3GZGA

Crystal structure of the xanthomonas axonopodis pv. citri molybdate-binding protein (moda) mutant (k127s)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
232
structure length
232
Chain Sequence
TAPVTVFAAASLKESMDEAATAYEKATGTPVRVSYAASSALARQIEQGAPADVFLSADLEWMDYLQQHGLVLPAQRHNLLGNTLVLVAPASSKLRVDPRAPGAIAKALGENGRLAVGQTASVPAGSYAAAALRKLGQWDSVSNRLAESESVRAALMLVSRGEAPLGIVYGSDARADAKVRVVATFPDDSHDAIVYPVAALKNSNNPATAAFVSWLGSKPAKAIFARRGFSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Molybdate-binding periplasmic protein; permease
publication title Crystal structure of the Xanthomonas axonopodis pv. citri molybdate-binding protein (ModA) mutant (K127S)
rcsb
source organism Xanthomonas axonopodis pv. citri
total genus 72
structure length 232
sequence length 232
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3gzgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3gzgA02
1AMFA 4R9GA 3ZKKA 1N3WA 3PUZE 4G8NA 4PE5B 1FTMA 4GL8A 4X9TA 4OERA 3VLWA 2ZYMA 2GHAA 3LSWA 3K6XA 4Q8RA 3PMVA 4C0RA 2FNCA 4DCYA 1B0LA 3KBRA 4YKJA 3HN0A 4HS7A 3MZ9A 5A5XA 4P11A 3MPLA 2PT1A 1B32A 1WVJA 1LBBA 3TAJA 1NFTA 1B9JA 3KZGA 1ZLQA 3FVOA 4NF8A 1LCFA 3DM0A 3RLFE 3VE1B 3O2AA 4F3GA 3WAEA 3KFMA 4F29A 1XT8A 2RC9A 2HFBA 4NE4A 1A8FA 4Z7EA 3V89B 3EQ1A 2VOZA 1P1QA 4EF2A 3KN8A 3U94A 4N6PA 3TEPA 3B7DA 1LSTA 4LVQA 3IORA 2XXHA 5BUUA 3CG1A 2UYFA 1EU8A 4LP2B 2GH9A 1B40A 2DS9A 1URGA 2CMOA 1DPEA 5ITOA 1NH8A 1ZJLA 4TLMB 2PYYA 3OO6A 1NNTA 2V25A 4R6YA 1LAXA 2Z8DA 2GFEA 3T9XB 2FYIA 4DIGA 1AOVA 2GRVA 4WKMA 2ALUA 4U4SA 1B4ZA 3JYRA 3MVWA 1IXHA 1MY4A 3T9HB 2OBGA 3G7WA 3HHFA 5M2VA 4AB5A 5H8QA 3PGFA 3TELA 2XXIA 1Y4TA 1Z7ME 5IKBA 4OZ9A 4JSOA 4KPTA 2DWIA 4FEDA 1HSEA 4YB5A 4XXUA 3Q26A 4NF6B 5B7DA 4PFYA 4U23A 2QS4A 4ONYA 1M5DA 3G3JA 2HZKA 4QRZA 3M8UA 1OLCA 3B6WA 3K01A 1LLSA 4I62A 1IUDA 1ZIUA 2Y7RA 4RXLA 3SEWA 2E0SA 1MY2A 2X26A 2X7PA 3RY3A 5I56B 3I6VA 2DYXA 3VFJA 1A99A 3W9WA 2O7IA 2UVGA 4MLVA 3ZS6A 3FXQA 5ITPA 4ZDMA 4H8JA 5H8SA 3OD7A 4QFLA 1MS7A 4YMBA 1PEBA 1Z7NE 1P99A 2I3WA 2P2AA 3KGCA 3PMWA 5KZTA 2I0BA 4QSDA 4POXA 2DOJA 4HCYA 2ZYNA 1O63A 2VD3A 2Y84A 4FIMA 2ANJA 1LAFE 3RUMA 2HQ0A 3VLUA 1MY1A 4NF4A 4OVJA 2HAUA 4GD5A 2REJA 1SD3A 4LQ2A 4ZE8A 4NF5B 2XXUA 1UIUA 3SDFA 1B46A 2V3UA 3OSRA 2F8DA 2DVCA 4GRKA 4ZEIA 3IB2A 5FTHA 1CB6A 3QAXA 2DWHA 2RCAA 3RQTA 2YLNA 4JB7A 4OEUA 2HZLA 1M5BA 3S9MC 1XVXA 1JEUA 3CR9A 3H6TA 3UK4A 1VR5A 3QIMA 3S9EA 3TTNA 1USYH 1N7WA 2QMXA 1LAGE 3C33A 5B70A 5H8NA 2AYSA 3PUVE 3ZKLA 3UGWA 2I49A 1JNFA 1B5IA 1MH4A 1HSJA 1P1UA 4K3FA 2G93A 3IK6B 3DELB 4NWCA 2ZYOA 3K6VA 4U22A 3BFTA 2M8CA 3OENA 3HSTA 1SVXB 1OMPA 4XIGQ 4TOZA 3MVZA 2F5XA 2YJPA 3R7XA 5CMCA 2O51A 3A09A 1A40A 1B7ZA 1AH5A 4E0XA 5ICQA 3TZAA 1NMUA 2OJTA 1JW4A 1VFEA 3U93A 5I2NB 1IXCA 1QUIA 4XKQA 1A55A 1FTLA 3MQ9A 3PPNA 3S2VA 1BP5A 2F78A 1DMBA 5JEIA 3C36A 5K2YA 4KYEA 3RTWB 1UTHA 3KG2A 2Z22A 3IJXB 4MH5A 2F36A 4O3AA 1YAEA 5DEXA 3MVXA 2PT2A 5DTBA 3FD3A 4EQ7A 4DLDA 2RC7A 4AQ4A 2O69A 3MBPA 1SI1A 4YKPA 1SDXA 4ZEBA 1DOTA 4ZZEA 4H65A 4WEDA 1MPBA 4JWXA 2HAVA 1IIWA 4OESA 5CM6A 1MY3A 2P0SA 1US5A 4IGRA 3MP1A 3T93B 3H7MA 4ISUA 3A3UA 3PV0E 2DXYA 5ISUA 4H0WA 3T66A 1FQCA 3EHSA 4F1UA 3MP6A 1MQIA 2OWTA 3CFZA 4OFLA 2XXWA 5HM4B 1B52A 5I57B 4NTLA 1YCJA 4IO3A 1B3EA 1B7HA 4YMAA 2Y7WA 4O3CA 1IXIA 3IO6A 1UIVA 3OOAA 1Y9UA 4R75A 3JZJA 2O1MA 4RPNA 3E4RA 4WXJA 3T9UA 3G3GA 4NEDA 2IEEA 1DTZA 2B3BA 3CSGA 4KCCA 3OO7A 4IO4A 5I2KB 4BDOA 4ESWA 2ONKE 3K2DA 4I1DA 1WDNA 2F7CA 4H1XA 3PD9A 2UVHA 4NF6A 5L9OA 4YZZA 4FORA 3RNNA 1JW5A 3RT8A 4N13A 3V83A 1I6AA 4P0IA 3OSQA 4RNSA 1EZOA 3S9LC 1MXVA 5KCJB 1PBQA 3B6QA 3Q27A 1QUKA 5I56A 2KLFA 1N76A 1UTHB 3MWBA 1JQFA 4R73A 5AA1A 4JXIA 2B3FA 1FW0A 2DE2A 1R6ZA 5DEXB 2DXRA 2XXPA 3LUYA 2H5YA 3FGSA 3D4GA 3EHTA 4G4PA 2G29A 2XXRA 3P7IA 3MAMA 3VLVA 1Y3QA 4ELRA 3H6VA 2A5TB 3U8QA 2R71A 4GF8A 3CI8A 3THIA 4HTGA 2O7UA 4IY5A 3HO7A 1QUJA 2XXTA 3JV9A 5CI5A 4OFJA 1Q1KA 4XTCQ 1S50A 3IO4A 4PFWA 2P1SA 3FUZA 3KOTA 2LAOA 5AA2D 4GFRA 1B3HA 1RKMA 2I6EA 2X7QA 5DVJA 2I0CA 4YKIA 4NF5A 2VHAA 2I4BA 3LSXA 3D4CA 1SW4A 2ZXTA 3TTLA 3VXBA 4LQ5A 1Y1ZA 2H99A 4GWOA 1ELJA 3TCGA 4F3PA 1ZMGA 2V84A 4R72A 3C34A 4U4XA 1N3XA 4R74A 3UIFA 4R6KA 3K1MA 3F11A 3BFUA 1OQGA 5AA4B 1DSNA 2ZNSA 2XXXA 4EQBA 2D21A 1WODA 1MPDA 1B0HA 5DT6A 4EDPA 4GIZA 2F6PA 3IB0A 2XXQA 2XD3A 1ZTYA 4LATA 4UACA 5F7VA 3N5LA 1B7UA 1B6HA 3LSLA 3BBRA 3ZSFA 3AXFA 4ZE9A 3OO9A 1KWHA 2V93A 3WAFA 3EF7A 4FATA 5KDTB 5K2XA 4LA9A 3KJ7A 5JTYB 1JEVA 1DPPA 2BJJX 4KCDA 1B3GA 3IJOB 1OLAA 4LZ8A 5CRYA 5EHMA 3GBAA 1N0TA 2PMSA 1S7YA 3DLNA 3RTFB 4DXCA 3TPAA 3TKDA 2NWJA 4OTEA 1URSA 1QKAA 4F22A 4RJZA 4RPOA 5I2NA 4IO5A 2F34A 1NKXA 4XKRA 5ICTA 1SI0A 4L17A 1MXUA 3IB1A 2QSXA 1H76A 4R2BA 4F39A 5CC2A 2Z8FA 3IAZA 4OENA 2Q8JA 4QFOA 1USYE 4UA8A 1A7LA 2RC8A 4EUOA 1IITA 4G2ZA 1MDQA 3TQLA 2PVUA 1IZ1A 3PUYE 1B5JA 1FQAA 4ELOA 2THIA 5CMMA 3LBSA 5DVFA 4KI0E 1I6BA 3KN7A 2E1SA 3RT6B 3FZVA 4QFPA 3VVEA 1H45A 3T22A 4OQOA 4OEVA 1SBPA 2OLBA 2IA4A 4DE8A 3N94A 1PBPA 1B3LA 4ELQA 1VFDA 3FJMA 2H25A 1OVTA 3QK6A 1XVYA 3PUXE 3K1PA 5I57A 1LB9A 3TQWA 3FV1A 2DSFA 4NWDA 3UP9A 4M1VA 1ZKBA 1POY1 4QF9A 4GVOA 3LR1A 4QFNA 1R9LA 4BDRA 1JW1A 1Y4CA 2I3VA 2A5SA 5DVIA 1XOCA 3C4MA 3RN8A 3S4UA 2FA7A 4EQ9A 3VXCA 1SYIA 4YKKA 4M4GA 5IAIA 3GZGA 3OMBA 4RYAA 2NVUB 2Y7KA 2DE3A 3K1NA 3W9VA 3PPRA 2ABHA 3H6UA 3MVYA 5I2KA 1B5HA 1Y3PA 2Z23A 4PP0A 1PDAA 3CIJA 3IR1A 1IEJA 3UA8A 3E9XA 3O97A 4GXSB 1GGGA 2ZNTA 3IOVA 5TPAB 1MDP1 2QJEA 4OETA 1B51A 3TCFA 3G3HA 3UORA 5DYHA 4OXVA 1FCKA 3K6WA 3G3KA 3M3FA 2REGA 1B1XA 3I3VA 3KJTA 5KCJA 2H98A 5AE4A 4P0GA 3FVNA 1B58A 2F7AA 1M5EA 1N04A 1CE2A 2RCBA 3PUWE 2DWAA 1MXXA 3K4UA 2Q89A 1SW1A 4DXBA 5AA3A 2XX8A 2OK2A 2R6GE 3FV2A 3SKPA 1BTJA 2VP1A 3SEVA 3TTRA 1FTJA 4JDFA 2I48A 2XXYA 1B3FA 1J1NA 2F6GA 4MLQA 3TODA 2A5TA 4G68B 4IO7A 3U72A 4JWOA 4YICA 3N6TA 3MC2A 5L9MA 2DP8A 2ONSA 2F7BA 2Y7PA 4DDDA 4FECA 1UQWA 3GXAA 1DTGA 1LFIA 3OEMA 4EXLA 1VE4A 1MXWA 4IY6A 1Y3NA 3FJGA 3USDA 3HV1A 1N84A 3G3FA 3Q25A 3O9PA 2YPNA 3FXUA 4KQPA 3SETA 1O64A 4DZ1A 4C1UA 4HCWA 3V8XB 2F97A 3MW0A 4RY1A 5L8DA 2V3QA 4QFKA 3QXMA 1L5TA 5HBCA 4U1ZA 3FVGA 3KOSA 4U2RA 3FATA 4JWYA 4KYDA 5AA4A 3QUFA 4AB6A 1MRPA 4E0WA 1NL5A 1TFAA 1PC3A 1D9YA 3RGYA 3MUQA 1ZBMA 1GVCA 4ZZAA 4ELPA 2Q2CA 1IXGA 1POTA 2H9BA 3TFLA 2OWSA 1LCTA 3O28A 1T0KA 3CSBA 4ZEFA 3KN3A 1LB8A 5KDTA 3H03A 4LONB 3MP8A 5H8FB 5JTYA 3OELA 1B2HA 4F3BA 1NNPA 5H8HB 5I59B 5J1DA 4THIA 2RINA 4WEPA 2GHBA 3I5OA 2UYEA 1MG1A 1QVSA 3O6GA 3UN6A 4OWDA 4PFUA 3SEYA 3KEIA 3PPPA 3TMGA 4PETA 1P1OA 2DWJA 3IOTA 3K00A 2ZMBA 3LSFB 1NNFA 3OXNA 4IB2A 4FJPA 1SW5A 3N6UA 4MBPA 1MY0A 1URDA 2W7YA 4YB7A 4YU0A 2PBWA 1MXYA 2OCUA 1XHYA 2XD2A 3E13X 1FQFA 1BKAA 4IO2A 4YAHX 3L6HA 4U1OA 3VDFA 2O1LA 3ILUB 3IOWA 4I9DA 2VD2A 3QUJA 4IO6A 1LGBC 1RYXA 2QS1A 3C31A 3FVKA 2NOOA 1FTKA 3BKIB 3FXRA 3RPWA 5JK4A 4KHZE 1QJMA 1UTBB 4ECFA 1MH3A 3CFLA 4R2FA 3G3IA 1NNKA 2HCAA 3EPEA 4KR5A 3PU5A 3VVFA 4KFQA 1PB8A 2D5WA 2Z8EA 5AA2B 5BWJA 3HPIA 2ZYKA 2I58A 4KD5A 3FASA 4BLAA 5I58B 4GL0A 2RF1A 1D4NA 1BIYA 1MXZA 4QSEA 5FHNA 1FQDA 5CBRA 1H44A 3SEUA 1NH7A 4BDMA 4TQUQ 3TCHA 1JVYA 3HHGA 3W15C 5TP9B 3GLBA 2ESNA 2NUVA 4F1YA 5EYFA 4RK2A 4Q30B 3H4ZA 4R9FA 1MQGA 3MZ1A 4OFOA 1Q35A 3V5AA 3K02A 1MM7A 1P1WA 1FQEA 3M3LA 3IL1B 4H5FA 4GOTA 1RYOA 2QS3A 5FHOA 2Q9TA 4HW8A 5TPAA 3SESA 4N07A 3O29A 3TTKA 5L9SA 3R6UA 1GTKA 2UVIA 4OHNA 1EZPA 1SW2A 1ATGA 4POWA 4LZ7A 4F18A 4G68C 3T96B 3A3CA 4I8CA 1JVXA 4ZECA 3OO8A 3ILTB 2XHDA 4H5GA 1R9QA 1MM6A 3GBBA 5CBSA 1ZU0A 3K0VA 3ECRA 3E3KA 1I69A 1OIBA 2V3TA 4QSCA 4PQJA 1D9VA 1I6QA 1TFDA 1M5CA 4FE8A 5A5XB 3CG3A 1XS5A 3L6GA 3CRBA 4X48A 1A54A 4G68A 1B4HA 4H8IA 4X1BA 5FTIA 1YPNA 5LOMA 4NF8B 1D3KA 4MF3A 1QW0A 2Y7IA 2XX7A 4TLLB 3MPKA 3H06B 4XKPA 1P1NA 1LBCA 2QPQA 5I84A 4OYVA 1FQBA 1GV8A 3EN3A 2QMWA 3R26A 2D3IA 1YTVA 3H6WA 2VGQA 2AL5A 4QHQA 3PD8A 2XXVA 4F2OA 3QSLA 2ONRA 4F2QA 3PMXA 2UVJA 1SQYA 4G8MA 3HCQA 4NMYA 3B6TA 4O3BA 3U1OA 4JBZA 3FIRA 4U21A 1OVBA 4Q0CA 4LZ5A 3K6UA 5TU0A 4GQOA 2ZNUA 1LFGA 3H3GA 4H67A 2HEUA 3KSXA 1JETA 2AL4A 3O6IA 3TTMA 2PX1A 2R9JA 2XX9A 4OMBA 3TYHA 3CFXA 4F1VA 1HSLA 3ONMA 4ZS9A 1LFHA 5H8FA 5H8QB 4BDLA 3C32A 2WKYA 5H8HA 1OQHA 5FHMA 4EF1A 5I59A 3SERA 1QKBA 3DP8A 1M5FA 4ZEKA 1AL3A 3Q29A 1PB7A 3C35A 1LAHE 1F9BA 4YB6A 1R1NA 2DQVA 3CVGA 5CMBA 2DVZA 3PPQA 4X1DA 4ESXA 2QL3A 4H6DA 4PFTA 4G8HA 3IOUA 1MQHA 3M3KA 3VV5A 4JSDA 1ANFA 1US4A 5ELVA 1O7TA 1TWYA 1TXFA 5F1QA 4LUBA 3DP4A 2QRYA 2CZLA 2Q88A 3LC8A 1TT1A 2H4IA 2Q2AA 1H43A 3QYTA 1MQDA 1Y20A 2O84X 3S9NC 3TUSA 1QULA 4G77A 1A8EA 3VVDA 4ZEDA 5CMKA 4BDNA 1H3DA 3T9VA 3C9HA 2O68A 4IGTA 1UTBA 4Z0IA 4FAJA 2NXOA 1EH3A 4NF4B 4DCXA 3O66A 4MFIA 2B65A 1AIVA 4DXUA 4EXKA 3U92A 3MZBA 2AIXA 2F35A 1SYHA 3ODBA 1PB9A 5HPQA 2UXAA 5AA2A 3O6HA 3TDJA 4RA1A 3FJ7A 5I58A 2QS2A 1IQ7A 1XC1A 1MQJA 3IX1A 2HXWA 4Q5TA 1N7XA 1BLFA 2RKMA 4GXAA 4BDQA 4F31B 2O6AA 3KSJA 4RK9A 2I4CA 5TP9A 3N26A 4KYSA 1MPCA 2DE4A 2OZZA 3OEKA 5H8NB 3MJNA 3EHUA 3PPOA 1B05A 1VSOA 1EZ9A 1GR2A 3SEXA 3Q28A 4R6HA 4ND9A 5EHSA 1Y1MA 1S9TA 4XKNA 1FTOA 3DP6A 4FEBA 1B1HA 4F3SA 4C1TA 4F19A 1II5A 4GLIA
