3FXRA

Crystal structure of tsar in complex with sulfate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
total genus 86
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA03
4H0EA 4XKRA 3BFUA 3HSEA 4EJVA 1FTOA 4M9SA 2A07F 4G68C 1OYIA 3SEYA 1VFDA 1JETA 1PBQA 4QFOA 2F7BA 2W7YA 1ONVA 2D1VA 2G7HA 1MGTA 2XXIA 1R6ZA 4ESXA 3QU3A 2UVIA 4UVCA 1ZGJA 1E17A 3MZBA 4F2OA 4XBFA 1AMFA 1KU9A 4EUOA 5DEQA 3TCHA 3ISPA 2Z5UA 3S2VA 4DZ1A 3MPKA 5BQTA 1L3LA 3WTWC 3C4MA 3FUZA 5L3BA 3KEQA 2V79A 2H4IA 2W84A 1S7AA 4YICA 4YFXF 4R6YA 1LCFA 4IO2A 3AXFA 2QVOA 5CYVA 1TTYA 3SXYA 2UYFA 1PDNC 3K1PA 4HX4A 2A6HF 2LSOA 4R9GA 5D5UB 3EF7A 2DS9A 1NH8A 2PT1A 4OIQF 3E6BA 4UNOA 1H9GA 3RKYA 2VONA 1MQIA 5K5OA 3EHUA 2EFNA 2RGVA 3V83A 4BHBA 5DCFA 4WCGA 2ZCWA 3TQLA 4JDFA 5HS9A 3SZPA 2P5VA 3TDUC 3IL2A 4G68B 1YPNA 4BNCA 4XLNF 1T38A 5FFZA 5D4SA 4G6DA 1A8FA 4QSEA 4EQ9A 2O69A 1UFMA 2ZKZA 3KFWX 4N13A 1P1UA 1XGMA 3K6XA 1IN5A 1NKXA 1B32A 4I7HA 3RNNA 2LAOA 3O3KA 1B9JA 1SMTA 1A7LA 3GZGA 3FXUA 2KIFA 2QL3A 3KP6A 5I58B 4DXBA 3ZP5A 4O3MA 1EV7A 3GO5A 2J5PA 1QNTA 4ESBA 1UB9A 2RCAA 2KIUA 3C34A 3N6TA 2EJRA 2A61A 5E18F 1C0WA 3L6GA 2PEXA 4EJTA 1YQAA 4HW8A 2P5LC 3TMGA 5HLGA 3OXNA 2ZXTA 3N5LA 1ZLKA 1IXCA 3ROUA 3CI8A 2O1MA 3IWZA 2ZYKA 2V9VA 3KZYA 1TQIA 4EMSA 2P8TA 2I49A 4YMAA 1FQCA 4F1VA 1I6QA 3E13X 4C1TA 4YAHX 1P2FA 6PAXA 3E3KA 3IWFA 3KLNA 4YMBA 1VFEA 4RK9A 1RYXA 1JVXA 1SFUA 4QSCA 4P55A 2UVGA 2OCUA 2D21A 3EHTA 1GXQA 1FTJA 1FW0A 2XD2A 4MHGA 4BDLA 4KYWA 3CVGA 2ETHA 3L09A 1USSA 2ZNUA 3PPNA 1XVYA 4TOZA 4PCQA 2VN2A 4HX7A 3HSTA 3RJPA 1ZAOA 1P4WA 4ZS9A 1O3RA 1ZHFA 3CFXA 1ZN2A 3HN0A 1XCBA 3T8RA 1MQJA 3V8XB 3RI4A 4L0YB 4WEDA 4E0XA 2NOOA 4M74A 1U2WA 3C18A 1SAXA 4YB5A 3T5XA 2Z23A 2O3FA 2I3WA 2XXUA 2FE3A 5CVUA 1SD4A 1IRGA 2XAHA 1FY7A 