1IZ1A

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Dna binding protein
molecule keywords LysR-type regulatory protein
total genus 92
structure length 292
sequence length 292
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1iz1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A02
2YSRA 4U1OA 4DNCA 1R00A 2XXIA 2DQRA 5JI6A 2XVCA 3GWZA 1XCVA 4IVNA 3H7MA 3PFIA 2OWTA 4HX4A 4F1YA 1FQDA 2EFQA 4LB5A 4O3BA 1Z9CA 2DI3A 4MTEA 2DLLA 3KP3A 1Z1DA 1MD0A 4NQWA 2V1DA 4DCYA 3RTRA 1XCBA 2VD2A 3T9UA 3G3HA 4LJZF 3ZQ7A 2H6CA 1DTGA 4A0YA 3V4GA 2QQBA 4ETSA 4HCYA 2CO5A 5AA2A 3M3FA 3HIFA 3OV8A 3I64A 1ULYA 1IAWA 4FORA 3L7WA 4ESJA 2DVZA 3O2AA 1HSJA 1YLFA 2Y7RA 1IXIA 3I6VA 4NF8A 3I59A 4WXCA 5ICEA 4GXOA 4DLDA 2A5TA 1KU7A 4P96A 2WKYA 3BPVA 4ENNA 2LNBA 1GV8A 2QBYB 3WTVC 1Q35A 3RI4A 3ZPLA 1NFTA 5HLHA 4OENA 1JNFA 1YW7A 2QQ9A 2CZLA 5CVJA 2JPBA 3FVKA 1J2XA 1USYH 4OTEA 3K2ZA 4OETA 2OCUA 4UHTA 3VVFA 2STTA 1LBBA 3JZJA 4ELPA 3WTXC 3CTAA 1VTNC 2G7UA 3ZKLA 4BDLA 3LAJA 1J0RA 5CJ9A 4OHNA 4OEVA 2G93A 4LLLA 1DUXC 4YZZA 2VD3A 3H92A 1GGGA 4N9IA 3RIRA 4HF1A 1RUNA 3OEKA 1KYWA 5H6QA 1PDAA 1REPC 3EHUA 1S7YA 4E0WA 3FJ7A 1EV7A 1PEBA 1MJAA 4JWXA 3JTHA 5K2YA 1MM7A 2ELHA 1KU3A 3L00A 5FHNA 4GWOA 5JFRA 1Z6TA 2XASA 4WX9A 2QRYA 3JYRA 3PV0E 4HX7A 3C35A 3KN8A 3ZN1A 2IT0A 5DUIA 3J80K 3SQNA 4KT5C 1MQHA 1B05A 3TCGA 1XD7A 4OERA 3J81Z 3K6WA 1ZLJA 2P5LC 1AOVA 4CGZA 5CMBA 4HOBA 2F5EA 4CICA 1FP2A 1ZRFA 1B6HA 1VFEA 3PQKA 5LEJA 1PB9A 1NNPA 1LGBC 2MD5A 2XAJA 5HDNA 4ZEBA 5DEXB 2RCAA 3LA3A 3S2VA 4HQEA 2UVGA 3HO7A 3J7AO 4KYEA 2VBWA 1SD7A 2ZFWA 4KQPA 3TO6A 2X7PA 3EF7A 1ZG3A 4DDDA 4G6QA 1D9YA 4HS7A 4UXNA 1BP5A 1W5SA 1EH3A 4GL8A 3BZ6A 2DBBA 3GEZA 1MS7A 4OFJA 2QLZA 3ROUA 3OD7A 1TQIA 3VDFA 2O3FA 2WV0A 2XHKA 4YKJA 1UTBB 3BJAA 1SW2A 3KFMA 4Q4ZF 4Z2YA 1LQ1A 2Z9OA 1D8JA 4G8NA 2W85A 1DOTA 3ISPA 1KU2A 3IO4A 4RAYA 1DDNA 4U2RA 4KYWA 3TO9A 2PMSA 1LDJA 1NNKA 1R1UA 1LCFA 3BOQA 4U7DA 3PMXA 2VGQA 5A5XA 1M5FA 1QGPA 2V9VA 5L9MA 3Q9VA 3SERA 3K6UA 1S6LA 1FSHA 4ELOA 1MPCA 2P5KA 2FNAA 1MZBA 4M73A 1HKSA 5TPAB 3PUZE 4QSCA 3TQNA 2IVMA 3IWFA 3GX4X 2O1LA 3KETA 4GYGA 1W7PB 4HBLA 2DSFA 2A5SA 1BC7C 2G29A 1BI0A 5LGTA 5FGMA 2H09A 1PC3A 3F23A 1P1UA 4YU0A 1FBSA 4H5GA 4LP2B 1TNSA 3V8JA 1LB8A 2XD2A 1KGSA 1ZREA 5EHSA 1RUOA 1MY3A 2BJJX 4U22A 2COMA 2RC8A 3QRFF 1US4A 2E0SA 1SVXB 3OELA 4CDGA 2DOJA 2AXLA 2B3BA 3KP7A 4LFUA 3KGCA 2DPUA 3ZMVA 3O28A 1B4AA 1XDUA 1FYLA 1HKTA 4LONB 3IB0A 2EV5A 2I3WA 4RY1A 4GIZA 1B1HA 1N7XA 5FLXK 5BWJA 1UHMA 2LDUA 5DYMA 4A2UA 5AONA 1S8NA 1GR2A 3ZSFA 4OIPF 1K79A 3F6OA 3RTWB 1U78A 4KPTA 5K5QA 4RPOA 5FHMA 4BDMA 4WWCA 2EFOA 3IKTA 4LA9A 2Q89A 1OPCA 3CUQB 5TRDA 2RKMA 1I69A 2A07F 4AIKA 5I2NA 4I62A 4N6PA 5JTYA 3ABUA 1U8RA 4OFLA 1ONVA 1FC3A 2Y7PA 1MJ9A 3NEUA 3RY3A 5H8FA 3SKPA 4LK1F 1O3QA 1XGOA 2QSXA 2YX7A 4I2OA 3U9GA 3R6SA 4F3BA 2XIGA 1ZG5A 2P1SA 4EGYA 1LB2A 2ESNA 3F11A 3B6TA 3Q29A 4KA4A 3LBSA 2IA4A 3W9WA 5JTYB 1USTA 1ZLKA 4ZE9A 4U4XA 3VOEA 4MLQA 1SDXA 4FX4A 2DQLA 2XKPA 1SBPA 5DCMA 4WXJA 1Y4CA 3CFLA 2XXYA 2KIMA 3FIRA 4L9VA 3H6WA 2QJEA 4OWDA 1FX7A 1P1OA 5CBSA 2RGVA 2CGPA 3ODBA 2OBPA 5HLIA 1QZYA 2ZYKA 3TODA 3LQRA 1IUYA 3EDPA 5I2KB 1OLCA 3JTGA 4XXUA 1P99A 2P0SA 1MH4A 3A09A 2XX9A 3G3GA 2GA2A 2G7HA 2DXYA 2I3VA 4L18B 4ZH4F 1I6XA 1UFMA 1FQEA 5A5XB 4RA1A 3C9HA 5FTHA 3KOTA 1ZGAA 1SAXA 3WODF 1IRFA 5E8IA 1LFGA 1MDMB 2ZYMA 3QAHA 3RQTA 4ZEDA 1RIOH 3VLUA 3ZMUA 2FBIA 1LEAA 4HZFA 2BEOA 2PBIA 4FJPA 3T66A 1IZ1A 5DYHA 2PG4A 2PQ8A 4MLVA 3OEMA 5DCFA 3K6VA 1FY7A 4F1UA 4RK9A 2VT3A 3V5AA 3MP1A 3HYIA 3TTRA 3N4MA 3K01A 4KYDA 5H8HA 4K2EA 4BYYA 3E4RA 3MVWA 3R26A 1MPDA 3P7NA 2A6HF 3TZAA 4RPNA 3DEUA 5H8HB 4EF2A 2HWVA 4P5OA 4EM1A 4YKKA 5ERIA 1B1XA 2F36A 3QIMA 3IORA 2ZYOA 2IW5A 2EV6A 2B3FA 1ZYRF 3HHFA 3O6HA 4ZDMA 4KMUX 2IA0A 5L9OA 3VLWA 3KE2A 3M8EA 3ELKA 3PMVA 5CI5A 5AA3A 2AS5F 1UB9A 2F5DA 4IB2A 2OWSA 3B6QA 2XD3A 3CDHA 1WSUA 4G6DA 1UTHA 2BYVE 4XSXF 2F7BA 3EPEA 4Q5TA 3DXJF 4EXLA 4TV7A 2YR2A 4YFNF 2D3IA 1H76A 3CUQA 1HSTA 4PZJA 5DT6A 4EUOA 1QULA 1VE4A 3GXAA 2V3QA 3EQ1A 3T93B 4EV0A 4A6EA 1J59A 1LB9A 2D2WA 3DFGA 2HQ0A 1P92A 2HKXA 4G7OF 1L3LA 4NF5B 4Q0CA 1STZA 2I6EA 4G68C 4ZE8A 4IHSA 3I58A 5CVIA 1OVTA 1Z7UA 1UTHB 2M8CA 5F6FA 1NNTA 2GH9A 1N84A 3IK6B 4GLIA 3QOPA 2ZBKA 2FMYA 4ZZLA 3KG2A 4R72A 2HQNA 3MAMA 3JW4A 4KR5A 3RUMA 2OZZA 3FVOA 4FHTA 3KJ7A 4I98B 4RJZA 5ELVA 3H03A 5DD4A 2CSOA 4LLNA 4IO5A 3OSQA 3KCCA 4A6DA 1B3FA 1O57A 3KP2A 1PP7U 1B32A 1BOAA 1SD3A 3PUVE 5LRSA 3V7RA 3GZGA 1RZ4A 2A3SA 4TLMB 2JTVA 3DF8A 1KU9A 4WKMA 3PU5A 4R9GA 2DWIA 4GQOA 3O9PA 4ZYHA 1YTYA 3PPOA 4G8HA 3EETA 1F9BA 3F3XA 5A2QZ 1BJAA 3DLNA 1FTMA 1JQFA 1YFHA 5D8LB 3R4KA 1YW9A 2VOZA 2M30A 3CFXA 2ISYA 4KD5A 3R0AA 3IOVA 3H3ZA 4FAJA 1XDSA 1R5GA 3WAFA 5HS8A 1IN7A 3K0LA 2KRFA 3CR9A 4ESBA 4HCWA 4RNSA 2Q9TA 1N76A 1MY0A 2REJA 3IB2A 2HOEA 4DZ1A 3I71A 2VONA 3K0VA 5M2VA 4IJAA 4JBAA 3FMRA 1B0HA 4OESA 1M5BA 2UXNA 2X0LA 1PB8A 2XXHA 3K4UA 3LSFB 4GF8A 5I56A 5I84A 1U6GA 3FMQA 2ZMBA 5A2QK 4R6YA 1FQFA 4ZYEA 2V93A 3ZMSA 3QU3A 3MJNA 1B9JA 4I0AA 1XHYA 4YKIA 3K2DA 5EEGA 1R36A 