1IZ1A

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords LysR-type regulatory protein
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
total genus 92
structure length 292
sequence length 292
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1iz1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A02
2NRAC 5KZTA 3C1DA 3F8NA 4KT5C 1J9IA 1Z1DA 4KIGA 4NE4A 4I9DA 3GWZA 4H67A 1P1WA 2BYVE 2JSCA 2MC3A 2Y7WA 4YIIA 3LC8A 3B73A 4ZEIA 5AA4B 3M9AA 2DBBA 3KP3A 4PE5B 2H5YA 3G3FA 4WCGA 1IRFA 2KRFA 2QWWA 3D0SA 5E1XA 2XXRA 2K27A 4YICA 3O28A 2I0CA 2ZNTA 1GVCA 1B5JA 3PPOA 2HWVA 3W15C 2YLNA 4GXOA 3ECHA 1ZRDA 3C34A 2XXYA 1B2HA 3RQTA 1ZRFA 4JBAA 4HV6A 3IK6B 2EA4A 3BP8A 4MGRA 3BJAA 5K1YA 1BC8C 5E17F 1NH8A 5M2VA 1FQAA 1YS7A 3TQNA 3TAJA 3LQRA 5H6QA 1BLFA 2M8CA 4YFXF 3G3KA 2L01A 3FJMA 3PD8A 4OXVA 5CJ9A 1XDUA 2KIFA 1IN7A 1YO5C 3GW2A 3P7IA 1XDSA 1UQWA 1ZGAA 1P4AA 2I4CA 1DPEA 2IW5A 5DD4A 2X7QA 4EGZA 3KZZA 5TJJA 2GQQA 3MUQA 3QXMA 1LB9A 3RPQA 3H7MA 3ZKLA 4QFLA 4LQ5A 2ONKE 5A5XB 4ENNA 3S2VA 4RPNA 4KIBA 4MFIA 5L9MA 4QF9A 3MP8A 2H9BA 3G3ZA 5HS9A 3N4MA 3FJ7A 2G9WA 2FYIA 1VE4A 2I3VA 3IL1B 1BI2A 4KQPA 2D21A 3LSFB 4FECA 2FOKA 4LLLA 2I0BA 1LDKB 2FBHA 2VC1A 4EM0B 2VC0A 5AA3A 1ZN2A 2P5LC 3S9NC 1TW2A 2QQBA 5K5RA 1PB9A 1WDNA 3S9LC 4E0WA 2P6SA 1B3GA 3EHTA 4HCYA 2VGQA 3V7CA 3ZPLA 4OIQF 2UVIA 2F6GA 1OMIA 4NF8B 2CW0F 2ALUA 4DZ1A 1HSLA 3TTRA 2O03A 1IXGA 2V84A 2Z3YA 3K2DA 4YB5A 3CJNA 2HKXA 2STWA 1A7LA 4F3SA 3TKYA 1ZREA 3GFMA 5AA2D 2EK5A 4U7DA 1L0OC 2EFNA 1LBCA 3R61A 3C36A 1TBXA 3BKIB 1SD5A 3H03A 1FOKA 3OO7A 5H8HB 3PV0E 3U1DA 3TCFA 5HDGA 1BC7C 1I1SA 2G29A 5I56B 1G3YA 4CHUA 4NWCA 4K2EA 2LSOA 4GFRA 1LFIA 3VLVA 4I1DA 4EJVA 1UTHA 2K86A 2V3UA 2XROA 3IL2A 1XGOA 5L3FA 3TTLA 1MDMB 4HX8A 2LAOA 1SFUA 4I62A 3K1NA 5F64A 3U9GA 3ZMVA 1EH3A 1OQHA 4Y13A 3K2ZA 3W6KB 2QS2A 3OV8A 5HS8A 1SI0A 3B6QA 1LVAA 3N94A 2V3QA 5L9OA 1IXRC 1LSTA 4RK9A 1MGTA 4OETA 2HYGD 1XC1A 1B6HA 2M30A 1D3KA 2FBKA 4EM1A 3LSWA 1J75A 3MVWA 4ONYA 3C31A 1SAXA 1XS5A 3HHHA 1MXYA 4IB2A 2ESHA 5EEGA 3DQVC 3OO6A 3N6TA 3IOUA 1H9GA 2F36A 3M7GA 1J5YA 1UCRA 1MZBA 4QFOA 1DPRA 1HSJA 1OYYA 2DPDA 2HCAA 1QGPA 3IJXB 5ILVA 1B58A 1K78B 5AA4A 4GL8A 1HSEA 1OVBA 4G7ZF 2RDPA 1XSDA 4U1ZA 2EB7A 2XGXA 2MH2A 2W7YA 4B09A 5JTYB 1BN5A 2F7CA 5CC2A 2OAZA 3OELA 1MQHA 2K4BA 3FV2A 1C0WA 1RNLA 3R4KA 2GFEA 3DP4A 1B4ZA 2EV6A 2W57A 1JW1A 4LATA 1FSEA 3ZKKA 1KWHA 2HQRA 2QS3A 3PFIA 3OO8A 1TQPA 2EFQA 3E6CC 4RB2C 4I02A 3I54A 3COAC 2HOEA 4L5IA 1MY4A 2Q2AA 4M1VA 1JHFA 1A04A 2XAJA 2DWJA 5F7VA 1SD4A 3ZS6A 2V9VA 1QUKA 2OCUA 4IPAA 2DFIA 4ZYEA 5D6FA 1R6ZA 1UIVA 4GO1A 4OINF 1FQFA 4H8JA 1Y20A 1QKBA 1NNKA 2ZYMA 2Y84A 3L00A 1A55A 4RS8A 4OMBA 1B9JA 5LGNA 1F9BA 2B3BA 3RGYA 2OD5A 2I58A 3RN8A 1XD7A 3TCHA 4F39A 5A5XA 2XAGA 4F1VA 2Y7KA 4IVNA 1Z6TA 3GZGA 3T9UA 5L3EA 4WXCA 1WWXA 1IXSB 3BFUA 3ROUA 4OIRF 3MZ9A 3BFTA 2Q0OA 3U2RA 1G3TA 4XXUA 3E3KA 5HDKA 2VN2A 4YKIA 2D5WA 1FC3A 1UHWA 5E8IA 3S9EA 2WKYA 2VE9A 1QPMA 2DWIA 3RTFB 1IN6A 4IO5A 2E1NA 2Z8FA 5FHMA 4NF8A 3I3VA 5DEQA 4EUOA 5AIPA 4F1UA 2O1MA 5CM6A 1ZARA 2A5SA 2XAFA 4HW8A 1R5GA 4CO8A 3G7WA 3FXQA 4F19A 4G6QA 3F8CA 1PDNC 3H6WA 4ZH4F 2IT0A 4F31B 3ZMTA 1Z7NE 1M5FA 1O3TA 4F3GA 4JDFA 5D6EA 2OWSA 4TLLB 5FHOA 1J59A 3IOTA 5ED4A 2QRYA 4C0RA 5KVRA 4CDGA 1Y1MA 5H8HA 4MTEA 1PB8A 4ON0A 4XTCQ 3GBBA 2DI3A 3OENA 3C35A 4ELPA 3SEVA 2RV8A 5I56A 4HCWA 4ETSA 4KNYA 3M8EA 1T6SA 1O3QA 1ZLQA 4IY6A 3M3LA 1P92A 3IHUA 4AB5A 1MDMA 2HFBA 1B4HA 2OJTA 2BBYA 3SEXA 3H6VA 3ZMUA 4L0YB 4ELOA 3FM3A 3HSRA 1B40A 4YAHX 2P5VA 5E1WA 1B3FA 3V8LA 1R1NA 3U93A 3S2WA 2UXNA 1EV7A 1ZJLA 4GLIA 3BPXA 4XRFA 4GCVA 2F6PA 1IXHA 1PDAA 4GIZA 5LOMA 1HKQA 5KDTB 3HCQA 4JWOA 1VR5A 4UA8A 2PMSA 3RKWA 3KN3A 1QKAA 4E70A 2YPRA 1MM7A 4N0BA 5ICFA 3MPLA 5A2QK 1T2KA 4FE8A 3TTMA 2GXGA 1R23A 2HTSA 2NNYA 1FP2A 1MKMA 2ZXTA 5FLXZ 3QOPA 1FCKA 3SHFA 1LDDA 3O6BB 3PU5A 2O84X 3RLFE 5DVJA 4ELRA 3Q28A 2DS9A 2C6YA 4O3MA 3HPIA 1BBYA 1K78A 1I6BA 3MZ1A 1G3WA 3EPEA 1ANFA 1Y1ZA 3KZGA 4I7HA 2FNAA 4O3BA 2MBFA 2P8TA 3JAMZ 1N7XA 2ZNZA 3NQOA 3JV9A 1B1XA 5JTYA 1Z91A 1B05A 1LAHE 2QENA 4CICA 4DXBA 3IOVA 4IO7A 4ZE9A 2X26A 1WODA 3KP7A 1G6NA 3ONMA 1FNNA 3QAHA 1IN8A 3CVGA 1ON1A 2RC8A 2EA2A 5HLGA 1MQJA 1SMYF 1RUNA 2R71A 3V7RA 3TPAA 4N13A 2Y7PA 5DYHA 2G7UA 2M1BA 1LGBC 4HZFA 3B6WA 3JSOA 1HW1A 4H1XA 4FATA 2E0SA 2P7VB 3DP6A 4JXIA 2PYYA 5FHNA 2XXXA 1URDA 1Z6RA 3V8KA 3GYHX 1MY2A 2NOOA 3IO6A 4PDKA 3RT8A 1OYWA 3UA8A 2IJLA 4A5NA 1D5VA 2I49A 3GVAA 4RJZA 3R0JA 2VOPA 2W24A 3IOWA 3B6TA 1O7LA 4RXLA 1A8EA 4L18B 2P6TA 1OMPA 3U1OA 1JVXA 3UK4A 4YKJA 3GLXA 3L2CA 1EZPA 1YW9A 3A09A 4KDPA 3GXAA 2A69F 1NHAA 1OYIA 4KFCA 1ON2A 1XVYA 4BQAA 3TUSA 3SQNA 3UN6A 2Q2EA 3F23A 1OKRA 1LLSA 1SBPA 3T9HB 2QUFA 5AONA 4DXUA 1B1BA 3L7WA 2IEEA 2IA2A 1S3JA 2V3TA 2QVOA 2DPUA 2CYYA 4L9VA 4EJWA 5BWJA 4XKRA 2B3FA 2XD2A 1U5TC 4S04A 5KCJB 3FASA 3VB2A 1KGSA 3K9TA 3B7DA 1MY1A 4HX7A 2RCBA 2EWNA 2Y75A 4L9TA 3L6HA 4BDOA 4OHNA 1IXCA 3Q9SA 1H45A 3V5AA 3FMSA 4MTDA 3TYHA 1XVXA 5DV5A 4F2OA 1U6GA 4XLPF 1N7WA 4DCXA 3T8TA 4HOBA 1BKAA 3SERA 3QUFA 4U0VA 