1IZ1A

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR-type regulatory protein
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Dna binding protein
total genus 92
structure length 292
sequence length 292
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1iz1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A02
4A2UA 1D8KA 4HX4A 4MLQA 2ESNA 5F1QA 5I57A 3GXAA 1P1NA 4IO3A 4PGGA 5AA4B 1W4MA 2QMXA 2F5XA 4YKJA 2NUVA 4K2EA 2RVCA 3SETA 5CBRA 1UQWA 4ASNA 2XKPA 4JBZA 1I5ZA 2OLBA 5K5QA 3V8LA 4LLLA 1R5HA 2QS1A 1XGOA 3IKTA 3C31A 3FX3A 3ZKKA 1X3UA 3H3UA 3ULQB 2V84A 4X1BA 5H8HA 2REGA 1B4ZA 4ZEIA 4ZZLA 1FPQA 4NF6B 5KCJB 5A2QK 5CMMA 4Z7EA 1XDUA 2XXQA 3EQ1A 4POXA 4HQMA 3OSQA 2GIVA 5TRDA 3LSXA 5CVUA 2RN7A 5L3BA 4EQ9A 1FBSA 1LDKB 1LDDA 3FASA 5EYFA 2DVZA 2Z99A 2F34A 4ZH4F 2GH9A 3PD8A 1UTBB 3RI4A 1NNFA 4GVOA 1DP7P 4FE8A 4P11A 3RYPA 4WXHA 3WE3A 1MJ9A 2FMLA 3GZ6A 1ZAOA 1RYOA 5E1WA 2CSOA 3GBBA 2V3TA 4OFOA 4G7ZF 2A69F 1V4RA 3IRQA 2UZKA 2IJLA 3K1MA 5I58A 1FBQA 6PAXA 2Q8KA 1MQGA 3K00A 4O5VA 1WWXA 3M3LA 2Z8DA 1IUYA 3C18A 4YB7A 2AXLA 3S9EA 1R1VA 5D5XB 2UYEA 3FV2A 4LONB 3IO6A 2F6GA 1RUOA 2HR3A 4PETA 4OVJA 2P8TA 4I01A 4M74A 2EFWA 1USYE 2DLLA 1Y3NA 5ICEA 3ROUA 5B70A 4GIZA 3P7NA 5D5VB 3MP1A 4PE5B 4UXNA 3I71A 1HW2A 2OJTA 1H9GA 2XASA 2DE2A 3IJOB 2EA4A 5TP9B 4L9JA 4Q0CA 1ELJA 3C35A 2ONRA 5LLQA 2M8EA 3QU6A 4P5OA 1U8RA 3I5OA 2VD3A 2D45A 4NB5A 4X1DA 3QPHA 3FUZA 1LB2A 1VR5A 4D0PA 2MA3A 4S04A 5ICCA 1YYVA 1XVXA 2XX9A 3PPRA 4KYEA 4R6HA 3GF2A 1B0HA 5LHGA 4Q8RA 2PYYA 1F1ZA 2YX7A 2QRYA 2QPQA 4ZZAA 5CRYA 2G7HA 4P0IA 4Q47A 5BPIA 1MH3A 1P99A 3O6IA 5CVVA 3LAJA 4G8XA 3J80K 2VBWA 1IEJA 4RY1A 1NH7A 2JRTA 2QJEA 1T0KA 3CFXA 4HQEA 2YX4A 1NNPA 2XXVA 3Q26A 4EQQA 1ZLKA 3DP4A 5FLXZ 3KZGA 3VLWA 4U0WA 4LGWA 2KJBA 3LAPA 2DAOA 3ZMZA 3S9LC 4AIJA 1EH6A 2DOJA 3HRMA 1LAXA 4ND9A 1NKXA 1STZA 3VDFA 3IHUA 3RLFE 4ECFA 2RQPA 1I69A 4DXUA 3RPUA 4RB3C 3F23A 2NVUB 1ZH5A 1Y1ZA 1I1SA 3RDIA 2NNYA 3DPTA 4GXAA 1B9NA 3QAHA 1F5TA 2F5EA 1GTKA 4XKQA 2G7UA 4Y15A 4OMZA 2YJPA 4JQFA 3WAFA 5LHHA 4BQAA 3K6WA 2PMUA 4Z0IA 1P1OA 2L4AA 1HSLA 3LR1A 1LBBA 2H5YA 3F6VA 4EUOA 2PMHA 1AH5A 3E6BA 4UVAA 4BHPA 1B9JA 5IT3A 5L3CA 3WTWC 4UA8A 3GW2A 2W57A 5KK1A 2V1XA 2ZYMA 4OIRF 2O7UA 3C7JA 1R9LA 1TFAA 1HKSA 4GQOA 3BDDA 1U5TC 1GR2A 4NF4B 4G68B 1LEBA 1GGGA 2VONA 4GL0A 2Z5UA 4EGYA 3QSLA 4EF1A 3HSEA 3DPLC 3GXOA 3GYHX 1B5JA 5I59B 3GVAA 1R1TA 3OEMA 3E5UA 1VE4A 1J75A 3TODA 2QLZA 2XAGA 2DXYA 2Z23A 2DK8A 4DIGA 4G4PA 4B09A 5B7DA 3W6KB 1D4NA 4AB5A 1ZLQA 3MCZA 1A54A 1S9TA 4WXDA 1MY1A 2OQGA 1VTNC 4PP0A 4ZE9A 2EFNA 2XGXA 3F72A 2KIFA 2CW0F 2RV8A 4G77A 5D5WB 3H7MA 2FEZA 4G6DA 5FFZA 3QUJA 3L00A 3SEWA 1A40A 2XX7A 4LLNA 5J8FA 4LFUA 4F1VA 4L18B 3H6VA 4H5GA 4MLVA 5DV5A 3BKIB 4WF2A 3ZN1A 1BI3A 1LQ1A 4BDLA 5F6FA 2EJRA 3IRRA 4HTGA 5A2QZ 1SD7A 2YPNA 4RPOA 4MGRA 2P4WA 3ODBA 4U4SA 3CI8A 3I59A 1SMTA 1ZHFA 2UXXA 3O6HA 2RC8A 2I48A 2YSRA 2CO5A 3N26A 4F1YA 5DUKA 2DPUA 4QLCU 3RGYA 2OQRA 5DYHA 1B3LA 1FTJA 4N13A 4PFWA 3OO9A 3V8JA 2A61A 5I2NB 3DF8A 3AXFA 3C3WA 4R9GA 1MQIA 2IA0A 5JHUA 1XGMA 4A0ZA 3NEUA 3PQJA 3JTGA 2C6YA 5IKBA 5AIPA 4EGZA 2V1DA 4I0AA 1WODA 1SAXA 3F8FA 2HZKA 4F19A 3ECOA 5FGMA 4L0YB 3IB0A 1UIVA 1EU8A 4PQJA 4KR5A 3V8KA 3DLNA 3JW4A 2VBYA 2O7IA 1PUEE 1OVTA 5ITPA 1IN5A 3K6VA 4KICA 2IVMA 1B05A 4F7ZA 2K4JA 4F2OA 1B1BA 2RC4A 2W24A 1XC1A 1ZGJA 3KN3A 3BJ6A 5AA2D 1IIWA 1LFHA 3K1NA 2D3IA 1JHHA 5L9OA 4IGTA 4MHGA 3S4UA 4L9NA 2MBFA 2V79A 1OMPA 2NOOA 2PN6A 4CICA 3KN7A 1Y4CA 5ICTA 2ACJA 4YB6A 4UVCA 1BIYA 2IPQX 3TOAA 1P6RA 5LEKA 1SMYF 1ZIUA 3T96B 3SESA 1R7JA 4RJZA 1HSJA 3M8EA 1QBJA 2A3SA 2VE8A 3EHTA 2LNBA 1M5DA 4XRFA 5BOXA 2HS5A 4YFNF 4LZ5A 4IF4A 4I98B 2HCAA 1Z9CA 1IF1A 2Z22A 2IEEA 4OIPF 4YZZA 4A12A 1MPBA 3MAMA 5DCMA 3VVEA 1B9MA 2W7YA 5A5XA 3WTSC 3VVFA 2XIGA 4FX0A 3MZ1A 1FSEA 1SW4A 4G8MA 3H3GA 4EM2A 2ANJA 1FCKA 1B3GA 2GHBA 4DDDA 1JHFA 3CG1A 5DVFA 2NRAC 2PQ8A 3MBPA 2OK2A 4UV9A 3IWZA 3M3KA 5AA2B 3KCCA 4OESA 4UHTA 2K86A 3H92A 5L3DA 2XXWA 2JZYA 3J80Z 4M72A 5CVIA 3C1DA 1MXZA 3WU1B 2BEOA 3RPQA 3ZMSA 2DFIA 4NF8B 3LA7A 3T9XB 3M1EA 2NAZA 4CO8A 1FTMA 2H98A 3KSXA 2BYVE 2FBKA 4RGRA 2O51A 3O2AA 3FWEA 1YAEA 2GWRA 3BZ6A 4FIMA 2I49A 3RQTA 5HM4B 3MW0A 2XXPA 4RB1A 2B3BA 2XAFA 4JB7A 4ONYA 2DBBA 3EHSA 5AIQA 3RNNA 1TTYA 1N7XA 4KFCA 1YCJA 4A5NA 4MBPA 3T66A 5EEGA 1TXFA 1CGPA 1RZ4A 4KCCA 1O3TA 3V89B 4QSCA 4HF1A 3ZQ7A 3TCFA 1B5HA 1MQDA 4QFOA 5HVQC 1Z7NE 5I57B 2R7FA 2XXYA 4ZYEA 4GYIA 2VXZA 3TMGA 3GZ5A 4MNUA 4OINF 2ADUA 3JSOA 3PMVA 4R2FA 3IWFA 4E0XA 1V3FA 3SXYA 3RYRA 4ON0A 3CUOA 4GF8A 5H8HB 2WC2A 1BP5A 4FECA 4JSDA 2MLKA 3QOPA 2OBPA 3PPNA 1YW9A 2ZYOA 2PJPA 4HCWA 2XVCA 2Z3YA 1UFMA 2IW5A 2OCUA 2DQVA 2Y7PA 3E13X 3K01A 3HHGA 1B40A 1YW8A 1TWYA 2GA1A 4M9XA 3BFUA 2HTJA 2ZO4A 3KJ7A 3D5LA 2VOOA 2OWTA 3GX4X 2Z9OA 1IXRC 3CVGA 1KGSA 1Z7ME 5DD4A 1IN8A 2P2AA 3GBAA 2PEXA 3GZGA 4GCVA 5H6QA 1CF7A 1I6QA 1QZZA 1O7LA 4Y13A 5HDNA 5K2XA 5L3EA 1B7UA 5JI6A 3HTUA 5I58B 1FYMA 4BDNA 4BNCA 1ZMGA 2A6EF 2K7LA 1MGTA 4HAMA 2V9VA 2Q2EA 1MXVA 1VFDA 1IAWA 1FT9A 3FVOA 1JVYA 2R9JA 3SEVA 