1IZ1A

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR-type regulatory protein
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Dna binding protein
total genus 92
structure length 292
sequence length 292
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1iz1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A02
4MHGA 2UVJA 4BXUA 2K7LA 1K6OA 2GQQA 2OWTA 4Q8RA 3FATA 5TU0A 1JQFA 1L3LA 3H6VA 2NAZA 4RB3C 1XSDA 1U78A 4YFNF 1O64A 2RF1A 1B6AA 4RK2A 2IRFG 1U5TC 3IWZA 3V5AA 5LLQA 4DDDA 3O2AA 1XGNA 3BFTA 1MS7A 2ACJA 1P1OA 3TODA 1IRGA 4MFIA 3F8CA 5F1RA 4C1TA 1FC3A 2AIXA 4CDGA 2MH2A 3E6DA 2FA5A 3HRMA 1S6LA 5FFXA 1MY2A 4ELOA 4ZECA 4KIGA 2DWHA 1SYIA 1Y1MA 3G3GA 3IL1B 1TW3A 1WKMA 5LHIA 3QUFA 1P6RA 3E4RA 4BLAA 3REOA 3IRQA 1YAEA 1OR7A 2UXNA 5L8DA 5IAIA 2K4BA 5HDNA 1YCJA 4OFLA 4NQWA 1LFHA 1CF7A 2G9WA 3GFLA 1A54A 1JVXA 2OJTA 1B0LA 4BHBA 1I6QA 2OQGA 4PGGA 2D1HA 2H9BA 4DNCA 3CO7C 2WWYA 1IUDA 3D0SA 3PD9A 3GXAA 2QQAA 3V7CA 3KN8A 4I62A 1U5TB 3IJOB 1Z9CA 3ZPLA 1J1NA 4HF1A 3HOSA 1FQFA 2YX7A 3EPEA 3MPLA 3E97A 5I56B 1XN7A 4L9VA 4I7HA 2HOEA 2XGXA 5LHGA 3FJMA 1SD3A 3SDFA 4HZFA 3TCHA 2ZKZA 2BYVE 1BP5A 1O7LA 3F6VA 3WE3A 1OYWA 3F23A 3TOBA 5CMKA 3HTUA 3WTTC 1FW0A 4OIPF 4M73A 3O6IA 1NNFA 1G3WA 1ZRFA 3GF2A 4HX8A 4IVNA 2HZLA 2V79A 3N6UA 2DQVA 3FVNA 2AYSA 3DP7A 3JTHA 1MJ9A 4WEDA 2DP8A 3N6TA 1ANFA 5M2VA 3HRTA 2VBYA 4WXHA 4EF2A 5H6RA 5DD8A 3R7XA 4G8MA 1ZREA 1BKAA 2I3VA 2XKOA 3C1DA 3H6TA 4OETA 4LZ5A 4ZZAA 3E9XA 1BI1A 1K78A 4NMYA 1Z6RA 1KU7A 1ZBMA 2JT1A 2M87A 3R6SA 4WK8F 2V1UA 2Z8DA 1O63A 3K6UA 5DEQA 3PMWA 3DFGA 1O3SA 2ZJ2A 4UXNA 3U1OA 4OIQF 1MY0A 2J5PA 3AAFA 2QQBA 1ZN2A 3FV1A 4FIMA 1XGMA 1DPUA 3TYHA 2PVUA 1ZH5A 3MZHA 3LFKA 3JSPA 1YIOA 1WVJA 1J9IA 4PFWA 5JTYA 1T0KA 3QK6A 3ZS6A 1IITA 5A5XA 3PMXA 2VD3A 3HSFA 3UP9A 1USSA 4JSDA 3ZKLA 4EQ9A 3LAJA 1KGSA 2ZO4A 3BJAA 4IRGA 2RC9A 2X26A 3MZ1A 1SBPA 4DZ1A 3GW2A 1P1WA 5E17F 2UVIA 3O28A 4A6DA 3IAZA 2DQRA 2ESNA 4EM0B 2PT2A 2F5DA 2WC2A 4OERA 4YB5A 3RTRA 2QS3A 1AWCA 1YPNA 4N0BA 2H98A 4JWOA 1FSHA 3LSXA 2JTVA 1DPRA 1D5VA 5AA4B 3OV8A 5EEGA 1P92A 1D3YA 1Y4CA 1FTKA 4YFKF 1R1UA 1S7OA 1FP1D 2H09A 2XXTA 4C1UA 4MGRA 1B1HA 1SD7A 2XAQA 4OTEA 4U7BA 1N7XA 1UIVA 1IXSB 1JW1A 1S29A 3K6XA 4O3MA 3BDDA 3FF5A 1ZRDA 4MNUA 2OU2A 1IAWA 4R6KA 3M8EA 1SD4A 4H0EA 2UXXA 3O6HA 1HW1A 1YFHA 3VB2A 3IWFA 4UV8A 4F19A 4U0VA 3OO8A 3V8XB 3ZMZA 3MQ0A 1D8KA 4N13A 4TLMB 2P6SA 2Q2CA 2W7YA 4KPTA 5K5QA 4DLDA 1SW2A 4U22A 1BIBA 2QS2A 1USTA 4IF4A 4EUOA 2IP2A 2M5WA 2F7BA 4LLGF 3ECHA 5E1XA 5CMMA 3FWEA 3ABUA 1IN5A 2NRAC 2F5EA 1ZLQA 5LGTA 4HW8A 3QSLA 1MPCA 2V1DA 5E20A 3GZ6A 4F31B 2UWMA 1MXZA 3DEUA 3TKDA 1RUNA 1YW7A 2IEEA 1UHWA 1MD0A 2IJLA 3KEOA 2FE3A 3V8JA 3SHFA 1HW5A 3TCGA 1JXSA 4N9IA 4CZZA 3FASA 1OYIA 2A5TA 5F1QA 5EYFA 4DQ2A 4ENMA 1U6GA 2XXWA 2QS4A 2FYIA 3VVDA 4HCYA 2Y0MA 2LF8A 2RNJA 1DUXC 2O1MA 1DMBA 1Y3NA 5TP9A 3VXBA 3TEPA 1UIUA 3QU6A 4X48A 4KICA 5HS8A 3D4GA 3TKYA 3VLWA 1AMFA 1MM7A 2HWVA 3GUDA 4PZJA 4ONYA 1ZGAA 4R72A 4RB2C 1OLAA 2HQRA 4KD5A 3G3FA 4F39A 3IOWA 3MAJA 4PETA 2F34A 1IRFA 2YX4A 4IO5A 3A09A 2G7UA 4F2QA 5HLIA 5EEHA 3V7SA 2FNCA 3I59B 3LSLA 1Y0UA 4NF8B 2O8XA 3RUMA 4F18A 3F8BA 2GIVA 2QQ9A 3RJPA 1F5TA 2EFWA 4U4XA 2Q8JA 3ZMDA 2HTJA 2ZNSA 1JGSA 4OVJA 4KHZE 2VE8A 2EFOA 1XDSA 4A0ZA 2K86A 2ZFWA 4CXFA 1A8EA 4M4GA 5DYHA 3R0JA 2DPDA 1BIAA 2NUVA 4POWA 4NWDA 5FLXK 1LBCA 1T98A 5I58A 2FBIA 4G77A 1ZG1A 2QMWA 3S2WA 4PFUA 1EH8A 4YB7A 4MH5A 1FPQA 3H03A 4F3SA 1FP2A 2FSWA 2XXUA 5I59A 3MAMA 2LNBA 3K1PA 3ELKA 2OK2A 4LVQA 4ESJA 5AIPA 2PMSA 1MM6A 4HOBA 1SYHA 4CYDA 4XRFA 2P6TA 2D1VA 2R7DA 3MZ9A 4XBFA 1ZJLA 1XVXA 5L3BA 2FMLA 1GR2A 4JSOA 4P11A 1M5DA 5J1DA 5D6EA 1DPEA 5J8FA 3HRSA 1P4XA 3F11A 5AA3A 4LK1F 5FHMA 3RDIA 3HO7A 4I0BA 1XCBA 3KEIA 4IPAA 1KWHA 4F22A 3HTSB 2VOPA 1PBQA 2D45A 3EETA 3F6OA 4LMYA 3EYYA 1FBSA 2JRTA 3WGGA 1YTVA 4LG0A 2A07F 4AB5A 3S9LC 3FUZA 4KCCA 5CMCA 2GHAA 4QFLA 2E1NA 3LA7A 4GYGA 3KGCA 4OINF 2DAOA 2QWWA 1Y9UA 3IOTA 3ZKKA 1HQCA 3O3KA 2LDUA 3S9EA 4GQOA 3VE1B 3P9KA 4G6QA 2VC0A 2GRVA 4H1XA 5CVVA 1YYVA 5CVUA 3SZPA 1B3GA 4OIRF 2O61A 4Q0CA 3C18A 2EK5A 4EJOA 2XXIA 2OQRA 3ECOA 5L3CA 3KFMA 1DOTA 4OMYA 1W7PD 4LONB 2P7CB 2EB7A 2QSXA 1I27A 5D8KB 1MG1A 4YIIA 2GWRA 1FZPB 4U88A 4YB6A 3OENA 3CSBA 3FXUA 4EJUA 2BBYA 2K02A 1G3TA 3L09A 3SEVA 2E7WA 1ZMGA 3KETA 4TV7A 1S7YA 3N26A 1CF7B 2UZKA 5L3GA 3OELA 3Q5FA 5DTBA 1T39A 2ZCWA 2DXYA 5E1ZB 1IXGA 1LAHE 2XXVA 3KZYA 4PP0A 5DVFA 3IK6B 2DE3A 2DE2A 5I84A 2DWIA 4HV6A 4OESA 1BC8C 2FNAA 4G6DA 4RJZA 3S9MC 4YFXF 5HLHA 4A5MA 3V8LA 2RKMA 1Z1DA 1N84A 4KCDA 2HYFA 1I6XA 4IO4A 3FHZA 1Z7NE 4EJTA 4TQUQ 3K1MA 3MWMA 1QZYA 2Q2AA 3HPIA 1G6NA 2PX1A 1I69A 1VE4A 1ELJA 1P99A 3G7WA 3HUGA 2XKPA 4QF9A 3FD3A 2V3QA 1L5TA 4DCXA 1I6BA 1XS5A 2X7PA 4R9FA 5DUKA 3KSXA 4LFUA 1UFMA 2XASA 2HFHA 2PBWA 3L9FA 4NB5A 5ITOA 2O1LA 3BPXA 2DTRA 3OOAA 2Y84A 3ROUA 4IO7A 4Q5TA 4LQ2A 3F3XA 2CWEA 4MEXF 2R6GE 5AA2D 2F5XA 3FM5A 4YAHX 1YS6A 3HSEA 5K1YA 1OQHA 1K78B 3WTVC 5BPDA 2JSCA 4QSDA 3KBRA 3T93B 4D0PA 2A61A 1FNNA 1FBQA 2F35A 1HSLA 2ONSA 5FTHA 4A6EA 3KLOA 4L5JA 