1O3SA 1B0LA 1TTYA 1R5HA 3SEYA 2YX4A 5F7VA 3IRRA 4KICA 1IN4A 2XGXA 4L9NA 1PBPA 3BKIB 3HCQA 3ULQB 1Y0UA 3FF5A 5TPAA 3G3ZA 1IXSB 2M5WA 3MWBA 1U2WA 4H1XA 3RT8A 4R9FA 1TW3A 5AIPA 3O66A 1OYIA 2Y0MA 1QKAA 3KP6A 4M4GA 3FXQA 1A8FA 2XX8A 3UIFA 5ICTA 1HKQA 3CG1A 2I49A 3QP5A 5I2NB 1XC1A 4IXAA 3VLVA 3DKWA 3MVZA 1Z6RA 2NUVA 5D5UB 1CB6A 3O97A 1V3FA 2O51A 2QS2A 2OU2A 4G8MA 4M6YA 3Q26A 5EYFA 5ITPA 4YB6A 5AA1A 2L4AA 4EMSA 4HV6A 4IPAA 1FQAA 4EQ9A 2DP8A 3RT6B 4B09A 1F9NA 3VVEA 1XVYA 4GVOA 2RN7A 2VC0A 4EJOA 4AIHA 5ILVA 5DEXA 4F3SA 4EQQA 1W5TA 3FJGA 3WTYC 1BIYA 2DWAA 4M72A 5FLXZ 2UVIA 5CBRA 2RVCA 4YFKF 2XXRA 1HW2A 3K9TA 1PUEE 2KKOA 3FHZA 2UYEA 1K7AA 2V25A 3SEWA 3SZPA 2FQ3A 3DP8A 4KIGA 2R9JA 1GHCA 5JVTA 1G3TA 4HX8A 3A3CA 3PPPA 1I6QA 2EK5A 3B02A 2HEUA 2HQRA 1R7JA 3VXBA 3JSPA 2EA2A 2Y7IA 2DFIA 2R7DA 1FPQA 3H3GA 1MY2A 3E3VA 2FU4A 4HW8A 3ONMA 2H25A 3C4MA 5KK1A 2CFXA 2DS9A 5E1ZB 3O6GA 2ZNZA 1CF7B 2DXRA 3TTMA 4KDPA 4DXUA 4HF2A 3TUSA 4F3PA 5EHMA 4BXUA 3QAXA 2HYFA 3VVDA 3U1DA 4ZEIA 4JK1X 5D5XB 4YFXF 2O1MA 3J80Z 4RB1A 1DPUA 4JDFA 3I53A 1Y4TA 1HW1A 2P7CB 4KYSA 3GO5A 5BPDA 2O0YA 3VE1B 5FB2A 5AA2B 3QU6A 4K3FA 1XT8A 2DWJA 2ADUA 5H8SA 3C34A 5I59B 4B8XA 4YICA 2KJCA 1XMAA 2QWWA 5L3EA 3MZHA 1MG1A 1OQGA 4M9SA 3TELA 2IP2A 4QFOA 4Y15A 1FTJA 1N7WA 3O29A 3RTFB 5CC2A 1SI1A 1WWXA 1II5A 2RDPA 3EQLF 2F6GA 1P4WA 2C6YA 4KFCA 4EJVA 5I57B 3OXNA 1YW8A 4OIQF 2G9WA 2EA4A 4F1VA 5F64A 2FXAA 2OLBA 3AXFA 2CYYA 4EQBA 4PFTA 1G4DA 4QSEA 3FATA 3WTTC 1QUIA 3QP6A 2YPRA 2B0LA 2YJPA 3FASA 4YMBA 2VODA 2PBWA 2XXPA 1POY1 4L0ZB 1B3LA 1YQAA 2XKOA 3IX1A 4ELRA 2Z3YA 1O64A 3R0JA 1FYKA 2Q8JA 3KEQA 3N6TA 4XLNF 1BN5A 3V8KA 4GGGA 1X3UA 5K5RA 4JSDA 2M87A 1PP8F 1FW0A 1T0FA 2FNPA 4WEDA 2OA4A 2EJRA 2FBKA 4I0BA 4LG0B 3HRMA 2OBGA 4U1ZA 2HGCA 1B6AA 2XAQA 3W9VA 3E9XA 4XKPA 3OO7A 3VFJA 2E1SA 2IRFG 1US5A 1MJBA 3IOWA 4BNCA 4E70A 3DP6A 3KZGA 3CVGA 1D3KA 1YTVA 3N5LA 1N3WA 1SW1A 3V83A 3Q25A 2FE3A 4MH5A 4GOTA 1BM9A 2NVUB 1F5TA 4WEPA 4HV5A 2R3SA 1JW5A 5LLQA 2ZXTA 3UK4A 2I0BA 4XIGQ 3OO6A 3GUDA 3TAJA 2HEOA 1LCTA 1MXZA 2EFWA 1KA8A 3FVGA 4G68B 1BBYA 5ITOA 4F19A 1GVJA 4H5FA 1JE8A 1LVAA 4IF4A 5BOXA 3T9VA 2OZ6A 3FX3A 4IRHA 1OMIA 1B7UA 4OMBA 4PFUA 4NE4A 5IT3A 3E3KA 2EV0A 3LA7A 1URDA 2M1BA 2HZKA 1EU8A 3QUFA 3PMWA 1UQWA 1CE2A 1N3XA 2TDXA 4HDUA 3V89B 2DE4A 3WE3A 1XSVA 3V7CA 4U0VA 3T96B 1G3WA 2THIA 4U7BA 3N26A 4EJUA 3GBBA 1HBXG 3EHTA 5E17F 3KZYA 1D3YA 1XSDA 1XB4A 3RN8A 2A61A 4R2BA 4U23A 1OIBA 3Q27A 1RI7A 4POXA 4ECFA 4GCVA 3CSGA 4OINF 4CHUA 2JSCA 1Y20A 3E97A 1EH7A 1B5JA 2XHDA 2LF7A 3P7IA 1T6SA 4G9YA 4NB5A 4Q47A 1O63A 5D5VB 1LLSA 1OMPA 1USYE 2GIVA 1P1WA 3C18A 1B46A 3W15C 2FBHA 4NTLA 3WGHA 2DVCA 1U5TA 3KZZA 3REOA 3CO6C 3UGWA 1D9VA 2HR3A 3GZ6A 3IOTA 1S3JA 2ZNSA 3OMBA 1HQCA 1QUJA 3O2PE 4YKPA 4YMAA 3LUYA 2ONKE 2V3TA 4F29A 4PFYA 4LG0A 5I58B 1R6ZA 3GBAA 1EH6A 3GLBA 4OU0A 3Q5FA 2VOPA 4R8HA 2H98A 2W7YA 4XTCQ 2B65A 2L4MA 4OXVA 2KJBA 2ZXJA 4GFRA 4MF3A 3U94A 4NEDA 3JAMZ 3HV1A 1AIVA 2F5XA 2GAUA 2VC1A 3TDJA 1MGTA 2DTRA 2FA5A 2XAFA 1H44A 2Q2AA 2P6TA 1PBQA 5LEKA 4CZZA 1GVCA 1ZBMA 1R22A 3DM0A 5L3BA 4G7HF 4R73A 5ICQA 1Z05A 2UVHA 2PX1A 4GRKA 4BDQA 3TDZC 2UVJA 2DK5A 2XAHA 1D5VA 1QNTA 4L5IA 2Y7KA 1G3YA 5CMMA 4EXKA 2F35A 3LSWA 2MBFA 4PQJA 6PAXA 3BROA 1O7TA 1FLIA 1PB7A 2RINA 3C36A 3F22A 4R6HA 4R2FA 4U0YA 4H0EA 1TFDA 1BTJA 3G3IA 1QPMA 4DIGA 3K69A 1ZAOA 1B5IA 2CQKA 3MEXA 4LGWA 3NQOA 2OZUA 4CXFA 4C1UA 4A0XA 2ONRA 3BWGA 2Y84A 3IRQA 1I6AA 3CG3A 2CG4A 5D4RA 2XXQA 2EFNA 4JQFA 1P2FA 3MQ0A 4OMZA 1CF7A 4M74A 1ZGJA 3MZYA 2XV4S 4R74A 3IC7A 4MEYF 4RB0A 2FRHA 4Y17A 2K4JA 3TTLA 4QWQA 4WXDA 5CVRA 2ZJ2A 4F7ZA 4RXLA 3MZBA 5J6XA 3MCZA 3O6IA 2OQGA 4G4PA 2E1CA 2Z99A 2L01A 4A5MA 1TW2A 1YS7A 1R9LA 3CUQC 1ZKBA 5E8GA 4IHTA 3LAPA 2PJPA 2I4CA 1VSOA 3FGSA 3KSXA 4GXSB 1B4HA 1R1TA 1FTOA 4H6DA 4A0ZA 5LOMA 1J1NA 1QVSA 2MH2A 2UYFA 2F6PA 2STWA 5KCJA 3TQLA 4U21A 4RB3C 4OZ9A 2RV8A 2P8TA 4LZ5A 1QZZA 4DE8A 3ABTA 4OMYA 2JZYA 3C32A 1L5TA 4N0BA 1MXUA 4A5NA 3QUJA 3L2CA 2V6CA 2ZCWA 5AA4A 4NWDA 1MH3A 4HLYA 3M1EA 2MH9A 4JXIA 3PGFA 1DSNA 3J81K 3M8FA 2R71A 3ZKKA 2UZKA 1ZARA 3GFLA 3ERED 1Y1ZA 1BI2A 1TBXA 3F21A 1ON2A 2REGA 4F2QA 2RKHA 1D4NA 2CWEA 3FWEA 2PMHA 1IN5A 3E5QA 3IJXB 1F1ZA 1VR5A 4IRGA 3VODA 3HPIA 5IAIA 5AA4B 4X1BA 3WGIA 1XGNA 1H9GA 3BDDA 2A68F 3HUGA 4ZEKA 3MWMA 2W25A 3GLXA 2Q88A 3H6VA 4O3AA 3S9LC 3WTZA 2QS1A 4KCDA 2PT2A 1IW7F 3RYRA 2RNJA 2VBZA 2V1XA 4ESWA 3PPQA 1LAXA 2GZWA 3C33A 5I56B 4NF4B 1XMKA 1K78B 4AIJA 2H5YA 2Q2EA 1W7PD 2F34A 5DEQA 2Z33A 2HTSA 4OIOF 3NRVA 3IB1A 3DP7A 3LSTA 1S7OA 2PN6A 4H0WA 4HW0A 2O03A 1Y3NA 1OR7A 1LAHE 4QRZA 2HZTA 2HKOA 5KDTB 5AA2D 5FFXA 4LB6B 4L0YB 4NWCA 3EHSA 5DUKA 4EDPA 4PETA 1AWCA 2YU3A 4S04A 1J7KA 1ZG1A 2RF1A 3MVYA 4H67A 5ICCA 3ZMTA 4BHBA 2P5VA 3F6VA 3MFKA 4BH9A 2VN2A 5K5OA 3T9HB 4HA8A 3PUXE 3TFLA 3H3UA 3M7GA 4LQ5A 3S9EA 4M9XA 3HOSA 4ZECA 1U3EM 3COAC 4QF9A 5FD5A 4ESXA 1BI3A 1T38A 4LLGF 5CYVA 1B7HA 4RYAA 3PUWE 5JK4A 2P4WA 1QW0A 5LHIA 1JVYA 1B5HA 4QHQA 1AH5A 3FUZA 2AL4A 1QO0D 2I0CA 1TLHB 1O3RA 1MXXA 2HXWA 1EH8A 5D4SA 2GWRA 1XGSA 