3I71A 4Q47A 2FMYA 3OO8A 5F1RA 4IY6A 3TKDA 1QUJA 1QGPA 5H6QA 1GTKA 4HW0A 3VLUA 1HKSA 1ZH5A 4NF8B 3KN7A 3HHHA 4RJZA 5AIQA 5LEJA 3MWBA 3C1DA 5CBSA 5D4RA 5TPAB 2F8DA 1BJAA 3P9CA 3FATA 5H6RA 3FXQA 5FGMA 1B1HA 1LB8A 1MDP1 3R4KA 1BIBA 3F11A 3L00A 4AIJA 2LNBA 3QYTA 2X4HA 2VHAA 1PUEE 3BBRA 3EDPA 4ZEFA 4EM1A 3MPLA 1ZGAA 1CB6A 4TLLB 2G93A 2VBXA 1IQ7A 1LB9A 2QMWA 3LSLA 4GL8A 1B6HA 3BJ6A 1K7AA 1NH7A 3LSFB 3PPRA 1O64A 2ZNTA 5LOMA 4RGUA 1JEVA 3G3IA 3BY6A 1BIAA 4H1XA 3Q29A 3HHGA 2L02A 3ZMUA 4MF3A 4GQOA 3DV8A 1UHMA 3FX3A 2Z3YA 2Y0MA 3SQNA 1GR2A 4OENA 3WU0A 3F6VA 2DT5A 3LAPA 4DNCA 1JNFA 4IJAA 2H9BA 2VODA 1XMKA 3DPLC 2V3UA 3H3UA 4Q4ZF 1B7UA 4PETA 1EZPA 4Q0CA 3ZMSA 3TQWA 1AOVA 1UIVA 2G7UA 3P7NA 2PQ8A 3RPWA 3VB2A 3MFKA 4XLPF 5DUKA 3H6UA 4FORA 1Y3PA 2HCAA 1MH3A 3EYIA 4QWQA 3CFZA 1XD7A 3J7AO 2OLBA 3ULQB 2VD2A 1SYIA 2BYVE 4QRZA 4AWXB 3W9WA 4P11A 1IN7A 2FNPA 1G3SA 3VEPA 4RGRA 1US5A 2HZKA 1WDNA 4H6DA 3S9MC 3BZ6A 3KBRA 3E6MA 1V3FA 2KJBA 2GXBA 4EQQA 4ZZLA 3O9PA 4UACA 4N6PA 1MJAA 2ZFWA 1SMYF 5BS6A 5HM4B 2E1CA 4QHQA 3TQNA 1SD5A 1O57A 5ILVA 3DQVC 2HEUA 2FEZA 3CUOA 4UA8A 4A0ZA 3RLFE 2FMLA 5CVJA 2XXVA 3IL1B 1EH7A 3O29A 3QUJA 4NF6A 3I3VA 3NRVA 1J59A 2IJLA 4XTCQ 3SEUA 3U94A 4IRGA 3IB1A 3GFLA 2XXXA 4AIHA 1WRJA 2FOKA 1LGBC 1A8EA 2K27A 2CG4A 1F1ZA 1J5YA 3RPQA 1HXDA 1ULYA 3R61A 4HCYA 2HYGD 2XAFA 2V3QA 2GH9A 3FWEA 2A5SA 2NNYA 1XGSA 3HTUA 4LMYA 1SFEA 2IA0A 4NF6B 1BOAA 4CDGA 1Q35A 2QRYA 3VLWA 2W57A 4ZYDA 1U78A 3R0JA 5I2NA 4LLLA 2RCBA 4PP0A 2G9WA 4OOIA 1M5DA 3LSWA 4U1OA 5E17F 1D5VA 1PC3A 4BXUA 4G7HF 2A68F 3BROA 3MEXA 1R1UA 1VSOA 2QPQA 2VT2A 3BOQA 2VD3A 1KU2A 3ERED 4GFRA 2CWEA 1G6NA 4MBPA 2ZNSA 5KVRA 3G3GA 3PQJA 2M45A 3PV0E 1URSA 4RGSA 2P1SA 3G3HA 1TFDA 2ZO4A 4F39A 1W7PD 2RC4A 4GO1A 3R26A 2B65A 3I5OA 