2ZZWA

Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
330
structure length
330
Chain Sequence
RRYRWRIQTAWDAGTVGYSLFQKFTERVKELTDGQLEVQPFPAGAVVGTFDMFDAVKTGVLDGMNPFTLYWAGRMPVTAFLSSYALGLDRPDQWETWFYSLGGLDIARRAFAEQGLFYVGPVQHDLNIIHSKKPIRRFEDFKGVKLRVPGGMIAEVFAAAGASTVLLPGGEVYPALERGVIDAADFVGPAVNYNLGFHQVAKYIIMGPPETPAIHQPVDLMDFTINLNRWRSLPKPLQERFIAAVHEYSWIHYAGIQKANLEAWPKYRQAGVEVIRLSNEDVRKFRRLAIPIWFKWAKMDKYSREAFASQLEYMKGIGYVTDEELKGLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter, solute-binding protein
publication title Crystal structure of a periplasmic substrate-binding protein in complex with calcium lactate
pubmed doi rcsb
source organism Thermus thermophilus
total genus 130
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2zzwA00
4OVSA 4O8MA 4PDHA 2XXKA 4MX6A 4NGUA 4DI3D 3B50A 2CEYA 4P47A 4P8BA 4N91A 4N8YA 4MMPA 4N15A 4NQ8A 5IGAA 5I5PA 3GYYA 4NG7A 4XFEA 2ZZVA 4MNPA 2XWIA 4P56A 4O94A 4OVPA 4OANA 2PFZA 2V4CA 4N6KA 5IZZA 4MCOA 4PGNA 4PAFA 4NAPA 3FXBA 4N4UA 4PF6A 2XWVA 4NX1A 3U65A 4OVTA 4PCDA 5LTCA 4N17A 2WYPA 4NHBA 4P3LA 4PAIA 4NF0A 4MAGA 2HZKA 4P1LA 4OVQA 4PE3A 5CM6A 4N6DA 4XEQA 4OVRA 4PGPA 2HZLA 5I7IA 4PBQA 4PAKA 4N8GA 4UABA 4PF8A 4P1EA 4PFRA 4DI4B 2HPGA 4PFBA 4X04A 4X8RA 2ZZXA 2CEXA 4YICA 4PDDA 2XWOA 4XF5A 2PFYA 4PETA 2XWKA 4MEVA 4MIJA 4OA4A 2VPOA 4PFIA 4P9KA 2WYKA 4PBHA 2ZZWA 4MHFA 4NN3A 4PC9A 4O7MA 4MNIA 4LN5A 4MNCA 4YZZA 5IM2A 2XA5A 2VPNA 2WX9A
chains in the Genus database with same CATH superfamily
3ISPA 1B3HA 3TQWA 3E13X 1Y4TA 4O8MA 3S9NC 3K02A 4RA1A 1MM7A 4E0XA 3SEUA 4AB6A 2G93A 3PPPA 1MM6A 4R2FA 1LFIA 5BUUA 1NUYA 4IB2A 3LC8A 3N94A 4XKNA 3K1NA 4PF6A 2RF1A 4PCDA 1FPEA 1S9TA 5K2XA 2WYPA 2Q2AA 5CMCA 3N6TA 1G0IA 1POTA 1RDZA 1LAXA 3SEXA 2QVVA 1ANFA 1YAEA 2I0BA 1EYIA 3K6VA 1JW5A 5ITOA 2PYYA 3UP9A 2XX7A 2XXHA 4PF8A 2R6GE 5CMMA 3TPAA 1IXIA 5I2KA 4Q0CA 4NF6A 2V3TA 3W9WA 2QS3A 3LUYA 4GVOA 3OEMA 1N3WA 3OELA 2NOOA 4PETA 4KYDA 5FTIA 1NH8A 2RC7A 4ZDMA 3B6WA 1US4A 2QSXA 5TPAA 1PC3A 3VLVA 1FTJA 3MW0A 3I5OA 4LUBA 1IMAA 2L5VA 1M5BA 3K0VA 4MBPA 5J16A 4H5GA 4HXVA 2E1SA 3BIHA 1FBHA 1FJ6A 3EF7A 3BIGA 2UVGA 1FCKA 3RQTA 4MX6A 4DI3D 3SERA 4G68C 4GX6A 1DTZA 4LQ5A 5LDZA 4F19A 3EHSA 5H8SA 3O66A 2I0CA 1N76A 5IAIA 3IX1A 3U72A 5IZZA 3MZBA 3SEYA 2XXRA 5BWJA 2G29A 1MH4A 4HE1A 3RYDA 1H3DA 5I58A 4HE0A 1YCJA 4QFPA 4C1TA 3HV1A 5EYHA 2GH9A 4F29A 1MXYA 1LB8A 1P1QA 2DXRA 4PE3A 3FJMA 3ILUB 4N6DA 1Q9DA 1FRPA 3OO6A 5H8HA 4PBQA 3K4UA 4NF4B 3S9EA 1MQGA 4RXLA 4JB7A 2AL4A 1LAHE 1OVTA 2DE3A 2DWHA 3PUZE 5EHMA 4ESWA 2O6AA 2X26A 4XKQA 3TYHA 2F34A 2NUVA 4YB7A 3ZS6A 3U8QA 3MVWA 5EQAA 1IMBA 4MFIA 1USYH 3TTRA 1MQJA 3GLBA 3R7XA 2ZZWA 3KC1A 2QFLA 2Y7IA 4FJPA 3PPNA 3FV1A 3G3GA 3MP8A 1BTJA 4EXKA 5DEXB 4P8BA 1JEVA 3SESA 4ZE8A 1LEVA 4JWYA 3TTNA 2B4MA 1M5DA 3IO6A 4YMAA 2ZNSA 3IB2A 1Y3NA 1RDXA 3TZAA 3K01A 4R74A 3L6GA 4GX3A 5HPQA 4GRKA 3TQLA 3I6VA 2A5TA 5AE4A 2XWVA 4YU0A 4NE4A 1FBGA 3LUZA 4DXBA 4E0WA 1NV1A 3ZSFA 4MAGA 2ONRA 2VGQA 3R6UA 1NNPA 1FPIA 2F3BA 3U1OA 2WKYA 2CZHA 1GVCA 5ET6A 4OEVA 1BK4A 5TP9B 4I3EA 1US5A 3E79A 1PBQA 2H9BA 4UABA 1DSNA 3D1RA 4GXSB 3C32A 3TFLA 2O84X 4KFQA 2ZYNA 2FIEA 1FPFA 3LBSA 2F7CA 1IXGA 1URDA 2AYSA 1Y4CA 2XWKA 1SQYA 3GXAA 4YKJA 4KYEA 4F1VA 4JVIA 3ZKLA 4ZECA 1H43A 4H1XA 1TXFA 4OFLA 4YB6A 2YLNA 4FORA 5LOMA 2DQVA 2DE2A 4U4XA 3SEWA 2QMWA 2XXYA 4U2RA 1LBXA 3VXBA 5KDTA 3UA8A 3H6VA 1JEUA 1RYOA 4NF5A 1FPLA 4NWCA 3O6HA 4NG7A 4YKKA 1IITA 2LAOA 1ZU0A 4RJZA 4LATA 4X48A 2Q88A 4KQPA 1JW4A 3CFZA 3HO7A 1AIVA 2HXWA 3PPRA 2P3VA 5LTCA 2I3VA 3G3HA 2ONSA 4N07A 2F6PA 1B40A 1P1UA 2DXYA 4P0GA 1BIYA 2DWAA 2DVCA 1SD3A 2QVRA 1B0LA 5A5XA 4K3FA 4LZ7A 4JVCA 1NNKA 5L8DA 1NH7A 4PAKA 4H65A 3TEPA 1D9YA 1YXIA 1NMUA 3DELB 5AA2B 5M2VA 5ELVA 3HPIA 5FHOA 1TWYA 1B9JA 1YYZA 3UIFA 1ELJA 1EZ9A 4F22A 2GFEA 3RT8A 2KQZA 3KN3A 1OVBA 2OZZA 1NUWA 2XD3A 2DVZA 1O64A 3E9XA 3TELA 1Q1KA 1ZTYA 3C4MA 4Z7EA 1QKAA 5ET5A 2HCAA 3CR9A 3T1BA 3IO4A 2Y5LA 3S9LC 3OSRA 1B4ZA 2FA7A 3SETA 4ZZAA 5I59B 1XT8A 4JSDA 2QRYA 4EF2A 2CEYA 1QW0A 3C34A 4U23A 4ELOA 1FPKA 1XI6A 4PFTA 3OOAA 3GYYA 5KCJA 4MNPA 3B6QA 2V4CA 3KG2A 4MCOA 1FBDA 5CMBA 4QFNA 