1IZ1A

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
b'MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR-type regulatory protein
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Dna binding protein
total genus 92
structure length 292
sequence length 292
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1iz1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A02
2D21A 1O3SA 4KIFA 4P96A 1XSXA 4KMUX 2ZFWA 4LG0A 4DCXA 4M72A 1QUJA 4HCWA 3S9MC 4HBLA 2GAUA 1B1HA 3TDUC 4XLNF 1I6XA 1LLSA 2FYIA 1MH3A 5D5VB 4YKPA 4DLDA 4EXKA 3G3ZA 2Z3YA 4HZFA 1HSJA 4BYYA 1POTA 5IT3A 5IT9K 2B3FA 5I58A 1GVJA 5DYHA 2QZ8A 3GF2A 3HUGA 3GX4X 2QUFA 1B3HA 3IX1A 2PT2A 3H6VA 2VODA 2I49A 4KIGA 2DS9A 3K0LA 3O97A 1ONVA 1UTHA 2I4CA 3UK4A 4MQVA 5FTHA 3IO4A 4R79A 5D4RA 1NHAA 3V8LA 4F3SA 3CUQA 2HEUA 4JSOA 3TUSA 2H9BA 2J5OA 1SAXA 3H3ZA 3FXQA 4PFUA 2GRVA 4HOBA 2HEOA 3QYTA 1EH3A 4H65A 4U7DA 4YFXF 4A12A 3BJOA 1YG2A 4ISUA 4LZ5A 3Q9SA 1K7AA 4UVCA 3TTNA 1T38A 3S9LC 5FO5A 4YICA 2QMWA 4FIMA 5H8HA 1R1NA 2OZUA 3KP7A 4I0AA 2XX9A 2ZYOA 3MVWA 4FEBA 1LQ1A 3FJMA 1DPUA 2VE9A 2XXXA 2H94A 3F22A 1IUDA 3F8CA 1R00A 1QW0A 1GHCA 3HHGA 3EQ1A 1W4MA 1OMIA 2MC3A 3L7WA 3I53A 1I6AA 3ECHA 2A3SA 4GYIA 1T0KA 4DXUA 1O7LA 3LSWA 2VC0A 4UHTA 1FOKA 4YMAA 3TAJA 2OA4A 4G7ZF 1FT9A 3FJ7A 2FQ3A 4ZEFA 1IW7F 2PYYA 3ZN0A 3T93B 1SMTA 3IL1B 3I5OA 2IRFG 1IITA 3ZSFA 4LFUA 2O6AA 3QPTA 2PX1A 1PB8A 2QVOA 3WTWC 1P2FA 2RC8A 3FUZA 5CBSA 4I8CA 2RV8A 5AONA 2VT3A 4F18A 2F7CA 3MQ0A 3F8MA 5L9OA 4C1UA 2K7LA 2JPBA 4OQOA 5KZTA 5DV5A 3QUJA 1IXSB 2Z8FA 4LZ8A 3DKWA 3O6BB 5LRRA 1LBCA 2XX7A 1SFXA 4UV9A 1IAWA 1FQAA 4BXUA 4GO1A 1B05A 5KDTA 5K5QA 2XXHA 3MZ9A 1M5CA 3LA7A 3WG9A 4EQ7A 2HYFA 4FE8A 4KYWA 4L0ZB 1M5DA 4GF8A 2Y7KA 3MZHA 1FYMA 4YB7A 4MEYF 3TDZC 5K2XA 5ELVA 2FNCA 2A68F 1LFGA 2LKPA 4X1BA 3I59B 5JHUA 1IIWA 4JWXA 1IXGA 1IQ7A 2REJA 1B3LA 2F35A 5HLHA 2XUBA 1LAHE 2Z23A 1TQMA 1ON1A 3OOPA 1Z6RA 2D3IA 3A3CA 1R58A 2DE3A 3Q25A 2HYGD 5HOOA 4M9ZA 3EUHA 3H6TA 3E13X 1T0FA 3VXCA 3ABTA 4NB5A 3M9AA 3VLVA 3LUYA 3V7CA 2VE8A 3NEUA 3S4UA 1HW5A 2B3BA 2K27A 3ZMDA 5BWJA 3BOQA 4G6QA 1XCVA 2WC2A 3I58A 5HS7A 2R9JA 1LNWA 1N7WA 2F78A 2ZXJA 1SD6A 2FNPA 3BROA 1T6SA 1B0HA 1BP5A 1MY3A 2Q2CA 2PT1A 4IO6A 3HOSA 1Q1KA 4ZE9A 4KFCA 1AWCA 1XMKA 1BC8C 4UACA 3QIMA 3KZYA 3D5LA 1B2HA 3FZVA 1STZA 3J7AO 5I2KA 4ENKA 1MY1A 1OQHA 1UFMA 4R9GA 5H8NB 3FV1A 1E2XA 3JAMK 1REPC 4YFKF 3C32A 3UP9A 1EU8A 4ZYEA 5HDNA 4GYGA 3B6WA 3T22A 3DELB 4JWYA 2WTEA 4UXNA 4FX4A 4OIQF 2RVCA 4H1XA 3O2PE 1O63A 2YR2A 2IT0A 2XKOA 1A54A 1USTA 2F36A 4AVPA 4WKMA 1QKAA 3VVEA 5HVQC 2AS5F 2HZTA 1UTBB 4YB5A 3FVGA 1TQIA 4FJPA 1NH8A 1EZ9A 2PFBA 1H44A 1L5TA 4IVNA 1B3EA 1UQWA 2OZ6A 1ANFA 1IN8A 4JK1X 3OOAA 1ZJLA 4XRFA 1N3XA 2W84A 3LAJA 2V79A 4BHCA 1TW2A 1ZRDA 1UHWA 2M8CA 1YAEA 2W85A 3QPHA 4CGZA 2QL3A 4HV6A 4Y15A 2R71A 3RKYA 1LEBA 1TLHB 2QPQA 3RT6B 4MH5A 3M8EA 3J81Z 1XVYA 1LGBC 4WXHA 5ITPA 3QUFA 2NUVA 2OBGA 1W7PB 3HSFA 2VOOA 1YW8A 5CVIA 1MJAA 4NHJA 1UIUA 4QHQA 4WF2A 2F34A 3E6MA 5LOMA 3FIRA 3E5QA 3T8RA 2COMA 4X48A 4RB3C 5ED4A 2DPUA 1MPCA 4HX8A 3B7DA 2X7QA 4IF4A 4DXCA 2FA7A 1XB4A 3KSJA 1OVTA 4JSDA 4QF9A 4OMYA 2G93A 4ZEDA 1LCTA 2A6EF 2R3SA 3P9IA 4RYAA 3V8XB 5E18F 3EHTA 4P11A 4RGRA 5H8SA 3PGFA 4PZJA 3RLFE 4RGSA 1PP7U 4H67A 2JPCA 3TGNA 3WU0A 2FU4A 4XXUA 1D3YA 3S2VA 3COAC 2VP1A 3LR1A 4OFJA 3S9EA 5ILSA 3B6QA 3HHFA 4LUBA 5L9SA 5M2VA 5DVFA 1RZ4A 4XSZF 2QYOA 4AIJA 2MH9A 4HX4A 2I0BA 1XGMA 2Q8KA 2CGPA 1FQCA 1FSHA 4LLLA 1RNLA 2ESHA 4EJWA 3K1NA 1LFIA 1I69A 3O2AA 5KVRA 5HS9A 4WXJA 4ZEBA 2DE2A 5CMKA 3IOTA 4A0ZA 1A8EA 4RA1A 1XGOA 2FMLA 3GWZA 4MBPA 3BPXA 3K1PA 2FBKA 1KA8A 5D5UB 1MQHA 5A5XA 3K6VA 3I64A 1LB2A 1YS6A 1HSTA 3RTRA 4R9FA 1LVAA 1E17A 1US4A 3IKVA 2O03A 4U21A 2ISYA 3N26A 1J5YA 3BWGA 3HRUA 4BQAA 5AA2A 1FWZA 1URSA 3Q5FA 3R0AA 4RXLA 1BJAA 2OD5A 3W6JB 4L9VA 2DXRA 4BDMA 4ELPA 1NH7A 4LB6B 4OIRF 2F97A 3MFKA 5EYFA 4F22A 1JE8A 2RGVA 4GOTA 1ZIUA 2XKPA 3HSEA 3OXNA 1RYOA 3ZMUA 3MP6A 5ICEA 4HA8A 2HCAA 2D2WA 1XOCA 4DDDA 2VONA 3MZBA 3KFMA 3N6TA 2YSRA 4UVBA 2O0YA 2P5VA 2I48A 4KPTA 3BY6A 1XC1A 4KYSA 1V3FA 1Q35A 1OYIA 2FEZA 1FZPB 1ZGAA 4M74A 3F3XA 1YTVA 3AXFA 4OESA 1CGPA 2CSOA 2Y7IA 4I09A 1MDMA 3KCCA 1FYLA 3MZYA 1F9BA 4PP0A 3DV8A 1OQGA 2G29A 4F2OA 3MBPA 5E20A 2A5SA 2VBYA 1RUOA 3USDA 1YTYA 2FBIA 3MVYA 2JT1A 2ZNUA 3IOWA 1TQPA 3FVOA 2M5WA 1D9YA 3VVDA 4PCQA 3VB2A 3O6GA 2IPQX 4LG0B 4FATA 1JQFA 4OETA 3WU1B 4E0XA 3FASA 4ND9A 5EEHA 1T2KA 1FP1D 2ETHA 5L3EA 2O84X 1US5A 4M4GA 3PUVE 5I58B 3R0JA 4LVQA 3A09A 2DT5A 1KQ8A 4CICA 4ZS9A 1BN5A 3LSLA 4JDFA 3T1BA 3BFUA 5E8IA 5F1RA 1FTKA 1XT8A 1LAFE 4OU0A 3IWFA 1MY4A 4LONB 4IHSA 3OEKA 3T66A 2BYVE 1UTHB 5D6EA 3VLUA 3MAMA 1IZ1A 5B70A 2QQBA 1SFEA 1FW0A 3MJNA 2H5YA 3C33A 4ZYGA 5HLGA 2XIGA 1U8RA 2HZKA 3DP6A 3N6UA 4GLIA 1Z7ME 4KR5A 3G3HA 2HDCA 4EVIA 2IA1A 4BHPA 5LHIA 4YIFA 2E1CA 2GHBA 2FRHA 3IC7A 4YU0A 3LA3A 1P6RA 1HSEA 3U8QA 3ISPA 1CE2A 3GLBA 1SI1A 1SD3A 1VSOA 1Y1ZA 3IB0A 4K2EA 4EM2A 4EF2A 3KZZA 3TO9A 2P7CB 3FV2A 1LEAA 3HN0A 1SMYF 5FB2A 1QPMA 5HM4B 3C18A 1B46A 3TTMA 1OKRA 2QJEA 3DPTA 