chains in the Genus database with same CATH superfamily
1AMFA 4R9GA 3ZKKA 1N3WA 3PUZE 2F3DA 4G8NA 5IZZA 3NOHA 4PE5B 1FTMA 4GL8A 4X9TA 4OERA 3VLWA 2ZYMA 2GHAA 4FBPA 1FPKA 1EYKA 3LSWA 3K6XA 4Q8RA 3PMVA 4C0RA 2FNCA 4DCYA 1B0LA 3KBRA 4YKJA 3HN0A 4HS7A 3MZ9A 4PTKA 5A5XA 4P11A 3MPLA 2PT1A 1B32A 1WVJA 1LBBA 3TAJA 1NFTA 1B9JA 4JVDA 3KZGA 1ZLQA 3FVOA 4NF8A 1LCFA 3DM0A 4JVIA 3RLFE 3VE1B 3O2AA 4F3GA 3WAEA 2XWKA 3KFMA 2CEYA 4NAPA 2PCRA 4F29A 1XT8A 2RC9A 4HE1A 2HFBA 4NE4A 1A8FA 4Z7EA 3V89B 3EQ1A 2VOZA 1P1QA 4EF2A 3KN8A 3U94A 4N6PA 3TEPA 3B7DA 1LSTA 4LVQA 3IORA 2XXHA 5BUUA 1RDXA 3CG1A 2UYFA 1EU8A 4LP2B 5EQ7A 2GH9A 1B40A 2DS9A 1URGA 2CMOA 1DPEA 4X04A 5ITOA 1NH8A 1ZJLA 4TLMB 2PYYA 5IZ3B 3OO6A 1NNTA 2V25A 4R6YA 1LAXA 2Z8DA 2GFEA 3T9XB 2FYIA 4DIGA 1AOVA 2GRVA 4WKMA 2ALUA 3FXBA 4U4SA 1B4ZA 3JYRA 3MVWA 1FJ9A 1IXHA 1MY4A 3T9HB 2OBGA 3G7WA 3HHFA 5M2VA 4AB5A 5LTCA 5H8QA 3PGFA 3TELA 2XXIA 1Y4TA 1Z7ME 5IKBA 4OZ9A 4JSOA 4KPTA 1FPBA 2R8TA 2KR0A 2DWIA 4FEDA 1HSEA 2QVRA 1NV0A 4YB5A 4XXUA 3Q26A 4NF6B 5B7DA 4PFYA 4U23A 2QS4A 4ONYA 1M5DA 3G3JA 2HZKA 1NV7A 4HE0A 4QRZA 3M8UA 1OLCA 1K9ZA 3B6WA 3K01A 1LLSA 4I62A 1IUDA 1ZIUA 2Y7RA 4RXLA 3SEWA 2E0SA 1MY2A 2X26A 1SPIA 2X7PA 3RY3A 5I56B 3I6VA 2DYXA 3VFJA 1A99A 4O7MA 3W9WA 2O7IA 2UVGA 4MLVA 3ZS6A 3FXQA 5ITPA 4ZDMA 1FJ6A 4H8JA 5H8SA 3OD7A 4QFLA 1MS7A 4YMBA 1PEBA 1FPDA 4OVPA 2KQZA 1Z7NE 1P99A 2I3WA 2P2AA 3KGCA 3PMWA 4PDDA 5KZTA 2I0BA 4QSDA 4POXA 2DOJA 5IZ1A 4HCYA 2ZYNA 1O63A 2VD3A 4UABA 2Y84A 4FIMA 2ANJA 1LAFE 3RUMA 2FVZA 2HQ0A 4N81A 3VLUA 1MY1A 1LBWA 4NF4A 4OVJA 3ISPA 2HAUA 4GD5A 2REJA 4N17A 1SD3A 4LQ2A 4ZE8A 4NF5B 4PC9A 5IM2A 2XXUA 1UIUA 3SDFA 4GWWA 1B46A 2V3UA 3OSRA 2F8DA 2DVCA 4GRKA 4ZEIA 3IB2A 5FTHA 1CB6A 3QAXA 2DWHA 2RCAA 3RQTA 2YLNA 4JB7A 4OEUA 2HZLA 1M5BA 3S9MC 1XVXA 4NHBA 1JEUA 3CR9A 3H6TA 4N91A 3UK4A 1VR5A 3QIMA 3S9EA 3TTNA 3T1BA 4P1LA 1USYH 1N7WA 2QMXA 1LAGE 2QVUA 3C33A 5B70A 5DW8A 5H8NA 2AYSA 3PUVE 3ZKLA 3UGWA 4NGUA 2I49A 1JNFA 4PBQA 1K9YA 1B5IA 1MH4A 1HSJA 2WX9A 4PF6A 1P1UA 4PAIA 1DK4A 4K3FA 2G93A 3IK6B 3DELB 4NWCA 4H46A 2ZYOA 3K6VA 4U22A 3BFTA 2M8CA 1NUXA 3OENA 3HSTA 5LDZA 1SVXB 1OMPA 4XIGQ 4TOZA 3MVZA 4P1EA 2F5XA 2YJPA 3R7XA 5CMCA 2O51A 3A09A 1A40A 3RYDA 1B7ZA 1AH5A 4E0XA 5ICQA 3TZAA 1NMUA 1RDZA 2OJTA 1JW4A 1VFEA 3U93A 4OVQA 5I2NB 5ESYA 4GWUA 1IXCA 1QUIA 4XKQA 3RPLB 1A55A 1FTLA 3MQ9A 3PPNA 3S2VA 1BP5A 2F78A 1DMBA 5JEIA 3C36A 2CEXA 5K2YA 1INPA 4G61A 4KYEA 3RTWB 1UTHA 3KG2A 4GWZA 2Z22A 4GBWA 3IJXB 4MH5A 2F36A 4O3AA 1YAEA 5DEXA 3MVXA 3T0JA 2PT2A 5DTBA 3FD3A 4EQ7A 4DLDA 1BK4A 2RC7A 3MSTA 4AQ4A 2O69A 3MBPA 1SI1A 4YKPA 1SDXA 4PE3A 2ZZWA 3MYUA 4O7IA 4ZEBA 2CZKA 1DOTA 4ZZEA 4H65A 4WEDA 1MPBA 4JWXA 4PF8A 2HAVA 1IIWA 4OESA 5CM6A 1MY3A 2P0SA 1US5A 4IGRA 3MP1A 3T93B 3H7MA 4ISUA 3A3UA 1FPEA 3PV0E 2DXYA 5ISUA 4H0WA 3T66A 1FQCA 3EHSA 4F1UA 3MP6A 4MHFA 1MQIA 2OWTA 3CFZA 4OFLA 4GX6A 2XXWA 5HM4B 1B52A 4GX4A 5I57B 4NTLA 1YCJA 1NV4A 4P47A 4IO3A 1B3EA 1B7HA 4YMAA 2Y7WA 4O3CA 1IXIA 3LUZA 3IO6A 1UIVA 3OOAA 1Y9UA 2OX3A 5IZ3A 4R75A 3JZJA 2O1MA 4RPNA 3E4RA 2Q8MA 4WXJA 3T9UA 3G3GA 4NEDA 2IEEA 1DTZA 2B3BA 3CSGA 2CZIA 4KCCA 3OO7A 4IO4A 5I2KB 4BDOA 4ESWA 2ONKE 3K2DA 4I1DA 1WDNA 5F24A 2F7CA 4H1XA 1NUWA 2Y5KA 3PD9A 2UVHA 4NQ8A 4NF6A 5L9OA 4YZZA 4FORA 3RNNA 1JW5A 3RT8A 4N13A 3V83A 1I6AA 4P0IA 3OSQA 4RNSA 1EZOA 3KC0A 4P56A 3S9LC 1MXVA 5KCJB 1PBQA 3B6QA 3Q27A 1QUKA 5I56A 2KLFA 1N76A 1UTHB 3MWBA 1JQFA 4R73A 5AA1A 4JXIA 2B3FA 1FW0A 5ET5A 2DE2A 1R6ZA 5DEXB 2DXRA 2XXPA 3LUYA 2FIXA 2H5YA 3FGSA 3D4GA 3EHTA 4G4PA 2G29A 2XXRA 3P7IA 4MEVA 1KZ8A 3MAMA 2JJKA 3VLVA 1Y3QA 4ELRA 3H6VA 2A5TB 3U8QA 2R71A 4GF8A 3CI8A 3THIA 4HTGA 2O7UA 4IY5A 3HO7A 1QUJA 1CNQA 2XXTA 3JV9A 2PFZA 5CI5A 4OFJA 2WEFA 1Q1KA 4XTCQ 1S50A 3HFUA 3IO4A 4PFWA 2P1SA 3FUZA 3KOTA 2LAOA 5AA2D 4GFRA 1B3HA 1RKMA 2I6EA 2X7QA 5DVJA 2I0CA 4YKIA 4OA4A 4NF5A 2VHAA 2I4BA 3LSXA 3D4CA 1SW4A 2ZXTA 3TTLA 3VXBA 4LQ5A 1Y1ZA 2H99A 4PAFA 4GWOA 1ELJA 3TCGA 4F3PA 1ZMGA 3BIGA 2V84A 4R72A 3C34A 4U4XA 1N3XA 4R74A 3UIFA 4R6KA 3K1MA 3F11A 3BFUA 1OQGA 5AA4B 1DSNA 2ZNSA 2XXXA 4EQBA 2D21A 1WODA 1MPDA 1B0HA 5DT6A 4GIZA 4EDPA 2F6PA 3IB0A 2XXQA 2WYKA 2XD3A 1ZTYA 4LATA 4UACA 5F7VA 3N5LA 1B7UA 3IFCA 1B6HA 2VPNA 3LSLA 3BBRA 3ZSFA 3AXFA 4ZE9A 3OO9A 1KWHA 2V93A 1FTAA 3EF7A 3WAFA 4FATA 5KDTB 5K2XA 1NI9A 4LA9A 3KJ7A 5JTYB 1JEVA 1DPPA 2BJJX 4KCDA 1B3GA 4MCOA 4XF5A 3IJOB 1OLAA 4LZ8A 5CRYA 5EHMA 3GBAA 4NX1A 1N0TA 2PMSA 1S7YA 3DLNA 3RTFB 4DXCA 2XWIA 3TPAA 4PFIA 3TKDA 2NWJA 4PAKA 1URSA 4OTEA 1QKAA 4F22A 4RJZA 4RPOA 4O8MA 5I2NA 4IO5A 2WYPA 2F34A 1NKXA 4XKRA 5ICTA 3RPLA 4GBVA 1IMEA 1SI0A 1FPGA 4L17A 1MXUA 3IB1A 2QSXA 1H76A 4PBHA 4R2BA 4F39A 5CC2A 2Z8FA 3IAZA 4OENA 2Q8JA 4QFOA 1USYE 5FBPA 4UA8A 1RDYA 1A7LA 2RC8A 4EUOA 1IITA 4G2ZA 1YXIA 1MDQA 3TQLA 2PVUA 3CHGA 1IZ1A 3PUYE 1B5JA 1FQAA 4ELOA 2THIA 5CMMA 3LBSA 4OANA 5DVFA 4KI0E 1I6BA 3KN7A 2E1SA 3RT6B 3FZVA 4QFPA 4MIJA 3VVEA 4MAGA 1H45A 3T22A 4OQOA 4OEVA 1SBPA 4X8RA 2OLBA 2IA4A 4DE8A 3N94A 1PBPA 1B3LA 4I40A 4ELQA 1VFDA 3FJMA 2H25A 1OVTA 3QK6A 4N15A 1XVYA 3PUXE 3K1PA 5I57A 1LB9A 3TQWA 3FV1A 1LBXA 2DSFA 4PDHA 4NWDA 3UP9A 4M1VA 1ZKBA 1POY1 4QF9A 1G0IA 4GVOA 3LR1A 4QFNA 1R9LA 5EQ9A 4BDRA 1JW1A 1Y4CA 2I3VA 2HPGA 2A5SA 5DVIA 1XOCA 3C4MA 3RN8A 1YYZA 3S4UA 2FA7A 4EQ9A 4P3LA 3VXCA 1FBEA 4N6KA 1SYIA 4YKKA 4M4GA 5IAIA 3GZGA 3OMBA 4RYAA 2NVUB 2Y7KA 2DE3A 3K1NA 2MKZA 3W9VA 3PPRA 4HXVA 2ABHA 3H6UA 1KA0A 3MVYA 1B5HA 1Y3PA 2XWOA 5I2KA 2Z23A 4PP0A 1PDAA 3CIJA 4IR8A 3IR1A 1IEJA 3UA8A 3E9XA 3O97A 4XEQA 4GXSB 1FBCA 1GGGA 2ZNTA 3IOVA 5TPAB 1MDP1 2QJEA 4OETA 3IFAA 1B51A 4XFEA 3TCFA 3G3HA 3UORA 1FBFA 5DYHA 4OXVA 1FCKA 3K6WA 3G3KA 3M3FA 3QMFA 5ET7A 3SZPA 2REGA 1FPFA 1IMAA 1B1XA 3I3VA 3KJTA 5KCJA 2H98A 5AE4A 4P0GA 3FVNA 1B58A 4OVTA 2F7AA 1M5EA 1N04A 5I5PA 1CE2A 3ROJA 2RCBA 3PUWE 2DWAA 1MXXA 3K4UA 2Q89A 1SW1A 4DXBA 5AA3A 2XX8A 2OK2A 2R6GE 3FV2A 3SKPA 1BTJA 2VP1A 3SEVA 3TTRA 1FTJA 4JDFA 1NV2A 2I48A 2XXYA 1B3FA 1J1NA 2F6GA 4DI3D 4MLQA 3TODA 2A5TA 4G68B 3B50A 2OWZA 3EKIA 4IO7A 1LBZA 3U72A 4JWOA 4YICA 3N6TA 3MC2A 5L9MA 2DP8A 2ONSA 2F7BA 2Y7PA 4DDDA 4FECA 1UQWA 3GXAA 1DTGA 1LFIA 3OEMA 4EXLA 2VPOA 1VE4A 1MXWA 4IY6A 1Y3NA 4I3EA 3FJGA 3USDA 1EYJA 3HV1A 1N84A 3G3FA 1QGXA 3Q25A 3O9PA 2YPNA 3FXUA 4KQPA 3SETA 1O64A 4DZ1A 2QVVA 4C1UA 4HCWA 3V8XB 2F97A 3MW0A 4RY1A 5L8DA 2V3QA 4QFKA 3QXMA 1LBYA 1L5TA 4LN5A 5HBCA 4U1ZA 3FVGA 3KOSA 4U2RA 4OVRA 1EYIA 3FATA 1NV1A 4JWYA 4KYDA 5AA4A 3QUFA 4AB6A 1MRPA 4E0WA 1NL5A 1TFAA 1PC3A 1D9YA 3RGYA 3MUQA 1ZBMA 3A29A 1GVCA 4ZZAA 4ELPA 3KBZA 2Q2CA 1IXGA 1POTA 4MMPA 2H9BA 3TFLA 2OWSA 1LCTA 3O28A 1T0KA 3CSBA 4ZEFA 3KN3A 1LB8A 5KDTA 2GQ1A 1NV3A 3H03A 4LONB 3MP8A 5H8FB 5JTYA 3OELA 1B2HA 4F3BA 1NNPA 5H8HB 5I59B 5J1DA 4THIA 1D9QA 2RINA 4WEPA 2GHBA 3I5OA 2UYEA 1MG1A 1KA1A 1QVSA 3O6GA 3UN6A 4OWDA 4PFUA 3SEYA 3KEIA 3PPPA 3TMGA 5J16A 4PETA 1P1OA 4QBAA 2DWJA 3IOTA 3K00A 2ZMBA 3LSFB 1NNFA 3OXNA 4IB2A 4FJPA 1SW5A 3N6UA 4MBPA 1MY0A 1URDA 2W7YA 4YB7A 4YU0A 2PBWA 1MXYA 2OCUA 1XHYA 2XD2A 3E13X 1FQFA 1BKAA 4IO2A 4YAHX 3L6HA 4U1OA 3VDFA 4KXPA 2O1LA 3ILUB 3IOWA 4I9DA 2VD2A 3QUJA 4IO6A 1LGBC 1RYXA 4P9KA 2QS1A 3C31A 3FVKA 2NOOA 1FTKA 3BKIB 3FXRA 3RPWA 5JK4A 4KHZE 1QJMA 1UTBB 3PTYA 4ECFA 1MH3A 3CFLA 4R2FA 3G3IA 1FBHA 3LV0A 4N4UA 4PFRA 1YZ0A 4H45A 1NNKA 2PFYA 2HCAA 3GYYA 3EPEA 1FRPA 4KR5A 1IMDA 2FBPA 3PU5A 3VVFA 4KFQA 1PB8A 2D5WA 2Z8EA 5AA2B 5BWJA 3HPIA 2ZYKA 4PGPA 3E78A 2I58A 4KD5A 3FASA 4BLAA 5I58B 2Q74A 3U65A 4GL0A 2RF1A 1D4NA 1BIYA 1MXZA 4QSEA 5FHNA 1FQDA 2ZZVA 5CBRA 1H44A 3SEUA 1NH7A 4HE2A 4BDMA 4TQUQ 3TCHA 1JVYA 3KC1A 3HHGA 3W15C 5TP9B 1DBZA 3GLBA 2ESNA 2NUVA 4F1YA 5EYFA 2XXKA 4PFBA 4RK2A 1FBPA 4Q30B 3H4ZA 4R9FA 1MQGA 3MZ1A 4OFOA 