1IZ1A

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Dna binding protein
molecule keywords LysR-type regulatory protein
total genus 92
structure length 292
sequence length 292
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1iz1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iz1A02
4JB7A 1FYKA 2RC9A 3PMXA 3I4PA 4AIJA 1TNTA 2BV6A 2VT2A 4DLDA 4G8MA 3HCQA 1QZZA 3OO7A 4WF2A 4GQOA 1Y3PA 1MXYA 1Z1DA 2JTVA 2AL5A 2FE3A 2DOJA 1JNFA 5JEIA 2G9WA 5ICFA 2I3VA 3KFMA 4ON0A 2NYXA 2NUVA 5I2KB 1URDA 3HYIA 3RIRA 1B6AA 2FXAA 5K5OA 5FFXA 1N3XA 2UXAA 1Q35A 1SW2A 2QL3A 3TOBA 3O66A 4RJZA 5KVRA 1MJBA 4I7HA 1ULYA 3A3CA 4DXBA 4GO1A 3T96B 1PP7U 1WSUA 3ZSFA 4F1UA 3G3ZA 3ELKA 2A5TA 2F36A 1HKSA 1WRJA 4LB5A 1EH8A 4E70A 3DV8A 1VR5A 3SERA 4FIMA 4UUVA 4IXAA 3TMGA 3ZKKA 4L5IA 1SI0A 3CJNA 4IO5A 2V3QA 5DYHA 4NQWA 1ZAOA 4HA8A 3FMRA 2ALUA 2IA1A 3TTLA 1TFAA 4YB7A 3UORA 4A0ZA 4NF4B 1XS5A 1FPQA 4B09A 1IXGA 5CVIA 5EYFA 1TTYA 1QJMA 5ICGA 3D0SA 1KU2A 3GLBA 2QZ8A 4KI0E 3SEUA 3PV0E 3OOAA 3PUZE 3G3IA 1LDDA 1DDNA 1MH3A 1IN7A 4C1UA 4QFKA 2V25A 4U0VA 2XX9A 3IB2A 1QO0D 2PLYA 1MZBA 1MXVA 1QVSA 4BXUA 1E17A 4M9XA 2XHDA 4KIBA 1P1UA 3GXOA 3D5LA 3V7SA 5LHGA 3FJMA 1BJAA 3JYRA 1EZOA 1ZREA 1MS7A 4F1VA 1QUKA 1D9VA 2ZNUA 2OQGA 3IHUA 4PGHA 3O2AA 2MLGA 3M3KA 3PQJA 1J0RA 2VOOA 1N7WA 5L3BA 2MD5A 1J75A 4LLLA 4A6EA 2EWNA 3Q29A 3HOTA 1GTKA 1LEAA 3CUQC 1B32A 4KYSA 1UTHB 1TQIA 1IW7F 4EV0A 1DPPA 1R7JA 1KU9A 4KDPA 5DYMA 2DP8A 3KP7A 1B52A 2Q2EA 3KP4A 1IITA 3UA8A 2HFHA 1XD7A 5CRYA 5FD6A 4KD5A 4UVAA 1IIWA 3IL1B 5H8NA 2A5TB 2V3TA 2HAVA 3R26A 1CF7B 3C32A 4RAZA 1TBXA 3RI4A 1XGOA 3V4GA 2STTA 4ESJA 2ZNSA 4IVNA 5CLSA 1UQWA 3THIA 2HTSA 2LSOA 1S3JA 1FBQA 4Z2YA 1MPCA 4QHQA 2H25A 2H5YA 3R60A 5ED4A 1T0KA 4NE4A 1NNFA 2MH2A 1CGPA 1O63A 4FATA 3C4MA 2EFWA 3JSOA 4ELPA 2RKMA 5J8FA 3WTYC 4AWXB 2QPQA 3MP8A 5HVQC 2XAJA 4G68B 5L9MA 1ON1A 5I58A 3WE3A 3G73A 1G3SA 1IZ1A 5HLGA 2W7YA 3HHGA 5E8GA 4IO4A 2UZKA 1DOTA 3QOPA 4ZYDA 1KYWA 2UXXA 4XSZF 2D5WA 1S7YA 3DPTA 1FLIA 3O28A 4LUBA 2Q2CA 3NEUA 4QFLA 1RZ4A 2ZMBA 1I6XA 3DP7A 4BDOA 2BYVE 2K86A 1EH3A 4IO7A 3GUDA 1FTMA 1XGMA 3FJGA 4H67A 2PI0A 1BN5A 1POY1 2ZXTA 3GYHX 2KIFA 2XXRA 3PD8A 2DBBA 1FBUA 3H6UA 4NF5A 1B51A 3MP1A 3T22A 3R6SA 3SZPA 2R71A 1I27A 3MCZA 3REOA 3T66A 3ODBA 2THIA 1UIUA 3L9FA 4FJPA 1R5GA 1NH8A 2QS3A 4DIGA 2GA2A 3WTZA 3OO9A 4RY1A 4IPAA 4U2RA 1Y9UA 3E6MA 1Y1ZA 4IRGA 2FRHA 3QAXA 5FO5A 4YFKF 5B7DA 2G7UA 2JT1A 1PEBA 3QXMA 1N7XA 3OXNA 1PBPA 1A8EA 1YAEA 1T38A 4CYDA 3IX1A 3O9PA 1USYE 4QSEA 3G7WA 1NL5A 1ZRCA 3MP6A 1MY1A 2FSWA 1A54A 3U8QA 2QENA 3KEIA 4LG0B 3TQNA 2BJJX 4LLGF 5I84A 4JWOA 1N3WA 4ISUA 1REPC 3ABTA 5EEHA 4NWDA 4OXVA 4RB3C 1TNSA 4HV5A 4K2EA 3OD7A 1DTZA 1OYWA 3OMBA 4GRKA 3O6HA 3K0VA 2O84X 2Z8FA 4PQJA 3C7JA 2AS5F 3CG3A 3HO7A 4KYDA 4KYWA 2FU4A 1RKMA 1QGPA 1TXFA 2HWVA 4RNSA 2ZYKA 1XOCA 2Z8EA 2F5CA 2VE9A 1QKBA 4HDUA 5I56A 3ROUA 4XKPA 4ESBA 2VBZA 4Z7EA 2DK8A 4PP0A 1Q1KA 1ZKBA 1QNTA 4ENKA 1VFEA 5FFZA 1VSOA 2EA2A 1MQGA 1AH5A 4H1XA 1BC7C 3TKYA 2DQLA 2GXBA 1MXWA 3RGYA 3W15C 2BE5F 2V93A 5TPAA 1SD3A 5J8CA 1OVTA 2A61A 3F6OA 4M71A 1U5TC 1LVAA 3MAJA 1JE8A 2HZLA 1M5EA 3BJAA 2CYYA 4D0PA 2C6YA 5D8LB 5E20A 3GBBA 5DVIA 4ZDMA 3H06B 2GAUA 5D4SA 1D8JA 3ZPLA 1IXRC 3CG1A 4OESA 3H03A 5DVJA 2WWYA 1FQCA 3KJTA 2GRVA 2H9BA 3QYTA 4UA8A 2DTRA 3WE2A 4JWYA 4YMBA 3Q28A 4M9ZA 3HTSB 1LB8A 3MJNA 4CICA 3JSPA 1NFTA 3TTRA 1B1BA 3Q9SA 3ONMA 4H8JA 4EGZA 3IOWA 5JR3A 3PFIA 4EJTA 2Q2AA 1I6BA 4Q5TA 2KKOA 3CVGA 2GH9A 5I59A 1LCFA 4FX0A 1F9BA 3MEXA 1KYZA 5L3FA 1B2HA 4CDGA 3OEKA 2LDUA 4TLLB 1T39A 1XMAA 1MD0A 2KRFA 4Q48A 2V84A 4G7HF 5D6FA 1YW9A 2EFOA 3B7DA 5H8QA 3IO6A 4LJZF 2HCAA 3FASA 5FB2A 2PFBA 1PB7A 5DUKA 4E0WA 1SBPA 1Z9CA 2XRNA 2BGCA 1QPMA 3FHZA 4M73A 4ZYHA 3E5UA 4MQ9F 2XXIA 3DELB 2Z5UA 3GZ5A 3TELA 5DTBA 4ONYA 2RV8A 1N04A 3KZGA 5AA4B 4GL8A 1Y0UA 1TLHB 1KQ8A 3TO7A 1ZGJA 2PT2A 1N0TA 3IAZA 5L3GA 1RI7A 5KK1A 1PB9A 5TU0A 2VHAA 2RC4A 4LK1F 3V8JA 3C33A 5E18F 4RXLA 5HS8A 4HX8A 2D2WA 3SEVA 3W6JB 2FOKA 5CJ9A 2VD2A 3CO7C 5ERIA 1K78A 1ZH5A 3DP4A 1DP7P 1ZARA 5LGUA 4UV8A 2I0CA 3N5LA 4IO3A 2Z8DA 2V3UA 4EM0B 4M6XA 1F5TA 4ESFA 3FVGA 2RC8A 2ZYOA 4L18B 4P11A 4L5JA 1FTKA 2QQ9A 4A0YA 4ZS9A 1YLFA 4OZ9A 1FBSA 5TP9A 2DAOA 4OEUA 3MAMA 2GIVA 1ZGAA 2VOZA 4I02A 1YG2A 3R0JA 3IK6B 1ON2A 1XGNA 1LNWA 5KZTA 4CHUA 5CM6A 1HKTA 1ZG5A 4FHTA 3O3KA 3RKXA 3EDPA 3VVFA 3MC2A 1OLAA 4ZEIA 2STWA 5H20A 3QPTA 1O57A 2XAHA 2QRYA 5A5XA 1A7LA 3IR1A 1SD5A 2ZMEB 4K3FA 2WKYA 4R2BA 3ZMTA 3D4CA 2LF7A 2RC7A 4WXCA 1IUDA 4HS7A 3O6IA 4I8CA 4G2ZA 3QPHA 1FQAA 1IXHA 1XSDA 4LMYA 2Y48A 2UWMA 3S9NC 1UTBA 1EZPA 2QBYA 2CGPA 1BIBA 1PC3A 2P6SA 1ZLJA 4HBLA 4QSDA 1B3EA 3LSXA 4G68C 3T8RA 1R23A 1SW4A 4OERA 2RDPA 3U2RA 4S04A 2BBYA 1YYVA 3OO8A 3CO6C 3SKPA 2ZNZA 2HDCA 4KN7X 5D6EA 1I1SA 5E17F 1XDUA 4YICA 5FLXK 4X9TA 4OETA 1IN8A 5I2NB 5BPIA 5FHOA 2VD3A 2XXPA 4F31B 5D4RA 1OVBA 4YB6A 4WXDA 5BPDA 2FBHA 3V7RA 4G8XA 2OU2A 2RN7A 3F6VA 1B9JA 3ZMUA 5F1RA 3UK4A 4YKIA 3OENA 3LAPA 4RYAA 2ELHA 3IOTA 4KICA 2OZUA 4DXUA 4TQUQ 1IN5A 3OV8A 3P9KA 1SW5A 4M4GA 4GCVA 