3H6UA 1L5TA 3TPAA 3ABUA 1G6NA 1UHMA 4RB0A 5ICGA 2PMSA 1TQIA 1XN7A 5EHSA 3MP8A 3JSPA 4ENJA 1MXXA 5CM6A 3ZMUA 3SEYA 3T22A 3FJMA 3P9CA 4FT8A 3V8XB 4LMYA 4U1OA 4YU0A 4AWXB 2Y7KA 1TW3A 2H09A 1IRFA 4G68C 1NNKA 4EV0A 3K2ZA 2HQNA 1JGSA 1FTOA 1R1UA 5LGUA 2WTEA 1QUIA 3FF5A 4P0GA 1UIUA 4X9TA 3WE2A 4XBFA 4A6EA 1MRPA 1RIOH 2D1VA 5LRSA 4NMYA 4CHUA 1B3HA 1YQAA 1FTLA 3HN0A 2DTRA 3HHHA 2P5VA 5DDGA 2MD5A 1LCTA 4RA1A 4CXFA 4KUMA 5HLIA 3TTKA 1Z7UA 3VOEA 3O97A 1M5BA 1LCFA 5E20A 4XLPF 2RKHA 2M8CA 4EJOA 4GD5A 4XLNF 4QSEA 2PT1A 2THIA 4ZDMA 1USSA 3ISPA 2V25A 1B2HA 2I0BA 2UVJA 1SYIA 3KJTA 3TDZC 4WX9A 2P7VB 4F39A 3GFMA 1IXIA 2VN2A 3I58A 1XOCA 2CMOA 2LF7A 2QWWA 3IB2A 2VBXA 3D0SA 3I6VA 1B58A 4LZ7A 2I3VA 4F22A 3B02A 1AIVA 3H6TA 4AIHA 3WGGA 1SD6A 1B51A 5ISUA 3C32A 2DW4A 4RK2A 4H5FA 3SQNA 3RUMA 4LK1F 2O69A 2Y7RA 3VB2A 1T98A 5IT9Z 4O6JA 5KVRA 1DPUA 2PBIA 4EJWA 4I62A 2DT5A 1MDQA 1QULA 1W7PA 1FQAA 2YU3A 1FQDA 2QQ9A 3MZBA 1R22A 4HDVA 3MEXA 2DU9A 1R5GA 3HRTA 1PEBA 4OEUA 3R0JA 4G8NA 1Z91A 3FXRA 5I84A 2Q88A 5BUUA 4RGUA 1N7WA 3T5XA 2CG4A 2QBYA 4KNYA 1AMFA 4QSDA 5HOOA 1HKQA 4JWOA 2E7XA 2L02A 5FFXA 3PU5A 4U4XA 5FD6A 1FSHA 3O66A 3HRUA 3MPLA 2LAOA 4NF5B 2CYYA 1LBCA 1RKMA 4M1VA 5FHOA 3E6DA 1F9BA 1JW5A 3IOVA 3E6CC 3FJ7A 1ON1A 4IPAA 4L9TA 3HO7A 3S2VA 2LF8A 2V6CA 1I6AA 1I6BA 1R9QA 3O3KA 1IRGA 3D4CA 1D5VA 2VP1A 3G3HA 1NHAA 2K4BA 3MFKA 3RN8A 5JTYA 1JQFA 3G3KA 3J81K 4MQVA 4KIFA 5AE4A 3Q9VA 3FVKA 3KZYA 4GFRA 2B65A 2NWJA 4ISUA 1P4WA 1K79A 4ZEKA 4U23A 3TO7A 3JTHA 2REJA 5ILSA 3HUGA 2PLYA 1SD3A 1FQEA 3A3UA 3LSTA 4ESFA 5DCFA 4ZE8A 3ABTA 1Q1HA 1DUXC 1O7TA 2EWNA 5K1YA 1LAFE 3OEKA 1SFUA 2HZTA 2Q9TA 1QZYA 1AL3A 3MPKA 1DTGA 2E0SA 2Z8FA 2F5CA 5LBQA 5DD8A 3FM5A 1H45A 3K6UA 2O61A 2HQ0A 3FJGA 3CDHA 4MTDA 3VFZA 3BWGA 3MJNA 1LVAA 1SFEA 5KDTA 4NE4A 3KP2A 1A8FA 4HV6A 5I56A 2Q8JA 4KT5C 2HKXA 3I59B 1H43A 3E5QA 5ICQA 3OMBA 4KQPA 1WSUA 2P6TA 3R26A 4A0YA 4PCQA 3RTRA 1A04A 1SYHA 4MFIA 2FA5A 2HYFA 1BI2A 1IXCA 2RINA 1H0MA 1TNSA 3EHUA 4GLIA 4OWDA 5FO5A 4EMSA 4OYVA 3CFZA 2DE4A 4GL8A 5BMZA 3SHFA 2HXWA 1KYZA 4OOIA 2I58A 2E1NA 3PPQA 3L2CA 2WWYA 4ZS9A 1BTJA 2A07F 3TQWA 4U88A 2NYXA 2RCAA 2HEOA 1XGNA 1K7AA 4BXUA 4HLYA 2XKOA 2P5KA 2FNPA 2AL5A 1L3LA 1KU9A 2M45A 1FOKA 1P4AA 1ZRCA 4IO7A 2F7AA 2CWEA 2A5TA 1B7HA 4XKPA 3WODF 2KIUA 4BDQA 3JYRA 3U9GA 2ZFWA 4PDKA 5HBCA 4F18A 2Y7IA 3V7CA 2O84X 3U92A 1BKAA 4LG0A 3K0LA 3H4ZA 4P96A 1KU7A 2QYOA 3RKXA 2DI3A 2ZNYA 4ZZDA 1POY1 3BPXA 1PP7U 3FZVA 4PFTA 1QVSA 3TKDA 4U1ZA 4DZ1A 4N6PA 3QRFF 1QO0D 5JVTA 4FEBA 3G3GA 4HYEA 4RB2C 2PG4A 5E8GA 1YTYA 3W15C 3OD7A 1OYWA 1HQCA 1I27A 1IW7F 3WTTC 1FW0A 1XMKA 2L54A 2XXTA 1S6LA 4LUBA 3ML6A 4GXSB 3GO5A 1DPEA 5HDGA 1QNTA 4LA9A 5AA4A 3FVGA 3MP6A 2HTSA 1BLFA 1YS7A 2F35A 4NQWA 3B6WA 3FHZA 4UACA 4YIFA 5DCMB 1II5A 3IJXB 4L0ZB 3CRBA 1JETA 3MZ9A 3GLXA 4GRKA 5E18F 3EQLF 5A5XB 5M2VA 3JAMK 1J5YA 3F8BA 3KBRA 5F64A 3IOTA 4UNOA 1B3EA 4KIBA 4KN7X 3VXBA 3IO4A 3F8MA 3HRSA 5DTBA 3QU3A 3COAC 2PI0A 5HS8A 3WTXC 4I09A 2M1BA 3C9HA 3TDJA 1GVJA 1OYIA 1EH7A 3E5XA 4KDPA 4GGGA 1DMBA 4HZFA 2DXRA 4RGXA 3I3VA 3Q9SA 3K0VA 1EZOA 4HX7A 1F9NA 4JK1X 2G29A 2ESHA 2FNCA 3O9PA 4XTCQ 4BDRA 4NTLA 1VSOA 2FBHA 3CG3A 4OZ9A 4ENNA 2P7CB 5H8QB 1LFIA 1LB8A 1LLSA 4EM1A 4H0WA 5I2KA 4HF2A 2B0LA 4MH5A 3NQOA 4LLGF 2IA4A 1S7AA 4M9ZA 5D4RA 2FSWA 5H8FA 1UHWA 2KKOA 5D8LB 1WDNA 4F3BA 2DWIA 4FHTA 4HW0A 1FQCA 3ECRA 4ELOA 3K6XA 3PMXA 2VOPA 3MVZA 1HSTA 4C1UA 2I3WA 4R75A 4POWA 3MQ0A 5D6FA 4MF3A 3VV5A 4FEDA 4O3AA 1MY2A 4MEYF 3N5LA 3Q27A 2QQAA 4AIKA 3K69A 4H1XA 3T1BA 2EFPA 5DVJA 3GFIA 3ZPLA 3G3IA 4R9FA 3TEPA 5LGNA 5BPDA 2AIXA 2FF4A 2Q0OA 1QGPA 1H3DA 2DVCA 1OMIA 2GHAA 1BJAA 5LRRA 3ZMVA 3F3XA 1A8EA 4LVQA 2H27A 3CO6C 5EHMA 5L8DA 4CZZA 3N94A 1URDA 3L9FA 2DWJA 4JWXA 3O28A 1GVCA 2O6AA 1S7OA 4KPTA 5L3FA 1PDAA 5L3GA 2OA4A 3QXMA 4XXUA 2IP2A 1RI7A 1FBUA 4DE8A 3QPTA 4OQOA 1QPMA 2VHAA 3RTWB 3V5AA 1WKMA 1BI0A 1M5CA 3LFKA 1P4XA 3KFMA 2EV6A 1CF7B 2BJJX 2ZNUA 4IRHA 3R7XA 3PGFA 3F21A 1PB7A 4YAHX 3FGSA 3S9MC 3L7WA 5CJ9A 3C36A 1ZG1A 4F31B 1GXPA 2UXNA 2MH9A 1MQHA 4EQBA 3TYHA 1XS5A 3F8CA 2OZZA 3MWMA 4G7OF 1R58A 1EH8A 5CC2A 4I1DA 3M8FA 4ESJA 2YLNA 1S7YA 1XD7A 3I0TA 3G7WA 2E1CA 4UUVA 4TOZA 1Z1DA 1SBPA 1DDNA 3KEQA 1P1QA 3RTFB 3J7AO 4LK0F 1B46A 1Z05A 2XRNA 5CMCA 1PBPA 4A0XA 4GOTA 3BP8A 4A5MA 2OZ6A 5ED4A 1GV8A 4F29A 1M5FA 3UK4A 4QFNA 4KIGA 3WGHA 3L09A 1XGSA 1RUNA 3R0AA 1DPRA 4M71A 4X48A 4IVNA 2MH2A 1IXHA 1QQIA 1O57A 3WU0A 4EJVA 1Y3QA 4HV5A 3QUFA 1Y0UA 3E3VA 3S9NC 4R79A 1EZ9A 1OYYA 4JSOA 1US4A 1B59A 3F22A 2F36A 5H8NA 4XSXF 3ILUB 1Y1MA 4RNSA 1XCBA 3R4KA 2ALUA 3LWFA 3M3FA 3U94A 1VFEA 3EF7A 4OXVA 3MZHA 4U22A 3DKWA 4U2RA 4KHZE 4HX8A 1G3TA 1J59A 1S50A 1B0LA 2HEUA 4RGSA 1JE8A 5BQTA 2QS2A 4OERA 3CUQB 4YG2F 2JPCA 1PP8F 3T9VA 3W9VA 3KP4A 1G4DA 1L0OC 4Q5SF 3MUQA 3UN6A 2DPDA 3OV8A 3T9UA 4R2BA 1MPCA 4HBLA 5E1XA 4QHQA 3T0YA 1ATGA 1HSEA 1QUJA 3EETA 3KP3A 5E8IA 1R1NA 3W6JB 2VD2A 1ZBMA 2QM3A 2Y75A 1K6OA 1ZLJA 2EFQA 2GA2A 3I54A 3IL2A 4DQ2A 2VT2A 4EXLA 1O3RA 2H4IA 3IORA 3RT6B 4U7DA 4H8JA 4OFLA 5L9MA 3DP8A 1WQ2A 1IUDA 3KG2A 