3W15C 3V7RA 2DYXA 5ICQA 3BWGA 1H3DA 4I01A 3FZVA 2YLNA 2QZ8A 1Y3QA 4XSZF 1IXIA 4Q47A 4KN7X 3GYHX 2FEZA 1OMIA 2CW0F 4E70A 2RCAA 1US5A 3TQNA 2XUBA 2UXAA 5JTYB 1FQEA 2STWA 3UN6A 5A5XB 4RA1A 1UTHA 1DTGA 3TO9A 3IB1A 3QUJA 3TTMA 1B4ZA 4RGSA 4H8IA 1TFAA 4U21A 3LR1A 4RPOA 5LRRA 3E6MA 3I0TA 4H67A 2J5OA 1YW9A 3WTYC 4ZEDA 4O3AA 1EH3A 3E5XA 4G7HF 4LJZF 4M9SA 5E18F 4QSCA 1T6SA 2BGCA 3DQVC 3PQJA 1A40A 4ISUA 1RUOA 3KP5A 5BUUA 1FQCA 3CFXA 1H9TA 4IY5A 4JWYA 3KN3A 1OYYA 1SW5A 4M9ZA 5D5XB 4B8XA 3MP6A 5LHHA 2O69A 4XKNA 1XMKA 5TRDA 2V3TA 2ZNTA 5DCMA 5HPQA 4HS7A 4F29A 2LKPA 4P0IA 5HBCA 3SEYA 4JWXA 3IL2A 2STTA 5CVIA 2HR3A 4ND9A 3RYPA 4FX0A 4G7OF 5DCFA 4IO2A 3G3HA 3LSWA 1PDNC 4F2OA 3FM3A 4LQ5A 3H4ZA 1E2XA 3FVKA 1SVXB 3WG9A 4ZEIA 1KQ0A 3HRUA 3L6HA 3U8QA 3UK4A 5K5RA 1ONVA 4MTDA 3RPUA 3I58A 2L3DA 3MZYA 2L4MA 4PFYA 3WE2A 5I2NB 4KMUX 3T8RA 4A12A 3QP6A 1REPC 4RNSA 1KU2A 2OZUA 2A5TB 4DXCA 1D9YA 1MH4A 1W7PA 4KA4A 5ED4A 4M1VA 2Z3YA 2EA4A 2QYOA 3E13X 5TP9B 4RB1A 2FMYA 3EHSA 4THIA 4Q30B 5AONA 4GRKA 3D5LA 3P9IA 4O3CA 3FMQA 5L3FA 1B5HA 1NH8A 2H99A 4O3BA 3ZMSA 4P5OA 3H6UA 2Z23A 3IB2A 2D5WA 1KU3A 1LDJA 1U3EM 3RPWA 1SI1A 4WXJA 1LCTA 1BTJA 1GVCA 2O03A 2RN7A 1TLHB 3MP8A 3OSQA 1MH3A 2O84X 3TTLA 1BBYA 3I4PA 3WTXC 4RYAA 2H94A 4LK0F 1XGSA 1H76A 2DS9A 2XV4S 3KCCA 3ILUB 3DF8A 5ICEA 4U2RA 4YICA 4KUMA 2RC7A 2A6HF 2XXHA 2OZZA 2Z5UA 1JEVA 3PGFA 3OXNA 1B32A 2I0BA 1VFDA 3FV2A 1D4NA 3L7WA 2OZ6A 5I58B 4EXKA 4XLNF 5HS7A 1DDNA 3SKPA 3JW4A 3PUYE 2ZXJA 3GX4X 4G8XA 2EFPA 1UQWA 3H06B 3CDHA 4XKQA 4QFNA 1YW8A 4IHSA 1F9BA 1N7WA 5L9OA 1BI3A 2PLYA 2QLZA 2PYYA 1B7HA 1XDUA 3PU5A 3RYRA 2EA2A 2HYGD 5AA2A 4ENJA 4WF2A 5JK4A 1O7TA 1IN4A 3TDUC 1Z05A 4OMBA 5CI5A 1N3XA 3KOSA 3FVGA 5B7DA 4EM1A 1UCRA 1B2HA 1Y20A 2FA7A 4EMSA 2KJBA 1BN5A 4S04A 6PAXA 1SD5A 1XT8A 4NF4B 3DLNA 2W85A 4HAMA 5JFRA 2P1SA 4HQEA 1O57A 1G4DA 4R79A 3KOTA 2XAGA 4R6YA 1TTYA 3RN8A 1B1XA 2DE4A 4P9UA 4R73A 4LG0B 5DEXA 3PV0E 1LCFA 1RI7A 4F1UA 4MQVA 1US4A 2DWAA 2X7QA 3BP8A 1IXCA 5JHUA 3EDPA 2A5SA 2FOKA 3GFIA 2O6AA 3HHGA 1QW0A 2Z22A 4H5GA 2HGCA 2PBIA 1QVSA 2Z33A 1B51A 2XXXA 1R7JA 2YJPA 3U2RA 1LJ9A 1SFUA 1LQ1A 3E5QA 3SQNA 1QJMA 2PEXA 4WXDA 4HW0A 3KJTA 4KT5C 2NWJA 1JE8A 3MPKA 4B09A 2LAOA 1N04A 1B4HA 4NE4A 3ZN0A 2XD3A 4JB7A 3E6CC 3DM0A 2ISYA 3B73A 1NKXA 4OZ9A 2JZYA 4A0YA 2IW5A 1LB9A 1B7UA 2Y7KA 3P9CA 4HYEA 3OMBA 1QULA 4HDVA 2CYYA 3M1EA 1UHMA 1SDXA 2HKXA 5D5UB 2IT0A 5I2KB 4HX7A 4BNCA 3PUZE 4GXSB 1YLFA 1Z6TA 4WCGA 4IRHA 3QIMA 3KLNA 3PUVE 3ULQB 4YKIA 1Y1ZA 2BJJX 1L0OC 3O29A 5JEIA 3WGHA 4ZYEA 1W4MA 4R74A 3LBSA 4IRIA 1U8RA 2QENA 4OQOA 5FFZA 5HDKA 2COMA 4I02A 2F97A 2D2WA 4IGRA 3TUSA 4I2OA 4MF3A 4KIBA 5CJ9A 3RKWA 1JNFA 4KYEA 5DVIA 3HHFA 4AD9A 2EWNA 1B7ZA 4KDPA 4NF5A 5B70A 1B5JA 2M30A 3T9UA 4ZE8A 2V1XA 1KQ8A 1TQPA 4MEYF 4TOZA 1P4WA 3KP2A 1ATGA 3ZMUA 4L9JA 4PQJA 1WI9A 4PDKA 4ETSA 3WTZA 1PB9A 4HLYA 3U92A 3EHUA 3JSOA 3ML6A 1RKMA 3MVZA 4WWCA 1BLFA 2DW4A 3AXFA 2R7FA 4U4SA 2RVCA 3TQLA 3B6TA 2XXRA 1MDMA 1LB8A 4ZZEA 4UACA 5KZTA 1A04A 1U2WA 3KFWX 2H5YA 3VOEA 5ICGA 4UUVA 4YMAA 3MCZA 1QUJA 1UTHB 1CB6A 2QVOA 4GIZA 1ZG3A 3ECRA 3R6UA 4ZYDA 3K4UA 3F72A 1A8FA 1A55A 5CRYA 3GLXA 1G3SA 1ZYRF 2P5KA 3TAJA 5ICTA 3BKIB 4YKPA 4DE8A 3VVFA 4G94A 3OEKA 3VXCA 5H6QA 1R9QA 3IKTA 4JBZA 2BE5F 1POTA 3H3GA 4OENA 3M9AA 1ZLJA 2O7IA 2WKYA 1HBXG 5LRSA 3G3ZA 1ZIUA 4FHTA 2EV6A 2VONA 4WEPA 4FT8A 1P1NA 2QPQA 2H6CA 1R23A 1XB4A 5FO5A 3R4KA 4BDRA 4XKPA 4OHNA 4UA8A 1B4AA 4Z2YA 4A5NA 4EGYA 4ZEFA 2A3SA 1DSNA 2XXQA 5L3DA 2I3WA 2P2AA 1VSOA 5DCMB 2XX7A 1AOVA 3HV1A 3C4MA 4IXAA 5K2XA 4X1BA 2FF4A 4FX4A 4L0YB 2E1SA 3I71A 3QPHA 4EVIA 4UVCA 2KKOA 4OWDA 4JBAA 4E0XA 1LSTA 1NNKA 2QBYA 3TO7A 3ZMVA 3S2VA 3M3KA 1EH7A 2KRFA 2QM3A 1P1QA 2PFBA 1B0HA 4GVOA 1SQYA 1FYLA 3G3KA 1URDA 1H43A 4ASNA 4GL8A 2XX9A 2VOZA 4OOIA 3UA8A 4F3PA 1BOAA 2M45A 1IZ1A 1OPCA 1R5GA 3K6VA 2O6GE 1ON1A 3W9VA 5DDGA 1FYMA 2ZMEA 4KIFA 3Q26A 4QFOA 1FOKA 1W7PB 3T5XA 3TDJA 2HEOA 1WWXA 3ZP5A 1D9VA 4WX9A 5KCJA 1NNPA 2QS1A 1ZHFA 1LAXA 4U7DA 4L5IA 4NHJA 2XAFA 1T0FA 3K02A 3EYIA 2Y7PA 1FBUA 4FE8A 1H45A 2DVZA 3LUYA 4ELRA 4ENKA 3VEPA 1R00A 1MJAA 3CUQA 1HKQA 4G8NA 5LEKA 3T9VA 1PP7U 3S9NC 4C0RA 2FU4A 2MLKA 1MZBA 3SETA 1PBPA 2JPCA 2EV0A 4EV0A 2RDPA 3BJ6A 2EFNA 4UV9A 3TQWA 2F5FA 1GTKA 2E7XA 2QMXA 4BYYA 5H20A 3GZ5A 4CO8A 2CGPA 3GFJA 3VV5A 4Q4ZF 5I56A 5BWJA 4LLLA 3U9GA 1M5FA 5CVRA 3VVEA 1VR5A 4QFPA 2Q0OA 4MTEA 4LGWA 3CLOA 4UHTA 2VC1A 4ENNA 1NMUA 2HFBA 4JXIA 1SFEA 3JAMK 4HA8A 2XXYA 3O6GA 5HS9A 3T0YA 3TPAA 3C34A 3MC2A 2E0SA 1RIOH 1BM9A 3Q9VA 4HV5A 4YMBA 1JEUA 1J59A 3LWFA 1DPPA 4XXUA 4GXOA 4I98B 2ZYKA 4QRZA 5E1WA 1IXHA 2PJPA 3MW0A 2THIA 5K2YA 4S05A 4JQFA 4AQ4A 3C9HA 3C3WA 2VBWA 2F36A 3DP4A 3I6VA 2MC3A 1UTBA 2XIGA 3PD8A 2F6PA 1P2FA 3S4UA 5AA2B 1VFEA 3L00A 2ZYOA 5FHNA 2RGVA 2HEUA 1O7FA 1H0MA 2RCBA 4Z0IA 3RLFE 4Q5SF 1R1TA 3SESA 4KNYA 5CYVA 5H8FA 3EQLF 2W57A 3CG1A 2QL3A 5EHMA 3IORA 3DKWA 3MQ9A 3FIRA 3K00A 3KP7A 1LGBC 2HQ0A 3K9TA 1FQBA 3HSTA 2FRHA 4NEDA 2P7VB 3E3KA 3HCQA 4N07A 4F3BA 3FXQA 3EF7A 4LA9A 5DEXB 1LDKB 1M5BA 1OLCA 2REJA 3I53A 4KFQA 