4M4GA 1R36A 1ONVA 5D5WB 4L9JA 1II5A 3WGGA 3E97A 1AMFA 3WTUC 3USDA 1KQ8A 2ZYKA 4PFWA 4C1UA 3RUMA 4LFUA 4RGRA 1FQEA 4IHTA 4RB0A 1EH8A 1SW5A 1QO0D 3D4GA 3PPNA 1D4NA 2QBYB 1IZ1A 4F22A 2CGPA 3EN3A 1J1NA 1FSHA 1W7PB 3T9VA 1USYE 4A2UA 3C4MA 1W7PD 2EFPA 1MQDA 3MC2A 4IO3A 3TMGA 3G3JA 3IAZA 4QRZA 1ZMGA 1RYOA 1W5TA 4JSOA 2X4HA 3T8RA 3TDJA 4N9IA 1MDQA 3EYIA 3VV5A 1XCBA 3FVNA 2CFXA 2PFBA 3WG9A 5CBRA 1PBQA 1LDJA 1NNFA 3K69A 2STTA 4UNOA 4K3FA 1B4AA 1HW5A 3LSLA 2GRVA 1IIWA 4EF1A 5BPDA 3MP1A 1MPCA 2HTJA 4ZE8A 3MEXA 3TCGA 5KDTA 3IORA 2KJCA 4R79A 1D8JA 1FTKA 4R6KA 1XHYA 1BI0A 3LBSA 3KFWX 2VE8A 1FYLA 3CFXA 3KG2A 5K2YA 3WGIA 2HS5A 4P5OA 1OR7A 1XGMA 3JSPA 3TFLA 3EHUA 4I0BA 2HFHA 1UFMA 3FJGA 4POXA 3V89B 5L3CA 3LSTA 2A3SA 1R1VA 3WE2A 2RN7A 4JQFA 4QHQA 1H76A 3SFZA 3KN8A 4ZZDA 4KD5A 1JGSA 4U0WA 3IRQA 1LNWA 1PB7A 2GZWA 4G68C 2PQ8A 1LAGE 2I3WA 4XSZF 2RC7A 2ISYA 6PAXA 1S7AA 1PUEE 1V4RA 3N5LA 4XBFA 2O1LA 4R9FA 1U2WA 2H98A 4LK1F 4NMYA 1B5IA 3MW0A 4M9ZA 3KOTA 1KU9A 4P96A 2QPQA 3RPWA 1JEUA 3FXUA 4BDNA 2ELHA 1B7UA 2ZJ2A 1ZG1A 1A40A 1WQ2A 3OOAA 4OWDA 3I59B 3M1EA 3I5OA 1FBQA 2FEZA 2PMUA 3DLNA 2UYFA 4EJOA 3O9PA 1XMKA 2EFOA 4KMUX 4A6DA 4X1DA 3KZYA 2DSFA 4RPOA 3BROA 1D9YA 1OQGA 3ECOA 2VD3A 3GZ6A 1SFXA 3SZTA 1YPNA 3T1BA 2AIXA 2QS4A 4IO4A 4YG2F 3TDZC 4HBLA 4PETA 2EV0A 4C1TA 3J81Z 2DW4A 4U7BA 3WTYC 1MPDA 1S7YA 4CXFA 5ILSA 1O7FA 2F35A 4TV7A 4U23A 1SD3A 5CVUA 3KP5A 1T0FA 3PQKA 5KCJA 1LQ1A 2Y7RA 4NEDA 3MP6A 2KKOA 2KLFA 2MD5A 3TEPA 4FX0A 4GOTA 4ESWA 1Z7UA 3RPUA 1MQGA 3IO4A 1SYHA 4YMBA 4BDMA 2CQKA 1WI9A 2YX7A 2QMWA 3P9IA 1DMBA 3O2AA 4MQVA 2F5XA 4KYDA 4LK0F 3RIRA 4G4PA 3I71A 4TLMB 1FP1D 3HOTA 1URSA 4RAZA 3HOSA 4G8HA 5F6FA 3J7AO 1TT1A 2PN6A 3MVZA 3ISPA 3FVGA 1FWZA 3QUJA 4G2ZA 2ZO4A 1EZ9A 2XX9A 3QIMA 4QWQA 2QBYA 2OQGA 1HXDA 3KN7A 1R00A 2PX1A 4ASNA 3FIRA 3W6JB 2REGA 1W7PA 3VFJA 2A6EF 1F5TA 4M9SA 3C18A 2KJBA 2VT2A 4ZYHA 3HRSA 3K4UA 5B70A 1S9TA 3PGFA 2Y7IA 4QLCU 3Q25A 3IKTA 3KEOA 3ULQB 3CRBA 4GXAA 5I84A 2CO5A 1ZH5A 3M8UA 1HW2A 3N97A 4YKPA 2RNJA 1AL3A 3WE3A 1YW8A 1X3UA 4KR5A 2X7PA 2IA4A 1TFAA 2VBWA 5EHMA 3BBRA 2L4AA 2QYOA 1NFTA 5I2NB 4OFLA 2W25A 3RY3A 5TU0A 5K2XA 2XVCA 4P0IA 1Q35A 4XIGQ 1OIBA 3EQ1A 2PT1A 4H8IA 3OD7A 3CUOA 4RY1A 2H27A 4L9NA 4IXAA 3HYIA 5CVVA 3TOBA 1MDP1 1UIUA 1QNTA 3O97A 4HF1A 4ZEBA 1PBPA 2RVCA 3CFLA 4G7OF 5IT9Z 1K6OA 3PUVE 5DVIA 1YTYA 1Y4TA 3T9XB 3RNNA 1BI1A 1FY7A 1KYWA 2GAUA 2O8XA 4MEYF 2EFWA 4A12A 5D5XB 3WTVC 3IB0A 4KCDA 2BEOA 1D3YA 2DTRA 4L17A 1MXVA 2FA7A 3J80Z 3IR1A 4RK2A 2B65A 2DU9A 3P9KA 3FXRA 3IB1A 3LFKA 3T0YA 2V1UA 3CUQB 2DE2A 4JSDA 4A0YA 1BIYA 4G7HF 2AS5F 3ZMZA 3AXFA 2DVCA 3LUYA 1JETA 1IRGA 2GHBA 4OENA 3W9VA 2H6CA 3PMWA 3G73A 2A68F 3VDFA 1ZKBA 1FTMA 3K6UA 1A8FA 3PPRA 2FNCA 2ETHA 3HUGA 3QRFF 4EXLA 3WTTC 4O6JA 5IKBA 1USYH 3I59A 4R2BA 2XASA 2YPNA 5LBQA 3VXCA 2NS0A 3A3UA 5I2KB 3MZHA 4KCCA 3H6TA 2GA2A 1Z05A 3E13X 2UWMA 4HQEA 2LNBA 5CBSA 1Q1HA 1YFHA 3MFKA 1XMAA 1FLIA 3H3UA 4OOIA 5D5VB 1SFEA 4GYIA 3WU1B 3QAXA 3ILTB 4LZ8A 3OEKA 4QFNA 4YZZA 4LZ5A 3U92A 4G8NA 5HBCA 3O2PE 3HSFA 3DV8A 5BUUA 4UVCA 4QSCA 2REJA 4U2RA 3FVOA 4HTGA 2VHAA 4PCQA 3RJPA 1JHHA 3CSGA 3SXYA 2HAUA 3JAMK 2VP1A 5L8DA 2M45A 3JW4A 5ISUA 1P99A 4L5JA 4I0AA 4IGTA 2AL5A 2FXAA 5E18F 4R73A 4XKPA 5D4SA 1LEAA 3Q29A 1B6AA 1USTA 2D2WA 4MF3A 1RIOH 1FYKA 3WAEA 2QS1A 3C9HA 3I6VA 2O7IA 1BIAA 1LFGA 1B9NA 4BHCA 2DT5A 4NWDA 2OWTA 4IRIA 2FA5A 1JEVA 2FU4A 5HLHA 3MCZA 2O61A 4QSDA 1B5HA 1HQCA 5I57B 3GBAA 3M8FA 5LEJA 3WTZA 1PP8F 2ZCWA 3R60A 2Z33A 3FF5A 1L3LA 3I0TA 1F9NA 3QU3A 3FV1A 4OIOF 4AIJA 4AIKA 1ZAOA 3ERED 1O7TA 1Y4CA 1O64A 2ZNYA 3SKPA 3F6VA 5CLSA 4I8CA 5I2NA 4R1HA 2XXHA 2IVMA 3KSXA 5H8QB 1V3FA 3TELA 1H43A 3DEUA 1SMTA 3HN0A 1U3EM 5KK1A 1U5TB 2JT1A 3FMRA 4OEUA 2XKPA 5H8FB 2AXLA 3ELKA 4M9XA 3V4GA 3CUQC 3R6SA 4Q4ZF 2D1VA 4WWCA 2TDXA 3PPPA 4X1BA 2VOOA 2UXAA 4EJUA 1JW5A 2F5EA 1DDNA 1KA8A 4N07A 2CMOA 1Z7ME 3OOPA 2A5TB 1YLFA 2ZYOA 4NB5A 4LJZF 1TQIA 1B9MA 4IY5A 1TLHB 4M72A 3LAPA 2YU3A 1WRJA 5BPIA 1EU8A 4A0XA 1REPC 3FMQA 5CMKA 3ML6A 3QU6A 4KN7X 2VT3A 3PMVA 1XB4A 4YB7A 2F78A 1ZG3A 3CUQA 2J5PA 1IUDA 5E1ZB 2Y48A 3OO9A 1IUYA 1GTKA 2QM3A 3EHSA 5JI6A 4YFNF 4BH9A 3O3KA 2V1DA 3E6MA 5FTIA 2K02A 3RI4A 1J7KA 1RYXA 3G3HA 4HF2A 4LUBA 2DWAA 2EJRA 1TW3A 5LGTA 3WTWC 1I5ZA 4POWA 4WK8F 4G8XA 5TRDA 4F3PA 4BAYA 4U4XA 4ZYDA 4FORA 1VFDA 4PFTA 1B7ZA 4QFKA 3LAJA 1SDXA 3ODBA 2KIUA 3PUYE 1MXUA 1QJMA 5H8SA 5I2KA 1SD7A 2F7BA 5EEHA 4LLNA 3LA2A 2RQPA 1N84A 1HSTA 2Z22A 3ZMSA 2XXPA 1R7JA 2UXXA 2JRTA 4RNSA 3LA7A 3DKWA 4ELQA 3IB2A 1HBXG 3BZ6A 1B3LA 1NL5A 4BDLA 2HQNA 3CLOA 3HHGA 5D5UB 2PBWA 4OYVA 1SD6A 1DPUA 3D4CA 1KYZA 4M6XA 1FTLA 2WV0A 3I53A 2DQRA 3ZN0A 1H3DA 1IF1A 5FO5A 2E7XA 1U78A 1STZA 2JZYA 3K00A 3FM5A 3H4ZA 1M5BA 3SDFA 4G68B 1UTBB 3K1PA 2Q89A 2K4JA 2FE3A 2UYEA 3MBPA 4DXCA 1FYMA 1XSXA 3K1MA 1BTJA 3RT6B 3TZAA 4KHZE 2F8DA 3K6VA 1P1OA 2O7UA 3H3ZA 3RDIA 1TQMA 1B0HA 1DTGA 2R6GE 4ZECA 5EHSA 3U8QA 3WTXC 3IRRA 2R3SA 4RGUA 1L5TA 1YW7A 4ZEKA 1DUXC 2O68A 1JXSA 2RC4A 3T66A 2KIMA 1MJAA 3I4PA 4PZJA 3DPTA 3L09A 1YCJA 2DK5A 2QJEA 2O51A 