3M8FA 3K6UA 4QFPA 1MXYA 4RAZA 2MLGA 3FV1A 1II5A 2MLKA 1R36A 5ICGA 5BPDA 3F72A 2NAZA 1YW7A 3I5UA 2I0CA 4KN4X 3CO7C 3O66A 4MH5A 2Q88A 3VXBA 2D45A 1KA8A 5HDGA 1KYWA 1R1TA 4ESFA 1TW3A 4KUMA 4HQMA 4LONB 1SD7A 2B0LA 3CUQC 3Q26A 4OMZA 3KOSA 5EEGA 4H5GA 5FHOA 2OA4A 2F5CA 1FQDA 3I59A 2Y7KA 3KJTA 3SERA 1BC7C 3DP7A 3LA3A 4R72A 3IC7A 3E6DA 5BWJA 2CFXA 3U92A 2QYOA 1XN7A 1ZU0A 3PUZE 4F31B 3ZKKA 2L01A 4GCVA 1AL3A 1JXSA 4H8JA 2D5WA 2J5OA 3I59B 2KJCA 3U72A 1FSEA 3EUHA 4FX0A 4GYIA 4LA9A 1B5HA 2VT3A 1OLCA 4BH9A 1MM7A 3HUGA 5D5WB 1O63A 4HZFA 4IRIA 4JB7A 1ELJA 4POWA 3MWMA 3RT8A 4KNYA 4F22A 2K02A 1LEAA 3RY3A 3IOTA 1MDMB 3M8EA 4M6XA 4G2ZA 2F34A 1M5EA 5FTHA 2A69F 3PMWA 1HSJA 4RPOA 4RNSA 1XHYA 3OO6A 3E4RA 2F5EA 2QJEA 1T0KA 4XKQA 4A12A 1LQ1A 4EDPA 1BI3A 1TWYA 1FNNA 4JWXA 4R74A 1MDMA 3Q5FA 4KIGA 2QQ9A 1Z91A 4HV6A 4IRHA 2ISYA 2QQBA 3BJOA 1RUOA 2XD3A 4HF2A 2O7IA 1BI0A 2XKPA 4KMUX 3QAHA 4F3SA 3H06B 3V89B 3H6TA 4F1YA 5H8HA 1Y0UA 3SDFA 3O6IA 4Z0IA 3HRUA 2Q2EA 1FP1D 1SW2A 4L18B 5L9MA 2ACJA 1MPBA 3BP8A 4S05A 2JRTA 3PMVA 3GBAA 3HOSA 1JHFA 2UZKA 2P4WA 4BAYA 1U6GA 3F8FA 5I84A 1A04A 3WODF 1OQHA 4IGTA 1ZG5A 3HO7A 1SI0A 4ELQA 5DD8A 5H8HB 4UUVA 2V25A 4G68A 3QUFA 4ZZEA 1XGOA 3KN3A 2YX7A 5L9OA 4A0YA 2R9JA 2Q0OA 1SI1A 3KP5A 1WVJA 1HSTA 5J1DA 4AD9A 3PQKA 2Y84A 5CRYA 5F1QA 1AH5A 4MEXF 1R1NA 1FWZA 5AA2A 5I58A 3SFZA 5CI5A 4FECA 2GHBA 2OD5A 4P96A 1N04A 3R7XA 3QU6A 1RNLA 1NMUA 5DT6A 4ZDMA 3WTTC 5FB2A 4OHNA 4HOBA 3KOTA 1LBBA 4R75A 1EZ9A 2IA4A 3F21A 2IEEA 3BDDA 3LR1A 3ZMZA 5AA2B 1DSNA 2DXRA 1Q1KA 4LZ5A 2M30A 4KYEA 3EQLF 4YIIA 1FBUA 3F8BA 2XXYA 4ENMA 1KYZA 3D0SA 1G3YA 5FD6A 1P1OA 2CSOA 4G8NA 4M4GA 1U5TC 5L3FA 5LLQA 2WTEA 2Z8EA 2EWNA 2ADUA 2JZYA 5ICFA 3V7RA 1FX7A 3J80Z 4ISUA 2VXZA 2E7WA 2XVCA 2Y75A 2DU9A 4I0BA 