3DP8A 2XAHA 3ERED 1O3RA 1TNSA 1BIYA 1OVTA 3KG2A 2G7HA 4AIKA 2Q2EA 3C33A 1T2KA 2B65A 3CR9A 3CUOA 3O2PE 5HM4B 1XC1A 1H44A 2L54A 2CG4A 4OEUA 4G2ZA 2F78A 2DWJA 4UVBA 2V25A 2OAZA 2H25A 4H6DA 1WQ2A 3HYIA 2GHBA 3LSFB 4DXUA 3C32A 3M7GA 2OBGA 3KEQA 4FJPA 3VLVA 3FJGA 1JHHA 1SMYF 3GBBA 3O66A 2HTSA 3Q28A 1SW4A 4EJWA 2V3UA 3K69A 3R61A 1JW4A 3BOQA 3VFZA 4QLCU 2QUFA 1B6HA 3RKYA 4X1DA 4FEDA 2HXWA 1EZ9A 2GA1A 2D3IA 2DOJA 3OEMA 5JVTA 3THIA 1FWZA 3BJOA 2B3BA 3ABTA 1M5EA 4CICA 4RXLA 4RPNA 3P7IA 3T66A 3V8KA 2NYXA 1PB8A 3J7AO 2HZTA 2IPQX 4YG2F 4O6JA 2EFQA 4G8HA 2L01A 5FD5A 1FTMA 3I54A 2ZNZA 3T22A 1OMPA 3JZJA 1TQIA 1F9NA 2A68F 3LC8A 3EN3A 4HTGA 1XSXA 3RT8A 3PPQA 5H8HA 2RINA 3F8FA 1B58A 5H8SA 1LFIA 3ZQ7A 3C36A 4KFCA 1X3UA 1MDP1 2MD5A 4OMZA 1PDAA 2V9VA 2ZBKA 4NF5B 3IHUA 1ULYA 4GFRA 3N5LA 3ISPA 2VXZA 4XLPF 2F5CA 3V83A 5LEJA 1TFDA 3O9PA 3QAXA 1XSVA 2UVHA 1II5A 4U1OA 1SFXA 1HSJA 4GO1A 4HLXA 4BAYA 1HXDA 5K5OA 1S8NA 2HCAA 1BI2A 3OOPA 1B05A 2ZNYA 1GHCA 1MQHA 1J75A 1ODDA 4DCYA 1JW5A 1MDMB 1QBJA 1R36A 4U0YA 2R71A 5H8QA 4POXA 2WV0A 5ICFA 4G4PA 4K3FA 3MUQA 1LLSA 1Z7UA 5L9MA 2VT2A 3T1BA 1M5CA 4EQBA 3GZGA 4KYDA 5LGUA 2KLFA 4XSXF 3WTSC 2UVGA 3QRFF 3W9WA 1XCVA 3R26A 3JAMZ 4L0ZB 5CVJA 3W6KB 1E17A 4KI0E 1FQDA 2XX8A 3KZZA 3VLUA 5IKBA 5CM6A 5CLSA 1B9MA 1ZRCA 3RTFB 3CI8A 3I3VA 4A2UA 4LLNA 2ISZA 1I5ZA 4R2FA 2KJCA 2GA2A 1D8JA 4WXCA 1SI0A 4BHCA 2GH9A 2H4IA 3KJ7A 2O0YA 3T9HB 1HKTA 1QUKA 3Q27A 3FMSA 4M9XA 2VODA 2HKOA 3MVWA 1FTOA 2OBPA 3CUQC 1Z7ME 4LZ7A 1USYH 1B9JA 3J80K 4L17A 2OD5A 1B3FA 5JI6A 2RC8A 1B40A 2QBYB 5ILSA 2I48A 2GXGA 2C6YA 4E0WA 4F7ZA 1T38A 1NH7A 2UYFA 1LVAA 3G3IA 3SERA 4U0WA 2GFEA 1USYE 2I49A 4LB6B 3PUWE 1OVBA 4EQQA 1MJBA 2PQ8A 1LAFE 2Y7RA 3M3FA 3HN0A 5H8NA 3HOTA 5I59B 2DO7A 3IB0A 5A2QZ 3IJXB 1QO0D 3BBRA 4KYWA 3TGNA 1YG2A 2ZMEB 2W84A 3OO6A 4AB6A 2DT5A 2W25A 3GVAA 4AIJA 4CHUA 5KCJB 4ZE9A 2ZNUA 4RK9A 1B9NA 2TDXA 2EJRA 4Y17A 3BPVA 5IT3A 3O97A 2HQNA 2DFIA 1NHAA 4MBPA 4P9FA 4IY6A 3N4MA 3K0VA 2F7CA 3BY6A 3KP6A 3ZN1A 3ODBA 4H5FA 3CUQB 3FJ7A 1B1BA 1YS7A 3OO9A 4ZYGA 5ICCA 1XMAA 3PPRA 4GXAA 1F4KA 1GVJA 3KP3A 3KP4A 4RAZA 1MY1A 3GFMA 3DXJF 3WODF 1I1GA 1EH6A 3WGIA 4L9TA 2DLLA 3CFZA 3N94A 1BC7C 3KE2A 4LB5A 4ESFA 2PN6A 2FNPA 4LD5A 3U1DA 1Q1KA 3D4CA 4GYIA 3MVYA 4OEVA 5BOXA 2M8EA 1D3KA 2F8DA 2CFXA 3QP5A 2JPBA 4M71A 3QXMA 4YKJA 1R1VA 3R0AA 1IUYA 3M8UA 1FQAA 5F6FA 4Y15A 2XVCA 2MLGA 4M6XA 1MXVA 2F6GA 3K01A 1KU9A 2I4BA 3DV8A 4AWXB 5I57A 2Y7IA 1B5IA 5LBQA 2W24A 4IJAA 1OQGA 3P7NA 1LFGA 1YQAA 2ZYNA 2M1BA 2XAJA 4ON0A 3I64A 3OD7A 3ONMA 3RQTA 3LAPA 2XD2A 2AS5F 2P5VA 2I0CA 2XROA 4AVPA 5FTIA 2ZYMA 4GD5A 5F64A 2FXAA 2YPRA 3Q29A 1UTBB 3TTKA 3C35A 3PMVA 3IX1A 2IA0A 3ZMTA 4BH9A 3MJNA 3TDZC 3KN7A 1BJAA 1RNLA 4RY1A 5EHSA 1TXFA 3WAEA 3I5OA 1B46A 4ZH4F 3G3JA 2WTEA 1RYOA 3UORA 4BDLA 5KK1A 3COAC 4YZZA 5H8FB 1AIVA 3SEUA 2IA4A 4GWOA 2O68A 3IO4A 4U23A 2X0LA 3A3UA 4OIOF 1DP7P 1SD6A 3H7MA 1LDDA 2ALUA 4R6HA 4BDNA 2RQPA 1PUEE 2Q8KA 2IVMA 1TT1A 4RAYA 1WRJA 3T8TA 1ON2A 4NF6A 3RGYA 2XHDA 3IO6A 3GBAA 4HCWA 5CBRA 2A69F 3G73A 3CTAA 1FTLA 1R9LA 4P55A 3RIRA 4LATA 5FGMA 1POY1 4GF8A 2VOOA 4ESBA 1I6AA 2NNNA 3PQKA 1V3FA 1TWYA 2DBBA 2DQLA 3QOPA 1PC3A 5F7VA 2VGQA 1MGTA 1B3EA 1AL3A 3K1NA 1YTYA 1MXUA 5DT6A 3FMRA 3TTRA 5HOOA 2HDCA 4LUBA 1JHFA 2G93A 4G7ZF 3TZAA 4N9HA 1IXRC 1ZARA 2KIMA 4ELQA 3U72A 4G68A 3K0LA 1MXWA 1J7KA 4ZZLA 1NNTA 1MKMA 1CGPA 1NL5A 1QQIA 1QZZA 2PMHA 5J6XA 1IIWA 2O51A 4EDPA 3K2DA 4ZEBA 3BZ6A 1XGOA 1P4AA 2DK8A 1NFTA 2B0LA 4PFTA 5CBSA 4ZZDA 5LGNA 5E8IA 4XKRA 1S7AA 4Y13A 1K79A 3BROA 5D4SA 1B3LA 4ZEKA 4KR5A 4PGHA 2DK5A 2QJEA 1UB9A 1K7AA 1AH5A 1OIBA 3VDFA 4FATA 2E1CA 4GOTA 2XHKA 4I1DA 2V6CA 3TOAA 2NXOA 4HX4A 4GLIA 1PB7A 3OO7A 2Q89A 3LA2A 3J80Z 4DIGA 2KIUA 3DPTA 2MA3A 4JK1X 1I1SA 4QFKA 5KDTA 2H27A 1Q35A 5TPAA 1MDQA 5BQTA 4QWQA 1YO5C 3CIJA 2HZKA 2O7UA 2HAVA 5J8CA 1QKBA 4OU0A 2ONKE 2YPNA 3BFUA 5H8HB 3JTGA 2Z8FA 4BDQA 2X4HA 2P5LC 1URGA 4F1VA 3L6GA 4YIFA 4PE5B 4NWCA 1G3YA 4M74A 2Z9OA 4R2BA 2ETHA 2FQ3A 5I2NA 1Z91A 1XHYA 1O3QA 4H0WA 2YU3A 3CVGA 2PMUA 4F3GA 2OA4A 1URSA 2AXLA 2L02A 3PUXE 2CZLA 2Q88A 1MXXA 1J0RA 4OXVA 1FX7A 1WDNA 4O5VA 5D5WB 1ZG5A 4GCVA 1S3JA 4G9YA 5DV5A 5BS6A 3PPOA 1FYKA 2I4CA 3LA3A 3CFLA 3RT6B 4XIGQ 3TELA 3Q9SA 2R9JA 2OWSA 3VODA 1SW1A 3WTWC 3QU3A 5D4RA 4DXBA 2XRNA 3CG3A 2EV5A 4EM2A 1MPDA 1S50A 4L9NA 1MRPA 5D6FA 5DUIA 5H8QB 4ESXA 4TLLB 3CJNA 2VD2A 1IQ7A 1TQMA 4IGTA 4MQ9F 2P0SA 2DVCA 2VHAA 4OFJA 3RNNA 3PPNA 5CMBA 4EQ7A 5AIQA 5D5VB 5FD6A 1R5HA 1EU8A 4KYSA 1HKSA 2NVUB 3J81K 4IO6A 2P4WA 2B3FA 1OKRA 3QAHA 1GV8A 5DYMA 1PP8F 1B3HA 1TBXA 1DTZA 3LQQA 2ABHA 4BHPA 1MY4A 4I9DA 1PEBA 2O3FA 3QPTA 3MFKA 3B7DA 3H3UA 1HSTA 3EUHA 3MVXA 3USDA 4BQAA 4HDUA 2ANJA 2YSRA 5AE4A 3U94A 1U5TA 5FB2A 3ZSFA 4H65A 3MZBA 2LSOA 1AOYA 1ZAOA 3MBPA 1EZOA 1R6ZA 1XVYA 1MPBA 4YKKA 3TO6A 1LBBA 1GXQA 4HQMA 3FVOA 1R58A 4I0AA 4NF4A 4F1YA 3NRVA 4FAJA 5ITPA 1QUIA 2PG4A 3HIFA 1RZ4A 5FHOA 2DU9A 5L3EA 1N3WA 5ILUA 2F2EA 3RI4A 3FXRA 1QKAA 4M6YA 3F8MA 4A0XA 2V84A 2UYEA 3B6QA 2H6BA 2IA1A 3OSRA 5H8NB 3SFZA 3E3VA 1LNWA 2Q9TA 2VBZA 