2E1CA 5J8CA 1YS6A 2QZ8A 3SETA 1H9TA 4Q5TA 2ZMEB 2FMLA 2NAZA 1VSOA 2JTVA 2ESNA 3GO5A 4BHPA 5LEKA 2HQ0A 5I57A 1WKMA 2XHKA 4ZZAA 1KU3A 5CVJA 4FJPA 4AD9A 4H6DA 4EQBA 2XXVA 4M6YA 4PFUA 2F34A 2BE5F 4Q48A 1YAEA 3TOAA 4H5GA 1AWCA 4LVQA 2VBZA 2FF4A 1US4A 1CF7B 3FVKA 2XAQA 4BHBA 5H8QA 1ELJA 4ENMA 3F22A 2I48A 1NNPA 2DOJA 1SQYA 3E3VA 1U5TA 2ONSA 5H8FA 3FHZA 4ESFA 4OTEA 3M3FA 3V7SA 4S05A 3R26A 5F1QA 3L6GA 4MHGA 2R7DA 3H92A 4RGXA 4WEDA 1Z9CA 1F1ZA 1IN4A 1O3SA 2Z5UA 2ABHA 2A5TA 3ILUB 3MVXA 2FSWA 4OIPF 3RTWB 2V25A 2HZKA 2OZUA 2F7AA 3HRTA 4LD5A 3NEUA 2IP2A 4F2QA 3HTUA 1IQ7A 5HPQA 3JTHA 4LLGF 3GFLA 2PT2A 3V8XB 1ZU0A 5JFRA 1POTA 1IN5A 1NNTA 3VE1B 1ODDA 3D5LA 2NXOA 3O6IA 3DELB 5I58B 2F97A 2FQ3A 5A2QZ 3SEYA 2PMHA 3ZQ7A 3IJOB 1YG2A 1CB6A 3QPTA 2XXQA 1DSNA 4G9YA 2R7FA 5J1DA 4EMSA 4CGZA 2HKOA 1XGNA 5ITOA 3EQLF 4HV5A 3V8JA 3LQQA 5JR3A 5CI5A 4LGWA 3MZYA 3EDPA 4ZZEA 2ACJA 3WODF 1DOTA 4IRGA 1LEBA 3GFJA 2OZ6A 1O3RA 3OMBA 4OMYA 1BM9A 4P0GA 2ZNSA 1PEBA 4ESJA 4GYGA 1W4MA 2OU2A 3C33A 4KN4X 2NVUB 2VBXA 4F18A 3EF7A 5L3DA 4U22A 2YX4A 2Y0MA 2D45A 1I27A 3B02A 4MEXF 2M5WA 4PGGA 4EVIA 3E5UA 4R75A 5IT9K 1PP7U 1R9QA 1GV8A 3ZSFA 1CE2A 1P1QA 2IA0A 1QW0A 2NNNA 3TDUC 2XX7A 4DQ2A 3KE2A 3CR9A 3SEUA 2COMA 4NF6B 4RAYA 3THIA 1D9VA 2QQ9A 4G68A 1J0RA 1UTBA 3VVDA 4PQJA 2DLLA 5D4RA 2I6EA 1FW0A 4L0ZB 3F72A 1AIVA 1QULA 2H94A 2HGCA 2HR3A 4IRHA 2P1SA 4NF4B 5ELVA 2E7WA 4I09A 2G93A 4YU0A 1HKTA 5HS7A 3VVFA 2XRNA 1MY0A 1ZHFA 3O6GA 4R2FA 1H44A 1IITA 3N6UA 5H8NB 5CMBA 1KQ0A 2RGVA 2PG4A 1JNFA 1R1UA 4LA9A 3F8BA 5J6XA 4EQ9A 5FFXA 3KSJA 4LB5A 1B59A 4Q47A 4Q30B 2VD2A 2ZMEA 1Y3PA 3MJNA 5ILUA 4RGSA 2GH9A 3HHFA 4NF5B 3FGSA 3JYRA 2CSOA 1LB2A 2A61A 3TO6A 1NH7A 4ZEDA 3GX4X 2QSXA 5B7DA 3WU0A 2PI0A 1OPCA 4HLYA 1BOAA 3AAFA 3F3XA 4OFJA 1BIBA 3IC7A 2VXZA 3KEIA 2A07F 2XKOA 4MH5A 3C7JA 3QYTA 1CF7A 4LZ7A 3UIFA 2H25A 5LRSA 2ZXJA 3TQLA 4KYWA 1GXPA 4R6YA 3KEQA 3LA3A 4FHTA 5TPAB 2F5FA 4I2OA 3KP4A 3FUZA 1B52A 3PUWE 4U0YA 4OZ9A 1OLAA 3SEWA 1TXFA 5CVIA 5IAIA 1ZLKA 2A6HF 1IXIA 1LAXA 3SESA 3LWFA 1S6LA 2DO7A 4HDVA 4U1OA 1DP7P 1P4WA 4H65A 3A3CA 2Z23A 3VOEA 2EV5A 5HVQC 3M3KA 4Z0IA 4Y15A 4EM2A 4IHSA 1MS7A 3VVEA 2RC9A 2HAVA 3MAJA 1JW4A 3CFZA 4WXJA 1O63A 4N6PA 3TKDA 3QP5A 2R9JA 2MLKA 3PMXA 4F1YA 5I58A 5K5OA 4JB7A 1MJ9A 2O3FA 4P11A 4R6HA 2ZKZA 5CMMA 2OK2A 1R22A 4KUMA 4RYAA 3GFIA 4M73A 2Q2CA 3CG1A 3F8MA 4FEBA 2YR2A 1U8RA 3L9FA 3PUXE 1Y3QA 3F21A 4KYSA 2IRFG 2XAHA 5AA2B 5DCFA 3WTSC 4BLAA 4AIHA 2F5CA 3KP2A 2OBPA 1BJAA 2WTEA 2I4BA 4TQUQ 2JPBA 5AIQA 2HDCA 4GRKA 4DLDA 1MJBA 2RKHA 5AA1A 2D3IA 3S4UA 1QUJA 4BXUA 1AOYA 4UACA 5DTBA 5EYFA 1P2FA 5FTHA 3OXNA 4KA4A 4RA1A 4DE8A 4UVBA 5JHUA 4U4SA 2Q88A 1ULYA 5CVRA 4ESXA 3ABTA 4NTLA 3T22A 3T5XA 1QVSA 2X0LA 3T96B 1I6QA 4EQQA 1HKSA 4FT8A 1YQAA 2ONRA 4O5VA 1FPQA 2GA1A 1B32A 2HEOA 4YMAA 1E17A 2Z99A 1B1HA 1NKXA 1MH3A 4Q8RA 1UHMA 2J5OA 5J8FA 2LDUA 5DUKA 4N9HA 2Q9TA 3EYYA 4HAMA 4XKQA 4ZZLA 1XCVA 5LHHA 1DPPA 3DP8A 4H0WA 4NF6A 5CRYA 2V93A 1WSUA 3Q9VA 5I59B 2DQLA 4U21A 2WWYA 1A54A 4MNUA 3GZ5A 1LJ9A 3F8FA 3DP7A 4P55A 1M5DA 4MQ9F 2O6AA 5LHGA 2RF1A 2O6GE 4B8XA 1B7HA 3E5QA 4R8HA 3G3IA 1FQBA 4NF4A 1J2XA 4UXNA 1E2XA 4KIFA 4ESBA 5D8KB 5BS6A 1Y9UA 4PGHA 1S7OA 3U94A 1Y0UA 2BV6A 2XV4S 2RCAA 5LRRA 4HA8A 2ISZA 2MH9A 4DDDA 2GIVA 1LAFE 5H8NA 1A99A 1MY3A 5JEIA 3RTRA 5FLXK 2HZTA 3P9CA 3MQ0A 1M5EA 1FQCA 2DE4A 3PQJA 5DYMA 5FD5A 3CO7C 4O3CA 1RZ4A 1QUIA 3TTNA 3DF8A 2D1HA 3O6HA 1JE8A 3H06B 3TODA 2QMXA 1MM6A 2NYXA 3E6BA 2HEUA 4QFPA 5LLQA 2F5DA 1I6XA 1GHCA 3GUDA 2MLGA 1FTJA 4JBZA 3K6WA 3KLOA 5F1RA 4NF5A 4F29A 3R6UA 4ISUA 5DUIA 4A0ZA 4Z2YA 3GF2A 3CSBA 1QBJA 2NWJA 1ZIUA 3IKVA 5TP9B 1T39A 1FBSA 2PEXA 4ND9A 4X9TA 5IT3A 5CMCA 4IGRA 4M71A 3K01A 2DWHA 4H0EA 2L54A 1ZLJA 4HDUA 1MG1A 5DEXB 2P7CB 1RI7A 3FWEA 1TNSA 4EDPA 4G8MA 2P5KA 1GR2A 1T38A 1EH7A 5DCMB 4LONB 1OLCA 2DQVA 1SI1A 2CZLA 2L3DA 1K79A 3GLBA 2ZYNA 5TPAA 3TQWA 3HV1A 2F2EA 2YJPA 4I01A 1K7AA 1F4KA 4TOZA 4AVPA 2E1SA 1R58A 3GXOA 1FT9A 4F3BA 3MWMA 1YTVA 1LFHA 1N76A 4HYEA 2P0SA 2PVUA 3HO7A 1I1GA 5FB2A 4ZYGA 2P2AA 3CDHA 4R9GA 1O57A 3F11A 3OSQA 1S29A 3MWBA 3VXBA 4A6EA 4RB1A 3P7NA 4GWOA 2WC2A 3MPKA 1D8KA 1P6RA 2OBGA 1SW4A 1IAWA 4EGYA 4UUVA 2PJPA 2VONA 1N3XA 1ZYRF 3C3WA 3PD9A 3VODA 4EQ7A 3KP6A 1S8NA 3QSLA 4EJTA 5DT6A 3F6OA 2DP8A 3JZJA 4JWXA 3ABUA 5E8GA 4HX4A 2G7HA 3CTAA 4WEPA 3QK6A 2K7LA 2VODA 1FQDA 5BMZA 5DVFA 1VTNC 4HF0A 3KJ7A 2V79A 2L4MA 3DM0A 5AA2A 3LSXA 1OVTA 5H6RA 4HS7A 4P9FA 3K0LA 4NHJA 2CG4A 4PP0A 3HRMA 2O0YA 3H3GA 4U88A 2Z8EA 2YSRA 4YFKF 3WGHA 4KI0E 2GXBA 4XSXF 5LGUA 5HOOA 1VFEA 4G6DA 4R74A 2ADUA 3HRUA 5BQTA 1P4XA 1JVYA 2O69A 2UVJA 1FBUA 5D8LB 4UV8A 3H6UA 4QSEA 4UV9A 3BPVA 2FNPA 4EV0A 3WAFA 1MRPA 5ICQA 4LG0B 5ERIA 2IPQX 4UHTA 5ICGA 3S9MC 5HM4B 2RKMA 4IO2A 2DE3A 2M87A 4Y17A 1N0TA 3EETA 3KBRA 5L3GA 4WXDA 2OZZA 4FAJA 1DTZA 3BDDA 2VOZA 5I59A 4THIA 3Q27A 3TGNA 1W5SA 4GD5A 2XX8A 3MQ9A 4G77A 1P1UA 4I98B 2XD3A 3HSTA 4BDQA 4EF2A 1PC3A 4AQ4A 2OA4A 4EXKA 3JTGA 1ZG5A 4KPTA 2UZKA 1RKMA 1JQFA 1MXZA 2A5YB 1KU7A 2ZNUA 4MLVA 5DD8A 3NRVA 1ZGJA 3HTSB 1US5A 3R7XA 