1Q35A 3V5AA 3K02A 2P3NA 1MM7A 1P1WA 1FQEA 3M3LA 3IL1B 4H5FA 4GOTA 1RYOA 2QS3A 5FHOA 2Q9TA 4HW8A 4GWSA 5TPAA 4N6DA 3SESA 4N07A 3O29A 3TTKA 5L9SA 3R6UA 1GTKA 2UVIA 4OHNA 2FHYA 1EZPA 1SW2A 1ATGA 4POWA 4JVCA 1NUZA 4LZ7A 4F18A 4G68C 3T96B 3A3CA 1LBVA 4I8CA 1JVXA 1VDWA 4ZECA 3OO8A 3ILTB 2XHDA 4H5GA 4N8GA 1R9QA 1MM6A 3GBBA 5CBSA 1FPLA 1ZU0A 1G0HA 3K0VA 3ECRA 3E3KA 1I69A 1OIBA 2V3TA 4QSCA 4PQJA 1D9VA 1I6QA 2V4CA 1TFDA 1M5CA 4FE8A 2HHMA 5A5XB 3CG3A 1XS5A 3L6GA 3CRBA 4X48A 1A54A 4G68A 4MX6A 1B4HA 1FBDA 4H8IA 4X1BA 5FTIA 1YPNA 1NV6A 4GX3A 5LOMA 5IGAA 4NF8B 1D3KA 4MF3A 1QW0A 2Y7IA 2XX7A 4TLLB 3MPKA 4MJOA 4N8YA 3H06B 4XKPA 1P1NA 4PCDA 1LBCA 2QPQA 4MNIA 5I84A 4AS4A 4OYVA 1FQBA 1GV8A 3EN3A 2QMWA 3R26A 2D3IA 1YTVA 3H6WA 2VGQA 2AL5A 4QHQA 1NV5A 3PD8A 1NUYA 2XXVA 4F2OA 3QSLA 1FPIA 1AWBA 2ONRA 2Y5LA 4F2QA 2FIEA 1IMCA 3PMXA 2UVJA 1SQYA 4G8MA 3HCQA 2VT5A 4NMYA 4QXDA 3B6TA 4O3BA 3U1OA 4JBZA 3FIRA 5T3JA 4U21A 1OVBA 4Q0CA 4LZ5A 3K6UA 4MNPA 5ET8A 5TU0A 4GQOA 2L5VA 2B4LA 2ZNUA 1LFGA 3H3GA 4H67A 2HEUA 3KSXA 1JETA 2AL4A 3O6IA 3TTMA 2PX1A 2R9JA 2XX9A 4OMBA 3TYHA 3CFXA 4DI4B 4OVSA 4F1VA 1HSLA 3ONMA 4ZS9A 1LFHA 5H8FA 5H8QB 4AS5A 4BDLA 1IMBA 5I7IA 3C32A 2WKYA 5H8HA 1OQHA 5FHMA 4EF1A 5I59A 1LEVA 3SERA 1QKBA 3DP8A 1M5FA 4ZEKA 1AL3A 3Q29A 1PB7A 3C35A 1LAHE 1F9BA 4YB6A 1R1NA 2QFLA 2DQVA 3CVGA 2WBBA 5CMBA 2DVZA 2F3BA 3PPQA 4X1DA 4ESXA 5I3SA 2QL3A 4H6DA 2BJIA 4PFTA 4GWYA 4G8HA 3IOUA 1MQHA 3M3KA 3VV5A 4JSDA 3FBPA 1ANFA 1US4A 5ELVA 1O7TA 4MNCA 1TWYA 1TXFA 5F1QA 2HXRA 3BIHA 4LUBA 3DP4A 2QRYA 2CZLA 4NF0A 2Q88A 5EYGA 3D1RA 3LC8A 1TT1A 2H4IA 4P8BA 2Q2AA 1H43A 3QYTA 1MQDA 1Y20A 5ET6A 2O84X 3S9NC 3TUSA 4NG7A 1QULA 4G77A 1A8EA 1FSAA 3VVDA 4ZEDA 5CMKA 4BDNA 1H3DA 3T9VA 4GWXA 2ZZXA 3C9HA 2O68A 4IGTA 1UTBA 4Z0IA 1JP4A 4FAJA 2DDKA 2NXOA 1EH3A 4NF4B 1IMFA 2WBDA 3O66A 4DCXA 4MFIA 2B65A 2P3VA 1AIVA 4DXUA 4EXKA 5EQ8A 4O94A 2XWVA 2XA5A 3U92A 3MZBA 2AIXA 2F35A 1SYHA 3E79A 3ODBA 1PB9A 5A5LA 5HPQA 2UXAA 5AA2A 3O6HA 3TDJA 4RA1A 3FJ7A 5I58A 1FBGA 2QS2A 1DCUA 1IQ7A 1XC1A 1MQJA 3IX1A 1XI6A 2HXWA 4Q5TA 1N7XA 1BLFA 2RKMA 4GXAA 2B4MA 1FPJA 4BDQA 3B8BA 4F31B 2O6AA 3KSJA 4RK9A 2I4CA 5TP9A 3N26A 4KYSA 1MPCA 5EQAA 2DE4A 2OZZA 3OEKA 5H8NB 3MJNA 4I3YA 3EHUA 3PPOA 1B05A 1VSOA 1EZ9A 1GR2A 1Q9DA 3SEXA 3Q28A 4R6HA 4ND9A 5EHSA 1Y1MA 1S9TA 5EYHA 2CZHA 4PGNA 4XKNA 1FTOA 3DP6A 4FEBA 1B1HA 4F3SA 4C1TA 4F19A 1II5A 4GLIA 4NN3A
chains in the Genus database with same CATH topology
1AMFA 4R9GA 3ZKKA 1N3WA 3PUZE 4G8NA 4PE5B 1FTMA 4GL8A 4X9TA 4OERA 3VLWA 2ZYMA 2GHAA 3LSWA 3K6XA 4Q8RA 3PMVA 4C0RA 2FNCA 4DCYA 1B0LA 3KBRA 4YKJA 3HN0A 4HS7A 3MZ9A 5A5XA 4P11A 3MPLA 2PT1A 1B32A 1WVJA 1LBBA 3TAJA 1NFTA 1B9JA 3KZGA 1ZLQA 3FVOA 4NF8A 1LCFA 3DM0A 3RLFE 3VE1B 3O2AA 4F3GA 3WAEA 3KFMA 4F29A 1XT8A 2RC9A 2HFBA 4NE4A 1A8FA 4Z7EA 3V89B 3EQ1A 2VOZA 1P1QA 4EF2A 3KN8A 3U94A 4N6PA 3TEPA 3B7DA 1LSTA 4LVQA 3IORA 2XXHA 5BUUA 3CG1A 2UYFA 1EU8A 4LP2B 2GH9A 1B40A 2DS9A 1URGA 2CMOA 1DPEA 5ITOA 1NH8A 1ZJLA 4TLMB 2PYYA 3OO6A 1NNTA 2V25A 4R6YA 1LAXA 2Z8DA 2GFEA 3T9XB 2FYIA 4DIGA 1AOVA 2GRVA 4WKMA 2ALUA 4U4SA 1B4ZA 3JYRA 3MVWA 1IXHA 1MY4A 3T9HB 2OBGA 3G7WA 3HHFA 5M2VA 4AB5A 5H8QA 3PGFA 3TELA 2XXIA 1Y4TA 1Z7ME 5IKBA 4OZ9A 4JSOA 4KPTA 2DWIA 4FEDA 1HSEA 4YB5A 4XXUA 3Q26A 4NF6B 5B7DA 4PFYA 4U23A 2QS4A 4ONYA 1M5DA 3G3JA 2HZKA 4QRZA 3M8UA 1OLCA 3B6WA 3K01A 1LLSA 4I62A 1IUDA 1ZIUA 2Y7RA 4RXLA 3SEWA 2E0SA 1MY2A 2X26A 2X7PA 3RY3A 5I56B 3I6VA 2DYXA 3VFJA 1A99A 3W9WA 2O7IA 2UVGA 4MLVA 3ZS6A 3FXQA 5ITPA 4ZDMA 4H8JA 5H8SA 3OD7A 4QFLA 1MS7A 4YMBA 1PEBA 1Z7NE 1P99A 2I3WA 2P2AA 3KGCA 3PMWA 5KZTA 2I0BA 4QSDA 4POXA 2DOJA 4HCYA 2ZYNA 1O63A 2VD3A 2Y84A 4FIMA 2ANJA 1LAFE 3RUMA 2HQ0A 3VLUA 1MY1A 4NF4A 4OVJA 2HAUA 4GD5A 2REJA 1SD3A 4LQ2A 4ZE8A 4NF5B 2XXUA 1UIUA 3SDFA 1B46A 2V3UA 3OSRA 2F8DA 2DVCA 4GRKA 4ZEIA 3IB2A 5FTHA 1CB6A 3QAXA 2DWHA 2RCAA 3RQTA 2YLNA 4JB7A 4OEUA 2HZLA 1M5BA 3S9MC 1XVXA 1JEUA 3CR9A 3H6TA 3UK4A 1VR5A 3QIMA 3S9EA 3TTNA 1USYH 1N7WA 2QMXA 1LAGE 3C33A 5B70A 5H8NA 2AYSA 3PUVE 3ZKLA 3UGWA 2I49A 1JNFA 1B5IA 1MH4A 1HSJA 1P1UA 4K3FA 2G93A 3IK6B 3DELB 4NWCA 2ZYOA 3K6VA 4U22A 3BFTA 2M8CA 3OENA 3HSTA 1SVXB 1OMPA 4XIGQ 4TOZA 3MVZA 2F5XA 2YJPA 3R7XA 5CMCA 2O51A 3A09A 1A40A 1B7ZA 1AH5A 4E0XA 5ICQA 3TZAA 1NMUA 2OJTA 1JW4A 1VFEA 3U93A 5I2NB 1IXCA 1QUIA 4XKQA 1A55A 1FTLA 3MQ9A 3PPNA 3S2VA 1BP5A 2F78A 1DMBA 5JEIA 3C36A 5K2YA 4KYEA 3RTWB 1UTHA 3KG2A 2Z22A 3IJXB 4MH5A 2F36A 4O3AA 1YAEA 5DEXA 3MVXA 2PT2A 5DTBA 3FD3A 4EQ7A 4DLDA 2RC7A 4AQ4A 2O69A 3MBPA 1SI1A 4YKPA 1SDXA 4ZEBA 1DOTA 4ZZEA 4H65A 4WEDA 1MPBA 4JWXA 2HAVA 1IIWA 4OESA 5CM6A 1MY3A 2P0SA 1US5A 4IGRA 3MP1A 3T93B 3H7MA 4ISUA 3A3UA 3PV0E 2DXYA 5ISUA 4H0WA 3T66A 1FQCA 3EHSA 4F1UA 3MP6A 1MQIA 2OWTA 3CFZA 4OFLA 2XXWA 5HM4B 1B52A 5I57B 4NTLA 1YCJA 4IO3A 1B3EA 1B7HA 4YMAA 2Y7WA 4O3CA 1IXIA 3IO6A 1UIVA 3OOAA 1Y9UA 4R75A 3JZJA 2O1MA 4RPNA 3E4RA 4WXJA 3T9UA 3G3GA 4NEDA 2IEEA 1DTZA 2B3BA 3CSGA 4KCCA 3OO7A 4IO4A 5I2KB 4BDOA 4ESWA 2ONKE 3K2DA 4I1DA 1WDNA 2F7CA 4H1XA 3PD9A 2UVHA 4NF6A 5L9OA 4YZZA 4FORA 3RNNA 1JW5A 3RT8A 4N13A 3V83A 1I6AA 4P0IA 3OSQA 4RNSA 1EZOA 3S9LC 1MXVA 5KCJB 1PBQA 3B6QA 3Q27A 1QUKA 5I56A 2KLFA 1N76A 1UTHB 3MWBA 1JQFA 4R73A 5AA1A 4JXIA 2B3FA 1FW0A 2DE2A 1R6ZA 5DEXB 2DXRA 2XXPA 3LUYA 2H5YA 3FGSA 3D4GA 3EHTA 4G4PA 2G29A 2XXRA 3P7IA 3MAMA 3VLVA 1Y3QA 4ELRA 3H6VA 2A5TB 3U8QA 2R71A 4GF8A 3CI8A 3THIA 4HTGA 2O7UA 4IY5A 3HO7A 1QUJA 2XXTA 3JV9A 5CI5A 4OFJA 1Q1KA 4XTCQ 1S50A 3IO4A 4PFWA 2P1SA 3FUZA 3KOTA 2LAOA 5AA2D 4GFRA 1B3HA 1RKMA 2I6EA 2X7QA 5DVJA 2I0CA 4YKIA 4NF5A 2VHAA 2I4BA 3LSXA 3D4CA 1SW4A 2ZXTA 3TTLA 3VXBA 4LQ5A 1Y1ZA 2H99A 4GWOA 1ELJA 3TCGA 4F3PA 1ZMGA 2V84A 4R72A 3C34A 4U4XA 1N3XA 4R74A 3UIFA 4R6KA 3K1MA 3F11A 3BFUA 1OQGA 5AA4B 1DSNA 2ZNSA 2XXXA 4EQBA 2D21A 1WODA 1MPDA 1B0HA 5DT6A 4EDPA 4GIZA 2F6PA 3IB0A 2XXQA 2XD3A 1ZTYA 4LATA 4UACA 5F7VA 3N5LA 1B7UA 1B6HA 3LSLA 3BBRA 3ZSFA 3AXFA 4ZE9A 3OO9A 1KWHA 2V93A 3WAFA 3EF7A 4FATA 5KDTB 5K2XA 4LA9A 3KJ7A 5JTYB 1JEVA 1DPPA 2BJJX 4KCDA 1B3GA 3IJOB 1OLAA 4LZ8A 5CRYA 5EHMA 3GBAA 1N0TA 2PMSA 1S7YA 3DLNA 3RTFB 4DXCA 3TPAA 3TKDA 2NWJA 4OTEA 1URSA 1QKAA 4F22A 4RJZA 4RPOA 5I2NA 4IO5A 2F34A 1NKXA 4XKRA 5ICTA 1SI0A 4L17A 1MXUA 3IB1A 2QSXA 1H76A 4R2BA 4F39A 5CC2A 2Z8FA 3IAZA 4OENA 2Q8JA 4QFOA 1USYE 4UA8A 1A7LA 2RC8A 4EUOA 1IITA 4G2ZA 1MDQA 3TQLA 2PVUA 1IZ1A 3PUYE 1B5JA 1FQAA 4ELOA 2THIA 5CMMA 3LBSA 5DVFA 4KI0E 1I6BA 3KN7A 2E1SA 3RT6B 3FZVA 4QFPA 3VVEA 1H45A 3T22A 4OQOA 4OEVA 1SBPA 2OLBA 2IA4A 4DE8A 3N94A 1PBPA 1B3LA 4ELQA 1VFDA 3FJMA 2H25A 1OVTA 3QK6A 1XVYA 3PUXE 3K1PA 5I57A 1LB9A 3TQWA 3FV1A 2DSFA 4NWDA 3UP9A 4M1VA 1ZKBA 1POY1 4QF9A 4GVOA 3LR1A 4QFNA 1R9LA 4BDRA 1JW1A 1Y4CA 2I3VA 2A5SA 5DVIA 1XOCA 3C4MA 3RN8A 3S4UA 2FA7A 4EQ9A 3VXCA 1SYIA 4YKKA 4M4GA 5IAIA 3GZGA 3OMBA 4RYAA 2NVUB 2Y7KA 2DE3A 3K1NA 3W9VA 3PPRA 2ABHA 3H6UA 3MVYA 5I2KA 1B5HA 1Y3PA 2Z23A 4PP0A 1PDAA 3CIJA 3IR1A 1IEJA 3UA8A 3E9XA 3O97A 4GXSB 1GGGA 2ZNTA 3IOVA 5TPAB 1MDP1 2QJEA 4OETA 1B51A 3TCFA 3G3HA 3UORA 5DYHA 4OXVA 1FCKA 3K6WA 3G3KA 3M3FA 2REGA 1B1XA 3I3VA 3KJTA 5KCJA 2H98A 5AE4A 4P0GA 3FVNA 1B58A 2F7AA 1M5EA 1N04A 1CE2A 2RCBA 3PUWE 2DWAA 1MXXA 3K4UA 2Q89A 1SW1A 4DXBA 5AA3A 2XX8A 2OK2A 2R6GE 3FV2A 3SKPA 1BTJA 2VP1A 3SEVA 3TTRA 1FTJA 4JDFA 2I48A 2XXYA 1B3FA 1J1NA 2F6GA 4MLQA 3TODA 2A5TA 4G68B 4IO7A 3U72A 4JWOA 4YICA 3N6TA 3MC2A 5L9MA 2DP8A 2ONSA 2F7BA 2Y7PA 4DDDA 4FECA 1UQWA 3GXAA 1DTGA 1LFIA 3OEMA 4EXLA 1VE4A 1MXWA 4IY6A 1Y3NA 3FJGA 3USDA 3HV1A 1N84A 3G3FA 3Q25A 3O9PA 2YPNA 3FXUA 4KQPA 3SETA 1O64A 4DZ1A 4C1UA 4HCWA 3V8XB 2F97A 3MW0A 4RY1A 5L8DA 2V3QA 4QFKA 3QXMA 1L5TA 5HBCA 4U1ZA 3FVGA 3KOSA 4U2RA 3FATA 4JWYA 4KYDA 5AA4A 3QUFA 4AB6A 1MRPA 4E0WA 1NL5A 1TFAA 1PC3A 1D9YA 3RGYA 3MUQA 1ZBMA 1GVCA 4ZZAA 4ELPA 2Q2CA 1IXGA 1POTA 2H9BA 3TFLA 2OWSA 1LCTA 3O28A 1T0KA 3CSBA 4ZEFA 3KN3A 1LB8A 5KDTA 3H03A 4LONB 3MP8A 5H8FB 5JTYA 3OELA 1B2HA 4F3BA 1NNPA 5H8HB 5I59B 5J1DA 4THIA 2RINA 4WEPA 2GHBA 3I5OA 2UYEA 1MG1A 1QVSA 3O6GA 3UN6A 4OWDA 4PFUA 3SEYA 3KEIA 3PPPA 3TMGA 4PETA 1P1OA 2DWJA 3IOTA 3K00A 2ZMBA 3LSFB 1NNFA 3OXNA 4IB2A 4FJPA 1SW5A 3N6UA 4MBPA 1MY0A 1URDA 2W7YA 4YB7A 4YU0A 2PBWA 1MXYA 2OCUA 1XHYA 2XD2A 3E13X 1FQFA 1BKAA 4IO2A 4YAHX 3L6HA 4U1OA 3VDFA 2O1LA 3ILUB 3IOWA 4I9DA 2VD2A 3QUJA 4IO6A 1LGBC 1RYXA 2QS1A 3C31A 3FVKA 2NOOA 1FTKA 3BKIB 3FXRA 3RPWA 5JK4A 4KHZE 1QJMA 1UTBB 