2ZZWA

Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
330
structure length
330
Chain Sequence
RRYRWRIQTAWDAGTVGYSLFQKFTERVKELTDGQLEVQPFPAGAVVGTFDMFDAVKTGVLDGMNPFTLYWAGRMPVTAFLSSYALGLDRPDQWETWFYSLGGLDIARRAFAEQGLFYVGPVQHDLNIIHSKKPIRRFEDFKGVKLRVPGGMIAEVFAAAGASTVLLPGGEVYPALERGVIDAADFVGPAVNYNLGFHQVAKYIIMGPPETPAIHQPVDLMDFTINLNRWRSLPKPLQERFIAAVHEYSWIHYAGIQKANLEAWPKYRQAGVEVIRLSNEDVRKFRRLAIPIWFKWAKMDKYSREAFASQLEYMKGIGYVTDEELKGLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, solute-binding protein
publication title Crystal structure of a periplasmic substrate-binding protein in complex with calcium lactate
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transport protein
total genus 130
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2zzwA00
4OANA 4NGUA 2HPGA 2WYKA 4DI4B 4PE3A 2XWOA 4O94A 2XA5A 4OVRA 4OVQA 4MEVA 4N8YA 4UABA 2WX9A 4N4UA 4OVPA 4P47A 3B50A 4PGPA 4P56A 4LN5A 4PETA 2CEXA 4MNCA 2VPOA 4N6DA 4MIJA 4PAFA 4P1LA 4O7MA 4N91A 4O8MA 5I5PA 4P9KA 5LTCA 4PGNA 4PC9A 4PDDA 4PFBA 4P1EA 4XF5A 2V4CA 4N17A 4MCOA 5IM2A 4NX1A 4MAGA 2WYPA 5IGAA 2HZLA 2PFZA 5CM6A 2VPNA 4NN3A 4PCDA 2XWVA 4NHBA 4N15A 2HZKA 4NAPA 4PFRA 3U65A 2XXKA 4PBQA 4X04A 5I7IA 4PF6A 4DI3D 4OVTA 3FXBA 4MMPA 4MHFA 4OA4A 2CEYA 4MNIA 4PDHA 4P8BA 4PBHA 4PFIA 4OVSA 2ZZXA 4X8RA 4NQ8A 4PAIA 5IZZA 2XWIA 4MX6A 4PAKA 4PF8A 4XEQA 4N8GA 2ZZVA 4MNPA 4NG7A 4XFEA 4YZZA 2PFYA 4N6KA 4YICA 3GYYA 4P3LA 2ZZWA 2XWKA 4NF0A
chains in the Genus database with same CATH superfamily
4H8JA 2NXOA 3OEKA 1MPCA 4FATA 4R75A 3P7IA 3EKIA 3CIJA 4N4UA 4QSEA 3O2AA 2E0SA 2DP8A 3FGSA 3K6UA 1LBWA 4ZZAA 4H8IA 3LV0A 5DEXB 2H5YA 1T0KA 5K2YA 4FORA 4G61A 5TPAB 4AS4A 2I0BA 3RTWB 3T9XB 3SDFA 3CI8A 4H5GA 1FQCA 1URGA 1YXIA 4XXUA 3MP6A 4N17A 2RCBA 3PPPA 3ONMA 1NV3A 2DWHA 4EQBA 4JVDA 4JBZA 1PC3A 4NN3A 3H6TA 1R9QA 2GH9A 4I8CA 3ZSFA 3N5LA 2ONKE 4ESXA 3IOWA 3E79A 3K1MA 3LSFB 4G68A 2RINA 2YPNA 4MHFA 3N6UA 5I59B 1MG1A 4QHQA 4QFLA 4AB5A 4YB7A 3Q29A 4PFWA 2QS3A 2R8TA 4GVOA 3H3GA 4PAIA 2FVZA 1ZJLA 4PAKA 1MH4A 2I4CA 4PF8A 4DE8A 2ZZVA 2ZNUA 4OZ9A 3PU5A 4N6KA 1WVJA 2XXYA 2XXHA 4P3LA 2Q8MA 1VSOA 1BK4A 4ZEFA 2PYYA 2F97A 1JP4A 2HQ0A 4AS5A 3FVNA 4HCWA 5TU0A 4U21A 4OVQA 5H8QA 1PB9A 3E4RA 3KG2A 1EZPA 3PD9A 3FJGA 3OD7A 5BUUA 4NE4A 2Z8DA 5DT6A 3KJTA 1LFHA 1FPDA 1B3FA 3PUZE 3ILUB 1XC1A 3LSWA 4GXSB 3SEXA 4WXJA 5A5XB 5M2VA 4FAJA 4NMYA 2Q88A 2DVZA 1GV8A 4NEDA 3O97A 3MBPA 4DCXA 5IAIA 4LZ7A 3RYDA 1USYH 1I6BA 1FBEA 4BDQA 3PV0E 2MKZA 2QRYA 2CZHA 4NHBA 4PBQA 1FBCA 1YYZA 1B05A 3ZKKA 4OVJA 3VLVA 4F22A 4PF6A 2QVUA 5CMKA 2V25A 2Y7PA 3TKDA 2FIEA 1IZ1A 3U93A 4JVIA 2DXYA 1SPIA 2Y5LA 3IB0A 5CMBA 1UTHA 3M3KA 4BLAA 4DXBA 4MLQA 1Q9DA 2F7BA 2UVHA 1LCFA 3KGCA 3FUZA 3FVGA 4N8GA 3TQLA 1B5JA 4MLVA 4ELPA 3C9HA 1ELJA 4H1XA 2Y84A 5B7DA 3V83A 4AQ4A 4HE2A 4QFNA 4EXKA 3IO4A 1PDAA 3E78A 1Y3NA 4U1ZA 4NGUA 2WYKA 1IMEA 1SI1A 3B6TA 4LONB 2F7AA 5I3SA 4HXVA 5CBSA 1LBBA 3PMVA 5AA4A 1QGXA 1MM7A 4QXDA 5ICTA 1MQIA 1NL5A 3H4ZA 2THIA 4R2FA 1DPEA 1Y4TA 2V3QA 4R9FA 3CR9A 4C1UA 5EQ8A 1XOCA 3S9LC 3K1PA 2F36A 5AA2D 4O7MA 3FV2A 4P9KA 1FQDA 1QULA 3K6VA 3C34A 2AL4A 2CMOA 1IXIA 5B70A 3SKPA 1TT1A 1AIVA 2R6GE 2XXWA 1WODA 2DDKA 4IO5A 4GL0A 2I58A 3PUWE 1B5IA 3VV5A 4DXCA 4LQ2A 1FTJA 2RC8A 3TELA 4DXUA 1B1XA 4GXAA 2XXUA 2CEYA 3EN3A 2QMWA 2XXQA 1DSNA 3A09A 2DWAA 3TODA 4IO3A 3S9EA 3D4CA 4I40A 3PD8A 3H03A 3PPNA 2I49A 1LEVA 3K6XA 1KWHA 3FIRA 1SQYA 1QKAA 5DW8A 2AL5A 3QUFA 4QFOA 3OSRA 1ZBMA 4YMBA 4G8NA 1P99A 3PUXE 1M5BA 4M1VA 3KOSA 1OMPA 3QMFA 1BTJA 4P56A 3KJ7A 4PETA 1J1NA 3KN3A 2OLBA 1VFEA 1NMUA 2PBWA 3W9VA 1KA0A 4O3AA 3MJNA 4F18A 3WAFA 3G3FA 3OO7A 1Y3QA 2HXRA 5JEIA 1IXHA 1FTOA 1SW2A 2QJEA 1P1NA 4MCOA 1MH3A 3QSLA 1IMBA 2CZKA 3DM0A 3HN0A 5AA2B 1L5TA 2QMXA 4OFOA 4X1BA 1G0HA 4IY6A 3U65A 4NF8A 1SW1A 3IB1A 2WKYA 5H8FA 1IQ7A 3TCFA 3OEMA 3FXBA 3A3UA 3SETA 1MXWA 4LATA 5ET5A 2F35A 2R71A 1MQHA 4F3BA 4X8RA 1A7LA 2DQVA 4PFYA 1JQFA 5K2XA 5I58B 3C31A 3IOVA 4XEQA 1IIWA 4NG7A 3E13X 4KHZE 1IMFA 2V3UA 3T9UA 3UA8A 3RQTA 1NUXA 1B7ZA 1FPLA 1N84A 4OFJA 2O7UA 2Y7WA 3UORA 3H6UA 1UIUA 4F3PA 4DZ1A 2OZZA 4ELQA 3EPEA 4YKKA 1TFDA 1N7WA 