2EWNA 3GYHX 4IO4A 2PFBA 3E13X 3FM3A 3WE2A 2A5TB 5KCJB 3GZ5A 1B1BA 2JPCA 3JSOA 2A5YB 2JRTA 4ZYDA 3CSBA 3ECRA 4ZZEA 1QJMA 4N9HA 1AOYA 2Y75A 3ILUB 2QM3A 3USDA 3T8RA 3GF2A 1NL5A 4GL0A 1MDMA 3G3JA 5K2XA 4FEDA 1YCJA 4RB2C 2DO7A 2UXXA 3LR1A 3FVNA 2QENA 3L9FA 3PUYE 3ZP5A 5H8NA 1ZHFA 1MDQA 3CIJA 4XKRA 4ONYA 4MHGA 4KHZE 4R6KA 2IJLA 3FZVA 4KCCA 3F72A 4ZZDA 1TNTA 2PVUA 5L9SA 1MY1A 1R1NA 4M1VA 4DCXA 3A3UA 3IO6A 1SFUA 1RYXA 2XXUA 2QZ8A 4LQ2A 5HLGA 1QBJA 1JETA 1G6NA 1OYWA 2Z22A 1H9TA 1FTLA 3TYHA 1ELJA 3N97A 2NNNA 3N94A 1SYIA 5HPQA 4YIIA 3ECOA 1BI1A 1FTKA 3KN7A 3PPNA 2GQQA 3QSLA 1U5TC 1R1VA 5EEHA 1SI0A 3G73A 2P7VB 2XAGA 3K1PA 4X9TA 5B7DA 5KZTA 4NF4A 3EYIA 3F8NA 1A7LA 4QLCU 2W84A 5DTBA 3ILTB 3BFTA 3FV2A 2HDCA 4R1HA 4BDOA 1T98A 5E1XA 5IT9Z 3CO7C 5DVJA 2VHAA 1IEJA 3RLFE 1TFAA 4ZZAA 1IITA 1ZRDA 2W24A 1IN8A 3U8QA 4NF5A 4G68A 1LDDA 4UVBA 4P0IA 4ND9A 3TCFA 5L3FA 1ODDA 1ON1A 1J5YA 2ZMEB 4O6JA 2NWJA 3FXUA 2O61A 2NXOA 5H8QB 2ZNTA 2F5CA 2VE8A 3EN3A 1XSXA 2QVOA 1BIBA 1D8KA 1ZN2A 3HSFA 2F5FA 5CLSA 2HTJA 2J5PA 4H65A 3RPWA 2A69F 4RAZA 1S50A 5DVFA 3KP5A 2MC3A 3UA8A 1WKMA 3SEUA 5BPIA 1YYVA 1UTBA 2F7CA 3WAEA 3D5LA 1WODA 1ZTYA 1KQ8A 1SQYA 5KVRA 3B7DA 4H8JA 4GD5A 1DP7P 4N07A 4ISUA 1Q1HA 3IL2A 5I57A 4KN4X 1Y3QA 2Z8FA 1H0MA 3T0YA 1GXPA 2YPNA 1H45A 2ZNYA 1M5EA 3TMGA 3BJOA 2EB7A 3BY6A 5HS7A 1M5CA 4EVIA 4WF2A 2ONSA 5BQTA 4AWXB 5CVVA 5E1WA 1KYZA 4I02A 2AL5A 4Q5SF 4G2ZA 3B6WA 1URSA 3D0SA 3WTSC 4RGSA 4RK2A 3S2WA 2O68A 3FXRA 3P9CA 4R79A 5L3DA 3SEXA 1KQ9A 1MXYA 3M3LA 1B3GA 5CRYA 3KP4A 2PI0A 1P1NA 1AL3A 1UIVA 2NNYA 4EF1A 1P4AA 4BHCA 1Y1MA 5L3CA 5I59A 1SFXA 3QPTA 4UV8A 4OFOA 3S4UA 5BS6A 2Z5UA 4ENJA 2VOOA 5H6RA 4RGUA 1YPNA 2XX7A 1IXGA 3VB2A 1LAGE 1Z7ME 3SEVA 2O7UA 3F8FA 5J1DA 2NS0A 4PE5B 2BBYA 2ACJA 2ZO4A 1J9IA 3GVAA 1R23A 4FIMA 4XLPF 4L17A 1G3SA 1UIUA 4NHJA 1XS5A 5BUUA 3WGGA 4UUVA 4X1DA 5ISUA 1BC8C 2ESHA 1IF1A 2NAZA 1FZPB 4IY6A 1P4XA 2F97A 4HTGA 1EZPA 4EM2A 4LK0F 2F78A 2HAVA 5TU0A 1A99A 4PP0A 4KUMA 4S05A 2KLFA 4TOZA 2FF4A 3SZTA 1YS6A 4M9ZA 3FV1A 4JSOA 3R61A 1EZOA 3DQVC 1Y9UA 4XRFA 3H6UA 2O6AA 4IO6A 3IKVA 1ZLQA 1HSLA 4PDKA 5AE4A 3LA2A 2ABHA 3U92A 4QFNA 3UN6A 4AQ4A 1NHAA 1DPRA 1K78A 2GHBA 3U72A 1RKMA 4THIA 2E7WA 3BP8A 1DTZA 2ANJA 3RNNA 1URGA 3P9KA 4Z0IA 5LHHA 2H99A 3L09A 1A8EA 2HS5A 4LD5A 1AMFA 4I1DA 1FBUA 5J8FA 2O84X 1B3EA 3FM5A 3OENA 2O69A 2L3DA 4HYEA 1MXVA 2F7AA 1JHHA 2QMWA 4HAMA 1O7LA 2PEXA 5ICFA 3I4PA 3CRBA 5FO5A 1IXHA 3E5UA 5LGNA 1IIWA 3K1NA 4UV9A 2UXAA 3H06B 5F1QA 3HN0A 1U5TB 3OSRA 3TDUC 2DK8A 4QSDA 1TQPA 5L8DA 2KIUA 4ZS9A 1MKMA 4MEXF 4C1TA 4OQOA 4EQ7A 1BIAA 1JW4A 3R6UA 4AB6A 2XXVA 3TKDA 4POWA 1V4RA 3V7SA 3PPRA 4ASNA 4L9JA 1LJ9A 2LKPA 2L54A 2QUFA 2O7IA 2H6BA 3MZ1A 3CJNA 2XROA 5LRRA 4CYDA 4U4SA 2H4IA 2DT5A 2FSWA 2H94A 1NMUA 3T22A 1JHFA 3TEPA 4NMYA 4ENKA 4I01A 2V84A 3RGYA 4YIFA 4OYVA 3OOPA 1B52A 1CGPA 4YB7A 5DVIA 4IRIA 4BAYA 3GFMA 3GFIA 1LEBA 1L0OC 5HOOA 1ZMGA 2QYOA 1SD5A 1ZH5A 3PD9A 5TP9A 3TOAA 1FWZA 2XRNA 3K1MA 4PGHA 4Q48A 4EM0B 1LBCA 2Q0OA 4ESFA 3ZN0A 3LQQA 1YAEA 3RJPA 1SMYF 3C3WA 1IUDA 4KMFA 1OYYA 3BFUA 3I59B 1XN7A 1XOCA 4JBZA 1JXSA 4XKNA 1EZ9A 2R6GE 1SMTA 3TTKA 4L5JA 4FX0A 2X7QA 3RDIA 1LDKB 2NYXA 2BV6A 1IN6A 2OJTA 2V3UA 3KLNA 2RC7A 3C31A 2K86A 1LNWA 4UNOA 3I5UA 2V79A 1HW5A 4F22A 3H6TA 3QK6A 3S9NC 2DW4A 4MQ9F 2HYGD 2QL3A 2D5WA 4R75A 4ZEFA 4WCGA 3TOBA 3U1OA 2D21A 3KEOA 5KDTA 1C0WA 3TTNA 4EJTA 1WQ2A 2Z23A 2ISZA 4LATA 2OK2A 4OIRF 4N13A 2GHAA 5LGUA 1A54A 4KN7X 3LWFA 3TO7A 1N04A 4MGRA 3P9IA 2WWYA 1OQHA 4TLLB 1OVBA 3LFKA 2QPQA 2NRAC 3I3VA 4EJWA 4AVPA 3E6CC 4FECA 2IA2A 1LFIA 4Y13A 3ML6A 1H43A 4IGRA 2ZKZA 2DWHA 2FEZA 3V8LA 3RKXA 2PLYA 5B70A 5FFZA 3T5XA 2R7FA 2I48A 4I8CA 4PGGA 1HSEA 3R60A 3K6XA 5JEIA 1NKXA 4UA8A 1TXFA 2RC4A 3KLOA 3IJOB 2ZMEA 2FA7A 1IQ7A 3FD3A 2QS4A 3G3FA 3KBRA 3JV9A 3TKYA 3VXCA 2WTEA 4F2OA 1XGMA 2FYIA 2D1HA 1GTKA 4IO7A 3MVXA 3I54A 3HOTA 3DPLC 2PYYA 3PD8A 4F31B 4U88A 5JR3A 1MQDA 1R9QA 2IA1A 5E18F 2DPDA 1I27A 4WXHA 2V1UA 3SETA 2OQRA 4H8IA 2NOOA 3V8XB 4UACA 1DPPA 1FQCA 3ZMDA 4QFLA 3MPLA 3WU1B 4G8XA 5AIQA 3K00A 2K7LA 1Z7NE 3HHHA 1JEUA 5BMZA 2DU9A 3IWZA 1SFEA 2XXTA 1FSEA 4BDRA 4YG2F 5CM6A 1I5ZA 2X26A 4MTDA 3MQ9A 3VEPA 5FD6A 1MPBA 2ALUA 4DXCA 2MLGA 3IAZA 4P0GA 3IOUA 5CMCA 3SESA 5F1RA 2IPQX 3QPHA 3E6BA 4FE8A 4NF8B 4KI0E 2KIFA 3WG9A 4P55A 2Y48A 1A55A 2XXXA 3O6BB 4LVQA 4LUBA 1ANFA 2VT2A 4I9DA 1M5DA 3BBRA 3HTUA 1JVXA 2L02A 4C0RA 1Y3PA 2F8DA 4FT8A 5HDGA 3D4CA 3K02A 2RC9A 1O3TA 3TCHA 1IXRC 1UHWA 1QQIA 2D1VA 2H27A 3TQWA 1LAFE 1P6RA 2EFPA 4MFIA 2M8EA 3UORA 5FHOA 5I2KA 1J75A 3D4GA 2M45A 4OOIA 4I09A 2HAUA 5K1YA 3QYTA 2FNCA 4AD9A 5HM4B 3M3KA 4ENMA 5H8FB 1XVXA 2GFEA 1B9NA 4GO1A 3KJTA 3VV5A 4ELQA 4BDNA 1MQGA 1SYHA 2AIXA 1FNNA 5J8CA 1JW1A 1BLFA 4L9TA 2JT1A 4LMYA 3WTUC 4XSZF 2YLNA 2FOKA 3LC8A 5CVUA 3TGNA 1I1GA 1NH7A 1JGSA 3HRSA 4BHPA 3E6DA 1LFHA 3HRUA 4CO8A 5HDKA 4UVAA 2HFHA 1YO5C 3ECHA 3KSJA 4ZYGA 5TJJA 4G7ZF 1KWHA 2RQPA 4QFKA 3M8UA 3EYYA 2DQVA 1B9MA 1QKBA 3U2RA 3SDFA 5H20A 3EUHA 1TT1A 3MC2A 5DDGA 1Q1KA 1F4KA 5E20A 3HTSB 4FATA 2ETHA 3RPUA 1FQBA 