2GA1A 2QSXA 5ILVA 3U72A 1H45A 4FX0A 5H8HB 3KGCA 5HDKA 4RPNA 5IAIA 1EV7A 2XAFA 1WWXA 1G3SA 3H6UA 4NQWA 4TLLB 2P0SA 3T96B 4BDQA 1EH6A 3DP8A 3ZMZA 1Y3QA 4N07A 5F1QA 2QQAA 4F1UA 2EV0A 3HCQA 2IVMA 3CIJA 2XASA 4A5NA 2GH9A 4NF8A 1UIVA 3IJOB 5CMBA 1KYWA 2D1VA 3FF5A 5DEXA 4ESWA 1B7UA 2GXBA 2XD3A 5DD4A 5JFRA 3BPVA 4PGGA 1H3DA 3ONMA 4RB1A 3V5AA 3RQTA 3K2ZA 2NS0A 3V8KA 1FPQA 2OJTA 2Q89A 1QNTA 4AD9A 2KJCA 1JW5A 2DI3A 3HYIA 1MG1A 1DUXC 5ITOA 3K6WA 3UIFA 2RINA 4A0XA 1NKXA 2V3TA 5I57A 2V1DA 3DEUA 2DWAA 4DE8A 3C7JA 4HQMA 1JVXA 5AIPA 4NF6A 1ODDA 2PMSA 4KUMA 3RKWA 3KLNA 3LQRA 2NXOA 4QFPA 2ZYNA 3G73A 1R1UA 3RYPA 4R6YA 3H3UA 2O69A 1Y3PA 4TQUQ 2P8TA 1A40A 4OMZA 3EHSA 4NMYA 3J81K 3TOAA 4LGWA 2HAUA 4RAYA 5LEKA 5KDTB 2P4WA 4P9UA 4ZZEA 5FHMA 4ELRA 5HS8A 3CTAA 5LEJA 3U92A 3CJNA 1WSUA 3JTHA 2H6CA 3BKIB 1LDJA 2DBBA 4OINF 2RKHA 1JETA 4G77A 1Z1DA 4MLQA 3RJPA 3GO5A 4GIZA 3JSOA 3TDJA 4OEVA 1YW9A 3EDPA 1RIOH 3IL2A 3KOTA 4EM1A 2ISZA 1KGSA 3GFMA 1GR2A 4H0EA 1NFTA 4H5GA 4LD5A 1ZLKA 2ZYMA 3KP3A 3BFTA 2OCUA 1A99A 1O64A 2EFPA 3GZ5A 5ICCA 4LK0F 5CVUA 3TQNA 2F5FA 1OYWA 1GXQA 2K4BA 1G3WA 1ZHFA 3SFZA 3DP4A 3R6UA 3K01A 3K9TA 1DTZA 2HKXA 1H9TA 4A6DA 1AL3A 2ZXTA 5HDGA 5TRDA 4NWCA 3KJ7A 3UN6A 1W5TA 3ULQB 2CO5A 4XKQA 2A6HF 1J9IA 2OQRA 2ZYKA 1PDNC 2KIMA 3E4RA 3TMGA 4R6HA 4OEUA 1HBXG 4ENNA 2DYXA 3VEPA 3IB2A 3FJGA 4R75A 4KA4A 1SYHA 4I62A 3RPQA 1HQCA 1S50A 5D6FA 5L3BA 4I0BA 5I2KB 2H27A 1B58A 1CB6A 1JNFA 4I01A 4ON0A 4H8IA 2O3FA 3EYIA 2EV6A 5E1WA 3HSTA 2VHAA 3IR1A 1B9JA 1LB9A 4P55A 1B7HA 3Q27A 4BHBA 4IO4A 4ZZDA 5ICQA 3EN3A 3IORA 3L09A 1MQJA 3ZMTA 3QP5A 1MM6A 1G3TA 2J5PA 1GV8A 3QAXA 2GZWA 1Z91A 2Z33A 5DVIA 1VFEA 3WAFA 2XVCA 3M7GA 1KU9A 2OAZA 4QLCU 3J80Z 2YPNA 3W9VA 3VFZA 1B6AA 3IRQA 4G68C 4LP2B 5BMZA 1EZOA 2BV6A 3H3GA 3FATA 3QSLA 1J7KA 2KIUA 1U3EM 3DXJF 4PGHA 4RGXA 3E97A 3ILUB 3R6SA 2CZLA 3EHUA 4EQ9A 1YS7A 2CQKA 1CF7A 1SFUA 2GQQA 3IOVA 3IWZA 1TT1A 1T39A 2DPDA 3K00A 1DTGA 2LNBA 1IRGA 1U6GA 3I0TA 1ZGJA 5JVTA 3PQKA 4L5IA 4NF4A 2Y48A 2P7VB 4OYVA 5JEIA 1FBUA 4MF3A 4K3FA 4HDVA 3FVKA 1TXFA 3L9FA 4KT5C 3CUOA 4L18B 2GHAA 3WTUC 2NOOA 1USYE 3SZTA 3WGIA 5CBRA 2AIXA 3WTTC 1VFDA 5CRYA 3C31A 4GXSB 2Q8JA 4U4SA 1DP7P 3JSPA 3U1OA 5IKBA 3KN8A 1JW4A 2MA3A 5KCJB 4N13A 2V3UA 2B0LA 1XGNA 1B4HA 1YO5C 1DMBA 2KLFA 5E17F 4GXAA 3LFKA 4XKPA 5FHOA 1I27A 1IN6A 4F39A 1I1GA 4KHZE 1G6NA 1FQFA 3N5LA 1Z6TA 1QBJA 5L3DA 4QWQA 3MEXA 2ZJ2A 4OFLA 4LB5A 1ULYA 2OLBA 3QAHA 4ZEKA 1F5TA 5CVVA 1Y4TA 4GRKA 1P4WA 1RYXA 3TO7A 3O9PA 2K86A 1SVXB 3HTUA 5AA4A 3ZN1A 2KJBA 5H20A 5FD5A 3DM0A 3SHFA 3A3UA 3K69A 2X4HA 3KP5A 4Q0CA 3MUQA 2R7DA 3MCZA 4OZ9A 1S8NA 1SYIA 2UZKA 4ASNA 4ZZLA 5JK4A 3KEQA 1FP2A 3KEOA 1B3GA 1POY1 3ZKLA 4UNOA 2EA2A 1JEVA 3EYYA 2A5TA 3ERED 5DDGA 1II5A 1TFDA 4F3BA 2FMYA 4F3GA 3GEZA 1BTJA 5B7DA 2WWYA 2E0SA 4JQFA 2VD3A 5TP9A 3HSRA 3ZQ7A 5A5XB 5L3CA 3F21A 2QENA 2LF8A 1BI3A 2EFQA 4U1OA 3UORA 2I3VA 3QP6A 3WGGA 1J0RA 2P2AA 5AA2B 2PMUA 4KMFA 4AIHA 4RY1A 3O6IA 1A04A 4M9SA 2UYEA 5H8FA 3MW0A 2ESNA 2Y7PA 1QULA 1H9GA 2V1XA 4R2FA 3CG3A 5CMCA 4IHTA 1R6ZA 4WCGA 2L3DA 3UA8A 5FLXZ 3TO6A 3VVFA 3I6VA 3RPWA 4XBFA 5L8DA 2F8DA 3PQJA 4U1ZA 3U9GA 4N6PA 1R7JA 5AA3A 2XXRA 2VOPA 3KN3A 2DU9A 1MY2A 4F1YA 2GXGA 4A6EA 2BBYA 3QU3A 2E1NA 2ONRA 2FNAA 1A55A 3E9XA 4AB6A 2UXNA 1S6LA 4M1VA 3PD9A 3WTVC 2VD2A 4HS7A 3K0VA 2QMXA 3KP2A 3D4GA 4KCDA 2Y75A 1GVCA 4IO3A 2F5CA 2UVHA 4CYDA 1WDNA 4HCYA 1Y3NA 3BJ6A 4I1DA 1P1OA 3KSXA 4QFLA 3H03A 3KFWX 3CFXA 2H6BA 2DQVA 1MDMB 3HO7A 2VXZA 4DZ1A 3O29A 4OHNA 3ABUA 1R9QA 2Z5UA 1BI2A 4IGRA 4U4XA 1MXYA 2LDUA 4L9NA 2P1SA 2A69F 4F19A 3GYHX 2HGCA 1XS5A 2ELHA 2VT2A 1A7LA 4ZH4F 2PLYA 1YQAA 2XXVA 3GXOA 1QZZA 1BKAA 3RT8A 4HW0A 5L3GA 4DXBA 1OVBA 4IRGA 1FTMA 2XROA 2PI0A 5I84A 2L4AA 4EQBA 5H6RA 2XHKA 3FXRA 4C1TA 2PBIA 1SD5A 4DNCA 1SDXA 1NMUA 4S04A 1OIBA 1R9LA 3HRMA 1B51A 1FY7A 4EV0A 3T8TA 3MAJA 1DOTA 3V4GA 3ZP5A 1W5SA 3REOA 4EJTA 1XGSA 1USYH 3G3JA 1EZPA 4Z7EA 3OO7A 5KCJA 2E7XA 1LAXA 3CO7C 2QS1A 4MFIA 1R1TA 1MH4A 3JYRA 3S9NC 1TBXA 1P1QA 3PV0E 1O57A 3H7MA 4XSXF 2XXWA 3SEUA 4EGYA 4WWCA 1D9VA 4FECA 4MLVA 2WV0A 1D3KA 3MVXA 2F2EA 1ZU0A 2G7HA 1IN4A 1PBQA 4G94A 2XXYA 4L17A 3ZS6A 1FCKA 3HHHA 3PPPA 4LMYA 1P4XA 3TKDA 2HS5A 4H0WA 3KP6A 2HOEA 4O3AA 5JTYA 4HF2A 4EQQA 3FM5A 4UUVA 2H99A 3PMWA 2REGA 1O7FA 4FAJA 2A5YB 2MH2A 4OXVA 4FHTA 1FSEA 4E70A 2PJPA 3LSXA 4KYDA 1C0WA 2O7IA 3KN7A 3FWEA 5D5WB 1N76A 3KP4A 4OFOA 3ILTB 4ESJA 1IXRC 1EH8A 1M5BA 3VE1B 1P4AA 5I59A 1ON2A 4NF8B 5ICFA 1P92A 5DEXB 4AB5A 4YIIA 1QJMA 4AQ4A 5DCMA 2F6PA 2TDXA 3ZKKA 1XSDA 4QRZA 2B65A 1KU3A 1QZYA 5D5XB 4CXFA 2PEXA 4NF5A 4QFKA 4KIBA 4G4PA 3FMSA 1VR5A 2E1SA 3J80K 1QO0D 2Y84A 5FTIA 1U2WA 2M1BA 4B09A 4L5JA 3IJXB 1HXDA 5BPDA 3N4MA 2EB7A 3DFGA 1ZH5A 4F2QA 5E1ZB 3WE3A 2IA4A 5I57B 4Q4ZF 3OO9A 2LSOA 3TFLA 4G9YA 4X9TA 4UVAA 4A2UA 2W24A 4NF6B 2CG4A 3BBRA 3G3GA 3PUYE 2EK5A 1FTOA 3THIA 2H09A 1JEUA 3RTWB 3KEIA 5DD8A 1PBPA 3VFJA 4HDUA 5JI6A 1FQBA 1J2XA 3F8NA 4BDOA 2OQGA 1ELJA 5DVJA 1WQ2A 5LGUA 4I9DA 3T5XA 4A0YA 2I6EA 2I0CA 3H6WA 2OWSA 4OMBA 2I4BA 1MM7A 2UXAA 4GVOA 2AXLA 2I3WA 