;  2Y7I A;  4POX A;  1B3G A;  3W9W A;  1SI1 A;  3N94 A;  2ZYM A;  5I59 B;  2VP1 A;  3TZA A;  4IGR A;  4N07 A;  1AOV A;  4X9T A;  3SET A;  4ZZE A;  4KI0 E;  4DDD A;  1FTM A;  3MPK A;  3PMV A;  1A7L A;  4F19 A;  1UIU A;  1D4N A;  2KLF A;  3RN8 A;  2Z23 A;  3ILT B;  1P99 A;  4XKN A;  4GFR A;  4ELQ A;  4LP2 B;  2GFE A;  4JSO A;  5CRY A;  3T9V A;  3MP1 A;  4P0G A;  1NH7 A;  1IXH A;  4F39 A;  4F3P A;  3EHU A;  3TPA A;  4H67 A;  4OHN A;  1NNK A;  4R6Y A;  4PE5 B;  1ZJL A;  3HST A;  3CFX A;  1EZP A;  2DVZ A;  1SW4 A;  4NF4 B;  1JNF A;  3MQ9 A;  4OYV A;  4LQ5 A;  4R74 A;  4YZZ A;  1JVY A;  2P1S A;  3MJN A;  3GZG A;  2B3B A;  4YKJ A;  3TTR A;  2HEU A;  3W9V A;  2D3I A;  2A5T B;  3KJ7 A;  1S9T A;  4HS7 A;  4U1O A;  1NNT A;  2CMO A;  4IO7 A;  1NNF A;  2I3V A;  1JVX A;  3WAF A;  4EDP A;  2DWJ A;  3ECR A;  3SEV A;  3OSQ A;  4LZ7 A;  2UYF A;  1ZKB A;  2ZYN A;  2V3T A;  1ZIU A;  1NNP A;  3RTF B;  1PBQ A;  3PMX A;  1XVX A;  3Q27 A;  4NF6 B;  3KZG A;  3QK6 A;  1LBB A;  1KWH A;  1IXI A;  1MXY A;  2PX1 A;  4H65 A;  3OO7 A;  1LGB C;  1XOC A;  3MVX A;  4U2R A;  5J1D A;  1M5B A;  3K00 A;  4OXV A;  1I6B A;  2D21 A;  3HHF A;  2HAV A;  4L17 A;  4C0R A;  4F2Q A;  4JDF A;  2V93 A;  1Y4C A;  3V8X B;  2H4I A;  1MG1 A;  4JXI A;  3PPP A;  3IOR A;  5L9M A;  3S9N C;  3E4R A;  5FTI A;  1B6H A;  4E0W A;  4YMA A;  4F1Y A;  3C31 A;  1NMU A;  3SKP A;  4F31 B;  1B51 A;  4EQ9 A;  3P7I A;  3TQL A;  5JEI A;  3HO7 A;  3N6U A;  2UVH A;  4DIG A;  5ITO A;  2DWH A;  5EHM A;  1O63 A;  4YMB A;  4F18 A;  3M3K A;  1LAG E;  1DTG A;  5CMK A;  1UIV A;  4UA8 A;  2NXO A;  2FYI A;  4ZS9 A;  2ZNS A;  3CR9 A;  2P0S A;  4R9F A;  1B1H A;  2QS3 A;  1Z7N E;  3G3I A;  1GGG A;  3B6Q A;  3ODB A;  4OFO A;  3UA8 A;  1LFG A;  5CI5 A;  3OO6 A;  1UTH B;  1USY E;  3KOS A;  3CFL A;  1B1X A;  5BUU A;  4THI A;  4U22 A;  3RT8 A;  3QAX A;  4TOZ A;  1MY2 A;  4IGT A;  4NTL A;  5ITP A;  2HCA A;  4OEU A;  4GF8 A;  3PUZ E;  3HV1 A;  4RA1 A;  4DCX A;  3KN8 A;  3VXC A;  4KQP A;  5DEX A;  2XXP A;  2XXY A;  4YB6 A;  3BFU A;  1GR2 A;  2YJP A;  3OSR A;  4Q0C A;  4GXA A;  1MXV A;  1EZ9 A;  1URG A;  1IXG A;  5H8F B;  3TMG A;  4QF9 A;  2XXI A;  3G3F A;  4LZ5 A;  2QS4 A;  3DP4 A;  3QSL A;  2F35 A;  1LB8 A;  2Q2A A;  3IB2 A;  1MQG A;  1LST A;  1MRP A;  1B5J A;  1D9V A;  1B2H A;  1MM7 A;  2O68 A;  2I0B A;  1JET A;  1WDN A;  