3S2VA 3IB1A 1MM6A 3G3GA 1IUYA 5LBQA 3K2ZA 1PP8F 1G4DA 5H8HB 4ZZDA 1LBBA 1QZYA 3KETA 2IRFG 1JQFA 5AA3A 1MY3A 5FTHA 5I2NA 4ZEFA 3TUSA 4AIHA 3R7XA 3EYIA 2HOEA 4NF6B 2G7HA 5HDKA 2CFXA 5DCFA 1K7AA 2EFNA 4YIFA 1TT1A 4YMAA 4F3PA 3F8NA 3LA2A 1CB6A 3E13X 2DYXA 1O3QA 3QIMA 3BZ6A 3FMQA 2OZZA 3ISPA 4G6QA 3A09A 2MC3A 5FLXZ 2CW0F 2UVJA 1P1WA 5IKBA 1AOYA 1LB2A 3WAFA 5TP9B 3P9CA 4OIQF 5DCMB 2MH9A 3KN8A 2KJBA 2A6HF 2QJEA 4OMZA 3DXJF 5H6RA 1W7PA 2PMUA 5A5XB 3ECHA 3E6DA 1SFEA 4KMFA 3QK6A 3M1EA 3G3JA 2QVOA 1XN7A 3TO6A 3H3GA 2D1VA 4GL0A 3BKIB 3I5UA 2JPCA 4BDRA 4MEYF 3ZS6A 2NVUB 1DPUA 3ML6A 4AB6A 3K02A 3L6HA 2VONA 2A5YB 3IKTA 1L5TA 1QW0A 1H43A 3GF2A 2XIGA 1FTJA 3I59A 1P4WA 1XSVA 1EH7A 2ETHA 4RK9A 3S9LC 4OIRF 1M5FA 3J80Z 1SYIA 4L0ZB 1MRPA 3EPEA 5FGMA 2JZYA 2XXTA 1TQMA 4N0BA 2DW4A 2GHBA 2OWTA 3Q25A 3LWFA 5CI5A 4KMUX 2EV0A 3E97A 2NNNA 1MQIA 4H0EA 4RB0A 4BHBA 4NMYA 1ZN2A 4UV9A 2F6GA 1LGBC 4ND9A 3SQNA 1Y20A 4BDQA 5A2QK 4NHJA 3I64A 2QM3A 3H6WA 5CMBA 3TYHA 3UIFA 2XD3A 1F4KA 3TCFA 3SEXA 1S8NA 4OINF 1B3HA 4OU0A 2QS1A 3HN0A 4IF4A 4HZFA 2HXWA 2M45A 2A5SA 3FVNA 1U78A 1FP2A 4C0RA 1B59A 1U5TA 4MBPA 4Z0IA 4G8NA 4ZYGA 4I09A 4G94A 3KEOA 2FBKA 5CBRA 5HS7A 5CMMA 1OIBA 1ZMGA 3RY3A 2QBYB 5ITPA 1MY0A 2QWWA 2VC0A 1ZRDA 3WTSC 3DP8A 3VFZA 3QP6A 3GO5A 3PMWA 2KJCA 5DD8A 2NNYA 4XIGQ 2HYGD 5BMZA 1J7KA 4XRFA 2O61A 2CQKA 3F8CA 1MJ9A 1WQ2A 1G6NA 3E6BA 1ODDA 2VOPA 4F29A 2PBIA 1JHHA 2P4WA 1MPDA 4R1HA 5AA2A 5K2XA 2XX8A 3BOQA 3Q5FA 5A2QZ 1XVYA 3SXYA 4A5NA 3EQ1A 4LG0A 3ILTB 5IT3A 3PU5A 3V7CA 3B6QA 2V1XA 4U7DA 3MUQA 4Q5SF 1LEBA 4EM2A 4PETA 1I1GA 3K1PA 2DI3A 1BOAA 3GEZA 4WEDA 3GFLA 1XC1A 4MLQA 3EETA 1B40A 5L3CA 2XHKA 2RCBA 4KT5C 1BM9A 4IGRA 3S4UA 3K6XA 1O3TA 2CWEA 2OAZA 4QFOA 3B02A 1S6LA 3O6GA 2Y7PA 5D5WB 5CVUA 1Y4CA 2F8DA 2OD5A 4NEDA 1USTA 2IW5A 2ABHA 1RIOH 2V1DA 4KFCA 2ZYMA 4Y13A 3I5OA 5I56B 5DVFA 2V79A 3N97A 2DE4A 2WC2A 3QP5A 4YKPA 4R9GA 2O6GE 5F7VA 3IOVA 3MWMA 1MQDA 2E1CA 1HSEA 1S7OA 3TQLA 1S50A 2W85A 5AE4A 3U93A 2ONRA 3PUYE 1PBQA 3NQOA 5H8FA 4LATA 4LVQA 3K9TA 4G8HA 4UNOA 3HOSA 4DDDA 3RT8A 4CO8A 2M5WA 4E0XA 1I6QA 2F7BA 1ZG3A 2FF4A 1C0WA 1NHAA 2DPUA 2RKHA 1YCJA 4MNUA 2PVUA 3RKWA 4Q30B 5I58B 3L00A 1HW2A 5AIQA 1R9LA 1Z7NE 2QS4A 3B6WA 2A68F 1D4NA 3V8LA 4FAJA 4A0XA 3BJ6A 3I0TA 4GVOA 5BUUA 2HR3A 2W25A 4KN4X 5LLQA 1FSHA 1ELJA 2DWHA 4H5GA 2D45A 3K01A 1W5TA 1ZLKA 2XV4S 2EJRA 3DF8A 3KZZA 2QQBA 3TQWA 2O69A 3EF7A 2Y0MA 4JK1X 5HM4B 1P92A 2O51A 3K00A 1MQHA 2FNCA 3FV1A 4NF5B 2UYFA 1Y4TA 3L2CA 1TW2A 3TCHA 4G9YA 3HSFA 1SDXA 5KDTA 5CC2A 3IRQA 4GXOA 4PGGA 3LFKA 4XSXF 1P4AA 5L8DA 4H6DA 1NKXA 3PPQA 3GFIA 3WTUC 2A07F 1XSXA 3HHFA 1FSEA 2Y75A 5D8KB 1CF7A 3MZYA 1L3LA 1URGA 2IA4A 3E5XA 2VP1A 3FX3A 3PPOA 5DV5A 3ULQB 3M9AA 2QYOA 1XMKA 4HQMA 2COMA 3GLXA 4JQFA 3ECRA 2M30A 1Z7UA 4LFUA 4BHCA 2DSFA 3R6UA 4PDKA 3KJ7A 5JTYB 3DQVC 1OMIA 3IKVA 2REGA 2PEXA 5F64A 1XB4A 2IVMA 4MLVA 1JEVA 1OQGA 4YFNF 1MDQA 3WU1B 4OHNA 1WDNA 1P1NA 3DKWA 1U2WA 1H9TA 2OBGA 4ELOA 2OA4A 5ICEA 3R61A 1B5JA 4R79A 3T5XA 3QUJA 2K4BA 5LGNA 3KG2A 4KA4A 3H6VA 2LNBA 2F2EA 3FMSA 4KUMA 1KQ9A 3GX4X 3MVYA 3TEPA 2V9VA 1FW0A 1US4A 3HHHA 1HW5A 4UHTA 3U1OA 2HTJA 1WWXA 4KCDA 3WGHA 2NS0A 1JW4A 4FX4A 2VODA 4M72A 3N4MA 4AQ4A 3T8TA 4HCWA 3D4GA 5AONA 2YPNA 4GYGA 1YS6A 4BH9A 3C9HA 1XVXA 3L09A 5F1QA 2DK5A 2H6CA 1S9TA 3KN3A 3C34A 1WKMA 3CFXA 1DMBA 5ICCA 4HYEA 1P1QA 4U21A 2F5DA 1P99A 5I57A 1Z6TA 1GHCA 3TFLA 2PBWA 2HEOA 4N6PA 1GV8A 4UACA 4FECA 4L17A 4MEXF 1B6HA 4B8XA 1IXSB 3F8FA 2Y7WA 1OKRA 1YS7A 4OEVA 1IAWA 4RB1A 3JTHA 2OBPA 1BI0A 5JVTA 4ENNA 4GWOA 2XAQA 2F97A 2OZ6A 1HXDA 1BI3A 4WX9A 1PDAA 1SW1A 4ELRA 1B7UA 3C31A 3MVWA 1QBJA 3EHTA 4L0YB 4G4PA 2FNAA 2CO5A 1LQ1A 3MQ9A 3E3VA 2CZLA 2IA0A 2ANJA 3ILUB 5I2KA 2HKOA 1B5HA 2ZYNA 4ZE9A 4Q4ZF 4MQVA 1FCKA 4ENJA 3TKDA 1W7PB 1P6RA 4M6YA 4N13A 4GD5A 2O7IA 1USSA 4ENMA 3CDHA 4O3AA 4ZEDA 1K79A 1J59A 4KPTA 3HRUA 3LSLA 1H45A 3VE1B 3IB0A 1O3SA 5BS6A 4OFLA 1JEUA 1FOKA 1T98A 4GFRA 1YO5C 3AAFA 1FQBA 3FJ7A 4P9FA 3UN6A 3PUVE 2GXGA 4EQQA 4EF2A 1B4HA 3G3FA 3U72A 4AD9A 3TO9A 3TTNA 4BYYA 3MZBA 3F11A 1YFHA 2X7QA 2Q88A 3MW0A 4BHPA 3HV1A 4YB5A 2D3IA 1S7AA 3T1BA 5KCJA 4OTEA 1UIVA 1QQIA 2V6CA 3EN3A 1KU3A 3PGFA 4Q8RA 2GHAA 3LBSA 3TTKA 1AMFA 3CFLA 2UXNA 2HQRA 2JSCA 2XROA 4U4SA 1R1NA 2GZWA 3M7GA 3RYRA 1D3KA 1HSLA 3VLWA 4YG2F 2KIUA 2GFEA 1GXQA 4ZZEA 2CMOA 4GXSB 4ECFA 4Q47A 2YX7A 3BROA 3PD9A 4YU0A 2ISYA 2VC1A 2Y84A 4HQEA 4NF6A 2RVCA 1PUEE 3USDA 3V5AA 5CMKA 4KHZE 3E3KA 4L9NA 2QMXA 1BC8C 1WVJA 2EFQA 3QRFF 3S9EA 4PFWA 5JK4A 3JZJA 1BIAA 4O5VA 3P7IA 5D5XB 4EGYA 4R6YA 2YLNA 1TFDA 5CVJA 3CRBA 1D3YA 1B0HA 4R2FA 1FQDA 1H9GA 3KOTA 2ZMEA 3ZMDA 2RCAA 4R74A 3ERED 1A99A 2L3DA 4WKMA 2ZJ2A 3OEMA 1IXCA 4WCGA 4XKNA 1G3WA 3KZYA 1R1UA 2NWJA 5ISUA 3U92A 2QLZA 4AVPA 4HW8A 4LB6B 3WG9A 2E0SA 4LA9A 1O7FA 4IY6A 2P6TA 1JHFA 2D21A 1I69A 4TLMB 4ESXA 4RGSA 2EFPA 1ZTYA 1B0LA 3GZGA 3BDDA 3KP2A 3S2WA 3K1MA 4DQ2A 2RGVA 2ZCWA 1RUNA 2QUFA 5HDGA 4PCQA 2I58A 3Q27A 3U94A 3CI8A 1KGSA 4KCCA 3FUZA 4YKJA 4U0YA 2L4MA 4EXLA 3KOSA 1ZIUA 2KIMA 3CSBA 2GA1A 1W4MA 3F8BA 