1S29A 3JAMZ 4G6QA 1MY0A 1W7PB 1B5IA 3ZSFA 3USDA 5AONA 3SZTA 1SQYA 1QKBA 3VVDA 4IO5A 1ZG5A 4LD5A 1E2XA 3WG9A 4AD9A 1SW1A 1YIOA 3KP7A 3QAXA 1N84A 2STTA 3REOA 3P9KA 1UCRA 3TTNA 2ZMEA 5K2YA 1FLIA 3B6QA 3K9TA 2R71A 2V3UA 3ONMA 2O68A 4OENA 1BN5A 2QBYB 4BYYA 3UA8A 2IRFG 4G9YA 2VGQA 1IN4A 4DLDA 2UVGA 1BM9A 5E17F 2BGCA 4C1TA 1IN7A 3EUHA 1TQMA 3TCGA 2CZLA 3P9IA 1IN6A 1UTHA 3HV1A 5JK4A 3VEPA 1SDXA 1KWHA 2HYGD 3GWZA 4I0BA 2PFBA 1YFHA 4A6DA 5LEJA 3DP6A 3FMSA 3KOTA 4ZZEA 3UGWA 5JTYB 3HOTA 2VODA 4KA4A 1MDP1 4BAYA 2YPRA 3OELA 4IO6A 4H0EA 4F2QA 1ZREA 4ELPA 3L6HA 3MAJA 1B3FA 2ZXTA 3KGCA 2O03A 4IHSA 4RPNA 2FMYA 3HTSB 4DXCA 2QZ8A 1B1HA 2Z33A 1CB6A 2O1MA 3TDUC 1YO5C 3LC8A 2OD5A 2K02A 5F1RA 2P5LC 3HSFA 5DEXA 2W84A 4LB6B 1FP1D 4F3GA 2ZNSA 2BE5F 1DSNA 2PT2A 4WEDA 3U93A 3RJPA 4IB2A 4K3FA 3DV8A 3G3FA 2OBGA 4G94A 3H06B 2EB7A 1YG2A 1FY7A 1A55A 4ZYHA 4L17A 1XCVA 4Z2YA 2DO7A 3DFGA 1ZN2A 5KDTB 1ANFA 3F6OA 3M7GA 5I56B 1D9YA 4AVPA 1PB9A 4KCDA 4JXIA 4U7BA 3E9XA 4KMFA 4YIIA 2HDCA 2VT3A 3BJAA 4XKRA 3TTLA 4I8CA 4R8HA 5CMBA 4DCYA 2ZKZA 4Q48A 2MC3A 2PX1A 1MXUA 3RT8A 3TELA 3CJNA 4M73A 3TAJA 2LDUA 3R61A 4YKIA 2BBYA 1O3SA 1FYKA 4OETA 1N0TA 3GFLA 4FATA 2HFBA 5ERIA 1MDMA 1YW7A 1LGBC 2ZCWA 4N9IA 4JBAA 2UVHA 3H3ZA 3Q29A 3KP6A 3HCQA 2Y0MA 4WEPA 1SI0A 2A5TB 3FMRA 3O6GA 3V83A 2X4HA 4JDFA 2HGCA 5DUIA 1B7ZA 4LG0B 1Z6RA 5FD5A 3C33A 5JEIA 1YTVA 4ENKA 1D3YA 2D21A 2I0CA 2KJCA 1B1XA 2O6GE 3IOUA 1BIAA 2OU2A 3FIRA 4M6XA 1B6HA 3BROA 4O3MA 2V1UA 3I64A 3LA2A 3ELKA 1DOTA 5TU0A 4KN4X 1NMUA 2F97A 1OPCA 3F11A 1Q35A 3PV0E 1MH4A 1US5A 2JTVA 3TOBA 5TPAA 1MQJA 2Y7WA 4F3SA 4YICA 1PC3A 1YPNA 4UVBA 3PPOA 3QP5A 4NHJA 3G73A 1TW2A 3N6TA 4KMUX 5JR3A 1B4HA 2NXOA 2RKMA 4LQ5A 1ZGAA 2ISYA 2F7BA 3TUSA 4FAJA 4BDOA 3HYIA 1GHCA 1XSVA 4F3PA 2EA2A 3ZN0A 4UV8A 4TLLB 4ZEDA 1OKRA 4CDGA 3CTAA 5F7VA 3L6GA 3TTMA 5HS9A 1KQ8A 4OMYA 5K5RA 1ZTYA 4L9VA 4Q5TA 1NFTA 1BC7C 3JZJA 1DPPA 1OLAA 3R60A 2I6EA 2A5YB 1K78A 3R6SA 1T0FA 1NNTA 1J1NA 3TO9A 4P9FA 3WGIA 4WKMA 2ZMBA 2YR2A 2W25A 1MM6A 3OENA 1F4KA 2GAUA 3BOQA 4NEDA 2COMA 4AB6A 2Y84A 1MXYA 3KETA 1I6XA 2I4BA 2H9BA 3VE1B 1TBXA 5CLSA 4RS8A 5J8CA 1T2KA 3LUYA 3WTYC 4TQUQ 2DQRA 4XIGQ 2EV0A 5I2KB 3SFZA 3PUXE 1FNNA 4N9HA 1P1UA 3M9AA 1SD4A 5BWJA 4EJUA 3SZPA 1S3JA 3LQRA 1YLFA 5CI5A 3B73A 3HSRA 1RYXA 5J1DA 2F78A 3KOSA 1Y9UA 1MM7A 4MTEA 1U5TA 2RCBA 5H8FB 3TTRA 3KSJA 2HWVA 2HOEA 1WRJA 4LP2B 3MVWA 3QP6A 3ZKLA 4B8XA 4ESXA 1N04A 4ELRA 1ZJLA 1JVXA 1LEAA 1MXWA 2R3SA 2HAUA 4G7HF 1P2FA 4R74A 3A3CA 5CYVA 4PZJA 2ZBKA 3BY6A 4OU0A 1TT1A 2ETHA 3OSRA 4TV7A 4QRZA 2D1HA 1Q1KA 4KYDA 3SEXA 5FTIA 2F7CA 1USYH 4O3BA 4P9UA 1MY4A 3R6UA 4ZEBA 2VC0A 1FTKA 3CUQC 1R36A 3RY3A 4FORA 1LAHE 4KI0E 4NWDA 1AWCA 4WXJA 1QJMA 3PUVE 1OQHA 1MZBA 3WTVC 4M4GA 2E1SA 1MY3A 4E0WA 1LB9A 4IY6A 2L4MA 1ZKBA 4WWCA 4I02A 1OVBA 3HHFA 2UXAA 3MWBA 3H6WA 4I2OA 4XSZF 2XROA 5DVIA 4JWYA 2RGVA 2XXRA 1EV7A 4HDUA 4RYAA 3KN8A 1LNWA 3FMQA 3W9WA 2ZJ2A 5H8SA 2J5OA 2FU4A 1WI9A 4KYSA 1G3WA 1SD5A 2WV0A 2AYSA 3SKPA 4RK9A 3LQQA 2G93A 1JW4A 3M8UA 4ZYGA 1A99A 3ILTB 3IB1A 2O3FA 3N6UA 2RF1A 1ODDA 1U6GA 3HIFA 1P1WA 2K27A 5H6RA 5BS6A 1B32A 3C4MA 4OMBA 2QVOA 1BC8C 5L9SA 2M30A 1IQ7A 2XHKA 2L01A 2Q2AA 1IZ1A 3TQLA 2XD2A 4IO2A 3CO7C 2F5FA 2MLGA 1KU3A 3RPWA 1H9TA 4H67A 4IHTA 1D9VA 3T9HB 1EZPA 2QS4A 2I4CA 2GXGA 1Y4TA 4OFJA 1ULYA 2FYIA 4OHNA 2E7WA 2VOZA 2RC9A 5EEHA 3VODA 2HKOA 4GXOA 1G3YA 4EVIA 2EFOA 3TCHA 1BIBA 1J0RA 2QL3A 2CGPA 1IITA 4NF6A 5JFRA 5KCJA 3FM3A 1DTZA 1YS6A 2IA2A 3LSWA 1XVYA 3ECHA 3G3JA 2FQ3A 2X7QA 3K2DA 1R6ZA 4EM0B 1PBQA 3MVXA 1USTA 1H44A 4C0RA 1KQ0A 5H8NB 2JT1A 2DS9A 2EV5A 2DSFA 1UTBA 2XXHA 1SFXA 1CE2A 3PFIA 2DQLA 4BH9A 2PVUA 4NF5A 1OR7A 3QIMA 1ZARA 3P7IA 3PUYE 2ZYKA 4Y17A 3GLBA 4RAZA 2H99A 1SW2A 2DE3A 1HW5A 5ICFA 4H6DA 3E97A 2IT0A 3U1OA 1Y20A 5ELVA 3U1DA 1FP2A 3KLNA 1TQPA 3VLUA 1W5TA 3EN3A 1BBYA 1GXQA 4TLMB 2B3FA 3SEUA 3DQVC 2GRVA 2FE3A 2EK5A 1UB9A 4HLXA 5D5UB 2ZYNA 1R23A 4M6YA 1T38A 2FXAA 1J7KA 1REPC 4PFUA 3IL1B 2J5PA 1B6AA 3BBRA 1BI1A 3TKYA 1XT8A 3TO6A 2RC7A 4ELQA 3T8RA 2TDXA 3KLOA 1SI1A 2UYFA 2H94A 4FJPA 1XMAA 5D4SA 1IXGA 3KFWX 3DXJF 2O8XA 3F8NA 5TP9A 3MZYA 3IKVA 3IOWA 1N3XA 1OLCA 1URGA 3RKYA 4H65A 1S8NA 1QKAA 1IXSB 2ZMEB 3O2PE 4THIA 2RNJA 2VE9A 4R6YA 3TGNA 2Y48A 1TNTA 3VXCA 1ZRDA 2OWSA 4I7HA 3FD3A 5ITOA 3DP7A 5CVJA 4G2ZA 3KEOA 1XHYA 4EQ7A 3J81Z 3EYIA 1FQFA 4YB5A 4Q30B 2ONKE 4CGZA 4Q4ZF 3ZMDA 3THIA 1HXDA 1M5EA 1LJ9A 3IX1A 1U78A 3I5UA 2ZNTA 3E3KA 2DWAA 3RKWA 2HAVA 3ZP5A 3BJOA 4BHCA 1UTHB 2DK5A 5HS7A 2WKYA 5FHNA 4LATA 2KIMA 4R73A 2X26A 3UP9A 3PUZE 4QWQA 3KE2A 4IXAA 3N97A 4IRGA 1ZYRF 2Z8EA 1LSTA 2D2WA 4EJTA 2L3DA 4QFPA 3CR9A 3IAZA 5LHIA 2XUBA 2ISZA 3OO8A 4HCYA 2QUFA 3IK6B 2CQKA 2A68F 2XHDA 1KYWA 5DEXB 4ESBA 4LZ8A 2LKPA 2XV4S 2F8DA 3Q5FA 3OOPA 4BHBA 4I9DA 2Q2CA 1AOVA 4ZYDA 3QYTA 3TFLA 1T39A 2IA1A 1MJBA 3AAFA 1XSXA 3DELB 1FC3A 4ENMA 2KRFA 3IR1A 2F5DA 1C0WA 5FTHA 1I1GA 3LSFB 4HA8A 1U3EM 2AL4A 4RXLA 5CBSA 2XAHA 1J2XA 4M9SA 4GO1A 1MKMA 3MQ9A 2DWHA 1TLHB 1XB4A 5LGTA 5IT9K 1W7PD 1U2WA 3KEIA 5CMKA 3GUDA 4QFLA 3TZAA 3SDFA 3V4GA 2XXUA 