2OBG A;  1B7H A;  4YKK A;  4KFQ A;  3MVY A;  5I56 B;  3K4U A;  2XX9 A;  1XT8 A;  2HZL A;  3G3J A;  1PBP A;  2XXU A;  4ZE8 A;  2QSX A;  3O29 A;  4YAH X;  3ZSF A;  1MXW A;  4KCD A;  4NF5 A;  3OXN A;  1NH8 A;  2DQV A;  3TOD A;  4C1U A;  2DXR A;  4E0X A;  3UGW A;  1B3F A;  1AL3 A;  4EF1 A;  4EXK A;  1N3X A;  3KJT A;  2HXW A;  1AIV A;  1LCT A;  1B5H A;  5KCJ B;  1H43 A;  5I2K B;  4XXU A;  3VLV A;  3H6T A;  4ELO A;  3KEI A;  1MQH A;  4RK2 A;  2ESN A;  1VFE A;  2RC7 A;  2OLB A;  1B9J A;  3KBR A;  2H25 A;  2Y84 A;  2F7B A;  4G8H A;  2NUV A;  3KSJ A;  4XKQ A;  2DWI A;  4NED A;  1WVJ A;  2DYX A;  4QHQ A;  2QS1 A;  3FVO A;  2ABH A;  3IOW A;  1IIW A;  4QFK A;  4R6K A;  5B7D A;  3SER A;  5CMC A;  1FQB A;  3OEL A;  4DCY A;  3FAT A;  4EF2 A;  4BDQ A;  4X1D A;  3K6V A;  3QUJ A;  3TYH A;  3PPN A;  1P1W A;  3KFM A;  1B40 A;  1Y1Z A;  3MBP A;  3M8U A;  1ELJ A;  2XXX A;  3I6V A;  3FVN A;  3V89 B;  1VFD A;  3T93 B;  3ZS6 A;  2QMW A;  3SEU A;  3O9P A;  5I2N A;  1URS A;  2RKM A;  3DP8 A;  1SYI A;  2H98 A;  2X26 A;  1B0H A;  3GBA A;  2QJE A;  3C36 A;  4HW8 A;  2IEE A;  4HCY A;  1HSE A;  1M5C A;  2A5T A;  2I4C A;  4DE8 A;  4FEB A;  2GHB A;  4P11 A;  1D9Y A;  1GV8 A;  1F9B A;  1OLA A;  4I9D A;  2F7A A;  3L6G A;  3HCQ A;  5TPA A;  2OWT A;  4AQ4 A;  2O7U A;  3H6U A;  3BKI B;  3IO6 A;  3UOR A;  1Y20 A;  1FCK A;  1M5D A;  1JQF A;  5F7V A;  1FW0 A;  4NF6 A;  1Y3P A;  5I58 A;  3H7M A;  4NF5 B;  1XHY A;  4ZEK A;  4Q8R A;  4OFJ A;  1L5T A;  1FQD A;  4DZ1 A;  1XS5 A;  2VHA A;  3JV9 A;  4DXC A;  3TTN A;  2Q9T A;  1PB7 A;  4OFL A;  1M5E A;  2OWS A;  3TEP A;  1B46 A;  2RC9 A;  4G2Z A;  2I4B A;  1IEJ A;  3I5O A;  3K2D A;  4Z0I A;  3OEN A;  3VVE A;  1SYH A;  4YKI A;  3S9M C;  5ICT A;  1ZTY A;  1URD A;  4KHZ E;  3CSB A;  2UVG A;  3IO4 A;  4MF3 A;  4WED A;  3DM0 A;  3E3K A;  2I0C A;  3OEM A;  4GIZ A;  3UIF A;  3N5L A;  3UN6 A;  4YIC A;  1FTO A;  4ZED A;  4NWC A;  1O64 A;  2UXA A;  2H99 A;  3S9E A;  3T66 A;  3RQT A;  2PYY A;  5CC2 A;  3T22 A;  5H8N B;  5CBS A;  2OZZ A;  3DP6 A;  4U23 A;  1VR5 A;  3PGF A;  3K02 A;  3RUM A;  2HQ0 A;  1USY H;  2O1M A;  3TQW A;  4M1V A;  1JW5 A;  3RNN A;  3U92 A;  3EN3 A;  3CRB A;  4YB5 A;  1MPD A;  4R72 A;  1OIB A;  4MFI A;  4WKM A;  1SW5 A;  5I2N B;  3UP9 A;  1N7X A;  4U4S A;  4C1T A;  1PEB A;  4G68 C;  3V5A A;  1UTH A;  3UK4 A;  1DTZ A;  3IOV A;  