4ECFA 1MH3A 3CFLA 4R2FA 3G3IA 1NNKA 2HCAA 3EPEA 4KR5A 3PU5A 3VVFA 4KFQA 1PB8A 2D5WA 2Z8EA 5AA2B 5BWJA 3HPIA 2ZYKA 2I58A 4KD5A 3FASA 4BLAA 5I58B 4GL0A 2RF1A 1D4NA 1BIYA 1MXZA 4QSEA 5FHNA 1FQDA 5CBRA 1H44A 3SEUA 1NH7A 4BDMA 4TQUQ 3TCHA 1JVYA 3HHGA 3W15C 5TP9B 3GLBA 2ESNA 2NUVA 4F1YA 5EYFA 4RK2A 4Q30B 3H4ZA 4R9FA 1MQGA 3MZ1A 4OFOA 1Q35A 3V5AA 3K02A 1MM7A 1P1WA 1FQEA 3M3LA 3IL1B 4H5FA 4GOTA 1RYOA 2QS3A 5FHOA 2Q9TA 4HW8A 5TPAA 3SESA 4N07A 3O29A 3TTKA 5L9SA 3R6UA 1GTKA 2UVIA 4OHNA 1EZPA 1SW2A 1ATGA 4POWA 4LZ7A 4F18A 4G68C 3T96B 3A3CA 4I8CA 1JVXA 4ZECA 3OO8A 3ILTB 2XHDA 4H5GA 1R9QA 1MM6A 3GBBA 5CBSA 1ZU0A 3K0VA 3ECRA 3E3KA 1I69A 1OIBA 2V3TA 4QSCA 4PQJA 1D9VA 1I6QA 1TFDA 1M5CA 4FE8A 5A5XB 3CG3A 1XS5A 3L6GA 3CRBA 4X48A 1A54A 4G68A 1B4HA 4H8IA 4X1BA 5FTIA 1YPNA 5LOMA 4NF8B 1D3KA 4MF3A 1QW0A 2Y7IA 2XX7A 4TLLB 3MPKA 3H06B 4XKPA 1P1NA 1LBCA 2QPQA 5I84A 4OYVA 1FQBA 1GV8A 3EN3A 2QMWA 3R26A 2D3IA 1YTVA 3H6WA 2VGQA 2AL5A 4QHQA 3PD8A 2XXVA 4F2OA 3QSLA 2ONRA 4F2QA 3PMXA 2UVJA 1SQYA 4G8MA 3HCQA 4NMYA 3B6TA 4O3BA 3U1OA 4JBZA 3FIRA 4U21A 1OVBA 4Q0CA 4LZ5A 3K6UA 5TU0A 4GQOA 2ZNUA 1LFGA 3H3GA 4H67A 2HEUA 3KSXA 1JETA 2AL4A 3O6IA 3TTMA 2PX1A 2R9JA 2XX9A 4OMBA 3TYHA 3CFXA 4F1VA 1HSLA 3ONMA 4ZS9A 1LFHA 5H8FA 5H8QB 4BDLA 3C32A 2WKYA 5H8HA 1OQHA 5FHMA 4EF1A 5I59A 3SERA 1QKBA 3DP8A 1M5FA 4ZEKA 1AL3A 3Q29A 1PB7A 3C35A 1LAHE 1F9BA 4YB6A 1R1NA 2DQVA 3CVGA 5CMBA 2DVZA 3PPQA 4X1DA 4ESXA 2QL3A 4H6DA 4PFTA 4G8HA 3IOUA 1MQHA 3M3KA 3VV5A 4JSDA 1ANFA 1US4A 5ELVA 1O7TA 1TWYA 1TXFA 5F1QA 4LUBA 3DP4A 2QRYA 2CZLA 2Q88A 3LC8A 1TT1A 2H4IA 2Q2AA 1H43A 3QYTA 1MQDA 1Y20A 2O84X 3S9NC 3TUSA 1QULA 4G77A 1A8EA 3VVDA 4ZEDA 5CMKA 4BDNA 1H3DA 3T9VA 3C9HA 2O68A 4IGTA 1UTBA 4Z0IA 4FAJA 2NXOA 1EH3A 4NF4B 4DCXA 3O66A 4MFIA 2B65A 1AIVA 4DXUA 4EXKA 3U92A 3MZBA 2AIXA 2F35A 1SYHA 3ODBA 1PB9A 5HPQA 2UXAA 5AA2A 3O6HA 3TDJA 4RA1A 3FJ7A 5I58A 2QS2A 1IQ7A 1XC1A 1MQJA 3IX1A 2HXWA 4Q5TA 1N7XA 1BLFA 2RKMA 4GXAA 4BDQA 4F31B 2O6AA 3KSJA 4RK9A 2I4CA 5TP9A 3N26A 4KYSA 1MPCA 2DE4A 2OZZA 3OEKA 5H8NB 3MJNA 3EHUA 3PPOA 1B05A 1VSOA 1EZ9A 1GR2A 3SEXA 3Q28A 4R6HA 4ND9A 5EHSA 1Y1MA 1S9TA 4XKNA 1FTOA 3DP6A 4FEBA 1B1HA 4F3SA 4C1TA 4F19A 1II5A 4GLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AMF A;  4R9G A;  3ZKK A;  1N3W A;  3PUZ E;  4G8N A;  4PE5 B;  1FTM A;  4GL8 A;  4X9T A;  4OER A;  3VLW A;  2ZYM A;  2GHA A;  3LSW A;  3K6X A;  4Q8R A;  3PMV A;  4C0R A;  2FNC A;  4DCY A;  1B0L A;  3KBR A;  4YKJ A;  3HN0 A;  4HS7 A;  3MZ9 A;  5A5X A;  4P11 A;  3MPL A;  2PT1 A;  1B32 A;  1WVJ A;  1LBB A;  3TAJ A;  1NFT A;  1B9J A;  3KZG A;  1ZLQ A;  3FVO A;  4NF8 A;  1LCF A;  3DM0 A;  3RLF E;  3VE1 B;  3O2A A;  4F3G A;  3WAE A;  3KFM A;  4F29 A;  1XT8 A;  2RC9 A;  2HFB A;  4NE4 A;  1A8F A;  4Z7E A;  3V89 B;  3EQ1 A;  2VOZ A;  1P1Q A;  4EF2 A;  3KN8 A;  3U94 A;  4N6P A;  3TEP A;  3B7D A;  1LST A;  4LVQ A;  3IOR A;  2XXH A;  5BUU A;  3CG1 A;  2UYF A;  1EU8 A;  4LP2 B;  2GH9 A;  1B40 A;  2DS9 A;  1URG A;  2CMO A;  1DPE A;  5ITO A;  1NH8 A;  1ZJL A;  4TLM B;  2PYY A;  3OO6 A;  1NNT A;  2V25 A;  4R6Y A;  1LAX A;  2Z8D A;  2GFE A;  3T9X B;  2FYI A;  4DIG A;  1AOV A;  2GRV A;  4WKM A;  2ALU A;  4U4S A;  1B4Z A;  3JYR A;  3MVW A;  1IXH A;  1MY4 A;  3T9H B;  2OBG A;  3G7W A;  3HHF A;  5M2V A;  4AB5 A;  5H8Q A;  3PGF A;  3TEL A;  2XXI A;  1Y4T A;  1Z7M E;  5IKB A;  4OZ9 A;  4JSO A;  4KPT A;  2DWI A;  4FED A;  1HSE A;  4YB5 A;  4XXU A;  3Q26 A;  4NF6 B;  5B7D A;  4PFY A;  4U23 A;  2QS4 A;  4ONY A;  1M5D A;  3G3J A;  2HZK A;  4QRZ A;  3M8U A;  1OLC A;  3B6W A;  3K01 A;  1LLS A;  4I62 A;  1IUD A;  1ZIU A;  2Y7R A;  4RXL A;  3SEW A;  2E0S A;  1MY2 A;  2X26 A;  2X7P A;  3RY3 A;  5I56 B;  3I6V A;  2DYX A;  3VFJ A;  1A99 A;  3W9W A;  2O7I A;  2UVG A;  4MLV A;  3ZS6 A;  3FXQ A;  5ITP A;  4ZDM A;  4H8J A;  5H8S A;  3OD7 A;  4QFL A;  1MS7 A;  4YMB A;  1PEB A;  1Z7N E;  1P99 A;  2I3W A;  2P2A A;  3KGC A;  3PMW A;  5KZT A;  2I0B A;  4QSD A;  4POX A;  2DOJ A;  4HCY A;  2ZYN A;  1O63 A;  2VD3 A;  2Y84 A;  4FIM A;  2ANJ A;  1LAF E;  3RUM A;  2HQ0 A;  3VLU A;  1MY1 A;  4NF4 A;  4OVJ A;  2HAU A;  4GD5 A;  2REJ A;  1SD3 A;  4LQ2 A;  4ZE8 A;  4NF5 B;  2XXU A;  1UIU A;  3SDF A;  1B46 A;  2V3U A;  3OSR A;  2F8D A;  2DVC A;  4GRK A;  4ZEI A;  3IB2 A;  5FTH A;  1CB6 A;  3QAX A;  2DWH A;  2RCA A;  3RQT A;  2YLN A;  4JB7 A;  4OEU A;  2HZL A;  1M5B A;  3S9M C;  1XVX A;  1JEU A;  3CR9 A;  3H6T A;  3UK4 A;  1VR5 A;  3QIM A;  3S9E A;  3TTN A;  1USY H;  1N7W A;  2QMX A;  1LAG E;  3C33 A;  5B70 A;  5H8N A;  2AYS A;  3PUV E;  3ZKL A;  3UGW A;  2I49 A;  1JNF A;  1B5I A;  1MH4 A;  1HSJ A;  1P1U A;  4K3F A;  2G93 A;  3IK6 B;  3DEL B;  4NWC A;  2ZYO A;  3K6V A;  4U22 A;  3BFT A;  2M8C A;  3OEN A;  3HST A;  1SVX B;  1OMP A;  4XIG Q;  4TOZ A;  3MVZ A;  2F5X A;  2YJP A;  3R7X A;  5CMC A;  2O51 A;  3A09 A;  1A40 A;  1B7Z A;  1AH5 A;  4E0X A;  5ICQ A;  3TZA A;  1NMU A;  2OJT A;  1JW4 A;  1VFE A;  3U93 A;  5I2N B;  1IXC A;  1QUI A;  4XKQ A;  1A55 A;  1FTL A;  3MQ9 A;  3PPN A;  3S2V A;  1BP5 A;  2F78 A;  1DMB A;  5JEI A;  3C36 A;  5K2Y A;  4KYE A;  3RTW B;  1UTH A;  3KG2 A;  2Z22 A;  3IJX B;  4MH5 A;  2F36 A;  4O3A A;  1YAE A;  5DEX A;  3MVX A;  2PT2 A;  5DTB A;  3FD3 A;  4EQ7 A;  4DLD A;  2RC7 A;  4AQ4 A;  2O69 A;  3MBP A;  1SI1 A;  4YKP A;  1SDX A;  4ZEB A;  1DOT A;  4ZZE A;  4H65 A;  4WED A;  1MPB A;  4JWX A;  2HAV A;  1IIW A;  4OES A;  5CM6 A;  1MY3 A;  2P0S A;  1US5 A;  4IGR A;  3MP1 A;  3T93 B;  3H7M A;  4ISU A;  3A3U A;  3PV0 E;  2DXY A;  5ISU A;  4H0W A;  3T66 A;  1FQC A;  3EHS A;  4F1U A;  3MP6 A;  1MQI A;  2OWT A;  3CFZ A;  4OFL A;  2XXW A;  5HM4 B;  1B52 A;  5I57 B;  4NTL A;  1YCJ A;  4IO3 A;  1B3E A;  1B7H A;  4YMA A;  2Y7W A;  4O3C A;  1IXI A;  3IO6 A;  1UIV A;  3OOA A;  1Y9U A;  4R75 A;  3JZJ A;  2O1M A;  4RPN A;  3E4R A;  4WXJ A;  3T9U A;  3G3G A;  4NED A;  2IEE A;  1DTZ A;  2B3B A;  3CSG A;  4KCC A;  3OO7 A;  4IO4 A;  5I2K B;  4BDO A;  4ESW A;  2ONK E;  3K2D A;  4I1D A;  1WDN A;  2F7C A;  4H1X A;  3PD9 A;  2UVH A;  4NF6 A;  5L9O A;  4YZZ A;  4FOR A;  3RNN A;  1JW5 A;  3RT8 A;  4N13 A;  3V83 A;  1I6A A;  4P0I A;  3OSQ A;  4RNS A;  1EZO A;  3S9L C;  1MXV A;  5KCJ B;  1PBQ A;  3B6Q A;  3Q27 A;  1QUK A;  5I56 A;  2KLF A;  1N76 A;  1UTH B;  3MWB A;  1JQF A;  4R73 A;  5AA1 A;  4JXI A;  2B3F A;  1FW0 A;  2DE2 A;  1R6Z A;  5DEX B;  2DXR A;  2XXP A;  3LUY A;  2H5Y A;  3FGS A;  3D4G A;  3EHT A;  4G4P A;  2G29 A;  2XXR A;  3P7I A;  3MAM A;  3VLV A;  1Y3Q A;  4ELR A;  3H6V A;  2A5T B;  3U8Q A;  2R71 A;  4GF8 A;  3CI8 A;  3THI A;  4HTG A;  2O7U A;  4IY5 A;  3HO7 A;  1QUJ A;  2XXT A;  3JV9 A;  5CI5 A;  4OFJ A;  1Q1K A;  4XTC Q;  1S50 A;  3IO4 A;  4PFW A;  2P1S A;  3FUZ A;  3KOT A;  2LAO A;  5AA2 D;  4GFR A;  1B3H A;  1RKM A;  2I6E A;  2X7Q A;  5DVJ A;  2I0C A;  4YKI A;  4NF5 A;  2VHA A;  2I4B A;  3LSX A;  3D4C A;  1SW4 A;  2ZXT A;  3TTL A;  3VXB A;  4LQ5 A;  1Y1Z A;  2H99 A;  4GWO A;  1ELJ A;  3TCG A;  4F3P A;  1ZMG A;  2V84 A;  4R72 A;  3C34 A;  4U4X A;  1N3X A;  4R74 A;  3UIF A;  4R6K A;  3K1M A;  3F11 A;  3BFU A;  1OQG A;  5AA4 B;  1DSN A;  2ZNS A;  2XXX A;  4EQB A;  2D21 A;  1WOD A;  1MPD A;  1B0H A;  5DT6 A;  4EDP A;  4GIZ A;  2F6P A;  3IB0 A;  2XXQ A;  2XD3 A;  1ZTY A;  4LAT A;  4UAC A;  5F7V A;  3N5L A;  1B7U A;  1B6H A;  3LSL A;  3BBR A;  3ZSF A;  3AXF A;  4ZE9 A;  3OO9 A;  1KWH A;  2V93 A;  3WAF A;  3EF7 A;  4FAT A;  5KDT B;  5K2X A;  4LA9 A;  3KJ7 A;  5JTY B;  1JEV A;  1DPP A;  2BJJ X;  4KCD A;  1B3G A;  3IJO B;  1OLA A;  4LZ8 A;  5CRY A;  5EHM A;  3GBA A;  1N0T A;  2PMS A;  1S7Y A;  3DLN A;  3RTF B;  4DXC A;  3TPA A;  3TKD A;  2NWJ A;  4OTE A;  1URS A;  1QKA A;  4F22 A;  4RJZ A;  4RPO A;  5I2N A;  4IO5 A;  2F34 A;  1NKX A;  4XKR A;  5ICT A;  1SI0 A;  4L17 A;  1MXU A;  3IB1 A;  2QSX A;  1H76 A;  4R2B A;  4F39 A;  5CC2 A;  2Z8F A;  3IAZ A;  4OEN A;  2Q8J A;  4QFO A;  1USY E;  4UA8 A;  1A7L A;  2RC8 A;  4EUO A;  1IIT A;  4G2Z A;  1MDQ A;  3TQL A;  2PVU A;  1IZ1 A;  3PUY E;  1B5J A;  1FQA A;  4ELO A;  2THI A;  5CMM A;  3LBS A;  5DVF A;  4KI0 E;  1I6B A;  3KN7 A;  2E1S A;  3RT6 B;  3FZV A;  4QFP A;  3VVE A;  1H45 A;  3T22 A;  4OQO A;  4OEV A;  1SBP A;  2OLB A;  2IA4 A;  4DE8 A;  3N94 A;  1PBP A;  1B3L A;  4ELQ A;  