1LDJA 3EYYA 1JW1A 2LSOA 5K5OA 3Q28A 1FQBA 3N4MA 4YKPA 1JXSA 1FWZA 3NRVA 2M87A 2GZWA 4NF4A 3FATA 4G68A 2R6GE 3DM0A 1Y3PA 2ZNZA 4YFXF 5HLGA 1MDMB 3B7DA 4EDPA 2OZUA 1BOAA 4WXCA 4R72A 5I59A 2X0LA 3A09A 2D5WA 2QQBA 4MQ9F 5TJJA 1MS7A 3WTZA 4QFKA 3PQKA 2JPBA 4QF9A 4WCGA 1O63A 3ZMTA 1MD0A 3K4UA 5H8QA 4EXKA 1KQ9A 2HFHA 1J9IA 2QMWA 1NH8A 1H76A 3FXUA 2P1SA 5D8KB 1LAGE 2CFXA 3HOSA 1HKTA 4S05A 1Z6TA 5AA1A 1QW0A 1XSDA 2V93A 3U8QA 5H20A 2GQQA 2G9WA 1QUKA 3GFJA 3QK6A 3I4PA 3T8TA 1OQGA 1RNLA 5TPAB 2X7PA 3U2RA 1ZG3A 3MVYA 2H6CA 4LB5A 4DCXA 3HPIA 4HOBA 4KYWA 4AQ4A 3SERA 4ESWA 1P92A 3V7RA 2NNNA 5HLHA 2UVIA 1N3WA 3V7SA 3Q25A 5FHMA 2QS3A 2XXXA 3CIJA 4YMAA 1FYLA 1O3QA 2A5SA 4N0BA 3PD9A 2P6SA 5LOMA 1O64A 3CFLA 3FV1A 3KP5A 3EPEA 2F6PA 1O7FA 3KZZA 4ZEFA 2F2EA 5I2NA 4IGRA 3WTUC 2ZXJA 2BV6A 4N07A 3VFJA 2KLFA 3O6BB 2ONSA 1MG1A 5ILUA 3MC2A 3HSTA 3EDPA 1D3KA 2O1LA 3RIRA 1K78B 3BPVA 2AS5F 4BDMA 3CLOA 3E4RA 4OIOF 3D4GA 4LQ2A 2XXIA 4YFKF 3ZS6A 1EH3A 2NS0A 2XAJA 1NL5A 3O29A 2VBZA 1ZRFA 4GYGA 2JSCA 2R7DA 1PDNC 2FNAA 2Q89A 4OEVA 2GFEA 5E1ZB 4XKNA 5D6EA 4NWCA 4ETSA 4YMBA 4HF0A 1TFDA 2UWMA 1N76A 4O3CA 1SW5A 1ON2A 3UORA 1OIBA 2PBWA 4CYDA 4IO4A 4YKKA 4FX4A 4E70A 3G3ZA 4U21A 5AA3A 1FZPB 3CSBA 5HPQA 4IY5A 1B52A 4HS7A 4OTEA 2FOKA 3K02A 2STWA 1U5TB 1ONVA 2VC1A 4L5IA 3PUWE 2HZLA 2ELHA 2FRHA 1JNFA 5FLXK 4KFQA 3OXNA 5DYMA 1HBXG 1FX7A 1G3SA 2HQRA 5DEQA 1URSA 3B6TA 2QSXA 2FBIA 3K1PA 2H6BA 4L5JA 3LBSA 2M5WA 3TQNA 4H8IA 4DNCA 1XDSA 5HDKA 4EF2A 2A6HF 1T6SA 5CVRA 3FVNA 1A7LA 3PPPA 3S2WA 1LFGA 3OO6A 4OIQF 2XAQA 1JEVA 1MPDA 2V3QA 4BLAA 2W85A 4R6KA 4U0YA 1KA8A 2XD3A 3OO7A 3H03A 3OOAA 4ZECA 5AA2A 4IJAA 4U0VA 3WAEA 1B4AA 2DYXA 4DXBA 3UIFA 5DT6A 4P55A 1SVXB 1PB8A 1WVJA 1E17A 2O0YA 4RAYA 3T93B 3I53A 5ILVA 4NF8A 3LSLA 3DEUA 1POTA 3PMWA 1MJAA 4GWOA 3JV9A 1HW1A 1D8JA 5FB2A 3FXQA 1R00A 5J6XA 3IC7A 2FA7A 4KD5A 3E6MA 2QENA 1W5SA 4WK8F 2OAZA 2RDPA 3LA3A 1AOYA 3CSGA 2DP8A 3BFTA 3GEZA 1ZU0A 3CUQA 3C34A 3ERED 1JEUA 5KZTA 4LJZF 4R1HA 4F1UA 3U72A 3VLVA 2P0SA 2XX8A 4PGHA 2GXBA 1KU2A 4HW8A 4G8HA 4MEXF 2ABHA 2H25A 4PFYA 4IRIA 5IAIA
chains in the Genus database with same CATH superfamily
4A2UA 2VB6A 2E5NA 1D8KA 4HX4A 4MLQA 2ESNA 5F1QA 5I57A 2EPFA 1P1NA 3GXAA 4IO3A 3CF5F 2Y30A 4PGGA 5AA4B 4M3DA 1W4MA 5ESYA 2JMWA 2QMXA 2F5XA 3H9QA 4YKJA 2NUVA 4K2EA 2IS6A 1V55H 2RVCA 4C30A 3SETA 5CBRA 4J01A 3I4NJ 4ASNA 1UQWA 1RC9A 2JVHA 2XKPA 4JBZA 3EUHC 1I5ZA 2OLBA 5K5QA 3V8LA 4LLLA 3FIWA 2Y9ZA 1R5HA 2QS1A 1XGOA 3IKTA 3C31A 3FX3A 5DW8A 1X3UA 3H3UA 3ULQB 2V84A 4X1BA 2R7ZJ 2REGA 1B4ZA 5H8HA 4ZEIA 4DYCA 4ZZLA 2LKXA 1FPQA 4NF6B 5KCJB 2CU7A 3VWBA 3EKIA 5A2QK 5CMMA 3ROJA 4Z7EA 2R4GA 1XDUA 3DBLB 2XXQA 2HU9A 3EQ1A 4POXA 4HQMA 1ZELA 3OSQA 2GIVA 2F48A 2LG4A 4A3IJ 3IP4B 5TRDA 1FJLA 1NUYA 3LSXA 5CVUA 1TC3C 2RN7A 5L3BA 4EQ9A 1FBSA 1LDKB 1LDDA 3FASA 5FKLA 2DVZA 2Z99A 2F34A 4N6KA 1DP3A 5EYFA 3QYFA 4ZH4F 2GH9A 3PD8A 2ZXWH 1UTBB 2KDZA 1UHSA 3RI4A 1NNFA 4GVOA 3KEYA 1DP7P 3HL2A 4FE8A 4P11A 3Q0UA 3RYPA 3CHGA 4WXHA 3WE3A 1MJ9A 1PYVA 3TMOA 2FMLA 3GZ6A 1ZAOA 2Y0SA 4AU7A 1Y1WJ 1RYOA 5E1WA 2CSOA 3GBBA 2V3TA 4OFOA 4G7ZF 2A69F 1V4RA 5C3EJ 3IRQA 3ZXSA 5C44J 2IJLA 2UZKA 3K1MA 1HLVA 4N17A 4P1LA 2ELKA 5I58A 1FBQA 6PAXA 3K7AJ 4V2GA 2Q8KA 4O5VA 1WWXA 4E7SA 1EJ9A 2GXAA 1MQGA 2Z8DA 3M3LA 1IUYA 3C18A 2JUGA 4HRIA 2ICWG 2AXLA 4YB7A 2Q8MA 5IY5H 4PJJA 4A3EJ 3IUOA 2Z1DA 3H0GJ 1R1VA 3VYTB 5D5XB 4BL0B 1LEVA 2UYEA 4MIJA 3S9EA 3CDLA 3FV2A 1R9TJ 4LONB 4XRSG 1IRXA 3IO6A 3ZR8X 3MVPA 2F6GA 1RUOA 2HR3A 1T33A 1UG0A 4PETA 5FBPA 4OVJA 1WJ5A 3LSRA 4ITVA 1BR2A 2P8TA 3OY9A 4I01A 4M74A 2LLKA 3NWSA 2EFWA 1USYE 2DLLA 4MNCA 2WX9A 1Y3NA 2QSGX 2DOAA 5ICEA 3IH3A 3ROUA 3VPRA 5B70A 1BJZA 2JA6J 4GIZA 3P7NA 5D5VB 3MP1A 4PE5B 2XPVA 4AVZA 4A3CJ 1FPFA 4UXNA 4BE1A 2CH0A 2DA2A 3I71A 1HW2A 2OJTA 1H9GA 2XASA 1FOWA 3BR3A 2DE2A 3IJOB 2EA4A 4N6DA 5TP9B 4L9JA 4F3SA 2EIKH 2WAFA 2OX3A 1ELJA 4Q0CA 3C35A 2ONRA 1A6IA 3K4LA 5LLQA 2M8EA 3QU6A 4MJOA 4C9YA 1TL8A 3GTJJ 2BHYA 4P5OA 2LY9A 3JRAA 1TT5B 5TISC 1U8RA 1JGGA 2VD3A 3I5OA 2D45A 4NB5A 2L7MP 3QPHA 1QA6A 1G0IA 3FUZA 4X1DA 1LB2A 3HKZA 1VR5A 4D0PA 3ZKKA 1VQ9I 4II3A 2MA3A 4S04A 5ICCA 1MBGA 1YYVA 1XVXA 2XX9A 3PPRA 5CKTA 3GF2A 4KYEA 4R6HA 3MZ8A 1B0HA 5LHGA 4Q8RA 1RRJA 2PYYA 1Z21A 4LG3A 1F1ZA 2YX7A 4CCKA 2QRYA 2QPQA 4OVQA 4ZZAA 4E7IA 2OUMA 5CRYA 3MN2A 2FOWA 2G7HA 4P0IA 3WU2C 3OYEA 2E36A 4Q47A 5BPIA 1P7JA 2KISA 1MH3A 4C2TA 4RA2A 1P99A 5FLVA 3O6IA 5CVVA 3LAJA 3GZNB 4G8XA 3J80K 2ID6A 2VBWA 1IEJA 4RY1A 5J3LA 4PFPA 5GPAA 1NH7A 2BXYA 2JRTA 2NS8A 3M07A 2QJEA 1T0KA 3H35A 4HQEA 2YX4A 3CFXA 1NNPA 2XXVA 3Q26A 4EQQA 4N81A 1ZLKA 3ASOH 4BY7J 2DA5A 3DP4A 5FLXZ 3KZGA 3VLWA 4U0WA 5J40A 4LGWA 2KJBA 3LAPA 1ZGWA 3GBGA 2KZGA 2DAOA 3ZMZA 2VUMJ 3S9LC 4AIJA 1EH6A 2DOJA 3HRMA 1LAXA 1PJRA 4ND9A 1NKXA 2BY2A 3G2BA 1STZA 3VDFA 4C3IJ 4XQFA 1HA8A 3IHUA 3RLFE 4ECFA 1VQNI 2RQPA 1I69A 4DXUA 1G59A 4G12A 3HPGA 3RPUA 4RB3C 3IH2A 2NVUB 3F23A 2HVSA 1ZH5A 1Y1ZA 3LSHA 1I1SA 3RDIA 2NNYA 4V19K 3DPTA 4GXAA 5IZ3B 1BK4A 1T0FC 2ZZWA 1B9NA 4BACA 3HM5A 1WHUA 3QAHA 1F5TA 