4LONB 4Y17A 4JWXA 4LP2B 5AA1A 3QU3A 2DE2A 5E1WA 1M5DA 5DUIA 1B5IA 1PB8A 3H4ZA 1VFDA 2RINA 4HF0A 3ZKLA 4FT8A 1AOVA 4PFYA 2ONSA 3GFMA 1J5YA 2IA2A 3KGCA 4P0IA 1UHWA 1MG1A 1VE4A 1R6ZA 1SYHA 2XXUA 2PQ8A 2W84A 4DNCA 4KIGA 3PUWE 2Y7RA 1X3UA 2I0BA 2P7VB 2XXYA 2JRTA 2DE3A 4DCYA 3GVAA 3KLNA 3IOUA 2FA7A 1J9IA 4HAMA 3HIFA 1UHMA 2BEOA 2O3FA 3IWFA 2F5FA 2ZBKA 4G6DA 3CUQA 2YX4A 3WODF 3DLNA 3I6VA 1UFMA 4RPOA 1URSA 4IRHA 3LSFB 4L9TA 1HQCA 3JW4A 4P5OA 1F1ZA 4EM1A 1US5A 3ZN0A 4YZZA 2VBWA 3OSQA 2B3FA 1G3TA 1ZHFA 1GVCA 2YSRA 5K5RA 4LK0F 5I59B 1R00A 3M3LA 3TAJA 4GF8A 3I58A 3E5QA 4PZJA 4ELQA 2E7XA 2AYSA 5IT9K 3HSTA 3QSLA 5BOXA 4UXNA 2W24A 1U6GA 3K6WA 4BLAA 3P9IA 5ICQA 1O64A 4WEPA 3W6KB 4PFTA 4OVJA 1HBXG 3VFJA 4A6DA 4R9FA 1YW8A 1MH4A 4JDFA 2V1UA 1Z05A 2AIXA 1H0MA 3HTUA 3C18A 2I49A 2QS2A 2Q0OA 2RQPA 1YIOA 2ISZA 4HF1A 1YPNA 1OPCA 2HQ0A 1J2XA 1E2XA 1T0FA 1MXZA 5H8QB 1XCBA 2VE8A 2H98A 4HV6A 1NNPA 4H0WA 3SEWA 3VLUA 3T0YA 4FEBA 1MGTA 3G3HA 4RGRA 3MWBA 1B05A 4I1DA 2XKPA 2X26A 1YQAA 3RPQA 1XT8A 2ZNYA 2PMSA 4G68A 1S29A 3FWEA 2XXXA 4O3BA 1Z91A 4QFPA 1M5BA 3Q26A 5DT6A 5ILUA 4L9VA 4N9IA 4ZZAA 5JTYA 1B58A 1XCVA 1KWHA 2XXHA 3UGWA 3LC8A 5L9OA 2OCUA 1B1HA 3S9MC 4EJWA 3BFUA 3RNNA 4ZH4F 2UYEA 2XXWA 4U23A 4OIPF 4DE8A 3WU0A 4ZECA 5E1ZB 4JXIA 2H09A 1JXSA 3VXCA 1SMTA 4H5FA 1VTNC 2WTEA 2F7CA 2FYIA 3VOEA 1QUIA 3F72A 2NAZA 2X0LA 2YR2A 3B73A 5H8SA 5KDTB 3WTTC 3LUYA 3QAHA 2PG4A 4BQAA 4HLXA 4U1OA 1TWYA 1B9NA 5E1XA 2P5VA 3F21A 1XHYA 1KA8A 3IRRA 4F3SA 3IORA 4PE5B 2I48A 3BFTA 3RQTA 4A12A 1U3EM 2VGQA 2REJA 5ICTA 1R1TA 3BP8A 2R7DA 5D5UB 4BDMA 2ZO4A 1B7ZA 2ZXJA 2VT3A 4IO2A 1G3YA 4XBFA 5TJJA 1H3DA 3KP5A 3M8EA 1N84A 4NF8B 2L02A 2F5EA 4OIOF 3W9VA 3KCCA 4G7ZF 3PUXE 4HCYA 1AWCA 3I59B 3EYYA 2LKPA 2MLKA 2X4HA 1II5A 3LR1A 3N94A 2M8CA 2Z22A 3MPKA 3V8XB 2FEZA 3IWZA 4QF9A 3MZ1A 1Y3QA 2B3BA 3UP9A 2HFBA 4EVIA 1JW1A 2OQRA 3MPLA 1GR2A 5HOOA 1DPEA 1SQYA 3TCGA 4MTDA 1OYYA 3O2PE 3ZP5A 2DWJA 1U5TB 3B6TA 3TZAA 5LEJA 1SAXA 4CZZA 1OQHA 2XGXA 5L3DA 3TPAA 4P96A 4OOIA 2EV5A 3WTVC 4X1BA 1ONVA 3GFJA 1SFXA 1R1VA 2TDXA 1LLSA 3IJXB 1HKQA 1IN6A 2P7CB 2YU3A 4RGXA 3H92A 2O8XA 3LSWA 2PX1A 1EZ9A 2H94A 1ZBMA 1O7LA 1OR7A 4GXAA 4F7ZA 4CGZA 3J80K 1IN4A 1U8RA 3HUGA 1I6AA 1BI2A 5L3EA 4QFNA 2XXVA 3BPVA 4F3BA 1ANFA 3MZ9A 3PPNA 4EMSA 5LHIA 4NB5A 3QU6A 1OLCA 3KN7A 4LLNA 4LD5A 4TOZA 4U0WA 2P1SA 2MBFA 3ZN1A 1BTJA 2P5KA 4I9DA 5JHUA 3WTWC 3KBRA 2PYYA 4X1DA 3ZQ7A 2Q9TA 1LAFE 3OO6A 2RNJA 3JAMZ 3W9WA 5EEGA 3RKYA 2HZKA 1UTHA 2I4CA 3U9GA 4LGWA 4MGRA 4F39A 1O3RA 4IB2A 1SMYF 1EV7A 2P8TA 2G29A 1IF1A 4CXFA 5F6FA 1P4XA 1Y3NA 1Z6RA 3EQLF 3MVXA 4QWQA 1FQFA 1IQ7A 2M8EA 1MXXA 4JBAA 4R8HA 1A40A 1D8KA 1UCRA 4N07A 3LAJA 3SETA 3C3WA 1FWZA 1WI9A 5LRRA 3HPIA 2PJPA 2DVCA 2Z99A 3E6CC 3RN8A 5CBSA 2GQQA 2Y7IA 3KSJA 2I6EA 3HRMA 3JAMK 4OFJA 3IL2A 2M87A 4IHSA 3WGGA 2O68A 3H6TA 3KE2A 4WXHA 4P55A 1FTOA 4XKRA 5FTIA 4HX7A 2IP2A 5CVVA 3RUMA 1RUOA 3M8FA 1IEJA 3C35A 2O1MA 5H8NB 5AA2D 6PAXA 5LEKA 3U1DA 3NRVA 3C36A 2IT0A 4GIZA 4KYEA 2LAOA 1TW3A 2VN2A 5CYVA 5HLHA 2HKXA 1GXPA 4WXJA 3HSRA 3ABUA 5ELVA 5FHMA 4O3MA 1FY7A 3R4KA 1LBCA 5LHHA 1B3GA 1LFHA 1HSTA 3VVDA 2J5OA 2DO7A 2ACJA 1T2KA 5ILVA 4YIIA 1UTBB 5FHNA 1FTLA 3K1NA 3MQ0A 2FMYA 4BNCA 1Z7ME 3LQRA 2OLBA 3J7AO 2O0YA 3PMVA 1H76A 1SVXB 4DCXA 2HYFA 2F6PA 3PPPA 3BY6A 1BBYA 3O29A 2A69F 5LRSA 2M1BA 5DEQA 1QUJA 2IEEA 4EJVA 4FORA 3O6BB 4A2UA 5M2VA 2G93A 2FQ3A 1SD7A 3BWGA 2I3WA 1L0OC 4OYVA 1ZJLA 4OMBA 1B3FA 4ZEKA 2EK5A 1LAXA 4Y15A 1SD6A 4F2OA 1M5CA 2MA3A 3T93B 1GGGA 1K78B 3ZMZA 4OWDA 4R75A 2DWIA 4LQ2A 2VXZA 1JVYA 3SZTA 4WWCA 2H4IA 4DXCA 4HOBA 2Z9OA 2CSOA 2OJTA 3H3ZA 4ETSA 1POTA 5KCJB 1FT9A 4YAHX 3LA7A 4F18A 4JBZA 5DCMA 4HTGA 3SEYA 4MFIA 5EHSA 3I3VA 1FQEA 3T9HB 3GW2A 1FP1D 1ZYRF 1B4ZA 4FE8A 4MF3A 4XLNF 1HSJA 3HRTA 4X48A 1LCTA 4I2OA 2DQVA 3H7MA 3FGSA 4L9JA 3E4RA 1STZA 2XX7A 1I5ZA 2P2AA 1D9YA 3L6GA 3RTRA 1KQ0A 3COAC 3VXBA 1LFIA 3F22A 1B4AA 5AIPA 1MDMA 2UVGA 4GLIA 2ESNA 4R6KA 2K7LA 4U22A 1SD4A 2OK2A 4Q0CA 4NF8A 3DFGA 3TOAA 4KNYA 2LF8A 1MKMA 5LGTA 3KSXA 2K4JA 3WTXC 3FXUA 4QRZA 5J1DA 3IC7A 3VLVA 3FD3A 3F8MA 3FM5A 3TODA 5HS9A 3CR9A 5H8FB 4HW0A 2A3SA 3K69A 3WAEA 1GVJA 4G7OF 2UVHA 2VBXA 1TQPA 4XKQA 4GOTA 3TGNA 5CVRA 3T9XB 4RB2C 5K2YA 1K6OA 2PN6A 4R72A 2ESHA 3K0LA 4F3GA 3CUOA 3EUHA 5I57B 2EA4A 3V8KA 2R3SA 2ONKE 4BDNA 1WODA 3C1DA 2K27A 1B46A 1R36A 4F22A 3K4UA 3HSEA 1BIYA 1MM7A 3J81Z 2F35A 2HQNA 2WV0A 3HRSA 4IJAA 2L54A 4OQOA 2H99A 1AL3A 4C1TA 3PQKA 4EQBA 4RK2A 1NNKA 5IAIA 3TDUC 5TRDA 2AXLA 2DT5A 2VBYA 3ZMVA 3RT6B 3SHFA 4GYIA 1MDP1 2NRAC 1A55A 1H44A 2B65A 1LSTA 3IO4A 4EXKA 4RPNA 3EHUA 3V89B 4M9SA 4JSOA 1IXIA 3I54A 2QSXA 2Z3YA 2X7PA 4UVCA 1MPBA 1ZLQA 4KIFA 1FC3A 2Q8JA 1YTYA 3TDJA 1JVXA 4JSDA 5DEXA 2QQAA 1BLFA 2UVIA 3TDZC 3FVKA 2XAFA 3VEPA 2OWSA 3VDFA 4WK8F 2XKOA 3CLOA 5ITOA 4H65A 1DPRA 4P9UA 2Z33A 2O7UA 3JV9A 4P0GA 3FIRA 5DEXB 4HDVA 3FVOA 2R6GE 1KU7A 1QULA 2H6BA 3GZ6A 1T6SA 4RAYA 2L4AA 1MXUA 1LAHE 1Q1HA 3K2DA 2Q8KA 3MVZA 2F5XA 4IGTA 1LJ9A 5JI6A 1IRFA 4OMYA 2XAGA 2AL4A 3KLOA 3VODA 1USYH 3J81K 1ZRFA 2DVZA 2DFIA 