5TU0A 2KRFA 3IO6A 5F7VA 4FATA 5BPIA 3TOBA 1F9NA 3B73A 4A6DA 4BDNA 3CO6C 1QULA 3M1EA 3MZ1A 4ENKA 4RA1A 3FVGA 4LJZF 2BV6A 3C33A 4AQ4A 3K02A 1J2XA 4RB2C 2M5WA 3RYRA 1R5GA 4RK2A 4RXLA 3I4PA 1SFXA 1O7TA 1QZZA 2NUVA 1HSLA 1A55A 3S9EA 2Z8DA 1I27A 3P9KA 3RQTA 2RC8A 1B3HA 4QSDA 5FTIA 5ICCA 3ZN0A 4ESJA 2VBWA 3WTVC 2AL5A 3PD8A 3TDJA 1WQ2A 2I4CA 4U0YA 4JXIA 5TJJA 1PDAA 3VE1B 2F5DA 2DWJA 3DXJF 1YCJA 1S9TA 4RB3C 1ZRCA 3S4UA 4OU0A 2DO7A 1T0FA 3LQRA 3CJNA 2ZMEA 2ISZA 2COMA 1FTKA 4RY1A 3VV5A 4NF5B 2R71A 4RB0A 3DEUA 2XX8A 2XHDA 1BN5A 3FMRA 1I1GA 1BP5A 4UHTA 2VBYA 3LBSA 1RI7A 3BJAA 3ECOA 3MQ0A 5TPAA 5J8FA 4YZZA 3BWGA 1JW5A 3CG1A 2NWJA 4Z7EA 1NHAA 4NF5A 3K0VA 3ILUB 1DOTA 1B3GA 1Y20A 3KP3A 1Y1MA 5EEHA 3A3UA 3I64A 1TLHB 1H9TA 3MVXA 4K2EA 4LQ5A 4HV5A 1S6LA 2HTJA 4AIKA 5M2VA 4WWCA 2HFBA 4NF4B 2CGPA 4GWOA 3FMQA 3J80K 1Z9CA 4THIA 4JK1X 1NNFA 2REGA 5LRSA 4Y15A 2EFQA 3C3WA 5ITPA 3U9GA 3RTWB 3J81K 3CG3A 4WXDA 4ONYA 1FQFA 5CVVA 2ZYNA 4ZE8A 3GW2A 3CRBA 2OWTA 4P5OA 2ZMBA 5JTYB 1S7OA 2XIGA 3C35A 1SW5A 3T22A 4M9ZA 2BJJX 5H8NB 2CW0F 2HZTA 3U1OA 1I5ZA 3F22A 3GWZA 1YO5C 3ZQ7A 1P4AA 4CYDA 2TDXA 3RYPA 1MXZA 5ITOA 1EH8A 5D8LB 3IJOB 4ELRA 1TQPA 3LQQA 2B3BA 1LAGE 2GRVA 1IXSB 3H4ZA 5DDGA 3B7DA 4GLIA 3ZSFA 3PUXE 3SZTA 5DTBA 5I57A 4NMYA 5I56B 1BI1A 5LHIA 5H8NA 2HAUA 3M8UA 5CBRA 4XKPA 4U0VA 2YX4A 3VXCA 3L6HA 2MH2A 3TCFA 2EFOA 4XSXF 1OKRA 5H20A 2AS5F 3E9XA 3JV9A 2W25A 4HQEA 4N07A 4HF1A 4I1DA 2ESNA 3CLOA 1P6RA 4R1HA 3GEZA 2PG4A 1PB9A 5I57B 5I56A 5BOXA 4L9VA 3JZJA 4NWCA 4LLGF 3TKYA 4YU0A 5FHMA 5K5RA 1H3DA 4H8IA 3RN8A 2EV5A 1MS7A 3K6VA 3BPXA 3PU5A 2K7LA 2ZYOA 5E20A 1BM9A 4EGZA 3HOTA 4F3GA 3T0YA 3FJGA 3TODA 2DQLA 3F8NA 1B59A 3M7GA 5DCMA 5ED4A 3WTXC 1P92A 1RZ4A 3LAJA 2Z9OA 3IO4A 1WSUA 3KP2A 1PP7U 4DCYA 3MAJA 