1B7U A;  1QKB A;  1UQW A;  1II5 A;  3TKD A;  1YTV A;  3U8Q A;  1BIY A;  3U1O A;  5LOM A;  1PDA A;  3IB1 A;  5TPA B;  3TEL A;  3TDJ A;  1MY3 A;  5ICQ A;  1LFH A;  3PUX E;  3FUZ A;  4BDN A;  1AH5 A;  5H8F A;  4KD5 A;  4DXU A;  2GRV A;  5HPQ A;  1A99 A;  5I58 B;  3CI8 A;  4YB7 A;  1CB6 A;  4OMB A;  1QUL A;  2IA4 A;  2PT2 A;  1YCJ A;  4X48 A;  1OVT A;  2XD3 A;  4IO5 A;  3FXU A;  3O6I A;  3SEW A;  4TLL B;  3K6X A;  4RK9 A;  3K6U A;  5I56 A;  3PV0 E;  2Y7W A;  1IIT A;  3G7W A;  4LZ8 A;  4PFU A;  2Y7R A;  5I84 A;  1LB9 A;  2AL5 A;  3EHT A;  1LLS A;  1P1U A;  2I3W A;  2REJ A;  1MPB A;  2UVI A;  3K1N A;  4OEV A;  3M3L A;  1H76 A;  3OMB A;  3PMW A;  1B52 A;  1GTK A;  4G4P A;  4KYS A;  4GD5 A;  2W7Y A;  3MP8 A;  3VE1 B;  4F22 A;  2YLN A;  4IY6 A;  2DWA A;  1ZBM A;  4ZEC A;  2OJT A;  4U1Z A;  3O28 A;  5KCJ A;  3TCH A;  3B7D A;  5I2K A;  4QSD A;  4H8J A;  2HAU A;  3VLU A;  2XXT A;  1UTB B;  5I57 B;  3HPI A;  4I1D A;  2F6G A;  3H06 B;  3SDF A;  1FQF A;  3RLF E;  5IKB A;  1OQG A;  3C32 A;  3LR1 A;  4ZEF A;  2F97 A;  2O7I A;  1EU8 A;  4KYD A;  2AL4 A;  3MZ9 A;  5IAI A;  3JZJ A;  4R2B A;  3THI A;  1B32 A;  1MY4 A;  2WKY A;  3GBB A;  3RY3 A;  3VV5 A;  1ZU0 A;  5K2Y A;  2RF1 A;  2RIN A;  1R9Q A;  3MVZ A;  1OMP A;  5DVF A;  3N6T A;  2RCB A;  3FV2 A;  3B6W A;  3OEK A;  5AA2 D;  3O6H A;  2V3Q A;  1POT A;  1I69 A;  4IO6 A;  1QVS A;  4QFL A;  2D5W A;  3CG3 A;  2G29 A;  3JYR A;  1GVC A;  3H6V A;  1QUJ A;  4OEN A;  4ECF A;  3CVG A;  4K3F A;  3V83 A;  4MLV A;  2ZNT A;  3TCF A;  3CFZ A;  5FHM A;  2I6E A;  4OER A;  3IOT A;  1ZMG A;  1DPE A;  1B3H A;  3KN7 A;  3RPW A;  1B7Z A;  1N84 A;  3GXA A;  2VGQ A;  5HM4 B;  3IJX B;  1MH3 A;  4G77 A;  4WXJ A;  3LUY A;  4H8I A;  2HZK A;  3T96 B;  3G3H A;  3FVG A;  1FQE A;  4EQB A;  5AA2 B;  4I8C A;  3K01 A;  3Q28 A;  1MH4 A;  4RPN A;  3QIM A;  3MZ1 A;  1R1N A;  2QL3 A;  4PFW A;  1LCF A;  1QKA A;  4F1V A;  1H45 A;  4Q5T A;  3SEY A;  2DE3 A;  1Y9U A;  3C33 A;  4O3A A;  1TFA A;  2QRY A;  4FED A;  1RKM A;  4FOR A;  3IAZ A;  2XXQ A;  2ONS A;  3FAS A;  2Z8E A;  4IO2 A;  5CBR A;  3FIR A;  1P1N A;  5DVI A;  4ONY A;  3VLW A;  5H8S A;  3RGY A;  1MQI A;  1B05 A;  4H1X A;  1N04 A;  2I49 A;  2AIX A;  4F29 A;  2XXV A;  4G68 A;  1MM6 A;  4KYE A;  3FXQ A;  4R9G A;  4O3B A;  1PB9 A;  3I3V A;  3PPR A;  1TT1 A;  2YPN A;  3E9X A;  3LSL A;  4R73 