1VFD A;  3FJM A;  2H25 A;  1OVT A;  3QK6 A;  1XVY A;  3PUX E;  3K1P A;  5I57 A;  1LB9 A;  3TQW A;  3FV1 A;  2DSF A;  4NWD A;  3UP9 A;  4M1V A;  1ZKB A;  1POY 1;  4QF9 A;  4GVO A;  3LR1 A;  4QFN A;  1R9L A;  4BDR A;  1JW1 A;  1Y4C A;  2I3V A;  2A5S A;  5DVI A;  1XOC A;  3C4M A;  3RN8 A;  3S4U A;  2FA7 A;  4EQ9 A;  3VXC A;  1SYI A;  4YKK A;  4M4G A;  5IAI A;  3GZG A;  3OMB A;  4RYA A;  2NVU B;  2Y7K A;  2DE3 A;  3K1N A;  3W9V A;  3PPR A;  2ABH A;  3H6U A;  3MVY A;  5I2K A;  1B5H A;  1Y3P A;  2Z23 A;  4PP0 A;  1PDA A;  3CIJ A;  3IR1 A;  1IEJ A;  3UA8 A;  3E9X A;  3O97 A;  4GXS B;  1GGG A;  2ZNT A;  3IOV A;  5TPA B;  1MDP 1;  2QJE A;  4OET A;  1B51 A;  3TCF A;  3G3H A;  3UOR A;  5DYH A;  4OXV A;  1FCK A;  3K6W A;  3G3K A;  3M3F A;  2REG A;  1B1X A;  3I3V A;  3KJT A;  5KCJ A;  2H98 A;  5AE4 A;  4P0G A;  3FVN A;  1B58 A;  2F7A A;  1M5E A;  1N04 A;  1CE2 A;  2RCB A;  3PUW E;  2DWA A;  1MXX A;  3K4U A;  2Q89 A;  1SW1 A;  4DXB A;  5AA3 A;  2XX8 A;  2OK2 A;  2R6G E;  3FV2 A;  3SKP A;  1BTJ A;  2VP1 A;  3SEV A;  3TTR A;  1FTJ A;  4JDF A;  2I48 A;  2XXY A;  1B3F A;  1J1N A;  2F6G A;  4MLQ A;  3TOD A;  2A5T A;  4G68 B;  4IO7 A;  3U72 A;  4JWO A;  4YIC A;  3N6T A;  3MC2 A;  5L9M A;  2DP8 A;  2ONS A;  2F7B A;  2Y7P A;  4DDD A;  4FEC A;  1UQW A;  3GXA A;  1DTG A;  1LFI A;  3OEM A;  4EXL A;  1VE4 A;  1MXW A;  4IY6 A;  1Y3N A;  3FJG A;  3USD A;  3HV1 A;  1N84 A;  3G3F A;  3Q25 A;  3O9P A;  2YPN A;  3FXU A;  4KQP A;  3SET A;  1O64 A;  4DZ1 A;  4C1U A;  4HCW A;  3V8X B;  2F97 A;  3MW0 A;  4RY1 A;  5L8D A;  2V3Q A;  4QFK A;  3QXM A;  1L5T A;  5HBC A;  4U1Z A;  3FVG A;  3KOS A;  4U2R A;  3FAT A;  4JWY A;  4KYD A;  5AA4 A;  3QUF A;  4AB6 A;  1MRP A;  4E0W A;  1NL5 A;  1TFA A;  1PC3 A;  1D9Y A;  3RGY A;  3MUQ A;  1ZBM A;  1GVC A;  4ZZA A;  4ELP A;  2Q2C A;  1IXG A;  1POT A;  2H9B A;  3TFL A;  2OWS A;  1LCT A;  3O28 A;  1T0K A;  3CSB A;  4ZEF A;  3KN3 A;  1LB8 A;  5KDT A;  3H03 A;  4LON B;  3MP8 A;  5H8F B;  5JTY A;  3OEL A;  1B2H A;  4F3B A;  1NNP A;  5H8H B;  5I59 B;  5J1D A;  4THI A;  2RIN A;  4WEP A;  2GHB A;  3I5O A;  2UYE A;  1MG1 A;  1QVS A;  3O6G A;  3UN6 A;  4OWD A;  4PFU A;  3SEY A;  3KEI A;  3PPP A;  3TMG A;  4PET A;  1P1O A;  2DWJ A;  3IOT A;  3K00 A;  2ZMB A;  3LSF B;  1NNF A;  3OXN A;  4IB2 A;  4FJP A;  1SW5 A;  3N6U A;  4MBP A;  1MY0 A;  1URD A;  2W7Y A;  4YB7 A;  4YU0 A;  2PBW A;  1MXY A;  2OCU A;  1XHY A;  2XD2 A;  3E13 X;  1FQF A;  1BKA A;  4IO2 A;  4YAH X;  3L6H A;  4U1O A;  3VDF A;  2O1L A;  3ILU B;  3IOW A;  4I9D A;  2VD2 A;  3QUJ A;  4IO6 A;  1LGB C;  1RYX A;  2QS1 A;  3C31 A;  3FVK A;  2NOO A;  1FTK A;  3BKI B;  3FXR A;  3RPW A;  5JK4 A;  4KHZ E;  1QJM A;  1UTB B;  4ECF A;  1MH3 A;  3CFL A;  4R2F A;  3G3I A;  1NNK A;  2HCA A;  3EPE A;  4KR5 A;  3PU5 A;  3VVF A;  4KFQ A;  1PB8 A;  2D5W A;  2Z8E A;  5AA2 B;  5BWJ A;  3HPI A;  2ZYK A;  2I58 A;  4KD5 A;  3FAS A;  4BLA A;  5I58 B;  4GL0 A;  2RF1 A;  1D4N A;  1BIY A;  1MXZ A;  4QSE A;  5FHN A;  1FQD A;  5CBR A;  1H44 A;  3SEU A;  1NH7 A;  4BDM A;  4TQU Q;  3TCH A;  1JVY A;  3HHG A;  3W15 C;  5TP9 B;  3GLB A;  2ESN A;  2NUV A;  4F1Y A;  5EYF A;  4RK2 A;  4Q30 B;  3H4Z A;  4R9F A;  1MQG A;  3MZ1 A;  4OFO A;  1Q35 A;  3V5A A;  3K02 A;  1MM7 A;  1P1W A;  1FQE A;  3M3L A;  3IL1 B;  4H5F A;  4GOT A;  1RYO A;  2QS3 A;  5FHO A;  2Q9T A;  4HW8 A;  5TPA A;  3SES A;  4N07 A;  3O29 A;  3TTK A;  5L9S A;  3R6U A;  1GTK A;  2UVI A;  4OHN A;  1EZP A;  1SW2 A;  1ATG A;  4POW A;  4LZ7 A;  4F18 A;  4G68 C;  3T96 B;  3A3C A;  4I8C A;  1JVX A;  4ZEC A;  3OO8 A;  3ILT B;  2XHD A;  4H5G A;  1R9Q A;  1MM6 A;  3GBB A;  5CBS A;  1ZU0 A;  3K0V A;  3ECR A;  3E3K A;  1I69 A;  1OIB A;  2V3T A;  4QSC A;  4PQJ A;  1D9V A;  1I6Q A;  1TFD A;  1M5C A;  4FE8 A;  5A5X B;  3CG3 A;  1XS5 A;  3L6G A;  3CRB A;  4X48 A;  1A54 A;  4G68 A;  1B4H A;  4H8I A;  4X1B A;  5FTI A;  1YPN A;  5LOM A;  4NF8 B;  1D3K A;  4MF3 A;  1QW0 A;  2Y7I A;  2XX7 A;  4TLL B;  3MPK A;  3H06 B;  4XKP A;  1P1N A;  1LBC A;  2QPQ A;  5I84 A;  4OYV A;  1FQB A;  1GV8 A;  3EN3 A;  2QMW A;  3R26 A;  2D3I A;  1YTV A;  3H6W A;  2VGQ A;  2AL5 A;  4QHQ A;  3PD8 A;  2XXV A;  4F2O A;  3QSL A;  2ONR A;  4F2Q A;  3PMX A;  2UVJ A;  1SQY A;  4G8M A;  3HCQ A;  4NMY A;  3B6T A;  4O3B A;  3U1O A;  4JBZ A;  3FIR A;  4U21 A;  1OVB A;  4Q0C A;  4LZ5 A;  3K6U A;  5TU0 A;  4GQO A;  2ZNU A;  1LFG A;  3H3G A;  4H67 A;  2HEU A;  3KSX A;  1JET A;  2AL4 A;  3O6I A;  3TTM A;  2PX1 A;  2R9J A;  2XX9 A;  4OMB A;  3TYH A;  3CFX A;  4F1V A;  1HSL A;  3ONM A;  4ZS9 A;  1LFH A;  5H8F A;  5H8Q B;  4BDL A;  3C32 A;  2WKY A;  5H8H A;  1OQH A;  5FHM A;  4EF1 A;  5I59 A;  3SER A;  1QKB A;  3DP8 A;  1M5F A;  4ZEK A;  1AL3 A;  3Q29 A;  1PB7 A;  3C35 A;  1LAH E;  1F9B A;  4YB6 A;  1R1N A;  2DQV A;  3CVG A;  5CMB A;  2DVZ A;  3PPQ A;  4X1D A;  4ESX A;  2QL3 A;  4H6D A;  4PFT A;  4G8H A;  3IOU A;  1MQH A;  3M3K A;  3VV5 A;  4JSD A;  1ANF A;  1US4 A;  5ELV A;  1O7T A;  1TWY A;  1TXF A;  5F1Q A;  4LUB A;  3DP4 A;  2QRY A;  2CZL A;  2Q88 A;  3LC8 A;  1TT1 A;  2H4I A;  2Q2A A;  1H43 A;  3QYT A;  1MQD A;  1Y20 A;  2O84 X;  3S9N C;  3TUS A;  1QUL A;  4G77 A;  1A8E A;  3VVD A;  4ZED A;  5CMK A;  4BDN A;  1H3D A;  3T9V A;  3C9H A;  2O68 A;  4IGT A;  1UTB A;  4Z0I A;  4FAJ A;  2NXO A;  1EH3 A;  4NF4 B;  4DCX A;  3O66 A;  4MFI A;  2B65 A;  1AIV A;  4DXU A;  4EXK A;  3U92 A;  3MZB A;  2AIX A;  2F35 A;  1SYH A;  3ODB A;  1PB9 A;  5HPQ A;  2UXA A;  5AA2 A;  3O6H A;  3TDJ A;  4RA1 A;  3FJ7 A;  5I58 A;  2QS2 A;  1IQ7 A;  1XC1 A;  1MQJ A;  3IX1 A;  2HXW A;  4Q5T A;  1N7X A;  1BLF A;  2RKM A;  4GXA A;  4BDQ A;  4F31 B;  2O6A A;  3KSJ A;  4RK9 A;  2I4C A;  5TP9 A;  3N26 A;  4KYS A;  1MPC A;  2DE4 A;  2OZZ A;  3OEK A;  5H8N B;  3MJN A;  3EHU A;  3PPO A;  1B05 A;  1VSO A;  1EZ9 A;  1GR2 A;  3SEX A;  3Q28 A;  4R6H A;  4ND9 A;  5EHS A;  1Y1M A;  1S9T A;  4XKN A;  1FTO A;  3DP6 A;  4FEB A;  1B1H A;  4F3S A;  4C1T A;  4F19 A;  1II5 A;  4GLI A; 
#chains in the Genus database with same CATH topology
 1AMF A;  4R9G A;  3ZKK A;  1N3W A;  3PUZ E;  2F3D A;  4G8N A;  5IZZ A;  3NOH A;  4PE5 B;  1FTM A;  4GL8 A;  4X9T A;  4OER A;  3VLW A;  2ZYM A;  2GHA A;  4FBP A;  1FPK A;  1EYK A;  3LSW A;  3K6X A;  4Q8R A;  3PMV A;  4C0R A;  2FNC A;  4DCY A;  1B0L A;  3KBR A;  4YKJ A;  3HN0 A;  4HS7 A;  3MZ9 A;  4PTK A;  5A5X A;  4P11 A;  3MPL A;  2PT1 A;  1B32 A;  1WVJ A;  1LBB A;  3TAJ A;  1NFT A;  1B9J A;  4JVD A;  3KZG A;  1ZLQ A;  3FVO A;  4NF8 A;  1LCF A;  3DM0 A;  4JVI A;  3RLF E;  3VE1 B;  3O2A A;  4F3G A;  3WAE A;  2XWK A;  3KFM A;  2CEY A;  4NAP A;  2PCR A;  4F29 A;  1XT8 A;  2RC9 A;  4HE1 A;  2HFB A;  4NE4 A;  1A8F A;  4Z7E A;  3V89 B;  3EQ1 A;  2VOZ A;  1P1Q A;  4EF2 A;  3KN8 A;  3U94 A;  4N6P A;  3TEP A;  3B7D A;  1LST A;  4LVQ A;  3IOR A;  2XXH A;  5BUU A;  1RDX A;  3CG1 A;  2UYF A;  1EU8 A;  4LP2 B;  5EQ7 A;  2GH9 A;  1B40 A;  2DS9 A;  1URG A;  2CMO A;  1DPE A;  4X04 A;  5ITO A;  1NH8 A;  1ZJL A;  4TLM B;  2PYY A;  5IZ3 B;  3OO6 A;  1NNT A;  2V25 A;  4R6Y A;  1LAX A;  2Z8D A;  2GFE A;  3T9X B;  2FYI A;  4DIG A;  1AOV A;  2GRV A;  4WKM A;  2ALU A;  3FXB A;  4U4S A;  1B4Z A;  3JYR A;  3MVW A;  1FJ9 A;  1IXH A;  1MY4 A;  3T9H B;  2OBG A;  3G7W A;  3HHF A;  5M2V A;  4AB5 A;  5LTC A;  5H8Q A;  3PGF A;  3TEL A;  2XXI A;  1Y4T A;  1Z7M E;  5IKB A;  4OZ9 A;  4JSO A;  4KPT A;  1FPB A;  2R8T A;  2KR0 A;  2DWI A;  4FED A;  1HSE A;  2QVR A;  1NV0 A;  4YB5 A;  4XXU A;  3Q26 A;  4NF6 B;  5B7D A;  4PFY A;  4U23 A;  2QS4 A;  4ONY A;  1M5D A;  3G3J A;  2HZK A;  1NV7 A;  4HE0 A;  4QRZ A;  3M8U A;  1OLC A;  1K9Z A;  3B6W A;  3K01 A;  1LLS A;  4I62 A;  1IUD A;  1ZIU A;  2Y7R A;  4RXL A;  3SEW A;  2E0S A;  1MY2 A;  2X26 A;  1SPI A;  2X7P A;  3RY3 A;  5I56 B;  3I6V A;  2DYX A;  3VFJ A;  1A99 A;  4O7M A;  3W9W A;  2O7I A;  2UVG A;  4MLV A;  3ZS6 A;  3FXQ A;  5ITP A;  4ZDM A;  1FJ6 A;  4H8J A;  5H8S A;  3OD7 A;  4QFL A;  1MS7 A;  4YMB A;  1PEB A;  1FPD A;  4OVP A;  2KQZ A;  1Z7N E;  1P99 A;  2I3W A;  2P2A A;  3KGC A;  3PMW A;  4PDD A;  5KZT A;  2I0B A;  4QSD A;  4POX A;  2DOJ A;  5IZ1 A;  4HCY A;  2ZYN A;  1O63 A;  2VD3 A;  4UAB A;  2Y84 A;  4FIM A;  2ANJ A;  1LAF E;  3RUM A;  2FVZ A;  2HQ0 A;  4N81 A;  