4UA8A 3GZGA 1PB9A 4JSOA 4LQ2A 1GR2A 3OO8A 3Q29A 2RINA 1URGA 4IY6A 2UYEA 3HCQA 4FBPA 2RC8A 1N3XA 3FD3A 1B5JA 2F36A 3RY3A 4GWSA 4WEDA 1OIBA 3TMGA 3O28A 3ROJA 4DCYA 1R1NA 2GHBA 3K1MA 1EYKA 4PFRA 4QFOA 1QVSA 1T0KA 5AA2D 1N0TA 3MAMA 4TQUQ 2MKZA 4PP0A 1QKBA 4THIA 1FBPA 1SDXA 3FVNA 1WDNA 3RPLA 2E0SA 2DS9A 1AH5A 5H8FA 4R2BA 1FPJA 2QJEA 3MP6A 4GWUA 5L9MA 1Y1MA 5F1QA 3Q26A 4IR8A 4OFOA 4IO4A 4IO2A 1MY4A 3CFXA 2VPNA 1FQCA 4OZ9A 4N13A 1N7XA 5I2NB 4GBVA 4GFRA 3HHFA 2WEFA 4X9TA 3Q27A 4G2ZA 4X1DA 4OWDA 1CE2A 1M5CA 3FIRA 1TFAA 3IJOB 3RTWB 2PFZA 2PMSA 4ELRA 4KYSA 3VE1B 2BJJX 4H67A 4NEDA 3VV5A 3WAEA 3O9PA 4Z0IA 3N5LA 1MPCA 3NOHA 1B32A 1A8FA 4DIGA 5AA4B 2FIXA 4P3LA 3BBRA 1UQWA 3E3KA 3FZVA 1XVXA 2Y84A 1JVXA 2XXPA 4H5FA 1MPDA 1IUDA 4EQBA 1A54A 3E78A 5I57B 1EZOA 3K1PA 2XX9A 1XC1A 5IZ3A 5JTYB 1FTAA 3C33A 3IAZA 2A5SA 3FJ7A 4ZE9A 4O3BA 4L17A 2BJIA 1ZMGA 1FBCA 4QBAA 4OERA 1FQAA 5B70A 1TT1A 4PFYA 1IMEA 3LR1A 3TCFA 4MIJA 1RYXA 3QIMA 3S9MC 3M8UA 1SW1A 1QGXA 1FQBA 3PTYA 2OWTA 1H45A 3MZ9A 2XA5A 4BDMA 3DP8A 4XKRA 1JQFA 4NF8B 3MWBA 5L9SA 2WBBA 4YB5A 1EZPA 1SW4A 2Y7PA 1D4NA 1AL3A 4FE8A 4PE5B 3HHGA 2R9JA 5I56B 4HW8A 2XXXA 5I5PA 4XFEA 4NF6B 4OESA 3HSTA 4BLAA 3I3VA 1Z7ME 3C9HA 3IB0A 5CMKA 4DE8A 3RPWA 4R73A 1LB9A 1LBYA 4PGNA 5I3SA 2F35A 2W7YA 4OVTA 3FATA 1LSTA 5T3JA 4POXA 4LP2B 3RLFE 5DVFA 3TTKA 1R6ZA 5HBCA 2Y7WA 2PVUA 1MY1A 4NMYA 5CM6A 1EYJA 4O3CA 4IO5A 1KA1A 2QS1A 3FXRA 5H8NA 3PV0E 3A09A 1N04A 4GWYA 1KWHA 3DP6A 4MH5A 1NL5A 2FVZA 4G8HA 5L9OA 2VHAA 2THIA 4P1EA 3Q25A 4X8RA 2VD3A 1LCFA 1LBZA 1FQDA 1MXXA 2XXIA 3CIJA 1GV8A 1MQIA 2RC9A 2NVUB 4QFKA 2JJKA 4DZ1A 4XKPA 3QMFA 2D3IA 1D9QA 1KA0A 4NF4A 3IOTA 1NUZA 2DDKA 3VVEA 1NV0A 3KGCA 3EN3A 1VSOA 4NN3A 3KBRA 4DLDA 4POWA 2RCBA 5H8HB 3G3IA 4YKIA 4YMBA 1FPDA 3W15C 4C1UA 4GWXA 5IKBA 2YJPA 1FPBA 4OYVA 2VP1A 4EQ9A 4PFWA 4N6KA 5H8QB 4QSCA 1QJMA 3IJXB 5AA3A 3RTFB 2P2AA 3G3JA 5EYFA 4QSDA 4TLLB 1B6HA 4KHZE 4N4UA 3QSLA 1ZIUA 1FTMA 2Q9TA 3IR1A 4O7IA 4BDOA 3MVXA 3UK4A 1B51A 2XXUA 1OLAA 1UIVA 3VVDA 3VVFA 1AWBA 1M5FA 2X7QA 4QHQA 1IXHA 1A99A 2F7AA 4Q5TA 4KCDA 2V93A 4UACA 2X7PA 1I69A 3PUYE 2VOZA 2AIXA 2PCRA 4F39A 2UVHA 3T9VA 5DTBA 3FGSA 2Z23A 1Y20A 3LV0A 5I84A 4EF1A 2Q89A 3PMXA 3CI8A 2F6GA 4G8MA 1B3GA 4PDDA 4LA9A 2A5TB 2OK2A 1DMBA 1ZBMA 4ZZEA 5DVIA 4QXDA 3KOTA 2V3QA 2B65A 4GWOA 1MXZA 2VPOA 4LZ5A 1VDWA 4ELQA 3FVGA 4P9KA 2P1SA 2XXQA 3DLNA 2I4CA 3B7DA 5TU0A 1K9ZA 2XX8A 4YZZA 2HAUA 1IMCA 4KXPA 3CSBA 5DT6A 4PDHA 4NGUA 1IXCA 4F31B 3FXUA 4ND9A 3FUZA 3ILTB 1ATGA 3KOSA 3CVGA 4N81A 4OVPA 2UVJA 3FVOA 4F3SA 3MPKA 1NV4A 5B7DA 2R8TA 1NUXA 3O6GA 4MF3A 4NAPA 1N7WA 2V3UA 4EQ7A 3QYTA 4H8JA 3FXQA 1IZ1A 5ET7A 4F2OA 1HSJA 2PT2A 4XIGQ 3IOWA 1ZKBA 5EQ8A 3IFCA 3THIA 5DYHA 1NV7A 4P1LA 4I62A 3BKIB 1CNQA 1Y3PA 2D5WA 5EQ7A 1BLFA 1JVYA 3K6WA 5KDTB 2D21A 1SW5A 4OTEA 4LZ8A 2Z8FA 2I49A 1B7UA 2GHAA 2DOJA 4PFUA 2H5YA 4AB5A 4Q30B 2O69A 4WXJA 3PUWE 1R9QA 1A55A 2HHMA 3OXNA 1P1NA 1IQ7A 4EUOA 4HTGA 4XF5A 2PFYA 3TCGA 1OLCA 1UTHB 3KFMA 1FTOA 1H44A 3M3LA 4GL0A 4R9GA 1B5HA 1S50A 2H25A 2P0SA 1M5EA 2H99A 3KSJA 4MLVA 4O7MA 4F3GA 1B3FA 4OVSA 2O1LA 4JVDA 3TDJA 4TOZA 3H6UA 3KZGA 5FHNA 4G8NA 4KD5A 2DSFA 4MMPA 5IGAA 3TCHA 2Z22A 5A5LA 4G68A 4H45A 1D9VA 2VT5A 2WBDA 4P0IA 1DBZA 5I59A 1UTBB 2ZYOA 1TFDA 1ZJLA 4NX1A 2FBPA 1NV5A 2F97A 3CRBA 4ONYA 1QUKA 1NI9A 3IK6B 4NF0A 3ODBA 1VFDA 4ELPA 4ECFA 3FV2A 1DPPA 2XD2A 3K2DA 2Q74A 4QRZA 3C35A 1ZLQA 4FEBA 1SYIA 2HZLA 3MVYA 4KI0E 3ECRA 4N8GA 4H8IA 2I3WA 5KCJB 3FVKA 3CHGA 4PFBA 1P1OA 4F2QA 2CZKA 4OHNA 1FPGA 2V25A 4AS4A 4ZS9A 1QUJA 1OQHA 3FJGA 4R6KA 3G7WA 4RNSA 3IOUA 1PB7A 1WVJA 3QUFA 4HE2A 3KBZA 4GBWA 2CZLA 1LCTA 3SZPA 2FYIA 5ESYA 4M1VA 3O2AA 1NKXA 1SYHA 3TODA 1IEJA 3K6XA 3D4CA 1YZ0A 2ABHA 3HN0A 3SEVA 1OMPA 2OBGA 2Z8EA 4OQOA 2XXVA 3IL1B 4KCCA 4OANA 4DXUA 2B4LA 5JK4A 3TKDA 3OSQA 4ESXA 3T66A 3T22A 1LAGE 4OMBA 1FTLA 3QXMA 4O3AA 4EXLA 4GOTA 1AMFA 3G3FA 4U1ZA 1FJ9A 1D3KA 3JV9A 3TTMA 4U1OA 1BP5A 3CG3A 3OO7A 4KR5A 2OJTA 1VR5A 4XEQA 1RKMA 1FQEA 5FBPA 1DK4A 3H7MA 2QVUA 3O97A 1B58A 3VFJA 5AA4A 3IB1A 4DI4B 1B46A 4ISUA 2M8CA 2Z8DA 1MG1A 5I57A 5DW8A 3A3UA 1MXVA 3V8XB 2PT1A 4GWWA 5JTYA 4OA4A 