1JHHA 3ABUA 1EU8A 1IZ1A 4R2FA 4D0PA 1US4A 1T6SA 2PMHA 4L9NA 2H6BA 5HDKA 1OIBA 5J8CA 3WGGA 1Z6TA 3TOAA 5D8KB 1B58A 3FMSA 4WX9A 4OETA 4JQFA 4WXCA 4O6JA 1B4ZA 5IT9Z 3GZ6A 3KSXA 4R6KA 1YTVA 4U88A 3FJ7A 1Z7NE 3O6GA 1MY3A 4KDPA 2MC3A 2H27A 5HS7A 1XSXA 3HSRA 3B6TA 4R6HA 1Y9UA 3JAMZ 4DE8A 2O61A 1MY4A 1QJMA 3USDA 5HLIA 1UHWA 3KJ7A 1YAEA 5FFXA 4RB1A 1KQ9A 2L4MA 1O3SA 2LKPA 1NNPA 1B3EA 4I8CA 1FQBA 3HSFA 2E0SA 1IUYA 5DUIA 3GLXA 3ZMTA 4M71A 3OEKA 3GYHX 3KEIA 2R3SA 4U7BA 5BUUA 3OOPA 1B40A 2GA1A 2XXWA 2L4AA 4GL0A 4HAMA 2P7VB 1UTBB 5IKBA 3RTFB 4GGGA 4PFUA 1ZLQA 3W9VA 4BDMA 3N6UA 2DE2A 3U1DA 2EV6A 4Y17A 3FJMA 3E97A 3EPEA 4GD5A 3U93A 1MG1A 2W24A 2VOPA 4UXNA 2LDUA 1ZG1A 3K00A 3JAMK 1Z7UA 1X3UA 1UIUA 2YLNA 4A2UA 2AL4A 1RIOH 2VOZA 3Q27A 4JSDA 1BC8C 3DKWA 2XAJA 4RAYA 4Q5SF 4DQ2A 1GHCA 1B7HA 3OO9A 1ZARA 2X7QA 2B3FA 3MJNA 4IHSA 3THIA 4JBAA 3UA8A 4G8XA 2OQRA 1K78A 3Q28A 5HBCA 3G3JA 4KIFA 2WC2A 4NB5A 4ZECA 3VVDA 2GA2A 2HYFA 4O3CA 2HQNA 2RVCA 1BTJA 4EGYA 2C6YA 1MQGA 1POTA 3FVOA 4U1ZA 4ZYHA 4H0WA 4OMBA 2VC1A 3FM5A 1ON2A 3BKIB 2ZJ2A 4DXUA 3N94A 1K78B 3MC2A 4G7ZF 1MDQA 3DFGA 1A54A 3ZPLA 5L8DA 2F7AA 1B3FA 5DYMA 2O1LA 3WTZA 3QXMA 3H6VA 4RS8A 1XB4A 2EFPA 3GFIA 2E1SA 1FSHA 1U5TA 1MXUA 3MP8A 1YS6A 1G3TA 3FIRA 1FOKA 3H92A 4YB6A 4PGHA 1ZMGA 4K3FA 3WAEA 3K01A 3LFKA 1SW4A 2DPUA 4M73A 3VVFA 1LFHA 3N97A 3JYRA 4P9FA 4KR5A 4GIZA 4FAJA 4P0IA 1LCTA 3E3VA 1OMIA 2A5YB 3IORA 3V4GA 1PB8A 4N0BA 3KP4A 2P6TA 2QQAA 4XRFA 4EJUA 1P4XA 1YTYA 1RYOA 2AIXA 2XV4S 3IAZA 2DXYA 3T66A 2KIMA 2H6CA 3V8LA 3OMBA 2RQPA 2IPQX 4NQWA 3S2WA 2CO5A 4R79A 2DWHA 4LB5A 1XC1A 1W4MA 1U3EM 3B02A 1IITA 1LB2A 5HPQA 4U0WA 3GZ5A 5CJ9A 1UTHB 3QPTA 4HYEA 4AB6A 2QUFA 4A5MA 5D5VB 5TRDA 4KQPA 1JQFA 2HQRA 2Z22A 4LZ7A 5B7DA 4MQ9F 3K1NA 2X7PA 1DPEA 