1LB9A 3I71A 1SFUA 4ZE8A 1XGSA 3CIJA 2HEUA 2R9JA 3A3UA 4OFOA 4I98B 3VV5A 5LOMA 2DWAA 4ESWA 4LQ5A 1ZG1A 1JETA 4FEDA 3ZMSA 4RA1A 5E8IA 3RLFE 4I0BA 1EH6A 3F3XA 2D1HA 4IHTA 1FYLA 1D5VA 4HLYA 3M3FA 1FYMA 4NWCA 4DZ1A 3FV2A 3DP6A 4F19A 2R7FA 3G3KA 1LDJA 2ZKZA 3FATA 4OENA 1RYXA 3LA3A 2KLFA 5HLIA 3MZHA 3RTWB 3VB2A 5AA4A 3N6UA 4BAYA 3CFZA 3H3UA 3SFZA 4R73A 1DTGA 1R58A 3MBPA 4U4XA 3CUQB 1RYOA 2E1NA 3R0AA 2K02A 3SDFA 1OYIA 1Y1MA 4U88A 3VVEA 2F7AA 1V3FA 1W7PD 4ZYEA 4QSCA 4AIKA 1W5SA 2GWRA 1B7HA 1LAGE 3QUFA 4MH5A 3IJOB 3FF5A 5H6QA 4YKKA 3O97A 4I01A 2Z23A 2L01A 1ATGA 1N76A 4I62A 3TTMA 2FBIA 4M74A 4EUOA 2O6AA 2O03A 3KP3A 4M1VA 4POXA 1R22A 5BQTA 3FXQA 2JPBA 4YFXF 4A5MA 1J1NA 1JGSA 1OMPA 3OELA 1A04A 3DM0A 3L7WA 3CSGA 5BWJA 3I53A 1DSNA 1A8FA 4XLPF 1EU8A 5FD5A 3GXAA 3BJOA 4PFUA 2PMHA 3Q9VA 1FNNA 1FZPB 1F9NA 3F23A 1IRGA 4R6HA 3KFWX 1LFGA 4AB5A 3RTFB 4EF1A 4BDLA 2FMLA 4ASNA 2E7WA 2EV6A 4GGGA 2DXRA 2O1LA 3E9XA 2XUBA 1BI1A 2XASA 4KR5A 2DQRA 3RPUA 4EJOA 2F34A 4HX4A 2PT1A 2J5PA 3AXFA 3RJPA 2DLLA 2HS5A 2ZNTA 4KQPA 5TPAB 3KEQA 5L9SA 3SESA 1B3LA 4ZEBA 4H8IA 1MQJA 2DU9A 5B70A 2W57A 3OOPA 5JFRA 4MTEA 4EJUA 2QMWA 2NXOA 3RDIA 4I0AA 4EQ9A 4LZ5A 2Q89A 3M8UA 4IRIA 3T9UA 5K1YA 4N9HA 2P5LC 1R5HA 3RPWA 3OSRA 1RNLA 3N6TA 2IJLA 5H8HA 2EB7A 4S05A 4MHGA 3CTAA 3FZVA 4RS8A 3LSTA 3P7NA 4TV7A 5AA2B 5J6XA 2RF1A 1NH7A 3K6UA 5D5VB 5HPQA 4QLCU 4G77A 1B9MA 1AIVA 2YPRA 3DEUA 1QKAA 1O7TA 2XD2A 3EHSA 4THIA 4KFQA 5HBCA 4XXUA 3K6VA 4IO6A 5DDGA 3FM3A 4O3CA 1NMUA 4XTCQ 3V83A 2DS9A 1B1XA 3KP6A 2DXYA 2XXQA 1YTVA 5EHMA 2HGCA 1FX7A 1V4RA 1MDMB 3RYPA 1MJAA 1MY2A 4EDPA 2HZTA 3BPXA 4LZ7A 1NNTA 3JTGA 2FA5A 4EQ7A 2IPQX 4RGUA 3T9VA 1P1OA 1BKAA 1MY4A 3ECOA 1R9QA 4NTLA 1BP5A 3MFKA 2DPDA 3GBAA 3DPLC 5ILSA 2E1SA 3FXRA 2I4BA 3BBRA 2A6EF 2FNPA 4ZZLA 4NF4A 5DD4A 1UB9A 1DUXC 4F2QA 2CG4A 1HW1A 5K5QA 4HF2A 4LZ8A 4U1ZA 2XVCA 3N26A 2B0LA 1CE2A 2YJPA 1SI1A 2Y7KA 2ZFWA 3PPRA 5IT9Z 2ADUA 5HDNA 2HAUA 4POWA 4U7BA 3WGIA 2F78A 3LQQA 2NOOA 3GWZA 5CMCA 1PDNC 1JW5A 4F1YA 1ZU0A 1XDSA 4UVBA 1LDKB 4O6JA 2H27A 1YW7A 2P0SA 4IY5A 1P2FA
chains in the Genus database with same CATH superfamily
4JB7A 1FYKA 2RC9A 3PMXA 4OAYA 3I4PA 4A69C 1TNTA 4AIJA 2HPMA 2BV6A 2VT2A 3OR1C 4DLDA 2OF7A 4G8MA 3EPZA 1FMVA 2RAEA 4LN5A 1ENHA 4B4CA 3HCQA 1QZZA 2ELKA 1MIJA 3OO7A 3KC1A 5K7FA 4WF2A 4GQOA 1Y3PA 1OLTA 1Z1DA 1MXYA 1SVMA 2W4SA 3CLQA 2JTVA 1WI3A 2AL5A 2FE3A 4J19A 2X48A 2DOJA 5F24A 1JNFA 5JEIA 2JVGA 2G9WA 4XL9A 5ICFA 2I3VA 3KFMA 2ZJQF 4ON0A 2NYXA 3LSJA 2NUVA 5I2KB 4Y52J 3S15J 4MJOA 1URDA 3ASOH 3HYIA 3RIRA 2EH3A 1B6AA 5EG0B 2FXAA 1YITI 5K5OA 5FFXA 1N3XA 2UXAA 2M4GA 1Q35A 1SW2A 3TOBA 2QL3A 3O66A 5KVRA 4HE2A 3IFCA 4RJZA 2LFBA 1MJBA 1SVLA 4I7HA 1ULYA 1VF9A 5HODA 5E3OA 1SEUA 3AL0B 4GO1A 3A3CA 4DXBA 3T96B 3VSKA 1PP7U 5C4XJ 1WSUA 3ZGKA 3ZSFA 1J09A 5EG0A 4F1UA 1F36A 3G3ZA 3ELKA 1ERDA 3OYMA 2A5TA 3PUFA 3LSIA 2CJJA 3OS1A 2F36A 1HKSA 2FD5A 1I3AA 1WRJA 1YJNI 4LB5A 1EH8A 4E70A 3DV8A 1VR5A 1CNQA 4FIMA 3X2QH 3QPSA 3SERA 4UUVA 3LSKA 4IXAA 3TMGA 3ZKKA 4L5IA 4GWXA 1SI0A 3CJNA 4IO5A 4XNFA 2V3QA 5DYHA 4NQWA 4S0HB 2MGQA 1ZAOA 4HA8A 3FMRA 2NVXJ 2IA1A 2ALUA 3TTLA 2Y31A 1TFAA 4YB7A 2K9SA 3UORA 4A0ZA 1GT0C 4NF4B 4PAIA 1XS5A 5E3LA 1FPQA 4B09A 1IXGA 5CVIA 4PFRA 2UV1A 5EYFA 4UB8C 1TTYA 1QJMA 5ICGA 4XLCA 3D0SA 1KU2A 1NUXA 4P3LA 3GLBA 2V6EA 2VIXA 2QZ8A 4KI0E 3SEUA 2ZZXA 3PV0E 3JRDA 3OOAA 3PUZE 3G3IA 2QKMB 1LDDA 1DDNA 3DBHB 1MH3A 1IN7A 4C1UA 4QFKA 2V25A 5K7HA 4U0VA 3FXMA 2XX9A 3IB2A 1QO0D 2PLYA 1MZBA 1MXVA 4A3DJ 4BXUA 1NUWA 1QVSA 1E17A 1ORKA 2FQ4A 4M9XA 5GADJ 3G71I 5ET8A 2XHDA 4KIBA 3HFUA 1T56A 3DKYA 4IQJA 3GXOA 3D5LA 3V7SA 5LHGA 1P1UA 1BJAA 4YIRX 3FJMA 3JYRA 3I55I 1ZREA 2VUMJ 1MS7A 4F1VA 3S3OA 5TISC 1QUKA 1D9VA 3H0GJ 2ZNUA 2WBDA 2OQGA 3IHUA 2JUGA 4PGHA 1GV2A 1BR4A 4QSHA 2MLGA 4CZCA 3PQJA 1J0RA 2VOOA 1IMCA 1N7WA 5L3BA 3M3KA 2MD5A 3DLLF 1J75A 4LLLA 4A6EA 2EWNA 3Q29A 4LG3A 3HOTA 1GTKA 1LEAA 3QOEA 2HPIA 3CUQC 1B32A 4KYSA 1UTHB 4AIDA 1TQIA 3DTEA 1IW7F 4EV0A 1DPPA 1R7JA 1KU9A 4KDPA 3K10A 5DYMA 1D1AA 4BJ6C 4DW6A 2EILH 4B43A 1DU0A 2DP8A 3IH2A 3KP7A 2Q2EA 4NDLA 3KP4A 4BDYA 1IITA 1B52A 3UA8A 2HFHA 1MMAA 2R7TA 1XD7A 5DTDA 5CRYA 5FD6A 4KD5A 2L7MP 4UVAA 1Z0XA 2P81A 1IIWA 3IL1B 3OL3A 4XRSG 4E7LA 5H8NA 2A5TB 2V3TA 1FPGA 2HAVA 3HJEA 3GTPJ 3JRAA 2JJ7A 1CF7B 3R26A 4HNTA 4RAZA 1TBXA 3RI4A 1XGOA 3V4GA 3C32A 2XWKA 2STTA 1NUYA 4ESJA 2ZNSA 4IVNA 5CLSA 1UQWA 3THIA 4BGDA 2HTSA 2LSOA 1S3JA 1FBQA 4Z2YA 1MPCA 2M0MA 1IO2A 4QHQA 2H25A 2H5YA 3R60A 5ED4A 3M4OJ 1T0KA 4NE4A 1NNFA 2MH2A 1CGPA 1O63A 1XI6A 1BK4A 3C4MA 4FATA 2EFWA 3JSOA 1ETYA 1QRYA 4ELPA 2RKMA 2LLKA 5J8FA 3WTYC 4AWXB 2QPQA 4M3DA 5HVQC 2XAJA 3MP8A 4G68B 5L9MA 1ON1A 5I58A 3WE3A 2K3FA 3BCAA 3G73A 5FLMJ 3L2VA 1G3SA 1IZ1A 3F9KA 4N91A 5HLGA 2W7YA 3HHGA 5E8GA 4IO4A 2DOEA 4M3BA 2UZKA 2E35A 2F4MB 1DOTA 1G8XA 2OCCH 3QOPA 4PDHA 4ZYDA 4E7KA 1KYWA 2UXXA 1VQPI 4XSZF 5J4YA 2D5WA 1DGRM 1S7YA 3DPTA 1FLIA 2XWIA 3O28A 4LUBA 3CC7I 2Q2CA 1OJLA 3NEUA 4XKWA 1D5YA 1RZ4A 2VKDA 5F1JA 2ZMBA 1I6XA 3DP7A 4QFLA 3ESWB 3PO2J 5FKOA 3RZOJ 