3OOAA 4G77A 3H06B 1MQGA 1H43A 4RJZA 2OK2A 4HTGA 2REGA 2KQZA 4QBAA 4H65A 2R9JA 4N91A 2QVRA 5DEXA 3VVFA 4ZDMA 2M8CA 3FVKA 5CMMA 1NV5A 3S2VA 4GWZA 3ILTB 5EYFA 4BDNA 1Q1KA 4G8MA 4H0WA 1FJ6A 4G68C 4O7IA 3IAZA 3UP9A 1LLSA 1EU8A 4PCDA 4I1DA 5HM4B 4NAPA 5H8NB 1B0HA 2FBPA 1NH7A 1US4A 3BKIB 3W9WA 5FBPA 1KA1A 3F11A 5I59A 2OX3A 2F6PA 3CFZA 3BBRA 1P1WA 3OO8A 1EYIA 4ZECA 2X7PA 1XS5A 2H99A 1B9JA 3OO6A 3ZS6A 3IJXB 1SYIA 1Y1MA 2VD2A 2WBDA 3GZGA 4XFEA 4YZZA 5FHNA 2PFYA 2ZNSA 4YICA 4H6DA 4LZ8A 3TAJA 2VHAA 5CMCA 2HCAA 2Z8FA 4MBPA 2XWOA 1FW0A 3QUJA 4RPNA 4N13A 3RPLB 4PTKA 4NF6B 1TWYA 3G3KA 2DE2A 3DELB 5JTYB 1USYE 4P0IA 3PUVE 2OCUA 4N6DA 3HHGA 5CRYA 4F3GA 3UK4A 1XVYA 3IR1A 4O8MA 4LUBA 2H98A 4ZEBA 2PT1A 3HV1A 3MAMA 5TP9A 2O6AA 3K0VA 3K1NA 5EYHA 5ICQA 1MY4A 1FTLA 1TXFA 5I2NA 5A5XA 2D21A 5IZ1A 2ANJA 4Z7EA 3LSXA 3TEPA 1R9LA 4U4SA 5EQAA 4QSDA 3G3IA 1QKBA 2GHAA 5DVFA 2HAUA 5AA3A 1UTBB 3SESA 4F1YA 3CVGA 1SDXA 1LAFE 3PTYA 3ODBA 3IJOB 3HCQA 1A8FA 2ALUA 2B4LA 3S9NC 1YCJA 4XKQA 3TTMA 4OVSA 5KDTB 4N6PA 4EDPA 5IZZA 4Q0CA 3K2DA 1POY1 2E1SA 1OLAA 1N3WA 3WAEA 3G3JA 4OTEA 5DTBA 2XWKA 1D9YA 4PFUA 3L6GA 4OESA 3M3FA 2PMSA 3O9PA 1LFGA 2XX9A 4DI4B 1SBPA 2WBBA 1LB8A 4U1OA 4MEVA 4K3FA 4EQ7A 1B0LA 2KLFA 2OWTA 4QRZA 2I3WA 3U94A 2F8DA 1ZTYA 2RC9A 3VLUA 1VE4A 1MXUA 1Y4CA 1NI9A 1NV2A 2G93A 2DE3A 4OFLA 2XXIA 2PCRA 3OO9A 1B7UA 1UIVA 3G3HA 5EQ7A 3T1BA 4R6KA 3GXAA 3JYRA 3KC1A 3MVXA 1NV1A 1MM6A 2D3IA 1M5DA 4RK9A 4QFKA 3OSQA 2WYPA 4Q5TA 4KYSA 1N3XA 2HZLA 3MPLA 3RLFE 1N7XA 4GWUA 5CM6A 1B2HA 4F39A 4N15A 3QXMA 2HZKA 4GQOA 2Z23A 1FQAA 4DI3D 1D4NA 1URDA 2F7CA 4P8BA 4FE8A 3N6TA 3VDFA 1WDNA 1B6HA 3ZKLA 4NQ8A 2DS9A 3LUYA 4ZE9A 3D1RA 4Z0IA 3T66A 3GLBA 2I6EA 3EHTA 2XXVA 3Q25A 4GOTA 2Q9TA 2XXTA 4H5FA 1S9TA 2IA4A 4LA9A 4Q30B 2I3VA 4OANA 1MRPA 1JEUA 5KCJB 1IMCA 3BFTA 4QFPA 1JW1A 2XA5A 1FPFA 2ZYKA 1B3LA 1AMFA 1GTKA 1EZ9A 1IMDA 2FYIA 4ND9A 4F1VA 3LUZA 4KFQA 4OWDA 4PGNA 2YLNA 3VVDA 5IZ3B 4G68B 4XF5A 4JSOA 1FPKA 5BWJA 4GF8A 3CSGA 1FRPA 4R6YA 3CG3A 1BLFA 1K9YA 3O6HA 2ABHA 2I48A 2DWIA 3HSTA 1RYOA 5AA2A 3DP8A 4GBWA 3UN6A 3C36A 2DE4A 1IXGA 1RDYA 1FTAA 2A5SA 2RCAA 3RTFB 2Q2CA 1NUWA 4UA8A 1ANFA 2CZLA 4XKNA 3PPOA 3TCGA 2CZIA 1JEVA 5H8SA 4XKPA 1EZOA 2O51A 3TTKA 3THIA 4PFTA 4YMAA 1B1HA 5ITPA 2UXAA 5I58A 2F34A 2Q2AA 1PB8A 3FXRA 1JNFA 2XX8A 3JV9A 3H6WA 1NUYA 3Q28A 1LCTA 3MPKA 2NWJA 1XVXA 2A5TB 4ONYA 1D3KA 1NFTA 1II5A 1SW4A 1ZU0A 1DTGA 3GBBA 1HSJA 3OELA 4LN5A 1MDP1 1A8EA 2VPOA 5JK4A 4MIJA 3FVOA 5DVIA 1PB7A 4L17A 4R9GA 3T22A 4POWA 2FNCA 3MUQA 2VT5A 3R6UA 1Z7ME 2F6GA 4P1EA 2X7QA 4KQPA 4G4PA 1XI6A 3T96B 2Y7IA 3QK6A 5AA1A 3TCHA 2KR0A 4ZS9A 2VPNA 1FBGA 3TFLA 4OERA 4KPTA 4PFRA 3VFJA 3AXFA 1AWBA 2B65A 3T0JA 5H8NA 1IMAA 1CE2A 1YTVA 3K00A 4MH5A 4MNIA 4PDHA 1NNFA 4ZEIA 4FIMA 1OLCA 1JETA 4PP0A 4N07A 3M8UA 3B6QA 4JB7A 2XWIA 3RGYA 4X48A 1B52A 4FEDA 2I4BA 4F29A 3IORA 2L5VA 2F3BA 4NF0A 1FPGA 2HPGA 2VP1A 3DP6A 4HW8A 3KFMA 1EYKA 5L8DA 5HBCA 3PPQA 4UABA 5DVJA 4M4GA 3RPLA 4NF6A 4RY1A 4ISUA 2F78A 3V8XB 2VGQA 3OENA 5JTYA 3TZAA 1YZ0A 4U2RA 2O69A 4F3SA 4GD5A 3FD3A 4P1LA 4YKJA 5H8HB 2PX1A 2ZMBA 2V84A 3CG1A 4KD5A 5FHMA 4TLMB 3PGFA 3TDJA 4LQ5A 1CB6A 4U23A 3VXBA 3E9XA 2IEEA 2JJKA 3ROJA 2GHBA 4WEDA 3T93B 1NV0A 5HPQA 2ONRA 3U72A 3IFAA 3KOTA 3RT6B 4EF2A 1MY0A 4GX3A 1PBPA 4OXVA 1RYXA 4HE0A 1UTBA 5TPAA 2Y7RA 4OVTA 3B7DA 5F24A 1LAGE 3LBSA 3R7XA 4POXA 3U92A 2BJIA 5ELVA 3R26A 1B7HA 2RF1A 2AIXA 2HFBA 1SYHA 3G3GA 5KDTA 2DYXA 4KYDA 5DYHA 4YKPA 4GIZA 1MXVA 1O64A 1A40A 2QS1A 3FJ7A 1H3DA 1ATGA 4QF9A 4MNPA 1B3GA 2YJPA 1ZMGA 2H25A 3MVYA 4FEBA 4GLIA 2H9BA 2HEUA 2W7YA 3H7MA 2Z22A 1I69A 2GQ1A 3EQ1A 1GGGA 4PE3A 2H4IA 5I57B 1M5CA 2AYSA 4FBPA 4NF5B 1UQWA 3K01A 3S4UA 2WX9A 5I56B 4KR5A 2FHYA 1I6AA 1MDQA 1ZIUA 1FCKA 4IO4A 2O84X 2CEXA 1FBPA 3IO6A 4NF4B 4U4XA 4I3YA 4MF3A 4BDOA 1FQFA 1NV4A 4I9DA 4YKIA 5I5PA 4U22A 1RDXA 4JVCA 1FTMA 2VD3A 3QIMA 4WEPA 4OMBA 1AOVA 5I2KB 4RPOA 2P0SA 1FSAA 4MAGA 1P1UA 4GWWA 1S50A 3A3CA 2OWZA 2XXXA 5I84A 2PFZA 2ZYOA 5ET6A 3VLWA 3FXUA 4HCYA 4LVQA 1H45A 4X04A 3M3LA 3KN7A 3A29A 4RA1A 2F3DA 1LB9A 3EHUA 3HHFA 4R72A 4R2BA 2UYFA 4RNSA 1NNTA 1SD3A 1B51A 3ISPA 4UACA 5ISUA 