1IZ1A

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Dna binding protein
molecule keywords LysR-type regulatory protein
total genus 92
structure length 292
sequence length 292
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1iz1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A02
4JK1X 3UN6A 2W25A 3TKDA 3DPTA 3PPNA 1UIVA 4R8HA 2O51A 2WV0A 3IB0A 1XC1A 5LEJA 2RCAA 3T22A 4H5FA 1ZN2A 3Q9SA 3I54A 4HV5A 2ESNA 3MP8A 2P1SA 2UVJA 4ZEBA 5TP9B 4FAJA 2CSOA 1FCKA 5ISUA 1MKMA 1Q1HA 4XBFA 1B05A 3PPOA 3DPLC 2QQ9A 3G3HA 3K6WA 3PV0E 4HX4A 5EEGA 4L0YB 3F8BA 4F1UA 5D5UB 3E6BA 1SMTA 3KLNA 1B3EA 1J2XA 2J5PA 3ROUA 1OIBA 4M6YA 2MLKA 4EJVA 2ELHA 3FJMA 3N26A 3F8FA 3I4PA 3QU6A 3ILTB 4E70A 4ENKA 1TQMA 1CF7B 2MA3A 3J81Z 4L17A 3CO7C 1OQHA 5AONA 1LLSA 1M5BA 2ZNZA 4X1BA 3ISPA 1FOKA 1S7YA 4K2EA 4FECA 4OZ9A 4NF6A 3MUQA 3M8FA 4RS8A 3HCQA 2BGCA 1U8RA 4F3SA 1IN5A 3IO6A 5JVTA 1G3SA 3PD9A 4KIGA 3F8NA 3RNNA 2HYFA 4U0VA 4ZZDA 1TBXA 2Z9OA 1JW1A 3HHHA 1KWHA 1ATGA 3C7JA 2H98A 5KZTA 3L6HA 2DPUA 1SD6A 4A6DA 2I49A 4C1TA 3Q27A 5E1XA 1P92A 5H8QA 2DQLA 1QKBA 1ZKBA 3ULQB 4G7HF 1FLIA 1MM7A 4LLGF 3FHZA 2ESHA 2HKXA 4KIBA 3G3FA 3K2ZA 2VOPA 4M9SA 1R36A 4ZDMA 3VVDA 3WODF 1UB9A 2Y0MA 2OJTA 3T66A 3OD7A 1V4RA 4GL0A 3O6BB 4PFTA 3T5XA 3THIA 2P8TA 1V3FA 3I5UA 4H6DA 2MH2A 3WGGA 2W57A 1WSUA 3FVGA 2JPBA 4ZZLA 2XHDA 3O6GA 1R1VA 3R61A 3U93A 1VTNC 1QUKA 4NB5A 5FFXA 3MWMA 3WTZA 1QJMA 2A5TB 5CBSA 3N97A 1JW5A 1M5EA 4KHZE 2ONKE 1XGMA 3SZTA 4R9GA 1Y4CA 2QM3A 3KP2A 1JGSA 4NF4A 4ASNA 4AQ4A 1VFDA 3OMBA 3TDZC 5DD8A 1LFHA 2L54A 2ZMEA 4I9DA 2EWNA 1DPUA 5LHHA 1PDNC 2RV8A 4KCCA 4N13A 4XKNA 1P4AA 2WKYA 3Q26A 4Q4ZF 1MDQA 4GXSB 1MXXA 1KQ0A 4ZYHA 4U1OA 2M5WA 1YLFA 3RY3A 4BDNA 2G7HA 1PBQA 1F4KA 3ZPLA 1FX7A 3TCGA 2DO7A 2UXXA 3TUSA 3LSWA 2CWEA 1S6LA 3FXUA 2M30A 2DFIA 1O3SA 2A69F 3LFKA 3OEKA 4GXOA 3RTWB 3RQTA 4FT8A 1IRGA 3J7AO 2D3IA 3RN8A 5ITOA 4KYWA 1KU3A 3PUYE 1H9GA 2G7UA 1MXVA 5LHGA 3N6TA 2I3VA 4K3FA 3R7XA 4G8XA 3IK6B 1F9BA 4XKPA 2GA2A 2F34A 3VV5A 4UVCA 2DE2A 4ZEKA 5DCFA 1YW7A 3PUVE 1RI7A 4FIMA 4HS7A 2DLLA 4D0PA 2H9BA 1QNTA 4AIHA 1S8NA 3CSBA 4G7OF 5FHMA 2QJEA 3LSXA 4UXNA 3BROA 3R60A 1OQGA 4Z0IA 2PMSA 5DV5A 3CUQC 2Y7WA 2Y84A 3QUJA 4DCXA 4EM0B 4R9FA 3NEUA 3MAMA 5I56B 1LB8A 3V5AA 2E1CA 4LQ5A 3FJ7A 2EFOA 1NHAA 2KIUA 3F8CA 2FNAA 5KDTA 5DCMB 2DWHA 1POTA 4LFUA 3T0YA 3S9EA 5FD6A 2NNNA 1LEAA 1XN7A 3KG2A 5K5RA 5ICEA 2PBWA 1CB6A 4DXUA 2GXBA 4ND9A 1ZAOA 4JWXA 4M4GA 4ZECA 1G3WA 4G7ZF 2LF7A 3S2VA 5I2KA 2DBBA 3KEOA 3CFLA 3MP1A 4IGTA 2OBPA 3FWEA 1LCTA 1FQCA 1R1TA 1ZREA 3DELB 2PT1A 4PFWA 1JQFA 2KKOA 2VE9A 3HSEA 1K78B 2I6EA 3TFLA 3KP4A 4KYSA 4RB0A 3RT6B 4GVOA 4M71A 2H4IA 3KLOA 3FASA 3E9XA 3FVKA 4EJUA 3D5LA 4NF8B 3REOA 4GOTA 4X48A 5BOXA 1O63A 3USDA 1OVBA 4RB3C 3HTUA 1BC7C 3V7CA 3WE2A 1FBSA 4CDGA 3FJGA 1GXQA 2GHBA 4U4XA 4IRHA 1YAEA 1MGTA 1HQCA 1FYMA 1N84A 2FMYA 4I0AA 3ZN0A 3FUZA 1A40A 1DPEA 2F8DA 3LBSA 1JE8A 5JFRA 1ZTYA 4ZE8A 4OESA 3N94A 3I59B 2M8CA 4DXCA 4LQ2A 1SFEA 4XRFA 2I0CA 3HSTA 5KCJB 2P4WA 4X9TA 5FHOA 4QFPA 2QS1A 3ZKKA 4P5OA 2QMWA 3IX1A 1I5ZA 3D0SA 2WWYA 1U78A 3VLUA 3E97A 2Y7IA 4OOIA 3JYRA 1Y3PA 3G3JA 3TQLA 2FQ3A 3MVWA 2BV6A 1U2WA 3ZMDA 3OOAA 4KICA 4R2FA 1ZMGA 1XDUA 4YG2F 4KYDA 2A6EF 3PGFA 2XX8A 1B4HA 1JETA 2FMLA 1FYKA 1FTKA 5FTHA 2Z23A 4NWCA 1HSJA 1TWYA 3GBBA 4ZYGA 4MF3A 1WRJA 5L3DA 3F11A 2QENA 2KRFA 1KU9A 4NQWA 2NXOA 2AXLA 4BH9A 1MXZA 1XGOA 2H27A 5K1YA 1IAWA 1IXHA 3JZJA 4A12A 1DPPA 4OWDA 3QU3A 5LOMA 4UV9A 1UTBB 2Y7KA 1B5IA 2ALUA 3ODBA 3FZVA 3VODA 5DVIA 3K0VA 2HQRA 1MY4A 1BLFA 1BTJA 1MY1A 1ZIUA 2ZNUA 3U2RA 1ZJLA 1TQPA 4O3CA 4DXBA 2PYYA 1FQBA 2ZXJA 4ENJA 3S9NC 3VEPA 3CIJA 2UVIA 3JTHA 2XIGA 4NEDA 2KLFA 4HQMA 3G73A 3KFWX 2Q2CA 2JTVA 2CO5A 1MQDA 3HHFA 3HO7A 4L5JA 3FM3A 2FNPA 3LQRA 5JTYB 1LFGA 1MRPA 1NH8A 2G9WA 4Y15A 2V3UA 3MZBA 3E3KA 3TTMA 2QRYA 2VBWA 2XUBA 4YKPA 2XXWA 4FX0A 3GZGA 3B73A 1B9NA 4I2OA 3PUXE 3O9PA 3IB2A 3LUYA 4U7BA 3IWZA 4RGUA 3PU5A 4YKKA 2PG4A 4EVIA 4EUOA 1Y0UA 4G68A 1MD0A 1PP7U 2HQNA 3OOPA 2PX1A 1ZLJA 1B5JA 1G6NA 2OBGA 3DQVC 1MDMB 5HS9A 1FP2A 4Q5TA 3PPRA 5TPAB 4IO3A 2Q8JA 1B7HA 3RKWA 4MBPA 3H3GA 3MPLA 5AA4B 1ZRCA 3MVZA 2MLGA 1RNLA 4I01A 5BPIA 3H3ZA 2XXIA 2HYGD 4OMYA 4GO1A 4OFJA 3F6VA 3LSFB 2RC8A 4G6DA 2O1MA 3OEMA 3EUHA 4IY5A 2IW5A 4IO4A 4U2RA 4B09A 1XMKA 4LZ5A 3R0JA 1Z6TA 3VLVA 5FGMA 3TO6A 4XKQA 2XROA 2D5WA 2V6CA 4I7HA 4FEBA 1LAGE 2NNYA 3ZP5A 4YB5A 3QAXA 2P6SA 2BYVE 5H8HB 4ESXA 2HS5A 1PDAA 1XSXA 4ZE9A 4RAYA 2XXYA 5DTBA 5AIPA 4QFLA 1C0WA 2HTJA 1ZG5A 4QSCA 4HW0A 5FB2A 1GGGA 3OO7A 3WAFA 3SZPA 3J80K 5DCMA 4P55A 1R58A 2GZWA 1YYVA 3TKYA 5BPDA 3GWZA 4TQUQ 2FOKA 1ZYRF 4U7DA 2FBIA 3D4GA 1GR2A 1HXDA 1ZGJA 3BJAA 3SEXA 5J8FA 3L6GA 4EM1A 5D4SA 4KI0E 2V25A 4Y17A 1J5YA 4KMFA 1D3KA 3PMXA 4WEDA 1UFMA 1SI0A 4F22A 4OQOA 3G3IA 4EQBA 1WDNA 1FQDA 4G8HA 5CLSA 4AVPA 5H20A 4L9VA 3TCFA 4BHCA 5CVUA 2F7BA 2FA7A 4G4PA 4IO2A 2M45A 3ZQ7A 3C32A 1SYIA 1WODA 3ZKLA 1RIOH 3O6IA 2STWA 4MQVA 2FA5A 4MH5A 2VXZA 3FIRA 2RC4A 3FMQA 4GQOA 1G4DA 4KYEA 4O5VA 3EPEA 4LLLA 5LRSA 4EF2A 3ONMA 5H8FA 1NNTA 3TTLA 