1H9GA 5IT9K 4FORA 1W5SA 4P0GA 4CGZA 4EXLA 3B02A 1FT9A 2D21A 2M8CA 2XXPA 4RGRA 3GEZA 4UVAA 2DSFA 4QHQA 4ZDMA 1N0TA 2GXBA 4RS8A 2PT1A 4LZ8A 2MH9A 1R22A 2KIFA 3V4GA 3IKVA 1MXYA 3EQ1A 4R8HA 2CQKA 2BEOA 4R75A 1IN6A 1J2XA 3FX3A 2NS0A 2I58A 4WKMA 3WAFA 2FBHA 4OFOA 1TNTA 1A99A 4IHTA 4R9GA 3E5UA 4HF0A 5ERIA 2ESHA 2Y75A 3N97A 2YR2A 5ELVA 2GZWA 3GXOA 2NNYA 1MQJA 3K6WA 4IO3A 2OCUA 5A2QK 1XD7A 2NOOA 3I5UA 3MEXA 2MBFA 5I2KA 2PI0A 1STZA 1Y3PA 5JR3A 1ZU0A 3NQOA 1IN8A 2RV8A 3RY3A 3KSJA 1Y4TA 2RC4A 1ZLKA 5HLGA 1JETA 3EHTA 4ZYHA 2BV6A 1FY7A 3QYTA 3UIFA 1QPMA 5I57B 3V89B 1O3TA 3JYRA 1ZGJA 3F8NA 2ADUA 5AA1A 4EF1A 1MQIA 4KMFA 3GWZA 4BDMA 3SEWA 1V4RA 5AA4A 4M72A 3SZTA 5E8GA 3DPLC 4IB2A 4R1HA 3DP6A 3UGWA 2ELHA 2DXRA 2VE9A 1GGGA 1W5TA 1EZPA 3TMGA 3WTUC 4OYVA 3GLBA 4G68C 2A5YB 1IF1A 3PFIA 1KYWA 2HS5A 2R3SA 1F1ZA 3T9XB 2L4AA 2FBKA 3CSGA 3VFJA 1IW7F 2GAUA 3KZGA 5ISUA 1SAXA 2DPUA 2I6EA 3RTWB 3MP1A 3WU0A 2VT3A 3O6BB 2ONRA 3C31A 2V93A 3Q25A 3LQRA 1BI0A 1FLIA 1ZTYA 4NF6B 4RGXA 1KYZA 2AL5A 1LB2A 4JDFA 1HSEA 2QRYA 3L2CA 1FSEA 4NTLA 1ZKBA 1LEAA 2OLBA 3FGSA 3HHHA 1FCKA 5DD4A 4XTCQ 1A7LA 4MLQA 2Z99A 5TJJA 4I8CA 1HW2A 3H92A 4PCQA 1N76A 3HSRA 4RB0A 5HDGA 1VTNC 5KVRA 3A3CA 5D8LB 5CC2A 3PPPA 4ELPA 1TW2A 2DI3A 2HAUA 1KQ9A 3JV9A 4RGUA 3M8FA 4HF2A 2RKHA 4N6PA 5FLXZ 4YU0A 5DVJA 3T96B 3SEXA 5L9SA 1EV7A 3K2ZA 2A6EF 2AL4A 3J81Z 3RPQA 1WODA 2Z8EA 4G68B 4MLVA 4P96A 2VN2A 4K2EA 5ILVA 1B52A 4BDOA 3RKXA 3GO5A 4GGGA 4Q48A 2Y7WA 3F22A 1JVYA 3IOVA 4FECA 3IRRA 4L18B 3E6BA 4LP2B 2K27A 2VP1A 1LAGE 3F21A 1IEJA 3SXYA 3TTNA 5LOMA 4ESWA 3TCFA 3WU1B 4EGZA 2P8TA 3ILTB 4H8JA 4EJVA 5BPIA 3I59A 1QGPA 4NF8A 1XOCA 2ZMBA 3M3LA 2VBXA 3CRBA 1J5YA 1MY3A 1QNTA 4U1ZA 2IA2A 4AIHA 4ECFA 3NEUA 3CO6C 3B6WA 3IC7A 1KA8A 1FTJA 1IN7A 3R60A 3H6WA 2CMOA 4FEBA 4KN4X 4HBLA 5HVQC 3H3ZA 1SMTA 1Q1HA 1MQDA 4GL0A 4KQPA 3LSTA 5TPAB 1GXPA 3U93A 4Z7EA 1LEBA 5KDTB 3TFLA 1CE2A 1RYXA 2F7AA 2REGA 1S9TA 1MQGA 3IOUA 2ZXTA 2K4JA 4ZS9A 2Y48A 3IR1A 1R1NA 4I09A 2CSOA 2G29A 3C7JA 1B59A 2LF7A 3W6JB 3DELB 1WSUA 1C0WA 5IT9Z 1P1UA 4QSEA 4UNOA 2CO5A 3MWBA 4X9TA 5BMZA
chains in the Genus database with same CATH superfamily
2H1LA 2COBA 3OL4A 4MHGA 1YJNI 2UVJA 5F04A 4BXUA 2K7LA 1K6OA 2GQQA 2X51A 1JUMA 4NNJA 3DBRB 2OWTA 4Q8RA 3FATA 2HPGA 5TU0A 1JQFA 1L3LA 2VJIA 3H6VA 2NAZA 1YJWI 4RB3C 4XR6A 1XSDA 1U78A 2LH9A 1FEXA 2V9PA 4YFNF 3PNTA 1O64A 5GAHJ 2RF1A 1B6AA 5J1UA 1W5CC 1EJ9A 4RK2A 2E2IJ 2IRFG 2B9SA 1U5TC 3IWZA 5EQ9A 5LLQA 4A3KJ 3V5AA 4DDDA 1BA5A 3O2AA 1XGNA 3CCVI 4IO9F 3BFTA 2IEKA 4IHYA 1MS7A 3DU6A 2ACJA 2JN6A 1P1OA 1AKHB 3TODA 4DYCA 2MD0A 1IRGA 4MFIA 3F8CA 1VQ9I 3QWLA 5F1RA 4XRMA 4C1TA 1WPKA 4X04A 1FC3A 4OAYA 3JRBA 4A3DJ 3GCMA 4CDGA 2AIXA 2MH2A 3E6DA 2FOWA 3OYLA 2FA5A 3BTCA 2L5QA 3HRMA 1S6LA 5FFXA 1MY2A 3A01A 4ELOA 4ZECA 4KIGA 2DWHA 1BK4A 4AYBA 1SYIA 1Y1MA 5A5LA 3NARA 3G3GA 3IL1B 3JRGA 2F3DA 2CJJA 5F27A 4CCJA 2FVZA 1TW3A 3VPRA 3B6AA 3L1PA 1WKMA 5LHIA 2RQQA 3RZDJ 1FOXA 3QUFA 2OC6A 2W1OA 3HBLA 1P6RA 3E4RA 3D1NI 4BLAA 3REOA 3IRQA 1YAEA 4DZJA 1OR7A 2UXNA 3OYAA 3A1YA 4ZTJA 5L8DA 2HPMA 5IAIA 2K4BA 5HDNA 3HOWJ 1EF4A 1YCJA 4NQWA 4OFLA 1LFHA 1MMAA 1CF7A 1FPEA 2G9WA 3GFLA 1A54A 1JVXA 2OJTA 1B0LA 4D7NA 4BHBA 1I6QA 2OQGA 4PGGA 2D1HA 5IP7J 4DNCA 5EF6A 2WWYA 3CO7C 1IUDA 3D0SA 3ONQA 2H9BA 3GXAA 3LSMA 1FTTA 3PD9A 2QQAA 3V7CA 3KN8A 4A3LJ 3H35A 4I62A 1U5TB 4BJTA 3IJOB 3RSNA 3DU5A 1Z9CA 3ZPLA 3FKJA 1WVRA 3HOSA 2OV7A 4HF1A 1J1NA 3HZJA 3ZR8X 1FQFA 2YX7A 1WI3A 3EPEA 2QF7A 1K4TA 2LFBA 3E97A 3MPLA 4G12A 5I56B 1XN7A 4XKCA 3LSHA 3PNVA 4L9VA 2R5YB 4I7HA 2HOEA 2XGXA 5LHGA 4RAGA 2OUMA 3FJMA 3K4NA 1SD3A 4MMPA 3SDFA 3OYFA 3TW7A 4HZFA 3TCHA 2ZKZA 2BYVE 1BP5A 4BEHA 4PAIA 4PBQA 5HODA 5KHDA 4F93B 2IS6A 1O7LA 3F6VA 3WE3A 1OYWA 3F23A 2MC4A 3TOBA 4D5FA 4QTRA 5CMKA 4P8BA 3HTUA 3WTTC 1FW0A 4EDPA 4OIPF 4M73A 3O6IA 4A93J 1NNFA 1MNDA 2V1NA 1G3WA 4W97A 3IFAA 1ZRFA 5J4YA 2KL4A 5ESYA 3GF2A 4HX8A 4IVNA 2HZLA 2V79A 3N6UA 2DQVA 2K5CA 4DOZA 3FVNA 2AYSA 3DP7A 3JTHA 1MJ9A 1OCTC 4WEDA 2DP8A 3N6TA 1ANFA 5M2VA 3HRTA 2VBYA 4CUGA 1FPIA 4WXHA 2VL8A 4EF2A 3K4LA 5H6RA 2RAEA 4JX5A 1BW6A 5DD8A 3R7XA 2IGOA 3LSRA 3GYYA 2VKVA 4G8MA 2G0EA 4XLCA 1ZREA 1BKAA 3E1SA 2I3VA 2XKOA 3C1DA 3H6TA 4OETA 1LBXA 5KAIC 4RDUA 4LZ5A 4ZZAA 3E9XA 1BI1A 1K78A 4NMYA 1OFCX 4EATA 1Z6RA 1KU7A 1ZBMA 4AM3A 2JT1A 2M87A 3R6SA 4WK8F 2V1UA 2Z8DA 2PJRB 2CW7A 4IHWA 3GTLJ 3SEZA 1O63A 5HLTA 5DEQA 3PMWA 3DFGA 3CCSI 3CJTB 1O3SA 2ZJ2A 3OIQA 4UXNA 3S3MA 4OIQF 3U1OA 1MY0A 2J5PA 1YYZA 2FIXA 2PX9A 3SDGA 3OS1A 3AAFA 2QQBA 3U21A 1ZN2A 2WAQA 3FV1A 1XGMA 1DPUA 4FIMA 2PVUA 3TYHA 1ZH5A 2PCRA 1D0XA 1JT0A 3MZHA 3LFKA 1RDZA 2PFZA 3ZGKA 3JSPA 1FTAA 4NX1A 1OCZH 4BGDA 1YIOA 1WVJA 3BTIA 1TWAJ 1J9IA 4PFWA 5JTYA 5C44J 1T0KA 3QK6A 3ZS6A 1IITA 1T8IA 5A5XA 2VKEA 1R4MB 2VD3A 3HSFA 3PMXA 3UP9A 3CCMI 2V6EA 1NUXA 1QHHD 1USSA 4JSDA 4AVZA 3ZKLA 4EQ9A 3LAJA 1KGSA 4IQ4A 2ZO4A 3BJAA 4IRGA 2RC9A 2X26A 3MZ1A 4XMYA 1SBPA 4DZ1A 3GW2A 1P1WA 3S2HJ 5E17F 2UVIA 3O28A 4A6DA 3IAZA 2DQRA 3HGYA 2ESNA 4EM0B 2PT2A 3QMFA 2F5DA 2WC2A 4OERA 2KRHA 4YB5A 