1NUZA 2F5EA 1GTKA 4XKQA 2G7UA 4Y15A 3PTYA 5IM2A 3S15J 4OMZA 2YJPA 4JQFA 4XLCA 3WAFA 5LHHA 4BQAA 1V5FA 3K6WA 2PMUA 3SDBA 1B72A 2WYKA 4Z0IA 1P1OA 2XC7A 2L4AA 1HSLA 3LR1A 1LBBA 2H5YA 3F6VA 4EUOA 2PMHA 1AH5A 3CJRB 3E6BA 4UVAA 4BHPA 1B9JA 5IT3A 2B4LA 5L3CA 3WTWC 3H36A 2M7AA 3J7AY 4UA8A 4HNTA 3GW2A 2W57A 3S8PA 5KK1A 2V1XA 2ZYMA 4OIRF 3W2AA 2O7UA 3C7JA 1R9LA 1TFAA 2V1NA 1HKSA 4XKWA 3BC8A 2WA0A 1U5TC 3BDDA 3SEQA 4IOCF 4E7JA 1GR2A 4GQOA 4NF4B 4G68B 1LEBA 1GGGA 2W1OA 2VONA 4PFRA 4GL0A 2Z5UA 3RPLB 4EGYA 3K4BA 2R93J 3QSLA 2KRHA 2KP6A 1OFCX 3HSEA 4EF1A 2ZSHB 1H88C 2M3AA 3DPLC 3GXOA 4NC6A 3IAS2 3GYHX 1B5JA 2WYPA 4HSTA 3CCLI 5I59B 3GVAA 1R1TA 1WJEA 3OEMA 3E5UA 1VE4A 3QOEA 1J75A 1Z3YA 3TODA 2QLZA 2XAGA 3NWTA 2DXYA 2DK8A 2Z23A 4DIGA 1LPQA 3GTQJ 4KXPA 4G4PA 3GTLJ 4MLOA 4B09A 4IR8A 3W6KB 1MMDA 1D4NA 4OVTA 1N77A 4AB5A 1MNDA 5CQGA 1ZLQA 4X04A 2CMPA 3MCZA 3TEPA 1A54A 1S9TA 2DOFA 4WXDA 1MY1A 4GWZA 2OQGA 3FKIJ 1VTNC 4I3YA 4OVRA 4PP0A 1TWHJ 2EFNA 4ZE9A 2XGXA 3F72A 3OR2C 2KIFA 3HOVJ 2CW0F 2RV8A 3E1SA 2IXSA 4G77A 5D5WB 3P5JA 2FEZA 4D7NA 3H7MA 4DBRA 4G6DA 5FFZA 3QUJA 3L00A 3SEWA 1A40A 2XX7A 4LLNA 5J8FA 1VQOI 4LFUA 4F1VA 1M1EB 4L18B 3H6VA 3FISA 2CUZA 4H5GA 4MLVA 5DV5A 4GWYA 2Q74A 3BKIB 4WF2A 3ZN1A 4AUXA 1BI3A 4QTRA 1LQ1A 4BDLA 5F6FA 1ZQ3P 2EJRA 2VQGA 3IRRA 3W6VA 2W00A 4HTGA 5A2QZ 1SD7A 4KJZA 2YPNA 4OVPA 4RPOA 4MGRA 2P4WA 3ODBA 4U4SA 3CI8A 2EZKA 1SMTA 3I59A 1ZHFA 2UXXA 3O6HA 2RC8A 2I48A 2YSRA 2CO5A 3N26A 4F1YA 3S1RJ 5DUKA 2DPUA 4QLCU 3RGYA 2OQRA 5DYHA 3PL8A 1B3LA 1FTJA 4N13A 4PFWA 2P0WA 1VFCA 3K4CA 3V8JA 2A61A 3OO9A 5I2NB 3DF8A 3AXFA 3GYYA 3C3WA 4R9GA 4IQ4A 1MQIA 2IA0A 3GTMJ 2FBPA 1FPKA 5JHUA 1XGMA 4A0ZA 3NEUA 3PQJA 3I55I 3JTGA 2C6YA 5IKBA 5AIPA 2HOAA 4EGZA 2V1DA 1WI3A 2HDWA 4I0AA 1SAXA 3F8FA 4BQNA 1WODA 3ECOA 1WZ2A 1FRPA 2HZKA 5E79C 3HGGA 5FGMA 4RBOA 4IQJA 4L0YB 5JLWA 1AHDP 1UIVA 1EU8A 4J19A 3IB0A 4PQJA 4KR5A 4MHFA 4YEJA 1EF4A 3DKXA 2BW3A 3V8KA 3DLNA 3QWLA 3CCJI 3HOWJ 3CCEI 3CMMA 3JW4A 3D5RC 2VBYA 2OTJI 1SFKA 2O7IA 1PUEE 1OVTA 1ENHA 2O9LA 5ITPA 1IN5A 3K6VA 4KICA 2IVMA 4RAFA 1B05A 4XK4A 2K4JA 4JP0A 4F7ZA 1B1BA 2RC4A 1EYIA 1IMCA 2W24A 1XC1A 1ZGJA 4MIMA 3BJ6A 2HPGA 2HXOA 3KN3A 4GBWA 1IIWA 4MEVA 5AA2D 1LFHA 4E7HA 3K1NA 2V4JC 2D3IA 1JHHA 5L9OA 4IGTA 4MHGA 2ELJA 4L9NA 1LFUP 3S4UA 1X3WB 2MBFA 4CSWA 4E4HA 2KQRA 2V79A 4PSXA 1OMPA 2NOOA 3BQZA 3A2KA 5DM7F 2MKZA 2XF7A 2PN6A 4CICA 3KN7A 1Y4CA 5ICTA 2ACJA 3T0JA 4YB6A 4UVCA 1BIYA 2IPQX 1N25A 1P6RA 2LK2A 3TOAA 3WG7H 1SMYF 2EZIA 5LEKA 1ZIUA 3T96B 3SESA 1R7JA 4RJZA 2CUEA 1HSJA 3M8EA 4M3FA 3O29A 1I3AA 4B4CA 2NOJB 1QBJA 2A3SA 2VE8A 1FBDA 3EHTA 3LSPA 2LNBA 5GADJ 1M5DA 4XRFA 5BOXA 3JREA 2HS5A 3LMMA 4YFNF 1R71A 4LZ5A 4IF4A 3DEEA 4I98B 1E3HA 1DK4A 2HCAA 1Z9CA 1IF1A 1YIJI 5FROA 2Z22A 2IEEA 4OIPF 1ZR4A 3G71I 4XL9A 4YZZA 4A12A 1MPBA 3MAMA 4O8MA 4PK4A 5DCMA 3DEWA 5EGOB 3VVEA 1B9MA 1OR7C 1QVUA 2G0EA 2W7YA 2DOEA 5A5XA 3WTSC 3HPHA 3BR1A 3VVFA 2XIGA 4FX0A 2DDBA 3QPSA 3D1NI 4XKCA 3MZ1A 1FSEA 1SW4A 4G8MA 2VQHA 4EM2A 2DODA 3A01B 3H3GA 2ANJA 1FCKA 1B3GA 2GHBA 2V4CA 4DDDA 1JHFA 3HOYJ 3CG1A 5DVFA 2NRAC 2PQ8A 4CCLA 3MBPA 2OK2A 4UV9A 2HOTA 1ERDA 2F5VA 3IWZA 3M3KA 5AA2B 3KCCA 3E78A 2L9VA 4OESA 5K7FA 4UHTA 2K86A 3H92A 5L3DA 4AYBA 2XXWA 5TU0A 5A5LA 3GCMA 2JZYA 3J80Z 3JRBA 4M72A 5CVIA 4I76A 5IAIA 3C1DA 2WV1A 5HLTA 3WU1B 1MXZA 2LMDA 2BEOA 3RPQA 3ZMSA 2DFIA 4NF8B 3LA7A 2DMNA 3T9XB 1MNMC 1FMWA 3M1EA 3PIOF 2NAZA 4CO8A 5EG0B 1SAUA 1FTMA 2H98A 3KSXA 2BYVE 2FBKA 3HOZJ 4RGRA 3M8JA 2O51A 3O2AA 2VPOA 3FWEA 1YAEA 3PNVA 2GWRA 1N75A 3BZ6A 4FIMA 3JRFA 2I49A 1CQTA 3DBHB 3RQTA 5HM4B 3MW0A 3NOHA 3BTIA 3FXLA 4XORA 2XXPA 4RB1A 2B3BA 2XAFA 4GBVA 4LIUA 4JB7A 4ONYA 1WH7A 3V42A 1D0ZA 1Q9DA 2DBBA 2MC4A 3EHSA 4XF5A 5AIQA 3RNNA 1TTYA 5EYGA 4PBQA 1N7XA 4KFCA 1LFPA 1YCJA 4A5NA 4MBPA 3T66A 5EEGA 1U0JA 3OS2A 2XB5A 2MD0A 1TXFA 4O94A 1YOVB 1CGPA 1RZ4A 4KCCA 3H3VK 1O3TA 3V89B 4QSCA 4HF1A 3ZQ7A 4Y7NJ 3FHNA 3TCFA 1B5HA 1MQDA 4QFOA 2A6TA 4XLHA 5HVQC 1Z7NE 5TGTA 5I57B 2R7FA 2V6EA 4BY1J 2XXYA 4ZYEA 4IOAF 2IGKA 2FQ4A 4BDYA 4GYIA 4F52A 4A3LJ 5CQEA 2VXZA 4JVIA 1YE9A 3TMGA 3GZ5A 4MNUA 4OINF 2ADUA 3JSOA 2XWVA 3PMVA 1RDYA 4R2FA 3IWFA 1D9QA 4E0XA 1IMFA 3KYLA 1V3FA 5EQAA 1XPXA 3SXYA 3RYRA 4ON0A 1NV2A 3CUOA 1IO2A 2R5ZA 4BE2A 2H8RA 4GF8A 3QMFA 5H8HB 5F0FA 2WC2A 1BP5A 4FECA 4JSDA 2MLKA 2VPNA 1JUMA 3QOPA 2OBPA 3PPNA 1YW9A 2ZYOA 2PJPA 2XGEA 4HCWA 2XVCA 2Z3YA 1UFMA 2IW5A 2OCUA 1V5GA 2DQVA 2Y7PA 2WADA 3E13X 3K01A 3HHGA 4U87A 1B40A 1YW8A 2DMUA 1TWYA 2GA1A 4M9XA 3BFUA 2HTJA 2VASA 2ZO4A 1W36C 3KJ7A 3D5LA 2VOOA 2OWTA 3FK7A 3GX4X 2ZB9A 4F92B 3BG7A 1FBEA 2Z9OA 1IXRC 3MKZA 1KGSA 1Z7ME 5DD4A 1IN8A 2P2AA 3CVGA 3GBAA 2PEXA 4N15A 3GZGA 4GCVA 3OSGA 5B7DA 1IV8A 5H6QA 1CF7A 2Y31A 4GRIA 1I6QA 3J7ZI 1QZZA 1O7LA 4Y13A 5HDNA 5K2XA 3OMYA 5L3EA 2F4IA 2R7SA 3M4OJ 3C2GA 1B7UA 5JI6A 4EEFG 3ZQLA 1K4TA 2XWOA 1JJ8C 2JVGA 3HTUA 3QQAA 1FYMA 3BZKA 4UY8I 4QF9A 4BDNA 5I58B 4BNCA 1ZMGA 2A6EF 2K7LA 1MGTA 4P8BA 4HAMA 3BG5A 2V9VA 3K70D 2Q2EA 3TBIA 1K6YA 1YJWI 1MXVA 1VFDA 3W2WA 1IAWA 4GDFA 4IHXA 5FKOA 