2LF7A 3CSBA 1XHYA 4Q5TA 2HTJA 3OMBA 5A2QZ 1R22A 1JXSA 2OU2A 3MVZA 2HTSA 2M30A 1DDNA 5DT6A 4IRHA 1BIAA 3QXMA 2V93A 5LGNA 2XHDA 1TNSA 3R61A 3GZ6A 3BZ6A 2O1MA 4EMSA 4RB2C 3KLOA 4JXIA 5FFXA 2H25A 4MNUA 1B4AA 3M8FA 3VODA 1G4DA 2O51A 3QRFF 4YKIA 3CG1A 1XSVA 5CM6A 2ONKE 2HZLA 1B7ZA 4ELQA 2FE3A 5TPAA 3K6UA 1Z9CA 3LSTA 1N7XA 4XKNA 4Y17A 2MD5A 2AYSA 1WRJA 3FGSA 4HX7A 4ONYA 3MP8A 5FHNA 1A8FA 1LAGE 2JRTA 5K2YA 2YU3A 5BPIA 3C1DA 1LDDA 4ZDMA 3KZGA 1MY0A 1O3QA 1ZG5A 1XN7A 4Y13A 1BLFA 3B73A 4LQ5A 5DYMA 2AL5A 1R1VA 1XDSA 3LSFB 1MPDA 1ZLQA 2EA4A 2GIVA 4I2OA 1LSTA 2L54A 2Y7WA 4OTEA 2RN7A 2YLNA 2MLKA 3F8FA 3LAPA 1S7OA 5J8CA 1H43A 3OD7A 4RNSA 2O8XA 1MXXA 1Z05A 4E0WA 4D0PA 3HRSA 4Q5SF 3RY3A 5F64A 5ISUA 4U2RA 2ZMEA 5J6XA 5H6QA 4ETSA 2EFOA 1S29A 4XTCQ 4PFWA 3IOUA 4IPAA 2A61A 2KRFA 3FD3A 4MEXF 3O66A 3CI8A 3Q29A 4OOIA 3IK6B 4EJUA 4MTEA 4R1HA 3RNNA 3SEXA 5FGMA 1PC3A 1ZMGA 5FLXK 3RYRA 1P99A 3T9XB 4BNCA 4ZYDA 2XXUA 4HW8A 4N9IA 1MXWA 4HQEA 4C0RA 2HR3A 1MQIA 1YYVA 1N04A 4I98B 2OBPA 5AIQA 2M8EA 4H5FA 2BEOA 2O7UA 3Q9VA 1MQDA 1CF7B 3F8BA 1B32A 4POXA 2UYFA 4N9HA 2BJJX 3PU5A 4EDPA 2CWEA 2YJPA 1IXCA 2DVZA 4RPOA 3RGYA 2HWVA 4NF4B 5H8QA 2X7PA 4YMBA 4Z0IA 3VDFA 4LLGF 4U0YA 3M1EA 1PB9A 2VGQA 5DTBA 5HLIA 2XRNA 2NVUB 1U78A 1U5TC 4U7BA 3OSRA 2VBWA 1MKMA 4G68B 4G6DA 2G7UA 3MP1A 1BI1A 4BDNA 1EH7A 1TNTA 1P1WA 5I2NA 4IY5A 3JZJA 4G7HF 2XXPA 2PQ8A 5D8LB 5I56A 1D8JA 1W7PD 3GZGA 3M3FA 3QOPA 2PN6A 1AMFA 2IW5A 5EHSA 5D8KB 1QKBA 3PD8A 1B1XA 3E6DA 4GL0A 2Q2EA 1I6QA 4YZZA 3SDFA 4HV5A 3H4ZA 4YG2F 1TWYA 5LHGA 5K5RA 3WTZA 1SD4A 3SEYA 4U23A 3VXBA 1ZG1A 3IKTA 1B5IA 1QUKA 1DPEA 3ZPLA 5AA4B 3TZAA 2PMHA 2F7AA 4HYEA 4YKKA 2RQPA 1U5TA 1B52A 1B3FA 3GBAA 1R5GA 1XD7A 1RI7A 4O3CA 1KQ9A 2KKOA 2NWJA 2KIFA 3F11A 2XGXA 3T9HB 3KG2A 3I3VA 2X0LA 1SW2A 3TTLA 3RKXA 2A5TB 4TOZA 4ESBA 3BDDA 2JTVA 2W57A 5E8GA 1KYZA 4EXLA 4CDGA 3WGHA 2OWTA 5TP9B 3CUQC 3CVGA 5CI5A 2XXQA 5BS6A 1F4KA 2EJRA 3G3IA 3ECOA 4TV7A 3RDIA 3GBBA 3PPOA 4G8MA 2DP8A 5H8FB 2ZNSA 2X26A 3P9CA 3HTSB 1ZYRF 1FTJA 1XCBA 3Q26A 4AWXB 3TTKA 3U93A 2ZNZA 2XD2A 4FEDA 5D4SA 3RTFB 2RC9A 2ZNTA 2QQ9A 3G7WA 3IHUA 1FX7A 3U2RA 3FHZA 2V1UA 2AL4A 2Z99A 4EUOA 4HF0A 3R26A 3FX3A 3O6HA 3AAFA 1FNNA 1IN5A 4FT8A 2Y7RA 2GA2A 2GFEA 4G2ZA 1BIYA 4R74A 4RK9A 2HKOA 2DW4A 5E1XA 4JWOA 3E6BA 5LRSA 4RGUA 4ZECA 3P7IA 1ZLJA 5L9MA 1BC7C 1MPBA 2NNNA 4KYEA 1K78A 3SETA 1X3UA 5ERIA 3WTXC 4KNYA 2XAGA 4WEDA 4ZEIA 1Y9UA 3EPEA 1OYYA 2G9WA 1M5EA 3OO6A 3PMVA 5ILUA 3V7SA 2CMOA 4I02A 4ENJA 5EHMA 5K5OA 2V84A 2UVJA 4ZZAA 3WODF 2O68A 2A07F 2XAQA 2Z8DA 3ODBA 1AOVA 1WI9A 2RC7A 5AE4A 1GGGA 3O28A 2RF1A 2P5KA 3MPLA 4YKJA 2DWJA 2MLGA 3E3VA 3R7XA 4IJAA 3OELA 4ZE8A 3U94A 2DFIA 2FOKA 4BAYA 4GL8A 3C4MA 4KICA 2NYXA 4G68A 5A2QK 3FVNA 2C6YA 1QQIA 3PMXA 5ICTA 3JTGA 2XV4S 3CFZA 1B5HA 4LJZF 5TJJA 4L9JA 1JW1A 1LJ9A 3JW4A 1QGPA 2DK8A 3K1MA 2DWIA 3ZMVA 5DCFA 1KU7A 1JGSA 2IJLA 1TTYA 3EETA 2CYYA 2DE4A 2M87A 2FXAA 4OIOF 1MRPA 2XAHA 4P0GA 3SKPA 1I5ZA 1OR7A 2EV5A 2ZKZA 3LWFA 3CRBA 3I54A 2UVGA 6PAXA 2FA5A 4QSDA 3C3WA 1MJ9A 3GUDA 3L2CA 3WTYC 3V8JA 4KCCA 1B9NA 4JBAA 4KI0E 2NRAC 2UXXA 2QBYA 2QM3A 4NEDA 2XX8A 2DTRA 5JTYB 3NRVA 3CSGA 2UVIA 3TTRA 2ABHA 1HW1A 5DEQA 4CHUA 2IEEA 2PG4A 2Y0MA 4IXAA 4IY6A 1NNTA 3M3KA 1NL5A 2DAOA 4RS8A 1YPNA 4KN7X 2F5EA 1TW3A 2XXIA 1UB9A 1SI0A 4XIGQ 3PUZE 3GW2A 2F5XA 2R6GE 1JVYA 1IRFA 5CJ9A 1FBQA 4AIKA 4PDKA 2PBWA 3TCHA 4LLNA 1ZG3A 5I59B 2EFWA 4F3PA 4R8HA 1YFHA 2YPRA 3ROUA 4I7HA 3PUXE 4H6DA 1M5FA 1O3RA 3KOSA 5DCMB 4PFTA 1SW1A 2DWHA 4BDLA 2Z8EA 2RC4A 1I6BA 2FSWA 5CMMA 3OEMA 4NF5B 1AH5A 4M6YA 2QWWA 2RDPA 1FLIA 1XVXA 1NNPA 5FFZA 2WKYA 1BBYA 2E7WA 1VTNC 4GWOA 1MGTA 3SQNA 4M71A 4O3BA 1G3YA 3C9HA 3WAEA 3OV8A 4EM0B 1B9MA 3RPUA 2OZZA 4YFNF 1ZRFA 4U22A 1S9TA 2L01A 5K1YA 3TPAA 4HTGA 1IUYA 2V25A 3W9WA 3DLNA 4IO2A 3M3LA 3RIRA 1AOYA 4R6KA 3GFJA 4F29A 3L00A 4WEPA 3N97A 3LQQA 4O3MA 3QU6A 4HAMA 1MDP1 1P1NA 4BH9A 1XMAA 4N0BA 2DQRA 4F31B 2W25A 3P9KA 4L0YB 3ML6A 1F1ZA 4EJVA 3SESA 1Y20A 2H4IA 3BJAA 1SBPA 1MXUA 4CO8A 2DO7A 3GLXA 3W6KB 5FD6A 3PPNA 4BLAA 2ONSA 1GTKA 3K2DA 2ANJA 3IRRA 2F7BA 1ZREA 3T9VA 1PB7A 4PFYA 3C34A 1HW2A 4F1VA 3RI4A 2O61A 4IB2A 4MQ9F 2JZYA 1WVJA 1ZKBA 5BUUA 1UCRA 3HPIA 3V89B 3GXAA 3V7RA 2ZMBA 4LZ7A 1L3LA 4WXCA 1IN7A 1RKMA 4M73A 2VBZA 5LBQA 1N84A 4GCVA 4X1DA 4WX9A 1P1UA 4IGTA 3CFLA 5L3FA 5TPAB 2VBXA 3R60A 4DQ2A 3SXYA 3OENA 1NNKA 3W15C 1PP8F 4QSEA 2BE5F 4YAHX 2ZNYA 4WK8F 3F72A 3CR9A 4UV8A 2STWA 1YCJA 4KDPA 1KQ0A 1V4RA 2Q9TA 3L6GA 1WKMA 1FQEA 4OERA 4Z2YA 3TELA 2Q88A 1H0MA 3CDHA 3JV9A 2M45A 4ESXA 1DPPA 4U0WA 4OIPF 1B5JA 4XKRA 3M8UA 4JBZA 1WODA 1ZAOA 2ZMEB 2ALUA 1DPRA 4MGRA 5F6FA 1O7TA 4P5OA 4PETA 1R5HA 4M9XA 2V9VA 5J8FA 4EGZA 3E5XA 1FYKA 5CVJA 4RJZA 3TQWA 1BM9A 3MWBA 4MTDA 2VN2A 4OWDA 3TEPA 5IT9Z 2GWRA 2YX4A 3I59A 2RNJA 2L4MA 4NWDA 3DPLC 1IXHA 2LAOA 1HKQA 1L0OC 1MD0A 3CLOA 1RUNA 3O3KA 1N3WA 3Q28A 1B4ZA 5CVRA 3LA2A 4O6JA 2DVCA 3BP8A 3FMRA 1OLAA 1JHFA 2Q2AA 3TCGA 2IP2A 3RN8A 3PPQA 4HF1A 2QRYA 3QK6A 5CYVA 2ZO4A 3NQOA 4EF1A 1R36A 1MXZA 5H8QB 3SEVA 3SEWA 3VLWA 3DF8A 4S05A 2W7YA 4R73A 3I4PA 