2RQPA 4HTGA 4M73A 4WX9A 3M3LA 2REGA 1U5TC 2HZKA 5B7DA 1UTBA 4LA9A 3F72A 3BKIB 2LDUA 5H6RA 1NNFA 3M1EA 5HPQA 1MY0A 2DT5A 5F1RA 2F5DA 1SD3A 3B6WA 5ELVA 3WE3A 2O68A 4JDFA 1JW4A 3B6TA 4GLIA 3NRVA 3RKYA 4BDMA 3MFKA 4KR5A 1AMFA 2AYSA 4U88A 3EF7A 2HCAA 1NFTA 1O7FA 1QZZA 1R5GA 4LGWA 2L01A 1QPMA 1LGBC 1I6AA 1TXFA 1T39A 3K69A 3U92A 3CFXA 3QOPA 4C1UA 2P5KA 1Z7ME 3W9VA 1B6AA 2IA2A 4JWYA 1H44A 4L9JA 3T9VA 3RLFE 1R22A 2GWRA 1RKMA 4H67A 5I84A 2D21A 4HV6A 5BQTA 4R6HA 3GFMA 5D8LB 4BDRA 4HDUA 1MPBA 3RYPA 4JBZA 2YX7A 3VE1B 2EV6A 4KN7X 1Z9CA 3GW2A 3ABTA 1T98A 1K78A 4MTDA 2DP8A 4I62A 4OYVA 2B65A 1ZRFA 2QQBA 4NF8A 3CJNA 2QVOA 5L9SA 5A5XA 2EV0A 3HRTA 5CMKA 1AWCA 1JEUA 2DSFA 2YPNA 3ZSFA 1LBBA 1B6HA 3SEVA 1MJ9A 4S04A 3OSRA 4M1VA 4R2BA 5BS6A 4MEXF 2OLBA 2OWSA 3JTGA 4LONB 3TDUC 2KJCA 1XB4A 4RNSA 1A55A 2V3TA 2F5CA 1IN8A 3RUMA 2EFQA 1IN7A 1R7JA 3K1MA 4OIOF 3DF8A 4IXAA 1Z6RA 2G93A 2PI0A 4XIGQ 1ONVA 2PEXA 3ABUA 1ODDA 4AD9A 2HKOA 3ZN1A 1LB2A 5LLQA 1SYHA 2GHAA 2RC7A 2YX4A 3IJXB 1BI2A 1FTMA 1YS6A 2QL3A 5TPAA 4IO6A 3VFJA 2K7LA 3I59A 4LG0B 3V4GA 3PUWE 2ACJA 3VLWA 1GVCA 2Y48A 3C1DA 1SFXA 1J7KA 2QBYA 2D45A 1FC3A 2ZKZA 4AWXB 5F6FA 1SBPA 5BWJA 2F5EA 3QRFF 4OTEA 2PBIA 2A6HF 1MS7A 3K01A 3BFUA 3UIFA 1W7PD 3FD3A 2YSRA 4NHJA 3ZMZA 1Y20A 2HFBA 3VVEA 5EEHA 4IGRA 3LSLA 4IPAA 4RK2A 1LBCA 4IF4A 4NMYA 2MBFA 1AH5A 1DTGA 1S9TA 4OETA 3L2CA 2P7CB 3IOWA 4YKIA 2KIMA 1MQIA 1XVXA 3P9IA 2L4AA 4XSXF 3DFGA 2IRFG 1UIUA 2EB7A 1HKQA 1EZPA 1OKRA 5K5OA 1ZGAA 4U21A 1B9JA 4HAMA 3ZMUA 5ICFA 2XXRA 1B3HA 5JEIA 2F78A 5AA2D 3JSPA 5H8NB 5TRDA 2IVMA 2V79A 5HM4B 2CFXA 3L9FA 4F1VA 2M8EA 1BBYA 2A61A 4I98B 2JRTA 3ZMVA 3HRUA 3HSFA 1Q1KA 3KJTA 4GL8A 4Z2YA 4QF9A 3JW4A 1KU7A 1KYWA 1S29A 2OZUA 3PD8A 3CSGA 5D6FA 2HEOA 1QQIA 5CVJA 1OMIA 3MEXA 2THIA 3BBRA 3G3GA 2BE5F 4HOBA 2K86A 1HW1A 4MNUA 1LVAA 2A3SA 4OIQF 4RYAA 1SW5A 1D9VA 2VBZA 4EXLA 3K6VA 3C36A 4LATA 1QVSA 3H92A 1YIOA 3IKTA 2Z22A 2QYOA 3GF2A 1KU2A 2UYFA 3ELKA 2JZYA 2XAFA 3RTRA 4FATA 4HX7A 3HUGA 4XXUA 1H76A 3I5OA 1IZ1A 4CHUA 1BI0A 2ZCWA 4OIRF 2AIXA 3H4ZA 4QFOA 2UYEA 5H8HA 3I53A 3N5LA 2DU9A 2HZTA 3MZ1A 3RPUA 2OA4A 4JSOA 3A3UA 1FTOA 3E6DA 2L4MA 1EZ9A 3IOTA 1DDNA 1II5A 1HSEA 3TCHA 1X3UA 3R0AA 4BXUA 1KQ9A 3PQJA 3QK6A 4GRKA 2I4BA 1W5TA 3T9HB 4XTCQ 5E8GA 1XCBA 1BI1A 1A8FA 2DE3A 2FBKA 4LB5A 1TQIA 4QSDA 4ZEDA 3VB2A 2P5LC 2HZLA 3IRRA 3GYHX 5K5QA 3R6UA 4WWCA 5LGNA 3CFZA 5CM6A 1IXSB 3KE2A 3E6CC 4KN4X 3T8TA 2FXAA 3PUZE 4YKJA 2OK2A 3BPVA 3QAHA 4QWQA 3QPTA 2FE3A 1QGPA 3FGSA 3BJOA 2I58A 4IB2A 4P0GA 3OO6A 3EQLF 1SAXA 3H6WA 3PPPA 5I57A 5A5XB 1JHHA 5DDGA 4F3GA 3IAZA 3SFZA 3P9KA 3CR9A 2VOOA 3TTNA 1LSTA 1NNKA 2DI3A 4NF5B 1A8EA 3PMVA 1CF7A 3WTXC 4HX8A 4RB1A 2HDCA 3BDDA 4EQ9A 1QO0D 5DEQA 2GIVA 2GH9A 4R73A 2EFNA 2XAGA 4ZZEA 2RDPA 5H8FB 3U9GA 4IRIA 3J81K 3SESA 3LQQA 2QWWA 3PFIA 3W6KB 2Q2EA 1D5VA 4L18B 1IQ7A 1B52A 1SQYA 2BEOA 4I1DA 1I1GA 4YB6A 3C33A 4GIZA 4CO8A 3P7IA 4YICA 1JVXA 4RPNA 3H3UA 1U5TB 4Y13A 1ZU0A 4JQFA 3TAJA 1EU8A 4OMBA 2I0BA 2FF4A 5IT3A 2ETHA 3GLBA 1YW9A 3FMRA 2X0LA 3Q9VA 3TOAA 1B40A 1UHWA 4YFNF 5D5VB 4YAHX 4L9NA 4G68C 3F3XA 2DK8A 5HDNA 3OV8A 4HLXA 4GGGA 2H09A 4AB5A 3IRQA 2HQ0A 2V9VA 5K2XA 3V89B 1M5FA 5H6QA 4F2OA 3CTAA 2VD3A 3T9XB 4MLVA 2GA1A 1Z1DA 2A5SA 4DIGA 1HW2A 4YB7A 4Q5SF 1HW5A 3PQKA 3VDFA 5CMBA 2RKHA 4PE5B 1HKTA 2M87A 1U3EM 1DUXC 1BM9A 3IORA 4HDVA 2R7DA 4EJTA 5FTIA 1DSNA 1SMYF 2E7WA 5I2NA 2XXPA 1R1NA 5TJJA 1ZBMA 2F6PA 1T0KA 1SW1A 4I0BA 1N0TA 4LVQA 3TDJA 3DP7A 1B0LA 2W84A 3VFZA 4DE8A 3KP7A 1RUOA 1P1WA 1TW2A 2CG4A 2MD5A 3O3KA 3G3KA 3HN0A 1S50A 4RXLA 3KBRA 3RPQA 3H6TA 1E17A 2XX7A 5ILSA 3KZGA 3CG1A 5BMZA 2M1BA 3MJNA 3IL2A 4R75A 4JWOA 4UVBA 1Z05A 1N7WA 3FXQA 4H8IA 5FO5A 3O29A 4TLMB 5HBCA 2VBYA 1XSVA 2OD5A 1MH4A 1XOCA 4KNYA 1A7LA 4RY1A 2P6TA 4G6QA 2FYIA 3CUQA 2ZMBA 4BQAA 1HBXG 3QXMA 2ZNTA 5JI6A 2F7CA 3DP4A 5D6EA 5F7VA 1O3TA 2OAZA 1Y1MA 1IXIA 5ICCA 1FQAA 5TP9A 3VXCA 4EQQA 2RVCA 4QRZA 3V8LA 1MQJA 4N07A 3Q28A 4UHTA 3MZ9A 2DE4A 1XMAA 2H94A 2OZZA 4A2UA 1XT8A 4U23A 4EGYA 2XXXA 2QUFA 1RYOA 4PFUA 5A2QK 2VC1A 3SERA 2QS2A 3QP5A 5DYHA 4F19A 2R7FA 3WTTC 4G8MA 3I6VA 2NAZA 2OQRA 1FTLA 2BBYA 2FU4A 3FF5A 5TU0A 3VXBA 1USSA 2UXNA 3HOTA 1N3XA 1D4NA 3T96B 3HPIA 3GVAA 2I3WA 5EHSA 4GYGA 3CDHA 2UZKA 3TQWA 1TNSA 1FSHA 1FBUA 5ICQA 1EV7A 2Z33A 5CVIA 1B3FA 1N7XA 1YG2A 2ZYMA 2XXVA 2HOEA 3S4UA 5ICTA 3HOSA 3HV1A 1LAHE 2VD2A 3QSLA 2XXUA 2FBHA 3H03A 4NF6B 4XLPF 2V1XA 5D8KB 3C9HA 3KOSA 4C0RA 4AIJA 4KUMA 2GAUA 2XKPA 4N6PA 1L5TA 4QFNA 4P96A 3MPKA 1DPRA 2HEUA 1WKMA 3T9UA 2EA4A 1MY3A 3SQNA 4HF0A 1O3QA 1WWXA 5CI5A 2DWIA 2LSOA 1IITA 1QUIA 3GXAA 2QMXA 1IW7F 2HXWA 3EN3A 2E1NA 3O6HA 1YS7A 2PN6A 5HDGA 4H1XA 5F64A 1PB9A 2XD3A 4B8XA 3UA8A 3IL1B 2LAOA 3E5QA 3DXJF 2KIFA 4Z7EA 5CVVA 4CGZA 2FEZA 1JXSA 4PZJA 1TT1A 5L8DA 2FNCA 3L00A 1ZARA 3O97A 2K4JA 2OU2A 3U1OA 2H25A 1FT9A 1OLCA 3E6MA 3S9MC 1O7TA 2V93A 3F8MA 2ZMEB 1LDKB 2VE8A 2O6AA 4MEYF 4OENA 5DT6A 3UGWA 2NWJA 4DNCA 4P9UA 1OYIA 4IHSA 4CICA 3FVOA 4DDDA 2CW0F 1XSDA 1QW0A 2A5TA 2DWAA 3KFMA 4ELPA 2NOOA 4JBAA 2LF8A 2QSXA 4MQ9F 2D2WA 