4F3BA 3F23A 1T98A 3KCCA 1WODA 1N3WA 4PDKA 4MEYF 2YPNA 3GXOA 3F6OA 1USYH 2A5TA 1MKMA 1JGSA 2XXPA 3N4MA 1FTMA 2OBGA 4H67A 1DTGA 2RV8A 4OYVA 4FEDA 1QZYA 3I54A 3HPIA 1W5TA 4YKKA 1QKAA 1D3YA 4I2OA 3V5AA 1I6AA 1L0OC 4H5FA 1EZOA 3O2AA 2RKHA 1B7ZA 4YKJA 3VFZA 1FP2A 1RKMA 2Y7RA 4OIRF 2D2WA 2Z33A 2WWYA 4EJWA 1B05A 2O03A 3W15C 4WXHA 3CSBA 2EA2A 1OPCA 2OZUA 3NEUA 3WE2A 3ODBA 1I6BA 1EH6A 2PBWA 1ZKBA 2JTVA 1M5BA 2FQ3A 3H7MA 1OVBA 2FBKA 2ESHA 5DVJA 2FYIA 4LATA 5DVFA 2UXNA 3QPHA 5ISUA 2XKOA 3UGWA 1ON1A 2DBBA 4NHJA 4Q48A 3HCQA 2YR2A 4EXLA 4UV8A 2XX7A 1B5IA 5JR3A 4OIPF 1G4DA 5LHGA 3ZKLA 1PBPA 1P1QA 4MFIA 2Q89A 1F4KA 1SDXA 4KFQA 1FQAA 1FYMA 5IT9K 2OZZA 2IA2A 1XDSA 5IT3A 3OD7A 1JE8A 3JTGA 3TDZC 1MXXA 4CO8A 2I3VA 3SEVA 2O6AA 4R9FA 4E0WA 2I6EA 2HTSA 1IUDA 3GFJA 5D6FA 2ZMEB 3N26A 1MXVA 3M3KA 1VR5A 2K4BA 4GOTA 4HS7A 1S3JA 2CQKA 5CC2A 3SETA 2CZLA 3S9NC 1HW2A 4R2BA 5TP9B 4FJPA 3IB0A 4UVBA 3J81Z 4ZEBA 2ZNZA 2O51A 1YFHA 5K2YA 1J75A 1Z7ME 4KYDA 4O5VA 5HVQC 1YW8A 2ZNYA 2UXAA 2HKXA 2QENA 5I2KB 1USTA 5A2QK 1CF7B 3V7CA 2A6EF 1E2XA 2E7XA 3WGIA 3IOUA 1Z6RA 1MM6A 4ECFA 4F19A 3TPAA 2BEOA 5TP9A 3VLVA 1UQWA 3F8CA 5LGTA 4IPAA 4TV7A 5JK4A 1I1SA 3CIJA 1IRFA 3GXAA 4JWOA 2IA1A 4GXAA 1XCVA 2BE5F 1WI9A 1P1WA 4F7ZA 4ZEIA 1GV8A 4AVPA 4NF4A 3KLOA 1YIOA 1M5CA 3Q9SA 1M5FA 4KN7X 3TO9A 1IXGA 3ZN1A 2HOEA 4XIGQ 2VC0A 4ELPA 1TXFA 3HV1A 4EJOA 1B9NA 1D9VA 3QSLA 3L2CA 1DPRA 3OO7A 1MPCA 5JEIA 2HS5A 2QZ8A 1XGNA 3SHFA 3IX1A 3T9VA 3FV2A 1R1VA 4IO3A 5JTYA 1B1BA 3WTSC 1VE4A 3O97A 4U21A 2PMUA 4NE4A 1N7WA 3KGCA 2HAVA 1B5JA 1W7PB 1FC3A 2Y48A 3MVWA 5AA3A 1DTZA 2NRAC 4IO4A 2RNJA 4CZZA 1K6OA 1I6XA 4NWDA 3MVZA 1MD0A 5CVIA 2XROA 1O7LA 1JEUA 3CFLA 2H94A 1OYYA 1B46A 3CR9A 3K69A 3SEXA 5ICEA 1TFAA 2HR3A 2PT2A 5AA2D 1LFGA 2FF4A 3E5UA 