1WVRA 4BDOA 2BYVE 2K86A 2WAFA 1EH3A 4IO7A 3GUDA 1FTMA 1XGMA 3FJGA 4H67A 1Z7LA 1P7JA 2PI0A 1BN5A 3BG9A 1POY1 4RA2A 1DP3A 1QVTA 1SPIA 2ZXTA 3MZ8A 3QODA 2KIFA 3GYHX 2XXRA 3PD8A 4P8BA 2DBBA 1FBUA 3H6UA 3BCBA 1B51A 3MP1A 4NF5A 3R6SA 3T22A 3SZPA 2R71A 3OYBA 1LFUP 2K40A 5LFAA 1VI0A 1I27A 3MCZA 3REOA 4ZDPA 3T66A 3ODBA 2THIA 5IP9J 1UIUA 4PJLA 3L9FA 4FJPA 1FPFA 4NN3A 4XF5A 1R5GA 2I10A 4IZZA 1NH8A 1NV3A 3ZOBA 2QS3A 4DIGA 2GA2A 3WTZA 1TT5B 3OO9A 3UKGA 1VQ6I 4NG7A 4RY1A 2LP0A 4IPAA 4U2RA 3M8JA 3E6MA 1Y9UA 5M3FJ 1Y1ZA 4IRGA 2FRHA 3QAXA 5FO5A 4E6KG 1UHSA 4YFKF 5B7DA 3AG2H 2G7UA 2JT1A 1P7IA 4KISA 4HE1A 2R8TA 1PEBA 3QXMA 2DT6A 1DBZA 1N7XA 3OXNA 2CEYA 3CC2I 1PBPA 1A8EA 4HXVA 1YAEA 3H9GA 1T38A 4CYDA 3LSPA 5F04A 3IX1A 2XPUA 3O9PA 2KQZA 1USYE 5M5WJ 3ZQGA 3G7WA 1NL5A 1ZRCA 3MP6A 1MY1A 4QSEA 2FSWA 4BDZA 2DOAA 1A54A 3U8QA 5I5PA 2NS7A 2QENA 2ID6A 4QPOA 3KEIA 2UUZA 4LG0B 4DZPA 2DA7A 3TQNA 3GBGA 4RBOA 2BJJX 4LLGF 5I84A 4JWOA 4P1WA 1N3WA 4ISUA 4MNPA 1REPC 2CUJA 3ABTA 2NOGA 5EEHA 4MNCA 2GXAA 4NWDA 4OXVA 4RB3C 1TNSA 4HV5A 4K2EA 3OD7A 1DTZA 1OYWA 3OMBA 3CJTB 4O94A 2XGDA 3ONQA 4GRKA 3O6HA 3K0VA 2O84X 4AU7A 2X51A 2Z8FA 4PQJA 3IAS2 3C7JA 2ZC2A 4MFEA 2AS5F 3CG3A 2W00A 3HO7A 4KYWA 4KYDA 2FU4A 4IHYA 2WYKA 1RKMA 4MCOA 2NOJB 1QGPA 1TXFA 2HWVA 1AKHB 2PFYA 4RM2A 4BL0B 4RNSA 5IYDJ 4BEHB 2ZYKA 1XOCA 2Z8EA 2F5CA 4RAGA 1NK2P 2VE9A 1QKBA 1Y39A 4FASD 4HDUA 1X58A 5K7ZA 3S16J 5I56A 1AA7A 3ROUA 4XKPA 4ESBA 3OYAA 2VBZA 4Z7EA 2DK8A 2XDVA 1TWAJ 2E34A 1Q1KA 1ZKBA 1QNTA 4ENKA 4PP0A 1VZ0A 2L9NA 1VFEA 4XOTA 5FFZA 1VSOA 2EA2A 1OCCH 1MQGA 1AH5A 4H1XA 1BC7C 3TKYA 2DQLA 2GXBA 3QYFA 1MXWA 1B72B 3RGYA 3W15C 2MSYA 2BE5F 5EQ7A 2V93A 5TPAA 4BXFA 5J8CA 2YU9J 1X4PA 1SD3A 1OVTA 4GBWA 2A61A 1ETWA 4Y33A 3F6OA 4M71A 4X0GA 2BVMA 1U5TC 1LVAA 3MAJA 1JE8A 1JP4A 2HZLA 1M5EA 3BJAA 2CYYA 4D0PA 2C6YA 3G4SI 5D8LB 5E20A 3GBBA 5DVIA 3MD2A 4ZDMA 3H06B 1A6IA 2GAUA 1X1CA 2MW8A 4XR6A 5D4SA 1D8JA 4XM3A 3ZPLA 3VSLA 1IXRC 3CG1A 1W1WE 3OS2A 4OESA 3H03A 4XEQA 5DVJA 4PBQA 3M1CA 2WWYA 4BACA 1FQCA 2GRVA 2H9BA 2VJ5A 1G2HA 3KJTA 4G6TB 3QPLA 3QYTA 1JUSA 2DTRA 5FKMA 3WE2A 4JWYA 4YMBA 3Q28A 4OWRB 1LFBA 3JRFA 1IJWC 4M9ZA 3HTSB 1LB8A 3MJNA 4BY7J 1AHDP 4CICA 3JSPA 1NFTA 3TTRA 1B1BA 2Q74A 2NXNB 3Q9SA 3ONMA 1AU7A 4H8JA 4EGZA 1NV6A 3IOWA 5JR3A 3PFIA 4EJTA 3AL0C 2Q2AA 4MAGA 1I6BA 4Q5TA 2KKOA 3SZGA 3CVGA 2GH9A 4B48A 3Q0VA 3S93A 4N4OB 5I59A 4KITB 4FX0A 1HDDC 1F9BA 2ZSHB 1LCFA 3MEXA 2KLOA 4BEHA 3ZQIA 1KYZA 5L3FA 1B2HA 4CDGA 3OEKA 1AKHA 1D9QA 4BBSJ 1T95A 2LDUA 1QU3A 4M3FA 2D5VA 1T39A 4TLLB 1XMAA 1MD0A 2WAQN 3QQAA 2KRFA 2DODA 2OV7A 2KR0A 4Q48A 2DFHA 3BZKA 2V84A 4G7HF 3DCFA 5D6FA 1YW9A 2EFOA 3B7DA 5H8QA 3HOWJ 2VI6A 2CQ7A 3IO6A 2EZKA 4LJZF 1LE8B 3RSNA 5FB2A 2HCAA 5EGOB 3FASA 5IZ1A 2PFBA 1GDTA 1PB7A 2HXRA 5DUKA 4E0WA 1HA8A 1SBPA 3LUZA 1Z9CA 2XRNA 2BGCA 1KONA 1QPMA 3FHZA 3VYRB 2LD5A 2NVTJ 4M73A 4ZYHA 2Y2ZA 3E5UA 3OIOA 4MQ9F 2XXIA 3DELB 5ET5A 2Z5UA 3GZ5A 3TELA 5DTBA 4ONYA 1FBDA 2L9SA 2RV8A 2W1OA 1N04A 3KZGA 5AA4B 2XRLA 4X6AJ 4GL8A 1Y0UA 1TLHB 1KQ8A 1VNDA 1ZGJA 3TO7A 2PT2A 1N0TA 3IAZA 1RI7A 5KK1A 5L3GA 1PB9A 2X6OA 2VHAA 2RC4A 5TU0A 4LK1F 1IGNA 5EJCA 3V8JA 3C33A 4EEFG 5E18F 4RXLA 4AYBN 5HS8A 4HX8A 3DTKA 2D2WA 3LSHA 2CZIA 3W6JB 2FOKA 3SEVA 2IS2A 1RC9A 2WA0A 5CJ9A 2VD2A 3CO7C 5ERIA 1K78A 2CV0A 3FISA 1ZH5A 3DP4A 1MBKA 1BW6A 1X3WB 1DP7P 1ZARA 4PTKA 4PGPA 5LGUA 4UV8A 5GAHJ 3S3NA 2I0CA 1VFCA 3N5LA 4IO3A 2Z8DA 2V9PA 2V3UA 3GZNB 4EM0B 4M6XA 1F5TA 4ESFA 3FVGA 3KPHA 3OYFA 3OS0A 4ITVA 2RC8A 2ZYOA 4L18B 1WFXA 4P11A 3CMMA 4L5JA 1FTKA 4ABZA 4C2MJ 2QQ9A 4A0YA 4ZS9A 1YLFA 4OZ9A 1FBSA 5TP9A 3CDLA 2KDOA 4Y7NJ 2B9SA 1FPJA 2DAOA 3ZQQA 4OEUA 3MAMA 2GIVA 3FXBA 1ZGAA 2VOZA 1FRPA 4QIWN 4I02A 1Q9DA 3BR5A 1YG2A 2VT5A 1NTCA 3R0JA 3IK6B 1ON2A 1XGNA 4JP0A 1LNWA 1D0ZA 2CMPA 5KZTA 2VXDA 4CHUA 5CM6A 1HKTA 1ZG5A 4FHTA 3O3KA 3RKXA 4KXPA 3EDPA 3VVFA 3MC2A 1OLAA 1S5LC 1X1AA 4ZEIA 2R7OA 2STWA 1F43A 5H20A 3IH4A 3QPTA 1O57A 4PFOA 1WJEA 2XAHA 3HGYA 5GPAA 2QRYA 5A5XA 3KIOA 1ZQ3P 5FKKA 4YELA 2WEFA 3HOYJ 1A7LA 3IR1A 1Y6IA 1SD5A 2ZMEB 4K3FA 3FBNB 2WKYA 4R2BA 3ZMTA 2LBFA 3D4CA 2LF7A 1N78A 2RC7A 2EBIA 2BXZA 4WXCA 1IUDA 4HS7A 3FXOA 3O6IA 4I8CA 4G2ZA 4CUGA 3QPHA 1FQAA 4D1QA 1IXHA 1XSDA 4LMYA 2Y48A 2UWMA 4NHBA 3S9NC 1UTBA 1EZPA 2QBYA 2CGPA 1BIBA 1PC3A 1PUFA 2P6SA 1MBJA 1ZLJA 4HBLA 4QSDA 3J7YJ 1B8IB 1B3EA 3LSXA 3T8RA 1R23A 1SFOJ 4G68C 1SW4A 4OERA 2RDPA 3U2RA 2L7KA 4S04A 2BBYA 1YYVA 3OO8A 1JKPC 3CO6C 3D1RA 1NV1A 3SKPA 2ZNZA 2HDCA 1MNDA 3EUAA 4KN7X 1T08B 5D6EA 5E17F 1I1SA 1XDUA 2CQXA 3OYLA 5FLXK 4YICA 4X9TA 2FOWA 2R7QA 1IN8A 2M8GX 4OETA 5I2NB 5CKTA 1MMGA 4RAFA 5BPIA 1FBCA 2VD3A 5FHOA 2XXPA 2N8GA 4F31B 5D4RA 1OVBA 4YB6A 4Y4RA 4WXDA 5BPDA 3OOUA 2FBHA 1YZ0A 3V7RA 4G8XA 5F0HA 2OU2A 2RN7A 3F6VA 2M2EA 3G2BA 1B9JA 3ZMUA 3ZXSA 5F1RA 4NX1A 3UK4A 4YKIA 3OENA 3LAPA 4RYAA 2ELHA 2LBFB 4AM3A 3OL4A 1VDWA 3IOTA 3VDXA 4KICA 2OZUA 1MSEC 4DXUA 2BY2A 4KT6A 5J47A 1Y1WJ 1I50J 4TQUQ 2QEXI 2RNGA 1IN5A 3OV8A 3HBLA 3P9KA 3ERMA 1SW5A 4M4GA 3BTCA 1LBWA 4GCVA 3RPLB 3IB1A 3S2VA 2IBDA 