1MY3A 2Q8JA 4DCYA 1LBCA 3CRBA 3VXCA 1R6ZA 4I3EA 1LFIA 1DK4A 2Z8EA 1LGBC 1IXCA 1S7YA 4X9TA 4F1UA 1NNKA 3O29A 1FQBA 3MZ1A 5CC2A 4O3BA 1HSEA 3N26A 1BP5A 2NVUB 5EQ9A 5KCJA 1LAHE 4OVRA 4E0XA 1B3HA 2QPQA 1XT8A 3FZVA 4GWYA 1BIYA 1MY1A 1MPBA 4KXPA 4THIA 5FHOA 2UYEA 4OEUA 4JXIA 3MP8A 1FBHA 1NH8A 4PDDA 4F19A 1B5HA 3CSBA 4JDFA 4RYAA 5CI5A 3C35A 5IZ3A 3C4MA 1I6QA 4JWXA 4NX1A 4H67A 2Y5KA 4NWCA 1VR5A 4KCCA 4IB2A 4KCDA 1FPIA 1H76A 4P11A 4LZ5A 3FATA 2HHMA 2XWVA 4ELOA 2DXRA 3TMGA 3KBRA 5EYGA 2XXKA 4IO7A 3SEWA 3K4UA 1DPPA 1SW5A 4ZZEA 2GFEA 1B3EA 3KC0A 2DWJA 1LAXA 1NUZA 4PFIA 2NUVA 3W15C 3MZ9A 3IX1A 4IO2A 3U8QA 1OVBA 3RN8A 1A99A 3U1OA 4DLDA 4EQ9A 3CFLA 4KYEA 4QSCA 3SERA 3MVZA 2XD3A 2DSFA 3TPAA 4N81A 3T9VA 1DMBA 4OHNA 2B3FA 1GVCA 5TP9B 2A5TA 4O94A 4N8YA 3HPIA 5I2NB 3GBAA 2UVGA 3PMXA 3KZGA 3MWBA 1EYJA 4OENA 3B50A 4GWSA 1AH5A 4G2ZA 4R74A 1P1QA 4NTLA 3RNNA 2B4MA 1MXZA 3HFUA 4EXLA 4DDDA 1EH3A 1OIBA 1FJ9A 5T3JA 2RC7A 2ZNTA 3N94A 3TUSA 3PMWA 5F1QA 4I62A 3RT8A 3UIFA 2O1LA 4H46A 2OWSA 1QW0A 4XKRA 3SEUA 1Z7NE 5EHSA 3IL1B 4OYVA 1US5A 4PQJA 4ESWA 3MQ9A 1A54A 3LC8A 1LBXA 4JWOA 1NV7A 1PEBA 4GWXA 3MVWA 3KBZA 4MMPA 4X1DA 4R73A 1Y3PA 2P3NA 1QUIA 2O68A 1MY2A 1LBVA 1M5FA 1RDZA 1NKXA 4FECA 1Y20A 2P2AA 5L9MA 1LSTA 4MJOA 4GX6A 5ET8A 1F9BA 3FV1A 1YPNA 2ZXTA 2OBGA 3DLNA 2FA7A 2XXRA 4IY5A 2OJTA 4DIGA 4C0RA 4BDLA 3TTLA 3GYYA 1JW4A 3Q26A 3OMBA 4TLLB 3K6WA 2O7IA 4NWDA 3TTRA 1PBQA 3L6HA 3MC2A 5H8QB 2QL3A 4XIGQ 3V5AA 1QJMA 1N76A 1TFAA 4RK2A 3C32A 1INPA 1MQJA 1NV6A 4P47A 2XHDA 4PGPA 3Q27A 1MQDA 3RPWA 5L9OA 3PUYE 4G8HA 3EHSA 5CBRA 1B32A 4IGRA 3SEYA 5ITOA 3MYUA 3PPRA 4ZEKA 4ECFA 2D5WA 2F5XA 3O6IA 4PC9A 2QS2A 1FBDA 3KSXA 3K02A 4PFBA 5FTHA 5H8HA 1IEJA 1O7TA 4LP2B 2QVVA 3DP4A 1Y1ZA 2XX7A 3O28A 1OVTA 3IK6B 1IITA 5IM2A 1ZLQA 4EF1A 3NOHA 4GRKA 2Q89A 2ZYNA 3MW0A 1XHYA 1DBZA 3G7WA 4ZE8A 3FXQA 1B58A 3LSLA 5EHMA 2P1SA 1KZ8A 1MS7A 1FTKA 3IOUA 5IKBA 4C1TA 3H6VA 4OEVA 3KSJA 4GWOA 1UTHB 3QYTA 4F2OA 3CFXA 3O66A 1GR2A 1ZKBA 4E0WA 2V93A 3BFUA 4MX6A 2RKMA 5A5LA 3BIGA 1FPBA 3MZBA 1POTA 2P3VA 1IUDA 2ZZWA 3O6GA 4F31B 2ZYMA 1YAEA 5I57A 2UVIA 4GBVA 1NNPA 2O1MA 5AE4A 3QAXA 4NF5A 5AA4B 3CHGA 1QUJA 2DOJA 5I56A 4TQUQ 4RXLA 2XD2A 1QUKA 3V89B 4GL8A 1Q35A 1R1NA 3MP1A 2HXWA 4P0GA 5FTIA 1OQHA 4TOZA 4NF4A 1MPDA 2FIXA 3B8BA 4AB6A 4JSDA 1B4HA 1N0TA 2BJJX 5LOMA 1B40A 1DCUA 2V4CA 3T9HB 4PE5B 3HO7A 5I2KA 4EUOA 1A55A 3OXNA 2PVUA 2VOZA 5IGAA 2ONSA 1N04A 2REJA 3IB2A 1FBFA 4GX4A 4GFRA 3LR1A 4ZEDA 5I7IA 1B46A 3FJMA 3VE1B 1JVYA 4F2QA 1P1OA 1CNQA 3E3KA 4O3CA 3TQWA 3RUMA 1JW5A 4BDRA 2G29A 3I5OA 1D9VA 1URSA 2QSXA 3D4GA 3VVEA 1Y9UA 1QVSA 2WEFA 1FQEA 3IOTA 3FASA 4OQOA 2B3BA 2LAOA 5LDZA 1G0IA 2X26A 2GRVA 1B4ZA 2PT2A 3USDA 3S9MC 4XTCQ 3C33A 1DTZA 1OQGA 5KZTA 2HAVA 1RKMA 3I3VA 1FPJA 4YB5A 4OVPA 4HS7A 2V3TA 2XXPA 4IR8A 3B6WA 4YU0A 1D9QA 4MNCA 1DOTA 2I0CA 3UGWA 5J16A 3TYHA 3ECRA 4PAFA 3TTNA 4MFIA 4KI0E 1JVXA 5LTCA 1K9ZA 4WKMA 3EF7A 3FBPA 5F7VA 1VFDA 3KEIA 4H45A 4YB6A 5ET7A 3SEVA 1MXYA 4BDMA 1BKAA 4OETA 2UVJA 2QFLA 1FPEA 3RY3A 1H44A 3BIHA 4ELRA 1LBYA 5J1DA 4NF8B 3IFCA 3MSTA 5H8FB 1MXXA 2Q74A 4FJPA 2Y7KA 1SI0A 4YAHX 4OA4A 4HE1A 2NOOA 4PBHA 4Q8RA 5L9SA 2ZZXA 3I6VA 2DVCA 1AL3A 1SVXB 2QS4A 3KN8A 4IGTA 2ESNA 4JWYA 1LBZA 1M5EA 3SZPA 4IO6A 1O63A 3JZJA 5ESYA 1VDWA 1HSLA 4R6HA
chains in the Genus database with same CATH topology
4O94A 3EKIA 4N8YA 4N4UA 1EYJA 3B50A 4GWSA 4LN5A 1LBWA 2VPOA 5JK4A 2KQZA 4QBAA 4MIJA 2B4MA 3LV0A 4N91A 2QVRA 3HFUA 4G61A 2VT5A 1FJ9A 5T3JA 4AS4A 4P1EA 4H46A 1YXIA 1NV5A 4N17A 1XI6A 4GWZA 1NV3A 1FJ6A 4O7IA 4JVDA 2KR0A 2VPNA 4NN3A 1FBGA 4PCDA 1LBXA 4NAPA 4PFRA 1AWBA 3T0JA 2FBPA 1NV7A 3E79A 1IMAA 4GWXA 3KBZA 4MHFA 4MMPA 4MNIA 2P3NA 3W9WA 4PDHA 5FBPA 1KA1A 1LBVA 2R8TA 1RDZA 2OX3A 4MJOA 4GX6A 1EYIA 4PAIA 2FVZA 5ET8A 2XWIA 4PAKA 4PF8A 2ZZVA 2WBDA 4XFEA 4YZZA 2PFYA 4N6KA 4YICA 3GYYA 4P3LA 2Q8MA 2L5VA 1BK4A 2F3BA 1JP4A 4NF0A 1FPGA 2HPGA 4AS5A 2XWOA 1EYKA 4HCWA 4OVQA 3RPLB 4PTKA 4UABA 1INPA 2DE2A 1NV6A 3RPLA 4P47A 4PGPA 1YZ0A 1FPDA 4N6DA 3MYUA 4P1LA 4O8MA 2F5XA 4PC9A 1FBDA 5EYHA 4PFBA 2QVVA 2DVZA 2JJKA 5IM2A 5IZ1A 3ROJA 3NOHA 3RYDA 1NV0A 5EQAA 3IFAA 