1VE4A 2VC1A 2HFHA 2ZBKA 4R72A 2XAJA 1OLCA 3E3KA 1MZBA 2HQRA 1QVSA 2V6CA 1H76A 5KK1A 1FQDA 4Q48A 4FORA 4GFRA 1MXVA 4UA8A 2DK5A 5I2NB 4B8XA 1ZARA 3G3KA 1OPCA 3T9UA 3LC8A 5I56B 1J75A 1URGA 1B40A 2D1HA 1ZTYA 2HAVA 5H8NA 3VV5A 2PVUA 3OO8A 2QS4A 2Q0OA 2RCAA 3B02A 1PDAA 4A5MA 1J1NA 5F7VA 3PFIA 1S3JA 5EEGA 4HLYA 4KQPA 3D4CA 2DQLA 2XXTA 1N0TA 2D5WA 1MS7A 3U1DA 2UWMA 3F6OA 1OMPA 3F6VA 1UHMA 1HKSA 3K4UA 3OSQA 4ESFA 4P9FA 4G8HA 4OVJA 1U5TB 2RKMA 3MQ9A 3MZ1A 1D8KA 1UTBA 1MJBA 2F6GA 3KJTA 2ADUA 3IO6A 4G8NA 1DSNA 3G3FA 3FM3A 3HOTA 1J59A 3MWMA 2FBHA 3S2WA 4DIGA 3GFIA 3HV1A 2F5DA 3DP7A 4LATA 4U0VA 4JB7A 4YB6A 3N94A 1PUEE 1Y0UA 1R23A 3ECRA 2YX7A 3CO6C 1LDKB 4LK1F 3F23A 4WXDA 2K02A 3T0YA 3IAZA 2P5LC 1LCFA 1W7PA 4BDRA 3TODA 3KBRA 4U88A 4XLPF 3E6CC 1QUIA 3RUMA 2CW0F 4NTLA 1ZN2A 1JHHA 3I71A 4CZZA 1MDQA 2IA2A 4Q47A 5HPQA 3E5UA 4F7ZA 4O5VA 1HSLA 5J1DA 1URDA 5AA2D 4LQ2A 4P0IA 1S7YA 3C35A 4TLMB 3D0SA 1F9NA 4QFOA 2ZCWA 4GGGA 1SD7A 2HQNA 3CUQB 3TOBA 3I5UA 4LA9A 1FTLA 5BQTA 2EFNA 1XDUA 5HBCA 4POWA 1BOAA 2JSCA 4KD5A 2FF4A 3KETA 4RK2A 2P6SA 3FMQA 1S7AA 4ENMA 3EF7A 5LLQA 1K78B 2NNYA 5LGTA 1IF1A 2HXWA 1YW7A 1K6OA 3ELKA 1BI0A 3B6TA 2H98A 2DSFA 3FXUA 1GXPA 3K6XA 4IO5A 4M6XA 3MPKA 4Q8RA 3WE2A 4R2BA 3IB1A 5LHHA 4IRIA 5BOXA 3VOEA 4H8JA 4ZYHA 1HKTA 1K79A 4GQOA 4RB0A 4GXOA 1PEBA 3UGWA 3SZPA 4IO7A 3EQLF 1LFHA 2QS2A 1LBBA 1NNFA 1IXIA 4PE5B 1Y4CA 1I1SA 1O3TA 3HIFA 2RCBA 1D4NA 1D5VA 1ZRCA 3JAMZ 3HRTA 2V3QA 4PQJA 2Z9OA 4GD5A 2OK2A 4THIA 3H92A 4ELOA 4Q30B 2MBFA 4KFQA 1IEJA 4OENA 3V83A 4MHGA 3TYHA 2EWNA 3PUWE 4ECFA 1BIBA 1SW4A 2CFXA 3TKYA 5JR3A 1AIVA 2STTA 3C36A 1YLFA 2BGCA 3KE2A 2HFBA 1Q1HA 4G8XA 2Z22A 2NAZA 3K02A 1B59A 5ICGA 3H06B 1FBSA 1YIOA 3DQVC 4QFNA 5AA1A 3LBSA 1Z7UA 1FC3A 2VOZA 2K4JA 2I58A 1ATGA 2DOJA 2HQ0A 3TCFA 1Z7NE 2O6GE 3P7NA 1SQYA 3SERA 1KU2A 3MC2A 5TU0A 3TQLA 4DCYA 2QBYB 4EJOA 2THIA 4QSCA 4G7OF 5DUIA 1T98A 3GVAA 1SW5A 2DLLA 2QLZA 2L02A 1MQGA 1USSA 1Y1MA 1LB8A 4L9TA 5CC2A 2P6TA 3GFLA 2IA0A 2R7FA 3R4KA 3ZMSA 3WTSC 1B0LA 3L6HA 1TFAA 2DXYA 2QS3A 4HLXA 1B6HA 4KN4X 2ACJA 2D45A 5DUKA 3PPRA 1B1BA 5CLSA 4NE4A 2O1LA 1ZBMA 4RAZA 1KWHA
chains in the Genus database with same CATH superfamily
4IOCF 2D21A 1O3SA 4KIFA 2XWIA 4P96A 1XSXA 4KMUX 3ZQHA 4ZJZA 1DCUA 2ZFWA 4LG0A 3B50A 3ASOH 4DCXA 4M72A 2V4JC 1QUJA 1VDWA 4HCWA 4R6YA 3S9MC 3EPZA 4HBLA 2GAUA 1B1HA 3TDUC 4XLNF 1I6XA 3CMAI 5ESYA 4MIJA 1LLSA 1Q9DA 2FYIA 4IL6C 1MH3A 5D5VB 4PK4A 5C4XJ 4YKPA 4DLDA 2ME6A 4EXKA 3G3ZA 2Z3YA 4HZFA 1HSJA 1WCMJ 2W1OA 4BYYA 1POTA 5IT3A 5IT9K 2B3FA 5I58A 1GVJA 5DYHA 2KDOA 2EPFA 2QZ8A 3GF2A 2WBDA 2JN6A 2E34A 4GWXA 1MMAA 3HUGA 3GX4X 2QUFA 1IMBA 1B3HA 3IX1A 1A36A 2PT2A 3H6VA 2VODA 2I49A 3GBGA 4KIGA 3FXOA 2DS9A 3K0LA 3O97A 1ONVA 1UTHA 2I4CA 3UK4A 4OVQA 4MQVA 3J7YJ 5FTHA 3CMMA 3IO4A 3W3CA 4R79A 5D4RA 1NHAA 3V8LA 1JP4A 4F3SA 3TEDA 3CUQA 4BQOA 2FX0A 2HPIA 2HEUA 5FKOA 4JSOA 3ZQCA 3TUSA 2H9BA 2J5OA 4F52A 1SAXA 3H3ZA 3FXQA 4PFUA 4QTRA 2HNHA 2GRVA 2JUGA 2JVGA 4HOBA 4O94A 2HEOA 3GTJJ 3QYTA 1ETWA 3SDGA 3VYSB 1EH3A 4H65A 4U7DA 2VQLA 4YFXF 4U87A 4A12A 3BIGA 2JJ7A 3BJOA 1YG2A 4ISUA 1LE8B 2XWKA 4LZ5A 3Q9SA 1K7AA 1DGWY 4XKVA 3C2HA 4UVCA 2E1OA 1R6RA 4A3MJ 3TTNA 1T38A 3BTIA 2QEXI 2BOLA 2E2JJ 2D5VA 3S9LC 5FO5A 4YICA 2QMWA 1V5EA 2EZKA 4FIMA 5H8HA 5H8FB 1R1NA 2OZUA 1E3PA 3A0BC 3KP7A 4I0AA 3ZQLA 2XX9A 2ZYOA 2R8TA 2KLOA 3MVWA 4FEBA 5IZ3A 1DBZA 1LQ1A 3FJMA 1DPUA 2VE9A 1IV8A 3K4MA 2F3BA 2XXXA 3RZOJ 2R7TA 2BY3A 2H94A 3A01A 2X1EA 3F22A 2DTZA 4C9YA 5EG0B 1IUDA 3F8CA 1D1AA 1R00A 4UB6C 1GHCA 3HHGA 1QW0A 3EQ1A 1W4MA 3MKZA 1OMIA 4GBVA 1FPFA 2GIZA 3N05A 2MC3A 3L7WA 2ZC2A 1U9NA 3BG3A 3DEWA 4LIVA 3I53A 1I6AA 3ECHA 3CC2I 2A3SA 4GYIA 5EQ8A 1T0KA 4DXUA 1O7LA 3LSWA 2VC0A 4UHTA 5F04A 1FOKA 3TAJA 2OA4A 4YMAA 4G7ZF 1FT9A 3FJ7A 2FQ3A 4GX6A 2CUFA 2NVXJ 4ZEFA 2HQAA 1IW7F 2PYYA 3ZN0A 1HDDC 4D5CA 3T93B 1SMTA 3QWLA 1Y0NA 1YZ0A 3I5OA 3IL1B 4UUTA 2IRFG 2DA7A 1IITA 4LFUA 2O6AA 3QPTA 2PX1A 1PB8A 2IS4A 3ZSFA 2QVOA 2AQEA 3WTWC 1P2FA 5DS9A 3CF5F 1LVKA 2RC8A 3S1RJ 3FUZA 5CBSA 4I8CA 2RV8A 5AONA 5IP7J 2ZZVA 2VT3A 5IYDJ 3KZIC 4F18A 2F7CA 4J01A 3JRDA 3MQ0A 3F8MA 3GTQJ 4C1UA 2WA0A 5L9OA 2K7LA 4NC8A 4EEFG 3DU6A 2JPBA 3EUHC 2RNGA 4OQOA 5KZTA 2LMDA 5DV5A 3QUJA 1IXSB 2DXIA 2Z8FA 4LZ8A 3DKWA 3RPLB 5FBPA 3O6BB 1SVOA 5LRRA 2OX3A 2MKZA 3OYDA 3JRBA 1SFXA 1LBCA 2XX7A 4UV9A 1F36A 2IXSA 3IP4B 4E6KG 3KEYA 4BXUA 1IAWA 1FQAA 4GO1A 1V55H 1G59A 1B05A 5KDTA 1EYKA 4MNPA 2E35A 5K5QA 2XXHA 3MZ9A 1M5CA 3LA7A 3WG9A 2WY7Q 3QMFA 4EQ7A 2HYFA 3C2BA 4FE8A 4KYWA 4L0ZB 1M5DA 4GF8A 2Y7KA 3MZHA 4XOTA 1FYMA 4YB7A 4MEYF 3TDZC 4MCOA 3QQAA 2FNCA 5ELVA 5K2XA 2A68F 2DA4A 1LFGA 2LKPA 4O7IA 3I59B 4X1BA 1IDYA 5JHUA 1IIWA 2R93J 4JWXA 1OCRH 1IXGA 4PDDA 1JKRC 1IQ7A 5F0HA 2REJA 1B3LA 4NG7A 2F35A 5HLHA 2XUBA 3HOXJ 2MABA 1LAHE 2Z23A 1TQMA 3BTCA 1ON1A 2L9VA 3OOPA 1XG1A 3FBIB 1Z6RA 2FOWA 4M3FA 2D3IA 3A3CA 1R58A 2DE3A 1WJBA 3Q25A 5FJ8J 3PSFA 2Y2ZA 2HYGD 1QHGA 5HOOA 4M9ZA 3EUHA 3H6TA 5DTDA 1T0FA 2K3PA 2W48A 1FOXA 3E13X 3ABTA 4NB5A 3VXCA 3M9AA 4M6VA 4E7SA 1XTAA 4JX4A 4YEJA 2GXAA 3VLVA 