3PU5A 3MUQA 3SDFA 1B1HA 1NNFA 3KSXA 4ZEFA 3IORA 3EHUA 2OWZA 4RY1A 4FAJA 4PBHA 4GWZA 4F3BA 3C31A 2PBWA 4LN5A 1LBBA 4I1DA 1POY1 3KC0A 2HXRA 3RNNA 1B05A 1EH3A 3PPQA 1H76A 4GXAA 3T0JA 1B52A 2OCUA 5IZ3B 1IMDA 4H46A 3U94A 4BDRA 2UYFA 4N8YA 2GQ1A 1P1WA 3OD7A 3EQ1A 2ALUA 2ZZVA 1B7HA 4WKMA 2GRVA 2NXOA 4HS7A 4NF8A 3P7IA 4R6HA 5CBSA 1MH3A 1FBFA 3E4RA 3UORA 1DPEA 3H03A 5I56A 1J1NA 1B4HA 3A3CA 1F9BA 5I2KB 2ESNA 2DE4A 3M3KA 1LGBC 2FHYA 2RCAA 2H98A 1MXWA 4QFLA 5IZ1A 1A40A 3L6HA 2HFBA 3C36A 5I7IA 2NWJA 5TPAB 1LLSA 4MJOA 3M3FA 2Y5KA 1FTKA 3RN8A 4FATA 2IA4A 4YICA 3KJ7A 4NWDA 3B6TA 4H6DA 2DP8A 3F11A 4I9DA 3OO9A 1LFHA 4I8CA 3RT6B 4OENA 2OX3A 3U92A 1LBCA 3MZ1A 3KJTA 3H4ZA 3PD8A 3SKPA 5ITPA 2YPNA 4U22A 4MHFA 1O7TA 1SI1A 3H3GA 3UGWA 5IM2A 1PDAA 3MBPA 1MXUA 4ZEDA 5H8NB 1URSA 3USDA 5CRYA 2QS4A 1MQDA 1VE4A 5I58B 4N91A 4N15A 4NQ8A 5ICTA 3ZKKA 4JWOA 2O7IA 1Y3QA 4P56A 2R71A 3V5AA 5EYGA 4PQJA 5CI5A 4PAFA 3D4GA 1Y1ZA 4GQOA 2CZIA 1VFEA 4N17A 2ZNTA 4NHBA 4F3PA 4QSEA 2REGA 2ZNUA 1Y9UA 1I6QA 4OVQA 3PGFA 4DXCA 3DP4A 1INPA 1SPIA 5H8QA 3TUSA 2F78A 2UVIA 5JEIA 1CB6A 2XXWA 1MDP1 5DEXA 3CG1A 4GX4A 1DTGA 2I4BA 3MQ9A 3K6UA 3T9XB 3V83A 3OEKA 4HCWA 4IO3A 4X04A 3KN8A 1II5A 2CEXA 3CFLA 1MY2A 3TAJA 1JW1A 4DCXA 2O68A 2XWOA 1YTVA 4ZEIA 5K2YA 2XXTA 2DYXA 3N6UA 3OENA 3EKIA 4RK9A 1FSAA 3MSTA 5EQ9A 1G0HA 1MPBA 1SI0A 2I6EA 1NNTA 4M4GA 1LFGA 4F1YA 1P99A 5TP9A 2KR0A 3AXFA 4TLMB 1LBVA 1DOTA 1GGGA 1I6BA 4RYAA 2XHDA 3B50A 4G61A 4WEPA 1XOCA 1FW0A 1EU8A 1LAFE 1A7LA 3MP1A 4U4SA 3T93B 3JYRA 3ONMA 2DWJA 4KPTA 4JBZA 1B5IA 4HCYA 3GBAA 3EHTA 2FNCA 3DM0A 3TTLA 2HQ0A 1AOVA 3Q28A 3GBBA 3W9VA 2F3DA 3WAFA 2REJA 4OETA 4GL8A 1RDYA 2Q2CA 3VXCA 3T9HB 1LBWA 1SVXB 3O29A 1B0HA 4MLQA 1MDQA 4BDLA 1O63A 2V84A 5ICQA 4FEDA 3MJNA 1IMFA 1MRPA 4OXVA 4ZEKA 2PX1A 3FASA 3PPOA 4R9FA 4P11A 4AQ4A 1NV6A 2F7BA 2H4IA 2ZXTA 2KLFA 2I48A 4NF5B 3LSLA 3T96B 5KZTA 1S7YA 3MYUA 2WYKA 1N84A 3RGYA 4F1UA 1USYE 3MPLA 4PC9A 4IGTA 1XS5A 1K9YA 3BFUA 1YPNA 2XXKA 1B3EA 4OEUA 1UTHA 4LONB 1HSEA 4P47A 2Q8JA 4YAHX 1JETA 4RPNA 3FBPA 3KN7A 2QL3A 4N6PA 2P3NA 5AA2A 2XWIA 5J1DA 3MVZA 2UXAA 4H0WA 2RKMA 5A5XB 3PUVE 3LSFB 4LVQA 4BDQA 3FXBA 1FQFA 4BDNA 2B3BA 5CBRA 3U65A 5ET8A 4YKPA 4OVJA 3S2VA 2AL5A 4RPOA 4PAIA 2QMXA 3VLWA 4R72A 5FTHA 4I3YA 1NFTA 2HZKA 3V89B 2F8DA 1MS7A 1IIWA 3N26A 4JWXA 4IO6A 4G4PA 3PD9A 3QUJA 1Q35A 3OMBA 3K00A 3IFAA 1NV2A 1PB8A 1WODA 4X1BA 4R6YA 5DVJA 3H6WA 1UTBA 3O6IA 3PMVA 1B7ZA 4G77A 2HEUA 2QPQA 2HPGA 1R9LA 2B3FA 1XVYA 3QK6A 4G68B 3EPEA 3G3KA 3PUXE 4IGRA 4EDPA 1OQGA 1A8EA 1MQHA 2HAVA 5ISUA 1Z7NE 2O1MA 5AA1A 3R26A 2Q8MA 4MEVA 2CMOA 4QF9A 1JP4A 4PFIA 3U93A 2ANJA 2Y7RA 1MY3A 4IO7A 4PTKA 2ZYMA 4MNIA 3T9UA 4MNCA 2OLBA 4Q8RA 3A29A 4IY5A 3S4UA 1HSLA 2DWIA 3RUMA 2O7UA 2Y7KA 4C0RA 1JNFA 1SBPA 4JXIA 4U21A 3LSWA 4O94A 1B3LA 2QS2A 1BKAA 4ZEBA 4I40A 3LSXA 1GTKA 3IOVA 5F24A 3B8BA 1MY0A 1QULA 4GLIA 4GD5A 3VDFA 3CSGA 4FIMA 4GF8A 2OWSA 1L5TA 1QUIA 4RK2A 3BFTA 1FBEA 2I58A 3RPLB 5CC2A 1PEBA 3UN6A 2ONKE 4OVRA 5H8FB 4PGPA 4DDDA 2F5XA 5I2NA 1B1XA 4AS5A 1XHYA 3H06B 3QAXA 4JDFA 5EHSA 2IEEA 2VD2A 2ZZXA 4F18A 2ZMBA 4R75A 3PMWA 3HFUA 5FHMA 4GIZA 1NV3A 4NTLA 2O51A 1B2HA 1I6AA 2ZYKA 1DCUA 1PBPA 5HM4B 4FECA 3H6TA 3JZJA 4XXUA 5F7VA 1KZ8A 4XTCQ 1SW2A 3MC2A 3KEIA 3VLUA 1UIUA 2WX9A 4OFJA
chains in the Genus database with same CATH topology
2Y5LA 3ISPA 4O8MA 4PDHA 4NGUA 2CEYA 1FPKA 1XI6A 4N91A 4N15A 4NQ8A 3GYYA 4MNPA 1NUYA 4N81A 4P56A 4OVPA 2V4CA 5EYGA 1NV4A 4MCOA 1FBDA 2R8TA 1NUXA 4PAFA 4NAPA 4PF6A 5ET7A 2CZIA 4PCDA 1FPEA 4N17A 2WYPA 4NHBA 5EQ8A 1G0IA 3IFCA 1RDZA 1NV7A 4P1LA 4FBPA 4OVQA 2WX9A 2QVVA 1CNQA 1INPA 1SPIA 5EQ7A 4GWSA 1EYIA 3ROJA 4GX4A 1EYKA 4PF8A 4PFRA 4HCWA 4X04A 2CEXA 3W9WA 2MKZA 1FBPA 2HHMA 3RPLA 2XWOA 4XF5A 2PFYA 4PETA 1FPJA 3EKIA 4GWUA 1FSAA 3MSTA 1IMAA 5EQ9A 1G0HA 2L5VA 4IR8A 5J16A 4O7MA 4HXVA 2VPNA 3BIHA 1FBHA 1FJ6A 3BIGA 2KR0A 1LBVA 4OVSA 4JVDA 4GBVA 4MX6A 4DI3D 3B50A 4G61A 2WEFA 4GX6A 4X9TA 5LDZA 4F19A 4MMPA 5IGAA 5A5LA 4H45A 2PFZA 5IZZA 2VT5A 4HCYA 2WBDA 1DBZA 3NOHA 4HE1A 4NX1A 3RYDA 2FBPA 1NV5A 4HE0A 2FIXA 4P3LA 5EYHA 3W9VA 2F3DA 1NI9A 4NF0A 1RDYA 3E78A 4PE3A 