1R71A 3HKZN 3RTRA 4BUPA 2QS3A 1N25A 2ZXIA 4BY7J 1AWCA 1MSEC 1YPNA 4N0BA 2H98A 4JWOA 4X0GA 4MJOA 1FSHA 3LSXA 2JTVA 2ZZVA 1DPRA 4IR8A 3FK7A 1D5VA 5AA4B 3OOUA 3OV8A 3W2AA 3OWTA 5EEGA 1P92A 4I6ZA 1D3YA 1Y4CA 1FTKA 3ZQGA 4YFKF 1R1UA 1S7OA 1FP1D 2H09A 2EQRA 4IL6C 2XF6A 2XXTA 4C1UA 3OYGA 4BE2A 1FJLA 2WAEA 4MGRA 5J47A 1B1HA 1SD7A 2XAQA 3JRIA 4OTEA 4U7BA 4HEA2 5IZ3B 1N7XA 1UIVA 1IXSB 2L9RA 4DYRA 1S29A 1JW1A 3K6XA 4O3MA 5J3LA 3BDDA 3FF5A 1ZRDA 3LL7A 4MNUA 2OU2A 1WJ5A 1WJCA 4E7ZA 1IAWA 4R6KA 3M8EA 1SD4A 4RLFA 4H0EA 2UXXA 5E3NA 1NV3A 1HC8A 4Z6YA 1HW1A 1YFHA 1G0HA 3O6HA 4UB6C 3VB2A 3IWFA 4UV8A 5FROA 4F19A 4U0VA 3OO8A 3V8XB 3ZMZA 5GPAA 3MQ0A 1D8KA 4N13A 4TLMB 2P6SA 5EYRA 1FBHA 2FUG2 2OF7A 2Q2CA 2W7YA 2DFHA 1NK3P 5K5QA 4KPTA 4DLDA 1SW2A 1LFBA 2M0CA 1BIBA 2QS2A 4U22A 1USTA 4IF4A 4EUOA 2IP2A 2M5WA 2HOTA 2F7BA 2HZDA 4LLGF 3ECHA 5E1XA 5F0HA 3DBHB 3FWEA 4CYCB 4FTHA 2I5UA 1IN5A 3ABUA 2NRAC 2F5EA 1ZLQA 5LGTA 4HW8A 3QSLA 1MPCA 2V1DA 5E20A 3GZ6A 4F31B 2UWMA 1MXZA 3DEUA 4YIRX 1RUNA 3TKDA 1YW7A 2LBFB 2IEEA 1UHWA 1MD0A 2IJLA 3KEOA 3OS0A 2FE3A 3V8JA 3SHFA 4BXFA 1HW5A 2GXAA 1TC3C 3NAUA 1HLVA 2K9MA 1JXSA 4N9IA 3TCGA 1V5EA 3BR3A 4CZZA 4PAKA 3FASA 1OYIA 2A5TA 5DM6F 5F1QA 5EYFA 4DQ2A 3S1QJ 4ENMA 1U6GA 2XXWA 2QS4A 1Y1WJ 2FYIA 2I10A 4ZDLA 3VVDA 4ANJA 5M5WJ 2Y0MA 2LF8A 2RNJA 1DUXC 3E0JB 1DMBA 2E2HJ 1Y3NA 2O1MA 2QVVA 5TP9A 3VXBA 5FJ8J 1UIUA 3QU6A 4X48A 4KICA 4AS5A 5HS8A 3L2RA 3ROJA 1U8BA 3D4GA 1FTZA 3TKYA 3VLWA 1AMFA 1MM7A 2HWVA 4GRIA 3GUDA 4PZJA 3QQAA 3TP3A 4ONYA 1ZGAA 4R72A 2LLKA 2DDAA 4RB2C 1OLAA 2HQRA 4KD5A 3G3FA 4F39A 3IOWA 2LMDA 3MAJA 4PETA 2F34A 3I4MJ 2XGEA 3LMMA 1IC8A 2VKHA 1IRFA 2YX4A 4FBPA 4IO5A 3M07A 3A09A 2G7UA 1R6RA 4F2QA 1BW5A 5HLIA 2BHYA 5EEHA 3V7SA 3I59B 2FNCA 2QEXI 3LSLA 3LUZA 1Y0UA 4NF8B 5IZZA 2O8XA 3RUMA 4F18A 3F8BA 1T33A 2GIVA 2QQ9A 3RJPA 1F5TA 2EFWA 2CV1A 2JA7J 4U4XA 2Q8JA 3DCFA 3ZMDA 4B47A 2HTJA 5KNLA 2ZNSA 4DI3D 1JGSA 4OVJA 4KHZE 2VE8A 2EFOA 3KC0A 1XDSA 4XM3A 5GADJ 4A0ZA 2K86A 2ZFWA 4CXFA 1X1PA 1EYJA 1A8EA 4M4GA 5DYHA 3R0JA 2DPDA 1BIAA 2NUVA 4POWA 3KC1A 4NWDA 5FKKA 5FLXK 2CUJA 1LBCA 1T98A 5I58A 1SVMA 4YEJA 1VQNI 2AO9A 2FBIA 4G77A 1ZG1A 2QMWA 3S2WA 1TWGJ 2Z16A 4AYBN 1EH8A 2KP6A 1LEVA 1I3QJ 4PFUA 3LSGA 4MH5A 4YB7A 2BY2A 1FPQA 2K40A 4E7IA 3H03A 4F3SA 1FP2A 2FSWA 2XXUA 5I59A 3MAMA 2LNBA 3K1PA 3OYDA 1FBPA 3ELKA 1NUYA 4NC6A 2OK2A 4LVQA 5EZHA 4ESJA 5AIPA 2PMSA 1MM6A 4HOBA 4F3QA 1SYHA 4CYDA 4XRFA 1I50J 2P6TA 2D1VA 2BOLA 2HQAA 2R7DA 4IOAF 3MZ9A 4XBFA 1RDXA 3I9V2 2E5ZA 3G1MA 1ZJLA 1XVXA 5L3BA 2FMLA 3OYBA 1GR2A 4JSOA 4IX7A 4P11A 1M5DA 3OIPA 5J1DA 1K9ZA 1D1BA 5D6EA 1DPEA 2Y2ZA 1XS9A 5J8FA 1OR7C 3HRSA 1P4XA 3F11A 4BKXA 1DU0A 5AA3A 4LK1F 5FHMA 3RDIA 4X1EA 3HO7A 4I0BA 1XCBA 3J7YJ 3KEIA 2W48A 4IPAA 1KWHA 1YXIA 3BCAA 4RMNA 3W6VA 3G71I 4F22A 3HTSB 2VOPA 1PBQA 2WYKA 1SFKA 2HNHA 4NBQA 2D45A 3K6UA 3EETA 3F6OA 4LMYA 4PSXA 1MBKA 3EYYA 3SEVA 1FBSA 3A02A 2JRTA 3G2BA 3WGGA 1YTVA 3ZQFA 1LFUP 3HOZJ 4LG0A 2DN0A 2A07F 3CJQB 2EZIA 2VQHA 4AB5A 3FUZA 4KCCA 5CMCA 3S9LC 2GHAA 2ELKA 4QFLA 1S5LC 2E1NA 3LA7A 4GYGA 3KGCA 4OINF 2DAOA 2QWWA 1Y9UA 3IOTA 3ZKKA 2FQ4A 5J40A 3B8BA 1HQCA 2DA7A 2LDUA 3O3KA 3S9EA 4GQOA 3RPUD 3VE1B 2WA0A 3P9KA 3K2AA 1IG7A 4G6QA 2VC0A 1X1BA 2GRVA 4H1XA 5CVVA 1YYVA 5CKTA 5CVUA 3SZPA 4OAZA 4OIRF 2O61A 1B3GA 4Q0CA 3C18A 2EK5A 4EJOA 1Y56A 2XXIA 4HPQA 3TW6A 2OQRA 3ECOA 5L3CA 3A01B 3ASNH 1DOTA 3KFMA 2H8RA 4OMYA 1W7PD 2LKSA 4LONB 5IGAA 2P7CB 2EB7A 2ELJA 2QSXA 1GVDA 4LITA 1I27A 5D8KB 1MG1A 3Q3SA 4YIIA 1BR2A 2GWRA 4U88A 3OYKA 1FZPB 3OENA 3CSBA 4YB6A 2E35A 3FXUA 4EJUA 5FKNA 1X1AA 2AHQA 3A0BC 4HRIA 2BBYA 4GWZA 2K02A 3HPHA 1G3TA 3L09A 3AG3H 3W2WA 2E7WA 4BQQA 1ZMGA 3VSKA 2N8GA 3KETA 4TV7A 1S7YA 3N26A 2FD5A 4NQWB 5GAEJ 1CF7B 2PFYA 2UZKA 5L3GA 1R9TJ 2UUZA 1WCMJ 3OELA 2L7FP 3Q5FA 2DA1A 2V4JC 5DTBA 2KQRA 3FHNA 2ZCWA 1T39A 2DXYA 4GBWA 5E1ZB 1IXGA 1SVOA 1LAHE 4JVIA 3PIOF 2XXVA 3KZYA 4PP0A 5DVFA 3IK6B 2JA2A 4OA4A 2DOAA 2DE3A 1B72A 1EKEA 2DE2A 2WAQN 5I84A 2DWIA 4HV6A 5IYBJ 2FBPA 1BC8C 2FNAA 4G6DA 4OESA 4RJZA 4EEFG 4RBOA 3S9MC 2KDOA 4YFXF 2JA5J 5HLHA 2WBMA 4A5MA 3V8LA 3AG1H 2RKMA 4MNPA 1Z1DA 1N84A 2Y5LA 5K7HA 4KCDA 2KR0A 5HNFA 4BEHB 2HYFA 1I6XA 4IO4A 3FHZA 1FPKA 1Z7NE 1YITI 1JUSA 3ABMH 4EJTA 3PUFA 4TQUQ 3QYEA 3K1MA 3MWMA 1QZYA 1ZQ3P 2Q2AA 1G59A 3HPIA 4PE3A 1G6NA 2PX1A 1DGWY 3A0HC 1I69A 4XK4A 2HYJA 3MKWB 5LDZA 1VE4A 4XEQA 2YS9A 1ELJA 1P99A 3G7WA 3WHCA 3HUGA 2XKPA 4QF9A 3FD3A 1M1EB 2V3QA 1L5TA 1I6BA 4ZJZA 1XS5A 3IUOA 4AUXA 2HHMA 1JI8A 5ET7A 5EYGA 2X7PA 4R9FA 5DUKA 2MGQA 3KSXA 4A3BJ 4LFUA 1UFMA 2XASA 2HFHA 2PBWA 3L9FA 3GLLA 3BQZA 4NB5A 2OCEA 5ITOA 2O1LA 5KCMA 3BPXA 2DTRA 3OOAA 1D1CA 3ROUA 2Y84A 4IO7A 1XX5A 3LSJA 3E79A 3F3XA 4LQ2A 4Q5TA 3HOVJ 1NV5A 2CWEA 2OCCH 4MEXF 2R6GE 5AA2D 5F0CA 2F5XA 1I3AA 3FM5A 4YAHX 1YS6A 3P5JA 2TCTA 3HSEA 5K1YA 2GOMA 1K78B 1OQHA 4P9KA 3KX2A 2JMWA 3WTVC 4YRVA 2XWOA 3S3OA 5BPDA 2JSCA 1Y1VJ 3S1MJ 3KBRA 4QSDA 4D0PA 2A61A 4DW6A 3T93B 3NOHA 1XTAA 1FNNA 1FBQA 2F35A 1HSLA 2ONSA 5FTHA 1TZLA 4A6EA 4HNVA 3KLOA 4L5JA 2QSGX 4JVDA 3W15C 