1FT9A 3FVOA 2XGDA 3CCUI 1OCPA 1X3ZB 2PMZN 3LFUA 2Y9YA 1JVYA 3S2DJ 2R9JA 3SEVA 2F4OB 4II2A 3H6UA 4OAZA 1L5TA 3TPAA 3ABUA 1G6NA 1UHMA 4RB0A 4BEHA 4MFEA 2HI3A 3BCAA 5ICGA 3OYKA 2QFLA 5KAFC 2PMSA 1TQIA 3EUKL 1XN7A 4IO9F 5EHSA 1NUWA 3MP8A 3JSPA 4ENJA 1FBHA 1MXXA 5CM6A 3ZMUA 3SEYA 3T22A 5IYBJ 3FJMA 3P9CA 4FT8A 3V8XB 4LMYA 4GWWA 4U1OA 4AWXB 4YU0A 4DZJA 2Y7KA 1TW3A 2H09A 1IRFA 4RMNA 4G68C 1NNKA 4EV0A 2UV1A 3K2ZA 4JOMA 2HQNA 1JGSA 3HG9A 1R1UA 1JUPA 1FTOA 5LGUA 2VJJA 2WTEA 1QUIA 3FF5A 1INPA 4YIRX 1UIUA 4P0GA 3WE2A 4XBFA 5KNLA 4X9TA 4HE2A 4A6EA 1NV6A 1MRPA 1RIOH 2D1VA 5LRSA 4NMYA 1Y8RB 4FETA 5EYRA 4CHUA 3ABKH 1B3HA 1YQAA 1FTLA 2OCEA 3HN0A 2DTRA 3EUAA 3HHHA 5IGAA 2DYSH 2DFEA 2MGQA 2P5VA 5DDGA 2MD5A 3TEDA 1B8IB 1LCTA 5ET5A 3ZQHA 1ETWA 1UELB 4RA1A 4CXFA 4KUMA 4PFBA 2M0MA 5HLIA 4FTHA 3TTKA 2R7RA 4ZYAA 1Z7UA 1TWFJ 3VOEA 1Z3XA 3O97A 5DS9A 1LCFA 1M5BA 2KRCA 5E20A 4XLPF 2JQ7A 2XGCA 2RKHA 3AG2H 2M8CA 1ZK8A 4EJOA 3ABLH 4GD5A 4XLNF 1IC8A 3BR2A 4QSEA 2CRGA 2JN6A 3H9GA 2PT1A 2THIA 1USSA 2VQCA 3ISPA 1GT0C 4ZDMA 2V25A 1QU3A 3KC0A 3ZQCA 2L2OA 1B2HA 2I0BA 4PFOA 2UVJA 5IYDJ 2JJ7A 2CQQA 1SYIA 3KJTA 3S1QJ 2L9SA 3TDZC 4WX9A 3LSKA 2CW8A 2P7VB 4F39A 3GFMA 3DTEA 4JX6A 1IXIA 2VN2A 1X1CA 1RPWA 3I58A 3IFAA 1XOCA 5F1JA 5IP6A 2H1KA 2COBA 4CCMA 2LF7A 2KIQA 1AU7A 2CMOA 2QWWA 3IB2A 2VBXA 2BY3A 1SVMA 2L9NA 3D0SA 3I6VA 1B58A 4LZ7A 4E6KG 2I3VA 3B02A 5IOZA 1NG6A 4J00A 3H6TA 4F22A 1AIVA 1FTAA 4AIHA 3WGGA 1SD6A 1B51A 5ISUA 1ZTRA 3OYHA 3C32A 3L2VA 2DW4A 4BQOA 4RK2A 4A3GJ 1OCRH 5GTHC 3SQNA 4H5FA 3RUMA 4LK1F 2O69A 2Y7RA 2EH3A 3VB2A 3S3MA 2KR0A 2IGNA 1TT0A 1T98A 2ZXIA 5FKKA 2BVLA 2P81A 4O6JA 3CQZJ 5KVRA 5IT9Z 1DPUA 2PBIA 4PF6A 4EJWA 1BA5A 4I62A 2DT5A 4DZPA 3OYFA 1MDQA 1QULA 1W7PA 1ETYA 4HXVA 4RM2A 1FQAA 2YU3A 4DJAA 1FQDA 2QQ9A 3CJQB 3MZBA 1R22A 2X48A 4HDVA 3MEXA 2DU9A 1TWGJ 1R5GA 3HRTA 4FE7A 4BQQA 4JX4A 4BS9A 1PEBA 4OEUA 2HXIA 3R0JA 4G8NA 2V7FA 1Z91A 3FXRA 5I84A 2B9SA 2Q88A 5BUUA 4RGUA 1N7WA 3T5XA 1FBFA 2CG4A 2QBYA 3ONQA 3HKZN 4KNYA 1AMFA 4QSDA 4AS4A 5HOOA 1HKQA 3PM1A 5J4YA 2E7XA 2L02A 1IJWC 5FFXA 1U8BA 3KC1A 4JWOA 2I5UA 3PU5A 4U4XA 1QGXA 5FD6A 1E3PA 1FSHA 3O66A 3HRUA 3MPLA 2XPUA 2LAOA 2XRLA 4NF5B 2CYYA 1LBCA 1RKMA 4M1VA 5FHOA 3E6DA 1F9BA 1H89C 1JW5A 4JVDA 3IOVA 3E6CC 3FJ7A 1ON1A 4IPAA 4L9TA 3HO7A 3S2VA 2LF8A 2V6CA 3OSFA 1I6AA 1I6BA 1R9QA 1W5CC 4XOTA 3O3KA 4HE1A 4NF0A 1IRGA 3Q3SA 1FOYA 4QXDA 3AFHA 2VPRA 1D5VA 3D4CA 2VP1A 3G3HA 1NHAA 2K4BA 3RSNA 2ZC2A 3MFKA 4PAKA 3RN8A 2FIEA 1UMQA 5M3MJ 5JTYA 1JQFA 3G3KA 3J81K 4PTKA 3CESA 4MQVA 4KIFA 1ACIA 4UUSA 5AE4A 1BR4A 2WBMA 1XTAA 3Q9VA 1YI2I 1HDDC 3KZYA 2R7UA 3FVKA 1V5EA 3KYDB 2QEXI 2B65A 4GFRA 2LFBA 2NWJA 3RYDA 4ISUA 1MBJA 1P4WA 1K79A 4ZEKA 4U23A 1MMAA 3TO7A 3JTHA 3CF2A 4JVCA 2REJA 5ILSA 3HUGA 3JRDA 2PLYA 1OQYA 3BR0A 1KA0A 1SD3A 4UABA 1FQEA 3A3UA 3LSTA 4ESFA 5DCFA 4ZE8A 3ABTA 1Q1HA 1DUXC 5GTIC 1O7TA 2EWNA 5K1YA 1LAFE 3OEKA 1SFUA 2HZTA 4NUBA 2Q9TA 4C3JJ 1QHGA 1QZYA 1AL3A 3MPKA 4YRVA 2DJIA 1DTGA 2E0SA 2OWZA 2Z8FA 2TCTA 2F5CA 2GOXB 2L0KA 5DD8A 3FM5A 5LBQA 3OS1A 1H45A 2O61A 2HQ0A 3FJGA 3K6UA 2L7KA 2E2JJ 4DIQA 3CDHA 4MTDA 3VFZA 3BWGA 3MJNA 1W36D 1PVEA 1LVAA 1SFEA 3CLQA 4B3AA 5KDTA 1MIJA 2JRMA 4NE4A 3KP2A 3GTOJ 2Y5LA 1A8FA 4HV6A 4F2OA 2ZFUA 3BIGA 5I56A 2Q8JA 4KT5C 2HKXA 1T08B 3I59B 2LY1A 1ETKA 1H43A 3E5QA 5ICQA 3OMBA 4KQPA 1WSUA 1H8AC 2P6TA 3LSJA 5EDNA 4A0YA 3R26A 4PCQA 1LKXA 1A04A 3RTRA 3OL3A 2FA5A 4XMYA 5FKNA 1SYHA 2HYFA 9ANTA 4MFIA 1BI2A 1IXCA 2VIXA 2DMQA 2RINA 1H0MA 2CV0A 1J09A 1TNSA 2Y2ZA 2EILH 1NV4A 3EHUA 1GUUA 3OYIA 2QVUA 5FO5A 4GLIA 4EMSA 4OYVA 3CFZA 4OWDA 2VKDA 2DE4A 3ZOBA 1S5LC 4GL8A 5BMZA 3SHFA 1A36A 4PF8A 2HXWA 4DOZA 1KYZA 4OOIA 4DBQA 2I58A 4NG7A 2E1NA 3PPQA 3L2CA 3OYNA 1JI8A 2WWYA 4ZS9A 1R4MB 1BTJA 2A07F 3TQWA 4U88A 2NYXA 2RCAA 2HEOA 1XGNA 1K7AA 4BXUA 1X19A 4HLYA 4AM3A 1EA3A 2BW3B 2P5KA 2XKOA 2FNPA 2BZTA 2AL5A 1L3LA 1KU9A 2W82A 2M45A 2VL8A 1IGNA 1FOKA 1P4AA 1T8IA 1D0YA 1ZRCA 4IO7A 2F7AA 2CWEA 1FPEA 2A5TA 2O5RA 5JHFA 1B7HA 4XKPA 3WODF 2KIUA 4BDQA 3JYRA 3U9GA 1D0XA 2ZFWA 4PDKA 5HBCA 4F18A 2Y7IA 4MFDA 3HZJA 3PIPF 3V7CA 2O84X 3U92A 4XM3A 1BKAA 4LG0A 3K0LA 3H4ZA 4PDDA 4P96A 1YJNI 1KU7A 2QYOA 2ZXHA 1X58A 2DI3A 2WAQN 2ZNYA 3RKXA 4ZZDA 1POY1 4H46A 4DI3D 3BPXA 4DI4B 1PP7U 3FZVA 4PFTA 3HGYA 3OOUA 4XKBA 1QVSA 1WFXA 3TKDA 4U1ZA 2DFHA 4A3JJ 4DZ1A 3AG3H 4N6PA 4HEA2 3QRFF 1QO0D 3PSIA 4OWRB 5JVTA 2VKHA 4FEBA 2KLOA 3G3GA 4HYEA 4RB2C 2PG4A 3FXMA 5E8GA 3OYMA 3DU5A 3S93A 1YTYA 4NQ8A 3W15C 3OD7A 1OYWA 1HQCA 1WGXA 1I27A 1IW7F 2KHMA 3WTTC 1FW0A 1YYZA 3RPLA 1XMKA 2L54A 2XXTA 1S6LA 5FRMA 4XN0A 2H1LA 1IMAA 4LUBA 3ML6A 4GXSB 3GO5A 1DPEA 5HDGA 1QNTA 1FPDA 2DN0A 4LA9A 5AA4A 3A03A 3FVGA 3MP6A 2HTSA 1BLFA 1YS7A 2F35A 4NQWA 3B6WA 3HB9A 3FHZA 4UACA 4YIFA 5DCMB 1MBEA 2OTLI 1II5A 3IJXB 4L0ZB 3CRBA 1JETA 1KZ8A 3GLXA 3MZ9A 4GRKA 5E18F 2CW7A 3EQLF 5A5XB 5M2VA 3ASNH 3JAMK 3O8GA 4CCOA 1J5YA 3F8BA 3KBRA 3O8HA 3KYCB 1D1BA 3OYGA 5F64A 2PJRA 3IOTA 3U21A 4UNOA 4KIBA 1B3EA 4KN7X 3VXBA 3IO4A 3F8MA 3HRSA 3FXBA 3QU3A 2VKEA 4FASD 2PFZA 3COAC 2ZZVA 1SFOJ 