5HLIA 3REOA 4ENJA 3E9XA 4F7ZA 3VFZA 5K5QA 1SVXB 2ANJA 1QZZA 1S50A 1I69A 1URGA 2AL4A 1KQ9A 3K02A 1R1TA 1USSA 3CG3A 4Q0CA 3Q5FA 4IO6A 2QLZA 3E5XA 3ECRA 5FD6A 3ZMDA 2ZFWA 4WKMA 4GXSB 3EUHA 3C32A 4XLNF 3PUZE 4H5FA 4BYYA 3FZVA 3BOQA 1TFDA 4E0XA 4AWXB 2H09A 4ECFA 3KETA 3VEPA 4MBPA 4UVAA 4ZS9A 4OERA 3RYPA 3BWGA 3FD3A 2QQAA 2P4WA 2BJJX 3OSRA 2Q8JA 1XT8A 3VLWA 5BOXA 5FFZA 2UVHA 2VBYA 3FX3A 3LR1A 3KFMA 1B0LA 1BP5A 4M74A 5TP9A 3Q26A 5CYVA 5DDGA 2XXTA 4O3AA 3VLUA 2IA1A 1GGGA 1LBBA 4XKNA 3DXJF 1XN7A 1N04A 3E6DA 2DXRA 1G3SA 4GVOA 5DEXA 4KICA 4X48A 1ZTYA 1QQIA 5DCMA 2FMYA 1I6AA 4LP2B 3R0AA 2XIGA 3RKXA 1MD0A 1XGSA 2Q8KA 1GVJA 1MH4A 4LMYA 3ZN1A 3SZPA 3TO9A 1SW2A 4NQWA 4OMZA 1N3WA 5AE4A 1KU2A 1XOCA 3HSEA 2H4IA 2CWEA 1CGPA 2W84A 4YKKA 4Z7EA 1POY1 2ZMBA 2FRHA 2LKPA 2Z8DA 3IX1A 1YIOA 1MPBA 4RB3C 1B3HA 5LHIA 2PBIA 1R5HA 3PPQA 3T93B 4FX4A 5H20A 2OLBA 4IJAA 2PLYA 3MAMA 2V6CA 4OVJA 4ZEFA 1TTYA 2GWRA 3O66A 4OU0A 1YYVA 1MXXA 4LQ2A 4GGGA 2M8EA 3I58A 1H0MA 1LB8A 3UGWA 1G4DA 1AH5A 4GQOA 2ZBKA 3J81K 4R72A 3BY6A 1B3EA 2XXIA 1NMUA 2RINA 1Q1KA 4KMFA 4G94A 3MVYA 1T0KA 3IWZA 2XXWA 4ZDMA 1EZOA 2L02A 3BJ6A 2DXYA 2BGCA 2FBIA 2AYSA 5L3BA 4DNCA 1P1NA 1M5CA 1LCTA 5L9SA 2H6BA 4KFQA 4KYEA 4GL0A 3UORA 4OEVA 1UB9A 3E4RA 5ICCA 2DK8A 3G3GA 3HIFA 4GF8A 5JK4A 3V83A 2JPCA 1ZBMA 3K0VA 4LB6B 5FGMA 3IWFA 1ATGA 4FIMA 3GEZA 1TNTA 3QPHA 5HDNA 1RUOA 3N26A 3TTKA 3I64A 5JVTA 2XHDA 2V1XA 4ENKA 3MZBA 4JWYA 3I5UA 3CI8A 4BDRA 4HLXA 4YIFA 1AOVA 4LG0A 1SW1A 4Q5SF 3ZP5A 4OQOA 4IF4A 1B51A 2Z9OA 5ICTA 2LF7A 3DPLC 3RKYA 3O29A 4MLQA 3W9WA 4CYDA 3UP9A 2H99A 5ITPA 4A5MA 5ICEA 4PFYA 1FX7A 3TO7A 2HZLA 4BNCA 2GHAA 3DFGA 3QP6A 4WX9A 1GXQA 4CZZA 3FATA 1B46A 1FTOA 4HQMA 4P9UA 3KCCA 2W85A 1MQIA 3U72A 1R9LA 1ZRCA 3OEMA 2HYFA 1UTHB 2QL3A 5E20A 4WXHA 3RYRA 2XXUA 2HXWA 4YB6A 1IW7F 1QZYA 3CIJA 2THIA 1IEJA 1XSVA 2XUBA 3KGCA 3KLNA 4DCYA 3KOSA 4JK1X 4WF2A 4D0PA 4DIGA 1WVJA 1FZPB 3J80K 1MXWA 4HW0A 2DVZA 1T98A 2LF8A 1BI3A 2NUVA 2B0LA 4AB6A 3BJOA 1LCFA 1Y3NA 3K6XA 4OESA 2DAOA 4OFOA 1TWYA 2OQRA 2DYXA 2MA3A 2UVGA 3CO6C 1EH6A 1SYIA 3KJTA 4FEDA
chains in the Genus database with same CATH superfamily
2NRAC 5KZTA 1X1AA 3C1DA 3BT9A 3F8NA 4KT5C 2WAFA 5FJ8J 1Z1DA 4KIGA 1J9IA 2FIXA 4I9DA 4NE4A 3GWZA 4H67A 1P1WA 2BYVE 2JSCA 2MC3A 4MHFA 2Y7WA 5I3SA 4YIIA 2R7ZJ 3LC8A 3B73A 4ZEIA 5AA4B 3M9AA 2DBBA 3KP3A 4PE5B 3KYDB 2H5YA 3G3FA 4OAZA 4WCGA 1H8AC 1IRFA 1Z7LA 2KRFA 2QWWA 3D0SA 4JX5A 5E1XA 2XXRA 2K27A 4YICA 3O28A 4XKBA 2I0CA 1T0FC 2ZNTA 1GVCA 1B5JA 3PPOA 1X2NA 2HWVA 3W15C 3M4OJ 2YLNA 4GXOA 3ECHA 5HLTA 1ZRDA 3O8HA 3C34A 1HF0A 2EIMH 3BR3A 1B2HA 4NUBA 2XXYA 3RQTA 1ZRFA 1YJ9I 1X19A 4JBAA 4HV6A 1YIJI 3IK6B 2EA4A 1YRNA 2F6CA 4L5EA 3BP8A 4MGRA 3BJAA 4E7SA 5K1YA 1BC8C 5E17F 2E1MC 1NH8A 5M2VA 2EIKH 1FQAA 1YS7A 3TQNA 1PUFB 1NUZA 2GXAA 3TAJA 3LQRA 3H0DA 5H6QA 3E0JB 1BLFA 2M8CA 4YFXF 1AKHB 3G3KA 2L01A 2OCCH 4W1UA 5EJCA 3FJMA 2NS7A 3OSGA 3PD8A 4OXVA 1HLVA 5CJ9A 1XDUA 4QPOA 2KIFA 1IN7A 1YO5C 5TISC 3GW2A 2HVSA 3P7IA 1XDSA 2WADA 4F91B 1UQWA 3HOVJ 1P4AA 1ZGAA 2CUEA 2I4CA 1DPEA 2IW5A 2QFLA 5DD4A 2X7QA 4EGZA 3KZZA 1VQ8I 1ITYA 5TJJA 2GQQA 1I39A 3MUQA 3H1CA 1FJ9A 3QXMA 3HDDA 1LB9A 3RPQA 4NC7A 3PUBA 5EG0B 3H7MA 5FLVA 3ZKLA 4QFLA 4LQ5A 2ONKE 5A5XB 3KBZA 4O94A 4HNTA 4ENNA 3S2VA 4RPNA 4KIBA 4MFIA 5L9MA 4QF9A 3MP8A 2H9BA 3G3ZA 5HS9A 3N4MA 3S16J 3FJ7A 2G9WA 4P1WA 2FYIA 4CZCA 1VE4A 3S8PA 2I3VA 4CA0A 3IL1B 1BI2A 4KQPA 2D21A 4XFEA 2Z2SB 1FJ6A 2FOKA 4LLLA 3LSFB 4FECA 2I0BA 1LDKB 2FBHA 2VC1A 3IH3A 4EM0B 2VC0A 4P47A 1ZN2A 2P5LC 5AA3A 3S9NC 1TW2A 2QQBA 1R6RA 1FMWA 5K5RA 1PB9A 1WDNA 3BIHA 4E0WA 2P6SA 1B3GA 5E3NA 3EHTA 2KQRA 4HCYA 3QYFA 2OPTA 2VGQA 3V7CA 2V9KA 3ZPLA 4OIQF 3TL4X 2UVIA 4DYCA 2F6GA 1K6YA 3BG3A 1H89C 1OMIA 1W1WE 2CW0F 2ALUA 3FXOA 4NF8B 5DS9A 1VDWA 1HSLA 4DZ1A 3VYUB 4O7IA 2Y5KA 2W4SA 3TTRA 4XICA 2O03A 1IXGA 2V84A 2Z3YA 4AYBN 3K2DA 4P1LA 1NK3P 1Y0NA 2PMZA 3LSKA 4YB5A 3CJNA 2F4MB 3GTQJ 2HKXA 3LL7A 4B1RA 4G6TB 3OYNA 2STWA 1A7LA 3S14J 4F3SA 2KFDA 3TKYA 5J4YA 3GFMA 1ZREA 2MSYA 2EK5A 4U7DA 5AA2D 2DA7A 1L0OC 1TP4A 2EFNA 1LBCA 3R61A 3C36A 2K85A 2H1KA 1NV3A 2DT7B 1TBXA 1TT5B 3BKIB 2LYCA 1SD5A 3H03A 1BJZA 1FOKA 3K4BA 3OO7A 1YX5A 5H8HB 3KX2A 3PV0E 3U1DA 2LBFB 3TCFA 2R7SA 2CZKA 2E34A 4OVQA 5HDGA 1BC7C 1I1SA 2G29A 5I56B 1G3YA 4C3JJ 4CHUA 4NWCA 4N15A 4K2EA 2LSOA 4GFRA 3U21A 5ET5A 3E1SA 1LFIA 3VLVA 4I1DA 4PAKA 4EJVA 1UTHA 2K86A 2V3UA 2XROA 3LMMA 3IL2A 1XGOA 2Q1ZB 1FSAA 4PFRA 5L3FA 3TTLA 3CMEI 2VKVA 1MDMB 2DFFA 4HX8A 1CNQA 2CQNA 1SFUA 2LAOA 2XGCA 3K1NA 5F64A 3U9GA 4I62A 3ZMVA 1EH3A 1OQHA 4Y13A 1YZ0A 3K2ZA 3W6KB 2QS2A 2V4CA 2KHMA 3OV8A 5HS8A 1SI0A 3B6QA 1LVAA 5H2FC 4B44A 2H8WA 4PFIA 3N94A 1Z0XA 2V3QA 5L9OA 2E19A 1IXRC 2QCOA 1LE8A 1LSTA 2NXNB 4RK9A 2M9HA 2XF5A 1MGTA 5IY5H 4QTRA 4OETA 2HYGD 1XC1A 1B6HA 2M30A 3GTLJ 2FBKA 1D3KA 4B3AA 4EM1A 2K9MA 2HPGA 1WFXA 3LSWA 1J75A 3MVWA 4ONYA 2JK3A 2DFHA 1SAXA 3C31A 1XS5A 3HHHA 3O8GA 1MXYA 4IB2A 1QGXA 2ESHA 5EEGA 1AHDP 3DQVC 3OO6A 3N6TA 3IOUA 1H9GA 2CJJA 3M7GA 5CQGA 1J5YA 2F36A 1UCRA 2DFEA 3CCVI 1MZBA 