3V7RA 1MMSA 2IS2A 3CCRI 2DYXA 5ICQA 3BWGA 1H3DA 4I01A 3FZVA 4V2GA 2VB6A 2YLNA 2QZ8A 1Y3QA 4XSZF 4HSTA 4Q47A 1IXIA 3ZCOA 3CCYA 1SC7A 2RREA 4KN7X 1TL8A 3GYHX 2FEZA 1OMIA 2CW0F 4E70A 2RCAA 3HGGA 1US5A 1ERDA 3TQNA 2XUBA 3WAEA 3M4OJ 2UXAA 5JTYB 1FQEA 1FIAA 2STWA 4XN0A 2BHZA 3UN6A 5A5XB 3JRCA 1UTHA 4RA1A 3TEDA 4LIVA 4A3MJ 5IP9J 1DTGA 5FKMA 1N78A 2KRCA 3TO9A 3IB1A 3QUJA 1IMFA 3ZQCA 3BG5A 3TTMA 1B4ZA 2WYPA 4RGSA 4H8IA 4U87A 2VASA 4QSHA 1TFAA 3LR1A 4RPOA 4U21A 2E19A 5LRRA 3BIHA 4NQ8A 3E6MA 3I0TA 4H67A 4YELA 4QXDA 4PJLA 2NVYJ 3BQYA 2J5OA 2BXZA 5EEAA 1YW9A 5LD2C 3KPHA 3WTYC 4ZEDA 4O3AA 3MZ8A 1GUUA 2XWKA 1EH3A 3E5XA 4G7HF 4H45A 3BR5A 5E79C 2NOJB 4LJZF 3HDDA 4M9SA 5E18F 4PAFA 1T6SA 2BGCA 4QSCA 3DQVC 3PQJA 2CV0A 1A40A 2VJJA 4PFOA 4ISUA 1RUOA 3ZXSA 3KP5A 2Y69H 3QYFA 1YZ0A 3PJRA 5BUUA 2M4KA 1FQCA 3CFXA 1JKRC 5F24A 4A3CJ 2DOEA 1H9TA 4IY5A 4JWYA 3KN3A 2O7OA 1OYYA 1SW5A 1LBWA 1QGXA 1WH7A 1MBHA 2DA2A 1RR8C 4B4CA 4M9ZA 5D5XB 4B8XA 1WZ2A 4C2MJ 3MP6A 5LHHA 2O69A 4XKNA 1XMKA 5TRDA 4IKFA 3TP0A 5M3MJ 2V3TA 3WU2C 1FBDA 4OWRB 3K7AJ 1OCPA 1E0EA 2ZNTA 5DCMA 4XL9A 4HS7A 5HPQA 4F29A 4KISA 2LKPA 4P0IA 5HBCA 3SEYA 4JWXA 3IL2A 2STTA 3HJEA 3A4CA 5CVIA 2HR3A 4ND9A 3RYPA 4FX0A 4G7OF 3VSLA 5DCFA 4E7KA 1G0IA 1NUWA 4N6KA 1ORKA 4IO2A 1VQMI 3G3HA 3QYBA 3LSWA 1PDNC 3I56I 4PGNA 4F2OA 3FM3A 4LQ5A 5ET5A 4Y33A 3H4ZA 1E2XA 2X1EA 2XB0X 3FVKA 1SVXB 3WG9A 4PK4A 2WADA 3CQZJ 4ZEIA 1KQ0A 3SFIA 4KJZA 3HRUA 3L6HA 3U8QA 4II3A 3UK4A 5K5RA 1ONVA 5EQ7A 4XKBA 4MTDA 3RPUA 3I58A 2L3DA 3MZYA 2L4MA 3MSTA 3S16J 4XKVA 1ETXA 1VQ8I 3FXJA 3WE2A 4GWSA 3PNYA 2CH0A 4KMUX 4PFYA 5I2NB 3T8RA 4A12A 3QP6A 1TP4A 1REPC 4AS4A 4RNSA 1KU2A 2OZUA 2A5TB 4DXCA 1D9YA 1MH4A 1W7PA 4KA4A 2E71A 1XC5A 5ED4A 4M1VA 3N05A 3BLYA 2Z3YA 2EA4A 2QYOA 4M6VA 4N4NB 4RB1A 2FMYA 3E13X 3EHSA 5TP9B 4THIA 2O8KA 1GV2A 5B5EC 4Q30B 5AONA 4GRKA 3D5LA 1EYIA 3P9IA 2NVXJ 2ECBA 4GWUA 4O3CA 3FMQA 2X6YA 5L3FA 1B5HA 1NH8A 2H99A 4NGUA 4O3BA 3ZMSA 4P5OA 3H6UA 5TISC 3EUHC 1Z21A 3L2UA 2Y5KA 2D5WA 2Z23A 3IB2A 1KU3A 1LDJA 1U3EM 4ZC3A 3HG9A 1ZR4A 5E3MA 3RPWA 1SI1A 3J7ZI 4P1LA 4WXJA 3PUBA 1LCTA 1BTJA 1I6HJ 1FOWA 1GVCA 2O03A 2RN7A 3I4NJ 1TLHB 3MP8A 3OSQA 1MH3A 2JUCA 2O84X 3HL2A 2DFEA 2Z2SB 3BTLA 3TTLA 5I3SA 1BBYA 3I4PA 3WTXC 4RYAA 2H94A 4LK0F 1XGSA 3S17J 1H76A 2DS9A 2XV4S 3KCCA 3ILUB 3DF8A 3IH4A 1F36A 4HNTA 3GTKJ 5ICEA 4U2RA 4YICA 4KUMA 2RC7A 2A6HF 2XXHA 2OZZA 4Y3OA 1Y0NA 5CQEA 2Z5UA 1JEVA 3PGFA 3OXNA 1B32A 4HCYA 2I0BA 1VFDA 3FV2A 1D4NA 3L7WA 2OZ6A 2JQ7A 4Y52J 5I58B 5JHFA 4EXKA 3K4KA 4XLNF 5HS7A 1XG1A 3O8GA 2EPFA 1DDNA 3SKPA 3JW4A 3PUYE 2CQNA 2ZXJA 3GX4X 4G8XA 1K9YA 2EFPA 4PCDA 1UQWA 3H06B 3CDHA 1GT0C 1NV7A 5IOZA 5GPCA 4QFNA 2P81A 4XKQA 1YW8A 4PFBA 5IYCJ 4IHSA 3PSFA 3X2QH 1F9BA 1N7WA 1BI3A 3KBZA 5L9OA 2PLYA 2OX3A 2QLZA 4PDHA 2PYYA 1VI0A 3W2VA 1XDUA 1B7HA 3PU5A 3RYRA 2EA2A 2HYGD 2EZLA 3PTYA 4ENJA 5AA2A 4WF2A 3BTJA 5JK4A 4AU7A 1O7TA 1IN4A 3TDUC 1Z05A 2HXIA 4B3XA 4OMBA 5CI5A 1N3XA 3KOSA 2BY1A 3FVGA 5B7DA 1GDTA 2K85A 5BNGA 4EM1A 1UCRA 1B2HA 1Y20A 1T56A 4EMSA 2R7ZJ 2FA7A 2KJBA 1BN5A 1Q1VA 1ZKGA 4S04A 6PAXA 4GWYA 1SD5A 1XT8A 4NF4B 3DLNA 3H36A 3ZQIA 2W85A 4HAMA 2QSHX 5JFRA 2P1SA 1SVLA 4HQEA 2Q8MA 1O57A 1G4DA 4R79A 3KOTA 2XAGA 3VYRB 1KA1A 1TTYA 4R6YA 1B1XA 5T3JA 3RN8A 2DE4A 4P9UA 4R73A 4LG0B 3HC7A 5DEXA 2L7MP 3PV0E 1IMEA 3B6CA 1LCFA 1RI7A 4XOTA 4MQVA 4F1UA 1US4A 3S8PA 2MKZA 1LE8A 2DWAA 2X7QA 1X4OA 3BP8A 2FJ1A 1JUPA 1IXCA 1DU6A 4CSWA 4KITB 1VNDA 5JHUA 2CV2A 3EDPA 2O9LA 3S2DJ 2A5SA 2WBBA 2FOKA 3E78A 1YX5A 3GFIA 2O6AA 3HHGA 1QW0A 2Z22A 4H5GA 1QZEA 2HGCA 2W82A 2PBIA 1QVSA 2Z33A 1B51A 1ACIA 1R7JA 2XXXA 3U2RA 1LJ9A 3FIWA 1SFUA 2YJPA 1LQ1A 2CZHA 3E5QA 3SQNA 3MN2A 1QJMA 1QRYA 2PEXA 4HW0A 4WXDA 9ANTA 4KT5C 3KJTA 2NWJA 4FETA 1JE8A 1E3PA 3MPKA 3FXOA 2QA4I 4HXVA 4B09A 2LAOA 1N04A 2LG4A 4PJNA 1B4HA 4NE4A 4NHBA 5LFAA 3ZN0A 1YJ9I 2XD3A 4JB7A 4RM3A 4RAFA 3E6CC 2IGNA 3DM0A 1DQUA 2EH3A 2DT6A 2EBIA 2ISYA 3AG4H 3B73A 4DI4B 4JX6A 2NXNB 4HE1A 1H89C 1TT0A 1X1DA 1NKXA 2JZYA 4S0HB 4OZ9A 4A0YA 2IW5A 2QKLB 1LB9A 2WEFA 1B7UA 3VDXA 2Y7KA 3P9CA 4HYEA 4D7MA 1B72B 1IRZA 1P7IA 1IMDA 2ZJRF 4HDVA 1U9OA 1FPBA 2CYYA 2IBDA 1UHMA 3M1EA 1QULA 1SDXA 5I5PA 3FISA 2IS1A 2HKXA 2VJ4A 5D5UB 2ICWG 2KDZA 1WJFA 4HX7A 3K10A 3K4CA 2IT0A 4BNCA 3PUZE 2JWTA 4J19A 4A3JJ 4GXSB 1YLFA 1XMXA 4OVSA 1Z6TA 1MIJA 2DFFA 3NWTA 2BZTA 4WCGA 4BJ5C 3OY9A 2KFDA 3OSFA 4IRHA 1MBJA 3QIMA 3KLNA 2VQLA 3ULQB 3PUVE 4YKIA 1VFCA 1Y1ZA 2BJJX 1L0OC 3RQIA 2VPRA 1WH5A 1X58A 3O29A 5JEIA 2X6XA 3WGHA 4ZYEA 2Q74A 1W4MA 4R74A 2CUFA 4GBVA 3SEQA 1FBCA 3LBSA 4IRIA 1U8RA 2QENA 4OQOA 5FFZA 2ECCA 2WAFA 4C3IJ 2COMA 3HUGB 4I02A 5HDKA 3DTKA 2R7UA 2F97A 4XLFA 2D2WA 4IGRA 2DA4A 3TUSA 4I2OA 4MF3A 4KIBA 2ZSHB 1CQTA 5CJ9A 3RKWA 1JNFA 1EYKA 3V42A 4KYEA 5DVIA 2L0KA 3HHFA 4GDFA 1Z67A 4AD9A 2EWNA 2A05A 1INPA 1B7ZA 2QKMB 4N15A 2IGKA 4KDPA 4NF5A 5B70A 1B5JA 2M30A 3T9UA 4M3FA 4MLOA 3H0DA 4ZE8A 2V1XA 1KQ8A 1W36D 1TQPA 3EKIA 2GBYA 4MEYF 1UJ8A 4TOZA 1FBEA 1P4WA 3KP2A 1ATGA 3ZMUA 4L9JA 4PQJA 1WI9A 4PDKA 1KONA 1HF0A 3RCOA 3GZNB 4ETSA 4C3JJ 3JRDA 