2PT1A 2K27A 4PCQA 4F3GA 3VFZA 5ILSA 1MRPA 1SW4A 1B4ZA 4QFPA 5D6EA 2K02A 2LSOA 1W7PA 2I58A 4EGZA 3LSXA 5H8NB 2Z8EA 2VXZA 4RS8A 4P9FA 4HQMA 2XUBA 2K4BA 3KFWX 4Q30B 5IT9K 3T1BA 4U0WA 1HXDA 3MZ9A 5I58A 2VE9A 1ZIUA 2H9BA 4HDVA 4YB5A 3R7XA 2BGCA 3OOAA 3I0TA 3RKWA 3DP4A 1MM6A 1MXWA 3DV8A 2A6EF 5D6FA 5H8QA 1DMBA 2IEEA 4KFQA 3HSEA 3U93A 1B40A 2MLKA 3SFZA 1ZRCA 1GXQA 3HSRA 1ZJLA 3T8TA 5HS9A 1N0TA 2UWMA 1NNFA 3WTWC 2CMOA 1IRGA 2GXGA 3KN3A 4RGRA 4LZ8A 1MY4A 1T2KA 4KIFA 1KQ0A 4M71A 3W6JB 2HCAA 2GA1A 3CFZA 1WVJA 3FMSA 3MAJA 4MNUA 5HVQC 5L3GA 4A12A 2BE5F 3C1DA 3F8MA 1S29A 3E6MA 1WI9A 3HRTA 3CLOA 5D8KB 4O3CA 4IO2A 3S9MC 3GFJA 3WU0A 4M6XA 3KOSA 3MPKA 4O5VA 1B59A 4IGTA 4KIBA 3DELB 2DE2A 4F18A 1R58A 3JAMK 3AAFA 4JB7A 3GW2A 2GRVA 4LZ7A 1I1SA 1Z91A 1FCKA 5ICGA 2MA3A 3F8CA 1JEVA 3OO8A 1MQIA 3MUQA 3MW0A 4GYIA 3B73A 3PQJA 4ON0A 4I7HA 4WK8F 3G3KA 1MDP1 4P11A 1POTA 3MBPA 1T39A 4FEBA 4XKQA 2GXBA 2Q8KA 5DCMB 4HLXA 3DPTA 3BPXA 1S9TA 3UP9A 3SXYA 4BLAA 3G7WA 3I5OA 2I4BA 4X48A 2DAOA 1B2HA 1A04A 4YAHX 2PMUA 3THIA 1O7FA 5TP9B 4OEUA 1H3DA 2Z8DA 2F2EA 2LF8A 3F8BA 4G94A 4OVJA 2O6GE 1ZU0A 2P6SA 5DV5A 2DYXA 1B3HA 3L6GA 4F39A 1TQMA 1RNLA 4DQ2A 1ATGA 5D5WB 4KNYA 1OKRA 4O3MA 1TWYA 1IXCA 1I6BA 3ZS6A 2D45A 1K6OA 2XXWA 5ILUA 3CUOA 3Q9SA 2Q2CA 2O8XA 4GXAA 1E17A 4MBPA 3BJ6A 2VBYA 4UVCA 3L6HA 1FP1D 3Q28A 1YG2A 3O3KA 4XBFA 3MP6A 5IKBA 2E7XA 3RYPA 2WC2A 5DD8A 3FJMA 4JWYA 3M9AA 4NF6B 2DE3A 4JWOA 2LAOA 2HZLA 2AYSA 2FMLA 2RCBA 3LSLA 2X4HA 2ZNUA 2J5OA 5LHGA 1LSTA 3IL1B 3GXOA 3E5XA 3IHUA 3W6KB 1FT9A 3MP8A 1RYOA 4G77A 1WDNA 2ZYNA 1DPEA 2E1NA 1NH8A 1VFDA 3ZMZA 4P9UA 3IR1A 5CMKA 2QS3A 4AB5A 1MQJA 3N6UA 3KEIA 4D0PA 4DXBA 4IY5A 3RPQA 1B51A 3RKYA 3OO9A 3CI8A 2VP1A 1A40A 1P1QA 4NF6A 4HF0A 4BQAA 1BKAA 4RGXA 4Q8RA 1FBQA 2HFBA 1UCRA 1PDNC 4E0XA 2VBXA 5FTIA 1S7AA 1SD6A 5LBQA 3H4ZA 3HSTA 2OAZA 5JHUA 1OLAA 1T0KA 1SD4A 1E2XA 2CW0F 1FOKA 2QBYA 1WRJA 3QXMA 3HHGA 1W4MA 4IO3A 4PFWA 3SHFA 2QQAA 2P2AA 4Z7EA 1USSA 1FYMA 2Y7WA 3TPAA 5HBCA 2QMXA 3T9XB 1QUKA 1YIOA 1B7ZA 3C7JA 5ED4A 4MQVA 2W57A 2OD5A 1B58A 1SW5A 4TQUQ
chains in the Genus database with same CATH superfamily
2YSRA 4U1OA 4DNCA 1R00A 2XXIA 2DQRA 1MMAA 5JI6A 2XVCA 3GWZA 1XCVA 4IVNA 2E5NA 3PFIA 2XRLA 4ZDOA 1YZ0A 3H7MA 2OWTA 2CUFA 3DTIA 2L7FP 3DU6A 4HX4A 4OAZA 5IM2A 4F1YA 1FQDA 2EFQA 4LB5A 4N8GA 5C4JJ 4O3BA 1QVTA 4IOCF 2DI3A 4MTEA 1Z9CA 4H46A 2DLLA 2N8GA 2DDAA 3KP3A 1Z1DA 1MD0A 2K9LA 4NQWA 2V1DA 4DCYA 3RTRA 2HPGA 1XCBA 2VD2A 3T9UA 1DU6A 3G3HA 3HGGA 1Y6IA 4LJZF 3ZQ7A 1GVCA 3DEWA 3KPHA 4J01A 4E7IA 3ZQGA 4BBSJ 2H6CA 5IZ1A 4IZZA 3FXMA 1DTGA 4A0YA 3V4GA 2QQBA 4ETSA 4HCYA 2CO5A 3SFIA 3OL4A 3M3FA 5AA2A 3HIFA 3OV8A 2M7AA 3I64A 1ULYA 3MKWB 3ERMA 2I5UA 1IAWA 2ZXHA 4FORA 2X51A 3E78A 4FBPA 3L7WA 4ESJA 2DVZA 3DKYA 3O2AA 1HSJA 1YLFA 2DOAA 2Y7RA 4XMYA 1W1WE 1IXIA 4I40A 1Q1VA 3I6VA 4NF8A 3I59A 4WXCA 5ICEA 4BE0A 4GXOA 4DLDA 2A5TA 1KU7A 3AG3H 4A3CJ 3JRHA 5J16A 3FBNB 4P96A 2WKYA 4N81A 2A5WA 3BPVA 1KONA 1FIPA 4ENNA 2LNBA 1GV8A 4DGWB 1VQ5I 2QBYB 3WTVC 2I8DA 1Q35A 3RI4A 2QSGX 3ZPLA 3KYCB 1NFTA 5HLHA 3ZR8X 4OENA 1ZKGA 3E79A 1JNFA 1YW7A 2QQ9A 2QQ8A 2WY7Q 2CZLA 5CVJA 5EYGA 4E4HA 2CW7A 2JPBA 1NV5A 2HQAA 3MMYB 1J2XA 3RQIA 2WBMA 3J7YJ 3K2ZA 1USYH 2OCUA 4UHTA 1NI9A 2WBBA 2XA5A 4OETA 3CP8A 4X6AJ 1DQUA 3VVFA 2RQQA 4BS9A 5HNFA 2STTA 1LBBA 5C3EJ 2LG4A 3JZJA 3WTXC 4ELPA 5K7FA 1FPDA 2OTLI 3CTAA 3C2BA 4MLOA 1VTNC 2G7UA 3ZKLA 4BDLA 2O7OA 3LAJA 1J0RA 2VLAA 1X1BA 5CJ9A 3M4OJ 4OHNA 1VQPI 4OEVA 2G93A 3M07A 4HNVA 4P9KA 4LLLA 1DUXC 4YZZA 2VD3A 3H92A 2HYJA 1GGGA 3IFAA 4N9IA 3RIRA 2GBYA 4HF1A 1RUNA 3OEKA 2M4KA 3ABLH 1KYWA 5EG0A 5F0FA 5H6QA 1PDAA 1REPC 3CESA 1X19A 3EHUA 4HG2A 3ZRGA 1S7YA 4E0WA 3FJ7A 1EV7A 4IO9F 1MJAA 1PEBA 4JWXA 3JTHA 5K2YA 1MM7A 5FLVA 4C2TA 2ELHA 1K9YA 3CCSI 1KU3A 4OVRA 3L00A 1IMAA 1T08B 1TL8A 5FHNA 4GWOA 5A5LA 5JFRA 1Z6TA 2XASA 3UR3C 2PMZA 4WX9A 1IV6A 2M8GX 1EF4A 2QRYA 3JYRA 3PV0E 2DA2A 4HX7A 4M3EA 3C35A 4IHYA 3WU2C 3KN8A 3ZN1A 2IT0A 3HPHA 5DUIA 3J80K 3BT9A 1JJ6C 5DTDA 5EYRA 3SQNA 5ET7A 4KT5C 1E3HA 1MQHA 1B05A 3TCGA 1XD7A 4XEQA 4PGPA 3S17J 4KT6A 4CCJA 3J81Z 3K6WA 4OERA 1ZLJA 2CJJA 1H89C 4RA2A 2P5LC 2W00A 2F3DA 1AOVA 4CGZA 5CMBA 4HOBA 2F5EA 4CICA 1FP2A 5EZGA 2P3NA 1ZRFA 1B6HA 3A29A 1VFEA 3PQKA 3PSFA 5LEJA 1PB9A 1NNPA 1JGGA 1LGBC 2MD5A 2XAJA 5HDNA 4ZEBA 5DEXB 1FTTA 2RCAA 3LA3A 1PUFA 2JN6A 2M7BA 3AG1H 3S2VA 4HQEA 2UVGA 3HO7A 1N78A 3RN8A 4BE1A 3J7AO 3AFHA 4KYEA 5J4VA 2DYRH 4CYCA 2VBWA 1SD7A 2ZFWA 1ZGWA 2R7SA 4KQPA 3TO6A 2X7PA 4Y33A 4P1EA 5KHDA 1FPBA 4F93B 3EF7A 3DU5A 1ZG3A 4DDDA 2Y30A 4G6QA 1D9YA 4HS7A 4UXNA 3ZCOA 3H1CA 1W5SA 5DM6F 1BP5A 3BZ6A 1VQ8I 2DBBA 3GEZA 1EH3A 4GL8A 1MS7A 4OFJA 2DDKA 2JSPA 2QLZA 3S1RJ 2HOSA 3ROUA 4PE3A 2CV2A 5CQGA 3OD7A 1TQIA 3VDFA 2DFFA 2O3FA 3LUZA 3BR5A 2WV0A 2XHKA 3E7LA 2CEXA 1UTBB 4O8MA 3BJAA 4YKJA 2DA7A 1SW2A 3KFMA 4Q4ZF 1NV3A 4Z2YA 4BY7J 1LQ1A 2Z9OA 4W97A 2X9DA 5F0CA 1D8JA 4G8NA 2W85A 4RDUA 1DOTA 3ISPA 1KU2A 3IO4A 1D1BA 4RAYA 1DDNA 4U2RA 3K4JA 4KYWA 1ETWA 3TO9A 2WB1A 1XPXA 1TWFJ 1JTXA 1QA6A 1LDJA 3IH3A 1NNKA 