4QFOA 3D5RC 1DPRA 1HSJA 1OYYA 2CH0A 5EGOB 1QGPA 2DPDA 2HCAA 5ILVA 1B58A 4ITVA 4GRIA 3TP3A 1K78B 5AA4A 4GL8A 2IS4A 1HSEA 1OVBA 4G7ZF 2RDPA 1XSDA 4U1ZA 1AWBA 4AS4A 2EB7A 1OCZH 2ME6A 2XXKA 3T0JA 2X1EA 2XGXA 3CESA 2MH2A 3DTKA 1RETA 2X6OA 5F08A 2W7YA 1TWAJ 2R7WA 2M34A 4B09A 5JTYB 4JP0A 1BN5A 2E2IJ 2F7CA 5CC2A 3I4NJ 2OAZA 3OELA 1MQHA 4FBPA 1K4TA 4RAFA 2K4BA 3HPHA 3WG7H 3FV2A 3CCLI 1C0WA 1RNLA 2WAQA 3R4KA 2GFEA 4M3FA 3DP4A 2LTPA 3H5NA 1B4ZA 1NK2P 2EV6A 2W57A 3CF2A 1LBYA 2WX9A 3A03A 1JW1A 1FMVA 3CCSI 2BOLA 1PUFA 4LATA 5B3SH 5IGAA 1FSEA 1SVMA 4Y4RA 3ZOBA 3ZKKA 1KWHA 2HQRA 1AKHA 2K3FA 2QS3A 3PFIA 3OO8A 1SC7A 1TQPA 2EFQA 3E6CC 4RB2C 4I02A 3G1LA 1FPFA 3IFCA 1X4OA 3I54A 3COAC 2VKHA 2OX3A 3J7ZI 2HOEA 4L5IA 5J3LA 4C2UA 1MY4A 2Q2AA 2XA5A 3A01B 2ZZXA 4M1VA 1JHFA 1A04A 2XAJA 4D7MA 4KITB 1SD4A 2DWJA 5F7VA 3ZS6A 2V9VA 3E78A 1NV6A 1QUKA 2OCUA 3FK7A 2FUG2 2DFIA 2VB6A 4IPAA 5D6FA 4ZYEA 3OYAA 1FBDA 1R6ZA 4GO1A 2NS8A 4OINF 1FQFA 2XB5A 1Y20A 4H8JA 1QKBA 1NNKA 2HXOA 2ZFUA 2ZYMA 4FISA 2Y84A 3L00A 4DZPA 4RS8A 4OAYA 1A55A 4OMBA 1G8XA 2OTJI 1B9JA 5LGNA 1F9BA 2B3BA 3RGYA 4A69C 2WYPA 2XF6A 2F48A 2HPMA 2OD5A 5CQEA 3CC7I 2W48A 2E1OA 5EG0A 2I58A 3X2QH 4HE0A 3RN8A 1XD7A 3TCHA 1LEVA 4F39A 5A5XA 2XAGA 4UY8I 4F1VA 2Y7KA 3OMYA 4IVNA 1Z6TA 3GZGA 3T9UA 2Q2EB 4N91A 1JT0A 2VQHA 1FEXA 5L3EA 1IRZA 4WXCA 1WWXA 4F3QA 1IXSB 3BFUA 4IOCF 3ROUA 4PGPA 3KC0A 2MABA 4OIRF 5J40A 3MZ9A 4B3XA 3BFTA 5IZ3B 2Q0OA 3U2RA 1G3TA 3CCUI 4BQQA 3CMAI 1W36D 3S93A 4XXUA 3E3KA 5HDKA 4PF6A 5EF6A 3HGYA 3ZQIA 2VN2A 5B66C 4YKIA 4A3MJ 2D5WA 3PL8A 1FC3A 1UHWA 4LG3A 4B4CA 5E8IA 3S9EA 2WKYA 2VE9A 2VPNA 1QPMA 2DWIA 3RTFB 1IN6A 1A35A 4IO5A 2E1NA 2Z8FA 2LC2A 3NOHA 3ZQQA 4NF8A 3I3VA 5FHMA 5DEQA 4EUOA 2JN6A 5AIPA 3S1NJ 2O1MA 4F1UA 1ZARA 5CM6A 2A5SA 4V2GA 1TWFJ 2XAFA 5JLWA 1R5GA 1X2MA 4CO8A 1NH3A 1UELB 3FXQA 1CQTA 3G7WA 3IFAA 4F19A 4G6QA 3F8CA 1PDNC 3H6WA 4ZH4F 1FOWA 1LUJB 1JJ6C 2IT0A 4F31B 3ZMTA 1Z7NE 1M5FA 4I6ZA 1O3TA 5FRNA 4F3GA 5KAIC 3K70C 3TW6A 4JDFA 5D6EA 2BHYA 2OWSA 4TLLB 4PJNA 5FHOA 1J59A 3IOTA 1DGWY 5ED4A 2QRYA 4Y7NJ 4C0RA 5KVRA 4CDGA 1Y1MA 5H8HA 2KPMA 4MTEA 2LBFA 1R71A 1PB8A 3OL3A 4ON0A 4XTCQ 4B43A 3GBBA 2DI3A 3B50A 4XKNA 4A3EJ 3OENA 3RZDJ 3C35A 4N17A 4ELPA 3SEVA 2KL4A 1QVUA 2RV8A 1ORKA 4HCWA 5I56A 3FK6A 3HPGA 1VQOI 4ETSA 3SEZA 2LK2A 4KNYA 4BJ6C 2L7FP 1D1CA 3M8EA 2A5WA 2IS6A 1T6SA 1O3QA 2XWOA 5M5WJ 3BG9A 1ZLQA 4HE1A 3AG4H 1XMXA 4DGWB 3PUFA 5K7ZA 4IY6A 3M3LA 2M4GA 1P92A 3IHUA 1VQPI 2B63J 4AB5A 2KDZA 1MDMA 2HFBA 1B4HA 2OJTA 2BBYA 1DGRM 4XORA 3ZMUA 3H6VA 3SEXA 4L0YB 4ELOA 3FM3A 1ZR2A 4MNPA 2AXTC 1RR7A 3W6VA 3HSRA 3PO2J 4N8YA 5FKNA 1B40A 1OQYA 4JVDA 4YAHX 4DYQA 2P5VA 3KYCB 5E1WA 3V8LA 2R5ZB 1IG7A 1DP3A 1B3FA 1R1NA 3U93A 3S2WA 2UXNA 1EV7A 2XRLA 1ZJLA 2WBDA 3G4SI 4GLIA 3BPXA 4XRFA 4C3IJ 4YELA 1SPIA 4GCVA 2ICWG 3MKLA 4NNJA 2F6PA 1VF9A 2G0EA 1IXHA 1NG6A 1PDAA 4GIZA 5LOMA 1HKQA 5KDTB 2CZHA 3HCQA 1VR5A 4JWOA 2PMSA 3RKWA 3KN3A 4UA8A 5T3JA 1QKAA 3SZGA 4E70A 2YPRA 1MM7A 4N0BA 5IM2A 5ICFA 3H9QA 3MPLA 2UUZA 5A2QK 1T2KA 1WHUA 4FE8A 2GXGA 1DK4A 3TTMA 1APLC 1R23A 4AYBA 2HTSA 2NNYA 1FP2A 1MKMA 2OJED 3TEDA 2ZXTA 5FLXZ 3QOPA 1FCKA 3SHFA 5C44J 4PDHA 1LDDA 3O6BB 4OWRB 3PU5A 2O84X 3RLFE 2QSFX 3K4NA 1X3WB 5EGOA 5DVJA 1DU0A 4ELRA 3Q28A 2DS9A 1VNDA 3BTLA 2C6YA 4O3MA 3HPIA 1BBYA 4S0HB 1K78A 3CCMI 1I6BA 3MZ1A 3L1PA 3TW7A 1BOBA 1G3WA 3CZ6A 2IGKA 1JKPC 1ANFA 1Y1ZA 3EKIA 3EPEA 3KZGA 4I7HA 4CUGA 2FNAA 3OOUA 1QPIA 4O3BA 1RC9A 1FJLA 2MBFA 2P8TA 3JAMZ 4FE4A 1N7XA 2KIQA 2ZNZA 3A4CA 3NQOA 4BKXA 3FXMA 2XSDC 3JV9A 1B1XA 5JTYA 1LVKA 1Z91A 5IP6A 1B05A 1LAHE 2QENA 4CICA 4DXBA 3IOVA 4IO7A 4ZE9A 2X26A 2ECBA 1WODA 1T95A 3KP7A 1G6NA 3ONMA 3S2DJ 4LITA 1FNNA 3QAHA 4GWYA 1IN8A 3CVGA 5EQ8A 1S7EA 4JYKA 5J16A 1ON1A 5GPAA 1X1CA 2NOJB 2RC8A 3VYTB 4H45A 2EA2A 5HLGA 1MQJA 1SMYF 1RUNA 2R71A 3V7RA 3TPAA 2LRDA 3MKZA 2Y7PA 4N13A 2G7UA 2M1BA 1LGBC 4HZFA 3B6WA 1U8BA 5DYHA 3JSOA 1HW1A 3L2VA 4H1XA 2E0SA 4FATA 2JSPA 2KQZA 4X04A 4XN0A 2P7VB 2QEXI 4E7HA 4A93J 3DP6A 2PYYA 4JXIA 4E7IA 2MG4A 1Y39A 1URDA 2XXXA 1Z6RA 3DWLE 3V8KA 1WJBA 2IBDA 2HI3A 3DBHB 4YRVA 3A01A 3GYHX 3S1MJ 2X6WA 1MY2A 4AU7A 2NOOA 3IO6A 2QKMB 2UV1A 3HJEA 4PDKA 3RT8A 4IHWA 3BCAA 4LN5A 5CPRB 1WH5A 1OYWA 3UA8A 2AO9A 2IJLA 4A5NA 1D5VA 2I49A 3GVAA 2CUZA 4RJZA 3ABKH 3R0JA 2VOPA 2W24A 3IOWA 3B6TA 1O7LA 4HSTA 4RXLA 3CCQI 1UJ8A 1A8EA 4L18B 2P6TA 2M7BA 3RQIA 1OMPA 3U1OA 1JVXA 3UK4A 4YKJA 2VQLA 3DU5A 3GLXA 3A0HC 3L2CA 1EZPA 1YW9A 3A09A 3BG7A 1Y1VJ 3MKYB 4KDPA 3GXAA 2A69F 4B47A 1YRNB 4IHXA 1NHAA 1OYIA 4KFCA 1ON2A 1XVYA 4BQAA 3TUSA 3SQNA 3CJQB 3UN6A 2Q2EA 3F23A 1OKRA 1LLSA 1SBPA 3E79A 4DI4B 3T9HB 2QUFA 2R7XA 5AONA 4DXUA 1B1BA 3L7WA 4X1EA 2IA2A 2IEEA 2GOXB 3HOZJ 2CRGA 1S3JA 2V3TA 2QVOA 5HNHA 1IJWC 2DPUA 2CYYA 2IXSA 4L9VA 4EJWA 5BWJA 4DW6A 4XKRA 2B3FA 2XD2A 1A5JA 1U5TC 4S04A 1Q1VA 5KCJB 3FASA 3VB2A 1KGSA 3K9TA 2LKXA 3B7DA 1MY1A 4HX7A 1EJ9A 2RCBA 2EWNA 2Y75A 4L9TA 3L6HA 5ET8A 4BDOA 4OHNA 1IXCA 2DA3A 3Q9SA 1H45A 3V5AA 3ASNH 3FMSA 4RM3A 4MTDA 3TYHA 1XVXA 3FIWA 5DV5A 4F2OA 3RPUD 4FCYA 1U6GA 