2Q74A 4N6DA 1LBWA 1Q9DA 1FRPA 2HZLA 5IZ3A 4PBQA 1FTAA 4N8GA 2DE3A 3CHGA 4PFBA 1IMFA 2CZKA 2BJIA 1NV6A 1FBCA 1FPGA 4QBAA 4AS4A 1IMEA 4MIJA 5EQAA 1IMBA 3MYUA 1QGXA 2WYKA 4HE2A 2ZZWA 4F1UA 3KBZA 3PTYA 4PC9A 4GBWA 3KC1A 2QFLA 3SZPA 2XA5A 5ESYA 4M1VA 1K9YA 2WBBA 2XXKA 1YZ0A 4P47A 4P8BA 5I5PA 3FBPA 4XFEA 1LEVA 2B4MA 2P3NA 2XWIA 5J1DA 4OANA 2B4LA 1RDXA 5JK4A 1LBYA 4PGNA 4GX3A 5I3SA 3FXBA 2XWVA 3U65A 4OVTA 5ET8A 1FJ9A 1FBGA 3LUZA 4PAIA 4I3YA 1NV1A 4MAGA 2HZKA 5T3JA 1FPIA 2F3BA 2CZHA 5ET6A 1BK4A 4I3EA 5CM6A 3IFAA 1NV2A 1EYJA 3E79A 4XEQA 1KA1A 5FBPA 1DK4A 4GWYA 2QVUA 2FVZA 4UABA 3D1RA 2QPQA 4P1EA 4DI4B 2HPGA 4X8RA 1LBZA 2FIEA 1FPFA 5DW8A 4GWWA 2XWKA 2JJKA 2Q8MA 4MEVA 3QMFA 4OA4A 1D9QA 1KA0A 1JP4A 4PFIA 1NUZA 2OWZA 2DDKA 4F1VA 4PBHA 1NV0A 4JVIA 4PTKA 4GWZA 4NN3A 4MNIA 4LN5A 4MNCA 3KC0A 2HXRA 3A29A 2DE2A 3T0JA 5IZ3B 1IMDA 1LBXA 4H46A 1FPDA 1FPLA 4N8YA 2GQ1A 4NG7A 4GWXA 2ZZVA 1FPBA 4O94A 4N6KA 4I40A 1FBFA 4N4UA 2P3VA 5F24A 5LTCA 3B8BA 2Q9TA 4O7IA 2DE4A 1AWBA 2FHYA 1FBEA 3RPLB 2QVRA 5IZ1A 4OVRA 4PGPA 4JVCA 2F5XA 5I7IA 4PAKA 4AS5A 2PCRA 4MJOA 1YXIA 2Y5KA 3LV0A 2ZZXA 4F18A 4YICA 3HFUA 1YYZA 4PDDA 1NV3A 1DCUA 2KQZA 4QXDA 2V3QA 1NUWA 2VPOA 1VDWA 2OX3A 2DVZA 1KZ8A 4P9KA 5ET5A 4MHFA 1K9ZA 3T1BA 5IM2A 4YZZA 1IMCA 4KXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVS A;  4O8M A;  4PDH A;  2XXK A;  4MX6 A;  4NGU A;  4DI3 D;  3B50 A;  2CEY A;  4P47 A;  4P8B A;  4N91 A;  4N8Y A;  4MMP A;  4N15 A;  4NQ8 A;  5IGA A;  5I5P A;  3GYY A;  4NG7 A;  4XFE A;  2ZZV A;  4MNP A;  2XWI A;  4P56 A;  4O94 A;  4OVP A;  4OAN A;  2PFZ A;  2V4C A;  4N6K A;  5IZZ A;  4MCO A;  4PGN A;  4PAF A;  4NAP A;  3FXB A;  4N4U A;  4PF6 A;  2XWV A;  4NX1 A;  3U65 A;  4OVT A;  4PCD A;  5LTC A;  4N17 A;  2WYP A;  4NHB A;  4P3L A;  4PAI A;  4NF0 A;  4MAG A;  2HZK A;  4P1L A;  4OVQ A;  4PE3 A;  5CM6 A;  4N6D A;  4XEQ A;  4OVR A;  4PGP A;  2HZL A;  5I7I A;  4PBQ A;  4PAK A;  4N8G A;  4UAB A;  4PF8 A;  4P1E A;  4PFR A;  4DI4 B;  2HPG A;  4PFB A;  4X04 A;  4X8R A;  2ZZX A;  2CEX A;  4YIC A;  4PDD A;  2XWO A;  4XF5 A;  2PFY A;  4PET A;  2XWK A;  4MEV A;  4MIJ A;  4OA4 A;  2VPO A;  4PFI A;  4P9K A;  2WYK A;  4PBH A;  2ZZW A;  4MHF A;  4NN3 A;  4PC9 A;  4O7M A;  4MNI A;  4LN5 A;  4MNC A;  4YZZ A;  5IM2 A;  2XA5 A;  2VPN A;  2WX9 A; 
#chains in the Genus database with same CATH topology
 3ISP A;  1B3H A;  3TQW A;  3E13 X;  1Y4T A;  4O8M A;  3S9N C;  3K02 A;  4RA1 A;  1MM7 A;  4E0X A;  3SEU A;  4AB6 A;  2G93 A;  3PPP A;  1MM6 A;  4R2F A;  1LFI A;  5BUU A;  1NUY A;  4IB2 A;  3LC8 A;  3N94 A;  4XKN A;  3K1N A;  4PF6 A;  2RF1 A;  4PCD A;  1FPE A;  1S9T A;  5K2X A;  2WYP A;  2Q2A A;  5CMC A;  3N6T A;  1G0I A;  1POT A;  1RDZ A;  1LAX A;  3SEX A;  2QVV A;  1ANF A;  1YAE A;  2I0B A;  1EYI A;  3K6V A;  1JW5 A;  5ITO A;  2PYY A;  3UP9 A;  2XX7 A;  2XXH A;  4PF8 A;  2R6G E;  5CMM A;  3TPA A;  1IXI A;  5I2K A;  4Q0C A;  4NF6 A;  2V3T A;  3W9W A;  2QS3 A;  3LUY A;  4GVO A;  3OEM A;  1N3W A;  3OEL A;  2NOO A;  4PET A;  4KYD A;  5FTI A;  1NH8 A;  2RC7 A;  4ZDM A;  3B6W A;  1US4 A;  2QSX A;  5TPA A;  1PC3 A;  3VLV A;  1FTJ A;  3MW0 A;  3I5O A;  4LUB A;  1IMA A;  2L5V A;  1M5B A;  3K0V A;  4MBP A;  5J16 A;  4H5G A;  4HXV A;  2E1S A;  3BIH A;  1FBH A;  1FJ6 A;  3EF7 A;  3BIG A;  2UVG A;  1FCK A;  3RQT A;  4MX6 A;  4DI3 D;  3SER A;  4G68 C;  4GX6 A;  1DTZ A;  4LQ5 A;  5LDZ A;  4F19 A;  3EHS A;  5H8S A;  3O66 A;  2I0C A;  1N76 A;  5IAI A;  3IX1 A;  3U72 A;  5IZZ A;  3MZB A;  3SEY A;  2XXR A;  5BWJ A;  2G29 A;  1MH4 A;  4HE1 A;  3RYD A;  1H3D A;  5I58 A;  4HE0 A;  1YCJ A;  4QFP A;  4C1T A;  3HV1 A;  5EYH A;  2GH9 A;  4F29 A;  1MXY A;  1LB8 A;  1P1Q A;  2DXR A;  4PE3 A;  3FJM A;  3ILU B;  4N6D A;  1Q9D A;  1FRP A;  3OO6 A;  5H8H A;  4PBQ A;  3K4U A;  4NF4 B;  3S9E A;  1MQG A;  4RXL A;  4JB7 A;  2AL4 A;  1LAH E;  1OVT A;  2DE3 A;  2DWH A;  3PUZ E;  5EHM A;  4ESW A;  2O6A A;  2X26 A;  4XKQ A;  3TYH A;  2F34 A;  2NUV A;  4YB7 A;  3ZS6 A;  3U8Q A;  3MVW A;  5EQA A;  1IMB A;  4MFI A;  1USY H;  3TTR A;  1MQJ A;  3GLB A;  3R7X A;  2ZZW A;  