2PMSA 4CCLA 1ETOA 1IMBA 1R1UA 3RKQA 1LCFA 3BOQA 4U7DA 3PMXA 3DLLF 4GWSA 4AUXA 3BR3A 1NUWA 2VGQA 3N05A 5A5XA 4J00A 1M5FA 4NNJA 1QGPA 2V9VA 3A02A 5L9MA 3IV5A 3Q9VA 2W48A 3K6UA 2EZLA 3SERA 1KZHA 1S6LA 1FSHA 4ELOA 1MPCA 2P5KA 2FNAA 3A0BC 1MZBA 4GWZA 4M73A 3H5RA 1HKSA 5TPAB 4I76A 4JX6A 3PUZE 1RR8C 4Y3OA 3S93A 4ITVA 2V26A 3CC7I 4QSCA 3TQNA 1T8IA 2IVMA 3IWFA 3GX4X 4KISA 2O1LA 3KETA 4GYGA 1W7PB 3OYGA 3ZOBA 4HBLA 2DSFA 2A5SA 1BC7C 2G29A 1BI0A 5LGTA 5FGMA 2H09A 1PC3A 4UB8C 1YYZA 5GAHJ 3HFUA 3F23A 1P1UA 4YU0A 1FBSA 4H5GA 4LP2B 1TNSA 3V8JA 1LB8A 1T33A 1KGSA 3CCLI 1ZREA 2XD2A 4A3DJ 5EHSA 1FPGA 5H2FC 3W3CA 1RUOA 1MY3A 3OR1C 2BJJX 4U22A 2COMA 2RC8A 3QRFF 1US4A 2E0SA 1SVXB 3OELA 4CDGA 2XPVA 2DOJA 2WEFA 2AXLA 2BVMA 3GTLJ 2B3BA 3KP7A 4X0GA 4LFUA 3KGCA 2DPUA 3ZMVA 3O28A 2OTJI 1B4AA 1XDUA 4XK4A 3UKGA 1FYLA 4BBRJ 1HKTA 4B48A 1X3WB 4LONB 3IB0A 2EV5A 2HXRA 1T0FC 1MNMC 1SANA 2I3WA 4GIZA 4RY1A 1B1HA 2R5YA 2AXTC 1N7XA 5FLXK 5BWJA 1UHMA 2LDUA 5DYMA 4A2UA 5AONA 1S8NA 2R7QA 1GR2A 3ZSFA 4OIPF 2KRCA 2XSDC 1K79A 1E3OC 2PJRA 3F6OA 3DKXA 3RTWB 5IZZA 2RNGA 1U78A 1ERDA 4KPTA 3BTCA 5K5QA 4RPOA 5FHMA 4BDMA 4WWCA 2EFOA 1TWCJ 3IKTA 2Q89A 1OPCA 3CUQB 4LA9A 4P1LA 4XFEA 5TRDA 2RKMA 1I69A 4BXFA 5J1YA 4AIKA 3JR9A 2A07F 4I62A 4N6PA 3ABUA 1U8RA 5I2NA 5JTYA 4OFLA 1ONVA 3FXLA 1M1EB 1FC3A 2Y7PA 1MJ9A 4XKCA 1N75A 3NEUA 3RY3A 4RM3A 5H8FA 3SKPA 1XTAA 3CLQA 1R9TJ 2OJED 2JK3A 4LK1F 1XGOA 2X6WA 4BEHB 1O3QA 2QSXA 2YX7A 3K7AJ 4I2OA 1X2MA 3U9GA 2LOOA 3R6SA 4X8RA 2V4JC 3L2RA 5JLXA 4F3BA 2XIGA 2R0QC 1ZG5A 4ABZA 2P1SA 2L9SA 2TRTA 4EGYA 1LB2A 2ESNA 3F11A 2VQLA 3KIOA 4KA4A 3B6TA 2IA4A 3LBSA 3Q29A 3W9WA 5JTYB 5EYHA 1USTA 1YITI 1ETQA 1ZLKA 4ZE9A 4U4XA 3PFYA 2MG4A 3VOEA 1SDXA 3S2HJ 4MLQA 4FX4A 3A03A 1FJLA 2DQLA 2XKPA 5FLMJ 1S9HA 1SBPA 5DCMA 4WXJA 1Y4CA 3CFLA 3CJQB 5EGOA 1TWGJ 1T95A 2K9MA 2KIMA 2KRHA 2WAQA 4L9VA 2XXYA 2RAEA 3FIRA 3QMFA 2CQ7A 3H6WA 4C3IJ 2VPRA 1NK3P 4N4NB 2QJEA 1B72A 2XB0X 3LSMA 4OWDA 1FX7A 1P1OA 1QVUA 5CBSA 4BJTA 2RGVA 3I9V2 2XF5A 2OBPA 1XX5A 2WADA 3HM5A 5HLIA 3OSFA 2CGPA 3ODBA 1QZYA 1R6RA 3FKJA 2ZYKA 3MN2A 3TODA 3LQRA 1IUYA 3EDPA 5I2KB 2KQZA 5LD2C 1OLCA 3JTGA 3BR0A 4XXUA 1P99A 3TW7A 3QWLA 2P0SA 1MH4A 2PJRB 3A09A 2XX9A 3G3GA 5EQ9A 2GA2A 2G7HA 3CMMA 3GZNB 2DXYA 2I3VA 4L18B 4ZH4F 1I6XA 1UFMA 1FQEA 4GX3A 3L2VA 5A5XB 4RA1A 2OCEA 3C9HA 5FTHA 3KOTA 1ZGAA 1SAXA 3PUFA 3WODF 3GTPJ 1IRFA 5E8IA 1LFGA 1MDMB 2ZYMA 3QAHA 4PJ0C 3RQTA 4HE0A 1RIOH 3RPLB 3VLUA 4ZEDA 3ZMUA 2DOEA 1LEAA 2FBIA 4HZFA 4UUTA 2BEOA 5EQ8A 2PBIA 4DZPA 4FJPA 4HXVA 3T66A 3HGYA 3Q0WA 1IZ1A 2DXIA 4UUSB 5DYHA 2PG4A 2PQ8A 2X1EA 4MLVA 3OEMA 5DCFA 4C3HJ 3K6VA 2ZZVA 1BW6A 1WJEA 2KISA 2DMQA 4BXXJ 5GAGJ 1FY7A 2DMPA 4LG3A 4F1UA 1BJZA 4RK9A 3KYLA 2VT3A 3V5AA 3MP1A 3HYIA 3HJEA 4YELA 3TTRA 2IXSA 3N4MA 3K01A 2BY1A 4KYDA 5H8HA 3WG7H 4K2EA 4BYYA 3E4RA 3MVWA 3R26A 3P5JA 1MPDA 2K3PA 3P7NA 4DBQA 2A6HF 2LVSA 1DGRM 3DEUA 4RPNA 3TZAA 5H8HB 2ME0A 4O7MA 4EF2A 1IJWC 2HWVA 4P5OA 5F1JA 2L5VA 4EM1A 4LIVA 4YKKA 5ERIA 1B1XA 4JP0A 2F36A 3QIMA 3IORA 2ZYOA 1NV4A 3H5NA 3OYLA 2WBDA 1Y56A 2IW5A 2EV6A 3O8HA 5EEAA 1ZYRF 3ZQFA 4BJ6C 2B3FA 3HHFA 3O6HA 2MD0A 4KMUX 2IA0A 4ZDMA 5L9OA 3VLWA 4I99C 3KE2A 3M8EA 4BEHA 1FBPA 3ELKA 3PMVA 5FJ8J 5CI5A 2V9KA 5AA3A 4IHVA 2R7WA 1B72B 5TISC 2AS5F 2R7UA 4IQ4A 1UB9A 2F5DA 4QSHA 4IB2A 2OWSA 3B6QA 1NUYA 3CDHA 5FRMA 1WSUA 2XD3A 4II3A 4G6DA 1UTHA 2BYVE 4XSXF 2F7BA 3EPEA 4Q5TA 3DXJF 2MGQA 4EXLA 4TV7A 3RQ4A 2YR2A 5HLTA 1FPFA 4YFNF 2JVGA 2D3IA 1H76A 1P7IA 3CUQA 1HSTA 4PZJA 5DT6A 4EUOA 4ZC3A 1QULA 1VE4A 3GXAA 2MC4A 2V3QA 3EQ1A 3T93B 4EV0A 4QBAA 4A6EA 1J59A 1LB9A 2QF7A 3G71I 2D2WA 3DFGA 1VQKI 2HQ0A 2VQGA 5C4XJ 1P92A 1U9NA 2HKXA 1DU0A 4G7OF 4AYBA 1L3LA 2GM4A 1STZA 3W2AA 4NF5B 4Q0CA 1DBZA 2I6EA 4G68C 4OTEA 4ZE8A 4IHSA 3I58A 5CVIA 1OVTA 4GWUA 1BW5A 1FPKA 1Z7UA 1UTHB 4M3GA 3HOZJ 2M8CA 3HOVJ 5F6FA 1NNTA 2MABA 1N84A 2GH9A 3IK6B 4GLIA 3AG2H 3QOPA 4XR6A 2ZBKA 2BXZA 3HBLA 2FMYA 2VUMJ 3RYDA 4ZZLA 4PDHA 3KG2A 4R72A 4DYCA 2HQNA 3MAMA 3JW4A 4CZCA 4KR5A 5I3SA 3RUMA 2OZZA 3FVOA 4FHTA 3KJ7A 4I98B 4RJZA 4XN0A 5FKOA 5IYDJ 3H03A 5ELVA 5DD4A 2CSOA 3U1KA 3GTKJ 3A01B 4LLNA 4IO5A 1P7JA 1UG2A 2BZTA 3KCCA 3VYRB 4A6DA 4D5FA 1B3FA 1O57A 3OSQA 3KP2A 1A6QA 1PP7U 1BOAA 1HOMA 1B32A 5LRSA 1SD3A 3V7RA 3TW6A 3PUVE 3RPLA 2G0EA 2YS9A 1D5YA 3GZGA 1RZ4A 2PFZA 2A3SA 1CQTA 2JTVA 3DF8A 1KU9A 4F52A 4TLMB 4WKMA 3PU5A 4R9GA 2DWIA 3GLLA 4GQOA 3KX2A 3O9PA 4ZYHA 1YTYA 3PPOA 4G8HA 3EETA 1F9BA 1LBXA 3F3XA 1AA7A 1BJAA 5A2QZ 3DLNA 2X48A 4BY1J 3OS1A 1FTMA 1JQFA 1YFHA 5D8LB 4N17A 2V7FA 3R4KA 3UNGC 1YW9A 2VOZA 2OPTA 2M30A 3OR2C 4C9YA 3CFXA 4NQWB 2ISYA 2WA0A 4KD5A 3R0AA 3IOVA 4BU2A 3H3ZA 4FAJA 2NVTJ 5BNGA 1XDSA 1R5GA 3WAFA 5HS8A 1IN7A 3K0LA 2KRFA 3QODA 4DOZA 3CR9A 1AU7A 4ESBA 2IS2A 2VKDA 5EG0B 3LNQA 1QU3A 4HCWA 2Q9TA 4RNSA 4IEJA 4XLAA 1MY0A 1N76A 2REJA 2FVZA 3IB2A 1ETVA 2HOEA 4DZ1A 3I71A 2VONA 1MBJA 3K0VA 2V1NA 5M2VA 4IJAA 4JBAA 3FMRA 1B0HA 4MHFA 1M5BA 4OESA 2DYSH 2UXNA 2X0LA 1PB8A 2Q74A 2XXHA 3K4UA 3LSFB 4GF8A 5I56A 5I84A 1U6GA 3FMQA 1FPEA 3LSGA 1X2NA 