2E1MB 4XLPF 4I76A 1N7WA 4DCXA 3T8TA 4HOBA 1BKAA 3SERA 3QUFA 4U0VA 4M4GA 4HG2A 1E0EA 1R36A 1WJCA 1ONVA 4BJ5C 5D5WB 4L9JA 1II5A 3WGGA 3E97A 1AMFA 3WTUC 1IUFA 3OYFA 4IOAF 1FBGA 1KQ8A 2ZYKA 1WGXA 4PFWA 3K4CA 3USDA 4C1UA 3RUMA 4LFUA 4RGRA 1IMCA 4IHTA 4RB0A 1FQEA 2DT6A 4OVRA 1EH8A 2Y0SN 5GAHJ 1SW5A 1QO0D 3D4GA 2K9SA 3PPNA 1D4NA 4N6KA 2HU9A 2QBYB 1IZ1A 4F22A 2CGPA 3A29A 1J1NA 3EN3A 3W2WA 1FSHA 1W7PB 1VQ6I 3T9VA 1USYE 4A2UA 3C4MA 1QZEA 1W7PD 2EFPA 3JRCA 3L2WA 3HOUJ 4M3BA 4PUSA 1MQDA 3MC2A 4IO3A 5FHNA 3TMGA 5J4VA 3G3JA 3IAZA 4QRZA 5FRMA 2N8GA 4H46A 1ZMGA 2R5YB 1RYOA 1HCRA 2XGDA 2DOEA 4P56A 4I3EA 5GAGJ 1G2HA 1W5TA 3CDIA 2X4HA 3A0BC 3SFIA 3T8RA 4JSOA 3TDJA 3LSGA 4N9IA 1MDQA 3EYIA 3VV5A 1XCBA 3FVNA 2CFXA 2PFBA 3WG9A 2IAIA 5F0HA 5CBRA 1PBQA 1LDJA 1NNFA 3K69A 2STTA 4UNOA 4K3FA 1B4AA 1HW5A 2BY1A 1FIPA 2R5ZA 3CHGA 1Z21A 3LSLA 2GRVA 4XRSA 1IIWA 5F27A 4EF1A 5BPDA 3MP1A 3VPRA 1MPCA 2BHZA 2HTJA 2CQ7A 1X1PA 3RPLB 4ZE8A 3MEXA 3TCGA 5KDTA 3IORA 2KJCA 4R79A 2OWZA 1D8JA 1FTKA 5EEAA 4R6KA 1XHYA 1BI0A 2K5CA 3KFWX 4BDYA 2VE8A 3LBSA 5EYGA 1FYLA 3CFXA 3KG2A 4BS9A 2O9LA 2WAEA 5K2YA 4OANA 3WGIA 2HS5A 4P5OA 4F93B 3K10A 2HXRA 4MIMA 1OR7A 1XGMA 3JSPA 3G71I 2Y2ZA 3TFLA 4B48A 1R5ID 3EHUA 4I0BA 2HFHA 1UFMA 3FJGA 1MBJA 4POXA 3V89B 5L3CA 2KZGA 3LSTA 2A3SA 1R1VA 3WE2A 2RN7A 5JVGF 4JQFA 4QHQA 5C3EJ 1H76A 3SFZA 3HFUA 3KN8A 9ANTA 4FAJA 3EUAA 2ZXIA 4ZZDA 1MNMC 4KD5A 1JGSA 4U0WA 1RKWA 3IRQA 1LNWA 3OL4A 1PB7A 5FLMJ 3W3CA 2GZWA 5M3MJ 4G68C 2PQ8A 3KIOA 3HZJA 3JR9A 1LAGE 2I3WA 3MSTA 3GBGA 4MLOA 4XSZF 2CQXA 3W2VA 2RC7A 1OJLA 4G12A 2ISYA 1B8IB 1VI0A 1S7AA 1E3OC 1R4MB 6PAXA 1PUEE 1V4RA 1U9OA 3N5LA 4XBFA 2O1LA 4R9FA 1I3AA 1U2WA 2H98A 4LK1F 4NMYA 3C2BA 5C4JJ 1B5IA 2HQAA 3MW0A 4M9ZA 3KOTA 4C30A 2EZIA 1ZKGA 5GP9A 1KU9A 2KP6A 4MIJA 4P96A 2QPQA 3RPWA 1JEUA 3FXUA 3HUGB 2DJIA 4BDNA 4XF5A 2ELHA 2HVRA 1B7UA 2ZJ2A 4NAPA 2WBMA 1ZG1A 1A40A 1WQ2A 2DMQA 2Y69H 2X9DA 2VJJA 4JVIA 3OOAA 4OWDA 4XLEA 3I59B 3M1EA 4NN3A 3I5OA 1FBQA 2FEZA 2PMUA 3ZQLA 3DLNA 2UYFA 4EJOA 3O9PA 1XMKA 3S17J 2EFOA 4KMUX 2ZMEC 3PSIA 4CCLA 3I55I 5TGTA 4A6DA 4GWWA 4X1DA 3KZYA 2ME0A 2QA4I 5IYCJ 2EINH 1I6HJ 2DSFA 4RPOA 2O5RA 3BROA 1D9YA 1VQMI 1OQGA 1V55H 3ECOA 2R7VA 2VD3A 3GZ6A 2R7TA 1SFXA 4I40A 3SZTA 1YPNA 3T1BA 4RBOA 2JUGA 2AIXA 2QS4A 4IO4A 3RCOA 4YG2F 3TDZC 2V7FA 4XRSG 1VFCA 4HBLA 4E4HA 4PETA 1Y8RB 2EV0A 3J81Z 2DW4A 2QVRA 5CKTA 4U7BA 1ZTRA 4BEHB 3WTYC 1MPDA 1S7YA 4J19A 4CXFA 5ILSA 1MBGA 1O7FA 2F35A 4TV7A 4U23A 2VKDA 1SD3A 5IOZA 5CVUA 3PIOF 2GM4A 3KP5A 1T0FA 3PQKA 5IZ1A 5KCJA 4PJJA 1LQ1A 2Y7RA 1OCCH 4NEDA 3MP6A 2KKOA 2KLFA 2MD5A 1SFOJ 3H3VK 2AHQA 4FX0A 4AS5A 3TEPA 3LSIA 4GOTA 4ESWA 3OYIA 1MNEA 2GIZA 1Z7UA 1JKQC 3RPUA 2QGUA 1JUSA 1MQGA 1SYHA 3IO4A 4YMBA 4KXPA 4BDMA 2CQKA 3H9GA 1WI9A 3MVPA 2YX7A 2QMWA 3P9IA 2M0MA 2VPRA 3HG9A 4MQVA 3RSNA 4LK0F 1BR4A 3RIRA 4J01A 1LPQA 2F5XA 4PBQA 4G4PA 3GLLA 3I71A 4TLMB 1FP1D 1WJ5A 3HOTA 1URSA 1XI6A 4RAZA 4AIDA 3HOSA 1NV1A 4G8HA 5F6FA 3J7AO 1JUPA 1TT1A 3IJXB 2PN6A 2X1CA 3MVZA 2DXIA 3KYLA 3ISPA 3FVGA 1FWZA 3QUJA 3HXLA 4FEDA 4G2ZA 5K7HA 2ZO4A 1EZ9A 2XX9A 2HVQA 3IAM2 3QIMA 4QWQA 2QBYA 1UMQA 1HXDA 2OQGA 3H9JA 3MZ8A 2R0QC 3KN7A 1R00A 2OV7A 2PX1A 1D0ZA 1U0JA 2BY0A 1I50J 3W6JB 1W7PA 4ASNA 2REGA 3FIRA 2A6EF 1F5TA 1FPIA 3VFJA 1S9HA 4M9SA 3C18A 3ERMA 2DDBA 3BR0A 2KJBA 2VT2A 3H0GJ 3HRSA 4CCMA 3IP4B 4ZYHA 1VQLI 3K4UA 1S9TA 3PGFA 2Y7IA 3HOWJ 5EYRA 4QLCU 3Q25A 3IKTA 4NGUA 2R5YA 3KEOA 4RM2A 3ULQB 4HNVA 3CRBA 4BXFA 4GXAA 5I84A 2CO5A 1ZH5A 5K7FA 1XC5A 2BY3A 5IYBJ 3UR3C 3N97A 1HW2A 3M8UA 4PC9A 4YKPA 2RNJA 2V4JC 1AL3A 3WE3A 5ET6A 1YW8A 1X3UA 4KR5A 2X7PA 4BU2A 2IA4A 2DN0A 1TFAA 2VBWA 2XB0X 1E3PA 1MBFA 2JA5J 3BBRA 5EHMA 2L4AA 5M5YJ 2QYOA 1NFTA 5I2NB 4N4NB 2W25A 4E7ZA 4OFLA 3RY3A 5TU0A 5K2XA 2XVCA 4P0IA 1Q35A 1GVDA 4M3EA 3RPLA 4XIGQ 2HDDA 1OIBA 3EQ1A 4MEVA 4NC6A 2PT1A 4H8IA 3OD7A 3CUOA 2HXIA 4RY1A 2H27A 3FBNB 4L9NA 4IXAA 3HYIA 3PFYA 5CVVA 3TOBA 1MDP1 1UIUA 1QNTA 5IP7J 4HF1A 4Y33A 3O97A 4ZEBA 3K7AJ 1PBPA 2RVCA 3CFLA 4G7OF 5IT9Z 3IH2A 1K6OA 3PUVE 1GDTA 5DVIA 1YTYA 1Y4TA 3T9XB 5F1JA 3OR1C 3RNNA 1BI1A 1FY7A 1KYWA 2GAUA 2O8XA 4MEYF 2EFWA 1FPDA 4MMPA 4A12A 5D5XB 3WTVC 3SDGA 3IB0A 4KCDA 2BEOA 2ELJA 1D3YA 2DTRA 4L17A 2Y0SA 1MXVA 1RKTA 3J80Z 2FA7A 3IR1A 4RK2A 2BJIA 4F52A 2CS3A 2B65A 5DM7F 3OR2C 2DU9A 3P9KA 3FXRA 3IB1A 2LREA 2LR8A 3LFKA 2XGEA 3T0YA 1RESA 3VDXA 2V1UA 2AQEA 3CUQB 2DE2A 4JSDA 4A0YA 3FXBA 1BIYA 4G7HF 2AS5F 3ZMZA 3AXFA 2DVCA 3DLAA 3M3YJ 3LUYA 1B8IA 1JETA 3HEFA 1IRGA 2E36A 2GHBA 4OENA 3W9VA 2H6CA 1NV0A 3G73A 1VQNI 3PMWA 1RPWA 2A68F 1UZCA 3VDFA 1WCMJ 1FTMA 1ZKBA 2MFZA 2L7ZA 1ERDA 3K6UA 2H8RA 2NVTJ 1A8FA 3K6GA 3GMEA 2FNCA 3PPRA 2ETHA 3HUGA 3QRFF 1Z77A 4EXLA 3AG2H 2OTLI 4IX7A 3WTTC 4O6JA 5IKBA 5IPAA 1USYH 1ZQ3P 3I59A 4DLDA 4R2BA 2XASA 2R7UA 5LBQA 2YPNA 3VXCA 2NS0A 4XQFA 3GZNB 4IO9F 3RKQA 2DDKA 3MZHA 3WHBA 3A3UA 3UNGC 5I2KB 2FD5A 4KCCA 1IO2A 2NVXJ 3H6TA 4C9YA 2GA2A 1Z05A 3E13X 2UWMA 3PIPF 4N8GA 4HQEA 2LNBA 1LBZA 2Q8MA 5CBSA 1Q1HA 2BXYA 3C2GA 3MFKA 1YFHA 1XMAA 1FLIA 3H3UA 2MW8A 4OOIA 5D5VB 