3KC1 A;  2QFL A;  2Y7I A;  4FJP A;  3PPN A;  3FV1 A;  3G3G A;  3MP8 A;  1BTJ A;  4EXK A;  5DEX B;  4P8B A;  1JEV A;  3SES A;  4ZE8 A;  1LEV A;  4JWY A;  3TTN A;  2B4M A;  1M5D A;  3IO6 A;  4YMA A;  2ZNS A;  3IB2 A;  1Y3N A;  1RDX A;  3TZA A;  3K01 A;  4R74 A;  3L6G A;  4GX3 A;  5HPQ A;  4GRK A;  3TQL A;  3I6V A;  2A5T A;  5AE4 A;  2XWV A;  4YU0 A;  4NE4 A;  1FBG A;  3LUZ A;  4DXB A;  4E0W A;  1NV1 A;  3ZSF A;  4MAG A;  2ONR A;  2VGQ A;  3R6U A;  1NNP A;  1FPI A;  2F3B A;  3U1O A;  2WKY A;  2CZH A;  1GVC A;  5ET6 A;  4OEV A;  1BK4 A;  5TP9 B;  4I3E A;  1US5 A;  3E79 A;  1PBQ A;  2H9B A;  4UAB A;  1DSN A;  3D1R A;  4GXS B;  3C32 A;  3TFL A;  2O84 X;  4KFQ A;  2ZYN A;  2FIE A;  1FPF A;  3LBS A;  2F7C A;  1IXG A;  1URD A;  2AYS A;  1Y4C A;  2XWK A;  1SQY A;  3GXA A;  4YKJ A;  4KYE A;  4F1V A;  4JVI A;  3ZKL A;  4ZEC A;  1H43 A;  4H1X A;  1TXF A;  4OFL A;  4YB6 A;  2YLN A;  4FOR A;  5LOM A;  2DQV A;  2DE2 A;  4U4X A;  3SEW A;  2QMW A;  2XXY A;  4U2R A;  1LBX A;  3VXB A;  5KDT A;  3UA8 A;  3H6V A;  1JEU A;  1RYO A;  4NF5 A;  1FPL A;  4NWC A;  3O6H A;  4NG7 A;  4YKK A;  1IIT A;  2LAO A;  1ZU0 A;  4RJZ A;  4LAT A;  4X48 A;  2Q88 A;  4KQP A;  1JW4 A;  3CFZ A;  3HO7 A;  1AIV A;  2HXW A;  3PPR A;  2P3V A;  5LTC A;  2I3V A;  3G3H A;  2ONS A;  4N07 A;  2F6P A;  1B40 A;  1P1U A;  2DXY A;  4P0G A;  1BIY A;  2DWA A;  2DVC A;  1SD3 A;  2QVR A;  1B0L A;  5A5X A;  4K3F A;  4LZ7 A;  4JVC A;  1NNK A;  5L8D A;  1NH7 A;  4PAK A;  4H65 A;  3TEP A;  1D9Y A;  1YXI A;  1NMU A;  3DEL B;  5AA2 B;  5M2V A;  5ELV A;  3HPI A;  5FHO A;  1TWY A;  1B9J A;  1YYZ A;  3UIF A;  1ELJ A;  1EZ9 A;  4F22 A;  2GFE A;  3RT8 A;  2KQZ A;  3KN3 A;  1OVB A;  2OZZ A;  1NUW A;  2XD3 A;  2DVZ A;  1O64 A;  3E9X A;  3TEL A;  1Q1K A;  1ZTY A;  3C4M A;  4Z7E A;  1QKA A;  5ET5 A;  2HCA A;  3CR9 A;  3T1B A;  3IO4 A;  2Y5L A;  3S9L C;  3OSR A;  1B4Z A;  2FA7 A;  3SET A;  4ZZA A;  5I59 B;  1XT8 A;  4JSD A;  2QRY A;  4EF2 A;  2CEY A;  1QW0 A;  3C34 A;  4U23 A;  4ELO A;  1FPK A;  1XI6 A;  4PFT A;  3OOA A;  3GYY A;  5KCJ A;  4MNP A;  3B6Q A;  2V4C A;  3KG2 A;  4MCO A;  1FBD A;  5CMB A;  4QFN A;  4UA8 A;  3GZG A;  1PB9 A;  4JSO A;  4LQ2 A;  1GR2 A;  3OO8 A;  3Q29 A;  2RIN A;  1URG A;  4IY6 A;  2UYE A;  3HCQ A;  4FBP A;  2RC8 A;  1N3X A;  3FD3 A;  1B5J A;  2F36 A;  3RY3 A;  4GWS A;  4WED A;  1OIB A;  3TMG A;  3O28 A;  3ROJ A;  4DCY A;  1R1N A;  2GHB A;  3K1M A;  1EYK A;  4PFR A;  4QFO A;  1QVS A;  1T0K A;  5AA2 D;  1N0T A;  3MAM A;  4TQU Q;  2MKZ A;  4PP0 A;  1QKB A;  4THI A;  1FBP A;  1SDX A;  3FVN A;  1WDN A;  3RPL A;  2E0S A;  2DS9 A;  1AH5 A;  5H8F A;  4R2B A;  1FPJ A;  2QJE A;  3MP6 A;  4GWU A;  5L9M A;  1Y1M A;  5F1Q A;  3Q26 A;  4IR8 A;  4OFO A;  4IO4 A;  4IO2 A;  1MY4 A;  3CFX A;  2VPN A;  1FQC A;  4OZ9 A;  4N13 A;  1N7X A;  5I2N B;  4GBV A;  4GFR A;  3HHF A;  2WEF A;  4X9T A;  3Q27 A;  4G2Z A;  4X1D A;  4OWD A;  1CE2 A;  1M5C A;  3FIR A;  1TFA A;  3IJO B;  3RTW B;  2PFZ A;  2PMS A;  4ELR A;  4KYS A;  3VE1 B;  2BJJ X;  4H67 A;  4NED A;  3VV5 A;  3WAE A;  3O9P A;  4Z0I A;  3N5L A;  1MPC A;  3NOH A;  1B32 A;  1A8F A;  4DIG A;  5AA4 B;  2FIX A;  4P3L A;  3BBR A;  1UQW A;  3E3K A;  3FZV A;  1XVX A;  2Y84 A;  1JVX A;  2XXP A;  4H5F A;  1MPD A;  1IUD A;  4EQB A;  1A54 A;  3E78 A;  5I57 B;  1EZO A;  3K1P A;  2XX9 A;  1XC1 A;  5IZ3 A;  5JTY B;  1FTA A;  3C33 A;  3IAZ A;  2A5S A;  3FJ7 A;  4ZE9 A;  4O3B A;  4L17 A;  2BJI A;  1ZMG A;  1FBC A;  4QBA A;  4OER A;  1FQA A;  5B70 A;  1TT1 A;  4PFY A;  1IME A;  3LR1 A;  3TCF A;  4MIJ A;  1RYX A;  3QIM A;  3S9M C;  3M8U A;  1SW1 A;  1QGX A;  1FQB A;  3PTY A;  2OWT A;  1H45 A;  3MZ9 A;  2XA5 A;  4BDM A;  3DP8 A;  4XKR A;  1JQF A;  4NF8 B;  3MWB A;  5L9S A;  2WBB A;  4YB5 A;  1EZP A;  1SW4 A;  2Y7P A;  1D4N A;  1AL3 A;  4FE8 A;  4PE5 B;  3HHG A;  2R9J A;  5I56 B;  4HW8 A;  2XXX A;  5I5P A;  4XFE A;  4NF6 B;  4OES A;  3HST A;  4BLA A;  3I3V A;  1Z7M E;  3C9H A;  3IB0 A;  5CMK A;  4DE8 A;  3RPW A;  4R73 A;  1LB9 A;  1LBY A;  4PGN A;  5I3S A;  2F35 A;  2W7Y A;  4OVT A;  3FAT