2ZMBA 5A2QK 4RAFA 2H8RA 4B43A 4R6YA 4B4CA 1FQFA 4ZYEA 2V93A 2PMZN 3ZMSA 3QU3A 3MJNA 4PBQA 2BHZA 1B9JA 4I0AA 3QPLA 2VQCA 1XHYA 4YKIA 3K2DA 5EEGA 1R36A 1O3SA 1B0LA 1TTYA 2DODA 1R5HA 3SEYA 1S5LC 3B8BA 3AKZA 2YX4A 5F7VA 3IRRA 2JRMA 4KICA 1IN4A 2XGXA 4L9NA 3H0DA 1PBPA 3BKIB 1E3PA 2IGOA 3HCQA 4HE2A 3ULQB 2QKLB 1ZR2A 3IFCA 1Y0UA 3FF5A 3W2WA 5TPAA 1K6YA 2IBDA 3G3ZA 1IXSB 3FXJA 2M5WA 3MKZA 1IDZA 3MWBA 1MIJA 3GTGJ 1U2WA 3DTKA 4H1XA 4IKFA 3RT8A 4R9FA 1TW3A 1ETYA 2JUGA 5AIPA 3MD2A 4QPOA 5EZHA 3O66A 1OYIA 2QCOA 2Y0MA 1QKAA 4MNIA 3KP6A 4M4GA 3FXQA 2IGMA 1A8FA 2XX8A 3PTYA 2EIJH 2ZJQF 3UIFA 1NTCA 5ICTA 1HKQA 1WGXA 2I49A 3CG1A 3QP5A 5I2NB 4GX4A 1XC1A 3IUOA 4IXAA 4MIJA 3VLVA 3DKWA 3MVZA 1Z6RA 1U8BA 1OCZH 2NUVA 5D5UB 1CB6A 3O97A 1V3FA 1IUFA 2O51A 2QS2A 2OU2A 4G8MA 4M6YA 3Q26A 5EYFA 4GBVA 5ITPA 2JWTA 1R71A 1OCOH 4YB6A 5AA1A 2L4AA 2QVUA 4W1UA 4EMSA 4HV6A 4IPAA 1JKRC 1FQAA 4EQ9A 2F4IA 2DP8A 3RT6B 4B09A 1F9NA 3VVEA 2R5ZA 2R5YB 3W2VA 1TT0A 1XVYA 4G6TB 1W5CC 2RN7A 2VC0A 3QOEA 4AIHA 4EJOA 5ILVA 4RBOA 1W0UA 4N6DA 4EQQA 3K10A 5DEXA 4F3SA 1W5TA 2EQRA 3FJGA 3DCFA 1RKWA 3WTYC 1BIYA 4A3IJ 2AQFA 2DWAA 4M72A 5FLXZ 4NGUA 1GV5A 2KQRA 2UVIA 2RVCA 4LITA 4ZTFA 5CBRA 1X1DA 4YFKF 1D9QA 2XXRA 4ZDLA 1HW2A 3K9TA 1PUEE 2IS4A 4PAIA 2KKOA 4P8BA 3FHZA 2WAEA 2UYEA 1K7AA 3BG6A 3A2KA 2V25A 3SEWA 3SZPA 2FQ3A 3DP8A 4KIGA 2TCTA 5IOZA 2R9JA 1GHCA 1UZCA 1G3TA 4HX8A 5JVTA 3FK7A 4V2GA 3A3CA 3VPRA 3PPPA 1I6QA 2EK5A 3B02A 2H1KA 3VWBA 2HEUA 2HQRA 1R7JA 4HNUA 4MAGA 3VXBA 3JSPA 5FBPA 2EA2A 2Y7IA 3RZOJ 2DFIA 1GVDA 2R7DA 1FPQA 1A6IA 2AO9A 3H3GA 1MY2A 3WHBA 3E3VA 2VKHA 2FU4A 4HW8A 3ONMA 2H25A 3C4MA 5KK1A 1JUSA 2CFXA 4NC6A 4N91A 2DS9A 5E1ZB 3O6GA 2ZNZA 1CF7B 2DXRA 2DJNA 3BQYA 2VPNA 3TTMA 4KDPA 4DXUA 4HF2A 3TUSA 2CU7A 2VXDA 4F3PA 2HVRA 4FASD 1I39A 1YJ9I 5EHMA 4BXUA 3K70C 1VQMI 3QAXA 2HYFA 2WYKA 3U1DA 3VVDA 4ZEIA 2X1CA 4B47A 4XL9A 4JK1X 5D5XB 4YFXF 3NWTA 3J80Z 2KL4A 2O1MA 1K9ZA 4RB1A 1DPUA 1N77A 1FOXA 2VT5A 2P81A 2M9HA 4JDFA 3I53A 1Y4TA 3G1OA 4CCKA 1LBZA 1YI2I 4NHBA 1R5ID 1HW1A 2P7CB 3T0JA 1X4OA 1Z21A 3H9QA 3GO5A 4KYSA 5BPDA 4GVOA 3CMAI 1SPIA 2O0YA 3HC7A 3VE1B 5FB2A 5AA2B 1WJ5A 4X1EA 3D1NI 3QU6A 4K3FA 2CZIA 3CCUI 1XT8A 2DWJA 2ADUA 5H8SA 3C34A 5I59B 4XLHA 3DTEA 4B8XA 2KZGA 4YICA 2KJCA 1XMAA 1IRXA 2QWWA 5L3EA 3MZHA 1MG1A 1OQGA 4M9SA 1Y39A 1FBFA 1WHUA 3TELA 2IP2A 3BLYA 4QFOA 4Y15A 4FTHA 1FTJA 1GLNA 1N7WA 3O29A 3RTFB 1IMFA 1FPLA 1SI1A 1WWXA 5CC2A 1II5A 2RDPA 4HSRA 3EQLF 5K7HA 2F6GA 1P4WA 2C6YA 4KFCA 4EJVA 5I57B 3OXNA 1YW8A 4OIQF 2G9WA 2EA4A 1Y1VJ 4AS5A 4IR8A 4F1VA 3MVPA 5F64A 4CA0A 4IOAF 1I6HJ 2FXAA 2OLBA 3AXFA 4B3XA 2CYYA 4EQBA 1WVRA 4PFTA 1G4DA 4QSEA 3FATA 3WTTC 1QUIA 3QP6A 2YPRA 2B0LA 2XAUA 2YJPA 3FASA 5F08A 4YMBA 2VODA 2PBWA 2XXPA 1POY1 4U87A 4L0ZB 1B3LA 5LTCA 1YQAA 2XKOA 3CF5F 2RREA 3IX1A 4XQFA 4ELRA 2Z3YA 4DYQA 1O64A 3R0JA 1FYKA 2Q8JA 3KEQA 3N6TA 3CJRB 3HOYJ 4XLNF 3OS0A 1BN5A 3V8KA 2JJKA 1U0JA 4GGGA 1X3UA 5K5RA 4JSDA 3KEYA 2XC7A 4DYRA 1MSEC 2M87A 1PP8F 2VI6A 1T0FA 1FW0A 3OIOA 2FNPA 1POGA 4OMBA 4WEDA 3GCMA 2OA4A 2EJRA 2FBKA 4I0BA 4LG0B 2KP6A 3HRMA 2OBGA 5IGAA 2ME6A 4U1ZA 2HGCA 1B6AA 2XAQA 2LD5A 1TWAJ 3E9XA 3W9VA 4XKPA 1R4MB 3OO7A 2LBFB 3VFJA 1KA0A 2E1SA 2IRFG 1MNDA 3VSKA 1MJBA 2H1LA 1KA1A 1US5A 3IOWA 4BNCA 4E70A 1RETA 3DP6A 3CVGA 1D3KA 1YTVA 3FBPA 1N3WA 4XRSA 3KZGA 4NDLA 5B66C 5B1BH 3CF2A 1SW1A 3V83A 1FPIA 2FE3A 3Q25A 2FX0A 4MH5A 4GOTA 1BM9A 3FHNA 2NVUB 3BCAA 4HV5A 1F5TA 2B63J 4WEPA 2R3SA 1JW5A 5LLQA 3AL0C 2ZXTA 3UK4A 3GTMJ 3DEEA 3K4MA 2I0BA 1OCRH 4E7LA 3OO6A 4XIGQ 3GUDA 4ZYAA 2HEOA 3TAJA 1LCTA 1MXZA 4F91B 2EFWA 1KA8A 4XKBA 3AG4H 3FVGA 4G68B 1BBYA 3FKIJ 5ITOA 2FBPA 4F19A 3TP0A 1GVJA 4H5FA 1JE8A 1LVAA 4IF4A 5BOXA 3T9VA 2VJIA 2OZ6A 3FX3A 4IRHA 1OMIA 4PUSA 1B7UA 1G0HA 1VQNI 5IT3A 2LMDA 3DWLE 1FBGA 3E3KA 4NE4A 2EV0A 3OMYA 4HRIA 3LA7A 1A5JA 3BIGA 1SVOA 1URDA 1LE8B 2M1BA 2HZKA 1LPQA 3CC4I 1EU8A 3QUFA 4OAYA 3PMWA 1X1PA 3CCRI 3BTLA 1CE2A 1UQWA 1N3XA 2TDXA 4HDUA 4A3LJ 3OOUA 3V89B 1ACIA 2DE4A 3WE3A 1XSVA 4HEA2 3V7CA 3PJRA 1K61A 2WB1N 4U0VA 3T96B 1G3WA 2THIA 4U7BA 4YEJA 2Y9YA 3N26A 1MBFA 4XF5A 4EJUA 3EUHC 1VQ9I 1HBXG 1QHGA 3EHTA 3ABMH 5E17F 3GBBA 3KZYA 1D3YA 1ENHA 1VNDA 1XB4A 1XSDA 3J7ZI 5DM7F 2A61A 4D7MA 4FQGA 3D1RA 3FVKA 4R2BA 4XRSG 1OIBA 4U23A 1QGXA 1RI7A 3Q27A 4POXA 1FJ9A 4ECFA 4GCVA 3CSGA 4OINF 4CHUA 2JSCA 1Y20A 1A31A 3E97A 1EH7A 1B5JA 1EYIA 2XHDA 2LF7A 3P7IA 1T6SA 4G9YA 4NB5A 4XLEA 4AS4A 4Q47A 2R93J 1O63A 5D5VB 4EEFG 2F5VA 3BG5A 2Y9ZA 1LLSA 2L7ZA 1OMPA 1USYE 2GIVA 1P1WA 3C18A 1B46A 1K4SA 3W15C 4NBQA 2XDVA 2FBHA 3V42A 3WGHA 4NTLA 2DVCA 2O9LA 1U5TA 2F48A 3KZZA 3REOA 3CO6C 3CCQI 3UGWA 2CUEA 1D9VA 4M3FA 3HOUJ 3LFUA 2HR3A 1RDXA 3GZ6A 2R7TA 3IOTA 1S3JA 4JYKA 5TGTA 2ZNSA 5DS9A 3OMBA 2QVRA 1HQCA 1QUJA 4OANA 2K9SA 5GADJ 3O2PE 2DMTA 4YKPA 3OYAA 4YMAA 3LUYA 1BR4A 2ONKE 2V3TA 4F29A 4PFYA 4LG0A 5I58B 1R6ZA 3GBAA 2EBIA 1EH6A 3GLBA 4OU0A 3Q5FA 1Z3XA 1UMQA 2GOXB 4R8HA 2VOPA 2B65A 2H98A 2W7YA 2L4MA 4XTCQ 4OXVA 2KJBA 3I4NJ 4OVPA 2ZXJA 4GFRA 4MF3A 3U94A 4NEDA 2VB6A 2CRGA 3GMEA 3JAMZ 