1UG0A 1CQTA 3OYHA 1MM6A 3G3GA 1IUYA 5LBQA 3K2ZA 1R4NB 2DDBA 4GFBA 3BR1A 1PP8F 1G4DA 5H8HB 3FKJA 5CPRB 4ZZDA 1LBBA 1QZYA 3KETA 2IRFG 5KNLA 3PO3J 1JQFA 1WH7A 4CCNA 2PJRB 1MY3A 5AA3A 5FTHA 5I7IA 3LFUA 5I2NA 4ZEFA 3TUSA 4AIHA 3R7XA 3EYIA 2HOEA 4NF6B 2FBPA 2G7HA 5HDKA 2CFXA 2DDAA 5DCFA 1K7AA 2EFNA 3KEYA 3BZCA 4YIFA 1TT1A 4QBAA 2QSHX 4YMAA 2CUFA 1MMSA 4F3PA 3F8NA 3S1RJ 4HNVA 3LA2A 2ID3A 1CB6A 1JJ8C 3E13X 2E5NA 2DYXA 1O3QA 3AG3H 3QIMA 3BZ6A 3FMQA 2OZZA 3ISPA 4G6QA 3A09A 2MC3A 5FLXZ 2CW0F 2UVJA 1P1WA 1Z67A 5IKBA 1X4OA 2PMZN 5GP9A 1AOYA 1N77A 4IHWA 1LB2A 3BR6A 3WAFA 5TP9B 3P9CA 4OIQF 5DCMB 1LVKA 2MH9A 3KN8A 2KJBA 2A6HF 1UAAA 4OMZA 2QJEA 1UG2A 2GIZA 3DXJF 2CU7A 2IGNA 3ROJA 5H6RA 4E7ZA 1W7PA 1MNEA 2PMUA 3JRBA 5A5XB 1S7EA 3ECHA 3E6DA 1SFEA 4KMFA 3QK6A 3OSGA 2X1CA 3M1EA 2QVOA 1XN7A 3CP8A 3PM1A 3TO6A 2D1VA 1T33A 3G3JA 2DJIA 3H3GA 1KA0A 4GL0A 2H27A 2CQNA 3GTJJ 3BKIB 3U65A 2ME6A 3I5UA 2JPCA 4P56A 4BDRA 2VPRA 4MEYF 4HG2A 3GYYA 3ZS6A 2NVUB 5JLXA 3H9JA 1DPUA 3ML6A 3PNTA 3TEDA 1FJLA 4YRVA 4AB6A 3DLAA 3B6CA 3K02A 3L6HA 4X1EA 2VONA 4FQGA 2A5YB 2CW8A 4CSWA 1UELB 3IKTA 1L5TA 1QW0A 2LY1A 1H43A 3GF2A 1RR8C 2XIGA 4UB6C 1FTJA 3A03A 3I59A 1P4WA 2WAQA 5J3LA 2DXIA 1XSVA 3L2RA 1EH7A 2ETHA 2F48A 4JYKA 3MKZA 4RK9A 3S9LC 4OIRF 2Y69H 3CCEI 1M5FA 3J80Z 1SYIA 4L0ZB 2M3AA 2DTZA 2HPGA 1MRPA 3EPEA 2BHZA 2JZYA 5FGMA 5EGOA 2XXTA 1TQMA 3HUGB 4N0BA 2DW4A 2IS1A 2DMTA 2GHBA 2OWTA 3Q25A 3LWFA 3LSMA 5CI5A 5ESYA 4F91B 1VQNI 4KMUX 2EV0A 3E97A 2NNNA 1IV6A 4RB0A 4H0EA 1MQIA 4BHBA 4NMYA 1ZN2A 4UV9A 1LBZA 5M5YJ 1LGBC 2F6GA 4ND9A 3SQNA 5GPCA 1Y20A 1JJ6C 5A2QK 4NHJA 4BDQA 1XC5A 3I64A 5A5LA 2QM3A 2E2HJ 3H6WA 5CMBA 3TYHA 3O8HA 3UIFA 2XD3A 1F4KA 3PUBA 3TCFA 3SEXA 1FTAA 1S8NA 5DS9A 4OINF 1WPKA 3Q3SA 4OU0A 4E4HA 1B3HA 2QS1A 3HN0A 4IF4A 2BW3B 2LH9A 3QYEA 4HZFA 2HXWA 2M45A 2A5SA 3FVNA 1U78A 3CCRI 4PGNA 3HB9A 1FP2A 4C0RA 4XIDA 1B59A 1U5TA 2QFLA 4MBPA 3E78A 4Z0IA 4G8NA 1EYIA 1S9HA 3W2VA 4ZYGA 4I09A 4G94A 3KEOA 2FBKA 4UUTA 2Z1DA 5CBRA 1B72A 4X8RA 2F5VA 5HS7A 5CMMA 1OIBA 2X26A 4PBHA 1ZMGA 3WG7H 2QBYB 3RY3A 4PC9A 5ITPA 1MY0A 2QWWA 4GWZA 2VC0A 4NNJA 1ZRDA 1YYZA 4AUXA 3WTSC 3DP8A 4OVRA 3VFZA 3QP6A 3GO5A 3PMWA 2E1MC 2KJCA 5DD8A 1VQKI 2R7WA 4DOZA 2NNYA 4XIGQ 3GLLA 1FOWA 2HYGD 1EZOA 2IGMA 1TWCJ 5BMZA 1J7KA 1ACIA 5EYGA 4XRFA 2O61A 2CQKA 3F8CA 1MJ9A 1WQ2A 2DA4A 1G6NA 2EZIA 3E6BA 4A3GJ 2B63J 2CQQA 1ODDA 2VOPA 4FCYA 4F29A 2PBIA 1JHHA 3CP2A 2P4WA 1INPA 1MPDA 4R1HA 5AA2A 2V26A 4A3BJ 5K2XA 4LIVA 2XX8A 1YXIA 3BOQA 5IGAA 2V4CA 3Q5FA 4CCLA 4PJ0C 5A2QZ 1XVYA 3SXYA 4A5NA 3EQ1A 2OPTA 2XF6A 4LG0A 3RKQA 3ILTB 3DWLE 5IT3A 5EEAA 2K3PA 3I9V2 3PU5A 5E3MA 3V7CA 3B6QA 2V1XA 4N6DA 1RKWA 4U7DA 4MIMA 3MUQA 1WJDA 4Q5SF 1LEBA 4EM2A 4PETA 4PE3A 3J7ZI 3ASNH 1VQ8I 1I1GA 3K1PA 3CCVI 3T0JA 2DI3A 1BOAA 3GEZA 3BC8A 4C9YA 4WEDA 2JRMA 4BJ5C 4F92B 3GFLA 1XC1A 4MLQA 5J4VA 3EETA 2ZZWA 1B40A 5L3CA 2XHKA 2ZSIB 4KT5C 1BM9A 2RCBA 3FK7A 1VQ7I 4IGRA 3S4UA 3K6XA 2X6YA 1O3TA 2CWEA 2OAZA 1AWBA 5EQ8A 4HE0A 4QFOA 3B02A 1S6LA 2IXSA 3GTKJ 5D5WB 5CVUA 1Y4CA 2F8DA 2OD5A 2Y7PA 3O6GA 1USTA 4NEDA 2R5ZA 2IW5A 2ABHA 4A3CJ 1RIOH 5T3JA 4BJTA 2V1DA 4KFCA 1WHUA 2ZYMA 5ET7A 4Y13A 3I5OA 5I56B 4PFPA 2LC2A 2V79A 3N97A 5DVFA 2DE4A 2PFZA 4I3EA 2WC2A 4JX5A 1OFCX 3QP5A 4YKPA 4R9GA 5C44J 2O6GE 5F7VA 3IOVA 3MWMA 1PYVA 1MQDA 2E1CA 1HSEA 1S7OA 2DDKA 2ZMEC 3TQLA 3VYUB 1S50A 2W85A 5AE4A 3U93A 4XN3A 2ONRA 3FDYA 3PUYE 4A3FJ 1PBQA 3NQOA 5H8FA 4J01A 4LATA 4I76A 4LVQA 3G1MA 2VJ4A 3K9TA 2FVZA 4UNOA 4G8HA 2JA6J 1LBXA 3HOSA 1ETXA 4UUSA 4DDDA 3RT8A 4CO8A 2M5WA 4E0XA 1I6QA 2F7BA 2KZGA 2E19A 1ZG3A 4OAZA 2FF4A 1C0WA 1NHAA 2IS4A 2R7UA 3IUOA 2KT0A 4C3JJ 2DPUA 2RKHA 1YCJA 4MNUA 4H46A 3TP0A 2PVUA 3NOHA 2IEKA 1SANA 3RKWA 1KA1A 4Q30B 4O7IA 2ZJPF 1Y1VJ 3L00A 1HW2A 5I58B 3K4JA 4PSWA 5AIQA 2KZVA 1R9LA 5IY5H 1ZK8A 3L2WA 3VPRA 1Z7NE 2QS4A 3B6WA 1YX3A 2A68F 3V8LA 2LKXA 4A0XA 1D4NA 3C2BA 2DMQA 3BJ6A 3CMYA 4FAJA 1RR7A 3I0TA 4GVOA 5BUUA 3K70C 2HR3A 2W25A 4KN4X 5LLQA 1VQ5I 1FSHA 1ELJA 2DWHA 4H5GA 4MX6A 2D45A 3HOZJ 3K01A 1W5TA 4IOCF 1MNMC 2QA4I 2XV4S 1ZLKA 2EJRA 5JHFA 3DF8A 3KZZA 5B1BH 2KDZA 3SJMA 1MW7A 2QQBA 1LPQA 3U1KA 3TQWA 1X1DA 1NK3P 2O69A 3RPUD 5IP7J 4DYRA 4GRIA 3CCUI 2Y0MA 3EF7A 2MABA 4JK1X 5HM4B 1P92A 2O51A 3K00A 1MQHA 2FNCA 3FV1A 4NF5B 2FIEA 2UYFA 4GDFA 1Y4TA 2QKLB 3L2CA 1TW2A 3TCHA 3KZIC 4G9YA 4DYCA 1OISA 3P5JA 3VYSB 3HSFA 2OJED 1SDXA 1JUMA 2FIXA 5KDTA 2Q2EB 5CC2A 4GXOA 1RESA 3K7AJ 4PGGA 3IRQA 3LFKA 4XSXF 1P4AA 5L8DA 3NAUA 4UABA 4H6DA 1NKXA 3PPQA 3K4NA 3GFIA 3WTUC 2NVQJ 2A07F 2F4OB 1XSXA 3HHFA 1FSEA 5B66C 2JJKA 2Y75A 5D8KB 1CF7A 3MZYA 1L3LA 1URGA 3S32A 3AG4H 3QYBA 2IA4A 3E5XA 2VP1A 3FX3A 3PPOA 5DV5A 3ULQB 3M9AA 5F0CA 3HC7A 3CCSI 2QYOA 1XMKA 4BQOA 4HQMA 2COMA 3GLXA 3DBRB 4JQFA 3ECRA 3FXLA 2M30A 1Z7UA 4LFUA 4BHCA 2DSFA 3R6UA 2Y5LA 1DGWY 4PDKA 3KJ7A 1E3PA 3S1NJ 1KZ8A 5JTYB 2CRGA 2VQHA 5IZZA 2ECCA 3O2AA 2GBYA 3DQVC 1OMIA 3IKVA 2REGA 2PEXA 5F0FA 2E71A 5F64A 1XB4A 2IVMA 4MLVA 2M4KA 3M07A 4NQ8A 1D0XA 1YX5A 1JEVA 4Z6YA 1OQGA 1TWGJ 3E1SA 4YFNF 3WU1B 1MDQA 4OHNA 1WDNA 