3LUYA 3V7CA 2DFFA 2VE8A 3NEUA 3S4UA 1HW5A 4L5EA 2B3BA 2K27A 2DMNA 3AG2H 3ZMDA 3OL4A 3OYEA 2OUMA 3GCMA 3BOQA 4G6QA 1XCVA 2WC2A 4GX4A 5BWJA 1IRXA 3OYFA 3I58A 3DKYA 4FBPA 5HS7A 2VQHA 1LNWA 4RMNA 1N7WA 2R9JA 2F78A 2A6TA 4XONA 2ZXJA 1SD6A 1IO2A 3L2VA 1HDPA 3BROA 2FNPA 2HVQA 1T6SA 5EEAA 2W4SA 1B0HA 1BP5A 3HOWJ 1MY3A 1YXIA 2PT1A 2Q2CA 4IO6A 4OWRB 2MW8A 3LSPA 5JHFA 3L1PA 1R9TJ 3DBRB 3HOSA 1Q1KA 4ZE9A 2X48A 1AWCA 2LYCA 4KFCA 1XMKA 1BC8C 4UACA 3QIMA 3KZYA 2X1DA 3D5LA 1ETVA 1B2HA 3FZVA 1FJ9A 2H1KA 5IZZA 1ZR4A 1STZA 3J7AO 5I2KA 1X58A 4ENKA 1MY1A 1OQHA 1UFMA 4R9GA 5H8NB 3PFYA 3FV1A 1E2XA 2LH9A 3JAMK 1REPC 1VQNI 4YFKF 3C32A 1JKOC 4LG3A 1FOWA 3JRGA 3UP9A 1EU8A 2ECCA 4ZYEA 5HDNA 4GYGA 4ZTFA 3B6WA 3T22A 2HQ5A 2VKEA 3DELB 1NV0A 3LSKA 4JWYA 2WTEA 1VQ9I 4PGPA 1MBHA 3LUZA 4KJZA 4UXNA 3DTIA 4FX4A 2IGOA 3ZR8X 4OIQF 2RVCA 4H1XA 4MEVA 3O2PE 1O63A 2YR2A 2IT0A 2XKOA 1A54A 1USTA 4Q8RA 3VYRB 1MMGA 2F36A 4AVPA 4HPQA 4F91B 4WKMA 1QKAA 3VVEA 5HVQC 2AS5F 2HZTA 1UTBB 4YB5A 3FVGA 1TQIA 4FJPA 3ABKH 1BW6A 3PO2J 1ETKA 2HXRA 1NH8A 1EZ9A 2PFBA 1H44A 4AS4A 1L5TA 5FLVA 3BG9A 4IVNA 1K6YA 3RQ4A 1B3EA 1UQWA 2OZ6A 2DJNA 1ANFA 5I3SA 2OF7A 1IN8A 2CUEA 4JK1X 1ZJLA 3OOAA 4IQ4A 2EZIA 4XRFA 1N3XA 2W84A 3LAJA 2V79A 4BHCA 1TW2A 3ZXSA 1UHWA 1ZRDA 1WH5A 1LBZA 2M8CA 1YAEA 5FKMA 2W85A 3QPHA 4J00A 4DBRA 4CGZA 2QL3A 4HV6A 4Y15A 2R71A 3RKYA 1S7EA 2LFBA 1LEBA 1TLHB 2QPQA 2BY2A 4IHXA 4MH5A 3RT6B 3SEQA 3M8EA 3J81Z 1XVYA 1LGBC 1PUFA 4WXHA 5ITPA 3QUFA 2NUVA 2OBGA 4OVPA 2FD5A 1W7PB 3HSFA 5GAHJ 1YW8A 5CVIA 2VOOA 1Y8RB 1SAUA 2CMPA 1MJAA 3L2QA 2HHMA 3NOHA 4F93B 4NQ8A 4BUPA 4NHJA 1UIUA 4QHQA 4WF2A 1RDXA 4YRVA 3B8BA 2F34A 1JT6A 3E6MA 3MVPA 5LOMA 3FIRA 3E5QA 3T8RA 2COMA 1D1CA 5EQAA 4X48A 4RB3C 5ED4A 2V6EA 2PCRA 4DBQA 1YJWI 3FKIJ 2FUG2 1NV3A 2DPUA 1MPCA 4HX8A 3B7DA 2X7QA 4IF4A 4DXCA 2CRGA 3JRIA 2ZFUA 2FA7A 1XB4A 1W36C 3KSJA 2X51A 1LBXA 5C44J 1OVTA 2Y5KA 5A5LA 4JSDA 4QF9A 2JVHA 4E7IA 4OMYA 2G93A 1MBFA 4ZEDA 1LCTA 2A6EF 2R3SA 3P9IA 4XLCA 4RYAA 5E18F 3V8XB 3AKZA 1ZELA 3OYAA 4X8RA 3EHTA 4P11A 2XWOA 4HE1A 4RGRA 3E7LA 5H8SA 4P1WA 2IGKA 4PZJA 3PGFA 4CSWA 3RLFE 4RGSA 1PP7U 4H67A 2JPCA 3TGNA 4PFPA 3WU0A 2FU4A 1B8IB 1D3YA 4XXUA 3S2VA 2E1MB 3COAC 2L5VA 2VP1A 3LR1A 4OFJA 2CV0A 3S9EA 3MKYB 5ILSA 3B6QA 2L7KA 3M3YJ 2CEXA 3HHFA 4LUBA 5M2VA 5L9SA 4GWYA 4OA4A 5DVFA 2NVTJ 1RZ4A 3BG5A 4XSZF 3QPSA 2QYOA 4XQFA 4AIJA 2MH9A 4HX4A 2I0BA 1XGMA 2Q8KA 2CGPA 1FQCA 3CP2A 1VQKI 1FSHA 1XC5A 4BJTA 4LLLA 1RNLA 3S1NJ 3S1MJ 2ESHA 4EJWA 5KCMA 2BXZA 1NV6A 2P3VA 3K1NA 1LFIA 1I69A 4KT6A 4NF0A 3O2AA 5KVRA 2DOAA 5HS9A 4BEHB 1XPXA 4WXJA 4HSRA 1A5JA 4ZEBA 2DE2A 5CMKA 3IOTA 3CZ6A 2VQGA 4A0ZA 1A8EA 4RA1A 1XGOA 3JRFA 2X85A 2FMLA 3GWZA 4FQGA 1H89C 4MBPA 5K7HA 3I4NJ 3BPXA 4AM3A 2PMZN 5M5XJ 3K1PA 2FBKA 1KA8A 1BL0A 2JA2A 5IP6A 5D5UB 1MQHA 2EZLA 5A5XA 3K6VA 3I64A 1LB2A 1HC8A 1YS6A 1X2NA 2IBDA 4N81A 1HSTA 2V9PA 3RTRA 1LVAA 1E17A 1US4A 4R9FA 3IKVA 1QPIA 2O03A 1LFUP 4DI3D 2DDKA 2JA6J 2ISYA 1V5GA 3N26A 1JT0A 1J5YA 3BWGA 3HRUA 3PL8A 4BQAA 1G0IA 5AA2A 1FWZA 1URSA 1Z7LA 3Q5FA 3R0AA 3M4OJ 4RXLA 1BJAA 2OD5A 2VUMJ 3W6JB 4MMPA 4L9VA 4N91A 2DXRA 4BDMA 1FPDA 4ELPA 1NH7A 4LB6B 4OIRF 2BVLA 5KNLA 1WHUA 2F97A 3MFKA 3CD6I 5EYFA 3S14J 4F22A 1JE8A 2RGVA 4GOTA 4O8MA 4DOZA 1R4MB 3A4CA 1ZIUA 2XKPA 3HSEA 4A69C 3OXNA 1RYOA 3ZMUA 3MP6A 5CPRB 5ICEA 4N4NB 2HU9A 4HA8A 2HCAA 3K10A 2D2WA 2R7XA 4E7JA 1XOCA 4DDDA 2VONA 5FKLA 3MZBA 4Y7NJ 3KFMA 3N6TA 4HNTA 1Y56A 4Y52J 2YSRA 4UVBA 2O0YA 2P5VA 2I48A 2M4GA 4KPTA 3BY6A 1XC1A 4KYSA 1V3FA 3LNQA 1Q35A 1OYIA 2FEZA 1FZPB 1ZGAA 4M74A 3F3XA 1YTVA 3HL2A 3AXFA 4OESA 4JX5A 5T3JA 1CGPA 2CSOA 2Y7IA 4I09A 1MDMA 3KCCA 1VQ7I 1FYLA 3MZYA 1F9BA 2F3DA 4PP0A 2CV2A 1WI3A 2DFHA 3DV8A 3HG9A 3OS1A 1OQGA 2G29A 4F2OA 2XF6A 3MBPA 5E20A 2A5SA 2VBYA 2XRLA 1RUOA 3USDA 1YTYA 2FBIA 3MVYA 2JT1A 3K70C 5F27A 2ZNUA 1JKPC 3IOWA 3AG4H 1TQPA 3FVOA 2WY8Q 4G61A 2M5WA 1D9YA 3VVDA 4PCQA 3VB2A 3O6GA 1TL8A 1GLNA 3QOEA 1WJ5A 2IPQX 4LG0B 3IH3A 1MSFC 4FATA 1ERDA 1JQFA 2Z1DA 4Y4RA 1WJEA 2L0KA 2CFOA 4OETA 1N75A 1ZGWA 1FJ6A 3WU1B 4E0XA 1IMFA 2MGQA 3FASA 1B4HA 2Y9YA 5EEHA 5E3MA 1FP1D 1T2KA 2ETHA 5L3EA 5GADJ 2HDDA 4ND9A 2DT6A 2F48A 2IAIA 2B4LA 2ZMEC 1US5A 2O84X 3IFCA 2CQQA 4M4GA 1RR7A 3PUVE 5I58B 3R0JA 4LVQA 3A09A 2DT5A 1RESA 1KQ8A 2H8WA 4CICA 4ZS9A 4E7KA 1BN5A 3UR3C 1TWAJ 3HUGB 2X9DA 3NAUA 1VQ4I 4A3CJ 3LSLA 4JDFA 3T1BA 3BFUA 5E8IA 5F1RA 1FTKA 2M8GX 1XT8A 1LAFE 4A3EJ 4OU0A 4IO9F 1JGGA 1X3WB 4X04A 1WJDA 3IWFA 4XN3A 5FKKA 4IHSA 3FBNB 1MY4A 3OEKA 4LONB 2BYVE 1TZLA 1UTHB 5D6EA 3VLUA 3RQIA 1IZ1A 3MAMA 2QQBA 3OMYA 1SFEA 4FE4A 1FW0A 3MJNA 2H5YA 3C33A 5F24A 4XF5A 2XDVA 4X1EA 4ZYGA 2XGDA 5HLGA 1IC8A 1BK4A 1VQMI 2XIGA 1U8RA 5M3MJ 2HZKA 1FPLA 3DP6A 2ZJRF 1Z7ME 4GRIA 3N6UA 4IZZA 4GLIA 3G3HA 2AO9A 2HDCA 4KR5A 3CCMI 2N8GA 4YELA 1IMDA 4EVIA 2IA1A 4BHPA 5LHIA 2EQRA 1T08B 2WAQA 4YIFA 3GTMJ 2E1CA 1XI6A 3GZNB 2FRHA 2GHBA 3IC7A 2QVUA 1ETQA 1NI9A 4YU0A 3LA3A 1P6RA 2HXIA 2WX9A 1HSEA 1DU0A 3U8QA 3ISPA 1CE2A 3GLBA 1SI1A 1SD3A 1VSOA 3PIOF 1Y1ZA 4K2EA 3IB0A 4B3XA 3G1LA 4EM2A 4EF2A 4PJ0C 