3WTZA 1PB9A 1ENHA 4HLYA 3W3CA 2L2OA 2VQGA 3U92A 4I99C 3JSOA 3EHUA 3ML6A 3OYNA 1RKMA 3MVZA 3GTMJ 4CCKA 4WWCA 1BLFA 1WJAA 2DW4A 2R7FA 3AXFA 4U4SA 2RVCA 2NVQJ 3TQLA 4HG2A 1D5YA 3B6TA 2XXRA 1MDMA 1LB8A 4ZZEA 3BR0A 1PVEA 1TT5B 4UACA 5KZTA 4MNIA 1A04A 1U2WA 1HOMA 3AG2H 2JJ7A 3KFWX 4CCLA 2H5YA 3VOEA 5ICGA 4UUVA 5FKOA 4YMAA 1YE9A 2NS7A 3MCZA 2GLOA 1QUJA 4Y7NJ 1ETOA 1UTHB 1CB6A 2QVOA 4GIZA 4MO7A 2Y9YA 3CC2I 1ZG3A 3ECRA 3RPLA 3R6UA 3BIGA 4ZYDA 3K4UA 3F72A 1A8FA 1A55A 5CRYA 2KMUA 1E3HA 3GLXA 4NAPA 1X3WB 3LOCA 1G3SA 1ZYRF 2P5KA 3RYDA 3TAJA 4H4KC 5ICTA 3ZQQA 3DWLE 3BKIB 4YKPA 4DE8A 5CMMA 3VVFA 4G94A 3OEKA 3VXCA 5H6QA 3UNGC 5B66C 2P3NA 1R9QA 3IKTA 4JBZA 1Z0XA 2BE5F 1POTA 3FXBA 3H3GA 2H8WA 3IAS2 2FX0A 2ZXHA 4OENA 1WJBA 3RKQA 3M9AA 1ZLJA 4LIUA 4II2A 1APLC 2O7IA 1HBXG 2WKYA 3ZRGA 5LRSA 3G3ZA 1ZIUA 4FHTA 2CZIA 1RPWA 2EV6A 2ME0A 2VONA 2CEYA 4WEPA 4FT8A 4CCOA 1P1NA 3H0GJ 2QPQA 2H6CA 1R23A 1XB4A 5FO5A 1D9QA 3KYLA 3R4KA 2XPWA 2EIKH 2M7AA 2LRDA 4XKPA 1AHDP 2VXDA 2R4GA 4OHNA 4BDRA 3S14J 4UA8A 1B4AA 4Z2YA 5EQ8A 4A5NA 4EGYA 4PF8A 4ZEFA 2A3SA 1DSNA 1ZELA 2XXQA 5L3DA 2DJIA 2I3WA 2P2AA 1VSOA 4DZPA 5DCMB 2XX7A 1AOVA 5GTHC 3HV1A 3C4MA 3SDBA 4IXAA 4V2FA 4X1BA 5K2XA 3QPLA 2FF4A 4CH7A 4FX4A 1H8AC 3VWBA 4L0YB 2E1SA 3I71A 3QPHA 4EVIA 4UVCA 2KKOA 3GTPJ 2GQ1A 4OWDA 4JBAA 5B1AH 4E0XA 1LSTA 2JK3A 1NNKA 2QBYA 5HNHA 2ZSIB 3TO7A 3ZMVA 4A3FJ 2KQZA 3S2VA 2X9DA 1FRPA 1EH7A 1JTYA 2KRFA 2QM3A 3M3KA 1P1QA 2F5VA 2PFBA 3U1KA 1B0HA 4GVOA 1P9QC 4QPQA 4MEVA 1SQYA 2R7QA 4JP0A 4JOMA 2XGDA 1FYLA 1W0UA 1URDA 1H43A 4ASNA 2GOXB 3G3KA 4NUBA 1Q9DA 4GL8A 2XX9A 4DBRA 2VOZA 3OYCA 4OOIA 3UA8A 4F3PA 1BOAA 2M45A 1IZ1A 5IPAA 1OPCA 1R5GA 1K83J 4CA0A 3DLLF 4BBSJ 3K6VA 2O6GE 1ON1A 3W9VA 5DDGA 1FYMA 2ZMEA 4KIFA 3Q26A 4QFOA 1FOKA 1WFXA 2IAIA 2ZB9A 1QVUA 2MYSA 1W7PB 3T5XA 3TDJA 2HEOA 2E34A 4BQNA 1WWXA 4B3AA 3ZP5A 1D9VA 3L2QA 4WX9A 5KCJA 4DBQA 1SFOJ 1NNPA 2QS1A 1ZHFA 1VQ5I 1LAXA 2X48A 4U7DA 5DS9A 4E7JA 4L5IA 4NHJA 3DKYA 2XAFA 1T0FA 1VQ7I 3K02A 3EYIA 2Y7PA 1FBUA 4FE8A 3MMYB 1DBZA 4P56A 1H45A 2DVZA 3LUYA 4ELRA 4ENKA 4PFRA 3VEPA 3A2KA 1R00A 1GV5A 1MJAA 3CUQA 1HKQA 2LY2A 5LEKA 4G8NA 1PP7U 3T9VA 3S9NC 4C0RA 2DMUA 2FU4A 2MLKA 1MZBA 3U65A 3IH2A 3SETA 1IRXA 1PBPA 4NF6B 2JPCA 3ASOH 2EV0A 4E6KG 4EV0A 2RDPA 3BJ6A 2EFNA 4UV9A 3TQWA 2F5FA 1SPIA 4M3BA 2VJ5A 1GTKA 2E7XA 4I3YA 5CPRB 2QMXA 4BL0B 5H20A 4BYYA 3GZ5A 4CO8A 4A3IJ 2CGPA 3GFJA 3VV5A 4Q4ZF 4N4OB 3GTOJ 4LLLA 5DW8A 5BWJA 3U9GA 1M5FA 5CVRA 3VVEA 1VR5A 4QFPA 2Q0OA 1BR1A 4LGWA 2EINH 3CLOA 2VC1A 4UHTA 4MTEA 4ENNA 4IHXA 1NMUA 2HFBA 3T0JA 2M4GA 4JXIA 1SFEA 3JAMK 4HA8A 2XXYA 3O6GA 5HS9A 3T0YA 3TPAA 3C34A 4PTKA 4LOCA 4OVPA 3MC2A 2E0SA 1F43A 2PMZA 3Q0WA 1BM9A 1RIOH 1MBFA 1IMBA 3Q9VA 1JP4A 4HV5A 4YMBA 4E7LA 1JEUA 1J59A 3LWFA 1DPPA 4XXUA 4GXOA 5EJCA 4I98B 2HQ5A 2ZYKA 4QRZA 5E1WA 5DM7F 2CEXA 1SEUA 1IXHA 2PJPA 4IHVA 1OJLA 2THIA 3MW0A 5K2YA 1AU7A 4S05A 2I8DA 2W4SA 1SANA 2CQ7A 4JQFA 5EQAA 4AQ4A 3C9HA 1VQKI 1D1AA 2OPTA 2VQCA 3C3WA 4N8YA 2VBWA 2F36A 3DP4A 1VQPI 3I6VA 3I3LA 2MC3A 4NG7A 3BG3A 1UTBA 2XIGA 4ZDOA 3PD8A 2F6PA 1P2FA 3S4UA 5AA2B 1VFEA 3L00A 2ZYOA 5FHNA 2RGVA 2HEUA 1O7FA 5KAFC 1H0MA 3HEFA 2RCBA 4Z0IA 4GWXA 3RLFE 4Q5SF 1R1TA 2BW3A 3SESA 1PYVA 4KNYA 1S7EA 5CYVA 5H8FA 2PJRA 3EQLF 2W57A 3CG1A 2QL3A 5EHMA 1UZCA 3IORA 3DKWA 1Y8RB 3MQ9A 3FIRA 3K00A 3KP7A 1LGBC 3K70C 2HQ0A 3K9TA 2LY1A 3OYMA 2FRHA 2L7KA 1FQBA 3HSTA 3S15J 3DKXA 4B43A 2AQFA 4NEDA 2P7VB 3E3KA 3HCQA 1XI6A 2KPMA 4N07A 3FXQA 3EF7A 4LA9A 4N4UA 4F3BA 5DEXB 1LDKB 1MNEA 4M3EA 1M5BA 4MHFA 1OLCA 3LSIA 3HB9A 2YU9J 2REJA 1OCOH 2O5RA 3I53A 1A6IA 4KFQA 1LE8B 3DP8A 2XAHA 3ERED 2M7BA 1O3RA 1TNSA 1BIYA 1OVTA 1K4SA 3BZCA 3BG9A 3KG2A 4OVRA 4BY1J 4JYKA 2G7HA 3CMYA 3RZOJ 1AWBA 4XRSG 4AIKA 1YI2I 2Q2EA 4PFPA 3C33A 1JKPC 1ITYA 1T2KA 2B65A 3CR9A 3CUOA 4PJJA 3O2PE 2DXIA 5HM4B 3H9GA 3H1CA 1XC1A 3GMEA 1H44A 2L54A 2KZVA 2CG4A 4GX4A 2EZHA 2LK2A 2L9NA 4OEUA 4G2ZA 5B3SH 2F78A 2DWJA 1HA8A 2XA5A 3CC7I 1RRJA 2EIJH 2Y0SA 4UVBA 2V25A 2HPIA 2OAZA 2P3VA 1V55H 2H25A 4H6DA 1WQ2A 4E7SA 2DTZA 3HYIA 2GHBA 3LSFB 4DXUA 2X1DA 1VDWA 2HVSA 3C32A 3M7GA 2OBGA 3KEQA 3OMBA 4FJPA 2GIZA 3VLVA 3FJGA 1JHHA 2VIXA 1IV8A 1SMYF 2WB1A 3CZ6A 2FIEA 3GBBA 3O66A 2HTSA 3Q28A 2V7FA 4BU2A 4EJWA 1SW4A 1YRNA 4BDZA 4F52A 1VQ6I 2V3UA 3K69A 2K9LA 4ITVA 3SYTA 3R61A 1JW4A 3BOQA 4Y4RA 3FBIB 3VFZA 4QLCU 2QUFA 1B6HA 3CDIA 3Q0UA 4D5CA 1JGGA 3RKYA 4X1DA 4FEDA 2HXWA 1EZ9A 2GA1A 1DP3A 2D3IA 3K4MA 2DOJA 3OEMA 4XOPA 5JVTA 3H9QA 5FRNA 3L2VA 1RETA 3THIA 1FWZA 2LR8A 3BJOA 1A6QA 2B3BA 2DA5A 3ABTA 1M5EA 4CICA 2MG4A 1ZGWA 2JRMA 1HDPA 1MBEA 1ZR2A 4RPNA 3CMMA 4RXLA 3P7IA 3T66A 1OLTA 3V8KA 3UR3C 2NYXA 1PB8A 3J7AO 2HZTA 2IPQX 4YG2F 2DDKA 1WJEA 4O6JA 3OYHA 2EFQA 4G8HA 2L01A 5FD5A 2Z1DA 1FTMA 3I54A 1LVKA 2ZNZA 1OMPA 3JZJA 3L2WA 3T22A 1TQIA 1N77A 1F9NA 2A68F 3IFCA 3LC8A 2DJNA 3G1OA 1XSXA 3EN3A 4HTGA 3RT8A 3PPQA 5H8HA 2DYSH 2RINA 3F8FA 1TWHJ 1T08B 1B58A 5H8SA 1P7JA 5LTCA 1LFIA 3ZQ7A 3C36A 3CESA 4KFCA 2CZKA 1X3UA 1PUFA 1MDP1 3BG7A 2MD5A 4OMZA 1PDAA 2V9VA 2ZBKA 4FE7A 4NF5B 3IHUA 