3VLU A;  1MY1 A;  1LBW A;  4NF4 A;  4OVJ A;  3ISP A;  2HAU A;  4GD5 A;  2REJ A;  4N17 A;  1SD3 A;  4LQ2 A;  4ZE8 A;  4NF5 B;  4PC9 A;  5IM2 A;  2XXU A;  1UIU A;  3SDF A;  4GWW A;  1B46 A;  2V3U A;  3OSR A;  2F8D A;  2DVC A;  4GRK A;  4ZEI A;  3IB2 A;  5FTH A;  1CB6 A;  3QAX A;  2DWH A;  2RCA A;  3RQT A;  2YLN A;  4JB7 A;  4OEU A;  2HZL A;  1M5B A;  3S9M C;  1XVX A;  4NHB A;  1JEU A;  3CR9 A;  3H6T A;  4N91 A;  3UK4 A;  1VR5 A;  3QIM A;  3S9E A;  3TTN A;  3T1B A;  4P1L A;  1USY H;  1N7W A;  2QMX A;  1LAG E;  2QVU A;  3C33 A;  5B70 A;  5DW8 A;  5H8N A;  2AYS A;  3PUV E;  3ZKL A;  3UGW A;  4NGU A;  2I49 A;  1JNF A;  4PBQ A;  1K9Y A;  1B5I A;  1MH4 A;  1HSJ A;  2WX9 A;  4PF6 A;  1P1U A;  4PAI A;  1DK4 A;  4K3F A;  2G93 A;  3IK6 B;  3DEL B;  4NWC A;  4H46 A;  2ZYO A;  3K6V A;  4U22 A;  3BFT A;  2M8C A;  1NUX A;  3OEN A;  3HST A;  5LDZ A;  1SVX B;  1OMP A;  4XIG Q;  4TOZ A;  3MVZ A;  4P1E A;  2F5X A;  2YJP A;  3R7X A;  5CMC A;  2O51 A;  3A09 A;  1A40 A;  3RYD A;  1B7Z A;  1AH5 A;  4E0X A;  5ICQ A;  3TZA A;  1NMU A;  1RDZ A;  2OJT A;  1JW4 A;  1VFE A;  3U93 A;  4OVQ A;  5I2N B;  5ESY A;  4GWU A;  1IXC A;  1QUI A;  4XKQ A;  3RPL B;  1A55 A;  1FTL A;  3MQ9 A;  3PPN A;  3S2V A;  1BP5 A;  2F78 A;  1DMB A;  5JEI A;  3C36 A;  2CEX A;  5K2Y A;  1INP A;  4G61 A;  4KYE A;  3RTW B;  1UTH A;  3KG2 A;  4GWZ A;  2Z22 A;  4GBW A;  3IJX B;  4MH5 A;  2F36 A;  4O3A A;  1YAE A;  5DEX A;  3MVX A;  3T0J A;  2PT2 A;  5DTB A;  3FD3 A;  4EQ7 A;  4DLD A;  1BK4 A;  2RC7 A;  3MST A;  4AQ4 A;  2O69 A;  3MBP A;  1SI1 A;  4YKP A;  1SDX A;  4PE3 A;  2ZZW A;  3MYU A;  4O7I A;  4ZEB A;  2CZK A;  1DOT A;  4ZZE A;  4H65 A;  4WED A;  1MPB A;  4JWX A;  4PF8 A;  2HAV A;  1IIW A;  4OES A;  5CM6 A;  1MY3 A;  2P0S A;  1US5 A;  4IGR A;  3MP1 A;  3T93 B;  3H7M A;  4ISU A;  3A3U A;  1FPE A;  3PV0 E;  2DXY A;  5ISU A;  4H0W A;  3T66 A;  1FQC A;  3EHS A;  4F1U A;  3MP6 A;  4MHF A;  1MQI A;  2OWT A;  3CFZ A;  4OFL A;  4GX6 A;  2XXW A;  5HM4 B;  1B52 A;  4GX4 A;  5I57 B;  4NTL A;  1YCJ A;  1NV4 A;  4P47 A;  4IO3 A;  1B3E A;  1B7H A;  4YMA A;  2Y7W A;  4O3C A;  1IXI A;  3LUZ A;  3IO6 A;  1UIV A;  3OOA A;  1Y9U A;  2OX3 A;  5IZ3 A;  4R75 A;  3JZJ A;  2O1M A;  4RPN A;  3E4R A;  2Q8M A;  4WXJ A;  3T9U A;  3G3G A;  4NED A;  2IEE A;  1DTZ A;  2B3B A;  3CSG A;  2CZI A;  4KCC A;  3OO7 A;  4IO4 A;  5I2K B;  4BDO A;  4ESW A;  2ONK E;  3K2D A;  4I1D A;  1WDN A;  5F24 A;  2F7C A;  4H1X A;  1NUW A;  2Y5K A;  3PD9 A;  2UVH A;  4NQ8 A;  4NF6 A;  5L9O A;  4YZZ A;  4FOR A;  3RNN A;  1JW5 A;  3RT8 A;  4N13 A;  3V83 A;  1I6A A;  4P0I A;  3OSQ A;  4RNS A;  1EZO A;  3KC0 A;  4P56 A;  3S9L C;  1MXV A;  5KCJ B;  1PBQ A;  3B6Q A;  3Q27 A;  1QUK A;  5I56 A;  2KLF A;  1N76 A;  1UTH B;  3MWB A;  1JQF A;  4R73 A;  5AA1 A;  4JXI A;  2B3F A;  1FW0 A;  5ET5 A;  2DE2 A;  1R6Z A;  5DEX B;  2DXR A;  2XXP A;  3LUY A;  2FIX A;  2H5Y A;  3FGS A;  3D4G A;  3EHT A;  4G4P A;  2G29 A;  2XXR A;  3P7I A;  4MEV A;  1KZ8 A;  3MAM A;  2JJK A;  3VLV A;  1Y3Q A;  4ELR A;  3H6V A;  2A5T B;  3U8Q A;  2R71 A;  4GF8 A;  3CI8 A;  3THI A;  4HTG A;  2O7U A;  4IY5 A;  3HO7 A;  1QUJ A;  1CNQ A;  2XXT A;  3JV9 A;  2PFZ A;  5CI5 A;  4OFJ A;  2WEF A;  1Q1K A;  4XTC Q;  1S50 A;  3HFU A;  3IO4 A;  4PFW A;  2P1S A;  3FUZ A;  3KOT A;  2LAO A;  5AA2 D;  4GFR A;  1B3H A;  1RKM A;  2I6E A;  2X7Q A;  5DVJ A;  2I0C A;  4YKI A;  4OA4 A;  4NF5 A;  2VHA A;  2I4B A;  3LSX A;  3D4C A;  1SW4 A;  2ZXT A;  3TTL A;  3VXB A;  4LQ5 A;  1Y1Z A;  2H99 A;  4PAF A;  4GWO A;  1ELJ A;  3TCG A;  4F3P A;  1ZMG A;  3BIG A;  2V84 A;  4R72 A;  3C34 A;  4U4X A;  1N3X A;  4R74 A;  3UIF A;  4R6K A;  3K1M A;  3F11 A;  3BFU A;  1OQG A;  5AA4 B;  1DSN A;  2ZNS A;  2XXX A;  4EQB A;  2D21 A;  1WOD A;  1MPD A;  1B0H A;  5DT6 A;  4GIZ A;  4EDP A;  2F6P A;  3IB0 A;  2XXQ A;  2WYK A;  2XD3 A;  1ZTY A;  4LAT A;  4UAC A;  5F7V A;  3N5L A;  1B7U A;  3IFC A;  1B6H A;  2VPN A;  3LSL A;  3BBR A;  3ZSF A;  3AXF A;  4ZE9 A;  3OO9 A;  1KWH A;  2V93 A;  1FTA A;  3EF7 A;  3WAF A;  4FAT A;  5KDT B;  5K2X A;  1NI9 A;  4LA9 A;  3KJ7 A;  5JTY B;  1JEV A;  1DPP A;  2BJJ X;  4KCD A;  1B3G A;  4MCO A;  4XF5 A;  3IJO B;  1OLA A;  4LZ8 A;  5CRY A;  5EHM A;  3GBA A;  4NX1 A;  1N0T A;  2PMS A;  1S7Y A;  3DLN A;  3RTF B;  4DXC A;  2XWI A;  3TPA A;  4PFI A;  3TKD A;  2NWJ A;  4PAK A;  1URS A;  4OTE A;  1QKA A;  4F22 A;  4RJZ A;  4RPO A;  4O8M A;  5I2N A;  4IO5 A;  2WYP A;  2F34 A;  1NKX A;  4XKR A;  5ICT A;  3RPL A;  4GBV A;  1IME A;  1SI0 A;  1FPG A;  4L17 A;  1MXU A;  3IB1 A;  2QSX A;  1H76 A;  4PBH A;  4R2B A;  4F39 A;  5CC2 A;  2Z8F A;  3IAZ A;  4OEN A;  2Q8J A;  4QFO A;  1USY E;  5FBP A;  4UA8 A;  1RDY A;  1A7L A;  2RC8 A;  4EUO A;  1IIT A;  4G2Z A;  1YXI A;  1MDQ A;  3TQL A;  2PVU A;  3CHG A;  1IZ1 A;  3PUY E;  1B5J A;  1FQA A;  4ELO A;  2THI A;  5CMM A;  3LBS A;  4OAN A;  5DVF A;  4KI0 E;  1I6B A;  3KN7 A;  2E1S A;  3RT6 B;  3FZV A;  4QFP A;  4MIJ A;  3VVE A;  4MAG A;  1H45 A;  3T22 A;  4OQO A;  4OEV A;  1SBP A;  4X8R A;  2OLB A;  2IA4 A;  4DE8 A;  3N94 A;  1PBP A;  1B3L A;  4I40 A;  4ELQ A;  1VFD A;  3FJM A;  2H25 A;  1OVT A;  3QK6 A;  4N15 A;  1XVY A;  3PUX E;  3K1P A;  5I57 A;  1LB9 A;  3TQW A;  3FV1 A;  1LBX A;  2DSF A;  4PDH A;  4NWD A;  3UP9 A;  4M1V A;  1ZKB A;  1POY 1;  4QF9 A;  1G0I A;  4GVO A;  3LR1 A;  4QFN A;  1R9L A;  5EQ9 A;  4BDR A;  1JW1 A;  1Y4C A;  2I3V A;  2HPG A;  2A5S A;  5DVI A;  1XOC A;  3C4M A;  3RN8 A;  1YYZ A;  3S4U A;  2FA7 A;  4EQ9 A;  4P3L A;  3VXC A;  1FBE A;  4N6K A;  1SYI A;  4YKK A;  4M4G A;  5IAI A;  3GZG A;  3OMB A;  4RYA A;  2NVU B;  2Y7K A;  2DE3 A;  3K1N A;  2MKZ A;  3W9V A;  3PPR A;  4HXV A;  2ABH A;  3H6U A;  1KA0 A;  3MVY A;  1B5H A;  1Y3P A;  2XWO A;  5I2K A;  2Z23 A;  4PP0 A;  1PDA A;  3CIJ A;  4IR8 A;  3IR1 A;  1IEJ A;  3UA8 A;  3E9X A;  3O97 A;  4XEQ A;  4GXS B;  1FBC A;  1GGG A;  2ZNT A;  3IOV A;  5TPA B;  1MDP 1;  2QJE A;  4OET A;  3IFA A;  1B51 A;  4XFE A;  3TCF A;  3G3H A;  3UOR A;  1FBF A;  5DYH A;  4OXV A;  1FCK A;  3K6W A;  3G3K A;  3M3F A;  3QMF A;  5ET7 A;  3SZP A;  2REG A;  1FPF A;  1IMA A;  1B1X A;  3I3V A;  3KJT A;  5KCJ A;  2H98 A;  5AE4 A;  4P0G A;  3FVN A;  1B58 A;  4OVT A;  2F7A A;  1M5E A;  1N04 A;  5I5P A;  1CE2 A;  3ROJ A;  2RCB A;  3PUW E;  2DWA A;  1MXX A;  3K4U A;  2Q89 A;  1SW1 A;  4DXB A;  5AA3 A;  2XX8 A;  2OK2 A;  2R6G E;  3FV2 A;  3SKP A;  1BTJ A;  2VP1 A;  3SEV A;  3TTR A;  1FTJ A;  4JDF A;  1NV2 A;  2I48 A;  2XXY A;  1B3F A;  1J1N A;  2F6G A;  4DI3 D;  4MLQ A;  3TOD A;  2A5T A;  4G68 B;  3B50 A;  2OWZ A;  3EKI A;  4IO7 A;  1LBZ A;  3U72 A;  4JWO A;  4YIC A;  3N6T A;  3MC2 A;  5L9M A;  2DP8 A;  2ONS A;  2F7B A;  2Y7P A;  4DDD A;  4FEC A;  1UQW A;  3GXA A;  1DTG A;  1LFI A;  3OEM A;  4EXL A;  2VPO A;  1VE4 A;  1MXW A;  4IY6 A;  1Y3N A;  4I3E A;  3FJG A;  3USD A;  1EYJ A;  3HV1 A;  1N84 A;  3G3F A;  1QGX A;  3Q25 A;  3O9P A;  2YPN A;  3FXU A;  4KQP A;  3SET A;  1O64 A;  4DZ1 A;  2QVV A;  4C1U A;  4HCW A;  3V8X B;  2F97 A;  3MW0 A;  4RY1 A;  5L8D A;  2V3Q A;  4QFK A;  3QXM A;  1LBY A;  1L5T A;  4LN5 A;  5HBC A;  4U1Z A;  3FVG A;  3KOS A;  4U2R A;  4OVR A;  1EYI A;  3FAT A;  1NV1 A;  4JWY A;  4KYD A;  5AA4 A;  3QUF A;  4AB6 A;  1MRP A;  4E0W A;  1NL5 A;  1TFA A;  1PC3 A;  1D9Y A;  3RGY A;  3MUQ A;  1ZBM A;  3A29 A;  1GVC A;  4ZZA A;  4ELP A;  3KBZ A;  2Q2C A;  1IXG A;  1POT A;  4MMP A;  2H9B A;  3TFL A;  2OWS A;  1LCT A;  3O28 A;  1T0K A;  3CSB A;  4ZEF A;  3KN3 A;  1LB8 A;  5KDT A;  2GQ1 A;  1NV3 A;  3H03 A;  4LON B;  3MP8 A;  5H8F B;  5JTY A;  3OEL A;  1B2H A;  4F3B A;  1NNP A;  5H8H B;  5I59 B;  5J1D A;  4THI A;  1D9Q A;  2RIN A;  4WEP A;  2GHB A;  3I5O A;  2UYE A;  1MG1 A;  1KA1 A;  1QVS A;  3O6G A;  3UN6 A;  4OWD A;  4PFU A;  3SEY A;  3KEI A;  3PPP A;  3TMG A;  5J16 A;  4PET A;  1P1O A;  4QBA A;  2DWJ A;  3IOT A;  3K00 A;  2ZMB A;  3LSF B;  1NNF A;  3OXN A;  4IB2 A;  4FJP A;  1SW5 A;  3N6U A;  4MBP A;  1MY0 A;  1URD A;  2W7Y A;  4YB7 A;  4YU0 A;  2PBW A;  1MXY A;  2OCU A;  1XHY A;  2XD2 A;  3E13 X;  1FQF A;  1BKA A;  4IO2 A;  4YAH X;  3L6H A;  4U1O A;  3VDF A;  4KXP A;  2O1L A;  3ILU B;  3IOW A;  4I9D A;  2VD2 A;  3QUJ A;  4IO6 A;  1LGB C;  1RYX A;  4P9K A;  2QS1 A;  3C31 A;  3FVK