1SFEA 3F9KA 4P3LA 4GYIA 4EEFG 3WU1B 4XIDA 5DM6F 4O7MA 3QAXA 3ILTB 4LZ8A 3OYHA 3OEKA 4QFNA 3PNYA 4YZZA 4LZ5A 3VSKA 3U92A 1TL8A 4G8NA 5HBCA 3PO3J 3O2PE 3HSFA 3DV8A 5BUUA 2RAEA 4UVCA 4QSCA 2REJA 2RNGA 4U2RA 4UB8C 3FVOA 4BEHA 4HTGA 3A1YA 2VHAA 5FKLA 4PCQA 1OCTC 2VQCA 2DMNA 3RJPA 4PSWA 1JHHA 2DMTA 3ZXSA 3CSGA 3SXYA 1VQ7I 3K4MA 2HAUA 3JAMK 2VP1A 5L8DA 2M45A 3JW4A 5ISUA 4QPQA 4PJMA 2FX0A 1P99A 3ABMH 5KAFC 1POGA 4L5JA 4BY7J 2YS9A 4I0AA 3DKXA 4M3DA 4IGTA 2EH3A 3SDBA 1YYZA 2AL5A 1XTAA 4PFOA 4A3BJ 2FXAA 5E18F 3OYCA 2MYSA 4R73A 4XKPA 1JTYA 5D4SA 1LEAA 1TZLA 3Q29A 2PJRB 2L9SA 1B6AA 1USTA 3BR1A 2D2WA 4MF3A 3ZRGA 1RIOH 1FYKA 2LP0A 3WAEA 5EYHA 3L2RA 3CCRI 3CJRB 2QS1A 3C9HA 3I6VA 1NI9A 2O7IA 1BIAA 1LFGA 2W82A 2JUCA 1B9NA 1MBHA 4BHCA 5IOYA 3IUOA 2DT5A 4NWDA 2E35A 2W00A 4I3YA 4ZJZA 2OWTA 4IRIA 2FA5A 1JEVA 1FOYA 2FU4A 4PTKA 5HLHA 3MCZA 2O61A 4QSDA 1B5HA 1HQCA 5I57B 3GBAA 3M8FA 2OC6A 3DPUA 5LEJA 3WTZA 5IZZA 1PP8F 1SEUA 3GTOJ 2ZCWA 3ZQFA 3R60A 4C1TA 2EILH 3Q0VA 3RQ4A 2Z33A 2ZJQF 3FF5A 1L3LA 3DBRB 3I0TA 3NWSA 4A3LJ 1F9NA 2IS2A 3MKWB 3QU3A 3BC8A 1D5YA 3FV1A 4OIOF 4II2A 4AIJA 1F43A 2KISA 1ZAOA 4AIKA 2GQ1A 3ERED 1O7TA 4P9KA 1Y4CA 1O64A 1RDXA 2ZNYA 1T56A 3SKPA 3F6VA 5CLSA 4I8CA 5I2NA 4R1HA 2JRMA 2JJ7A 2IVMA 2XXHA 3KSXA 1V3FA 4XKWA 3JRBA 1H43A 5H8QB 3TELA 3DEUA 2XWVA 1WPKA 1SMTA 3D1NI 3HN0A 1U3EM 5KK1A 1U5TB 2JT1A 3FMRA 3JRDA 2XKPA 4OEUA 5H8FB 2AXLA 3ELKA 3LSHA 4M9XA 2CV2A 3V4GA 3CUQC 3R6SA 1EA3A 4Q4ZF 2D1VA 4WWCA 1G59A 2TDXA 3PPPA 3PNVA 4X1BA 2VOOA 2LFBA 2UXAA 3K4LA 4EJUA 1JW5A 2F5EA 3JRGA 1DDNA 1R9TJ 4E6KG 4OVTA 1KA8A 4N07A 2CMOA 1Z7ME 3OOPA 2A5TB 1YLFA 3CP8A 2ZYOA 4NB5A 4LJZF 1IV6A 1BR2A 1TQIA 3RZOJ 1B9MA 4IY5A 1LBVA 3CCEI 1TLHB 1YI2I 4M72A 3LAPA 1ETYA 2YU3A 3CLQA 3OSFA 1Z67A 1WRJA 1NG7A 2Y9YA 5BPIA 1EU8A 4A0XA 1REPC 2X1DA 2F3DA 2KRHA 4OVPA 3OYGA 3FMQA 1EF4A 3ML6A 5CMKA 3QU6A 4KN7X 1S5LC 2HOTA 2VT3A 3PMVA 3AL0C 1XB4A 4YB7A 3H5RA 2F78A 1ZG3A 3CUQA 2J5PA 1W0TA 1IUDA 5E1ZB 2Y48A 3OO9A 1IUYA 1GTKA 3HKZN 1UHSA 5JHFA 4AM3A 2QM3A 3EHSA 3S2HJ 3U1KA 4YFNF 4BH9A 2XPUA 1X58A 5JI6A 4X8RA 2VASA 3CMYA 3O3KA 3ABLH 4C2MJ 2V1DA 2VJ4A 4UUTA 1JI8A 3E6MA 5FTIA 2K02A 3RI4A 1J7KA 5GADJ 1RYXA 3G3HA 4HF2A 4LUBA 2DWAA 2EJRA 3QPLA 1TW3A 5LGTA 4CCKA 3WTWC 1I5ZA 4POWA 3QQAA 4BE0A 4WK8F 1FPJA 4G8XA 1XG1A 4FASD 5TRDA 4F3PA 4BAYA 4F92B 4U4XA 4ZYDA 1Y8QB 4FORA 3EUHC 1VFDA 4PFTA 1B7ZA 4QFKA 2ECCA 2YU9J 2FOWA 3LAJA 1SDXA 2KIUA 3ODBA 1MXUA 1QJMA 3PUYE 5H8SA 5I2KA 1SD7A 2F7BA 5EEHA 4LLNA 3LA2A 2VUMJ 2RQPA 1INPA 3DEEA 1N84A 1HSTA 2Z22A 3ZMSA 2XXPA 2ELKA 2JJKA 3S9LC 1R7JA 2UXXA 2JRTA 4RNSA 3LA7A 3DKWA 4ELQA 2HQ5A 4EATA 3IB2A 2B9SA 1HBXG 3BZ6A 1B3LA 3MYUA 1P9QC 1NL5A 2OUMA 3TP0A 4BDLA 4BL0B 2HQNA 3CLOA 3HHGA 5D5UB 5E79C 1FTAA 2PBWA 3S1QJ 3BG5A 4RAGA 1SD6A 1DPUA 3D4CA 1KYZA 4OYVA 3VYRB 4FQGA 4M6XA 1D9QA 1FTLA 3EPZA 2VPOA 4XRMA 2WV0A 3I53A 2DQRA 3ZN0A 1H3DA 1IF1A 5I5PA 5FO5A 2E7XA 2L7KA 1STZA 2IGMA 2JZYA 4PJLA 1U78A 3K00A 3FM5A 3S15J 3H4ZA 4IHYA 1M5BA 3SDFA 1MMAA 4G68B 1SVOA 1OCRH 1UTBB 3K1PA 2Q89A 2K4JA 2WB1N 1SANA 2FE3A 4XOTA 2UYEA 3MBPA 1MMGA 4DXCA 1FYMA 1XSXA 3K1MA 1BTJA 3RT6B 1UG2A 4KHZE 3TZAA 2F8DA 3K6VA 1P1OA 2O7UA 3JCUC 3H3ZA 2CW8A 3RDIA 1ETQA 2DOFA 2EBIA 1TQMA 2LY9A 1B0HA 3FXJA 1DTGA 1MNDA 1MMDA 1JJ8C 2R6GE 5LDZA 4ZECA 2QF7A 2CFOA 5EHSA 3U8QA 3WTXC 4V19K 1YOVB 3IRRA 2R3SA 4RGUA 2PJRA 3FXKA 4RDUA 1YW7A 3IAS2 4PAFA 1L5TA 3CMMA 3A2KA 4PGNA 3D1RA 4ZDPA 2L2OA 4ZEKA 2QQ8A 1DUXC 2O68A 4XOPA 1JXSA 2RC4A 3T66A 2KIMA 1A31A 1A36A 1MJAA 3I4PA 1UIVA 3N05A 2DA1A 3HB9A 4PZJA 3DPTA 3L09A 1YCJA 2DK5A 2QJEA 2GBYA 3ONQA 2O51A 3B8BA 2E1CA 4QBAA 5J8CA 1YS6A 2QZ8A 1I3QJ 3SETA 1H9TA 1YXIA 4Q5TA 2ZMEB 3OYDA 1W0UA 2FMLA 2V9PA 2NAZA 2DA4A 5HODA 1VSOA 2JTVA 2ESNA 3GO5A 4BHPA 5LEKA 5EZHA 2HQ0A 5I57A 1WKMA 1YX3A 5FKOA 2XHKA 2HPIA 4HNUA 5J1UA 4Y3OA 3ZQGA 2WYKA 4A3CJ 2PFYA 4ZZAA 3CJTB 1KU3A 5CVJA 4BQOA 4AD9A 1Y56A 1IMEA 3PSFA 4FJPA 4H6DA 4DE8A 2IEKA 1ETKA 3LOCA 2E2HJ 2XXVA 2BW3B 4M6YA 4EQBA 2F4IA 3BTCA 3CQZJ 4PFUA 5C4XJ 2JMWA 2F34A 2BE5F 4Q48A 5GTHC 1YAEA 3TOAA 4BBSJ 2HZDA 4H5GA 1JTXA 1U9NA 1P7JA 1AWCA 4LVQA 2VBZA 2FF4A 3ZR8X 1US4A 1CF7B 4DBQA 3FVKA 2XAQA 3CC4I 4BHBA 2LVSA 2CEXA 5H8QA 1D0YA 3D5SC 4ENMA 3F22A 1ELJA 2I48A 1NNPA 2COBA 2DOJA 1SQYA 1QHGA 3E3VA 4U87A 1U5TA 1FTZA 2ONSA 5H8FA 4FE7A 4ESFA 3FHZA 1DCUA 4OTEA 3OIOA 1TT0A 3M3FA 3V7SA 4S05A 3R26A 5F1QA 3I4MJ 3L6GA 3TBIA 4MHGA 2R7DA 3H92A 1FTTA 3L2UA 4RGXA 5BNGA 4A3IJ 4WEDA 4MAGA 1Z9CA 4PK4A 4D1QA 1F1ZA 1IN4A 4BE2A 3RYDA 1O3SA 1TC3C 2K3PA 1SAUA 1Y1WJ 4MNCA 2Z5UA 2ABHA 3MD2A 2A5TA 4PAIA 3ILUB 3MVXA 3Q0UA 1DBZA 3CD6I 4PF8A 1HA8A 2FSWA 4OIPF 3RTWB 2ID3A 1YJWI 2V25A 2HZKA 2H1LA 2OZUA 2F7AA 2ZJRF 2RQQA 3HRTA 1LFUP 2O7OA 4LD5A 3NEUA 2IP2A 4RLFA 4F2QA 4NC8A 3HTUA 1IQ7A 5HPQA 4BQNA 3JTHA 3S3NA 1NV7A 4LLGF 3GFLA 2IS1A 2PT2A 3V8XB 3OYKA 1ZU0A 5JFRA 2GOMA 3VSLA 1IN5A 1NNTA 1POTA 3VE1B 1ODDA 1FBHA 3D5LA 1X4PA 2JVGA 2M8GX 1DMBA 3SJMA 3OYLA 2NXOA 3DELB 3O6IA 5I58B 2F97A 2X48A 4DOZA 2DYSH 3OS2A 2FQ3A 5A2QZ 3OY9A 4GWXA 3GTPJ 2HNHA 3SEYA 2PMHA 