1E0EA 3KZZA 3TO9A 2P7CB 3FV2A 1LEAA 1R71A 3HN0A 4A3IJ 4XORA 1PVEA 1SMYF 5FB2A 1QPMA 5HM4B 3C18A 3QYFA 1B46A 3TTMA 1OKRA 2QJEA 3DPTA 2GA1A 3CCQI 3BR5A 2QSXA 5ILVA 3U72A 4D9JA 2O5RA 4FX0A 1H45A 1YJNI 5H8HB 2IS6A 5HDKA 3KGCA 4RPNA 5IAIA 1EV7A 2XAFA 1WWXA 2BJIA 1G3SA 3K2AA 2CV1A 3H6UA 2TRTA 4NQWA 4TLLB 5IZ3B 2P0SA 4RDUA 3T96B 4BDQA 2M2EA 1EH6A 1EJ9A 3HPGA 3HM5A 3ZMZA 4E7LA 2QQAA 1Y3QA 3DP8A 2K3FA 4N07A 5F1QA 3A01B 1X1AA 2EV0A 3HCQA 2IVMA 3CIJA 2GLOA 2XASA 2V26A 4A5NA 5M3FJ 2GH9A 3I55I 4NF8A 1UIVA 3IJOB 4C30A 1KYWA 2D1VA 3FF5A 4IQJA 5CMBA 1VQ5I 1B7UA 2B7EA 2GXBA 2XD3A 5DD4A 5JFRA 3BPVA 4PGGA 1H3DA 3LV0A 2L2OA 3ONMA 5J1UA 4RB1A 3V5AA 3RQTA 3K2ZA 2NS0A 2YUSA 1FRPA 4XRSG 3V8KA 1FPQA 2OJTA 2B9SA 2Q89A 3OIOA 1RDYA 1QNTA 4AD9A 2KJCA 4C2MJ 2E2HJ 2DI3A 1JW5A 3HYIA 1MG1A 3CCSI 1DUXC 5ITOA 1K9YA 3K6WA 1UELB 3MKWB 4RM3A 3UIFA 2HOSA 2RINA 4C3JJ 4Y3OA 4A0XA 1NKXA 2V3TA 5I57A 2V1DA 3DEUA 4PFIA 2DWAA 3H5RA 4DE8A 2JA5J 3P5JA 3C7JA 4JVIA 4HQMA 1EA3A 1JVXA 5AIPA 1LBYA 1ODDA 1DMBA 1SVMA 1FBHA 4NF6A 2PMSA 3H1CA 4KUMA 3RKWA 3KLNA 3LQRA 3S1QJ 2NXOA 4QFPA 2ZYNA 2DDAA 2KPMA 4BKXA 3OS2A 3DKXA 1R1UA 3RYPA 3G73A 1D0XA 4E4HA 1WJCA 3H3UA 2HOAA 2O69A 3M8JA 2XPWA 1X3ZB 2P8TA 3BR0A 1A40A 1Y3PA 4PAKA 4TQUQ 4OMZA 3EHSA 4NMYA 3ZCOA 3TOAA 3J81K 1VQ8I 2ZXIA 1BA5A 1AU7A 2LREA 1IMAA 1LBVA 4LGWA 1CNQA 1E3OC 2HAUA 5IGAA 5GPAA 4RAYA 5LEKA 5KDTB 1RETA 2P4WA 4P9UA 1RPWA 3A0HC 4ZZEA 1WZ2A 5FHMA 1V54H 3FIWA 5HS8A 4ELRA 3CTAA 5LEJA 3U92A 3CJNA 1EYIA 3E4RA 4IO5A 1WSUA 3JTHA 2CQXA 1VZ0A 2H6CA 3PNVA 3BKIB 1LDJA 2DBBA 4OINF 2RKHA 1B72A 1JETA 4G77A 3SJMA 1BW5A 1Z1DA 4MLQA 3RJPA 3GO5A 3ZQIA 4GIZA 3JSOA 3TDJA 5LTCA 1I39A 3HEFA 1NK3P 1S5LC 4OEVA 1YW9A 3EDPA 1RIOH 4ZTJA 3W2AA 3IL2A 3KOTA 4GWUA 4EM1A 2ISZA 1X4OA 1KGSA 3GFMA 1GR2A 4H0EA 1NFTA 3E1SA 4H5GA 2QCOA 4LD5A 2OCCH 3OYJA 1ZLKA 1TWFJ 2ZYMA 3KP3A 3BFTA 2OCUA 4CUGA 2LOOA 1A99A 2EFPA 1O64A 2VKVA 3GZ5A 5ICCA 4LK0F 5CVUA 3TQNA 1OLTA 2F5FA 4DZJA 1EYJA 1OYWA 1GXQA 2K4BA 2XC7A 4PAIA 1G3WA 1ZHFA 3SFZA 3DP4A 3R6UA 3K01A 3K9TA 1DTZA 4F1UA 2HKXA 5LFAA 3DBLB 1H9TA 4A6DA 2K9NA 1AL3A 2ZXTA 5HDGA 5TRDA 1SANA 4P56A 4NWCA 3KJ7A 3UN6A 1W5TA 4PBHA 3FXJA 2FJ1A 3ULQB 1Z21A 3DPUA 1A35A 1ZK8A 4DI4B 2CO5A 4XKQA 2A6HF 3VYTB 2OQRA 4XKBA 1PDNC 2KIMA 4XOPA 1J9IA 2VPOA 2ZYKA 4N6DA 4R6HA 4MFEA 4OEUA 1HBXG 3TMGA 2BY0A 4ENNA 2WBBA 2ICWG 2DYXA 4PJLA 3VEPA 3FJGA 3IB2A 3LSJA 4KA4A 1SYHA 4I62A 4R75A 4PJMA 3RPQA 1HQCA 4XM3A 1S50A 2ZXHA 5D6FA 5L3BA 1NV1A 4I0BA 5I2KB 4JX6A 2H27A 1B58A 1CB6A 1JNFA 4I01A 4ON0A 4H8IA 2O3FA 3EYIA 2EV6A 5E1WA 3HSTA 1P7JA 2VHAA 4XR6A 3IR1A 1B9JA 1LB9A 4P55A 1B7HA 3Q27A 3W2WA 1WFXA 1SVLA 4BHBA 1HLVA 4LN5A 4PDHA 4IO4A 4PF6A 4ZZDA 5ICQA 2NVYJ 3EN3A 3IORA 3L09A 1MQJA 3ZMTA 3T0JA 3QP5A 3V42A 1MM6A 1X1CA 1G3TA 2J5PA 1GV8A 3QAXA 2OPTA 3VPRA 2GZWA 5IP9J 1GT0C 1Z91A 2M7BA 2Z33A 5DVIA 4ESWA 1VFEA 3WAFA 2XVCA 3M7GA 1KU9A 2OAZA 4QLCU 3J80Z 2YPNA 2A05A 3VFZA 3W9VA 1B6AA 2DA6A 3IRQA 4G68C 4MNCA 4LP2B 5BMZA 2ID6A 3OWTA 1EZOA 2BV6A 5EZHA 3H3GA 4KISA 3FATA 3ABLH 3BR1A 4BE2A 1J7KA 2KIUA 1U3EM 3DEEA 3DXJF 4PGHA 1MBEA 3W2VA 4RGXA 2ZZWA 3E97A 2R5ZA 3ILUB 3R6SA 2CZLA 3EHUA 4EQ9A 3EKIA 2PJRB 1YS7A 2CQKA 1R4NB 1CF7A 3HDDA 1SFUA 3OYKA 2XPUA 2GQQA 3IOVA 3IWZA 1TT1A 3OOUA 5C4JJ 1T39A 2DPDA 2WEFA 2LD5A 3K00A 1DTGA 2LNBA 1OR7C 1IRGA 1U6GA 3I0TA 2H8RA 1ZGJA 3PNTA 5JVTA 3PQKA 4L5IA 4CYCA 4NF4A 2Y48A 1Z0XA 5EYGA 2P7VB 4OYVA 5JEIA 1FBUA 3OYGA 1PUFB 2X1CA 4K3FA 4HDVA 3FVKA 4MF3A 2QSGX 3L9FA 4KT5C 3CUOA 1TXFA 4L18B 2ZJQF 4OVTA 2GHAA 3WTUC 2NOOA 4NC6A 5B1AH 1USYE 3SZTA 3WGIA 3KX2A 2AIXA 5CBRA 3B6AA 3HKZN 4AVZA 1UZCA 3WTTC 3M07A 1VFDA 5CRYA 5IY5H 3C31A 4XN0A 4GXSB 1K9ZA 2Q8JA 1ZQ3P 4U4SA 1TT0A 5DEXA 1VFCA 1DP7P 3JSPA 4B3AA 4QSHA 2LKXA 2XWVA 3U1OA 5IKBA 3KN8A 1JW4A 2MA3A 4N4UA 3S93A 5KCJB 1FBEA 4N13A 2V3UA 2B0LA 1XGNA 1YX5A 2GOMA 5F08A 2VI6A 3DTKA 1YHQI 1YO5C 2VASA 1A31A 3LFKA 2W82A 3IAS2 4GFBA 5E17F 4GXAA 1I27A 4XKPA 5FHOA 3PO3J 1IN6A 4J19A 4F39A 1I1GA 4KHZE 4P3LA 1G6NA 3CCRI 1FQFA 1Z6TA 1QBJA 5L3DA 3N5LA 4QPQA 1EZPA 4QWQA 3MEXA 4AS5A 3BC8A 2ZJ2A 4OFLA 1R5ID 2MYSA 4LB5A 2PFZA 1ULYA 5EF6A 1G0HA 2KRHA 4V2FA 4UB8C 2OLBA 3QAHA 5JLXA 1D9QA 1F5TA 5CVVA 4ZEKA 1Y4TA 2E60A 4GRKA 1P4WA 1RYXA 3TO7A 3O9PA 2K86A 2GM4A 1WJAA 1SVXB 2O7OA 3HTUA 3DTEA 5AA4A 2LG4A 1EF4A 3ZN1A 2KJBA 1MBGA 5FD5A 5H20A 3SHFA 2BVMA 5EYRA 1NV4A 3K69A 3A3UA 4NN3A 2X4HA 2KFDA 2M0MA 3KP5A 4HNVA 3MUQA 4GWSA 2R7DA 4HE0A 4Q0CA 4XFEA 3MCZA 2HOTA 2CQNA 4OZ9A 1S8NA 1SYIA 2I5UA 2UZKA 4ASNA 4ZZLA 5JK4A 4MJOA 3KEQA 3CJTB 1FP2A 1MBKA 3KEOA 1B3GA 1POY1 3ZKLA 2QVRA 4UNOA 4DZPA 3V89B 2EA2A 2ELKA 4GX3A 1JTYA 3TP3A 1JEVA 3EYYA 2A5TA 3CJQB 3ZQGA 3ERED 5DDGA 1II5A 1TFDA 4F3BA 2FMYA 4F3GA 3GEZA 1BTJA 5B7DA 2WWYA 1FIAA 2E0SA 4JQFA 1NH3A 2VD3A 3AG3H 5TP9A 3HSRA 3ZQ7A 4X6AJ 5A5XB 5L3CA 4OTEA 3F21A 2QENA 2G0EA 1YE9A 3ONQA 2LF8A 3SDBA 1BI3A 2EFQA 4U1OA 3UORA 2I3VA 3QP6A 3WGGA 1J0RA 3HOUJ 2P2AA 3PTYA 5AA2B 2PMUA 4KMFA 4AIHA 4RY1A 1KONA 3O6IA 2R7OA 1A04A 4M9SA 2UYEA 5H8FA 3MW0A 1FBPA 2Y5LA 2ESNA 1MIJA 2Y7PA 3PUFA 1QULA 