A;  2NOO A;  1FTK A;  3BKI B;  3FXR A;  3RPW A;  5JK4 A;  4KHZ E;  1QJM A;  1UTB B;  3PTY A;  4ECF A;  1MH3 A;  3CFL A;  4R2F A;  3G3I A;  1FBH A;  3LV0 A;  4N4U A;  4PFR A;  1YZ0 A;  4H45 A;  1NNK A;  2PFY A;  2HCA A;  3GYY A;  3EPE A;  1FRP A;  4KR5 A;  1IMD A;  2FBP A;  3PU5 A;  3VVF A;  4KFQ A;  1PB8 A;  2D5W A;  2Z8E A;  5AA2 B;  5BWJ A;  3HPI A;  2ZYK A;  4PGP A;  3E78 A;  2I58 A;  4KD5 A;  3FAS A;  4BLA A;  5I58 B;  2Q74 A;  3U65 A;  4GL0 A;  2RF1 A;  1D4N A;  1BIY A;  1MXZ A;  4QSE A;  5FHN A;  1FQD A;  2ZZV A;  5CBR A;  1H44 A;  3SEU A;  1NH7 A;  4HE2 A;  4BDM A;  4TQU Q;  3TCH A;  1JVY A;  3KC1 A;  3HHG A;  3W15 C;  5TP9 B;  1DBZ A;  3GLB A;  2ESN A;  2NUV A;  4F1Y A;  5EYF A;  2XXK A;  4PFB A;  4RK2 A;  1FBP A;  4Q30 B;  3H4Z A;  4R9F A;  1MQG A;  3MZ1 A;  4OFO A;  1Q35 A;  3V5A A;  3K02 A;  2P3N A;  1MM7 A;  1P1W A;  1FQE A;  3M3L A;  3IL1 B;  4H5F A;  4GOT A;  1RYO A;  2QS3 A;  5FHO A;  2Q9T A;  4HW8 A;  4GWS A;  5TPA A;  4N6D A;  3SES A;  4N07 A;  3O29 A;  3TTK A;  5L9S A;  3R6U A;  1GTK A;  2UVI A;  4OHN A;  2FHY A;  1EZP A;  1SW2 A;  1ATG A;  4POW A;  4JVC A;  1NUZ A;  4LZ7 A;  4F18 A;  4G68 C;  3T96 B;  3A3C A;  1LBV A;  4I8C A;  1JVX A;  1VDW A;  4ZEC A;  3OO8 A;  3ILT B;  2XHD A;  4H5G A;  4N8G A;  1R9Q A;  1MM6 A;  3GBB A;  5CBS A;  1FPL A;  1ZU0 A;  1G0H A;  3K0V A;  3ECR A;  3E3K A;  1I69 A;  1OIB A;  2V3T A;  4QSC A;  4PQJ A;  1D9V A;  1I6Q A;  2V4C A;  1TFD A;  1M5C A;  4FE8 A;  2HHM A;  5A5X B;  3CG3 A;  1XS5 A;  3L6G A;  3CRB A;  4X48 A;  1A54 A;  4G68 A;  4MX6 A;  1B4H A;  1FBD A;  4H8I A;  4X1B A;  5FTI A;  1YPN A;  1NV6 A;  4GX3 A;  5LOM A;  5IGA A;  4NF8 B;  1D3K A;  4MF3 A;  1QW0 A;  2Y7I A;  2XX7 A;  4TLL B;  3MPK A;  4MJO A;  4N8Y A;  3H06 B;  4XKP A;  1P1N A;  4PCD A;  1LBC A;  2QPQ A;  4MNI A;  5I84 A;  4AS4 A;  4OYV A;  1FQB A;  1GV8 A;  3EN3 A;  2QMW A;  3R26 A;  2D3I A;  1YTV A;  3H6W A;  2VGQ A;  2AL5 A;  4QHQ A;  1NV5 A;  3PD8 A;  1NUY A;  2XXV A;  4F2O A;  3QSL A;  1FPI A;  1AWB A;  2ONR A;  2Y5L A;  4F2Q A;  2FIE A;  1IMC A;  3PMX A;  2UVJ A;  1SQY A;  4G8M A;  3HCQ A;  2VT5 A;  4NMY A;  4QXD A;  3B6T A;  4O3B A;  3U1O A;  4JBZ A;  3FIR A;  5T3J A;  4U21 A;  1OVB A;  4Q0C A;  4LZ5 A;  3K6U A;  4MNP A;  5ET8 A;  5TU0 A;  4GQO A;  2L5V A;  2B4L A;  2ZNU A;  1LFG A;  3H3G A;  4H67 A;  2HEU A;  3KSX A;  1JET A;  2AL4 A;  3O6I A;  3TTM A;  2PX1 A;  2R9J A;  2XX9 A;  4OMB A;  3TYH A;  3CFX A;  4DI4 B;  4OVS A;  4F1V A;  1HSL A;  3ONM A;  4ZS9 A;  1LFH A;  5H8F A;  5H8Q B;  4AS5 A;  4BDL A;  1IMB A;  5I7I A;  3C32 A;  2WKY A;  5H8H A;  1OQH A;  5FHM A;  4EF1 A;  5I59 A;  1LEV A;  3SER A;  1QKB A;  3DP8 A;  1M5F A;  4ZEK A;  1AL3 A;  3Q29 A;  1PB7 A;  3C35 A;  1LAH E;  1F9B A;  4YB6 A;  1R1N A;  2QFL A;  2DQV A;  3CVG A;  2WBB A;  5CMB A;  2DVZ A;  2F3B A;  3PPQ A;  4X1D A;  4ESX A;  5I3S A;  2QL3 A;  4H6D A;  2BJI A;  4PFT A;  4GWY A;  4G8H A;  3IOU A;  1MQH A;  3M3K A;  3VV5 A;  4JSD A;  3FBP A;  1ANF A;  1US4 A;  5ELV A;  1O7T A;  4MNC A;  1TWY A;  1TXF A;  5F1Q A;  2HXR A;  3BIH A;  4LUB A;  3DP4 A;  2QRY A;  2CZL A;  4NF0 A;  2Q88 A;  5EYG A;  3D1R A;  3LC8 A;  1TT1 A;  2H4I A;  4P8B A;  2Q2A A;  1H43 A;  3QYT A;  1MQD A;  1Y20 A;  5ET6 A;  2O84 X;  3S9N C;  3TUS A;  4NG7 A;  1QUL A;  4G77 A;  1A8E A;  1FSA A;  3VVD A;  4ZED A;  5CMK A;  4BDN A;  1H3D A;  3T9V A;  4GWX A;  2ZZX A;  3C9H A;  2O68 A;  4IGT A;  1UTB A;  4Z0I A;  1JP4 A;  4FAJ A;  2DDK A;  2NXO A;  1EH3 A;  4NF4 B;  1IMF A;  2WBD A;  3O66 A;  4DCX A;  4MFI A;  2B65 A;  2P3V A;  1AIV A;  4DXU A;  4EXK A;  5EQ8 A;  4O94 A;  2XWV A;  2XA5 A;  3U92 A;  3MZB A;  2AIX A;  2F35 A;  1SYH A;  3E79 A;  3ODB A;  1PB9 A;  5A5L A;  5HPQ A;  2UXA A;  5AA2 A;  3O6H A;  3TDJ A;  4RA1 A;  3FJ7 A;  5I58 A;  1FBG A;  2QS2 A;  1DCU A;  1IQ7 A;  1XC1 A;  1MQJ A;  3IX1 A;  1XI6 A;  2HXW A;  4Q5T A;  1N7X A;  1BLF A;  2RKM A;  4GXA A;  2B4M A;  1FPJ A;  4BDQ A;  3B8B A;  4F31 B;  2O6A A;  3KSJ A;  4RK9 A;  2I4C A;  5TP9 A;  3N26 A;  4KYS A;  1MPC A;  5EQA A;  2DE4 A;  2OZZ A;  3OEK A;  5H8N B;  3MJN A;  4I3Y A;  3EHU A;  3PPO A;  1B05 A;  1VSO A;  1EZ9 A;  1GR2 A;  1Q9D A;  3SEX A;  3Q28 A;  4R6H A;  4ND9 A;  5EHS A;  1Y1M A;  1S9T A;  5EYH A;  2CZH A;  4PGN A;  4XKN A;  1FTO A;  3DP6 A;  4FEB A;  1B1H A;  4F3S A;  4C1T A;  4F19 A;  1II5 A;  4GLI A;  4NN3 A; 
#chains in the Genus database with same CATH homology
 1AMF A;  4R9G A;  3ZKK A;  1N3W A;  3PUZ E;  4G8N A;  4PE5 B;  1FTM A;  4GL8 A;  4X9T A;  4OER A;  3VLW A;  2ZYM A;  2GHA A;  3LSW A;  3K6X A;  4Q8R A;  3PMV A;  4C0R A;  2FNC A;  4DCY A;  1B0L A;  3KBR A;  4YKJ A;  3HN0 A;  4HS7 A;  3MZ9 A;  5A5X A;  4P11 A;  3MPL A;  2PT1 A;  1B32 A;  1WVJ A;  1LBB A;  3TAJ A;  1NFT A;  1B9J A;  3KZG A;  1ZLQ A;  3FVO A;  4NF8 A;  1LCF A;  3DM0 A;  3RLF E;  3VE1 B;  3O2A A;  4F3G A;  3WAE A;  3KFM A;  4F29 A;  1XT8 A;  2RC9 A;  2HFB A;  4NE4 A;  1A8F A;  4Z7E A;  3V89 B;  3EQ1 A;  2VOZ A;  1P1Q A;  4EF2 A;  3KN8 A;  3U94 A;  4N6P A;  3TEP A;  3B7D A;  1LST A;  4LVQ A;  3IOR A;  2XXH A;  5BUU A;  3CG1 A;  2UYF A;  1EU8 A;  4LP2 B;  2GH9 A;  1B40 A;  2DS9 A;  1URG A;  2CMO A;  1DPE A;  5ITO A;  1NH8 A;  1ZJL A;  4TLM B;  2PYY A;  3OO6 A;  1NNT A;  2V25 A;  4R6Y A;  1LAX A;  2Z8D A;  2GFE A;  3T9X B;  2FYI A;  4DIG A;  1AOV A;  2GRV A;  4WKM A;  2ALU A;  4U4S A;  1B4Z A;  3JYR A;  3MVW A;  1IXH A;  1MY4 A;  3T9H B;  2OBG A;  3G7W A;  3HHF A;  5M2V A;  4AB5 A;  5H8Q A;  3PGF A;  3TEL A;  2XXI A;  1Y4T A;  1Z7M E;  5IKB A;  4OZ9 A;  4JSO A;  4KPT A;  2DWI A;  4FED A;  1HSE A;  4YB5 A;  4XXU A;  3Q26 A;  4NF6 B;  5B7D A;  4PFY A;  4U23 A;  2QS4 A;  4ONY A;  1M5D A;  3G3J A;  2HZK A;  4QRZ A;  3M8U A;  1OLC A;  3B6W A;  3K01 A;  1LLS A;  4I62 A;  1IUD A;  1ZIU A;  2Y7R A;  4RXL A;  3SEW A;  2E0S A;  1MY2 A;  2X26 A;  2X7P A;  3RY3 A;  5I56 B;  3I6V A;  2DYX A;  3VFJ A;  1A99 A;  3W9W A;  2O7I A;  2UVG A;  4MLV A;  3ZS6 A;  3FXQ A;  5ITP A;  4ZDM A;  4H8J A;  5H8S A;  3OD7 A;  4QFL A;  1MS7 A;  4YMB A;  1PEB A;  1Z7N E;  1P99 A;  2I3W A;  2P2A A;  3KGC A;  3PMW A;  5KZT A;  2I0B A;  4QSD A;  4POX A;  2DOJ A;  4HCY A;  2ZYN A;  1O63 A;  2VD3 A;  2Y84 A;  4FIM A;  2ANJ A;  1LAF E;  3RUM A;  2HQ0 A;  3VLU A;  1MY1 A;  4NF4 A;  4OVJ A;  2HAU A;  4GD5 A;  2REJ A;  1SD3 A;  4LQ2 A;  4ZE8 A;  4NF5 B;  2XXU A;  1UIU A;  3SDF A;  1B46 A;  2V3U A;  3OSR A;  2F8D A;  2DVC A;  4GRK A;  4ZEI A;  3IB2 A;  5FTH A;  1CB6 A;  3QAX A;  2DWH A;  2RCA A;  3RQT A;  2YLN A;  4JB7 A;  4OEU A;  2HZL A;  1M5B A;  3S9M C;  1XVX A;  1JEU A;  3CR9 A;  3H6T A;  3UK4 A;  1VR5 A;  3QIM A;  3S9E A;  3TTN A;  1USY H;  1N7W A;  2QMX A;  1LAG E;  3C33 A;  5B70 A;  5H8N A;  2AYS A;  3PUV E;  3ZKL A;  3UGW A;  2I49 A;  1JNF A;  1B5I A;  1MH4 A;  1HSJ A;  1P1U A;  4K3F A;  2G93 A;  3IK6 B;  3DEL B;  4NWC A;  2ZYO A;  3K6V A;  4U22 A;  3BFT A;  2M8C A;  3OEN A;  3HST A;  1SVX B;  1OMP A;  4XIG Q;  4TOZ A;  3MVZ A;  2F5X A;  2YJP A;  3R7X A;  5CMC A;  2O51 A;  3A09 A;  1A40 A;  1B7Z A;  1AH5 A;  4E0X A;  5ICQ A;  3TZA A;  1NMU A;  2OJT A;  1JW4 A;  1VFE A;  3U93 A;  5I2N B;  1IXC A;  1QUI A;  4XKQ A;  1A55 A;  1FTL A;  3MQ9 A;  3PPN A;  3S2V A;  1BP5 A;  2F78 A;  1DMB A;  5JEI A;  3C36 A;  5K2Y A;  4KYE A;  3RTW B;  1UTH A;  3KG2 A;  2Z22 A;  3IJX B;  4MH5 A;  2F36 A;  4O3A A;  1YAE A;  5DEX A;  3MVX A;  2PT2 A;  5DTB A;  3FD3 A;  4EQ7 A;  4DLD A;  2RC7 A;  4AQ4 A;  2O69 A;  3MBP A;  1SI1 A;  4YKP A;  1SDX A;  4ZEB A;  1DOT A;  4ZZE A;  4H65 A;  4WED A;  1MPB A;  4JWX A;  2HAV A;  1IIW A;  4OES A;  5CM6 A;  1MY3 A;  2P0S A;  1US5 A;  4IGR A;  3MP1 A;  3T93 B;  3H7M A;  4ISU A;  3A3U A;  3PV0 E;  2DXY A;  5ISU A;  4H0W A;  3T66 A;  1FQC A;  3EHS A;  4F1U A;  3MP6 A;  1MQI A;  2OWT A;  3CFZ A;  4OFL A;  2XXW A;  5HM4 B;  1B52 A;  5I57 B;  4NTL A;  1YCJ A;  4IO3 A;  1B3E A;  1B7H A;  4YMA A;  2Y7W A;  4O3C A;  1IXI A;  3IO6 A;  1UIV A;  3OOA A;  1Y9U A;  4R75 A;  3JZJ A;  2O1M A;  4RPN A;  3E4R A;  4WXJ A;  3T9U A;  3G3G A;  4NED A;  2IEE A;  1DTZ A;  2B3B A;  3CSG A;  4KCC A;  3OO7 A;  4IO4 A;  5I2K B;  4BDO A;  4ESW A;  2ONK E;  3K2D A;  4I1D A;  1WDN A;  2F7C A;  4H1X A;  3PD9 A;  2UVH A;  4NF6 A;  5L9O