3BY6A 3C3WA 1A54A 3GEZA 5HVQC 3QIMA 1F1ZA 4OEVA 3KEIA 1FZPB 5J1DA 1VSOA 3D4CA 5DYMA 1IXCA 1KGSA 1EZOA 2YLNA 1OLAA 4DLDA 1P1UA 4OVJA 2G29A 2F97A 5CMMA 4GXAA 1O57A 3F6OA 4BHPA 1RYXA 4KIFA 1MQGA 4CXFA 4HF2A 2P2AA 1TLHB 1LEBA 3BP8A 3O28A 2NYXA 4G2ZA 5JHUA 4KQPA 2OCUA 2KJBA 5J8CA 1N3WA 4O3MA 3RDIA 2V1UA 4THIA 2D1HA 3BFTA 5I2KB 2DWJA 4HCWA 1YCJA 2DVZA 1W5SA 2YR2A 1LAXA 3F21A 2IA1A 1OYYA 2HR3A 3M3FA 3OO8A 5BUUA 3LA3A 2A68F 1B4ZA 4R6KA 4NTLA 4OU0A 1B3GA 4FE8A 3Q25A 1P6RA 1YFHA 2DS9A 1OYWA 4AB6A 5E17F 3L09A 2VT2A 1D8KA 4YIFA 1FW0A 2EFPA 1I6XA 3LWFA 1XS5A 2K02A 6PAXA 5AA1A 4HYEA 3VVFA 1MY2A 3ZMTA 1AL3A 5FD5A 4PFYA 5DUIA 2O1LA 1BP5A 2JT1A 3K2DA 1D9YA 3CUQB 5EHMA 1J59A 3V83A 4MHGA 5ILUA 1R5HA 4KPTA 3J80Z 4WXDA 4QFKA 3MZYA 2ZXTA 4PETA 1R9LA 3WGIA 1REPC 5AA2A 3KGCA 4LZ8A 1SVXB 3G7WA 2H6CA 4U0WA 2ZNYA 4WXCA 4I02A 3QPHA 5FFZA 3K4UA 5H8SA 3Q29A 3CRBA 3B02A 2QQAA 1MPCA 2XX9A 4BDQA 3TO9A 1MM6A 3KP5A 4H8JA 1YW8A 4G8NA 2LKPA 4O3AA 1RZ4A 4NF5A 4EDPA 5FLXK 1Z7NE 2F7AA 4UACA 2IA0A 3IC7A 1UQWA 3SKPA 3SEYA 1DP7P 4DCYA 2K4BA 2F5FA 3KEQA 1B9MA 4YU0A 4GD5A 5I57B 1MJAA 2W7YA 3SEUA 2H5YA 1B2HA 3EQ1A 5LRRA 5HDKA 1XDSA 4POWA 3TPAA 4G9YA 2EK5A 2TDXA 4OIPF 3EYIA 1ON1A 4IO5A 4PQJA 1IUYA 2EJRA 4Q0CA 1SDXA 4M9ZA 3MBPA 1TW3A 1U5TA 4A5NA 4IY6A 3KN3A 5K2YA 1GXPA 1FQEA 1WQ2A 3OELA 1CGPA 2XHKA 3W15C 1O7LA 2ZBKA 4X1DA 1LJ9A 2R3SA 4RB2C 2GRVA 2MC3A 1OMPA 2UVGA 1NH7A 4A0ZA 1FSEA 1OR7A 3U8QA 2ANJA 4EJOA 3HRMA 1BI3A 4GFRA 4G94A 3OO9A 5L9OA 3KP3A 1B7UA 2A5YB 2VGQA 4LUBA 3FX3A 1LNWA 2YPRA 3FVNA 5CMCA 2IEEA 2GQQA 2VT3A 3MC2A 2AL4A 3O2PE 1GVJA 3ML6A 1A99A 3RT8A 5HS7A 4A5MA 4ESWA 1EH6A 3CUOA 1USTA 1GV8A 5I2NB 4GF8A 5CBRA 1IXGA 1MDMA 2ADUA 3T93B 3TTRA 3K00A 2O7UA 3TELA 2VBXA 2Z5UA 3VOEA 4ESBA 3GUDA 2DXRA 1B7ZA 2XRNA 4ZZAA 5IAIA 3V8JA 3B6QA 3LSTA 3FATA 1SD5A 2XAQA 3DP6A 3I58A 2ZO4A 2P7VB 3IR1A 4KMUX 4QHQA 3CLOA 1KA8A 1JHFA 4LLNA 2O6GE 3WTSC 2NRAC 2O84X 4RGRA 4A0XA 2P0SA 3MQ0A 3UP9A 4L0ZB 3WU0A 5CRYA 3RYRA 3E5UA 1POY1 4U0YA 3TTKA 4FX4A 1Z7UA 4UVAA 4EGZA 1TNTA 5L9MA 3R4KA 1W7PB 1FWZA 4WXHA 4XLNF 1ZH5A 3SHFA 2ONSA 2DAOA 2HAUA 4E0XA 2W24A 1FP1D 5LHIA 4ECFA 1XGSA 2Q9TA 3O66A 1SD4A 3BZ6A 1RUNA 1T0FA 1IEJA 1SI1A 3FV1A 4PGGA 4ENNA 5DD4A 4HA8A 2B0LA 5CVRA 2O69A 2GFEA 4R72A 2UWMA 1T2KA 4YMBA 5ITPA 2Q88A 4FJPA 1O3RA 3P9CA 4CYDA 1MG1A 1MPDA 5M2VA 2R71A 4HW8A 5DUKA 1USYH 4M6XA 5DVFA 1P4XA 3WAEA 2Z99A 3HIFA 4ETSA 2XXTA 2R6GE 4WXJA 1J9IA 2XASA 2P5VA 3ECRA 3N6UA 4UA8A 1T6SA 1ZRDA 2IPQX 1SD7A 3KZYA 5AA2B 4CZZA 3I0TA 1K6OA 5B70A 4F3PA 1QZYA 5AE4A 4EF1A 4EQ7A 2COMA 2CGPA 3AXFA 3KSJA 4U4SA 2PVUA 1PUEE 2ABHA 3MQ9A 2HTSA 1URGA 1BOAA 4YMAA 4OERA 1IN4A 2HFHA 3K0LA 3RTFB 3QP6A 1IRFA 3EHSA 3F22A 4UV8A 1R00A 3HHGA 2X4HA 2OQGA 3WTYC 3H6UA 2V3QA 2BJJX 1B32A 3HYIA 2RCBA 1ZHFA 5A2QZ 2ZNSA 1EH7A 3TEPA 4OFOA 2QZ8A 3SETA 4ENMA 3M9AA 1R23A 2MH9A 4L9TA 2QBYB 5DEXA 3P7NA 3ZMSA 3GFLA 3GXOA 1I27A 3FM5A 3JSOA 5I59A 4R74A 3BPXA 4O3BA 4EXKA 4R1HA 3Q5FA 4WKMA 5FHNA 3DV8A 1BIYA 2PJPA 3JAMK 5ERIA 2AL5A 1G3YA 2DVCA 2K27A 1I6BA 2D1VA 5IT9Z 1MQHA 3BJ6A 2ZFWA 3MP6A 5JR3A 1H3DA 4RPOA 4ZEIA 2CQKA 4IRGA 3DKWA 2GXGA 3ZS6A 4NWDA 1PP8F 1BC8C 2B3FA 3M3KA 3RPWA 4LK1F 3WGHA 3MZHA 4O6JA 3K1PA 1H45A 1P99A 4M72A 3E3VA 2QLZA 4QLCU 1E2XA 1IXRC 4EMSA 4S05A 2F35A 2UVHA 4R79A 5LGTA 2RN7A 3KP6A 1L0OC 2XKOA 3I64A 1J75A 1R6ZA 5KK1A 2DQRA 3MVYA 1U6GA 2H6BA 1A04A 4RAZA 2DPDA 1S7AA 1NMUA 1PB8A 5CJ9A 2Q2AA 4KA4A 1ON2A 1ZLQA 2Z3YA 1J1NA 4ZEFA 4RGSA 2C6YA 2QPQA 1LAFE 1PBPA 3DM0A 3IKVA 4PP0A 4DZ1A 1NKXA 2Z8EA 4HQEA 4U22A 4G77A 4Q8RA 4BDOA 3ECOA 4IJAA 4WK8F 1BIBA 4BYYA 1DMBA 1AOVA 3HSRA 1QULA 1F9NA 5J6XA 4BAYA 1KYZA 1FQFA 4Q48A 1P1QA 2V84A 4UUVA 3C18A 1XD7A 4NE4A 1WI9A 4MLQA 1D3YA 4ZYDA 3W9WA 4H5GA 3KN7A 3E5XA 3C31A 5HLHA 1B4AA 3V8XB 1FYLA 2B3BA 3H06B 3CVGA 1YTVA 2R9JA 1S3JA 2AS5F 2ISZA 1NL5A 5LEKA 1W4MA 1UTHB 3KCCA 1PEBA 4F2QA 1H9TA 2V1DA 4OEUA 3U72A 5E1WA 1FTJA 1QUJA 3UORA 3CO6C 2CMOA 3K6UA 2H99A 3E13X 4ELRA 5E8IA 1ELJA 3IJOB 4ISUA 1YO5C 1M5CA 4N9IA 3CG3A 1HKSA 1Y1ZA 5F1QA 4F1YA 4N9HA 1HSLA 1FY7A 3WG9A 2VODA 4F39A 3OENA 2PFBA 2DXYA 1LCFA 3IOUA 4ELOA 1P4WA 2VONA 2RINA 3WU1B 2XV4S 4LB6B 1IIWA 1O64A 4JB7A 2EA2A 4F3BA 2IJLA 5CYVA 3GFIA 3B7DA 3DLNA 1MZBA 3G3ZA 2O7IA 2DK5A 2O8XA 3ECHA 1TFAA 3PMWA 1B0HA 3R26A 2XD2A 3E4RA 5L3GA 1ZLKA 2X26A 5AA3A 2VC0A 3W6JB 3F23A 1D8JA 4TOZA 3MCZA 3TQNA 4OINF 1BJAA 4WEPA 1I1SA 1TFDA 3M8EA 1P1NA 5H8QB 2NUVA 4ZYEA 3S9LC 4LMYA 1XVYA 1DOTA 5D5WB 4KCDA 1F5TA 1N76A 2W85A 1US4A 2DTRA 3LAJA 4F18A 4M74A 1GTKA 4MGRA 4P9FA 2XVCA 3MWBA 1B1HA 5L3CA 2RGVA 5H8NA 2PQ8A 4RJZA 3TGNA 2Q0OA 3KSXA 4ON0A 1LQ1A 4YFXF 4YFKF 1T38A 2IT0A 2OWTA 3V8KA 1IUDA 3EHUA 3I3VA 3EETA 2F6GA 3COAC 4BNCA 4A6EA 1CE2A 4ELQA 5L3EA 4I8CA 2PMHA 5DEXB 3K02A 2E1SA 2VP1A 3NQOA 2WC2A 3PPQA 4P11A 1Y9UA 1N04A 1SW2A 2FRHA 3RJPA 2Z8DA 2NVUB 1JVYA 3C35A 3KOTA 2VN2A 1H0MA 2I48A 1URDA 4M9XA 1USYE 5LGUA 1AIVA 1I69A 3MVXA 1YPNA 1JNFA 1UCRA 4AIKA 2ZYNA 3HTSB 3TYHA 3GZ5A 1BKAA 4F31B 4Q47A 3M7GA 3GX4X 2PT2A 5D4RA 1LB9A 3RIRA 4LJZF 2HAVA 3C34A 4ONYA 4IO7A 