1FBEA 4GX3A 2MKZA 2CZHA 4NHBA 1DBZA 4PBQA 1FBCA 1YYZA 4HE0A 4PF6A 4OVTA 3PTYA 1KZ8A 2QVUA 5F24A 2FIEA 4JVIA 2BJIA 2B4LA 1SPIA 2Y5LA 4OVSA 1Q9DA 5IZZA 4MX6A 5A5LA 4N8GA 3BIGA 4MNPA 1FPBA 2P3VA 2ZZWA 2GQ1A 4HE2A 2XWKA 3E78A 4NGUA 2WYKA 1IMEA 4DI4B 4PE3A 4FBPA 2WBBA 5I3SA 4HXVA 4MEVA 4GBVA 2WX9A 3CHGA 2FHYA 1QGXA 4QXDA 2CEXA 1FBPA 2V3QA 4I3YA 5EQ8A 1NV4A 1NI9A 1NV2A 4O7MA 2FIXA 2DE3A 3B8BA 5I5PA 4P9KA 1RDXA 4JVCA 2PCRA 5EQ7A 3T1BA 1DCUA 2V4CA 3KC1A 1NV1A 1FSAA 4MAGA 2WYPA 4GWWA 5IGAA 2OWZA 2HZLA 2PFZA 4GWUA 2DDKA 5CM6A 5ET6A 1FBFA 4GX4A 4N15A 4HCYA 2HZKA 4X04A 5I7IA 3A29A 4DI3D 2F3DA 2CEYA 4P8BA 1CNQA 3ISPA 4NQ8A 4I3EA 1DK4A 3D1RA 2WEFA 4I40A 4X9TA 4F1UA 1LEVA 2Q9TA 5LDZA 1G0IA 5DW8A 4OANA 1IMCA 5EQ9A 2XA5A 1FPFA 4OVRA 1FPJA 2QPQA 4OVPA 4M1VA 4GWYA 4IR8A 3QMFA 4P56A 4KXPA 4PETA 1D9QA 4MNCA 1IMDA 4F1VA 3LUZA 3W9VA 5J16A 1KA0A 4PAFA 1FBHA 5LTCA 1K9ZA 4PGNA 3FBPA 4PDDA 4F19A 4F18A 5IZ3B 4H45A 5IZ3A 4XF5A 5ET7A 2HXRA 1FPKA 4MCOA 1FRPA 4NX1A 2Y5KA 1IMBA 2CZKA 1K9YA 2QFLA 1FPEA 1FPIA 3BIHA 1LBYA 5J1DA 2HHMA 2XWVA 1G0HA 3IFCA 3MSTA 3U65A 5EYGA 2XXKA 4GBWA 2Q74A 2DE4A 1RDYA 1FTAA 3FXBA 3KC0A 1NUWA 4OA4A 4HE1A 4PBHA 2CZIA 1NUZA 4PFIA 2ZZXA 5ET5A 4X8RA 4XEQA 1LBZA 4NG7A 3SZPA 5ESYA 1VDWA 1IMFA 4N81A 1NUYA 1NUXA 1FPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAN A;  4NGU A;  2HPG A;  2WYK A;  4DI4 B;  4PE3 A;  2XWO A;  4O94 A;  2XA5 A;  4OVR A;  4OVQ A;  4MEV A;  4N8Y A;  4UAB A;  2WX9 A;  4N4U A;  4OVP A;  4P47 A;  3B50 A;  4PGP A;  4P56 A;  4LN5 A;  4PET A;  2CEX A;  4MNC A;  2VPO A;  4N6D A;  4MIJ A;  4PAF A;  4P1L A;  4O7M A;  4N91 A;  4O8M A;  5I5P A;  4P9K A;  5LTC A;  4PGN A;  4PC9 A;  4PDD A;  4PFB A;  4P1E A;  4XF5 A;  2V4C A;  4N17 A;  4MCO A;  5IM2 A;  4NX1 A;  4MAG A;  2WYP A;  5IGA A;  2HZL A;  2PFZ A;  5CM6 A;  2VPN A;  4NN3 A;  4PCD A;  2XWV A;  4NHB A;  4N15 A;  2HZK A;  4NAP A;  4PFR A;  3U65 A;  2XXK A;  4PBQ A;  4X04 A;  5I7I A;  4PF6 A;  4DI3 D;  4OVT A;  3FXB A;  4MMP A;  4MHF A;  4OA4 A;  2CEY A;  4MNI A;  4PDH A;  4P8B A;  4PBH A;  4PFI A;  4OVS A;  2ZZX A;  4X8R A;  4NQ8 A;  4PAI A;  5IZZ A;  2XWI A;  4MX6 A;  4PAK A;  4PF8 A;  4XEQ A;  4N8G A;  2ZZV A;  4MNP A;  4NG7 A;  4XFE A;  4YZZ A;  2PFY A;  4N6K A;  4YIC A;  3GYY A;  4P3L A;  2ZZW A;  2XWK A;  4NF0 A; 
#chains in the Genus database with same CATH topology
 4H8J A;  2NXO A;  3OEK A;  1MPC A;  4FAT A;  4R75 A;  3P7I A;  3EKI A;  3CIJ A;  4N4U A;  4QSE A;  3O2A A;  2E0S A;  2DP8 A;  3FGS A;  3K6U A;  1LBW A;  4ZZA A;  4H8I A;  3LV0 A;  5DEX B;  2H5Y A;  1T0K A;  5K2Y A;  4FOR A;  4G61 A;  5TPA B;  4AS4 A;  2I0B A;  3RTW B;  3T9X B;  3SDF A;  3CI8 A;  4H5G A;  1FQC A;  1URG A;  1YXI A;  4XXU A;  3MP6 A;  4N17 A;  2RCB A;  3PPP A;  3ONM A;  1NV3 A;  2DWH A;  4EQB A;  4JVD A;  4JBZ A;  1PC3 A;  4NN3 A;  3H6T A;  1R9Q A;  2GH9 A;  4I8C A;  3ZSF A;  3N5L A;  2ONK E;  4ESX A;  3IOW A;  3E79 A;  3K1M A;  3LSF B;  4G68 A;  2RIN A;  2YPN A;  4MHF A;  3N6U A;  5I59 B;  1MG1 A;  4QHQ A;  4QFL A;  4AB5 A;  4YB7 A;  3Q29 A;  4PFW A;  2QS3 A;  2R8T A;  4GVO A;  3H3G A;  4PAI A;  2FVZ A;  1ZJL A;  4PAK A;  1MH4 A;  2I4C A;  4PF8 A;  4DE8 A;  2ZZV A;  2ZNU A;  4OZ9 A;  3PU5 A;  4N6K A;  1WVJ A;  2XXY A;  2XXH A;  4P3L A;  2Q8M A;  1VSO A;  1BK4 A;  4ZEF A;  2PYY A;  2F97 A;  1JP4 A;  2HQ0 A;  4AS5 A;  3FVN A;  4HCW A;  5TU0 A;  4U21 A;  4OVQ A;  5H8Q A;  1PB9 A;  3E4R A;  3KG2 A;  1EZP A;  3PD9 A;  3FJG A;  3OD7 A;  5BUU A;  4NE4 A;  2Z8D A;  5DT6 A;  3KJT A;  1LFH A;  1FPD A;  1B3F A;  3PUZ E;  3ILU B;  1XC1 A;  3LSW A;  4GXS B;  3SEX A;  4WXJ A;  5A5X B;  5M2V A;  4FAJ A;  4NMY A;  2Q88 A;  2DVZ A;  1GV8 A;  4NED A;  3O97 A;  3MBP A;  4DCX A;  5IAI A;  4LZ7 A;  3RYD A;  1USY H;  1I6B A;  1FBE A;  4BDQ A;  3PV0 E;  2MKZ A;  2QRY A;  2CZH A;  4NHB A;  4PBQ A;  1FBC A;  1YYZ A;  1B05 A;  3ZKK A;  4OVJ A;  3VLV A;  4F22 A;  4PF6 A;  2QVU A;  5CMK A;  2V25 A;  2Y7P A;  3TKD A;  2FIE A;  1IZ1 A;  3U93 A;  4JVI A;  2DXY A;  1SPI A;  2Y5L A;  3IB0 A;  5CMB A;  1UTH A;  3M3K A;  4BLA A;  4DXB A;  