A;  1LST A;  5T3J A;  4POX A;  4LP2 B;  3RLF E;  5DVF A;  3TTK A;  1R6Z A;  5HBC A;  2Y7W A;  2PVU A;  1MY1 A;  4NMY A;  5CM6 A;  1EYJ A;  4O3C A;  4IO5 A;  1KA1 A;  2QS1 A;  3FXR A;  5H8N A;  3PV0 E;  3A09 A;  1N04 A;  4GWY A;  1KWH A;  3DP6 A;  4MH5 A;  1NL5 A;  2FVZ A;  4G8H A;  5L9O A;  2VHA A;  2THI A;  4P1E A;  3Q25 A;  4X8R A;  2VD3 A;  1LCF A;  1LBZ A;  1FQD A;  1MXX A;  2XXI A;  3CIJ A;  1GV8 A;  1MQI A;  2RC9 A;  2NVU B;  4QFK A;  2JJK A;  4DZ1 A;  4XKP A;  3QMF A;  2D3I A;  1D9Q A;  1KA0 A;  4NF4 A;  3IOT A;  1NUZ A;  2DDK A;  3VVE A;  1NV0 A;  3KGC A;  3EN3 A;  1VSO A;  4NN3 A;  3KBR A;  4DLD A;  4POW A;  2RCB A;  5H8H B;  3G3I A;  4YKI A;  4YMB A;  1FPD A;  3W15 C;  4C1U A;  4GWX A;  5IKB A;  2YJP A;  1FPB A;  4OYV A;  2VP1 A;  4EQ9 A;  4PFW A;  4N6K A;  5H8Q B;  4QSC A;  1QJM A;  3IJX B;  5AA3 A;  3RTF B;  2P2A A;  3G3J A;  5EYF A;  4QSD A;  4TLL B;  1B6H A;  4KHZ E;  4N4U A;  3QSL A;  1ZIU A;  1FTM A;  2Q9T A;  3IR1 A;  4O7I A;  4BDO A;  3MVX A;  3UK4 A;  1B51 A;  2XXU A;  1OLA A;  1UIV A;  3VVD A;  3VVF A;  1AWB A;  1M5F A;  2X7Q A;  4QHQ A;  1IXH A;  1A99 A;  2F7A A;  4Q5T A;  4KCD A;  2V93 A;  4UAC A;  2X7P A;  1I69 A;  3PUY E;  2VOZ A;  2AIX A;  2PCR A;  4F39 A;  2UVH A;  3T9V A;  5DTB A;  3FGS A;  2Z23 A;  1Y20 A;  3LV0 A;  5I84 A;  4EF1 A;  2Q89 A;  3PMX A;  3CI8 A;  2F6G A;  4G8M A;  1B3G A;  4PDD A;  4LA9 A;  2A5T B;  2OK2 A;  1DMB A;  1ZBM A;  4ZZE A;  5DVI A;  4QXD A;  3KOT A;  2V3Q A;  2B65 A;  4GWO A;  1MXZ A;  2VPO A;  4LZ5 A;  1VDW A;  4ELQ A;  3FVG A;  4P9K A;  2P1S A;  2XXQ A;  3DLN A;  2I4C A;  3B7D A;  5TU0 A;  1K9Z A;  2XX8 A;  4YZZ A;  2HAU A;  1IMC A;  4KXP A;  3CSB A;  5DT6 A;  4PDH A;  4NGU A;  1IXC A;  4F31 B;  3FXU A;  4ND9 A;  3FUZ A;  3ILT B;  1ATG A;  3KOS A;  3CVG A;  4N81 A;  4OVP A;  2UVJ A;  3FVO A;  4F3S A;  3MPK A;  1NV4 A;  5B7D A;  2R8T A;  1NUX A;  3O6G A;  4MF3 A;  4NAP A;  1N7W A;  2V3U A;  4EQ7 A;  3QYT A;  4H8J A;  3FXQ A;  1IZ1 A;  5ET7 A;  4F2O A;  1HSJ A;  2PT2 A;  4XIG Q;  3IOW A;  1ZKB A;  5EQ8 A;  3IFC A;  3THI A;  5DYH A;  1NV7 A;  4P1L A;  4I62 A;  3BKI B;  1CNQ A;  1Y3P A;  2D5W A;  5EQ7 A;  1BLF A;  1JVY A;  3K6W A;  5KDT B;  2D21 A;  1SW5 A;  4OTE A;  4LZ8 A;  2Z8F A;  2I49 A;  1B7U A;  2GHA A;  2DOJ A;  4PFU A;  2H5Y A;  4AB5 A;  4Q30 B;  2O69 A;  4WXJ A;  3PUW E;  1R9Q A;  1A55 A;  2HHM A;  3OXN A;  1P1N A;  1IQ7 A;  4EUO A;  4HTG A;  4XF5 A;  2PFY A;  3TCG A;  1OLC A;  1UTH B;  3KFM A;  1FTO A;  1H44 A;  3M3L A;  4GL0 A;  4R9G A;  1B5H A;  1S50 A;  2H25 A;  2P0S A;  1M5E A;  2H99 A;  3KSJ A;  4MLV A;  4O7M A;  4F3G A;  1B3F A;  4OVS A;  2O1L A;  4JVD A;  3TDJ A;  4TOZ A;  3H6U A;  3KZG A;  5FHN A;  4G8N A;  4KD5 A;  2DSF A;  4MMP A;  5IGA A;  3TCH A;  2Z22 A;  5A5L A;  4G68 A;  4H45 A;  1D9V A;  2VT5 A;  2WBD A;  4P0I A;  1DBZ A;  5I59 A;  1UTB B;  2ZYO A;  1TFD A;  1ZJL A;  4NX1 A;  2FBP A;  1NV5 A;  2F97 A;  3CRB A;  4ONY A;  1QUK A;  1NI9 A;  3IK6 B;  4NF0 A;  3ODB A;  1VFD A;  4ELP A;  4ECF A;  3FV2 A;  1DPP A;  2XD2 A;  3K2D A;  2Q74 A;  4QRZ A;  3C35 A;  1ZLQ A;  4FEB A;  1SYI A;  2HZL A;  3MVY A;  4KI0 E;  3ECR A;  4N8G A;  4H8I A;  2I3W A;  5KCJ B;  3FVK A;  3CHG A;  4PFB A;  1P1O A;  4F2Q A;  2CZK A;  4OHN A;  1FPG A;  2V25 A;  4AS4 A;  4ZS9 A;  1QUJ A;  1OQH A;  3FJG A;  4R6K A;  3G7W A;  4RNS A;  3IOU A;  1PB7 A;  1WVJ A;  3QUF A;  4HE2 A;  3KBZ A;  4GBW A;  2CZL A;  1LCT A;  3SZP A;  2FYI A;  5ESY A;  4M1V A;  3O2A A;  1NKX A;  1SYH A;  3TOD A;  1IEJ A;  3K6X A;  3D4C A;  1YZ0 A;  2ABH A;  3HN0 A;  3SEV A;  1OMP A;  2OBG A;  2Z8E A;  4OQO A;  2XXV A;  3IL1 B;  4KCC A;  4OAN A;  4DXU A;  2B4L A;  5JK4 A;  3TKD A;  3OSQ A;  4ESX A;  3T66 A;  3T22 A;  1LAG E;  4OMB A;  1FTL A;  3QXM A;  4O3A A;  4EXL A;  4GOT A;  1AMF A;  3G3F A;  4U1Z A;  1FJ9 A;  1D3K A;  3JV9 A;  3TTM A;  4U1O A;  1BP5 A;  3CG3 A;  3OO7 A;  4KR5 A;  2OJT A;  1VR5 A;  4XEQ A;  1RKM A;  1FQE A;  5FBP A;  1DK4 A;  3H7M A;  2QVU A;  3O97 A;  1B58 A;  3VFJ A;  5AA4 A;  3IB1 A;  4DI4 B;  1B46 A;  4ISU