3T1BA 4ESFA 3V7SA 2QS4A 4LZ7A 1Y4TA 1UHMA 3BOQA 1URSA 5DVJA 1B46A 2E0SA 4F7ZA 1R1UA 1EH8A 4BHBA 4LK0F 1GHCA 1BN5A 2O61A 3KETA 5I58A 3KZZA 4HF1A 2RNJA 4TV7A 4YIIA 4HLYA 2ZYKA 4ZH4F 3QYTA 3GZ6A 1B58A 2PLYA 5D5XB 4H0WA 5E18F 4FEDA 2HWVA 5KDTB 5FLXZ 4A0YA 1S7OA 2ISYA 2DOJA 3IWFA 2Y7RA 3RKXA 4EV0A 1ZG1A 2UXAA 1MJBA 2CYYA 5ICGA 4KFCA 4FORA 5E1ZB 1I6QA 3WTWC 3L7WA 2DQVA 3TOBA 3IOVA 1M5DA 1LDJA 1IF1A 2O3FA 2YU3A 3EDPA 4FHTA 3OSQA 4H0EA 3CI8A 1B51A 1K7AA 4R6YA 1MH3A 1Q35A 2Z8FA 3LR1A 2XAJA 3A3CA 5JK4A 2Q89A 4P0IA 4LG0A 1AOYA 3KN8A 3FMSA 4ESJA 2IA4A 4IHTA 1Y3QA 3DP8A 4MTEA 3TO7A 1US5A 2HGCA 1W7PA 3ILUB 2DW4A 5L3FA 2Y7PA 3U94A 4U1ZA 4OMZA 4BDLA 4L5IA 5HOOA 1UTHA 3ERED 5IT9K 1WVJA 4XSZF 3GLXA 2OZ6A 4LP2B 4DQ2A 4KFQA 5AIQA 1STZA 5ED4A 4TLLB 3A09A 3FV2A 1LDDA 1B1XA 4LD5A 2PMUA 2ZJ2A 5KVRA 1EH3A 4JSDA 3U1DA 4MFIA 2Y75A 1VE4A 1B3LA 1P2FA 1KQ8A 3TZAA 4NF4B 3I71A 4HBLA 4RA1A 3LC8A 1MXYA 4GWOA 5KCJA 4IVNA 2EV5A 4WF2A 5HLIA 4N0BA 3SDFA 3LAPA 2IP2A 4Q30B 4YZZA 3N4MA 4OXVA 1FNNA 3IO4A 2CZLA 3GBAA 2F36A 1QBJA 5EYFA 3UK4A 1VFEA 2YJPA 1ANFA 1ULYA 4E0WA 1JEVA 1L3LA 1IN6A 3WTUC 1B5HA 4POXA 1ZG3A 3K1NA 1YQAA 1QKAA 3HRSA 3DEUA 3JAMZ 4PGHA 3EYYA 3FXRA 3IHUA 1K79A 3OXNA 1VR5A 4OFLA 4F29A 2WTEA 4RK9A 3K6XA 4OHNA 1BIAA 1B1BA 4EM2A 1MXUA 2F2EA 2O03A 2ONRA 3R6SA 2X7PA 2XGXA 2A07F 3C4MA 4WCGA 3RGYA 2L3DA 2NS0A 5LBQA 3SEWA 2ZYOA 2XAHA 1FBQA 3GO5A 3LA7A 4UNOA 3WTVC 1YTYA 2JSCA 3TODA 3SXYA 3BWGA 4GCVA 5IKBA 5I59B 3H7MA 3T8RA 4KT5C 5E20A 4JXIA 2J5OA 3S2WA 1XGNA 5L3BA 3O2AA 1XHYA 4HCYA 1R9QA 1HSTA 2QS3A 3K9TA 1SFUA 1H43A 4XKRA 2LNBA 4GYIA 3M8UA 2REJA 2FSWA 3EHTA 4EJWA 3GFJA 1Y3NA 1OVTA 4KDPA 2XXQA 2RC9A 3MW0A 2RF1A 3TMGA 5CC2A 3AAFA 2Q8KA 4PCQA 5ILVA 1SW4A 3QUFA 1PC3A 4RGXA 5JTYA 1PB7A 3V7RA 3JV9A 2F5XA 4BLAA 3H6VA 4I09A 2DYXA 5HS8A 3IB1A 1G3TA 1DTZA 2STTA 1B59A 3LA2A 1MDP1 2VOZA 3MAJA 2RKMA 4H65A 2JPCA 3KJ7A 5I56A 4HZFA 1MXWA 4PDKA 5HLGA 4KD5A 2L02A 2E7XA 5AA4A 1P1OA 1NNPA 1LFIA 1OPCA 4G68B 4ZS9A 1Z91A 2VHAA 4QSEA 3RI4A 1J0RA 2O0YA 2XXHA 2EFWA 2X7QA 1XCVA 1TTYA 2I4CA 5I58B 1FPQA
chains in the Genus database with same CATH superfamily
4JK1X 3UN6A 2W25A 4YEJA 4HPQA 3TKDA 2R7ZJ 3DPTA 3PPNA 1IDZA 4N81A 2AXTC 1T95A 1UIVA 4XEQA 4R8HA 1HDDC 2O51A 4G61A 2WV0A 4A3CJ 1XC1A 3IB0A 5LEJA 2RCAA 3VYTB 3T22A 1NV0A 4H5FA 1ZN2A 4CCKA 3Q9SA 3I54A 1GT0C 4HV5A 2ESNA 3MP8A 2P1SA 2UVJA 3ASOH 4ZEBA 5TP9B 4FAJA 2CSOA 5TISC 1FCKA 5ISUA 1MKMA 1Q1HA 2CUJA 4Y33A 4XBFA 1B05A 3PPOA 3DPLC 2QQ9A 3G3HA 3K6WA 3PV0E 2QA4I 4MIJA 4HX4A 2GOXB 5EEGA 4L0YB 1VF9A 3F8BA 3ZCOA 4F1UA 5D5UB 3E6BA 1SMTA 2V7FA 3FK7A 4IL6C 3KLNA 1B3EA 1J2XA 2J5PA 3ROUA 1OIBA 1Y1WJ 2KRCA 4M6YA 2MLKA 4FISA 4EJVA 2ELHA 3LUZA 3HOUJ 3FJMA 3N26A 3OSGA 4PAKA 3F8FA 3I4PA 3QU6A 3W2VA 3ILTB 4E70A 4ENKA 1TQMA 1CF7B 2MA3A 3J81Z 2JUCA 4Y4RA 4PBQA 4L17A 1EJ9A 2B4MA 3S17J 1WGXA 2L9RA 3CO7C 1OQHA 5AONA 5GTIC 2CW8A 1LLSA 2DA4A 1M5BA 1ZTRA 2ZNZA 4PAFA 2M9HA 4X1BA 3ISPA 1FOKA 1S7YA 4K2EA 4FECA 4OZ9A 4NF6A 3MUQA 3M8FA 5EQAA 4RS8A 2DA6A 3HCQA 1SVOA 2BGCA 3H0DA 3RQ4A 1U8RA 5FRNA 4F3SA 3GTPJ 3L2QA 2MGQA 1V54H 1IN5A 1X3ZB 3FXLA 3IO6A 1XS9A 5JVTA 1G3SA 1JT0A 3PD9A 4KIGA 3F8NA 3RNNA 2HYFA 4U0VA 4ZZDA 1TBXA 2Z9OA 2R93J 3HHHA 1JW1A 1MBJA 3C7JA 1ATGA 1KWHA 4GBWA 2H98A 2Y9ZA 3L6HA 5KZTA 3KYLA 2DPUA 2Q74A 4KITB 4C2UA 3SDBA 3M4OJ 1SD6A 4A3GJ 4A6DA 2I49A 4C1TA 4RAFA 2CMPA 3Q27A 5E1XA 1P92A 5H8QA 2DQLA 4BDZA 2CUEA 1SFOJ 1QKBA 1ZKBA 3U65A 2WA0A 3ULQB 3H36A 4E7SA 3BR0A 4LLGF 3FHZA 4G7HF 1JUSA 1FLIA 1MM7A 2ESHA 2NVYJ 2R7UA 2HKXA 4KIBA 3G3FA 3K2ZA 3LL7A 2VOPA 4M9SA 1R36A 5C44J 4ZDMA 1Z0XA 3VVDA 3WODF 1UB9A 2Y0MA 4A3EJ 2OJTA 3T66A 3CCVI 2LKSA 1PUFA 1V4RA 3OD7A 4GL0A 4HNVA 1WFXA 3O6BB 4B44A 4XK4A 3S3NA 3T5XA 4PFTA 3THIA 2P8TA 1V3FA 3I5UA 4H6DA 4D1QA 1K61A 1V55H 2MH2A 2YUSA 3WGGA 2W57A 4RLFA 1WSUA 1FPEA 3FVGA 1GV2A 2DFEA 2JPBA 4ZZLA 1YX5A 2XHDA 3O6GA 1R1VA 5F0HA 1IC8A 4H46A 3R61A 1IO2A 4XLHA 3U93A 2WBMA 4PFRA 1VTNC 1QUKA 4NB5A 5FFXA 4S0HB 3MWMA 3WTZA 1A6IA 1QJMA 4JYKA 4HSTA 3N97A 1JW5A 2A5TB 5CBSA 3CCMI 1M5EA 1BOBA 4KHZE 1E3PA 4X1EA 1XGMA 3H35A 3SZTA 2CV2A 1Y4CA 2QM3A 3KP2A 2ONKE 4B43A 1JGSA 4NF4A 4ASNA 3AG2H 3RPLA 1VFDA 4AQ4A 3OMBA 3TDZC 5DD8A 1LFHA 2L54A 2ZMEA 4I9DA 2EWNA 1DPUA 5LHHA 2ID6A 1PDNC 4JWOA 2RV8A 4DZPA 4KCCA 4N13A 4XKNA 1P4AA 2HVSA 2WKYA 1LBZA 3Q26A 4Q4ZF 2RNGA 1MDQA 1I39A 1OJLA 2XGCA 4GXSB 1MXXA 2IEKA 1KQ0A 4ZYHA 4MAGA 2M5WA 1VNDA 3VYUB 4U1OA 1XMXA 1YLFA 3RY3A 1WHUA 4BDNA 2G7HA 1PBQA 2IXSA 1F4KA 3S16J 3ZPLA 1FX7A 1ZQ3P 1MBEA 3TCGA 2DO7A 4XLFA 1NI9A 2ELKA 2UXXA 3TUSA 3HM5A 3LSWA 4E7LA 1Z21A 1S6LA 2CWEA 4P3LA 3FXUA 4CA0A 3G1MA 2M30A 3W6VA 2DFIA 2L5QA 3CF2A 1O3SA 1TC3C 2A69F 3LFKA 3A01A 3CCUI 2JVHA 3OWTA 3OEKA 4GXOA 3RTWB 3RQTA 3LSRA 4FT8A 1IRGA 2R5YA 3J7AO 3HJEA 2D3IA 4DI4B 1CNQA 1OCRH 1LBVA 4C3HJ 3RN8A 1QVTA 4KYWA 1KU3A 5ITOA 2ZZWA 3PUYE 1H9GA 2EZIA 2G7UA 5IY5H 3PO2J 5LHGA 1MXVA 2DFHA 4AS4A 4F93B 3N6TA 2I3VA 4K3FA 3I56I 2BY3A 2X1CA 3R7XA 3FIWA 4G8XA 3IK6B 1F9BA 4XKPA 2GA2A 2CV0A 2F34A 2NVTJ 3VV5A 4UVCA 2DE2A 4ZEKA 5DCFA 