A;  4YZZ A;  4FOR A;  3RNN A;  1JW5 A;  3RT8 A;  4N13 A;  3V83 A;  1I6A A;  4P0I A;  3OSQ A;  4RNS A;  1EZO A;  3S9L C;  1MXV A;  5KCJ B;  1PBQ A;  3B6Q A;  3Q27 A;  1QUK A;  5I56 A;  2KLF A;  1N76 A;  1UTH B;  3MWB A;  1JQF A;  4R73 A;  5AA1 A;  4JXI A;  2B3F A;  1FW0 A;  2DE2 A;  1R6Z A;  5DEX B;  2DXR A;  2XXP A;  3LUY A;  2H5Y A;  3FGS A;  3D4G A;  3EHT A;  4G4P A;  2G29 A;  2XXR A;  3P7I A;  3MAM A;  3VLV A;  1Y3Q A;  4ELR A;  3H6V A;  2A5T B;  3U8Q A;  2R71 A;  4GF8 A;  3CI8 A;  3THI A;  4HTG A;  2O7U A;  4IY5 A;  3HO7 A;  1QUJ A;  2XXT A;  3JV9 A;  5CI5 A;  4OFJ A;  1Q1K A;  4XTC Q;  1S50 A;  3IO4 A;  4PFW A;  2P1S A;  3FUZ A;  3KOT A;  2LAO A;  5AA2 D;  4GFR A;  1B3H A;  1RKM A;  2I6E A;  2X7Q A;  5DVJ A;  2I0C A;  4YKI A;  4NF5 A;  2VHA A;  2I4B A;  3LSX A;  3D4C A;  1SW4 A;  2ZXT A;  3TTL A;  3VXB A;  4LQ5 A;  1Y1Z A;  2H99 A;  4GWO A;  1ELJ A;  3TCG A;  4F3P A;  1ZMG A;  2V84 A;  4R72 A;  3C34 A;  4U4X A;  1N3X A;  4R74 A;  3UIF A;  4R6K A;  3K1M A;  3F11 A;  3BFU A;  1OQG A;  5AA4 B;  1DSN A;  2ZNS A;  2XXX A;  4EQB A;  2D21 A;  1WOD A;  1MPD A;  1B0H A;  5DT6 A;  4EDP A;  4GIZ A;  2F6P A;  3IB0 A;  2XXQ A;  2XD3 A;  1ZTY A;  4LAT A;  4UAC A;  5F7V A;  3N5L A;  1B7U A;  1B6H A;  3LSL A;  3BBR A;  3ZSF A;  3AXF A;  4ZE9 A;  3OO9 A;  1KWH A;  2V93 A;  3WAF A;  3EF7 A;  4FAT A;  5KDT B;  5K2X A;  4LA9 A;  3KJ7 A;  5JTY B;  1JEV A;  1DPP A;  2BJJ X;  4KCD A;  1B3G A;  3IJO B;  1OLA A;  4LZ8 A;  5CRY A;  5EHM A;  3GBA A;  1N0T A;  2PMS A;  1S7Y A;  3DLN A;  3RTF B;  4DXC A;  3TPA A;  3TKD A;  2NWJ A;  4OTE A;  1URS A;  1QKA A;  4F22 A;  4RJZ A;  4RPO A;  5I2N A;  4IO5 A;  2F34 A;  1NKX A;  4XKR A;  5ICT A;  1SI0 A;  4L17 A;  1MXU A;  3IB1 A;  2QSX A;  1H76 A;  4R2B A;  4F39 A;  5CC2 A;  2Z8F A;  3IAZ A;  4OEN A;  2Q8J A;  4QFO A;  1USY E;  4UA8 A;  1A7L A;  2RC8 A;  4EUO A;  1IIT A;  4G2Z A;  1MDQ A;  3TQL A;  2PVU A;  1IZ1 A;  3PUY E;  1B5J A;  1FQA A;  4ELO A;  2THI A;  5CMM A;  3LBS A;  5DVF A;  4KI0 E;  1I6B A;  3KN7 A;  2E1S A;  3RT6 B;  3FZV A;  4QFP A;  3VVE A;  1H45 A;  3T22 A;  4OQO A;  4OEV A;  1SBP A;  2OLB A;  2IA4 A;  4DE8 A;  3N94 A;  1PBP A;  1B3L A;  4ELQ A;  1VFD A;  3FJM A;  2H25 A;  1OVT A;  3QK6 A;  1XVY A;  3PUX E;  3K1P A;  5I57 A;  1LB9 A;  3TQW A;  3FV1 A;  2DSF A;  4NWD A;  3UP9 A;  4M1V A;  1ZKB A;  1POY 1;  4QF9 A;  4GVO A;  3LR1 A;  4QFN A;  1R9L A;  4BDR A;  1JW1 A;  1Y4C A;  2I3V A;  2A5S A;  5DVI A;  1XOC A;  3C4M A;  3RN8 A;  3S4U A;  2FA7 A;  4EQ9 A;  3VXC A;  1SYI A;  4YKK A;  4M4G A;  5IAI A;  3GZG A;  3OMB A;  4RYA A;  2NVU B;  2Y7K A;  2DE3 A;  3K1N A;  3W9V A;  3PPR A;  2ABH A;  3H6U A;  3MVY A;  5I2K A;  1B5H A;  1Y3P A;  2Z23 A;  4PP0 A;  1PDA A;  3CIJ A;  3IR1 A;  1IEJ A;  3UA8 A;  3E9X A;  3O97 A;  4GXS B;  1GGG A;  2ZNT A;  3IOV A;  5TPA B;  1MDP 1;  2QJE A;  4OET A;  1B51 A;  3TCF A;  3G3H A;  3UOR A;  5DYH A;  4OXV A;  1FCK A;  3K6W A;  3G3K A;  3M3F A;  2REG A;  1B1X A;  3I3V A;  3KJT A;  5KCJ A;  2H98 A;  5AE4 A;  4P0G A;  3FVN A;  1B58 A;  2F7A A;  1M5E A;  1N04 A;  1CE2 A;  2RCB A;  3PUW E;  2DWA A;  1MXX A;  3K4U A;  2Q89 A;  1SW1 A;  4DXB A;  5AA3 A;  2XX8 A;  2OK2 A;  2R6G E;  3FV2 A;  3SKP A;  1BTJ A;  2VP1 A;  3SEV A;  3TTR A;  1FTJ A;  4JDF A;  2I48 A;  2XXY A;  1B3F A;  1J1N A;  2F6G A;  4MLQ A;  3TOD A;  2A5T A;  4G68 B;  4IO7 A;  3U72 A;  4JWO A;  4YIC A;  3N6T A;  3MC2 A;  5L9M A;  2DP8 A;  2ONS A;  2F7B A;  2Y7P A;  4DDD A;  4FEC A;  1UQW A;  3GXA A;  1DTG A;  1LFI A;  3OEM A;  4EXL A;  1VE4 A;  1MXW A;  4IY6 A;  1Y3N A;  3FJG A;  3USD A;  3HV1 A;  1N84 A;  3G3F A;  3Q25 A;  3O9P A;  2YPN A;  3FXU A;  4KQP A;  3SET A;  1O64 A;  4DZ1 A;  4C1U A;  4HCW A;  3V8X B;  2F97 A;  3MW0 A;  4RY1 A;  5L8D A;  2V3Q A;  4QFK A;  3QXM A;  1L5T A;  5HBC A;  4U1Z A;  3FVG A;  3KOS A;  4U2R A;  3FAT A;  4JWY A;  4KYD A;  5AA4 A;  3QUF A;  4AB6 A;  1MRP A;  4E0W A;  1NL5 A;  1TFA A;  1PC3 A;  1D9Y A;  3RGY A;  3MUQ A;  1ZBM A;  1GVC A;  4ZZA A;  4ELP A;  2Q2C A;  1IXG A;  1POT A;  2H9B A;  3TFL A;  2OWS A;  1LCT A;  3O28 A;  1T0K A;  3CSB A;  4ZEF A;  3KN3 A;  1LB8 A;  5KDT A;  3H03 A;  4LON B;  3MP8 A;  5H8F B;  5JTY A;  3OEL A;  1B2H A;  4F3B A;  1NNP A;  5H8H B;  5I59 B;  5J1D A;  4THI A;  2RIN A;  4WEP A;  2GHB A;  3I5O A;  2UYE A;  1MG1 A;  1QVS A;  3O6G A;  3UN6 A;  4OWD A;  4PFU A;  3SEY A;  3KEI A;  3PPP A;  3TMG A;  4PET A;  1P1O A;  2DWJ A;  3IOT A;  3K00 A;  2ZMB A;  3LSF B;  1NNF A;  3OXN A;  4IB2 A;  4FJP A;  1SW5 A;  3N6U A;  4MBP A;  1MY0 A;  1URD A;  2W7Y A;  4YB7 A;  4YU0 A;  2PBW A;  1MXY A;  2OCU A;  1XHY A;  2XD2 A;  3E13 X;  1FQF A;  1BKA A;  4IO2 A;  4YAH X;  3L6H A;  4U1O A;  3VDF A;  2O1L A;  3ILU B;  3IOW A;  4I9D A;  2VD2 A;  3QUJ A;  4IO6 A;  1LGB C;  1RYX A;  2QS1 A;  3C31 A;  3FVK A;  2NOO A;  1FTK A;  3BKI B;  3FXR A;  3RPW A;  5JK4 A;  4KHZ E;  1QJM A;  1UTB B;  4ECF A;  1MH3 A;  3CFL A;  4R2F A;  3G3I A;  1NNK A;  2HCA A;  3EPE A;  4KR5 A;  3PU5 A;  3VVF A;  4KFQ A;  1PB8 A;  2D5W A;  2Z8E A;  5AA2 B;  5BWJ A;  3HPI A;  2ZYK A;  2I58 A;  4KD5 A;  3FAS A;  4BLA A;  5I58 B;  4GL0 A;  2RF1 A;  1D4N A;  1BIY A;  1MXZ A;  4QSE A;  5FHN A;  1FQD A;  5CBR A;  1H44 A;  3SEU A;  1NH7 A;  4BDM A;  4TQU Q;  3TCH A;  1JVY A;  3HHG A;  3W15 C;  5TP9 B;  3GLB A;  2ESN A;  2NUV A;  4F1Y A;  5EYF A;  4RK2 A;  4Q30 B;  3H4Z A;  4R9F A;  1MQG A;  3MZ1 A;  4OFO A;  1Q35 A;  3V5A A;  3K02 A;  1MM7 A;  1P1W A;  1FQE A;  3M3L A;  3IL1 B;  4H5F A;  4GOT A;  1RYO A;  2QS3 A;  5FHO A;  2Q9T A;  4HW8 A;  5TPA A;  3SES A;  4N07 A;  3O29 A;  3TTK A;  5L9S A;  3R6U A;  1GTK A;  2UVI A;  4OHN A;  1EZP A;  1SW2 A;  1ATG A;  4POW A;  4LZ7 A;  4F18 A;  4G68 C;  3T96 B;  3A3C A;  4I8C A;  1JVX A;  4ZEC A;  3OO8 A;  3ILT B;  2XHD A;  4H5G A;  1R9Q A;  1MM6 A;  3GBB A;  5CBS A;  1ZU0 A;  3K0V A;  3ECR A;  3E3K A;  1I69 A;  1OIB A;  2V3T A;  4QSC A;  4PQJ A;  1D9V A;  1I6Q A;  1TFD A;  1M5C A;  4FE8 A;  5A5X B;  3CG3 A;  1XS5 A;  3L6G A;  3CRB A;  4X48 A;  1A54 A;  4G68 A;  1B4H A;  4H8I A;  4X1B A;  5FTI A;  1YPN A;  5LOM A;  4NF8 B;  1D3K A;  4MF3 A;  1QW0 A;  2Y7I A;  2XX7 A;  4TLL B;  3MPK A;  3H06 B;  4XKP A;  1P1N A;  1LBC A;  2QPQ A;  5I84 A;  4OYV A;  1FQB A;  1GV8 A;  3EN3 A;  2QMW A;  3R26 A;  2D3I A;  1YTV A;  3H6W A;  2VGQ A;  2AL5 A;  4QHQ A;  3PD8 A;  2XXV A;  4F2O A;  3QSL A;  2ONR A;  4F2Q A;  3PMX A;  2UVJ A;  1SQY A;  4G8M A;  3HCQ A;  4NMY A;  3B6T A;  4O3B A;  3U1O A;  4JBZ A;  3FIR A;  4U21 A;  1OVB A;  4Q0C A;  4LZ5 A;  3K6U A;  5TU0 A;  4GQO A;  2ZNU A;  1LFG A;  3H3G A;  4H67 A;  2HEU A;  3KSX A;  1JET A;  2AL4 A;  3O6I A;  3TTM A;  2PX1 A;  2R9J A;  2XX9 A;  4OMB A;  3TYH A;  3CFX A;  4F1V A;  1HSL A;  3ONM A;  4ZS9 A;  1LFH A;  5H8F A;  5H8Q B;  4BDL A;  3C32 A;  2WKY A;  5H8H A;  1OQH A;  5FHM A;  4EF1 A;  5I59 A;  3SER A;  1QKB A;  3DP8 A;  1M5F A;  4ZEK A;  1AL3 A;  3Q29 A;  1PB7 A;  3C35 A;  1LAH E;  1F9B A;  4YB6 A;  1R1N A;  2DQV A;  3CVG A;  5CMB A;  2DVZ A;  3PPQ A;  4X1D A;  4ESX A;  2QL3 A;  4H6D A;  4PFT A;  4G8H A;  3IOU A;  1MQH A;  3M3K A;  3VV5 A;  4JSD A;  1ANF A;  1US4 A;  5ELV A;  1O7T A;  1TWY A;  1TXF A;  5F1Q A;  4LUB A;  3DP4 A;  2QRY A;  2CZL A;  2Q88 A;  3LC8 A;  1TT1 A;  2H4I A;  2Q2A A;  1H43 A;  3QYT A;  1MQD A;  1Y20 A;  2O84 X;  3S9N C;  3TUS A;  1QUL A;  4G77 A;  1A8E A;  3VVD A;  4ZED A;  5CMK A;  4BDN A;  1H3D A;  3T9V A;  3C9H A;  2O68 A;  4IGT A;  1UTB A;  4Z0I A;  4FAJ A;  2NXO A;  1EH3 A;  4NF4 B;  4DCX A;  3O66 A;  4MFI A;  2B65 A;  1AIV A;  4DXU A;  4EXK A;  3U92 A;  3MZB A;  2AIX A;  2F35 A;  1SYH A;  3ODB A;  1PB9 A;  5HPQ A;  2UXA A;  5AA2 A;  3O6H A;  3TDJ A;  4RA1 A;  3FJ7 A;  5I58 A;  2QS2 A;  1IQ7 A;  1XC1 A;  1MQJ A;  3IX1 A;  2HXW A;  4Q5T A;  1N7X A;  1BLF A;  2RKM A;  4GXA A;  4BDQ A;  4F31 B;  2O6A A;  3KSJ A;  4RK9 A;  2I4C A;  5TP9 A;  3N26 A;  4KYS A;  1MPC A;  2DE4 A;  2OZZ A;  3OEK A;  5H8N B;  3MJN A;  3EHU A;  3PPO A;  1B05 A;  1VSO A;  1EZ9 A;  1GR2 A;  3SEX A;  3Q28 A;  4R6H A;  4ND9 A;  5EHS A;  1Y1M A;  1S9T A;  4XKN A;  1FTO A;  3DP6 A;  4FEB A;  1B1H A;  4F3S A;  4C1T A;  4F19 A;  1II5 A;  4GLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...