A;  2M8C A;  2Z8D A;  1MG1 A;  5I57 A;  5DW8 A;  3A3U A;  1MXV A;  3V8X B;  2PT1 A;  4GWW A;  5JTY A;  4OA4 A;  3PU5 A;  3MUQ A;  3SDF A;  1B1H A;  1NNF A;  3KSX A;  4ZEF A;  3IOR A;  3EHU A;  2OWZ A;  4RY1 A;  4FAJ A;  4PBH A;  4GWZ A;  4F3B A;  3C31 A;  2PBW A;  4LN5 A;  1LBB A;  4I1D A;  1POY 1;  3KC0 A;  2HXR A;  3RNN A;  1B05 A;  1EH3 A;  3PPQ A;  1H76 A;  4GXA A;  3T0J A;  1B52 A;  2OCU A;  5IZ3 B;  1IMD A;  4H46 A;  3U94 A;  4BDR A;  2UYF A;  4N8Y A;  2GQ1 A;  1P1W A;  3OD7 A;  3EQ1 A;  2ALU A;  2ZZV A;  1B7H A;  4WKM A;  2GRV A;  2NXO A;  4HS7 A;  4NF8 A;  3P7I A;  4R6H A;  5CBS A;  1MH3 A;  1FBF A;  3E4R A;  3UOR A;  1DPE A;  3H03 A;  5I56 A;  1J1N A;  1B4H A;  3A3C A;  1F9B A;  5I2K B;  2ESN A;  2DE4 A;  3M3K A;  1LGB C;  2FHY A;  2RCA A;  2H98 A;  1MXW A;  4QFL A;  5IZ1 A;  1A40 A;  3L6H A;  2HFB A;  3C36 A;  5I7I A;  2NWJ A;  5TPA B;  1LLS A;  4MJO A;  3M3F A;  2Y5K A;  1FTK A;  3RN8 A;  4FAT A;  2IA4 A;  4YIC A;  3KJ7 A;  4NWD A;  3B6T A;  4H6D A;  2DP8 A;  3F11 A;  4I9D A;  3OO9 A;  1LFH A;  4I8C A;  3RT6 B;  4OEN A;  2OX3 A;  3U92 A;  1LBC A;  3MZ1 A;  3KJT A;  3H4Z A;  3PD8 A;  3SKP A;  5ITP A;  2YPN A;  4U22 A;  4MHF A;  1O7T A;  1SI1 A;  3H3G A;  3UGW A;  5IM2 A;  1PDA A;  3MBP A;  1MXU A;  4ZED A;  5H8N B;  1URS A;  3USD A;  5CRY A;  2QS4 A;  1MQD A;  1VE4 A;  5I58 B;  4N91 A;  4N15 A;  4NQ8 A;  5ICT A;  3ZKK A;  4JWO A;  2O7I A;  1Y3Q A;  4P56 A;  2R71 A;  3V5A A;  5EYG A;  4PQJ A;  5CI5 A;  4PAF A;  3D4G A;  1Y1Z A;  4GQO A;  2CZI A;  1VFE A;  4N17 A;  2ZNT A;  4NHB A;  4F3P A;  4QSE A;  2REG A;  2ZNU A;  1Y9U A;  1I6Q A;  4OVQ A;  3PGF A;  4DXC A;  3DP4 A;  1INP A;  1SPI A;  5H8Q A;  3TUS A;  2F78 A;  2UVI A;  5JEI A;  1CB6 A;  2XXW A;  1MDP 1;  5DEX A;  3CG1 A;  4GX4 A;  1DTG A;  2I4B A;  3MQ9 A;  3K6U A;  3T9X B;  3V83 A;  3OEK A;  4HCW A;  4IO3 A;  4X04 A;  3KN8 A;  1II5 A;  2CEX A;  3CFL A;  1MY2 A;  3TAJ A;  1JW1 A;  4DCX A;  2O68 A;  2XWO A;  1YTV A;  4ZEI A;  5K2Y A;  2XXT A;  2DYX A;  3N6U A;  3OEN A;  3EKI A;  4RK9 A;  1FSA A;  3MST A;  5EQ9 A;  1G0H A;  1MPB A;  1SI0 A;  2I6E A;  1NNT A;  4M4G A;  1LFG A;  4F1Y A;  1P99 A;  5TP9 A;  2KR0 A;  3AXF A;  4TLM B;  1LBV A;  1DOT A;  1GGG A;  1I6B A;  4RYA A;  2XHD A;  3B50 A;  4G61 A;  4WEP A;  1XOC A;  1FW0 A;  1EU8 A;  1LAF E;  1A7L A;  3MP1 A;  4U4S A;  3T93 B;  3JYR A;  3ONM A;  2DWJ A;  4KPT A;  4JBZ A;  1B5I A;  4HCY A;  3GBA A;  3EHT A;  2FNC A;  3DM0 A;  3TTL A;  2HQ0 A;  1AOV A;  3Q28 A;  3GBB A;  3W9V A;  2F3D A;  3WAF A;  2REJ A;  4OET A;  4GL8 A;  1RDY A;  2Q2C A;  3VXC A;  3T9H B;  1LBW A;  1SVX B;  3O29 A;  1B0H A;  4MLQ A;  1MDQ A;  4BDL A;  1O63 A;  2V84 A;  5ICQ A;  4FED A;  3MJN A;  1IMF A;  1MRP A;  4OXV A;  4ZEK A;  2PX1 A;  3FAS A;  3PPO A;  4R9F A;  4P11 A;  4AQ4 A;  1NV6 A;  2F7B A;  2H4I A;  2ZXT A;  2KLF A;  2I48 A;  4NF5 B;  3LSL A;  3T96 B;  5KZT A;  1S7Y A;  3MYU A;  2WYK A;  1N84 A;  3RGY A;  4F1U A;  1USY E;  3MPL A;  4PC9 A;  4IGT A;  1XS5 A;  1K9Y A;  3BFU A;  1YPN A;  2XXK A;  1B3E A;  4OEU A;  1UTH A;  4LON B;  1HSE A;  4P47 A;  2Q8J A;  4YAH X;  1JET A;  4RPN A;  3FBP A;  3KN7 A;  2QL3 A;  4N6P A;  2P3N A;  5AA2 A;  2XWI A;  5J1D A;  3MVZ A;  2UXA A;  4H0W A;  2RKM A;  5A5X B;  3PUV E;  3LSF B;  4LVQ A;  4BDQ A;  3FXB A;  1FQF A;  4BDN A;  2B3B A;  5CBR A;  3U65 A;  5ET8 A;  4YKP A;  4OVJ A;  3S2V A;  2AL5 A;  4RPO A;  4PAI A;  2QMX A;  3VLW A;  4R72 A;  5FTH A;  4I3Y A;  1NFT A;  2HZK A;  3V89 B;  2F8D A;  1MS7 A;  1IIW A;  3N26 A;  4JWX A;  4IO6 A;  4G4P A;  3PD9 A;  3QUJ A;  1Q35 A;  3OMB A;  3K00 A;  3IFA A;  1NV2 A;  1PB8 A;  1WOD A;  4X1B A;  4R6Y A;  5DVJ A;  3H6W A;  1UTB A;  3O6I A;  3PMV A;  1B7Z A;  4G77 A;  2HEU A;  2QPQ A;  2HPG A;  1R9L A;  2B3F A;  1XVY A;  3QK6 A;  4G68 B;  3EPE A;  3G3K A;  3PUX E;  4IGR A;  4EDP A;  1OQG A;  1A8E A;  1MQH A;  2HAV A;  5ISU A;  1Z7N E;  2O1M A;  5AA1 A;  3R26 A;  2Q8M A;  4MEV A;  2CMO A;  4QF9 A;  1JP4 A;  4PFI A;  3U93 A;  2ANJ A;  2Y7R A;  1MY3 A;  4IO7 A;  4PTK A;  2ZYM A;  4MNI A;  