1YW7A 3PUVE 1RI7A 4FIMA 4HS7A 2DLLA 4D0PA 2BZTA 2MG4A 2H9BA 1QNTA 4AIHA 2FIXA 1S8NA 3I3LA 3JRGA 4R75A 3CSBA 4G7OF 3DLLF 5FHMA 2QJEA 3LSXA 3K10A 4UXNA 3BROA 2KQZA 5J47A 3R60A 4F92B 1OQGA 4Z0IA 2PMSA 5DV5A 3CUQC 2FVZA 2Y7WA 2Y84A 3QUJA 4DCXA 4EM0B 4R9FA 3NEUA 3MAMA 5I56B 3BZKA 1LB8A 2E1CA 4LQ5A 2VT5A 3V5AA 3FJ7A 2EFOA 1NHAA 1SVLA 2KIUA 3F8CA 2FNAA 5I84A 5DCMB 5KDTA 2DWHA 1POTA 4LFUA 3T0YA 3S9EA 5FD6A 2NNNA 3KX2A 1LEAA 1XN7A 2WY7Q 3KG2A 4NC6A 4BY7J 5ICEA 3C2BA 5K5RA 1ENHA 2PBWA 1CB6A 1JUPA 4DXUA 2GXBA 4ND9A 1ZAOA 3K4KA 4JWXA 3OS1A 2VLAA 4M4GA 4ZECA 1G3WA 4G7ZF 2LF7A 3S2VA 4PJ0C 5I2KA 2DBBA 3KEOA 1NV1A 3CFLA 2ZXWH 1FJ6A 3MP1A 4IGTA 2OBPA 3FWEA 1LCTA 3BT9A 4D7NA 4GX3A 3PNYA 1R1TA 1ZREA 1FQCA 3DELB 2PT1A 4PFWA 1JQFA 2KKOA 2VE9A 1BL0A 3HSEA 1K78B 2I6EA 3TFLA 3KP4A 4KYSA 4RB0A 4DIQA 4GVOA 2DODA 3RT6B 1R49A 1U9NA 2HPGA 4M71A 4IHWA 2H4IA 2LD5A 3KLOA 3FASA 3E9XA 3FVKA 4EJUA 3D5LA 3ASNH 2EH3A 4NF8B 1QRYA 3REOA 4LN5A 4GOTA 1JGGA 4X48A 5BOXA 1O63A 3USDA 1OVBA 4RB3C 3HTUA 1H88C 1BC7C 3V7CA 3WE2A 2Y0SN 1FBSA 4CDGA 3FJGA 1GXQA 2GHBA 2H8RA 4IRHA 1YAEA 4U4XA 1MGTA 1HQCA 1OR7C 5KAIC 2FMYA 2E1MB 4I0AA 4XLCA 3ZN0A 1FYMA 3FUZA 1A40A 1JUMA 1DPEA 2F8DA 3LBSA 1JE8A 5JFRA 4UUSA 4M3DA 1FTAA 1ZTYA 1J09A 1ZK8A 3N94A 1FRPA 3I59B 2L9SA 5HNFA 4I6ZA 2M8CA 4DXCA 3IP4B 4LQ2A 3GLLA 1SFEA 4XRFA 2I0CA 4H4KC 3HSTA 5KCJB 4BACA 2P4WA 4X9TA 5FHOA 3S1MJ 4QFPA 2QS1A 3Q3SA 2EQRA 3Q0UA 2JSPA 5LD2C 3S1NJ 3ZKKA 2KQRA 4P5OA 5HLTA 4E7KA 2QMWA 2K3PA 3IX1A 1I5ZA 3D0SA 2WWYA 1U78A 2WYKA 4OVQA 5ET5A 3E97A 3VLUA 2Y7IA 3CCEI 4OOIA 3JYRA 1Y3PA 3G3JA 3TQLA 2FQ3A 2Y30A 2BV6A 1Q9DA 3MSTA 3MVWA 3BTJA 1U2WA 3ZMDA 3OOAA 4KICA 4R2FA 1ZMGA 1XDUA 2DYSH 4YG2F 1XPXA 1HF0A 2A6EF 4AVZA 5DM6F 3PGFA 4KYDA 2XX8A 4IO9F 1BJZA 1B4HA 1JETA 2FMLA 2DOEA 4BEHA 1FYKA 1FTKA 5FTHA 2F4MB 4M3EA 2Z23A 4JVDA 1ETQA 2XWKA 4NWCA 1HSJA 4NGUA 1TWYA 3GBBA 4ZYGA 4CCOA 4DYQA 4MF3A 1WRJA 5L3DA 2Y5KA 2QENA 3S8PA 2KRFA 1KU9A 2LY2A 1DQUA 4NQWA 3VYRB 3A1YA 2LKXA 3RZOJ 2AXLA 4BH9A 1EYKA 1MXZA 2NXOA 1XGOA 2H27A 2O7OA 5K1YA 1IAWA 1IXHA 3JZJA 2B7EA 4A12A 5IZZA 1DPPA 4OWDA 3QU3A 3PJRA 5LOMA 1HA8A 4UV9A 1UTBB 2M8GX 3A0BC 1Z7LA 4Y3OA 2Y7KA 1MNDA 1U8BA 1B5IA 2ALUA 4CH7A 1D0ZA 3ODBA 3FZVA 3VODA 1DU0A 5DVIA 2Z1DA 4BQNA 3K0VA 2HQRA 1MY4A 1AHDP 1BLFA 1BTJA 1MY1A 1T8IA 1ZIUA 2ZNUA 3U2RA 1ZJLA 1TQPA 4O3CA 4DXBA 2R7WA 3HEFA 4DYRA 2PYYA 1FQBA 5ET8A 4NC7A 2ZXJA 4ENJA 3S9NC 3VEPA 3CIJA 2UVIA 1BR4A 2XIGA 3JTHA 2KLFA 4HQMA 4NEDA 2VKEA 1IMCA 3LNQA 3G73A 3KFWX 2Q2CA 1OLTA 2JTVA 1HLVA 2JA2A 2CO5A 3TL4X 1MQDA 2DDKA 4PSXA 3PO3J 3U1KA 3HHFA 2XB0X 3HO7A 4L5JA 4PJLA 3FM3A 2VPLA 1X4OA 2FNPA 2BHZA 3LQRA 1WJBA 5JTYB 2ZJPF 1LFGA 1MRPA 1NH8A 2G9WA 4Y15A 2V3UA 3MZBA 3E3KA 3TTMA 2QRYA 3MN2A 2VBWA 2XUBA 4YKPA 2XXWA 4FX0A 2WBDA 3GZGA 3G1OA 3B73A 1B9NA 4C2MJ 4I2OA 2XC7A 3PUXE 3O9PA 3HG9A 3IB2A 3LUYA 4U7BA 1OCOH 2DA5A 4N6KA 3IWZA 4RGUA 3PU5A 4YKKA 5IYBJ 2PG4A 4EVIA 4EUOA 1Y0UA 1RC9A 3PIOF 2WEFA 1UJ8A 4G68A 1MD0A 1PP7U 2HQNA 4C3JJ 3OOPA 2PX1A 1ZLJA 1B5JA 1G6NA 2M3AA 1FPFA 2OBGA 3DQVC 3HKZA 5C4XJ 4NHBA 2QVVA 1MDMB 5HS9A 1FP2A 4C3IJ 2F4IA 2W82A 3W2WA 4Q5TA 4AIDA 2W4SA 3PPRA 5TPAB 1NUXA 4IO3A 5EG0B 4IHYA 3HUGB 2Q8JA 5T3JA 1B7HA 1OQYA 3RKWA 4MBPA 5KHDA 3H3GA 2O8KA 2ZXHA 3MPLA 5AA4B 1ZRCA 3MVZA 2LP0A 2MLGA 1RNLA 4I01A 5BPIA 3H3ZA 4UY8I 2XXIA 3DTEA 1X1AA 3HB9A 2HYGD 2BW3A 2P81A 3IAS2 3M07A 4OMYA 4GO1A 4OFJA 3VSLA 3F6VA 4PUSA 2RC8A 2E19A 4G6DA 2O1MA 3LSFB 2OPTA 4AUXA 3OEMA 3EUHA 4IY5A 2IW5A 3AG4H 4IO4A 4B09A 4U2RA 2D5VA 1XMKA 2GM4A 4LZ5A 2KIQA 3R0JA 2FQ4A 4GWYA 3E7LA 1RR7A 1Z6TA 2NOGA 3VLVA 5FGMA 1K83J 3TO6A 4MFEA 4XKQA 2XROA 4HE0A 2D5WA 2V6CA 3NWTA 4I7HA 4FEBA 1LAGE 1XX5A 2NNYA 3A03A 3OIOA 3ZP5A 4YB5A 3NWSA 4HRIA 3ABLH 3D5SC 3QAXA 2P6SA 2BYVE 5H8HB 4ESXA 2HS5A 1PDAA 5I5PA 1XSXA 4ZE9A 3OYCA 4RAYA 2XXYA 5DTBA 2R92J 1ZR4A 2F5VA 3RCOA 2XWVA 5AIPA 1HC8A 1C0WA 4GWUA 4QFLA 2HTJA 1Y1VJ 2BY1A 1ZG5A 4QSCA 4HW0A 5FB2A 1GGGA 3OO7A 3WAFA 4FCYA 4C2TA 3SZPA 1Q1VA 3J80K 2ZJRF 2GLOA 5DCMA 4P55A 1R58A 2I5UA 2M4KA 2GZWA 1YYVA 3TKYA 1RDXA 5BPDA 3GWZA 2LC2A 3MZ8A 2FOKA 1FEXA 1R4MB 4TQUQ 1ZYRF 2X6OA 4U7DA 2QQ8A 5EYHA 2DMPA 2FBIA 3D4GA 1GR2A 1HXDA 1ZGJA 3BJAA 3L2VA 3SEXA 5HODA 5J8FA 3L6GA 2N8GA 5IOYA 1RRJA 4EM1A 5IM2A 5D4SA 3JRDA 4OA4A 4KI0E 1OISA 2Q8MA 2KPMA 2V25A 4Y17A 3B8BA 1MMNA 1J5YA 4KMFA 1D3KA 3PMXA 4WEDA 1UFMA 1SI0A 3MKLA 4F22A 4OQOA 3G3IA 4EQBA 3BIHA 1WDNA 2OCCH 1FQDA 4G8HA 2HQ5A 4M3GA 1D0XA 5CLSA 3BG5A 4MFDA 2I10A 4AVPA 5H20A 1A6QA 4L9VA 4FORA 1JJ6C 3TCFA 1UZCA 5CVUA 4BHCA 1RR8C 3E0JB 2F7BA 2FA7A 2M45A 3ZQ7A 3C32A 1FPIA 1SYIA 1WODA 3ZKLA 1RIOH 3O6IA 2STWA 4MQVA 2FA5A 4MH5A 1T56A 2VXZA 5HNHA 4UUSB 3PNVA 3FIRA 2RC4A 3FMQA 4GQOA 1G4DA 2EILH 4KYEA 4O5VA 5EZGA 3EPEA 4LLLA 5LRSA 1IRXA 3LSMA 1XG1A 2VB6A 3FKJA 4EF2A 3ONMA 4W1UA 5H8FA 3BTCA 1NNTA 2BY0A 4NDLA 3TTLA 1FIAA 1KA0A 2VPOA 2RQPA 4HTGA 4M73A 4WX9A 1YJ9I 3M3LA 1KZHA 1U5TC 3PUBA 2HZKA 2REGA 2ME6A 5B7DA 1UTBA 1X58A 4LA9A 3VPRA 3F72A 3BKIB 2LDUA 5H6RA 2M0CA 1NNFA 3M1EA 5HPQA 1R4NB 1MY0A 2DT5A 5F1RA 