1P1NA 2MD0A 3DKWA 1U2WA 2G0EA 1H9TA 2OBGA 4ELOA 2OA4A 5ICEA 3R61A 1B5JA 1NV7A 2KQRA 4R79A 2VQLA 3T5XA 3QUJA 2K4BA 1NV4A 3K70D 5LGNA 4DBQA 1VQMI 3FXKA 3KG2A 1KZHA 4KA4A 2JA8J 2LNBA 3H6VA 3BQZA 2F2EA 3FMSA 3HGGA 4KUMA 4HNUA 3CQZJ 1KQ9A 2L2OA 3GX4X 3MVYA 3TEPA 2V9VA 3UNGC 3MKWB 1FW0A 2BW3A 1US4A 4NAPA 1OR7C 3HHHA 4NC7A 2K5CA 1HW5A 1YOVB 3FHNA 1POGA 4UHTA 3U1OA 2HTJA 1WWXA 4KCDA 3WGHA 2NS0A 4GWYA 1JW4A 4FX4A 2EIMH 2VODA 4M72A 3N4MA 4Y3OA 2XAUA 4AQ4A 3T8TA 4HCWA 3D4GA 5AONA 2YPNA 4GYGA 4E7JA 1YS6A 3OYCA 1VQ4I 3S8PA 4BH9A 3C9HA 3TW6A 1XVXA 4P9KA 3L09A 5F1QA 2DK5A 2H6CA 3PTYA 2CFOA 1S9TA 1MSFC 3C34A 3KN3A 3HZJA 1WKMA 4XK4A 1IRZA 3CFXA 1DMBA 2CW7A 4HYEA 5ICCA 1P1QA 4U21A 2F5DA 1X2NA 1K9ZA 2RQQA 3FXJA 1Z6TA 1P99A 2F3DA 5I57A 1GHCA 3TFLA 2PBWA 4ZTJA 2HEOA 4N6PA 4UACA 1NV5A 1GV8A 4FECA 4L17A 4MEXF 1B6HA 4B8XA 1IXSB 3F8FA 2Y7WA 1OKRA 1YS7A 4OEVA 1IAWA 1H8AC 4JOMA 3LMMA 4E7SA 4RB1A 4C2UA 3JTHA 2CV1A 2OBPA 1BI0A 3VWBA 5JVTA 4ENNA 4PDDA 1IMEA 5C4JJ 4GWOA 2EPFA 2XAQA 3S14J 4P1EA 2F97A 2OZ6A 2LTPA 1HXDA 1BI3A 4WX9A 1XG1A 1PDAA 3ZCOA 1SW1A 3A0HC 4ELRA 3JRHA 2WB1A 1B7UA 3C31A 5I3SA 3MVWA 5DM7F 1QBJA 3EHTA 4L0YB 4G4PA 2FNAA 2CO5A 2Y9YA 5KHDA 3KYLA 1LQ1A 1E3HA 3MQ9A 3E3VA 2CZLA 2IA0A 2ANJA 2EIJH 3ILUB 5I2KA 4NQWB 2HKOA 4XKCA 3BT9A 2TRTA 1B5HA 2ZYNA 4ZE9A 4Q4ZF 3H9QA 1FEXA 1DQUA 4F3QA 2M0CA 4MQVA 3SEQA 4ENJA 1FCKA 3TKDA 1W7PB 1P6RA 4M6YA 4N13A 3CD6I 4MHFA 2LR8A 2ZXIA 4N17A 4GD5A 2O7IA 3Q0UA 1USSA 2AQFA 4XQFA 3CDHA 4ENMA 2P3VA 4O3AA 4ZEDA 1K79A 1J59A 4KPTA 3HRUA 3LSLA 1H45A 3VE1B 3S2HJ 3IB0A 1O3SA 5BS6A 3A0BC 4OFLA 1JEUA 1SAUA 1FOKA 2XWOA 1T98A 4AYBA 5JLWA 1YO5C 3AAFA 2OC6A 1FQBA 3FJ7A 4GFRA 4P9FA 4BE0A 2EZHA 3CJQB 2GXGA 4EQQA 4FTHA 3PUVE 3UN6A 4EF2A 4F55A 3CCJI 1B4HA 3G3FA 4UA8A 1YE9A 4C3HJ 4AD9A 3U72A 5IPAA 3TO9A 3TTNA 1FPLA 3ZR8X 4BYYA 3MZBA 3F11A 1MBHA 1YFHA 2LMDA 2X7QA 2Q88A 3MW0A 4BHPA 4IL6C 3HV1A 4YB5A 2D3IA 1S7AA 3T1BA 3MMYB 4JVCA 5KCJA 4XRMA 2KL4A 4OTEA 2NVYJ 1UIVA 1QQIA 2IGOA 3C2GA 2V6CA 3TP3A 3EN3A 1KU3A 3PGFA 4Q8RA 2GHAA 3LBSA 3TTKA 4E7HA 1AMFA 3CFLA 2UXNA 1K4TA 2HQRA 2R7ZJ 2JSCA 4CH7A 2XROA 4U4SA 1R1NA 2GZWA 3M7GA 3RYRA 1D3KA 1HSLA 3VLWA 1U9NA 4YG2F 4F52A 3SETA 2KIUA 4IOAF 1GXQA 1MBFA 2GFEA 3BIHA 4I3YA 4ZZEA 2HDDA 2CMOA 4GXSB 2DFFA 4ECFA 4Q47A 2YX7A 3BROA 4B3XA 1HLVA 2Q1ZB 3PD9A 4YU0A 2ISYA 2VC1A 2Y84A 4HQEA 4NF6A 4G12A 2RVCA 1PUEE 3USDA 2DN0A 3V5AA 5CMKA 4KHZE 3E0JB 1HF0A 3E3KA 4L9NA 2QMXA 1BC8C 4CCKA 1WVJA 5KCMA 2EFQA 2K9LA 1VQ9I 2HU9A 3QRFF 3S9EA 4PFWA 5JK4A 4A3JJ 3JZJA 1BIAA 2HI3A 2XGCA 4O5VA 5D5XB 3P7IA 1RPWA 1JUPA 4EGYA 2YLNA 4R6YA 5FRNA 1TFDA 5CVJA 1IDYA 3CRBA 4QTRA 2QQ8A 1D3YA 1ZGWA 1EYJA 2QGUA 1B0HA 4R2FA 1FQDA 1H9GA 3KOTA 2ZMEA 4PF8A 3ZMDA 2RCAA 3SYTA 4R74A 3CESA 3ERED 1A99A 2L3DA 2GOMA 4I40A 4WKMA 2ZJ2A 2EZLA 3K4KA 3OEMA 3HG9A 1IXCA 4WCGA 4LOCA 3GTLJ 1G3WA 3KZYA 2IS6A 3B50A 4XKNA 1ZR2A 1R1UA 2NWJA 1WCMJ 1IUFA 3U92A 5ISUA 1Y8RB 2QLZA 4AVPA 4LB6B 2HZDA 3WG9A 2OWZA 2E0SA 4HW8A 4LA9A 1Z3XA 1O7FA 1YJ9I 4G61A 1U9OA 3OYEA 4IY6A 2K9QA 2P6TA 2XPVA 1G0HA 2P0WA 2YUSA 1JHFA 2D21A 1I69A 4TLMB 2XB0X 4RGSA 4ESXA 2EFPA 2OTJI 2VKVA 3HKZN 1ZTYA 1GV5A 1TT0A 5EQ9A 2WY7Q 3I56I 1B0LA 3GZGA 3BDDA 3KP2A 1LUJB 2E5ZA 3S2WA 5EYHA 3K1MA 4DQ2A 5LDZA 2RGVA 2ZCWA 1RUNA 2QUFA 5HDGA 4PCQA 2I58A 3FK6A 3Q27A 1DK4A 1W36C 3U94A 3CI8A 1KGSA 2MKZA 4MNIA 4KCCA 3FUZA 4YKJA 4U0YA 2L4MA 2WAEA 4ZTFA 3KOSA 4EXLA 1ZIUA 2KIMA 1JKRC 3CSBA 1W4MA 2GA1A 3F8BA 4ZC3A 4Y17A 4A3IJ 4JWXA 4LONB 4LP2B 2AQEA 3QU3A 2O8KA 2DE2A 1ZR4A 2R93J 5E1WA 1M5DA 5DUIA 1B5IA 1FPEA 1PB8A 3H4ZA 1VFDA 2RINA 4HF0A 3ZKLA 4FT8A 1OCRH 1AOVA 4N4NB 1R9TJ 4PFYA 1EA3A 2ONSA 3DKXA 3GFMA 1V55H 1J5YA 2IA2A 2DT7B 3KGCA 4P0IA 4P47A 1UHWA 2HDWA 2L9VA 2E1MB 1MG1A 1VE4A 1N25A 1R6ZA 1SYHA 2XXUA 2PQ8A 2BY0A 5FROA 2W84A 4DNCA 1N75A 2V9KA 4KIGA 1SFKA 2DYRH 1A35A 3PUWE 4CYCB 2Y7RA 2Y30A 2LVSA 2IAIA 1I3QJ 4PUSA 1X3UA 2I0BA 2P7VB 2XXYA 3CJRB 1W5CC 2JRTA 4A93J 2VPLA 2VJIA 3L2QA 2DE3A 4DCYA 3GVAA 2BY1A 3KLNA 2FA7A 4XICA 2KPMA 4HAMA 1J9IA 3IOUA 3HIFA 1UHMA 2LKSA 2BEOA 3H35A 2O3FA 3IWFA 2F5FA 2GQ1A 2V1NA 2ZBKA 1U8BA 4G6DA 3MN2A 3CUQA 2YX4A 3WODF 3PSFA 2LY9A 3DLNA 3I6VA 1UFMA 5J1YA 3SDBA 4RPOA 1URSA 1H89C 3JRCA 4IRHA 3LSFB 2CV2A 4L9TA 4XLAA 4I99C 4BY1J 1HQCA 2KISA 3JW4A 4P5OA 3M3YJ 1F1ZA 4EM1A 1US5A 2F3BA 1IG7A 3ZN0A 2KIQA 4YZZA 2VBWA 3W2WA 3W2AA 3OSQA 4H45A 2B3FA 1G3TA 1K83J 3MYUA 1ZHFA 1GVCA 2YSRA 5K5RA 3OMYA 4LK0F 5I59B 1R00A 2Q8MA 3M3LA 3TAJA 4GF8A 4IHXA 3I58A 3E5QA 4PZJA 4UUSB 4ELQA 1ETVA 2E7XA 4ZYAA 2AYSA 5IT9K 2L9RA 3HSTA 3DEEA 2JMWA 3QSLA 5BOXA 4CCMA 4UXNA 4N81A 2W24A 3N05A 1U6GA 3IV5A 1FBHA 3K6WA 2ECBA 4BLAA 3P9IA 5IZ3A 5ICQA 4PJMA 3RQ4A 5M3MJ 1O64A 1OCPA 1P9QC 4BQQA 1W0TA 3K6GA 5HNFA 4WEPA 3W6KB 4OVPA 4IHVA 4OVSA 3LL7A 3A01A 4PFTA 5J40A 1HBXG 4OVJA 3VFJA 4A6DA 4R9FA 2HOAA 1YW8A 1K4SA 1MH4A 2HXIA 4JDFA 3EKIA 5LD2C 2V1UA 1Z05A 1BL0A 2AIXA 1PVEA 1MMNA 1H0MA 2BY3A 3W3CA 2R5ZB 3HTUA 3C18A 2I49A 2VLAA 2KMUA 2QS2A 2A6TA 2Q0OA 2RQPA 1YIOA 2ISZA 3HPHA 4HF1A 1YPNA 3BG3A 5GAGJ 3O8GA 1OPCA 