3T9U A;  4MNC A;  2OLB A;  4Q8R A;  3A29 A;  4IY5 A;  3S4U A;  1HSL A;  2DWI A;  3RUM A;  2O7U A;  2Y7K A;  4C0R A;  1JNF A;  1SBP A;  4JXI A;  4U21 A;  3LSW A;  4O94 A;  1B3L A;  2QS2 A;  1BKA A;  4ZEB A;  4I40 A;  3LSX A;  1GTK A;  3IOV A;  5F24 A;  3B8B A;  1MY0 A;  1QUL A;  4GLI A;  4GD5 A;  3VDF A;  3CSG A;  4FIM A;  4GF8 A;  2OWS A;  1L5T A;  1QUI A;  4RK2 A;  3BFT A;  1FBE A;  2I58 A;  3RPL B;  5CC2 A;  1PEB A;  3UN6 A;  2ONK E;  4OVR A;  5H8F B;  4PGP A;  4DDD A;  2F5X A;  5I2N A;  1B1X A;  4AS5 A;  1XHY A;  3H06 B;  3QAX A;  4JDF A;  5EHS A;  2IEE A;  2VD2 A;  2ZZX A;  4F18 A;  2ZMB A;  4R75 A;  3PMW A;  3HFU A;  5FHM A;  4GIZ A;  1NV3 A;  4NTL A;  2O51 A;  1B2H A;  1I6A A;  2ZYK A;  1DCU A;  1PBP A;  5HM4 B;  4FEC A;  3H6T A;  3JZJ A;  4XXU A;  5F7V A;  1KZ8 A;  4XTC Q;  1SW2 A;  3MC2 A;  3KEI A;  3VLU A;  1UIU A;  2WX9 A;  4OFJ A; 
#chains in the Genus database with same CATH homology
 2Y5L A;  3ISP A;  4O8M A;  4PDH A;  4NGU A;  2CEY A;  1FPK A;  1XI6 A;  4N91 A;  4N15 A;  4NQ8 A;  3GYY A;  4MNP A;  1NUY A;  4N81 A;  4P56 A;  4OVP A;  2V4C A;  5EYG A;  1NV4 A;  4MCO A;  1FBD A;  2R8T A;  1NUX A;  4PAF A;  4NAP A;  4PF6 A;  5ET7 A;  2CZI A;  4PCD A;  1FPE A;  4N17 A;  2WYP A;  4NHB A;  5EQ8 A;  1G0I A;  3IFC A;  1RDZ A;  1NV7 A;  4P1L A;  4FBP A;  4OVQ A;  2WX9 A;  2QVV A;  1CNQ A;  1INP A;  1SPI A;  5EQ7 A;  4GWS A;  1EYI A;  3ROJ A;  4GX4 A;  1EYK A;  4PF8 A;  4PFR A;  4HCW A;  4X04 A;  2CEX A;  3W9W A;  2MKZ A;  1FBP A;  2HHM A;  3RPL A;  2XWO A;  4XF5 A;  2PFY A;  4PET A;  1FPJ A;  3EKI A;  4GWU A;  1FSA A;  3MST A;  1IMA A;  5EQ9 A;  1G0H A;  2L5V A;  4IR8 A;  5J16 A;  4O7M A;  4HXV A;  2VPN A;  3BIH A;  1FBH A;  1FJ6 A;  3BIG A;  2KR0 A;  1LBV A;  4OVS A;  4JVD A;  4GBV A;  4MX6 A;  4DI3 D;  3B50 A;  4G61 A;  2WEF A;  4GX6 A;  4X9T A;  5LDZ A;  4F19 A;  4MMP A;  5IGA A;  5A5L A;  4H45 A;  2PFZ A;  5IZZ A;  2VT5 A;  4HCY A;  2WBD A;  1DBZ A;  3NOH A;  4HE1 A;  4NX1 A;  3RYD A;  2FBP A;  1NV5 A;  4HE0 A;  2FIX A;  4P3L A;  5EYH A;  3W9V A;  2F3D A;  1NI9 A;  4NF0 A;  1RDY A;  3E78 A;  4PE3 A;  2Q74 A;  4N6D A;  1LBW A;  1Q9D A;  1FRP A;  2HZL A;  5IZ3 A;  4PBQ A;  1FTA A;  4N8G A;  2DE3 A;  3CHG A;  4PFB A;  1IMF A;  2CZK A;  2BJI A;  1NV6 A;  1FBC A;  1FPG A;  4QBA A;  4AS4 A;  1IME A;  4MIJ A;  5EQA A;  1IMB A;  3MYU A;  1QGX A;  2WYK A;  4HE2 A;  2ZZW A;  4F1U A;  3KBZ A;  3PTY A;  4PC9 A;  4GBW A;  3KC1 A;  2QFL A;  3SZP A;  2XA5 A;  5ESY A;  4M1V A;  1K9Y A;  2WBB A;  2XXK A;  1YZ0 A;  4P47 A;  4P8B A;  5I5P A;  3FBP A;  4XFE A;  1LEV A;  2B4M A;  2P3N A;  2XWI A;  5J1D A;  4OAN A;  2B4L A;  1RDX A;  5JK4 A;  1LBY A;  4PGN A;  4GX3 A;  5I3S A;  3FXB A;  2XWV A;  3U65 A;  4OVT A;  5ET8 A;  1FJ9 A;  1FBG A;  3LUZ A;  4PAI A;  4I3Y A;  1NV1 A;  4MAG A;  2HZK A;  5T3J A;  1FPI A;  2F3B A;  2CZH A;  5ET6 A;  1BK4 A;  4I3E A;  5CM6 A;  3IFA A;  1NV2 A;  1EYJ A;  3E79 A;  4XEQ A;  1KA1 A;  5FBP A;  1DK4 A;  4GWY A;  2QVU A;  2FVZ A;  4UAB A;  3D1R A;  2QPQ A;  4P1E A;  4DI4 B;  2HPG A;  4X8R A;  1LBZ A;  2FIE A;  1FPF A;  5DW8 A;  4GWW A;  2XWK A;  2JJK A;  2Q8M A;  4MEV A;  3QMF A;  4OA4 A;  1D9Q A;  1KA0 A;  1JP4 A;  4PFI A;  1NUZ A;  2OWZ A;  2DDK A;  4F1V A;  4PBH A;  1NV0 A;  4JVI A;  4PTK A;  4GWZ A;  4NN3 A;  4MNI A;  4LN5 A;  4MNC A;  3KC0 A;  2HXR A;  3A29 A;  2DE2 A;  3T0J A;  5IZ3 B;  1IMD A;  1LBX A;  4H46 A;  1FPD A;  1FPL A;  4N8Y A;  2GQ1 A;  4NG7 A;  4GWX A;  2ZZV A;  1FPB A;  4O94 A;  4N6K A;  4I40 A;  1FBF A;  4N4U A;  2P3V A;  5F24 A;  5LTC A;  3B8B A;  2Q9T A;  4O7I A;  2DE4 A;  1AWB A;  2FHY A;  1FBE A;  3RPL B;  2QVR A;  5IZ1 A;  4OVR A;  4PGP A;  4JVC A;  2F5X A;  5I7I A;  4PAK A;  4AS5 A;  2PCR A;  4MJO A;  1YXI A;  2Y5K A;  3LV0 A;  2ZZX A;  4F18 A;  4YIC A;  3HFU A;  1YYZ A;  4PDD A;  1NV3 A;  1DCU A;  2KQZ A;  4QXD A;  2V3Q A;  1NUW A;  2VPO A;  1VDW A;  2OX3 A;  2DVZ A;  1KZ8 A;  4P9K A;  5ET5 A;  4MHF A;  1K9Z A;  3T1B A;  5IM2 A;  4YZZ A;  1IMC A;  4KXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...