3IP4B 1ULYA 1O4XA 1IDYA 3B50A 2AXTC 4GFRA 3N5LA 3ISPA 1UG0A 2VXZA 4UUTA 2F5CA 3VYUB 5LEJA 4XLPF 1TFDA 3V83A 3O9PA 4PC9A 3QAXA 1XSVA 2UVHA 2BJIA 1UAAA 1II5A 4U1OA 1SFXA 3K6GA 1HSJA 1NV2A 4XQFA 4GO1A 4HLXA 4BAYA 1HXDA 2A5WA 5K5OA 2VPOA 3PIPF 1S8NA 3H3VK 4OVTA 1XPXA 1J09A 2HCAA 4I40A 4O8MA 4LG3A 1BI2A 3OOPA 1B05A 4E4HA 5JVGF 2ZNYA 1GHCA 1MQHA 1J75A 1ODDA 4DCYA 3H5NA 2HDDA 1JW5A 3CCEI 2R7XA 1MDMB 1QBJA 1R36A 3EUAA 4U0YA 2BXYA 2R71A 4POXA 1X2MA 2LD5A 1U0JA 5H8QA 1RC9A 2WV0A 5ICFA 3C2BA 4G4PA 4K3FA 2DOFA 3H5RA 1OCCH 3MUQA 2DA3A 3D5SC 1LLSA 1Z7UA 5L9MA 2VT2A 1RDYA 3T1BA 1M5CA 2DT7B 4P47A 4EQBA 1UG2A 4PF6A 3PO2J 4F55A 3GZGA 4KYDA 4XIDA 5LGUA 3RPLB 2KLFA 5ET6A 4XSXF 3WTSC 2F4MB 2UVGA 3SJMA 3DLAA 5C4XJ 3QRFF 4OANA 3MYUA 3W9WA 1XCVA 3R26A 3JAMZ 4L0ZB 5CVJA 3W6KB 2XC7A 1E17A 1VF9A 1RKWA 4UABA 3MD2A 4KI0E 1UELB 3SZGA 1FQDA 4FQGA 5EZGA 1LBZA 3KZZA 2XX8A 3FXKA 5F1JA 5CLSA 3VLUA 5CM6A 1B9MA 5IKBA 1ZRCA 3RTFB 3M1CA 3CI8A 3I3VA 4A2UA 4LLNA 2E1MB 2ZMEC 2ISZA 4MIMA 1I5ZA 1DK4A 1GLNA 2CS3A 4R2FA 2KJCA 2GA2A 1D8JA 4N81A 4WXCA 1G8XA 2CQXA 1SI0A 3K4JA 4BHCA 2GH9A 2H4IA 3KJ7A 2O0YA 3T9HB 1HKTA 1QUKA 3Q27A 1T0FC 3FMSA 4KT6A 1LKXA 4M9XA 2VODA 2HKOA 3MVWA 2YUSA 1FPJA 1FTOA 3CCUI 2OBPA 3CUQC 1Z7ME 4LZ7A 1USYH 1B9JA 3J80K 4BACA 1MBGA 4L17A 2DDBA 2OD5A 3OMYA 1B3FA 3EPZA 5JI6A 3ZQLA 2RC8A 1B40A 2TRTA 2QBYB 1NTCA 3S3NA 1FMWA 5ILSA 2GXGA 2C6YA 3HOUJ 2I48A 4E0WA 4F7ZA 1T38A 1NH7A 2UYFA 1LVAA 3EUKL 3G3IA 3SERA 4U0WA 2GFEA 1USYE 2I49A 4LB6B 4IQJA 1OVBA 4EQQA 3PUWE 1MJBA 2E60A 2PQ8A 2PMZN 1TWFJ 3BR1A 2VLAA 4BE0A 1LAFE 4KXPA 1LBYA 4PJMA 2Y7RA 3M3FA 4OVQA 1VQ4I 3HN0A 5H8NA 2L9SA 3LNQA 3HOTA 3LSPA 3HOXJ 2DO7A 1NUZA 3IB0A 5I59B 5A2QZ 3IJXB 1QO0D 3BBRA 4KYWA 2QVRA 3TGNA 2QSFX 3ERMA 4NF0A 1V5FA 1YG2A 2ZMEB 2BVMA 2W84A 3OO6A 3S93A 2DT5A 4AB6A 1Y6IA 2LVSA 2W25A 2B4MA 5EDNA 3GTJJ 2DODA 3CF2A 3GVAA 1NG7A 4AIJA 4CHUA 5KCJB 4ZE9A 4ZYAA 2ZNUA 4RK9A 1B9NA 3WG7H 2TDXA 2EJRA 4Y17A 3BPVA 4F92B 1B8IA 4GFBA 3TL4X 5IT3A 3O97A 1LPQA 2HQNA 2DFIA 1NHAA 4A3EJ 2CMPA 4MBPA 4P9FA 4IY6A 3N4MA 1MSFC 1JJ8C 2F7CA 3K0VA 3BY6A 3KP6A 3ZN1A 3ODBA 3J7AY 4H5FA 3CUQB 3FJ7A 2Y30A 5FLMJ 1B1BA 1YS7A 2K9SA 5B1BH 4V19K 3OO9A 4ZYGA 5ICCA 1XMAA 3FBPA 3PPRA 1A31A 1JKOC 4GXAA 1F4KA 1GVJA 3KP3A 3DTIA 1S9HA 3KP4A 4RAZA 1W36C 2HVRA 3GFMA 1MY1A 3DXJF 3WODF 1I1GA 2RNGA 1EH6A 4XNFA 4CCNA 2MSYA 3WGIA 3KIOA 4L9TA 2DLLA 4D9JA 3CFZA 3N94A 1BC7C 3KE2A 3KYCB 4ESFA 4LB5A 2HOSA 2PN6A 2FNPA 2R93J 4LD5A 3U1DA 1Q1KA 5J1RA 3D4CA 4GYIA 3MVYA 5J1YA 4OEVA 5BOXA 2M8EA 1D3KA 2F8DA 2CFXA 3QP5A 3I55I 3CF5F 2JPBA 2VT5A 3IH3A 4M71A 3QXMA 1UHSA 4YKJA 1R1VA 3D5RC 3R0AA 1IGNA 1IUYA 5J16A 3M8UA 4BS9A 1FQAA 3HPGA 4MFDA 2CUZA 4XORA 5F6FA 4Y15A 2JSPA 5C4JJ 1CNQA 1ETYA 5TGTA 2XVCA 2MLGA 3KYDB 4M6XA 1MXVA 2F6GA 1U9NA 1KU9A 3G1LA 3K01A 2I4BA 1D0YA 3DV8A 4AWXB 5H2FC 5I57A 2Y7IA 1B5IA 2XWIA 5LBQA 2W24A 3S1NJ 2XAUA 3JRHA 4IJAA 1OQGA 3LV0A 2R7WA 3P7NA 2Y0SN 4P1WA 1LFGA 1YQAA 3CMAI 2M1BA 2K3PA 3E7LA 3HOYJ 1QU3A 2ZYNA 2XAJA 4ON0A 3C2HA 3I64A 3OD7A 2QCOA 3ONMA 3RQTA 3LAPA 2XD2A 3CCLI 5EGOA 1POGA 4N8GA 2AS5F 2OWZA 2P5VA 2WB1N 2CFOA 3FXMA 4XLAA 2XROA 4AVPA 2I0CA 2ZYMA 4GD5A 5FTIA 5F64A 3CMEI 2FXAA 2YPRA 1A5JA 3Q29A 4HE2A 1UTBB 3TTKA 3C35A 3PMVA 1V54H 2IA0A 2XB5A 3ZMTA 4XICA 2F3BA 3IX1A 4BH9A 1I39A 3TDZC 3KN7A 1BJAA 1RNLA 1E3OC 3MJNA 1TXFA 4RY1A 5EHSA 3I5OA 5IM2A 2BW3B 3GBGA 3PSIA 3ABKH 4UUSA 1B46A 4MFEA 4ZH4F 3G3JA 2WTEA 2X85A 1RYOA 3UORA 4BDLA 5KK1A 3COAC 4YZZA 5H8FB 1AIVA 3SEUA 2IA4A 2OTLI 2HOAA 4GWOA 2O68A 3IO4A 4U23A 2X0LA 4E7HA 1BJZA 2L5VA 2E1OA 3A3UA 4UY8I 2Q1ZB 4OIOF 1DP7P 2XPUA 2D5VA 2M34A 1SD6A 2GM4A 3H7MA 1LDDA 2HXOA 1X1CA 3TBIA 2ALUA 4R6HA 4BDNA 2RQPA 1PUEE 2Q8KA 1SAUA 2IVMA 1TT1A 2VPLA 4RAYA 1WRJA 3T8TA 1ON2A 4DIQA 4BDYA 4NF6A 3RGYA 2WY7Q 3KZIC 2K9QA 2XHDA 5J4VA 3GBAA 3IO6A 4HCWA 5EG0A 2NS8A 2A69F 2XPVA 3G73A 3CTAA 5CBRA 1FTLA 1IJWC 4P55A 1R9LA 3RIRA 4ZTFA 4LATA 5FGMA 2DMPA 2XGCA 1MNMC 1POY1 4GF8A 2VOOA 4ESBA 4B44A 1JKQC 1I6AA 2NNNA 3PQKA 1RR7A 1V3FA 2Q2EB 5F0FA 5FRMA 1LFPA 1TWYA 2DBBA 2DQLA 3QOPA 1PC3A 3TEPA 5F7VA 2DMQA 5EYHA 2VGQA 1MGTA 1NV1A 1B3EA 1AL3A 3K1NA 1YTYA 1MXUA 5DT6A 2ID3A 3FMRA 1KZHA 3G4SI 3TTRA 4XFEA 3JREA 4N91A 5JLXA 5HOOA 2HDCA 4LUBA 5M3FJ 1JHFA 2G93A 4G7ZF 1UMQA 2IGMA 4PUSA 5GAGJ 2JA6J 3TZAA 4N9HA 1IXRC 5I56A 4XF5A 1Y8QB 1ZARA 2KIMA 4CCMA 4PDDA 4O94A 2BY0A 2KLOA 4ELQA 3U72A 4G68A 3K0LA 2XDVA 3CLQA 1MXWA 1J7KA 4ZZLA 1NNTA 1MKMA 1CGPA 1NL5A 3PL8A 1QQIA 1QZZA 2ZZWA 1VQLI 1AA7A 1NV4A 2NVTJ 1YRNB 2PMHA 5J6XA 1IIWA 2ZFUA 2O51A 4DCXA 3K2DA 4FISA 4ZEBA 3BZ6A 1XGOA 1P4AA 2DK8A 1NFTA 1IMAA 1FOYA 3A29A 2LREA 2B0LA 4PFTA 1IDZA 5CBSA 4ZZDA 5LGNA 4AC0A 5E8IA 1FBFA 1S7AA 4Y13A 2Y31A 5K7FA 1K79A 4XKRA 3BROA 5D4SA 1B3LA 4ZEKA 4X6AJ 4RM2A 4KR5A 4PGHA 2DK5A 2X1CA 1EA3A 3DTEA 1UB9A 2QJEA 2M3AA 1K7AA 2LC2A 2R5ZA 1AH5A 1OIBA 4A69C 2R7SA 3VDFA 4FATA 2E1CA 4NDLA 1BR4A 4GOTA 2XHKA 2ZC2A 3CCJI 3UKGA 2V6CA 4I1DA 3TOAA 2NXOA 4HX4A 4GLIA 1PB7A 4L5EA 3OO7A 2EZKA 3GTGJ 2Q89A 3LA2A 2A6TA 4BJ6C 3J80Z 4NC7A 4DIGA 2KIUA 3DPTA