4IKFA 2HQ0A 1J2XA 1E2XA 1T0FA 1MXZA 5IYBJ 4OVQA 1XCBA 2QSGX 5H8QB 2VE8A 2H98A 4EATA 5DM6F 2VKEA 1WH5A 4HV6A 1NNPA 4H0WA 3ABKH 3SEWA 3VLUA 4DIQA 1T8IA 2ZFUA 3T0YA 4FEBA 1MGTA 3G3HA 4RGRA 3MWBA 3JRIA 1B05A 4I1DA 2XKPA 1FOYA 2AHQA 1YQAA 5TGTA 1ETKA 2ZNYA 3RPQA 5FJ8J 1XT8A 2IGKA 2PMSA 4G68A 4JVDA 4N8GA 1S29A 2JWTA 3FWEA 2XXXA 1WZ2A 1Z91A 4O3BA 4QFPA 2DA2A 2GLOA 1M5BA 4A3LJ 2B4LA 3Q26A 5DT6A 4NC6A 5ILUA 4L9VA 4N9IA 3BQYA 4C30A 3DU5A 4ZZAA 3CCQI 5JTYA 1B58A 2LYCA 1XCVA 1YIJI 1KWHA 1LEVA 5IP6A 2XXHA 4GWWA 1JGGA 1FPKA 3UGWA 3OYNA 1NG6A 3LC8A 2OCUA 1TWFJ 5EZHA 1B1HA 5L9OA 3S9MC 4EJWA 4HEA2 3BFUA 3RNNA 2QVRA 3WHBA 3H36A 4ZH4F 2UYEA 2XXWA 4U23A 1R71A 4OIPF 4DE8A 1XTAA 3WU0A 2ME0A 5E1ZB 1FMWA 4JXIA 1HDPA 4ZECA 2H09A 1JXSA 3VXCA 3CCLI 3S2DJ 1SMTA 4H5FA 4A3EJ 3HOVJ 3OYDA 1VTNC 2WTEA 2ZJRF 2F7CA 2FYIA 3VOEA 1QUIA 1H88C 2HXOA 2XF7A 3F72A 3GMEA 4O8MA 1RKTA 2NAZA 2TCTA 2X0LA 2YR2A 3B73A 1YHQI 5H8SA 5KDTB 3WTTC 3LUYA 1V5GA 3QAHA 1YI2I 3ZQFA 2PG4A 4BQAA 4HLXA 2XB5A 1TWYA 2CZHA 1B9NA 5E1XA 3OYJA 2P5VA 3F21A 4NF0A 4U1OA 3MKYB 1NH3A 1JTYA 1XHYA 2R7VA 1IRXA 1KA8A 3IRRA 5IM2A 4F3SA 5JVGF 3IORA 1ZTRA 3BTJA 2I48A 1QGXA 3BFTA 4PE5B 3RQTA 4A12A 1U3EM 2VGQA 5IZ3B 2VPOA 1WGXA 2JN6A 2WY8Q 2REJA 5ICTA 1R1TA 2BOLA 2CH0A 2XGEA 2R7DA 3BP8A 1Q1VA 1HOMA 2AXTC 2K85A 5CQGA 2HVQA 2K9NA 5D5UB 1FBEA 4BDMA 4KJZA 2ZO4A 1B7ZA 2ZXJA 2VT3A 2A5WA 3HEFA 3KX2A 4IO2A 1G3YA 4XBFA 1G0IA 2HVSA 3E79A 5TJJA 2DA5A 1H3DA 3KP5A 3M8EA 4AC0A 1RETA 1N84A 1SVOA 4NF8B 2L02A 3JRGA 1XS9A 2F5EA 4OIOF 3W9VA 3I3LA 2WX9A 3KCCA 4G7ZF 3PUXE 4HCYA 4JX6A 1AWCA 2BHYA 3I59B 3EYYA 3E7LA 2LKPA 2MLKA 2X4HA 4ZJZA 1II5A 3W6VA 2WBMA 3KYCB 3LR1A 3N94A 2M8CA 1UMQA 2Z22A 1FOXA 1JKOC 3MPKA 2FEZA 3V8XB 3IWZA 4QF9A 2JK3A 3MZ1A 3TW7A 2B7EA 2DYSH 2ZXWH 1Y3QA 2B3BA 4N4UA 3UP9A 2HFBA 4O7MA 4EVIA 1JW1A 2OQRA 4UY8I 1GR2A 5HOOA 1DPEA 1SQYA 2L5VA 1NV2A 3MPLA 4MTDA 3TCGA 1OYYA 3O2PE 3ZP5A 2DWJA 1U5TB 3B6TA 3TZAA 4MO7A 5LEJA 1SAXA 4IEJA 4CZZA 2O7OA 1X19A 2XGXA 5L3DA 1OQHA 3TPAA 4P96A 2ELJA 2QSFX 3OIQA 4OOIA 3SDGA 4FETA 4LITA 3H3VK 2EV5A 3WTVC 2X6XA 3AKZA 1QHHD 1A31A 3B8BA 4X1BA 2VJJA 1ONVA 1FTZA 2VQGA 3GFJA 2PMZA 3MVPA 1SFXA 1R1VA 5ET6A 2CUZA 3S1QJ 2TDXA 3DBLB 1LLSA 3IJXB 1HKQA 1LBVA 2JVHA 2L7FP 1IN6A 1QVUA 2MYSA 5C3EJ 4RGXA 2YU3A 2P7CB 1XPXA 3H92A 2XC7A 2O8XA 2R7SA 2Z16A 3LSWA 2PX1A 1EYKA 1EZ9A 2H94A 3HL2A 1ZBMA 3HOXJ 1O7LA 1OR7A 4GXAA 1G59A 4F7ZA 1HCRA 3CDIA 3J80K 3GCMA 4CGZA 4MIJA 1IN4A 1U8RA 1K9YA 1MBEA 3HUGA 4ANJA 1I6AA 1BI2A 2ICWG 3PJRA 2KP6A 1GVDA 5L3EA 4QFNA 4W1UA 5E3NA 3BPVA 2XXVA 1FPDA 4BE2A 2OUMA 1ZELA 4F3BA 2Z2SB 1ANFA 3MZ9A 3EUKL 1GLNA 4EMSA 3PPNA 3BG6A 4L5EA 5LHIA 4NB5A 3QU6A 1FPBA 1OLCA 4LLNA 4LD5A 3KN7A 4PAFA 4TOZA 4U0WA 4CYCA 2P1SA 2MBFA 1TZLA 4CA0A 3KBZA 3ZN1A 2DMUA 2P5KA 1BTJA 1D1BA 4I9DA 4BUPA 4DI4B 3LSGA 4XLHA 3A2KA 2BXYA 1X3ZB 5JHUA 3U21A 3WTWC 3KBRA 2PYYA 3PFYA 4X1DA 3EUHC 1IV8A 3ZQ7A 1EF4A 1JTXA 4DBRA 1LAFE 2Q9TA 2RNJA 4W97A 3JAMZ 3OO6A 5EEGA 3RKYA 2HZKA 1UTHA 2I4CA 2HYJA 4NGUA 3W9WA 3U9GA 4LGWA 4MGRA 4F39A 1FPIA 1O3RA 4IB2A 1SMYF 1EV7A 2A05A 2P8TA 2G29A 3RPLA 2V4JC 1IF1A 5F6FA 1P4XA 4CXFA 3CF5F 1Y3NA 1V5EA 2JA7J 1Z6RA 3EQLF 3MVXA 3RYDA 4PFIA 3PL8A 4QWQA 1FQFA 5IYCJ 1IQ7A 2M8EA 4RDUA 1MXXA 4JBAA 4R8HA 3GTOJ 1A40A 1UCRA 1D8KA 4N07A 3LAJA 4F93B 3C3WA 2R92J 2XSDC 1FWZA 1WI9A 3FBIB 5LRRA 2PJPA 3FKIJ 2DVCA 3HPIA 2Z99A 1EJ9A 3E6CC 2M34A 4H4KC 3RN8A 3H5AA 4RLQA 5CBSA 3BLYA 2GQQA 2Y7IA 3KSJA 2I6EA 3HRMA 2XWVA 3JAMK 4OFJA 3IL2A 4XFEA 2M87A 3QWLA 4IHSA 3WGGA 2O68A 3H6TA 3I4NJ 1VQOI 3KE2A 5EF6A 2E2IJ 4WXHA 4P55A 1WJBA 1FTOA 4XKRA 5FTIA 4HX7A 2IP2A 5CVVA 5J1UA 3RUMA 5IOYA 1RUOA 2W7NA 2W48A 3M8FA 1IEJA 3C35A 4MLOA 2LK2A 2O1MA 4B1RA 5H8NB 1FBFA 6PAXA 3LV0A 5AA2D 3CCYA 1Z3YA 5LEKA 2HVRA 3U1DA 1ETQA 3NRVA 3C36A 5LTCA 2IT0A 4GWUA 4GIZA 3BR2A 1T0FC 4KYEA 2LAOA 1R49A 1TW3A 2R7RA 2VN2A 3Q0WA 5CYVA 5HLHA 1YRNA 2HKXA 1GXPA 2PJRA 1IMDA 4WXJA 4GWSA 3NARA 4DGWB 5FRMA 3S3MA 3HSRA 3ABUA 5EDNA 1FIAA 1WJCA 5ELVA 2JA2A 1R6RA 2VB6A 5FHMA 5B5EC 1YRNB 4O3MA 3SEZA 2DA6A 1FY7A 3R4KA 1K61A 4XONA 1LBCA 5LHHA 1ITYA 1B3GA 1LFHA 2R0QC 1HC8A 1LKXA 1HSTA 3VVDA 2DA3A 1NG7A 2J5OA 2VKHA 1YJWI 2DMNA 2DO7A 3NWSA 2WV1A 3H0DA 2ACJA 5F08A 1B8IA 4CCOA 1T2KA 1E0EA 1FJ6A 3H5RA 4M3GA 1K6YA 5ILVA 4YIIA 3KC0A 1UTBB 4BKXA 3RZDJ 1I6HJ 5FHNA 1WJ5A 2LRDA 4XMYA 5FKLA 3UR3C 3K1NA 1FTLA 3MQ0A 3K4CA 2FMYA 4BNCA 1Z7ME 2WYPA 3LQRA 2OLBA 3J7AO 2O0YA 5FLVA 3PMVA 4AVZA 1H76A 1SVXB 4DCXA 2HYFA 3HKZA 2F6PA 3BY6A 3PPPA 1BBYA 3IH3A 4NUBA 3O29A 2A69F 5LRSA 2M1BA 3JCUC 5DEQA 1QUJA 4EJVA 2IEEA 4FORA 4N15A 2CUEA 1OCOH 4N8YA 4PAKA 3O6BB 4A2UA 5M2VA 2HQ5A 4C3IJ 5IOZA 1OCTC 4IX7A 2G93A 1BW5A 2FJ1A 2FQ3A 4GX3A 1SD7A 1RDXA 1FIPA 2GM4A 2M7BA 4E7IA 3BWGA 2I3WA 2QF7A 2Y0SN 1L0OC 4OYVA 1ZJLA 3ZQCA 1B3FA 4OMBA 3MKLA 4ZEKA 2EK5A 1I39A 1LAXA 1OCZH 3DU6A 3A02A 4Y15A 3B6AA 1SD6A 3CMEI 4F2OA 1M5CA 2I8DA 2MA3A 3T93B 2VPNA 1GGGA 4JX4A 1K78B 2KRHA 3ZMZA 3GTQJ 4RMNA 2WBBA 4OWDA 3CCMI 4R75A 2JA5J 2DWIA 4LQ2A 2VXZA 2KFDA 2RREA 2VL8A 3SZTA 4WWCA 1JVYA 4HOBA 2H4IA