4OVSA 2F5DA 2QF7A 2IGKA 4P1EA 4QXDA 5J1UA 1SD3A 3B6WA 5ELVA 3WE3A 2V6EA 5IZ3A 2O68A 4JDFA 1JW4A 3B6TA 4GLIA 1U0JA 3NRVA 3RKYA 1E3HA 4F91B 4BDMA 4NUBA 4ITVA 3MFKA 4IKFA 4KR5A 1AMFA 1SVMA 3A02A 4U88A 2AYSA 1NFTA 2HCAA 2HPIA 1JTYA 1O7FA 1QZZA 1R5GA 3EF7A 4PFBA 4LGWA 2L01A 1QPMA 2NOJB 4RK2A 3O8GA 1LGBC 1I6AA 1TXFA 1T39A 3K69A 1X1PA 3KYDB 2P3VA 3CFXA 3CZ6A 3U92A 5EEAA 1RDYA 3F9KA 3QOPA 4C1UA 2P5KA 1Z7ME 3W9VA 3MMYB 2F3DA 1B6AA 2M0MA 3PM1A 2CRGA 2IA2A 4FE4A 1H44A 4L9JA 3A29A 4JWYA 1ITYA 1R22A 2GWRA 1RKMA 4H67A 2L7MP 2CUZA 4HV6A 5FKMA 5BQTA 2R5YB 1FMVA 2D21A 3GFMA 5D8LB 4R6HA 4BDRA 4HDUA 1MPBA 2X1EA 3RYPA 2CEXA 4JBZA 1EKEA 2YX7A 3VE1B 2HU9A 2EV6A 4KN7X 2HHMA 1LFBA 1Z9CA 2E5ZA 3GW2A 3ABTA 1T98A 3U21A 1WCMJ 1W1WE 1POGA 4MTDA 4BQOA 3K70D 1K78A 2DP8A 2I8DA 4MNIA 4Y7NJ 4I62A 4OYVA 1B8IA 2HOTA 3QODA 3ZQFA 1V5GA 1ZRFA 2B65A 4PGPA 4XKCA 2QQBA 4NF8A 3CJNA 2QVOA 1GV5A 5A5XA 2EV0A 2A6TA 5L9SA 1N77A 3HRTA 4IQJA 5CMKA 1AWCA 4KXPA 1JEUA 2DSFA 3BIGA 2YPNA 1QHGA 1LBBA 3ZSFA 1B6HA 3SEVA 1MJ9A 3ONQA 4S04A 2EPFA 2NS8A 1VQ6I 5BS6A 4MEXF 2OLBA 3OSRA 2OWSA 4M1VA 4R2BA 4BJ5C 3JTGA 4LONB 3TDUC 3QPSA 3CDLA 2KJCA 5IGAA 3O8HA 1XB4A 4RNSA 3DBRB 1FIPA 1A55A 2V3TA 2VQCA 2F5CA 4D7MA 3V42A 4XICA 1IN8A 1Y0NA 2PFZA 4NBQA 2PX9A 4M3FA 2XAUA 2EFQA 2ZC2A 1IN7A 4IO2A 1R7JA 3OOUA 3RUMA 3TBIA 3K1MA 4OIOF 1N25A 4XLAA 3DF8A 4IXAA 3BR6A 1Z6RA 2G93A 2PI0A 4XIGQ 1ONVA 2PEXA 1VQ8I 3ABUA 1ODDA 3M1CA 4I3YA 4JX5A 4EEFG 2MSYA 4AD9A 2HKOA 3ZN1A 1LB2A 3DTIA 5LLQA 1SYHA 1MW7A 2FIEA 2GHAA 3FHNA 2YX4A 1AU7A 1OCCH 2FBPA 1SAUA 1BI2A 2RC7A 1FTMA 3IJXB 3CMYA 3ZQQA 1YS6A 2QL3A 5TPAA 1I3AA 4IO6A 3VFJA 1MMDA 2K7LA 2LLKA 3I59A 5F27A 4B3AA 4LG0B 1YYZA 3OYEA 3V4GA 1VZ0A 3OY9A 2E60A 2DXIA 3H9GA 3PUWE 2ACJA 2BW3B 1GDTA 3I4MJ 3VLWA 2B9SA 1GVCA 3TMOA 2OWZA 2Y48A 1WI3A 2DJNA 3C1DA 1SFXA 1J7KA 2QBYA 4HNTA 1FC3A 2Q2EB 2D45A 1IG7A 2QSHX 1IRZA 2ZKZA 2QSGX 4AWXB 3GTJJ 5F6FA 2IGNA 5ET7A 2LG4A 3WHCA 1SBPA 5BWJA 2F5EA 2QVUA 1ZELA 3QRFF 2PBIA 2A6HF 2HOAA 2WY8Q 2LY1A 1MS7A 3BFUA 3K01A 3HOZJ 3UIFA 4MLOA 1W7PD 3FD3A 2YSRA 4NHJA 3BCBA 4BY1J 2VJIA 2BHYA 2H8WA 3ZMZA 1Y20A 2HFBA 1NV4A 2VIXA 1K4SA 3VVEA 5EEHA 4KT6A 3JRFA 3X2QH 4O8MA 3DPUA 4IGRA 3KBZA 3LSLA 4IPAA 3M8JA 3OR1C 4B3XA 2E2HJ 3G4SI 4IF4A 1LBCA 2MBFA 1AH5A 1DTGA 1S9TA 4NMYA 4IQ4A 3L2CA 2P7CB 4OETA 3IOWA 4DZJA 4QPQA 4XRSG 3OYAA 2XPWA 4YKIA 2KIMA 4D9JA 1YE9A 4XF5A 4RDUA 1ETKA 3HGYA 1MQIA 4ZDLA 1XVXA 3P9IA 2L4AA 4XSXF 3DFGA 2IRFG 4BBRJ 1UIUA 3B6CA 2EB7A 1X19A 3FBPA 1HKQA 1EZPA 3MD2A 1OKRA 5K5OA 1ZGAA 5FLVA 2VUMJ 4OVRA 2CQQA 5BNGA 4U21A 1TWGJ 1B9JA 1EYIA 4MMPA 3FBNB 3CCQI 3OIPA 1D9QA 2WAFA 1VQKI 4II2A 4HAMA 3ZMUA 4UUTA 5ICFA 1B3HA 2WX9A 2F78A 2XXRA 5JEIA 4HXVA 3K2AA 5AA2D 3JSPA 5H8NB 1LPQA 5IYCJ 3DKYA 5FKOA 5TRDA 1AWBA 3TW7A 2DOFA 2IVMA 2V79A 5HM4B 2CFXA 2F4OB 3L9FA 2R7VA 2M8EA 3BG6A 1BBYA 1BK4A 2BXZA 2A61A 3BCAA 3BQYA 2JRTA 4I98B 3ZMVA 2ID3A 3HRUA 1OCTC 2K9NA 3HSFA 1Q1KA 4AS5A 4CCMA 3KJTA 2MABA 4IOAF 2BOLA 4XORA 2E34A 2K5CA 2K9LA 4GL8A 4Z2YA 4QF9A 3JW4A 1KU7A 1KYWA 1S29A 2K85A 2OZUA 3PD8A 3CSGA 2VXDA 5D6FA 1QQIA 5JLXA 1B72B 2HEOA 2XSJC 5CVJA 4PE3A 1OMIA 5E3LA 3MEXA 2THIA 3BBRA 3H3VK 3G3GA 3OMYA 2BE5F 4HOBA 2K86A 2JA7J 2G0EA 5GPAA 4PF6A 1HW1A 4MNUA 5GTHC 1VQPI 1LVAA 2A3SA 3DBLB 1P7IA 4OIQF 2LMDA 2LR8A 4RYAA 2CS3A 1A5JA 4KISA 1D9VA 1SW5A 2VBZA 2OV7A 4EXLA 3K6VA 1UELB 3C36A 4LATA 1QVSA 3H92A 1YIOA 3IKTA 2VKVA 2Z22A 2GOMA 2QYOA 3GF2A 1KU2A 2UYFA 3ELKA 2JZYA 2XAFA 3RTRA 4O94A 4GX6A 3H9QA 4XFEA 4FATA 4CSWA 4HX7A 3HUGA 4XXUA 1H76A 2MYSA 3I5OA 1IZ1A 2CV1A 2ZCWA 1BI0A 1RKWA 4OIRF 4CHUA 2AIXA 2CZHA 3H4ZA 4QFOA 2UYEA 5H8HA 3I53A 3N5LA 2DU9A 2HZTA 1K9YA 3MZ1A 2JN6A 3RPUA 2OA4A 2KRHA 1X2MA 4JSOA 3A3UA 3QWLA 3OYLA 1FTOA 1XC5A 1BR1A 3E6DA 2L4MA 1EZ9A 3CC4I 2LFBA 3IOTA 5EQ9A 4UB8C 1DDNA 1II5A 4PGNA 4NX1A 1HSEA 4A3DJ 3TCHA 1X3UA 3R0AA 2V4CA 2M7AA 4BXUA 1KQ9A 3PQJA 3QK6A 4GRKA 2I4BA 1W5TA 3T9HB 4XTCQ 2JJKA 5E8GA 3VYSB 1S7EA 4XIDA 1W36D 1XCBA 2ICWG 1BI1A 3OYNA 1A8FA 2DE3A 2IS6A 2HQAA 2FBKA 4LB5A 1TQIA 2CZIA 4QSDA 4ZEDA 4LG3A 3VB2A 3DU5A 2P5LC 2R7QA 2HZLA 5H2FC 1DBZA 3IRRA 2RQQA 3GYHX 1M1EB 5K5QA 3R6UA 4WWCA 4RAGA 5LGNA 2DA2A 3CFZA 5CM6A 1IXSB 3KE2A 3G71I 3W2AA 1R5ID 4RM3A 1QZEA 1MNMC 3E6CC 4KN4X 3T8TA 2FXAA 3AG3H 2H1LA 1QPIA 3PUZE 4ZDPA 4YKJA 2R4GA 2OK2A 2M7BA 3BPVA 3QAHA 1OCZH 3QPTA 4QWQA 3HFUA 1F43A 1QGPA 2DMTA 2FE3A 3FGSA 1NV3A 3BJOA 1YX3A 4B48A 2I58A 3OO6A 3EQLF 4IB2A 1SAXA 3H6WA 3PPPA 5I57A 5A5XB 1JHHA 2R7OA 3K6GA 3N05A 5DDGA 4F3GA 1Y8RB 3IAZA 1X2NA 3SFZA 3P9KA 3CR9A 2VOOA 3TTNA 3A4CA 1LSTA 3LSJA 3OYHA 1NNKA 2DI3A 3AL0C 5K7ZA 4NF5B 3BLYA 1A8EA 3L2WA 3PMVA 1CF7A 3JREA 3QOEA 1OFCX 5EGOA 3EPZA 4HX8A 4RB1A 3WTXC 3BDDA 2HDCA 4N17A 4EQ9A 1QO0D 5B1BH 5CPRB 5DEQA 1IV6A 2GIVA 2GH9A 4FQGA 4R73A 2EFNA 2XAGA 1A31A 4PFPA 3LV0A 4ZZEA 2RDPA 5H8FB 3U9GA 5F1JA 1QA6A 4IRIA 3J81K 3SESA 2KDZA 3LQQA 3SZGA 4A3LJ 2QWWA 1TWHJ 3PFIA 3W6KB 2Q2EA 1D5VA 4L18B 1IQ7A 1B52A 4PFOA 1SQYA 3PSFA 2BEOA 3G2BA 4I1DA 1I1GA 4YB6A 3C33A 3CD6I 4OAZA 4E7HA 4GIZA 4CO8A 3P7IA 2L9VA 4L5EA 