A;  3H3G A;  3KSX A;  4X1B A;  4QFP A;  3U93 A;  4JWY A;  1IXC A;  5K2X A;  4JSD A;  4F3S A;  4R2F A;  2I48 A;  1N0T A;  1MXZ A;  4JBZ A;  4GL8 A;  4ISU A;  3RT6 B;  1DSN A;  5H8N A;  4H0W A;  2BJJ X;  1JW1 A;  4GQO A;  5M2V A;  2XHD A;  2B3F A;  3LC8 A;  2VD2 A;  1FTJ A;  2F34 A;  5HBC A;  4MH5 A;  5L9S A;  1O7T A;  1FQC A;  5F1Q A;  1MDQ A;  1ATG A;  4F3B A;  2V25 A;  3QYT A;  4LON B;  5CM6 A;  5TU0 A;  1OLC A;  2XX8 A;  4U21 A;  3HN0 A;  2DOJ A;  1HSL A;  3U94 A;  1BTJ A;  4R6H A;  4R75 A;  5TP9 A;  4RXL A;  1IZ1 A;  3PPO A;  5AA4 A;  2O84 X;  3H6W A;  1SDX A;  4FAT A;  1MXU A;  1LAH E;  3OO9 A;  2Q8J A;  1BLF A;  5L8D A;  4TLM B;  4OET A;  4Q30 B;  4YKP A;  3F11 A;  4JB7 A;  4KCC A;  4YU0 A;  3MVW A;  2NOO A;  5FHO A;  4XIG Q;  4PFT A;  1P1O A;  5DYH A;  5H8H B;  1CE2 A;  4XKR A;  3TTL A;  2ZYK A;  5L9O A;  3MP6 A;  2E1S A;  5JTY B;  3C34 A;  1WOD A;  5KDT B;  1A8E A;  4UAC A;  3PUW E;  3TCG A;  2XXW A;  4KPT A;  2QMX A;  4RYA A;  3MUQ A;  5A5X B;  3PD8 A;  4GRK A;  2ANJ A;  4ZE9 A;  4ELP A;  3R6U A;  1LBC A;  4G68 B;  1N76 A;  3ILU B;  1IQ7 A;  5H8Q A;  3O66 A;  2ZYO A;  2Q89 A;  4NMY A;  3MPL A;  4LA9 A;  1NFT A;  3AXF A;  1MXX A;  1BP5 A;  1FTK A;  3QUF A;  2F6P A;  5CMB A;  1MY0 A;  3U72 A;  4QSC A;  4DXB A;  1A40 A;  3KOT A;  4OQO A;  2O1L A;  3MAM A;  3TUS A;  4QFO A;  4PET A;  1B0L A;  2Z8F A;  1UTB A;  1BKA A;  4OVJ A;  5I57 A;  2AYS A;  3O2A A;  2Y7K A;  3LSF B;  1QUK A;  5ISU A;  1XC1 A;  5AA1 A;  1VE4 A;  1Q1K A;  5FHN A;  4N13 A;  1SVX B;  2P2A A;  1YAE A;  1A8F A;  3BFT A;  3OD7 A;  4H6D A;  2VOZ A;  4HTG A;  3MZB A;  2XXR A;  2F7C A;  4RPO A;  1MS7 A;  3ONM A;  1QJM A;  3TFL A;  4OZ9 A;  1RYO A;  2M8C A;  3OOA A;  5TP9 B;  4POW A;  2OCU A;  5DTB A;  3FVK A;  5AA4 B;  2FA7 A;  3T9U A;  4ESW A;  4DLD A;  1Y3Q A;  5AE4 A;  3PUV E;  2X7Q A;  4ZDM A;  4BDR A;  4MBP A;  3A3C A;  2PT1 A;  4AB6 A;  1B3L A;  2XD2 A;  1A54 A;  1MQJ A;  3MW0 A;  3K1P A;  2DE2 A;  1OVB A;  1N3W A;  3VDF A;  3FV1 A;  1N7W A;  2ALU A;  2O51 A;  2I58 A;  3C35 A;  3R26 A;  1T0K A;  1JEV A;  2DXY A;  1Q35 A;  1B5I A;  3EHS A;  3Q29 A;  4U4X A;  2UYE A;  1SD3 A;  4PFY A;  5AA2 A;  3D4G A;  2XX7 A;  4F2O A;  2RCA A;  4OTE A;  1R6Z A;  2THI A;  3S4U A;  2ZXT A;  4I62 A;  1POY 1;  4Z7E A;  4FJP A;  1NL5 A;  4F3G A;  1S50 A;  1QW0 A;  2VD3 A;  4RJZ A;  