4MLQ A;  1Q9D A;  2F7B A;  2UVH A;  1LCF A;  3KGC A;  3FUZ A;  3FVG A;  4N8G A;  3TQL A;  1B5J A;  4MLV A;  4ELP A;  3C9H A;  1ELJ A;  4H1X A;  2Y84 A;  5B7D A;  3V83 A;  4AQ4 A;  4HE2 A;  4QFN A;  4EXK A;  3IO4 A;  1PDA A;  3E78 A;  1Y3N A;  4U1Z A;  4NGU A;  2WYK A;  1IME A;  1SI1 A;  3B6T A;  4LON B;  2F7A A;  5I3S A;  4HXV A;  5CBS A;  1LBB A;  3PMV A;  5AA4 A;  1QGX A;  1MM7 A;  4QXD A;  5ICT A;  1MQI A;  1NL5 A;  3H4Z A;  2THI A;  4R2F A;  1DPE A;  1Y4T A;  2V3Q A;  4R9F A;  3CR9 A;  4C1U A;  5EQ8 A;  1XOC A;  3S9L C;  3K1P A;  2F36 A;  5AA2 D;  4O7M A;  3FV2 A;  4P9K A;  1FQD A;  1QUL A;  3K6V A;  3C34 A;  2AL4 A;  2CMO A;  1IXI A;  5B70 A;  3SKP A;  1TT1 A;  1AIV A;  2R6G E;  2XXW A;  1WOD A;  2DDK A;  4IO5 A;  4GL0 A;  2I58 A;  3PUW E;  1B5I A;  3VV5 A;  4DXC A;  4LQ2 A;  1FTJ A;  2RC8 A;  3TEL A;  4DXU A;  1B1X A;  4GXA A;  2XXU A;  2CEY A;  3EN3 A;  2QMW A;  2XXQ A;  1DSN A;  3A09 A;  2DWA A;  3TOD A;  4IO3 A;  3S9E A;  3D4C A;  4I40 A;  3PD8 A;  3H03 A;  3PPN A;  2I49 A;  1LEV A;  3K6X A;  1KWH A;  3FIR A;  1SQY A;  1QKA A;  5DW8 A;  2AL5 A;  3QUF A;  4QFO A;  3OSR A;  1ZBM A;  4YMB A;  4G8N A;  1P99 A;  3PUX E;  1M5B A;  4M1V A;  3KOS A;  1OMP A;  3QMF A;  1BTJ A;  4P56 A;  3KJ7 A;  4PET A;  1J1N A;  3KN3 A;  2OLB A;  1VFE A;  1NMU A;  2PBW A;  3W9V A;  1KA0 A;  4O3A A;  3MJN A;  4F18 A;  3WAF A;  3G3F A;  3OO7 A;  1Y3Q A;  2HXR A;  5JEI A;  1IXH A;  1FTO A;  1SW2 A;  2QJE A;  1P1N A;  4MCO A;  1MH3 A;  3QSL A;  1IMB A;  2CZK A;  3DM0 A;  3HN0 A;  5AA2 B;  1L5T A;  2QMX A;  4OFO A;  4X1B A;  1G0H A;  4IY6 A;  3U65 A;  4NF8 A;  1SW1 A;  3IB1 A;  2WKY A;  5H8F A;  1IQ7 A;  3TCF A;  3OEM A;  3FXB A;  3A3U A;  3SET A;  1MXW A;  4LAT A;  5ET5 A;  2F35 A;  2R71 A;  1MQH A;  4F3B A;  4X8R A;  1A7L A;  2DQV A;  4PFY A;  1JQF A;  5K2X A;  5I58 B;  3C31 A;  3IOV A;  4XEQ A;  1IIW A;  4NG7 A;  3E13 X;  4KHZ E;  1IMF A;  2V3U A;  3T9U A;  3UA8 A;  3RQT A;  1NUX A;  1B7Z A;  1FPL A;  1N84 A;  4OFJ A;  2O7U A;  2Y7W A;  3UOR A;  3H6U A;  1UIU A;  4F3P A;  4DZ1 A;  2OZZ A;  4ELQ A;  3EPE A;  4YKK A;  1TFD A;  1N7W A;  3OOA A;  4G77 A;  3H06 B;  1MQG A;  1H43 A;  4RJZ A;  2OK2 A;  4HTG A;  2REG A;  2KQZ A;  4QBA A;  4H65 A;  2R9J A;  4N91 A;  2QVR A;  5DEX A;  3VVF A;  4ZDM A;  2M8C A;  3FVK A;  5CMM A;  1NV5 A;  3S2V A;  4GWZ A;  3ILT B;  5EYF A;  4BDN A;  1Q1K A;  4G8M A;  4H0W A;  1FJ6 A;  4G68 C;  4O7I A;  3IAZ A;  3UP9 A;  1LLS A;  1EU8 A;  4PCD A;  4I1D A;  5HM4 B;  4NAP A;  5H8N B;  1B0H A;  2FBP A;  1NH7 A;  1US4 A;  3BKI B;  3W9W A;  5FBP A;  1KA1 A;  3F11 A;  5I59 A;  2OX3 A;  2F6P A;  3CFZ A;  3BBR A;  1P1W A;  3OO8 A;  1EYI A;  4ZEC A;  2X7P A;  1XS5 A;  2H99 A;  1B9J A;  3OO6 A;  3ZS6 A;  3IJX B;  1SYI A;  1Y1M A;  2VD2 A;  2WBD A;  3GZG A;  4XFE A;  4YZZ A;  5FHN A;  2PFY A;  2ZNS A;  4YIC A;  4H6D A;  4LZ8 A;  3TAJ A;  2VHA A;  5CMC A;  2HCA A;  2Z8F A;  4MBP A;  2XWO A;  1FW0 A;  3QUJ A;  4RPN A;  4N13 A;  3RPL B;  4PTK A;  4NF6 B;  1TWY A;  3G3K A;  2DE2 A;  3DEL B;  5JTY B;  1USY E;  4P0I A;  3PUV E;  2OCU A;  4N6D A;  3HHG A;  5CRY A;  4F3G A;  3UK4 A;  1XVY A;  3IR1 A;  4O8M A;  4LUB A;  2H98 A;  4ZEB A;  2PT1 A;  3HV1 A;  3MAM A;  5TP9 A;  2O6A A;  3K0V A;  3K1N A;  5EYH A;  5ICQ A;  1MY4 A;  1FTL A;  1TXF A;  5I2N A;  5A5X A;  2D21 A;  5IZ1 A;  2ANJ A;  4Z7E A;  3LSX A;  3TEP A;  1R9L A;  4U4S A;  5EQA A;  4QSD A;  3G3I A;  1QKB A;  2GHA A;  5DVF A;  2HAU A;  5AA3 A;  1UTB B;  3SES A;  4F1Y A;  3CVG A;  1SDX A;  1LAF E;  3PTY A;  3ODB A;  3IJO B;  3HCQ A;  1A8F A;  2ALU A;  2B4L A;  3S9N C;  1YCJ A;  4XKQ A;  3TTM A;  4OVS A;  5KDT B;  4N6P A;  4EDP A;  5IZZ A;  4Q0C A;  3K2D A;  1POY 1;  2E1S A;  1OLA A;  1N3W A;  3WAE A;  3G3J A;  4OTE A;  5DTB A;  2XWK A;  1D9Y A;  4PFU A;  3L6G A;  4OES A;  3M3F A;  2PMS A;  3O9P A;  1LFG A;  2XX9 A;  4DI4 B;  1SBP A;  2WBB A;  1LB8 A;  4U1O A;  4MEV A;  4K3F A;  4EQ7 A;  1B0L A;  2KLF A;  2OWT A;  4QRZ A;  2I3W A;  3U94 A;  2F8D A;  1ZTY A;  2RC9 A;  3VLU A;  1VE4 A;  1MXU A;  1Y4C A;  1NI9 