2PI0A 5HS8A 1UTHB 3MSTA 3MMYB 1OLTA 3WTXC 3I3LA 4I09A 2M1BA 3C9HA 2CZKA 2XA5A 3TDJA 4GWXA 2VI6A 1GVJA 1OYIA 3OWTA 1EH7A 2KMUA 3E5XA 4KDPA 2NVTJ 4GGGA 1DMBA 4HZFA 2DXRA 4RGXA 3I3VA 3Q9SA 3K0VA 3VDXA 1EZOA 4CYCA 3RKQA 4HX7A 1F9NA 4JK1X 2G29A 2ESHA 1JTXA 2FNCA 1VQLI 2O7OA 3MYUA 3O9PA 4XTCQ 5IP9J 1YXIA 4BDRA 3L2UA 4NTLA 1VSOA 2FBHA 4PC9A 3CG3A 4OZ9A 4ENNA 2P7CB 5H8QB 2BJIA 1I39A 1DGWY 1Z7LA 1LFIA 1LB8A 1VNDA 2HZDA 4EM1A 1LLSA 4H0WA 3HFUA 5I2KA 4HF2A 2B0LA 4MH5A 1K61A 3BG9A 3NQOA 4LLGF 3HEFA 4F19A 5HNHA 2IA4A 1S7AA 2JUCA 4M9ZA 5D4RA 3E7LA 2JA5J 2QQ8A 2FSWA 4FBPA 1UHWA 5H8FA 2KKOA 5D8LB 1FBPA 1WDNA 2DWIA 4FHTA 4HW0A 1FQCA 3ECRA 4ELOA 4F3BA 2IGOA 1SEUA 2VOPA 3K6XA 3PMXA 5HODA 3MVZA 1HSTA 2AQFA 4C1UA 2I3WA 4R75A 2WAEA 1LBWA 2ID3A 4POWA 1LBXA 2E5ZA 3MQ0A 1UZCA 5D6FA 4MF3A 1XI6A 3VV5A 4FEDA 4O3AA 1MY2A 4MEYF 3N5LA 3Q27A 4E7KA 2LYCA 2QQAA 3K70C 2KDOA 4AIKA 2DA1A 3K69A 4KITB 4H1XA 3T1BA 4GWUA 2JWTA 2EFPA 5DVJA 2XXKA 3GFIA 3ZPLA 2DT7B 2PCRA 3G3IA 4B44A 5LGNA 4R9FA 3H1CA 2X6XA 5BPDA 2AIXA 2FF4A 2Q0OA 4XIDA 1QGPA 3GTGJ 1H3DA 4M6VA 2DVCA 1OMIA 4IHWA 2GHAA 1BJAA 5LRRA 2R5ZB 3ZMVA 3F3XA 2M7BA 4RDUA 1A8EA 4LVQA 2H27A 1YZ0A 3CO6C 2DXIA 5EHMA 1XS9A 2R5YA 5L8DA 4CZZA 3N94A 2NOGA 4C2MJ 1URDA 3L9FA 2DWJA 4JWXA 4NX1A 1APLC 3O28A 2BY1A 3LSGA 1AKHA 1GVCA 1GLNA 3I56I 2O6AA 3AL0B 1S7OA 4KPTA 1FTZA 5L3FA 1PDAA 4AYBN 2OA4A 5L3GA 2F3BA 2XPWA 2IP2A 1VQPI 3QXMA 4XXUA 3ESWB 1RI7A 4A69C 1F43A 3WHBA 1FBUA 3ZCOA 4DE8A 4BUPA 3QPTA 1BW5A 4OQOA 5DTBA 1LUJB 1QPMA 2AXTC 2VHAA 3RTWB 2CQNA 1WKMA 3V5AA 1BI0A 1M5CA 2IS4A 1A35A 3LFKA 3PO2J 1WJFA 1P4XA 3KFMA 2EV6A 1CF7B 2BJJX 2ZNUA 4ZJZA 4IRHA 1X1AA 3LV0A 3R7XA 3PGFA 2EZHA 4D5FA 3DLLF 4HNVA 3F21A 3CDIA 1OCTC 1PB7A 5KCMA 1R49A 4YAHX 1TWCJ 5LDZA 3FGSA 1EYJA 4MMPA 3S9MC 3L7WA 5CJ9A 4DYRA 3C36A 3JRCA 1ZG1A 4PAFA 1GXPA 2UXNA 4F31B 1JT0A 3OYLA 1IMDA 2MH9A 1MQHA 2M4GA 1MNEA 4EQBA 3A4CA 4F91B 2JA7J 1XS5A 2HXRA 3TYHA 3F8CA 4PUSA 2UUZA 3MWMA 4G7OF 1HDPA 1R58A 2Q2EB 2OZZA 1EH8A 5CC2A 4Z6YA 3NARA 4I1DA 3M8FA 4ESJA 2YLNA 1S7YA 3BG3A 3S1MJ 1XD7A 3I0TA 4X1EA 2E1CA 1QRYA 2VXDA 4UUVA 3G7WA 4GFBA 5EQ9A 1OISA 4ZDPA 4XN3A 4BEHB 5LFAA 4TOZA 1Z1DA 1ZR2A 4NBQA 2IGMA 4D7MA 1DDNA 1SBPA 2BXZA 3KEQA 1P1QA 3J7AO 4Q5TA 3RTFB 4LK0F 1B46A 1Z05A 2VKVA 2XRNA 1NI9A 5CMCA 1U9OA 2LD5A 1PBPA 4A0XA 1UJ8A 1YX3A 1JTYA 3VSLA 4GOTA 2K40A 2VJIA 3BP8A 4A5MA 1RKWA 4QPOA 3MKYB 1SVLA 3AKZA 2OZ6A 5ED4A 4E7ZA 2ZJQF 5IZ3A 1GV8A 4F29A 1M5FA 1AA7A 1LE8A 4N8YA 4QFNA 3UK4A 4KIGA 3SEZA 3WGHA 3L09A 4ZDOA 4XICA 1XGSA 1RUNA 3R0AA 4BU2A 1DPRA 4M71A 4X48A 4IVNA 2MH2A 2ZJRF 1FBCA 2EQRA 1IXHA 3PJRA 1QQIA 1O57A 3WU0A 5IP7J 2WY7Q 4EJVA 3ZQGA 1Y3QA 1OCCH 1FTTA 4HV5A 2B4MA 3QUFA 1Y0UA 4N91A 3E3VA 3X2QH 3S9NC 4R79A 1EZ9A 2NVQJ 1OYYA 2M0CA 1US4A 4JSOA 1B59A 3F22A 2F36A 2QVRA 5H8NA 3A1YA 4XSXF 3ILUB 3W3CA 1Y1MA 4RNSA 1XCBA 2JK3A 3R4KA 3LWFA 2ALUA 3M3FA 4NDLA 1VFEA 4GWSA 3U94A 3ZGKA 3EF7A 4OXVA 2YUSA 3KX2A 1W0UA 2BY0A 3MZHA 4U22A 3DKWA 4B47A 4BBSJ 4U2RA 4KHZE 4HX8A 1G3TA 1J59A 1IMEA 1B0LA 1Y1VJ 1S50A 2HEUA 4RGSA 2QSFX 1JE8A 4Y3OA 5C4JJ 5FLMJ 5BQTA 2QS2A 4OERA 3CUQB 4YG2F 2JPCA 5K7ZA 1PP8F 3GTKJ 5KAIC 3T9VA 3W9VA 2LBFA 1JKPC 3KP4A 4N8GA 2QF7A 2PFYA 1G4DA 1JUSA 1L0OC 1VQKI 4Q5SF 3MUQA 2ME0A 3UN6A 3RQIA 2DPDA 3OV8A 3T9UA 4R2BA 3JRHA 1MPCA 4HBLA 1DGRM 5E1XA 3T0YA 1ATGA 4QHQA 1VI0A 1HSEA 1QUJA 4B3XA 3EETA 3KP3A 5E8IA 1R1NA 1IDZA 3W6JB 3OYBA 2VD2A 1ZBMA 2QM3A 2Y75A 1K6OA 1ZLJA 2CZIA 2EFQA 5HNFA 1YJ9I 2GA2A 3I54A 3IL2A 4DQ2A 2VT2A 4EXLA 1S72I 1LFBA 4XLEA 1O3RA 2H4IA 2F3DA 3IORA 3RT6B 4U7DA 4H8JA 4OFLA 5L9MA 4O7IA 3DP8A 2WEFA 3CC2I 1V54H 4B1RA 1WQ2A 1T56A 1IUDA 3KG2A 3MKWB 1S29A 3JAMZ 4G6QA 1MY0A 1W7PB 2L5QA 1B5IA 4PFIA 3USDA 3ZSFA 5AONA 3L2RA 1I3QJ 3SZTA 5IZZA 3CCYA 1SQYA 1QKBA 1FMVA 3VVDA 4IO5A 1ZG5A 2DMPA 1E2XA 4LD5A 3WG9A 4AD9A 1SW1A 1YIOA 3KP7A 5GAGJ 4XRSA 2B63J 1N84A 1NV0A 3BIHA 2STTA 3QAXA 3REOA 3P9KA 1UCRA 3E0JB 2M9HA 4Y52J 3TTNA 2ZMEA 3IAM2 5K2YA 1FLIA 5K7HA 3B6QA 4A93J 1NUXA 3D1RA 3K9TA 2R71A 2V3UA 5EEAA 3ONMA 1RESA 2O68A 4OENA 1BN5A 2M34A 2V26A 2QBYB 4BYYA 3JCUC 3UA8A 2IRFG 4G9YA 2HVRA 2VGQA 1K9YA 3F0CA 3K00A 1IN4A 4DLDA 2UVGA 1BM9A 2CUJA 5B1AH 5E17F 1HC8A 2GIZA 2BGCA 3BCBA 3LSIA 5F04A 5GAEJ 1IN7A 3EUHA 4C1TA 1TQMA 5JVGF 1IMBA 3TCGA 1A6QA 3Q0WA 2CZLA 3P9IA 1IN6A 1UTHA 3HV1A 5JK4A 3VEPA 2KT0A 1SDXA 2HYJA 5M5WJ 1KWHA 2HYGD 3GWZA 4I0BA 2PFBA 1KZHA 4A6DA 5LEJA 1YFHA 3FMSA 3DP6A 3KOTA 4ZZEA 3UGWA 4PAIA 5JTYB 2XB0X 2M4KA 3HOTA 1MW7A 2X9DA 2VODA 4KA4A 1MDP1 4N4NB 4BAYA 4UUSB 2YPRA 2EIJH 2A5WA 3K4MA 3OYJA 3OELA 4IO6A 4H0EA 4F2QA 1YRNA 4ZTFA 1ZREA 4ELPA 3L6HA 3DTIA 3MAJA 1B3FA 2ZXTA 3KGCA 1VQMI 2HPIA 4P9KA 2O03A 4IHSA 4RPNA 3PO3J 2FMYA 3HTSB 1RDXA 4DXCA 2QZ8A 5BNGA 1B1HA 2Z33A 1CB6A 2BVMA 2O1MA 3TDUC 2OF7A 3SJMA 3HUGB 2OD5A 4JX5A 1YO5C 3OYAA 2K02A 1DU0A 3LC8A 3BG6A 5EF6A 5F1RA 3PSFA 2P5LC 3HSFA 5DEXA 2LOOA 2W84A 1YX5A 4LB6B 1FP1D 5LTCA 4F3GA 2ZNSA 2BE5F 1DSNA 2PT2A 4WEDA 3U93A 3RJPA 3FXJA 1IG7A 4IB2A 4K3FA 3DV8A 3G3FA 2OBGA 3OR1C 1X4OA 4G94A 4D5CA 2EB7A 3H06B 4HSRA 