4BGDA 3HV1A 1AIVA 5J1UA 2F5XA 2GAUA 2VC1A 3TDJA 1MGTA 2DTRA 2FA5A 2XAFA 1H44A 2Q2AA 2P6TA 1PBQA 2X85A 3CCEI 3CQZJ 4V19K 2LTPA 5LEKA 3HG9A 4CZZA 3JRIA 2ZJRF 1ZK8A 1ZBMA 2QFLA 1R22A 2Y5LA 2KIQA 3DM0A 4I6ZA 5L3BA 3MKYB 1CNQA 4G7HF 2W4SA 3FK6A 4R73A 5ICQA 1Z05A 2DFHA 2PX1A 2UVHA 4GRKA 4BDQA 3TDZC 2JA8J 2UVJA 2DK5A 5IP7J 5DW8A 2XAHA 5E3LA 1D5VA 1QNTA 4L5IA 4UUSA 2Y7KA 2KT0A 1G3YA 3E0JB 5CMMA 4EXKA 2F35A 2VL8A 1FJ6A 3LSWA 4BL0B 3B50A 5F27A 1R49A 2MBFA 4PQJA 2Z2SB 4GFBA 6PAXA 3BROA 1O7TA 1FLIA 1PB7A 2RINA 1DP3A 2L9RA 3C36A 2WX9A 3M3YJ 3HB9A 3F22A 1G0IA 4R6HA 4R2FA 4U0YA 5JVGF 1YE9A 5F0HA 4H0EA 2DDBA 1TFDA 1BTJA 4BDZA 3G3IA 1QPMA 3CCVI 3K69A 3U65A 1ZAOA 4DIGA 1B5IA 2CQKA 3MEXA 4LGWA 3S1QJ 2K85A 2OZUA 3NQOA 3IAM2 4CXFA 1LVKA 3PO2J 4C1UA 4A0XA 2ONRA 3BWGA 2Y84A 2DFEA 3IRQA 1I6AA 3CG3A 2CG4A 4JVIA 5D4RA 2XXQA 2EFNA 4JQFA 4IX7A 1P2FA 3MQ0A 3KC0A 1RDYA 4OMZA 1CF7A 4M74A 3A1YA 4QIWN 1T56A 1F36A 1X3ZB 1ZGJA 1K83J 3MZYA 2XV4S 4R74A 3IC7A 3RZDJ 4PF6A 4HPQA 1FTAA 4MEYF 4RB0A 2VJ4A 2FRHA 4D9JA 4Y17A 3G1MA 2BVLA 4CH7A 2K4JA 4MFEA 3TTLA 4QWQA 4WXDA 5CVRA 2ZJ2A 3L1PA 1TZLA 1I3QJ 4F7ZA 1VQ6I 4RXLA 3MZBA 5J6XA 1ETKA 3MCZA 3O6IA 1FMWA 2OQGA 4G4PA 2E1CA 2Z99A 2X1DA 2L01A 4A5MA 1TW2A 1FBCA 4GBWA 1YS7A 3S3MA 1R9LA 1D0XA 3CUQC 1ZKBA 5E8GA 4IHTA 3LAPA 2PJPA 2I4CA 1VSOA 1RC9A 3FGSA 3KSXA 4GXSB 4S0HB 4PFIA 2WAFA 1B4HA 1R1TA 1FTOA 4H6DA 4A0ZA 4HNTA 1J1NA 1QVSA 5LOMA 2MH2A 2YU9J 2UYFA 3TP3A 2F6PA 3PSIA 2STWA 5KCJA 3TQLA 4U21A 4RB3C 4OZ9A 2RV8A 1WH7A 2P8TA 1B8IB 4LZ5A 1QZZA 4DE8A 3ABTA 4OMYA 2JZYA 2F4MB 3C32A 1WJDA 4N0BA 1L5TA 4I3YA 3DBHB 2VIXA 1MXUA 5E3NA 4A5NA 2K3FA 2E35A 3HUGB 3QUJA 4G12A 3L2CA 2V6CA 1Y8QB 1YIJI 4E7KA 2ZCWA 5AA4A 3K70D 4NWDA 1MH3A 1TP4A 1A35A 2E1OA 4PK4A 4HLYA 3M1EA 1OFCX 2MH9A 4CCNA 2V6EA 4JXIA 3PGFA 1DSNA 3J81K 2ZB9A 3M8FA 2DT7B 4BKXA 4C2MJ 4BACA 1D1AA 2UZKA 4CCOA 2CUJA 1ZARA 2NXNB 3GFLA 4C3JJ 3ERED 1BI2A 1TBXA 1Y1ZA 1H88C 3F21A 1LUJB 1ON2A 4RLFA 2L0KA 2REGA 4F2QA 2RKHA 3OYNA 1D4NA 2Y0SA 4B1RA 1X1CA 2BW3A 4V2FA 2CWEA 3CCMI 3FWEA 2PMHA 1IN5A 2Q2EB 1E0EA 3E5QA 3IJXB 1F1ZA 1VR5A 1YOVB 4IRGA 3VODA 4XICA 1FEXA 3HPIA 5IAIA 2LYCA 5AA4B 2K5CA 1LBYA 2MSYA 4X1BA 2NS7A 3WGIA 1XGNA 1H9GA 2XGCA 2JA7J 3BDDA 2A68F 3HUGA 4ZEKA 3MWMA 2CFOA 1FIAA 2W25A 3BR1A 3GLXA 4RM2A 1PUFB 2M3AA 1JP4A 2Q88A 3GYYA 4NN3A 1Z67A 1FSAA 3PM1A 2JA6J 3H6VA 2NS8A 4O3AA 3S9LC 3WTZA 1INPA 2QS1A 4KCDA 2PT2A 1IW7F 1SAUA 3RYRA 2RNJA 1IDYA 2CV0A 2VBZA 3WHCA 1O4XA 2V1XA 2KLOA 3DPUA 4ESWA 3PPQA 1LAXA 1JUMA 2GZWA 2LY2A 4X04A 3C33A 4DJAA 4PGNA 2V4CA 3ASOH 4NX1A 5I56B 1GT0C 4NF4B 1XMKA 1K78B 1B8IA 4AIJA 2H5YA 2Q2EA 2V9PA 1W7PD 2F34A 5DEQA 2Z33A 2HPMA 2JA2A 2HTSA 3OSGA 4OIOF 3NRVA 3S14J 4MIMA 3U21A 3IB1A 3DP7A 3LSTA 1S7OA 2PN6A 4H0WA 1VQLI 5JHFA 4HW0A 2O03A 1Y3NA 5F24A 1OR7A 3RPUD 1LAHE 4QRZA 2HZTA 2HKOA 1LEVA 4PCDA 4A93J 4PBHA 5KDTB 5AA2D 5FFXA 2CW8A 2LLKA 1IV8A 4LB6B 4L0YB 4DZJA 3EHSA 4NWCA 5DUKA 2PX9A 3S3NA 4EDPA 4PETA 1FPJA 1AWCA 2YU3A 4S04A 3BR2A 1J7KA 4PSWA 2CUZA 1ZG1A 1KZ8A 2BY0A 2EILH 2RF1A 3MVYA 4H67A 5ICCA 3I55I 3SEQA 3TBIA 3ZMTA 4BHBA 2M2EA 2P5VA 3F6VA 3MFKA 5B3SH 3CMEI 3F0CA 4BH9A 2VN2A 5ET6A 1PVEA 5K5OA 3T9HB 4HA8A 3ABKH 1VFCA 2MYSA 3PUXE 3TFLA 3H3UA 3M7GA 5J4YA 4LQ5A 3S9EA 4M9XA 1OR7C 2KZVA 5J40A 3HOSA 4ZECA 1NV0A 1U3EM 2P3VA 3COAC 2NOGA 4XNFA 4QF9A 5FD5A 4ESXA 1BI3A 1T38A 4LLGF 5CYVA 1B7HA 1QHHD 4RYAA 2L7KA 3PUWE 1VQ4I 5JK4A 2P4WA 3DBRB 4Z6YA 1QW0A 2LK2A 1JT6A 4XORA 5LHIA 1JVYA 3EKIA 4NAPA 3CHGA 1B5HA 4B44A 1WH5A 4QHQA 1AH5A 3FUZA 2AL4A 1YX3A 1HA8A 1QO0D 2I0CA 3KC1A 3J7AY 4N6KA 1TLHB 1O3RA 1MXXA 4XOTA 2HXWA 1EH8A 5D4SA 5ET5A 4GDFA 1SVLA 2GWRA 4AC0A 1XGSA 2EWNA 4M3DA 3GYHX 2PFBA 2ZFUA 2R7RA 3E13X 2IAIA 4IO4A 1S72I 3FM3A 3WE2A 2A5TB 2HVQA 1GUUA 3CCJI 4BQQA 2Y0SN 5KCJB 3GZ5A 2LBFA 1LE8A 1B1BA 2JPCA 3JSOA 2A5YB 2UV1A 2JRTA 4ZYDA 2LY9A 3CSBA 3ECRA 4ZZEA 1QJMA 2A05A 4N9HA 1AOYA 3DLAA 2Y75A 3IP4B 1SFKA 3K6GA 5CQEA 4ANJA 3ILUB 4AVZA 2QM3A 5I5PA 3USDA 2CS3A 2H8WA 3T8RA 3GF2A 1NL5A 2DCEA 4GL0A 1MDMA 2OF7A 3G3JA 5K2XA 4FEDA 3HPGA 1YCJA 4RB2C 1LFPA 2DO7A 2GLOA 2UXXA 3LR1A 3FVNA 2QENA 1EKEA 3L9FA 3PUYE 3ZP5A 5H8NA 1ZHFA 1MDQA 3CIJA 4XKRA 4ONYA 4MHGA 4KHZE 4R6KA 2IJLA 2CQNA 3FZVA 4KCCA 3F72A 4ZZDA 1TNTA 1ETXA 1LFUP 5EQ7A 3LOCA 4MNCA 2PVUA 4NC7A 5FKLA 1MY1A 3JRCA 1R1NA 4M1VA 5L9SA 4DCXA 4BUPA 3FISA 3A3UA 4MMPA 2MW8A 4M6VA 3IO6A 1SFUA 1RYXA 2XXUA 2QZ8A 4LQ2A 3GBGA 4PAKA 4JOMA 1SVMA 5HLGA 1QBJA 1JETA 1G6NA 1OYWA 2Z22A 1H9TA 3BZCA 1P9QC 3RSNA 1FTLA 2ZXIA 3TYHA 1ELJA 2XSJC 3BG9A 1UAAA 3K4BA 2B4LA 3N97A 2NNNA 3LL7A 1SC7A 1SYIA 1FBDA 3N94A 5HPQA 2B4MA 1HDDC 1ZTRA 4YIIA 3ECOA 1BI1A 2R5ZB 3K4NA 1FTKA 1IGNA 5EJCA 3KN7A 3PPNA 3G1LA 2GQQA 3QSLA 1U5TC 1R1VA 5EEHA 4GWXA 2W7NA 1SI0A 3G73A 2P7VB 2XAGA 3K1PA 4X9TA 5B7DA 1RPWA 5IP6A 3JREA 3EYIA 4NF4A 3F8NA 4JX4A 5KZTA 2EH3A 1A7LA 4C2UA 4QLCU 3OIPA 2W84A 4FE4A 1WJCA 5DTBA 3ILTB 2QSHX 3BFTA 3KZIC 4DW6A 2OC6A 3FV2A 2HDCA 3H5AA 4R1HA 4BDOA 3S1NJ 1T98A 2I10A 3MYUA 2KDOA 5E1XA 1J09A 1LBVA 1EJ9A 3K4KA 5IT9Z 3CO7C 5DVJA 2VHAA 