2OCEA 3ZQ7A 5EZGA 3IJOB 1YG2A 2DMUA 1CB6A 3QPTA 2XXQA 3SYTA 4ANJA 4G9YA 2R7FA 1DSNA 5J1DA 4EMSA 4CGZA 2HKOA 3BQYA 1DU6A 1XGNA 5ITOA 3EQLF 1JUMA 4HV5A 3V8JA 2R7RA 3LQQA 5JR3A 1JKOC 4DI3D 4P1EA 5KCMA 3VYSB 2Q74A 5CI5A 4LGWA 4IR8A 3A02A 3MZYA 1ACIA 4BACA 3EDPA 4NX1A 2XDVA 3QYBA 3WODF 2ACJA 2M2EA 4ZZEA 2F3BA 1DOTA 4IRGA 2XSJC 2ZZWA 1LEBA 1LFPA 2OZ6A 2L9RA 3GFJA 1O3RA 1BM9A 4OMYA 1FBPA 3OMBA 4P0GA 3OYMA 2ZNSA 1PEBA 4ESJA 4GYGA 1W4MA 2OU2A 3BIGA 1PYVA 4BJTA 2EZKA 5FBPA 3C33A 1ZGWA 4KN4X 1XS9A 3SEQA 2NVUB 2VBXA 4F18A 3EF7A 5L3DA 1ZR4A 4U22A 2CU7A 4XN3A 2V6EA 2YX4A 3AKZA 3LUZA 1D1BA 2Y0MA 2Y31A 4XLFA 2D45A 1I27A 3B02A 4MEXF 2M5WA 2A05A 3B6AA 4PGGA 4EVIA 3E5UA 4R75A 5IT9K 1PP7U 4AUXA 1N75A 3KPHA 1R9QA 2R8TA 2L9VA 4HRIA 1GV8A 4BDZA 1FPKA 1WJEA 2BZTA 3ZSFA 1CE2A 1KZHA 1P1QA 2IA0A 1QW0A 2NNNA 3TDUC 2XX7A 4DQ2A 2W7NA 4PFPA 3KE2A 2LKSA 3CR9A 4GX6A 3SEUA 2COMA 4XKVA 4NF6B 3HKZA 4RAYA 3S32A 5EDNA 3THIA 2BVMA 1D9VA 1IV8A 1UAAA 2QQ9A 1RDZA 3LNQA 4G68A 1J0RA 1UTBA 4N4OB 2CQQA 2MD0A 3HC7A 4A3FJ 5EQAA 2I5UA 4PQJA 3VVDA 1K61A 1G0HA 2DLLA 5D4RA 2I6EA 1FW0A 4L0ZB 3F72A 2XC7A 1AIVA 1QULA 2H94A 2HGCA 2HR3A 3G1OA 4IRHA 2P1SA 4NF4B 5ELVA 2E7WA 3JREA 3H36A 4MX6A 4I09A 2G93A 4YU0A 5KHDA 2CV1A 1HKTA 5HS7A 1K83J 4UB6C 3VVFA 3FISA 2XRNA 1MY0A 1ZHFA 3O6GA 4R2FA 4AVZA 3LSJA 1H44A 2R7QA 3QYEA 1IITA 3W2AA 3N6UA 5CMBA 5H8NB 1KQ0A 2RGVA 4DJAA 2PG4A 1J09A 1JNFA 2WA0A 4XK4A 1R1UA 1NTCA 3ASOH 4LA9A 1QA6A 3F8BA 5J6XA 4EQ9A 4IHVA 5FFXA 3G1MA 4LB5A 3KSJA 1AU7A 3DCFA 1B59A 4Q47A 1OCPA 4Q30B 4GDFA 2VJ5A 2VD2A 2ZMEA 1Y3PA 3MJNA 3LSPA 1EYJA 5ILUA 3K4KA 4RGSA 2GH9A 1V54H 1VZ0A 3LFUA 3HHFA 4NF5B 3FGSA 3JYRA 2CSOA 2M3AA 2A61A 3Q0WA 4NBQA 3TO6A 5M3FJ 1LB2A 1NH7A 5E3OA 4ZEDA 3GX4X 2QSXA 3KC1A 5B7DA 1A6QA 1P7IA 2QKLB 3WU0A 2PI0A 1OPCA 4HLYA 2JQ7A 1BOAA 3F3XA 2BW3A 3AAFA 5DW8A 4OFJA 4W97A 4GFBA 1BIBA 1BA5A 3IC7A 2VT5A 2VXZA 3KEIA 2A07F 2XKOA 4MH5A 3PNTA 3C7JA 3QYTA 1CF7A 5DTDA 4LZ7A 2WB1A 4PCDA 3UIFA 1JKRC 2H25A 4HPQA 5LRSA 2ZXJA 4XLCA 3TQLA 4GX3A 4BBRJ 1GXPA 4KYWA 3NAUA 3OS0A 4R6YA 3KEQA 3K4JA 3LA3A 4FHTA 1IMFA 2F5FA 5TPAB 4I2OA 3KP4A 3OIPA 1S72I 3FUZA 1B52A 3PUWE 4U0YA 4OZ9A 1OLAA 3SEWA 1TXFA 1K9ZA 5CVIA 2HHMA 5IAIA 1ZLKA 1QVTA 2A6HF 1IXIA 1LAXA 3SESA 1HC8A 4NF0A 3LWFA 1S6LA 2ZC2A 1IC8A 2DO7A 4YIRX 4HDVA 4U1OA 1DP7P 2WBBA 1P4WA 4H65A 3A3CA 2Z23A 3VOEA 2EV5A 1R49A 2E60A 1VQKI 4N81A 2FQ4A 2DA6A 3BTIA 4DBRA 1WJDA 5HVQC 1GV5A 3ZQHA 3M3KA 1KZ8A 4PJ0C 4MJOA 4Z0IA 4HEA2 4Y15A 4EM2A 4IHSA 1MS7A 4GWZA 4PFBA 3FKIJ 3LV0A 3QOEA 4N4UA 3VVEA 1QRYA 2RC9A 2HAVA 3MAJA 4NHBA 1JW4A 3CFZA 4WXJA 1O63A 4N6PA 3TKDA 3QP5A 2R9JA 2MLKA 4Z6YA 3PMXA 4F1YA 5K5OA 4X6AJ 4JB7A 3FKJA 5I58A 1MJ9A 2O3FA 4P11A 4R6HA 2ZKZA 5CMMA 2OK2A 1R22A 4KUMA 4RYAA 3BR6A 4M73A 2L0KA 3GFIA 2Q2CA 3CG1A 3F8MA 4FEBA 4XR6A 2YR2A 1IDZA 3K2AA 3L9FA 1U8RA 3PUXE 1Y3QA 1WJFA 3MMYB 3F21A 4GWSA 2IRFG 4KYSA 2DJNA 4LIUA 3PJRA 3I56I 2XAHA 5AA2B 5DCFA 4E7JA 3WTSC 3BR2A 4BLAA 4AIHA 2KMUA 2F5CA 2M7AA 3KP2A 1QHHD 2OBPA 1BJAA 2WTEA 2I4BA 4TQUQ 2JPBA 5AIQA 4ZYAA 4YEJA 2HYJA 3BZKA 2HDCA 1MJBA 2RKHA 4GRKA 2D3IA 5AA1A 3DBLB 1VQ9I 3S4UA 4RA2A 2KZVA 4BXUA 4UUSB 1AOYA 1QUJA 4UACA 5DTBA 4QSHA 5EYFA 1P2FA 5FTHA 3OXNA 4KA4A 2VPLA 3K70D 4UVBA 5JHUA 4RA1A 2Q88A 1ULYA 5CVRA 4U4SA 4ESXA 2DMPA 3ABTA 4X0GA 4UABA 4NTLA 3T22A 3T5XA 1QVSA 2X0LA 4JVCA 1WI3A 5E3MA 4IL6C 3T96B 1I6QA 4EQQA 3S3OA 2XPVA 1HKSA 4FT8A 1YQAA 3P5JA 2ONRA 4O5VA 5FROA 1FPQA 5FKKA 2GA1A 2E5NA 1B32A 2WY7Q 2HEOA 4YMAA 1E17A 3CCYA 2Z99A 1B1HA 1NKXA 1MH3A 4Q8RA 1UHMA 1X1DA 2J5OA 4IZZA 2K9QA 5J8FA 5J1RA 4BGDA 2LDUA 5DUKA 1HDDC 4N9HA 3I3LA 2Q9TA 4HXVA 2YUSA 1LFBA 3EYYA 4HAMA 4J00A 3FXLA 4XKQA 3WHCA 4IQ4A 4ZZLA 1MBKA 1XCVA 5LHHA 1DPPA 3DP8A 4H0WA 1RRJA 4NF6A 2KDOA 5CRYA 2V93A 4O8MA 1WSUA 3Q9VA 5A5LA 5I59B 2DQLA 2ZXHA 3AL0B 2WWYA 1EYKA 4U21A 1A54A 3FHNA 2M0CA 4MNUA 3GZ5A 1LJ9A 1TWGJ 1MW7A 3DP7A 3F8FA 4MQ9F 4P55A 5LHGA 1M5DA 2O6GE 2O6AA 4B8XA 1B7HA 2RF1A 3E5QA 2A6TA 4R8HA 4ZC3A 1N77A 1R4NB 1JGGA 4XLHA 3G3IA 1FQBA 1OCOH 4NF4A 1J2XA 4UXNA 4XKCA 4E7LA 2LD5A 1E2XA 4KIFA 4II3A 1A6IA 1M1EB 1WH7A 2NOGA 4PGHA 5D8KB 4ESBA 1S7OA 5BS6A 1Y9UA 3U94A 1Y0UA 2BV6A 2XV4S 3V42A 3OS1A 2RCAA 5LRRA 4E7KA 4HA8A 4RLQA 2B4MA 3J7YJ 2ISZA 2MH9A 4Q0CA 2GIVA 3OYEA 4DDDA 1PJRA 1LAFE 4JX6A 4KJZA 2L7MP 3J7AY 1A99A 1BR1A 1MY3A 5H8NA 5F24A 5JEIA 3RTRA 2CZIA 5FLXK 2HZTA 3P9CA 2D5VA 3H5AA 1IMBA 3MQ0A 1M5EA 1FQCA 2QSHX 1MSFC 3PQJA 5DYMA 3FDYA 5FD5A 3CO7C 1RZ4A 1QUIA 4N6DA 3DF8A 2JA8J 2D1HA 3O6HA 1JE8A 4O3CA 2ZSIB 1ZELA 3H06B 4H4KC 3TODA 2QMXA 1MM6A 2NYXA 4MO7A 3E6BA 2X85A 3GCMA 2HEUA 1B72B 5LLQA 2F5DA 3ZGKA 1I6XA 5J47A 1GHCA 4QFPA 3GUDA 2MLGA 4DIQA 2GLOA 1BW5A 1FTJA 4JBZA 3K6WA 3KLOA 5F1RA 4NF5A 4F29A 3R6UA 4ISUA 2TRTA 5DUIA 2JVHA 4Z2YA 3Q3SA 4A0ZA 3GF2A 3CSBA 2VL8A 2Y30A 2V26A 4C2TA 1QBJA 2Z16A 3HOYJ 1IMDA 2XWKA 4ZTFA 3H35A 1NV2A 3BR5A 1ZIUA 2NWJA 3IKVA 5TP9B 1T39A 1FBSA 2PEXA 2VI6A 4ND9A 4X9TA 5ET7A 5IT3A 5CMCA 4IGRA 4M71A 2KRCA 3K01A 2DWHA 3CCJI 4H0EA 4GX4A 2L54A 1ZLJA 3JRIA 4PE3A 5LFAA 4HDUA 4BXXJ 1MG1A