3MC2 A;  3TTM A;  2DSF A;  3S9L C;  3L6H A;  5H8Q B;  1B4H A;  3HHG A;  2F8D A;  2E0S A;  1HSJ A;  4QRZ A;  1FQA A;  2F36 A;  3LSW A;  4N6P A;  3VXB A;  2FNC A;  2PMS A;  1AMF A;  3CG1 A;  3EF7 A;  4BDM A;  4JWX A;  1XVY A;  3VVF A;  2A5S A;  3IK6 B;  3H4Z A;  1VSO A;  4WEP A;  3WAE A;  2B65 A;  1DPP A;  2R9J A;  3KG2 A;  5EHS A;  4BDL A;  1Z7M E;  3KN3 A;  3VFJ A;  4QSE A;  3TTK A;  3M3F A;  2GH9 A;  1SI0 A;  2QPQ A;  2UVJ A;  2X7P A;  5B70 A;  3D4C A;  4IO4 A;  1LAF E;  1Y3N A;  5FTH A;  1I6A A;  1D3K A;  2NWJ A;  2PVU A;  4ESX A;  1RYX A;  2CZL A;  2ZNU A;  1JEU A;  3FZV A;  2V3U A;  4MLQ A;  3OO8 A;  2NVU B;  4FE8 A;  3H03 A;  2PBW A;  3FD3 A;  3R7X A;  2QS2 A;  1B58 A;  1QUI A;  5DVJ A;  3Q25 A;  3ZKL A;  2Q2C A;  3EPE A;  1MQD A;  4NWD A;  4H5G A;  3N26 A;  1TWY A;  4AB5 A;  1Y4T A;  3FXR A;  3EQ1 A;  4QFN A;  3SES A;  2DE4 A;  4ELR A;  1H44 A;  1EZO A;  2O6A A;  4GWO A;  3T9X B;  3PU5 A;  2XXH A;  3Q26 A;  2LAO A;  4H5F A;  4HCW A;  4ZEB A;  2F5X A;  1FTL A;  2Z8D A;  2H5Y A;  4GVO A;  4FEC A;  3G3K A;  4GXS B;  3LBS A;  3TAJ A;  2DS9 A;  4LVQ A;  5H8H A;  4P0I A;  4NF8 A;  1B3E A;  3GLB A;  2DP8 A;  5JTY A;  1DOT A;  2REG A;  5KDT A;  1M5F A;  3T9H B;  1TFD A;  4O3C A;  3O6G A;  1H3D A;  2Q88 A;  2HFB A;  5A5X A;  3IL1 B;  3FJM A;  1SQY A;  2R6G E;  3SEX A;  4FAJ A;  3DLN A;  1MPC A;  1US5 A;  5BWJ A;  1DMB A;  3BBR A;  4G8N A;  5I59 A;  4GL0 A;  2ONK E;  3PUY E;  2ONR A;  3FJG A;  2Z22 A;  3IX1 A;  2V84 A;  4GLI A;  1SW2 A;  1B4Z A;  4IY5 A;  3C4M A;  2G93 A;  3O97 A;  1NKX A;  3K0V A;  3K1M A;  4TQU Q;  1A55 A;  3KGC A;  3E13 X;  5EYF A;  2O69 A;  3S2V A;  3MWB A;  1LFI A;  1I6Q A;  1SW1 A;  3LSX A;  4M4G A;  2F78 A;  4F1U A;  1MDP 1;  1P1Q A;  3IB0 A;  4PQJ A;  4LQ2 A;  2DVC A;  4OES A;  4PP0 A;  5CMM A;  2GHA A;  4G8M A;  4ND9 A;  3W15 C;  3RTW B;  3FJ7 A;  2OK2 A;  2ZMB A;  5DEX B;  4BDO A;  3FGS A;  1R9L A;  4ZZA A;  3VVD A;  4NF4 A;  5AA3 A;  1ANF A;  5JK4 A;  4XTC Q;  1JW4 A;  4EQ7 A;  2RC8 A;  1IUD A;  3USD A;  4OWD A;  4ZEI A;  1OQH A;  3PD9 A;  1TXF A;  4EUO A;  3QXM A;  3PPQ A;  3B6T A;  1Y1M A;  4JWO A;  4LUB A;  4NE4 A;  4GOT A;  3DEL B;  3A3U A;  4RNS A;  4RY1 A;  1SBP A;  1US4 A;  5DT6 A;  3C9H A;  1LAX A;  3IR1 A;  5ELV A;  5KZT A;  1ZLQ A;  3A09 A;  1J1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...