A;  1NV2 A;  2G93 A;  2DE3 A;  4OFL A;  2XXI A;  2PCR A;  3OO9 A;  1B7U A;  1UIV A;  3G3H A;  5EQ7 A;  3T1B A;  4R6K A;  3GXA A;  3JYR A;  3KC1 A;  3MVX A;  1NV1 A;  1MM6 A;  2D3I A;  1M5D A;  4RK9 A;  4QFK A;  3OSQ A;  2WYP A;  4Q5T A;  4KYS A;  1N3X A;  2HZL A;  3MPL A;  3RLF E;  1N7X A;  4GWU A;  5CM6 A;  1B2H A;  4F39 A;  4N15 A;  3QXM A;  2HZK A;  4GQO A;  2Z23 A;  1FQA A;  4DI3 D;  1D4N A;  1URD A;  2F7C A;  4P8B A;  4FE8 A;  3N6T A;  3VDF A;  1WDN A;  1B6H A;  3ZKL A;  4NQ8 A;  2DS9 A;  3LUY A;  4ZE9 A;  3D1R A;  4Z0I A;  3T66 A;  3GLB A;  2I6E A;  3EHT A;  2XXV A;  3Q25 A;  4GOT A;  2Q9T A;  2XXT A;  4H5F A;  1S9T A;  2IA4 A;  4LA9 A;  4Q30 B;  2I3V A;  4OAN A;  1MRP A;  1JEU A;  5KCJ B;  1IMC A;  3BFT A;  4QFP A;  1JW1 A;  2XA5 A;  1FPF A;  2ZYK A;  1B3L A;  1AMF A;  1GTK A;  1EZ9 A;  1IMD A;  2FYI A;  4ND9 A;  4F1V A;  3LUZ A;  4KFQ A;  4OWD A;  4PGN A;  2YLN A;  3VVD A;  5IZ3 B;  4G68 B;  4XF5 A;  4JSO A;  1FPK A;  5BWJ A;  4GF8 A;  3CSG A;  1FRP A;  4R6Y A;  3CG3 A;  1BLF A;  1K9Y A;  3O6H A;  2ABH A;  2I48 A;  2DWI A;  3HST A;  1RYO A;  5AA2 A;  3DP8 A;  4GBW A;  3UN6 A;  3C36 A;  2DE4 A;  1IXG A;  1RDY A;  1FTA A;  2A5S A;  2RCA A;  3RTF B;  2Q2C A;  1NUW A;  4UA8 A;  1ANF A;  2CZL A;  4XKN A;  3PPO A;  3TCG A;  2CZI A;  1JEV A;  5H8S A;  4XKP A;  1EZO A;  2O51 A;  3TTK A;  3THI A;  4PFT A;  4YMA A;  1B1H A;  5ITP A;  2UXA A;  5I58 A;  2F34 A;  2Q2A A;  1PB8 A;  3FXR A;  1JNF A;  2XX8 A;  3JV9 A;  3H6W A;  1NUY A;  3Q28 A;  1LCT A;  3MPK A;  2NWJ A;  1XVX A;  2A5T B;  4ONY A;  1D3K A;  1NFT A;  1II5 A;  1SW4 A;  1ZU0 A;  1DTG A;  3GBB A;  1HSJ A;  3OEL A;  4LN5 A;  1MDP 1;  1A8E A;  2VPO A;  5JK4 A;  4MIJ A;  3FVO A;  5DVI A;  1PB7 A;  4L17 A;  4R9G A;  3T22 A;  4POW A;  2FNC A;  3MUQ A;  2VT5 A;  3R6U A;  1Z7M E;  2F6G A;  4P1E A;  2X7Q A;  4KQP A;  4G4P A;  1XI6 A;  3T96 B;  2Y7I A;  3QK6 A;  5AA1 A;  3TCH A;  2KR0 A;  4ZS9 A;  2VPN A;  1FBG A;  3TFL A;  4OER A;  4KPT A;  4PFR A;  3VFJ A;  3AXF A;  1AWB A;  2B65 A;  3T0J A;  5H8N A;  1IMA A;  1CE2 A;  1YTV A;  3K00 A;  4MH5 A;  4MNI A;  4PDH A;  1NNF A;  4ZEI A;  4FIM A;  1OLC A;  1JET A;  4PP0 A;  4N07 A;  3M8U A;  3B6Q A;  4JB7 A;  2XWI A;  3RGY A;  4X48 A;  1B52 A;  4FED A;  2I4B A;  4F29 A;  3IOR A;  2L5V A;  2F3B A;  4NF0 A;  1FPG A;  2HPG A;  2VP1 A;  3DP6 A;  4HW8 A;  3KFM A;  1EYK A;  5L8D A;  5HBC A;  3PPQ A;  4UAB A;  5DVJ A;  4M4G A;  3RPL A;  4NF6 A;  4RY1 A;  4ISU A;  2F78 A;  3V8X B;  2VGQ A;  3OEN A;  5JTY A;  3TZA A;  1YZ0 A;  4U2R A;  2O69 A;  4F3S A;  4GD5 A;  3FD3 A;  4P1L A;  4YKJ A;  5H8H B;  2PX1 A;  2ZMB A;  2V84 A;  3CG1 A;  4KD5 A;  5FHM A;  4TLM B;  3PGF A;  3TDJ A;  4LQ5 A;  1CB6 A;  4U23 A;  3VXB A;  3E9X A;  2IEE A;  2JJK A;  3ROJ A;  2GHB A;  4WED A;  3T93 B;  1NV0 A;  5HPQ A;  2ONR A;  3U72 A;  3IFA A;  3KOT A;  3RT6 B;  4EF2 A;  1MY0 A;  4GX3 A;  1PBP A;  4OXV A;  1RYX A;  4HE0 A;  1UTB A;  5TPA A;  2Y7R A;  4OVT A;  3B7D A;  5F24 A;  1LAG E;  3LBS A;  3R7X A;  4POX A;  3U92 A;  2BJI A;  5ELV A;  3R26 A;  1B7H A;  2RF1 A;  2AIX A;  2HFB A;  1SYH A;  3G3G A;  5KDT A;  2DYX A;  4KYD A;  5DYH A;  4YKP A;  4GIZ A;  1MXV A;  1O64 A;  1A40 A;  2QS1 A;  3FJ7 A;  1H3D A;  1ATG A;  4QF9 A;  4MNP A;  1B3G A;  2YJP A;  1ZMG A;  2H25 A;  3MVY A;  4FEB A;  4GLI A;  2H9B A;  2HEU A;  2W7Y A;  3H7M A;  2Z22 A;  1I69 A;  2GQ1 A;  3EQ1 A;  1GGG A;  4PE3 A;  2H4I A;  5I57 B;  1M5C A;  2AYS A;  4FBP A;  4NF5 B;  1UQW A;  3K01 A;  3S4U A;  2WX9 A;  5I56 B;  4KR5 A;  2FHY A;  1I6A A;  1MDQ A;  1ZIU A;  1FCK A;  4IO4 A;  2O84 X;  2CEX A;  1FBP A;  3IO6 A;  4NF4 B;  4U4X A;  4I3Y A;  4MF3 A;  4BDO A;  1FQF A;  1NV4 A;  4I9D A;  4YKI A;  5I5P A;  4U22 A;  1RDX A;  4JVC A;  1FTM A;  2VD3 A;  3QIM A;  4WEP A;  4OMB A;  1AOV A;  5I2K B;  4RPO A;  2P0S A;  1FSA A;  4MAG A;  1P1U A;  4GWW A;  1S50 A;  3A3C A;  2OWZ A;  2XXX A;  5I84 A;  2PFZ A;  2ZYO A;  5ET6 A;  3VLW A;  3FXU A;  4HCY A;  4LVQ A;  1H45 A;  4X04 A;  3M3L A;  3KN7 A;  3A29 A;  4RA1 A;  2F3D A;  1LB9 A;  3EHU A;  3HHF