1FY7A 1YG2A 3ZQIA 1A55A 2R0QC 2GRVA 3ABMH 4ZYHA 2KQZA 3A29A 4L17A 3AG1H 1SVOA 1R4NB 1XCVA 4Z2YA 4GX4A 3DFGA 2DO7A 3C2BA 1ZN2A 3TW7A 5KDTB 1ANFA 2DCEA 2KZVA 1SANA 3F6OA 3M7GA 5I56B 1D9YA 4AVPA 2WY8Q 3RPUD 1PB9A 4P47A 4Y4RA 1NK3P 4KCDA 4JXIA 4U7BA 2FHYA 3E9XA 4KMFA 4YIIA 3F9KA 2HDCA 2VT3A 3BJAA 2R7TA 4XKRA 3TTLA 4I8CA 2X6YA 4R8HA 3CCVI 5CMBA 1WJBA 4DCYA 2ZKZA 4Q48A 2V9PA 4M3EA 2MC3A 4CUGA 2PX1A 1MXUA 1UG2A 3PFYA 3RT8A 4IZZA 3TELA 3CJNA 4M73A 3VSKA 4PCDA 3TAJA 2LDUA 3R61A 4W1UA 4G6TB 4YKIA 2BBYA 1O3SA 1FYKA 4OETA 1N0TA 3GFLA 1G2HA 1Z0XA 4FATA 2HFBA 5ERIA 1MDMA 1YW7A 2FD5A 4AIDA 2Y0SN 2RNGA 2CS3A 1LGBC 2DA3A 2ZCWA 3K4NA 1TZLA 4N9IA 4JBAA 1S9HA 3H3ZA 2UVHA 3Q29A 3KP6A 4A3FJ 1CNQA 4QBAA 4V2FA 3HCQA 2Y0MA 4WEPA 1SI0A 2A5TB 3FMRA 3O6GA 5I5PA 3H9JA 3V83A 2X4HA 4JDFA 2HGCA 5J1RA 4AS5A 4YELA 2WB1A 5DUIA 2NVXJ 4ZDLA 1B7ZA 1LBZA 2KPMA 1NV5A 4LG0B 1Z6RA 5FD5A 3C33A 5JEIA 3G1LA 4ENKA 1D3YA 1YTVA 2D21A 1KA1A 2I0CA 2KJCA 1B1XA 2O6GE 1NV1A 3DU6A 3IOUA 1BIAA 3OL4A 2OU2A 3FIRA 4M6XA 1B6HA 2BOLA 3BROA 3K4KA 4CCJA 4O3MA 1FSAA 2L7ZA 2V1UA 3I64A 2OC6A 3ELKA 2K3FA 3LA2A 3IH4A 1SC7A 1DOTA 2BHZA 4NN3A 4KN4X 1NMUA 3CCQI 1OPCA 2F97A 1Q35A 3F11A 3FBPA 1MH4A 3PV0E 2VJ5A 4B43A 1US5A 2JTVA 3CP2A 2YS9A 3TOBA 5TPAA 3Q0VA 1MQJA 3OS0A 3AL0C 4MCOA 4ABZA 2Y7WA 1PUFA 4YICA 1PC3A 1YPNA 3KPHA 4IHVA 2F6CA 2JA2A 4UVBA 4CCNA 3PPOA 3QP5A 3DBRB 4NHJA 5IOYA 3SZGA 3G73A 1TW2A 5F27A 3N6TA 4KMUX 5JR3A 1JKQC 1B4HA 1WJAA 2NXOA 1GDTA 2RKMA 4LQ5A 1B72B 4NQWB 1ZGAA 2ISYA 2F7BA 3TUSA 4PGPA 4FAJA 4G61A 1E0EA 4BDOA 3HYIA 4A3MJ 1GHCA 4F93B 1XSVA 4F3PA 1OCOH 2EA2A 3ZN0A 2IBDA 4UV8A 1YHQI 4TLLB 4ZEDA 1OKRA 4CDGA 4IX7A 3CTAA 5F7VA 3L6GA 4MAGA 3TTMA 3VYSB 2DA4A 5HS9A 3EPZA 2PJRB 3OYCA 1WVRA 4XRMA 2FX0A 4FE4A 1KQ8A 4OMYA 5K5RA 1DCUA 2X6OA 3FBIB 2V9KA 4L9VA 1ZTYA 1NFTA 1BC7C 1UAAA 1DPPA 1OLAA 3R60A 2I6EA 3JZJA 2A5YB 3CD6I 1K78A 5B66C 3R6SA 1T0FA 3TL4X 1NNTA 1J1NA 3TO9A 4I6ZA 4HG2A 4P9FA 2HQ5A 3WGIA 4WKMA 2ZMBA 2YR2A 2W25A 1MM6A 3OENA 4HE0A 4XLFA 1F4KA 2GAUA 3BOQA 3TP3A 5EZGA 3PUBA 3S3OA 1K4SA 4NEDA 3DWLE 2COMA 2CJJA 4CYCB 2Y84A 4AB6A 1MXYA 3HOUJ 3KETA 1I6XA 2I4BA 2FJ1A 2H9BA 3VE1B 1TBXA 1MBHA 1O4XA 1X2NA 5CLSA 4RS8A 5J8CA 1Z77A 2I8DA 5J16A 1T2KA 3LUYA 3BTJA 3WTYC 4TQUQ 2DQRA 4XIGQ 2EV0A 1BR1A 2LREA 1NV7A 5I2KB 1ZKGA 3SFZA 4FISA 3PUXE 1FNNA 4N9HA 1P1UA 3CJTB 4XR6A 3M9AA 1SD4A 2GM4A 4EJUA 1HF0A 1LBVA 5BWJA 1F36A 1S3JA 1Y0NA 3LQRA 3SZPA 1YLFA 4S0HB 5CI5A 3B73A 3HSRA 2CUFA 1RYXA 5J1DA 4I99C 2F78A 1DBZA 1RR7A 3BZCA 4KISA 2WBBA 3KOSA 3FXOA 1Y9UA 3BR5A 4MTEA 1U5TA 4RAGA 1MM7A 2QSHX 3HDDA 2R7VA 2RCBA 3VYUB 5H8FB 3TTRA 1ETXA 3KSJA 2HWVA 2HOEA 1RKTA 1WRJA 1DU6A 4LP2B 4IKFA 3MVWA 2DTZA 3QP6A 2K3PA 5EJCA 3PUFA 3ZKLA 4B8XA 2X1DA 3G1MA 4ESXA 1N04A 4ELRA 1ZJLA 3KIOA 1JVXA 1LEAA 1KONA 5J1UA 1MXWA 3B6AA 2R3SA 2X6WA 2Z2SB 2HAUA 2HQAA 1P2FA 3DPUA 4G7HF 2XWIA 5CYVA 3A3CA 4PZJA 4R74A 2ZBKA 1VDWA 3BY6A 4OU0A 1TT1A 3KBZA 2ECCA 2ETHA 3OSRA 4TV7A 4A3DJ 4QRZA 2D1HA 1Q1KA 4KYDA 2HNHA 3SEXA 2W4SA 4LIVA 3GMEA 2F7CA 1USYH 5FTIA 3TP0A 1R6RA 2GQ1A 5C4XJ 4O3BA 4P9UA 1MY4A 2HHMA 3R6UA 2DT6A 5IZ1A 3QPLA 5B5EC 4ZEBA 1ETOA 2VC0A 2H8WA 2MYSA 3A0HC 3CUQC 1FEXA 1FTKA 2DDKA 1R36A 3RY3A 1W0TA 3M1CA 4FORA 1LAHE 4KI0E 4NWDA 2R5YB 1AWCA 2DDAA 2E34A 4WXJA 1QJMA 3PUVE 1OQHA 1MZBA 3WTVC 4M4GA 3RZOJ 2E1SA 1AKHB 4XKVA 1MY3A 4E0WA 1LB9A 3H5AA 4IY6A 4EATA 3RZDJ 3HC7A 2L4MA 1B8IA 1MSEC 1ZKBA 3A0BC 4I02A 4WWCA 1OVBA 3HHFA 4XEQA 2UXAA 4QPQA 4BBRJ 3MWBA 4X6AJ 5DM6F 1FPGA 3H6WA 4P1WA 4XSZF 4I2OA 2XROA 1GV2A 5DVIA 4JWYA 2RGVA 2XXRA 1EV7A 4HDUA 4RYAA 3KN8A 1LNWA 3FMQA 3W9WA 2ZJ2A 3K6GA 4RLFA 2JSPA 1VQ5I 2K85A 5H8SA 2J5OA 2FU4A 1WI9A 4KYSA 4HPQA 1G3WA 4C3HJ 2IS1A 5ET8A 2E1MB 1SD5A 2WV0A 3H5NA 4XNFA 2AYSA 3LQQA 2G93A 4RK9A 3SKPA 4M3BA 4H4KC 1JW4A 3M8UA 4P1EA 3FK6A 4ZYGA 2OCCH 2NXNB 1A99A 3ILTB 3CMEI 3IB1A 2A05A 2O3FA 2CEXA 1MSFC 2JJKA 5FKMA 1FBGA 2RF1A 1BW6A 1ODDA 3N6UA 1U6GA 1RDZA 3HIFA 1P1WA 2K27A 1OCZH 5H6RA 5BS6A 1B32A 1MMGA 4MO7A 3JR9A 3C4MA 2QVOA 2P3NA 1BC8C 4OMBA 5JLXA 2M30A 5L9SA 2RAEA 1IQ7A 2XHKA 1NG7A 2L01A 1IZ1A 2Q2AA 3TQLA 2XD2A 4IO2A 3CO7C 2F5FA 2MLGA 1KU3A 3RPWA 1H9TA 1FPIA 4H67A 4IHTA 1D9VA 3T9HB 3CP8A 1EZPA 2QS4A 2I4CA 2GXGA 1Y4TA 4OFJA 1ULYA 2FYIA 4DYQA 3IV5A 2M8GX 3HXLA 4OHNA 1I6HJ 2E7WA 2LY2A 2VOZA 1E3OC 2RC9A 5EEHA 2CFOA 4BE0A 2Z16A 4D9JA 3VODA 2HKOA 1LE8B 4GXOA 1G3YA 4EVIA 2EFOA 5F08A 3K4JA 3TCHA 1BIBA 1J0RA 3FKJA 2QL3A 2XF6A 2EIMH 2CGPA 1IITA 4NF6A 5JFRA 4L5EA 5KCJA 3FM3A 4PJLA 4BXXJ 1DTZA 1YS6A 3RQ4A 2TRTA 2IA2A 3LSWA 4A3BJ 5E3MA 3UKGA 1XVYA 4ZTJA 3ECHA 5I7IA 3H0DA 3G3JA 5IYCJ 2FQ3A 1X1PA 2X7QA 5EZHA 3I9V2 2LP0A 3G6EI 4EM0B 1PBQA 1R6ZA 3K2DA 3MVXA 1USTA 1H44A 4C0RA 4PE3A 1KQ0A 5H8NB 2DA6A 2JT1A 3S32A 1WJCA 2EV5A 3BR6A 2DS9A 2DSFA 2OJED 1UTBA 2KL4A 1WH5A 3C2HA 2HOSA 2OPTA 2XXHA 1SFXA 2XWKA 1CE2A 3PFIA 2DQLA 3RCOA 4BH9A 2PVUA 1OR7A 4NF5A 3QIMA 3HJEA 1ZARA 4QSHA 3P7IA 3PUYE 3BQYA 2ZYKA 5EYHA 3D5SC 1TP4A 4Y17A 4DW6A 3GLBA 4RAZA 2H99A 1Q1VA 1SW2A 1HW5A 4IL6C 2DJNA 3E97A 5ICFA 2DE3A 2IT0A 2PX9A 4H6DA