1LKXA 4P8BA 4YICA 1YJWI 2P3NA 4XKWA 2QKLB 4HG2A 1JVXA 4RPNA 5IZ3B 1RDZA 4GWZA 4E7JA 5M5WJ 2IAIA 3H3UA 1U5TB 4Y13A 1ZU0A 4BE1A 4JQFA 3TAJA 1EU8A 4JX4A 3EUHC 2I0BA 4OMBA 3LFUA 3K4BA 3GYYA 2FF4A 2Y9YA 5IT3A 1VQ4I 2ETHA 3CHGA 1YW9A 3FMRA 2X0LA 3GLBA 3Q9VA 3TOAA 1B40A 1UHWA 4ZJZA 3PL8A 4YFNF 1I3QJ 2XGEA 4G12A 3CP8A 4L9NA 5D5VB 4G68C 3CF5F 4YAHX 3F3XA 2GIZA 2DK8A 4U87A 3OV8A 4HLXA 5HDNA 3IAM2 2H09A 4GGGA 3IRQA 2HQ0A 2V9VA 3NAUA 5K2XA 4AB5A 3V89B 1M5FA 5H6QA 4X6AJ 2HI3A 1NG7A 2R5ZA 3CTAA 3AL0B 2PFYA 2VD3A 3T9XB 4F2OA 4XNFA 2EIJH 4MLVA 4MX6A 2GA1A 1Z1DA 2A5SA 4DIGA 1HW2A 4YB7A 2RAEA 4Q5SF 1HW5A 3PQKA 3VDFA 5CMBA 2RKHA 4PE5B 4D5FA 1HKTA 2M87A 1U3EM 1DUXC 4KJZA 4LIVA 1BM9A 3IORA 4FBPA 4HDVA 2R7DA 4EJTA 1MSFC 5FTIA 2ECBA 1DSNA 1NG6A 4MEVA 1SMYF 2E7WA 1MIJA 1IUFA 5I2NA 2CQXA 2NVXJ 2XXPA 1R1NA 5TJJA 1ZBMA 2F6PA 2GQ1A 4O7IA 1W0UA 1SW1A 1T0KA 5TGTA 3K4LA 4I0BA 4XL9A 1UHSA 3QYEA 1N0TA 4LVQA 3TDJA 3DP7A 1B0LA 2W84A 2QCOA 5F08A 3VFZA 4DE8A 2ME0A 1JI8A 2V9KA 3KP7A 4B1RA 1NUWA 2FJ1A 5J3LA 1TL8A 1RUOA 3CCYA 1TW2A 2CG4A 2EZHA 1P1WA 2MD5A 3O3KA 1UAAA 3G3KA 3HN0A 3IV5A 1S50A 4RXLA 4AU7A 3GTQJ 4PAIA 4P56A 3KBRA 2ELJA 3RPQA 3H6TA 3OR2C 1E17A 3A01B 1B8IB 2XX7A 5ILSA 5IP6A 3KZGA 3CG1A 5BMZA 2M1BA 3MJNA 3EUAA 3DCFA 5K7HA 3IL2A 5B66C 5F04A 4E7IA 3DWLE 4UVBA 1Z05A 3HOXJ 1LEVA 1N7WA 3FXQA 4H8IA 1G0IA 1ETXA 5FO5A 3O29A 4TLMB 5HBCA 2VBYA 1MH4A 1XSVA 2JMWA 2OD5A 1FSAA 3FXMA 1XOCA 4KNYA 1A7LA 4RY1A 2P6TA 4G6QA 2FYIA 1FJ9A 3CUQA 4CZCA 2ZMBA 4BQAA 1HBXG 3QXMA 1F36A 1Y39A 5JI6A 2F7CA 2ZNTA 2LBFB 3DP4A 5D6EA 5F7VA 1TWFJ 2MD0A 1O3TA 2OAZA 2X1DA 1Y1MA 4PF8A 1IXIA 1D1CA 5ICCA 3B50A 3CMEI 1FQAA 3ZRGA 1FOXA 4EQQA 5TP9A 3VXCA 2R7TA 2RVCA 3K4JA 4QRZA 3V8LA 1MQJA 1FTZA 4N07A 1N84A 3Q28A 2EIMH 1LFPA 4UHTA 4E4HA 3MZ9A 3H0GJ 2DE4A 1XMAA 2H94A 3FXJA 2OZZA 4RMNA 2DDBA 4A2UA 1NUYA 1XT8A 3FBIB 2L7ZA 4U23A 2KL4A 1OCPA 4EGYA 2XXXA 2QUFA 1Y8QB 3H1CA 1RYOA 4A3IJ 5A2QK 3M3YJ 2VC1A 4PFUA 1W0TA 3SERA 2QS2A 1K4TA 3QP5A 5DYHA 4F19A 1ETOA 2R7FA 3WTTC 4GX4A 4G8MA 2VI6A 5DTDA 3I6VA 4X04A 2NAZA 2OQRA 1FTLA 4N91A 1FPKA 2BBYA 5ESYA 2FU4A 3FF5A 3KPHA 5TU0A 4BU2A 1USSA 2UXNA 1Z77A 3HOTA 2JK3A 1N3XA 2HZDA 1D4NA 3JRCA 5FKNA 4OESA 3T96B 3HPIA 3GVAA 3LSKA 5KAFC 4GDFA 4GYGA 4BXXJ 3CDHA 1PUFB 1WZ2A 2I3WA 5EHSA 2UZKA 3TQWA 1TNSA 1FSHA 1FBUA 5ICQA 1SPIA 1EV7A 3LSGA 4FETA 2OF7A 2Z33A 5CVIA 5EYRA 1B3FA 1YG2A 1NK2P 1N7XA 2ZYMA 2JJ7A 1FTTA 2XWOA 2HOEA 2KP6A 2XXVA 3S4UA 3T9VA 3IUOA 3HOSA 3HV1A 5ICTA 1LAHE 2VD2A 3NOHA 3QSLA 2XXUA 2FBHA 3H03A 4JVIA 4NF6B 3SDGA 2V1XA 4XLPF 4NG7A 4X8RA 5D8KB 3K4NA 3C9HA 3KOSA 4C0RA 2X48A 5ET6A 3LSPA 4KUMA 4AIJA 4JOMA 2YS9A 2GAUA 2XKPA 4N6PA 1L5TA 4QFNA 4P96A 2XF6A 1DPRA 1JKPC 3MPKA 2HEUA 1WKMA 3FKIJ 1Y6IA 2EA4A 3T9UA 1MY3A 3SQNA 4HF0A 2DA1A 1O3QA 2LY9A 3DLAA 1WWXA 1FBHA 5CI5A 2DWIA 2LSOA 1IITA 2TRTA 4LITA 1QUIA 2QMXA 3GXAA 4F1VA 1IW7F 2M34A 2HXWA 3EN3A 2HXRA 2E1NA 3O6HA 1YS7A 2PN6A 1K6YA 4XONA 4YIRX 5HDGA 4H1XA 3CJQB 5F64A 1PB9A 2XD3A 4B8XA 3UA8A 3IL1B 2LAOA 2CQ7A 3E5QA 3DXJF 2KIFA 4Z7EA 5CVVA 1P9QC 4CGZA 2FEZA 1JXSA 4PZJA 1TT1A 5L8DA 1U9OA 2FNCA 4PC9A 2YU9J 3L00A 1ZARA 2CJJA 3O97A 4O7MA 5I7IA 4G4PA 2K4JA 2OU2A 3U1OA 1V5EA 5EGOB 1FT9A 1FBGA 1OLCA 3E6MA 2H25A 3S9MC 4IX7A 1O7TA 2XF5A 2V93A 3F8MA 2ZMEB 1LDKB 2LK2A 2NS7A 2VE8A 4MEYF 2O6AA 4OENA 1X1CA 5DT6A 3UGWA 2NWJA 1TZLA 3BC8A 4DNCA 3PUFA 4P9UA 1OYIA 4IHSA 4CICA 2KLOA 3CMAI 2CW0F 3WG7H 3FVOA 4DDDA 1XSDA 2NVQJ 4Z6YA 1QW0A 2A5TA 2DWAA 3KFMA 4ELPA 2NOOA 1E0EA 4JBAA 2LF8A 2E5NA 4OWRB 4MQ9F 1LE8A 2QSXA 4HE1A 2D2WA 2DMQA 1B72A 3BY6A 3K4MA 3C3WA 1A54A 3GEZA 2ZSHB 4E7ZA 1X1DA 5HVQC 1F1ZA 2MFZA 2R5ZB 3GTGJ 3QIMA 4OEVA 2JWTA 3KEIA 3J7ZI 1FZPB 5J1DA 4MO7A 1VSOA 2M2EA 2BVLA 3D4CA 1FMWA 5DYMA 1IXCA 1KGSA 1EZOA 2YLNA 1DU6A 1NUZA 2LVSA 1OLAA 4DLDA 4XMYA 1P1UA 5EDNA 2FUG2 4ZYAA 2F97A 2G29A 1FPLA 4GXAA 3CC7I 2WV1A 4OVJA 1W36C 5CMMA 3OIQA 1PVEA 1JJ8C 2DT6A 4V19K 1O57A 3F6OA 2KT0A 4BHPA 3TP0A 3WU2C 1RYXA 4KIFA 1MQGA 4CXFA 4HF2A 2P2AA 2A5WA 4C9YA 2PMZA 1TLHB 3QPLA 3ZQLA 1LEBA 3BP8A 3O28A 2NYXA 4G2ZA 5JHUA 1FBCA 3MKZA 3BQZA 1WJAA 4KQPA 2VQLA 2OCUA 2KJBA 5J8CA 1N3WA 4O3MA 5J16A 3RDIA 2V1UA 4THIA 3LSHA 2D1HA 3BFTA 5I2KB 4XN3A 2DWJA 4HCWA 1YCJA 1JKQC 2DVZA 1W5SA 3BR3A 2KISA 2YR2A 1LAXA 1X4PA 3F21A 2IA1A 1OYYA 2HR3A 4PBHA 3M3FA 1VQ9I 3OO8A 5BUUA 3CCJI 3LA3A 2A68F 3FK6A 1B4ZA 4R6KA 4NTLA 4OU0A 1B3GA 3I55I 4FE8A 2X6YA 2DCEA 1P6RA 2KFDA 2WAQN 3Q25A 1YFHA 2DS9A 1OYWA 4AB6A 2IGMA 3ZR8X 5E17F 3L09A 1MMGA 5F24A 2VT2A 1D8KA 4YIFA 1WH7A 2EFPA 1I6XA 3A0HC 1FW0A 3LWFA 1XS5A 1MMAA 2K02A 6PAXA 5AA1A 4HYEA 3VVFA 2W1OA 2Y31A 1MY2A 1QGXA 3ZMTA 1AL3A 5FD5A 4PFYA 5DUIA 3GMEA 1VI0A 2O1LA 1BP5A 4UB6C 1IMDA 2JT1A 3K2DA 3PTYA 1I50J 1D9YA 3CUQB 1RETA 5EHMA 2VASA 4F3QA 1J59A 1FBEA 4MHGA 2VPRA 5ILUA 2PCRA 3V83A 1GLNA 4BL0B 1R5HA 4J00A 4XKBA 4KPTA 3H5NA 2X6XA 2WB1N 3J80Z 2ZMEC 4WXDA 3AG1H 3MZYA 2WB1A 2R7RA 2ZXTA 4DOZA 2V4JC 4QFKA 4PETA 1R9LA 1SC7A 4N6DA 2EZKA 3WGIA 1REPC 3KGCA 5AA2A 4LZ8A 3FXBA 4BKXA 1SVXB 3ABKH 3G7WA 2H6CA 3ROJA 4U0WA 2ZNYA 