A;  4R72 A;  4R2B A;  2UYF A;  4RNS A;  1NNT A;  1SD3 A;  1B51 A;  3ISP A;  4UAC A;  5ISU A;  1MY3 A;  2Q8J A;  4DCY A;  1LBC A;  3CRB A;  3VXC A;  1R6Z A;  4I3E A;  1LFI A;  1DK4 A;  2Z8E A;  1LGB C;  1IXC A;  1S7Y A;  4X9T A;  4F1U A;  1NNK A;  3O29 A;  1FQB A;  3MZ1 A;  5CC2 A;  4O3B A;  1HSE A;  3N26 A;  1BP5 A;  2NVU B;  5EQ9 A;  5KCJ A;  1LAH E;  4OVR A;  4E0X A;  1B3H A;  2QPQ A;  1XT8 A;  3FZV A;  4GWY A;  1BIY A;  1MY1 A;  1MPB A;  4KXP A;  4THI A;  5FHO A;  2UYE A;  4OEU A;  4JXI A;  3MP8 A;  1FBH A;  1NH8 A;  4PDD A;  4F19 A;  1B5H A;  3CSB A;  4JDF A;  4RYA A;  5CI5 A;  3C35 A;  5IZ3 A;  3C4M A;  1I6Q A;  4JWX A;  4NX1 A;  4H67 A;  2Y5K A;  4NWC A;  1VR5 A;  4KCC A;  4IB2 A;  4KCD A;  1FPI A;  1H76 A;  4P11 A;  4LZ5 A;  3FAT A;  2HHM A;  2XWV A;  4ELO A;  2DXR A;  3TMG A;  3KBR A;  5EYG A;  2XXK A;  4IO7 A;  3SEW A;  3K4U A;  1DPP A;  1SW5 A;  4ZZE A;  2GFE A;  1B3E A;  3KC0 A;  2DWJ A;  1LAX A;  1NUZ A;  4PFI A;  2NUV A;  3W15 C;  3MZ9 A;  3IX1 A;  4IO2 A;  3U8Q A;  1OVB A;  3RN8 A;  1A99 A;  3U1O A;  4DLD A;  4EQ9 A;  3CFL A;  4KYE A;  4QSC A;  3SER A;  3MVZ A;  2XD3 A;  2DSF A;  3TPA A;  4N81 A;  3T9V A;  1DMB A;  4OHN A;  2B3F A;  1GVC A;  5TP9 B;  2A5T A;  4O94 A;  4N8Y A;  3HPI A;  5I2N B;  3GBA A;  2UVG A;  3PMX A;  3KZG A;  3MWB A;  1EYJ A;  4OEN A;  3B50 A;  4GWS A;  1AH5 A;  4G2Z A;  4R74 A;  1P1Q A;  4NTL A;  3RNN A;  2B4M A;  1MXZ A;  3HFU A;  4EXL A;  4DDD A;  1EH3 A;  1OIB A;  1FJ9 A;  5T3J A;  2RC7 A;  2ZNT A;  3N94 A;  3TUS A;  3PMW A;  5F1Q A;  4I62 A;  3RT8 A;  3UIF A;  2O1L A;  4H46 A;  2OWS A;  1QW0 A;  4XKR A;  3SEU A;  1Z7N E;  5EHS A;  3IL1 B;  4OYV A;  1US5 A;  4PQJ A;  4ESW A;  3MQ9 A;  1A54 A;  3LC8 A;  1LBX A;  4JWO A;  1NV7 A;  1PEB A;  4GWX A;  3MVW A;  3KBZ A;  4MMP A;  4X1D A;  4R73 A;  1Y3P A;  2P3N A;  1QUI A;  2O68 A;  1MY2 A;  1LBV A;  1M5F A;  1RDZ A;  1NKX A;  4FEC A;  1Y20 A;  2P2A A;  5L9M A;  1LST A;  4MJO A;  4GX6 A;  5ET8 A;  1F9B A;  3FV1 A;  1YPN A;  2ZXT A;  2OBG A;  3DLN A;  2FA7 A;  2XXR A;  4IY5 A;  2OJT A;  4DIG A;  4C0R A;  4BDL A;  3TTL A;  3GYY A;  1JW4 A;  3Q26 A;  3OMB A;  4TLL B;  3K6W A;  2O7I A;  4NWD A;  3TTR A;  1PBQ A;  3L6H A;  3MC2 A;  5H8Q B;  2QL3 A;  4XIG Q;  3V5A A;  1QJM A;  1N76 A;  1TFA A;  4RK2 A;  3C32 A;  1INP A;  1MQJ A;  1NV6 A;  4P47 A;  2XHD A;  4PGP A;  3Q27 A;  1MQD A;  3RPW A;  5L9O A;  3PUY E;  4G8H A;  3EHS A;  5CBR A;  1B32 A;  4IGR A;  3SEY A;  5ITO A;  3MYU A;  3PPR A;  4ZEK A;  4ECF A;  2D5W A;  2F5X A;  3O6I A;  4PC9 A;  2QS2 A;  1FBD A;  3KSX A;  3K02 A;  4PFB A;  5FTH A;  5H8H A;  1IEJ A;  1O7T A;  4LP2 B;  2QVV A;  3DP4 A;  1Y1Z A;  2XX7 A;  3O28 A;  1OVT A;  3IK6 B;  1IIT A;  5IM2 A;  1ZLQ A;  4EF1 A;  3NOH A;  4GRK A;  2Q89 A;  2ZYN A;  3MW0 A;  1XHY A;  1DBZ A;  3G7W A;  4ZE8 A;  3FXQ A;  1B58 A;  3LSL A;  5EHM A;  2P1S A;  1KZ8 A;  1MS7 A;  1FTK A;  3IOU A;  5IKB A;  4C1T A;  3H6V A;  4OEV A;  3KSJ A;  4GWO A;  1UTH B;  3QYT A;  4F2O A;  3CFX A;  3O66 A;  1GR2 A;  1ZKB A;  4E0W A;  2V93 A;  3BFU A;  4MX6 A;  2RKM A;  5A5L A;  3BIG A;  1FPB A;  3MZB A;  1POT A;  2P3V A;  1IUD A;  2ZZW A;  3O6G A;  4F31 B;  2ZYM A;  1YAE A;  5I57 A;  2UVI A;  4GBV A;  1NNP A;  2O1M A;  5AE4 A;  3QAX A;  4NF5 A;  5AA4 B;  3CHG A;  1QUJ A;  2DOJ A;  5I56 A;  4TQU Q;  4RXL A;  2XD2 A;  1QUK A;  3V89 B;  4GL8 A;  1Q35 A;  1R1N A;  3MP1 A;  2HXW A;  4P0G A;  5FTI A;  1OQH A;  4TOZ A;  4NF4 A;  1MPD A;  2FIX A;  3B8B A;  4AB6 A;  4JSD A;  1B4H A;  1N0T A;  2BJJ X;  5LOM A;  1B40 A;  1DCU A;  2V4C A;  3T9H B;  4PE5 B;  3HO7 A;  5I2K A;  4EUO A;  1A55 A;  3OXN A;  2PVU A;  2VOZ A;  5IGA A;  2ONS A;  1N04 A;  2REJ A;  3IB2 A;  1FBF A;  4GX4 A;  4GFR A;  3LR1 A;  4ZED A;  5I7I A;  1B46 A;  3FJM A;  3VE1 B;  1JVY A;  4F2Q A;  1P1O A;  1CNQ A;  3E3K A;  4O3C A;  3TQW A;  3RUM A;  1JW5 A;  4BDR A;  2G29 A;  3I5O A;  1D9V A;  1URS A;  2QSX A;  3D4G A;  3VVE A;  1Y9U A;  1QVS A;  2WEF A;  1FQE A;  3IOT A;  3FAS A;  4OQO A;  2B3B A;  2LAO A;  5LDZ A;  1G0I A;  2X26 A;  2GRV A;  