4H45A 2EZHA 1H9GA 2V1XA 2A5WA 4R2FA 3IAM2 3CG3A 5CMCA 1JUMA 1X1DA 2WADA 3RKQA 4IHTA 1R6ZA 4WCGA 2L3DA 3UA8A 5FLXZ 3TO6A 4U21A 3VVFA 3LL7A 1DQUA 3JRAA 3I6VA 4II2A 4XBFA 5L8DA 2F8DA 3RPWA 3PQJA 4U1ZA 2XF7A 1X4PA 3U9GA 4N6PA 1R7JA 3LFUA 2WAEA 3QYBA 5AA3A 2XXRA 2VOPA 3KN3A 2DU9A 1MY2A 4F1YA 2GXGA 4A6EA 4A3DJ 2BBYA 3QU3A 2P3NA 1Y1VJ 2E1NA 2FNAA 1A55A 2ONRA 3E9XA 4AB6A 2RREA 2UXNA 1S6LA 4IX7A 4M1VA 2KP6A 5E3OA 3PD9A 1QRYA 3WTVC 2VD2A 1ENHA 1POGA 2NXNB 1W0TA 4HS7A 3K0VA 2QMXA 3I56I 3KP2A 4W97A 3D4GA 4KCDA 2Y75A 1GVCA 4IO3A 3M1CA 2F5CA 3VWBA 3DCFA 1T33A 2UVHA 1JI8A 4CYDA 2PMZA 1WDNA 4HCYA 1Y3NA 3BJ6A 4I1DA 1P1OA 3KSXA 4QFLA 2RAEA 4PE3A 3H03A 3KFWX 3CFXA 2H6BA 2DQVA 1FTZA 1MDMB 3HO7A 5DW8A 5HODA 2VXZA 4DZ1A 3O29A 3FDYA 4OHNA 3ABUA 1OCZH 1R9QA 2Z5UA 1BI2A 4IGRA 3RYDA 4U4XA 1MXYA 2LDUA 1TWCJ 4ITVA 4L9NA 2HPGA 2P1SA 3K4BA 2A69F 2F4IA 3SEZA 4NGUA 4F19A 3GYHX 2HGCA 1QA6A 1G2HA 1YIJI 3TW6A 1XS5A 2E71A 2ELHA 2JK3A 2VT2A 1A7LA 4ZH4F 2PLYA 1YQAA 1FBFA 3GXOA 2FVZA 2XXVA 3KBZA 1QZZA 1N78A 1YX3A 1BKAA 1NV7A 3RT8A 4HW0A 5L3GA 4DXBA 1OVBA 3VSLA 2IS1A 4E7ZA 4IRGA 3CCLI 1FTMA 2XROA 2PI0A 5J4YA 1Z67A 3JREA 5I84A 3IUOA 1UJ8A 2L4AA 3OSGA 2R7UA 1U8BA 4V19K 4EQBA 5H6RA 1D0ZA 2XHKA 1PYVA 3FXRA 5KAFC 4C1TA 2PBIA 3I3LA 2P0WA 1SD5A 5IOZA 3BR3A 3E0JB 4DNCA 1SDXA 1NMUA 4S04A 1OIBA 3LSRA 3HRMA 1R9LA 1B51A 1FY7A 1J09A 3T8TA 3X2QH 3MAJA 4EV0A 1DOTA 3V4GA 4NF5A 3ZP5A 1MNMC 1W5SA 3REOA 4BBRJ 1XGSA 4EJTA 5KHDA 1USYH 3G3JA 3OO7A 4N6KA 4Z7EA 5KCJA 2E7XA 1LAXA 1FOYA 3CO7C 2QS1A 4MFDA 4I76A 3S15J 1KZ8A 4MFIA 4PFRA 1R1TA 1MH4A 3JYRA 3S9NC 1IMEA 1TBXA 4C2UA 1P1QA 4IHVA 3PV0E 1O57A 2WB1N 2DA5A 4FISA 1N77A 3NARA 3H7MA 4XSXF 2FIXA 3BTJA 2XXWA 5F0FA 3SEUA 4EGYA 4WWCA 1FIPA 2NOJB 1KZHA 1MBJA 1D9VA 4FECA 4MLVA 2WV0A 1D3KA 2WYPA 2F2EA 3MVXA 4PJJA 1CQTA 1ZU0A 2G7HA 1IN4A 1PBQA 3BZKA 4MX6A 4G94A 2XXYA 3L2RA 3S17J 4L17A 3ZS6A 1FCKA 3HHHA 3RPUD 3PPPA 4LMYA 1P4XA 1H88C 3TKDA 2HS5A 4H0WA 2Y31A 3KP6A 2HOEA 4O3AA 1WJFA 5JTYA 4HF2A 4EQQA 3CCYA 3FM5A 4UUVA 2R92J 2H99A 3PMWA 2REGA 4MNIA 5FROA 2XB0X 4UY8I 1O7FA 4AIDA 9ANTA 2JWTA 4FAJA 2A5YB 2MH2A 4I6ZA 4OXVA 4FHTA 1FSEA 2NVQJ 4E70A 1P7IA 4BDYA 5F0CA 3IFAA 3CF2A 2ZJPF 2PJPA 5GTIC 3LSXA 2O8KA 4KYDA 1C0WA 4NQWB 2O7IA 3KN7A 3FWEA 5D5WB 1N76A 3KP4A 3Q0VA 4OFOA 3KC0A 3ILTB 4PF8A 4ESJA 1IXRC 3S2HJ 3JR9A 1EH8A 1M5BA 3IH2A 5C3EJ 3VE1B 4XRMA 1P4AA 2CUJA 2V1NA 5I59A 1ON2A 3K4KA 5ICFA 4NF8B 1P92A 2RQQA 5DEXB 4AB5A 4DJAA 1EKEA 4B4CA 4YIIA 3GTKJ 1QJMA 4AQ4A 5DCMA 2F6PA 2TDXA 2R7RA 4OVRA 3ZKKA 1XSDA 1LFPA 3HOVJ 4PCDA 4QRZA 2B65A 1KU3A 1QZYA 2K5CA 5D5XB 2PEXA 2Y0SA 4CXFA 3JRHA 1K4TA 1UG2A 4KIBA 4N8GA 4QFKA 5TISC 4G4PA 3FMSA 3RCOA 1VR5A 2E1SA 3J80K 1QO0D 2Y84A 5FTIA 1U2WA 2M1BA 3H5NA 4XKWA 4B09A 4L5JA 3Q3SA 4KITB 3IJXB 1HXDA 5KAIC 5BPDA 3N4MA 4AC0A 2EB7A 1U9OA 3DFGA 1ZH5A 1VQOI 4F2QA 5E1ZB 3WE3A 2IA4A 5I57B 4Q4ZF 3OO9A 2LSOA 3TFLA 2L9NA 4G9YA 4X9TA 2LY9A 4UVAA 3U1KA 2W24A 4A2UA 4NF6B 2CG4A 4NUBA 3BBRA 1NG7A 2ZXWH 4AUXA 3G3GA 4MHFA 4BXXJ 3PUYE 2V4CA 2EK5A 1FTOA 2KR0A 3THIA 1IUFA 4PFBA 2H09A 2FIEA 1D1BA 2UUZA 3OYLA 1JEUA 4DIQA 3RTWB 3KEIA 5TGTA 5DD8A 1PBPA 3AL0C 3VFJA 3J7AY 1OJLA 5JI6A 4HDUA 1FQBA 1GDTA 1J2XA 3F8NA 4BDOA 2OQGA 1ELJA 4JYKA 2DA2A 2KRCA 1WQ2A 2MFZA 5LGUA 4I9DA 3T5XA 4F55A 2JA7J 5DVJA 4A0YA 4CH7A 2I6EA 2I0CA 3H6WA 3TW7A 4PSWA 2OWSA 1TWGJ 4OMBA 2F5VA 4HRIA 4G12A 2I4BA 2OCEA 3WHCA 1MM7A 2UXAA 4GVOA 2AXLA 3NWSA 4B47A 2I3WA 2LF7A 3CSBA 2UV1A 4M3DA 1XHYA 4BBSJ 2EH3A 3H3VK 1B72B 4Q5TA 4QBAA 3BR2A 4JVCA 1OCCH 3BLYA 2HTJA 3OMBA 5A2QZ 1R22A 3ASNH 1JXSA 1BOBA 2OU2A 2HTSA 3MVZA 4N8YA 5ET7A 4P47A 2M30A 1DDNA 5DT6A 1XMXA 4IRHA 1A6IA 1VNDA 1BIAA 2LVSA 3MYUA 2Y69H 3QXMA 2EIJH 1W1WE 2V93A 5LGNA 2XHDA 4KXPA 1TNSA 3BZCA 2JA8J 3HBLA 3R61A 3ZRGA 3GZ6A 3BZ6A 5HNHA 2O1MA 3UNGC 4EMSA 2QQ8A 4RB2C 2KZVA 3KLOA 4JXIA 5FFXA 2H25A 4MNUA 2OJED 1B4AA 3M8FA 3VODA 1G4DA 3VSKA 2O51A 3QRFF 4YKIA 3CG1A 3OYMA 2M4KA 1XSVA 5CM6A 2E5NA 1M1EB 4XNFA 2ONKE 2HZLA 2ZZXA 1B7ZA 4ELQA 1WGXA 2FE3A 5TPAA 3K6UA 1Z9CA 3LSTA 3GMEA 1N7XA 5IZ1A 1Y39A 4Y17A 2IEKA 2MD5A 4YIRX 4XKNA 2B63J 2AYSA 1WRJA 3FGSA 4HX7A 4ONYA 3MP8A 5FHNA 4A3KJ 1A8FA 1LAGE 2JRTA 1R49A 2YU3A 5BPIA 5K2YA 3C1DA 1LDDA 3DU5A 5M5WJ 4ZDMA 3KZGA 4AYBN 1MY0A 5LD2C 1ZG5A 1O3QA 1XN7A 4Y13A 3OYHA 5LDZA 1BLFA 5H2FC 2KT0A 3B73A 1K83J 4LQ5A 2WAFA 5DYMA 3B6CA 2AL5A 1R1VA 1XDSA 3LSFB 4NX1A 1MPDA 5GPCA 1ZLQA 5JVGF 2EA4A 2WBMA 2GIVA 2LY2A 3OIPA 4I2OA 2L54A 1LSTA 2Y7WA 3KC1A 2RN7A 2LAOA 2YLNA 2H1LA 2MLKA 3CCUI 3F8FA 3LAPA 3LSMA 1S7OA 5J8CA 3HOZJ 1H43A 3OD7A 4RM2A 4RNSA 3CHGA 2O8XA 1MXXA 1Z05A 3K4NA 2L9SA 4E0WA 4D0PA 1AKHA 3HRSA 4Q5SF 3RY3A 4P8BA 5F64A 5ISUA 4P1EA 4U2RA 5B3SH 1LFBA 2ZMEA 5J6XA 5H6QA 1S9HA 1UG0A 2TCTA 4NAPA 4ANJA 4ETSA 2EFOA 1S29A 4XTCQ 4PFWA 1SEUA 1ETXA 2PX9A 3IOUA 4C2TA 3K6GA 2A61A 2KRFA 4IPAA 3FD3A 4MEXF 3O66A 2LC2A 1NK2P 3CI8A 3Q29A 4OOIA 1NUWA 3IK6B 2KL4A 4EJUA 4MTEA 5E79C 3K7AJ 4R1HA 4CZCA 5J1YA 3RNNA 1T8IA 1X1PA 4NDLA 3HXLA 2VJJA 3SEXA 4CCMA 2VPRA 5FGMA 3DBHB 1PC3A 5FLXK 3RYRA 1VQPI 1P99A 1ZMGA 2BZTA 1KA0A 