4WXCA 4I02A 3QPHA 5FFZA 4N4NB 3K4UA 3W3CA 3Q29A 5H8SA 2DFFA 3CRBA 3VXBA 2DJIA 3B02A 2QQAA 1MPCA 2LH9A 2XX9A 2JUGA 1WJDA 1APLC 3TO9A 3OYIA 1MM6A 3KP5A 4GWXA 4H8JA 1YW8A 4G8NA 5KCMA 1D5YA 2LKPA 3RPUD 4O3AA 2E36A 1FOWA 1RZ4A 4NF5A 4EDPA 5FLXK 1Z7NE 2F7AA 4UACA 4II3A 2E35A 1YIJI 2IA0A 3IC7A 3RLFE 3SYTA 1UQWA 3SKPA 3SEYA 1DP7P 4DCYA 2K4BA 2F5FA 3KEQA 1B9MA 4NQ8A 2X6WA 4P1WA 1FBDA 4GD5A 4YU0A 5I57B 1MJAA 1PJRA 2HOSA 1FPGA 2W7YA 3SEUA 2H5YA 5EQ8A 1B2HA 1EA3A 4XRSA 1GVDA 5LRRA 3EQ1A 5HDKA 4AC0A 4PDDA 1XDSA 4POWA 3TPAA 1MBFA 4G9YA 5LFAA 2EK5A 3KEYA 3IH4A 2E2JJ 2TDXA 4OIPF 4P0GA 3EYIA 1NK3P 1ON1A 2K40A 1Z3YA 1VFCA 4P47A 1T33A 1LUJB 4QIWN 4IO5A 2ZJQF 4R9GA 2KDOA 1IUYA 2EJRA 4PQJA 4V2FA 3GCMA 4Q0CA 4IHXA 4M9ZA 1SDXA 2DMUA 3MBPA 5ITPA 4BEHB 2ZSIB 3JCUC 1TW3A 1U5TA 4LIUA 4A5NA 1W5CC 3DBHB 4IY6A 4M6VA 1RKTA 3KN3A 5K2YA 1GXPA 1ETVA 1FQEA 1WQ2A 3OELA 1CGPA 2JQ7A 2XHKA 3W15C 1O7LA 2ZBKA 3PSIA 4BXFA 4X1DA 1QU3A 3CCLI 1LJ9A 2R3SA 4RB2C 4PCDA 1X3WB 2LYCA 2GRVA 4OVTA 2MC3A 2AO9A 1OMPA 2UVGA 2VJJA 1NH7A 2F3BA 4A0ZA 1FSEA 4B4CA 2QSFX 1OR7A 3JRAA 3U8QA 2ANJA 2WADA 4EJOA 4RM2A 3HRMA 1BI3A 2EBIA 2MW8A 4GFRA 2DDAA 4G94A 3OO9A 4QTRA 5L9OA 4DW6A 3KP3A 1B7UA 3MVPA 2A5YB 2VGQA 4LUBA 5KNLA 2KHMA 3FDYA 2BXYA 3FX3A 1LNWA 2KZVA 2YPRA 3SEZA 4CCNA 2XSDC 2OTLI 2IEEA 3FVNA 5CMCA 2GQQA 2Y0SA 2VT3A 1FPJA 5EYGA 3MC2A 2AL4A 3O2PE 1GVJA 3ML6A 3S3MA 1YRNB 1N75A 1A99A 3RT8A 5HS7A 4A5MA 4ESWA 3RQIA 1EH6A 4BE2A 3CUOA 1USTA 4BDYA 5E3OA 5DM7F 1DGWY 5CQEA 1FBFA 1GV8A 5I2NB 4GF8A 2Y2ZA 4DBRA 5CBRA 1ETWA 1IXGA 1MDMA 2ADUA 3PIPF 3T93B 3TTRA 3K00A 5EG0A 3BR5A 2O7UA 3TELA 4OAYA 3FXOA 2VBXA 2W7NA 2Z5UA 3VOEA 1D0YA 4I99C 3GUDA 4PJMA 1XTAA 4ESBA 1YHQI 2DXRA 1B7ZA 2XRNA 4ZZAA 4IOCF 3DTKA 5IAIA 3E1SA 5GPCA 5EJCA 3V8JA 5GAEJ 3B6QA 2XB5A 3LSTA 3FATA 2MC4A 1SD5A 2XAQA 3DP6A 3I58A 2VKDA 3ZOBA 3S1QJ 2ZO4A 2KR0A 2UV1A 2IS2A 2P7VB 3IR1A 4KMUX 4QHQA 4RLQA 3CLOA 1KA8A 1JHFA 2O6GE 4LLNA 3WTSC 2NRAC 2Z2SB 1LBXA 2O84X 4RGRA 3F11A 5CKTA 1UG0A 4A0XA 2LBFA 2P0SA 3MQ0A 3UP9A 2XDVA 4L0ZB 3WU0A 5CRYA 5LTCA 2GXAA 3RYRA 3KYCB 3E5UA 1POY1 4U0YA 3L2RA 5I3SA 3TTKA 3E79A 4FX4A 1Z7UA 4UVAA 4EGZA 1TNTA 1LBYA 5L9MA 1HOMA 3R4KA 1W7PB 3HDDA 1FWZA 4WXHA 4XLNF 3H9JA 3E78A 1ZH5A 3SHFA 3Q0VA 5FKLA 2B4LA 2DAOA 2ONSA 2HAUA 2A05A 2W24A 1FP1D 4E0XA 5LHIA 4ECFA 1XGSA 1H8AC 2Q9TA 3O66A 1SD4A 3BZ6A 1RUNA 1T0FA 1IEJA 1KA1A 1SI1A 3FV1A 2WBBA 4PGGA 4ENNA 5DD4A 4B47A 4HA8A 2B0LA 5CVRA 1LVKA 2OJED 2O69A 2GFEA 4R72A 2UWMA 1T2KA 4XLEA 4ZTJA 4YMBA 2Q88A 2VJ5A 3OS2A 2ZZXA 4FJPA 3CJRB 4J01A 3UNGC 1O3RA 1WH5A 3P9CA 2XXKA 4CYDA 5C4JJ 1MG1A 1FPBA 1YJNI 5FROA 3T0JA 1MPDA 5M2VA 2R71A 4HW8A 5CQGA 1ETYA 5DUKA 1YZ0A 1USYH 2ZB9A 4M6XA 4RA2A 5DVFA 1P4XA 3WAEA 2Z99A 3HIFA 4ETSA 1P7JA 5IOZA 4X0GA 2R6GE 1J9IA 2XXTA 4WXJA 2XASA 2P5VA 3ECRA 3EKIA 3N6UA 3IFCA 1T6SA 4UA8A 1INPA 3OYGA 4HSRA 1NV2A 2WYPA 1ZRDA 2IPQX 1SD7A 3KZYA 5AA2B 2K9MA 4CZZA 2DMNA 5EQ7A 3I0TA 3JRIA 4N4UA 1K6OA 5B70A 4F3PA 1IV8A 2P0WA 1S9HA 3L1PA 3BG7A 1QZYA 1YITI 5AE4A 2H1KA 3J7AY 4EF1A 2IBDA 4EQ7A 1Z3XA 2COMA 4NQWB 1TWCJ 2CGPA 3AXFA 1QHHD 3KSJA 3GZNB 4U4SA 2PVUA 1PUEE 2ABHA 1YXIA 3MQ9A 2HTSA 1URGA 1BOAA 4YMAA 4OERA 1IN4A 2HFHA 3K0LA 4N4OB 3RTFB 1S72I 3QP6A 3BG9A 1IRFA 3EHSA 3KZIC 3F22A 4UV8A 1R00A 1X1BA 1BR2A 3BZCA 3HHGA 3IH3A 2X4HA 1D1BA 2OQGA 4AYBA 3WTYC 3H6UA 2X51A 2V3QA 3SEQA 5E3NA 3OYBA 3VWBA 1B32A 3FXKA 1ZR2A 1AKHB 2BJJX 2XF7A 3HYIA 4A3JJ 1XI6A 2R8TA 1ZHFA 2RCBA 2QKMB 5A2QZ 2ZNSA 1EH7A 1ZKGA 3MYUA 2XA5A 5FKKA 3TEPA 4IR8A 4OFOA 2QZ8A 1WJEA 4ENMA 3M9AA 3SETA 4A93J 1R23A 2MH9A 4L9TA 2QBYB 1BA5A 5DEXA 3P7NA 1LE8B 2CQNA 1YOVB 3CLQA 3ZMSA 3GFLA 3GXOA 4FASD 1DK4A 1I27A 4HE2A 3GTLJ 4ANJA 3FM5A 3JSOA 3JR9A 5I59A 2LREA 4R74A 3BPXA 4O3BA 2XPVA 4EXKA 4R1HA 4CYCB 3Q5FA 2PJRA 2OUMA 3VSKA 4WKMA 3DV8A 5FHNA 1BIYA 2PJPA 3JAMK 2R7XA 5ERIA 2AL5A 1G3YA 2DVCA 2K27A 1WVRA 2Y69H 2DOAA 2D1VA 2WAQA 5IT9Z 1I6BA 2KZGA 1MQHA 3BJ6A 2LRDA 2ZFWA 3MP6A 4W97A 5JR3A 1H3DA 4RPOA 2L7FP 1IMEA 3G1LA 4ZEIA 2CQKA 3QYBA 4IRGA 3DKWA 2GXGA 4BQQA 1JKRC 3ZS6A 4NWDA 4XR6A 1PP8F 1BC8C 2B3FA 3M3KA 3RPWA 3SFIA 4LK1F 4NF0A 2EIKH 3WGHA 3MZHA 4O6JA 3K1PA 1H45A 1P99A 4M72A 3E3VA 2QLZA 4QLCU 2AQEA 1SEUA 1E2XA 1IXRC 3QQAA 4EMSA 4Y52J 4S05A 2F35A 2UVHA 3OSFA 4BJ6C 2XWIA 2IS1A 5FRMA 4R79A 5LGTA 2RN7A 3KP6A 2VKHA 4JX6A 1L0OC 2XKOA 3I64A 3L2UA 1J75A 1R6ZA 1VDWA 4MNCA 3RYDA 1T08B 2JA6J 5KK1A 2DQRA 4ZE8A 5JVGF 3MVYA 4JP0A 1U6GA 3OYKA 2H6BA 4XQFA 4PK4A 1A04A 4RAZA 2DPDA 1S7AA 1NMUA 3UKGA 2QEXI 5CJ9A 1PB8A 2Q2AA 4KA4A 9ANTA 1ON2A 1ZLQA 4BE0A 1SANA 2XPUA 3ESWB 2Z3YA 1J1NA 4ZEFA 4P9KA 1SFKA 4DYCA 4RGSA 2C6YA 1MBKA 1LAFE 2QPQA 1PBPA 3DM0A 3IKVA 4PP0A 3HPHA 4DZ1A 3CESA 1FPDA 3BR1A 1NKXA 4HQEA 2Z8EA 4U22A 3HGGA 4G77A 4Q8RA 3ERMA 2HVQA 4BS9A 3ECOA 4IJAA 4WK8F 5M5YJ 2BY2A 1BIBA 1UMQA 2JRMA 4BYYA 1DMBA 1AOVA 3HSRA 1QULA 1F9NA 5J6XA 3CDIA 2ECCA 4BAYA 2HXOA 1KYZA 1FQFA 4Q48A 1P1QA 2V84A 4CUGA 4UUVA 3C18A 1XD7A 4NE4A 1WI9A 4MLQA 1D3YA 4ZYDA 3W9WA 3Q0WA 1VQNI 1EYJA 3KN7A 4H5GA 2VQGA 3E5XA 2B63J 3C31A 2R0QC 2BVMA 5HLHA