1B4Z A;  2PT2 A;  3USD A;  3S9M C;  4XTC Q;  3C33 A;  1DTZ A;  1OQG A;  5KZT A;  2HAV A;  1RKM A;  3I3V A;  1FPJ A;  4YB5 A;  4OVP A;  4HS7 A;  2V3T A;  2XXP A;  4IR8 A;  3B6W A;  4YU0 A;  1D9Q A;  4MNC A;  1DOT A;  2I0C A;  3UGW A;  5J16 A;  3TYH A;  3ECR A;  4PAF A;  3TTN A;  4MFI A;  4KI0 E;  1JVX A;  5LTC A;  1K9Z A;  4WKM A;  3EF7 A;  3FBP A;  5F7V A;  1VFD A;  3KEI A;  4H45 A;  4YB6 A;  5ET7 A;  3SEV A;  1MXY A;  4BDM A;  1BKA A;  4OET A;  2UVJ A;  2QFL A;  1FPE A;  3RY3 A;  1H44 A;  3BIH A;  4ELR A;  1LBY A;  5J1D A;  4NF8 B;  3IFC A;  3MST A;  5H8F B;  1MXX A;  2Q74 A;  4FJP A;  2Y7K A;  1SI0 A;  4YAH X;  4OA4 A;  4HE1 A;  2NOO A;  4PBH A;  4Q8R A;  5L9S A;  2ZZX A;  3I6V A;  2DVC A;  1AL3 A;  1SVX B;  2QS4 A;  3KN8 A;  4IGT A;  2ESN A;  4JWY A;  1LBZ A;  1M5E A;  3SZP A;  4IO6 A;  1O63 A;  3JZJ A;  5ESY A;  1VDW A;  1HSL A;  4R6H A; 
#chains in the Genus database with same CATH homology
 4O94 A;  3EKI A;  4N8Y A;  4N4U A;  1EYJ A;  3B50 A;  4GWS A;  4LN5 A;  1LBW A;  2VPO A;  5JK4 A;  2KQZ A;  4QBA A;  4MIJ A;  2B4M A;  3LV0 A;  4N91 A;  2QVR A;  3HFU A;  4G61 A;  2VT5 A;  1FJ9 A;  5T3J A;  4AS4 A;  4P1E A;  4H46 A;  1YXI A;  1NV5 A;  4N17 A;  1XI6 A;  4GWZ A;  1NV3 A;  1FJ6 A;  4O7I A;  4JVD A;  2KR0 A;  2VPN A;  4NN3 A;  1FBG A;  4PCD A;  1LBX A;  4NAP A;  4PFR A;  1AWB A;  3T0J A;  2FBP A;  1NV7 A;  3E79 A;  1IMA A;  4GWX A;  3KBZ A;  4MHF A;  4MMP A;  4MNI A;  2P3N A;  3W9W A;  4PDH A;  5FBP A;  1KA1 A;  1LBV A;  2R8T A;  1RDZ A;  2OX3 A;  4MJO A;  4GX6 A;  1EYI A;  4PAI A;  2FVZ A;  5ET8 A;  2XWI A;  4PAK A;  4PF8 A;  2ZZV A;  2WBD A;  4XFE A;  4YZZ A;  2PFY A;  4N6K A;  4YIC A;  3GYY A;  4P3L A;  2Q8M A;  2L5V A;  1BK4 A;  2F3B A;  1JP4 A;  4NF0 A;  1FPG A;  2HPG A;  4AS5 A;  2XWO A;  1EYK A;  4HCW A;  4OVQ A;  3RPL B;  4PTK A;  4UAB A;  1INP A;  2DE2 A;  1NV6 A;  3RPL A;  4P47 A;  4PGP A;  1YZ0 A;  1FPD A;  4N6D A;  3MYU A;  4P1L A;  4O8M A;  2F5X A;  4PC9 A;  1FBD A;  5EYH A;  4PFB A;  2QVV A;  2DVZ A;  2JJK A;  5IM2 A;  5IZ1 A;  3ROJ A;  3NOH A;  3RYD A;  1NV0 A;  5EQA A;  3IFA A;  1FBE A;  4GX3 A;  2MKZ A;  2CZH A;  4NHB A;  1DBZ A;  4PBQ A;  1FBC A;  1YYZ A;  4HE0 A;  4PF6 A;  4OVT A;  3PTY A;  1KZ8 A;  2QVU A;  5F24 A;  2FIE A;  4JVI A;  2BJI A;  2B4L A;  1SPI A;  2Y5L A;  4OVS A;  1Q9D A;  5IZZ A;  4MX6 A;  5A5L A;  4N8G A;  3BIG A;  4MNP A;  1FPB A;  2P3V A;  2ZZW A;  2GQ1 A;  4HE2 A;  2XWK A;  3E78 A;  4NGU A;  2WYK A;  1IME A;  4DI4 B;  4PE3 A;  4FBP A;  2WBB A;  5I3S A;  4HXV A;  4MEV A;  4GBV A;  2WX9 A;  3CHG A;  2FHY A;  1QGX A;  4QXD A;  2CEX A;  1FBP A;  2V3Q A;  4I3Y A;  5EQ8 A;  1NV4 A;  1NI9 A;  1NV2 A;  4O7M A;  2FIX A;  2DE3 A;  3B8B A;  5I5P A;  4P9K A;  1RDX A;  4JVC A;  2PCR A;  5EQ7 A;  3T1B A;  1DCU A;  2V4C A;  3KC1 A;  1NV1 A;  1FSA A;  4MAG A;  2WYP A;  4GWW A;  5IGA A;  2OWZ A;  2HZL A;  2PFZ A;  4GWU A;  2DDK A;  5CM6 A;  5ET6 A;  1FBF A;  4GX4 A;  4N15 A;  4HCY A;  2HZK A;  4X04 A;  5I7I A;  3A29 A;  4DI3 D;  2F3D A;  2CEY A;  4P8B A;  1CNQ A;  3ISP A;  4NQ8 A;  4I3E A;  1DK4 A;  3D1R A;  2WEF A;  4I40 A;  4X9T A;  4F1U A;  1LEV A;  2Q9T A;  5LDZ A;  1G0I A;  5DW8 A;  4OAN A;  1IMC A;  5EQ9 A;  2XA5 A;  1FPF A;  4OVR A;  1FPJ A;  2QPQ A;  4OVP A;  4M1V A;  4GWY A;  4IR8 A;  3QMF A;  4P56 A;  4KXP A;  4PET A;  1D9Q A;  4MNC A;  1IMD A;  4F1V A;  3LUZ A;  3W9V A;  5J16 A;  1KA0 A;  4PAF A;  1FBH A;  5LTC A;  1K9Z A;  4PGN A;  3FBP A;  4PDD A;  4F19 A;  4F18 A;  5IZ3 B;  4H45 A;  5IZ3 A;  4XF5 A;  5ET7 A;  2HXR A;  1FPK A;  4MCO A;  1FRP A;  4NX1 A;  2Y5K A;  1IMB A;  2CZK A;  1K9Y A;  2QFL A;  1FPE A;  1FPI A;  3BIH A;  1LBY A;  5J1D A;  2HHM A;  2XWV A;  1G0H A;  3IFC A;  3MST A;  3U65 A;  5EYG A;  2XXK A;  4GBW A;  2Q74 A;  2DE4 A;  1RDY A;  1FTA A;  3FXB A;  3KC0 A;  1NUW A;  4OA4 A;  4HE1 A;  4PBH A;  2CZI A;  1NUZ A;  4PFI A;  2ZZX A;  5ET5 A;  4X8R A;  4XEQ A;  1LBZ A;  4NG7 A;  3SZP A;  5ESY A;  1VDW A;  1IMF A;  4N81 A;  1NUY A;  1NUX A;  1FPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...