2LR8A 4BNCA 3T9XB 2OWZA 2EBIA 4ZYDA 1FBDA 1SFOJ 2XXUA 4RAFA 1RRJA 1YRNA 1YYZA 4N9IA 3PJRA 4HQEA 2PJRA 3PSIA 2HR3A 1MQIA 4BJ6C 1YYVA 1MXWA 4PC9A 4C0RA 1N04A 2R5ZB 2F4OB 3H9JA 4JOMA 4A3GJ 4I98B 2OBPA 5AIQA 2M8EA 4H5FA 3GLLA 1DGRM 2BEOA 2ID3A 2O7UA 1AWBA 2QFLA 3Q9VA 1MQDA 4ABZA 1CF7B 3F8BA 1B32A 3FBPA 4PFOA 4A3FJ 2O9LA 4POXA 2CZIA 4N4OB 2UYFA 4N9HA 2BJJX 4B44A 5CQEA 3PU5A 3BCBA 1HA8A 4EDPA 1JJ6C 3MMYB 3WHBA 2CWEA 2YJPA 1IXCA 2AXTC 2DVZA 4RPOA 3RGYA 2ECBA 2HWVA 4CYCB 4NF4B 5H8QA 4PGNA 2DN0A 1YITI 2X7PA 3OSFA 4YMBA 4Z0IA 3VDFA 3TP0A 3EUAA 4LLGF 4IR8A 4U0YA 3QYEA 4MAGA 3M1EA 1PB9A 2VGQA 5DTBA 5HLIA 2XRNA 4RA2A 1PJRA 3Q0UA 3G2BA 2NVUB 1FBCA 3HZJA 4BS9A 4OANA 4BY1J 3GTLJ 1RR8C 1T56A 1U78A 1U5TC 4U7BA 3OSRA 2VBWA 4HNUA 1MKMA 1O4XA 3E79A 2HYJA 2G7UA 4G6DA 4G68B 2W00A 3HOYJ 3MP1A 1XS9A 2VJ4A 3FXLA 1BI1A 4BDNA 1EH7A 1TNTA 1P1WA 5I2NA 4IY5A 3OYCA 3JZJA 3CCJI 4FTHA 4G7HF 2XXPA 2PQ8A 3CMYA 5D8LB 5I56A 1D8JA 1W7PD 4FETA 3GZGA 3M3FA 3QOPA 2PN6A 1AMFA 2CJJA 2IW5A 5EHSA 5D8KB 3A29A 1QKBA 3AFHA 4I3YA 3PD8A 1B1XA 3E6DA 2CZHA 2Q2EA 1I6QA 4GL0A 4YZZA 5EQ9A 3SDFA 4HV5A 3H4ZA 4YG2F 1TWYA 5LHGA 5K5RA 3WTZA 1SD4A 3SEYA 4U23A 3VXBA 3L2UA 1ZG1A 3IKTA 2K85A 1B5IA 1QUKA 2XAUA 1DPEA 3ZPLA 5AA4B 5EGOA 5EQ7A 2WV1A 3TZAA 2PMHA 2F7AA 4HYEA 2BHYA 2LK2A 2VPNA 2VKDA 2QSHX 4M3EA 4YKKA 2RQPA 2EINH 2V7FA 3JCUC 3GTOJ 1U5TA 1B52A 1B3FA 5IPAA 3GBAA 4N17A 3KYLA 1R5GA 1XD7A 1RI7A 2K9SA 2CEYA 2KQZA 4O3CA 5I7IA 1F43A 1KQ9A 1MMNA 2KKOA 4ZYAA 2KIFA 2NWJA 1N3WA 3F11A 4BQQA 4IOAF 2XGXA 3OYNA 2QA4I 4H46A 3T9HB 3W6VA 2KIQA 3KG2A 3I3VA 2X0LA 1SW2A 4HEA2 3RKXA 2KMUA 1MMDA 2F6CA 1MSEC 4CCJA 2YU9J 2A5TB 4ESBA 4N15A 4TOZA 3BDDA 2JTVA 3F9KA 3EUKL 2W57A 5E8GA 4DYQA 1KYZA 4F3QA 3KPHA 2LBFA 4D7NA 2L5QA 4CDGA 4EXLA 4UABA 2WAQN 3WGHA 2OWTA 5TP9B 3CUQC 3CVGA 5CI5A 2DOEA 4W1UA 2QGUA 5BS6A 1F4KA 2EJRA 2XXQA 3FXKA 2BHZA 3G3IA 3ECOA 2IS2A 4TV7A 3RDIA 3GBBA 3CESA 3PPOA 4G8MA 2DP8A 4EATA 2KHMA 1FEXA 2X26A 3P9CA 2ZNSA 5F1JA 1ZYRF 2X6OA 2HPMA 3HTSB 1U0JA 1FTJA 1XCBA 3Q26A 2DJIA 4AWXB 4HW8A 3OL3A 1W5CC 2VL8A 5J40A 4B1RA 1XX5A 4JVDA 3TTKA 3U93A 5HNFA 2ZNZA 4XIDA 2XD2A 1Y8QB 4FEDA 1AA7A 2WYKA 5D4SA 3RTFB 1IV6A 2RC9A 2QQ9A 2ZNTA 3G7WA 3IHUA 2B4MA 3A2KA 1FX7A 3U2RA 2OV7A 3FHZA 2FQ4A 2M0CA 5IYBJ 2V1UA 2HZDA 4GDFA 3L2WA 4G6TB 2AL4A 5EJCA 2JRMA 2Z99A 4BACA 4EUOA 5E3LA 1X19A 4HF0A 3R26A 1Z77A 3FX3A 2VIXA 3WU2C 3O6HA 1FPBA 3AAFA 3K4LA 1FNNA 1IN5A 4FT8A 5B66C 4UUSA 2EILH 3CDIA 1WH7A 3BQZA 2GA2A 4F92B 2GFEA 2Y7RA 1BIYA 4BY7J 4G2ZA 4R74A 3OR1C 2R4GA 3D5SC 4RK9A 2HKOA 2DW4A 4RAGA 5E1XA 5FLMJ 3E6BA 4JWOA 4QIWN 5LRSA 5IOYA 4RGUA 4ZECA 3QSLA 3P7IA 1ZLJA 5L9MA 1BC7C 1MPBA 4HSTA 2NNNA 5E3NA 4KYEA 1K78A 2L7FP 3SETA 1X3UA 5ERIA 3WTXC 4KNYA 2XAGA 4WEDA 4ZEIA 4MO7A 1Y9UA 3HGYA 1OYYA 2G9WA 1M5EA 3EPEA 3OO6A 4I3EA 3PMVA 5ILUA 3V7SA 3FXBA 4XMYA 4E7HA 1TC3C 2CMOA 4I02A 4ENJA 5EHMA 3C2GA 3LMMA 2XGEA 2Z16A 5K5OA 2V84A 4DYRA 2UVJA 4ZZAA 4DW6A 1FSAA 1NUYA 2XGCA 3WODF 3F0CA 4Y33A 2O68A 2A07F 3U65A 2XAQA 1VF9A 2Z8DA 3ODBA 1AOVA 1WI9A 4PUSA 2RC7A 5AE4A 1GGGA 3O28A 3D5RC 3SZGA 2RF1A 2P5KA 3MPLA 4YKJA 2DWJA 2MLGA 3E3VA 1NTCA 2COBA 3R7XA 1OQYA 3K4CA 4IJAA 3OELA 4ZE8A 3U94A 2DFIA 2R5YA 2FOKA 5EDNA 3TTLA 4BAYA 1HOMA 2CW7A 3GYYA 1LUJB 4GL8A 3C4MA 4KICA 2DA3A 2NYXA 4G68A 4X0GA 5A2QK 3FVNA 1JJ8C 2C6YA 1QQIA 3PMXA 4P9KA 5ICTA 3JTGA 3I4MJ 2XV4S 3CFZA 2BY1A 1B5HA 3HC7A 4LJZF 5TJJA 4D5FA 3ZOBA 1Y1WJ 4L9JA 1ORKA 1JW1A 1LJ9A 3JW4A 1QGPA 5GAEJ 2GQ1A 2DK8A 3K1MA 2HXOA 2DWIA 5ET6A 3ZMVA 4I99C 5DCFA 1GV5A 1KU7A 1JGSA 2IJLA 1TTYA 3GTPJ 3EETA 2CYYA 2V9KA 3PM1A 2VQCA 2KQRA 2M87A 2FXAA 4OIOF 1MRPA 2DE4A 3JRCA 2XAHA 4P0GA 3SKPA 1I5ZA 1OR7A 2EV5A 2ZKZA 3LWFA 3CRBA 4PBQA 3I54A 3DLLF 2UVGA 4FE7A 2OC6A 1INPA 6PAXA 3TMOA 1ETYA 2FA5A 2M3AA 3C3WA 1RDZA 4QSDA 1MJ9A 3GUDA 3L2CA 2QKLB 5IYCJ 3WTYC 3V8JA 1T0FC 5DM6F 4KCCA 4CCLA 1B9NA 2I8DA 2DA1A 4JBAA 4KI0E 2NRAC 2UXXA 2JMWA 2QBYA 2JSPA 2LKSA 2QM3A 4NEDA 4IEJA 2XX8A 1T95A 2DTRA 5JTYB 2ZSHB 2Q1ZB 4C3IJ 3NRVA 3CSGA 2UVIA 3TTRA 2ABHA 1HW1A 5DEQA 4CHUA 2BW3A 2IEEA 2PG4A 2Y0MA 1UHSA 4IXAA 4IY6A 2EIMH 1NNTA 3M3KA 2DODA 3S3OA 1I6HJ 2DAOA 1NL5A 4RS8A 1YPNA 4KN7X 2F5EA 3LSGA 2MSYA 1SFKA 1TW3A 2XXIA 4P1LA 1UB9A 1SI0A 4XIGQ 3PUZE 3A1YA 2DMTA 3CQZJ 3GW2A 2DOFA 3GTGJ 1JVYA 2F5XA 1IRFA 3BG6A 5CJ9A 1K4SA 1FBQA 3ZQFA 4PDKA 4AIKA 1FBGA 2PBWA 3TCHA 4LLNA 4II3A 2Q74A 1ZG3A 2WB1A 5I59B 2EFWA 2IGMA 4R8HA 5DM7F 1YFHA 2YPRA 4F3PA 3O8HA 3Q0WA 4I7HA 1GUUA 3ROUA 3PUXE 4H6DA 2CQ7A 3KYCB 1M5FA 1O3RA 1RKTA 1SC7A 3KOSA 5DCMB 4PFTA 2E2IJ 1SW1A 2DWHA 4BDLA 2Z8EA 2RC4A 4A3BJ 1I6BA 1VI0A 2F4MB 2FSWA 5CMMA 3OEMA 4NF5B 1AH5A 4M6YA 2QWWA 2RDPA 1FLIA 1XVXA 4FCYA 1DP3A 2CZKA 1NNPA 5FFZA 4BJ5C 2ZSIB 2X6WA 3IH4A 4CCKA 4BE0A 1BBYA 2E7WA 4IHWA 4OAYA 2WKYA 1VTNC 4GWOA 1MGTA 3SQNA 1NV5A 4M71A 4OAZA 2XPVA 4O3BA 4XLAA 4OVSA 1G3YA 3C9HA 2M34A 3WAEA 3D1NI 1UMQA 1G8XA 3OV8A 1B9MA 3RPUA 4EM0B 2QVVA 2OZZA 3A03A 4YFNF 1ZRFA 4U22A 1S9TA 2L01A 5K1YA 3TPAA 3G6EI 4HTGA 2XSDC 1IUYA 2V25A 3SFIA 3W9WA 3DLNA 4PAFA 4IO2A 3M3LA 3RIRA 1AOYA 4R6KA 3GFJA