2QSFX 5B1AH 2ZSHB 1MMNA 2F6CA 5EDNA 1IEJA 4XONA 1TFAA 4ZZAA 4XN3A 1IITA 1ZRDA 2W24A 2CEYA 2ELJA 1IN8A 3U8QA 4NF5A 4DIQA 4G68A 1LDDA 4UVBA 2Y5KA 4P0IA 5GP9A 4ND9A 2JA5J 3G6EI 1FBHA 5L3FA 1ODDA 4MCOA 3TCFA 1ON1A 1IRZA 2JJ7A 1OJLA 1J5YA 2HVSA 2ZMEB 1XI6A 2GIZA 4O6JA 3JRFA 2NWJA 3CP2A 3FXUA 3S1MJ 2O61A 2NXOA 4D1QA 5E3OA 4PDDA 5H8QB 1K4TA 2JQ7A 1HLVA 2ZNTA 2L2OA 2F5CA 1Z0XA 2VE8A 3EN3A 4DBRA 1XSXA 2QVOA 1BIBA 2Q8MA 1D8KA 1ZN2A 1EA3A 1OCPA 2VJJA 1VZ0A 3HSFA 2F5FA 4D7NA 5CLSA 2PCRA 1IO2A 2HTJA 2DTZA 2J5PA 4H65A 3RPWA 2A69F 4RAZA 1HC8A 1S50A 3KP5A 2MC3A 5DVFA 4CCMA 3UA8A 1WKMA 3SEUA 5BPIA 1YYVA 1UTBA 1VDWA 2F7CA 3ROJA 3D5LA 3WAEA 1WODA 3LSKA 1ZTYA 1KQ8A 1SQYA 2HXOA 5KVRA 3CD6I 3B7DA 4GD5A 1DP7P 4H8JA 4LN5A 4N07A 4OA4A 4ISUA 1Q1HA 3IL2A 5I57A 4KN4X 1Y3QA 2Z8FA 1H0MA 2QA4I 2FJ1A 3T0YA 1GXPA 2CQQA 1H45A 2YPNA 2ZNYA 2MKZA 3OYCA 1M5EA 3TMGA 3BJOA 2DA4A 3SJMA 2EB7A 3BY6A 5HS7A 1M5CA 4EVIA 3ZQLA 4XKVA 2HU9A 4JX5A 4WF2A 5GPAA 2ONSA 2DMUA 3ZQQA 5BQTA 5M5XJ 1G59A 4AWXB 5CVVA 1G2HA 5E1WA 1KYZA 1MMDA 2CQXA 3HZJA 4I02A 4PSXA 2AL5A 2ECBA 4AM3A 2DN0A 2EIKH 3CDLA 4Q5SF 4G2ZA 2JUCA 2NOJB 3B6WA 1URSA 2BHYA 3D0SA 3WTSC 4PJNA 1VF9A 4RGSA 1IMDA 4RK2A 3S2WA 1TC3C 2O68A 3FXRA 3P9CA 3HOWJ 1V5GA 4Y4RA 1V5EA 4R79A 5L3DA 3SEXA 3FDYA 4NQ8A 1KQ9A 1MXYA 3M3LA 1AHDP 1B3GA 5CRYA 3KP4A 4MX6A 2PI0A 4QXDA 3LMMA 1AL3A 1P1NA 1UIVA 3Q0UA 2NNYA 4EF1A 1DGWY 1P4AA 2QGUA 4BHCA 3QYBA 5IOYA 5L3CA 1Y1MA 5I59A 1SFXA 3QPTA 4UV8A 4MEVA 4OFOA 3TL4X 3S4UA 5BS6A 2Z5UA 4ENJA 2VOOA 5H6RA 4RGUA 1YPNA 1Y1WJ 2XX7A 1IXGA 3VB2A 1LAGE 1Z7ME 3SEVA 4F55A 2O7UA 3B6AA 3F8FA 1VQ7I 5J1DA 2L5QA 2NS0A 4PE5B 2BBYA 2ZO4A 3OWTA 3ZQHA 3GVAA 2ACJA 1R23A 1NH3A 1AKHA 1J9IA 4FIMA 4XLPF 4A3GJ 4L17A 1G3SA 3OYKA 4GWYA 3OYEA 1UIUA 4NHJA 1XS5A 4GWWA 2B9SA 3C2GA 5BUUA 3WGGA 4UUVA 5EGOB 4X1DA 3C2HA 4L5EA 2BY2A 4Y7NJ 1YHQI 1BC8C 2YUSA 2ESHA 4YIRX 2NAZA 1IF1A 1NK2P 5ISUA 1FZPB 4IY6A 3EUAA 1P4XA 2F97A 2EZHA 2XXKA 4HTGA 1EZPA 1ITYA 4EM2A 4LK0F 1R4NB 2F78A 1IMCA 2HAVA 5TU0A 2E60A 4E7ZA 1A99A 4GX6A 4PP0A 3BTJA 4KUMA 4PJLA 2XWVA 4S05A 2VQHA 3Q0VA 2KLFA 4TOZA 3SYTA 2FF4A 3SZTA 1ORKA 1JKOC 1YS6A 4M9ZA 3FV1A 4JSOA 3R61A 1EZOA 4E7SA 4JVDA 3DQVC 1Y9UA 4XRFA 3H6UA 2O6AA 2R7OA 4N4UA 4IO6A 3IKVA 1ZLQA 4BE2A 1HSLA 4PDKA 2OV7A 5AE4A 3LA2A 2ABHA 3U92A 4QFNA 3UN6A 4AQ4A 1MBHA 1NHAA 1DPRA 1K78A 3K4CA 2GHBA 3CC2I 3U72A 1RKMA 5IP9J 2E7WA 3BP8A 5KAFC 1DTZA 2ANJA 4THIA 3RNNA 1URGA 3P9KA 1YXIA 4Z0IA 5LHHA 2H99A 3L09A 2JMWA 2HS5A 4LD5A 1A8EA 3CCYA 1AMFA 4H4KC 1FBUA 5J8FA 4I1DA 2O84X 1B3EA 4AIDA 3FM5A 1ZELA 4A3KJ 1AWBA 3I4MJ 2L3DA 2O69A 3OENA 4HYEA 4E7HA 1MXVA 1JHHA 2F7AA 1U9OA 2QKMB 2QMWA 2GXAA 4HAMA 4BQOA 1O7LA 2PEXA 5ICFA 3I4PA 3CRBA 2DA6A 5FO5A 5FROA 4BJ5C 3E5UA 1IXHA 5LGNA 1IIWA 3KBZA 3K1NA 3PNTA 4UV9A 2UXAA 3ZXSA 3H06B 3HN0A 5F1QA 5IY5H 1U5TB 1V5FA 2IEKA 3OSRA 2CV1A 5ESYA 3TDUC 3GTQJ 3NWSA 2FIEA 4PFOA 4A3FJ 2F3BA 2E19A 2DK8A 3G4SI 4QSDA 1TQPA 3OYHA 4KXPA 3VSLA 5L8DA 2KIUA 4ZS9A 4H45A 1MKMA 4MEXF 1D0YA 4OQOA 4C1TA 4EQ7A 2DJIA 1Q9DA 1BIAA 1JW4A 3R6UA 4AB6A 2XXVA 3TKDA 4POWA 1V4RA 3E1SA 3V7SA 3FBIB 3PPRA 4ASNA 4P3LA 4L9JA 1LJ9A 2LKPA 2L54A 2QUFA 3VYTB 5ET8A 2O7IA 2H6BA 3MZ1A 1LKXA 3CJNA 3RCOA 2BJIA 3HL2A 5LRRA 2XROA 1GDTA 4CYDA 4U4SA 2H4IA 2DT5A 2FSWA 2H94A 1NMUA 3T22A 1JHFA 3QYEA 4O7IA 4PC9A 3TEPA 5M3FJ 2R92J 4ENKA 3LSIA 4NMYA 1MW7A 4I01A 2V84A 3O8GA 3RGYA 1LFBA 4YIFA 4OYVA 3OOPA 1B52A 2Q1ZB 4PFRA 1GV2A 4M3BA 1CGPA 4QPQA 4YB7A 5DVIA 3SZGA 4BAYA 3GFIA 3GFMA 4IRIA 1LEBA 2ZSIB 1H8AC 1L0OC 5HOOA 1ZMGA 2QYOA 4IQJA 1SD5A 1ZH5A 2KDZA 2VJ5A 3SDGA 3PD9A 4FE7A 5TP9A 3TOAA 2AHQA 1FWZA 2LRDA 2XRNA 3K1MA 1NV2A 4PGHA 4Q48A 2R71A 4RAGA 3D5RC 4AU7A 2Q0OA 4EM0B 4ZTJA 4ESFA 1RRJA 1LBCA 2XWIA 1WZ2A 2XWOA 3ZN0A 3LQQA 3DBLB 3MZ8A 2E1MB 1YAEA 3RJPA 1SMYF 3C3WA 1IUDA 1S7EA 2HPIA 4KMFA 1OYYA 4JVCA 3BFUA 3I59B 1XN7A 3OYMA 3LSHA 1XOCA 4JBZA 3BG7A 3GTOJ 1JXSA 3HXLA 2EIMH 3I56I 1WJAA 1EZ9A 1SMTA 2R6GE 4XKNA 3TTKA 4AYBN 4L5JA 4XRMA 4QTRA 2E2HJ 1FMVA 4FX0A 2X7QA 3RDIA 1LDKB 2ZC2A 2NYXA 2X6OA 3TEDA 2BV6A 1IN6A 4ZJZA 2OJTA 2V3UA 3KLNA 1NV1A 2RC7A 3C31A 4FETA 2FD5A 2ZMEC 2K86A 1LNWA 4UNOA 3I5UA 2V79A 1HW5A 2A6TA 4F22A 1VI0A 3H6TA 3QK6A 3FIWA 2DW4A 4MQ9F 3S9NC 2HYGD 2QL3A 2D5WA 4R75A 4ZEFA 3OS2A 2XF6A 4WCGA 3TOBA 2NVXJ 3U1OA 2D21A 3CDIA 3KEOA 4XIDA 5KDTA 1C0WA 3BQZA 2L9VA 4II2A 4EJTA 2K9QA 2HOTA 5IZ3B 1WQ2A 2Z23A 3TTNA 1UELB 2ISZA 4LATA 2OK2A 2P0WA 1X4PA 2ECCA 4OIRF 2ID3A 4N13A 5IZ3A 2IS6A 2GHAA 5LGUA 5T3JA 1A54A 2EPFA 1OISA 1JUPA 4KN7X 3LWFA 3TO7A 1N04A 4MGRA 1G8XA 3P9IA 2WWYA 1OQHA 4BQNA 5EQAA 4TLLB 4XKWA 1OVBA 2DT6A 4PFUA 3BC8A 3LFKA 2QPQA 2NRAC 3I3VA 4EJWA 1XS9A 3IAS2 4AVPA 5B5EC 3E6CC 3H3VK 1X58A 4FECA 2IA2A 3NAUA 5F04A 2IGNA 4Y13A 1YJWI 1WI3A 3ML6A 1LFIA 3K4LA 2CZHA 3KYDB 1H43A 3HOXJ 4IGRA 2ZKZA 1OCCH 4MO7A 2DWHA 2FEZA 3H9JA 3V8LA 3RKXA 2PLYA 5B70A 5FFZA 3T5XA 2R7FA 3VDXA 2I48A 1JTYA 1XC5A 3A01A 4I8CA 3OL3A 3SEZA 4PGGA 1HSEA 2VPOA 2M0CA 3R60A 3K6XA 5JEIA 3H9GA 1AKHB 1NKXA 4UA8A 2ICWG 1TXFA 2M34A 2RC4A 2K9NA 3KLOA 4LIUA 3IJOB 4UABA