2KKOA 4QFLA 3O6HA 2FXAA 4BHCA 1DUXC 4LB6B 3B6WA 4Q8RA 1Z05A 4L5JA 4EF1A 2I0BA 3F3XA 2QS4A 4OESA 2X0LA 3T9UA 5DV5A 3K9TA 4QFNA 2FA7A 3IHUA 2OQGA 4S04A 2D3IA 1V4RA 2GFEA 4DCXA 2VOOA 4HLXA 4NEDA 5FLXZ 2Y7WA 1O7FA 5E8GA 2OZ6A 2FNAA 5DYHA 3KEOA 5JHUA 4O3AA 2XUBA 2GWRA 4A5NA 4B8XA 3RPUA 4ZEDA 2K86A 5DCMB 2QLZA 1TNTA 3FXRA 5HLHA 4IXAA 1URGA 1R5HA 3K0LA 3C32A 3QP6A 4KD5A 4YKPA 2Q2AA 3KETA 1D9YA 3OOAA 2EK5A 4YKIA 3DP6A 1B6AA 3FM3A 1GXPA 1IW7F 5ICQA 5FO5A 3G3ZA 2NS0A 3IOVA 3MZHA 2PLYA 5LEKA 3K2DA 1QUIA 4NTLA 5LHHA 4OQOA 5JI6A 2I4BA 2R6GE 4G8MA 2DK5A 3ONMA 4U2RA 2Z99A 2OWSA 4EM0B 2GAUA 1POY1 5E1XA 1SD3A 2HXWA 5EHMA 3UIFA 3LA2A 1F5TA 4BDOA 4HDVA 2F5XA 3TTNA 3IK6B 3F8MA 2PI0A 2ALUA 2W85A 1S50A 1OVTA 4R73A 2JT1A 4ESWA 3HRTA 1R23A 3PUVE 1GGGA 3VOEA 5KK1A 3HHFA 4UV9A 3QIMA 1SVXB 3TTKA 2AXLA 2P0SA 4WEPA 4BHPA 5KDTA 3H3GA 1FBQA 2R7FA 1IIWA 5DVIA 1Y1ZA 2FU4A 1QBJA 2F5FA 2H09A 3RTRA 2QS2A 1IAWA 4ND9A 2GIVA 1ZIUA 3T9XB 4PZJA 4MTDA 1XS5A 4HLYA 1MQDA 5BMZA 5L3EA 4RYAA 2H99A 2NNNA 1ZREA 1UTBA 3MBPA 2JPCA 5F6FA 3TO7A 3JTHA 4X1BA 2YU3A 1B0HA 3PGFA 1TNSA 4U4SA 3W6JB 4ZYEA 1DPUA 4KT5C 2L3DA 4HX8A 4M1VA 4PFYA 4L0ZB 4GYGA 2HKOA 3H6WA 5CMCA 3OENA 3GLBA 3FZVA 4DLDA 2MA3A 5I2KA 2M87A 1UCRA 1A40A 5FHNA 2HFHA 3GVAA 1PEBA 1BLFA 1B3LA 3O6BB 1LAXA 3MQ9A 2XASA 3GF2A 3JSOA 1HW5A 1JW4A 4JWYA 5EHSA 4EQ7A 2IP2A 3AAFA 5LBQA 3EETA 2DSFA 1OR7A 3CDHA 1ATGA 5L3GA 1S29A 3QK6A 3BPVA 2V3TA 2P6SA 2V6CA 4L17A 2JSCA 4OVJA 4MLQA 4RGXA 1B4HA 4Q5TA 4N9HA 1D8JA 4X9TA 5JVTA 1P1NA 1R9LA 4CHUA 1DPPA 1GVJA 2PBIA 5JFRA 3TEPA 4F1UA 3LC8A 1LSTA 1WKMA 2PFBA 3G3KA 2STTA 3BFTA 3DELB 4O3BA 3TFLA 4KFCA 4FX4A 1TT1A 2PX1A 2XX9A 4KHZE 3HRSA 5KCJA 3I53A 4I9DA 1KGSA 3QRFF 4LZ8A 4GVOA 3L7WA 3LWFA 4BLAA 4LK0F 3TELA 1U5TB 2UVJA 3GBBA 2UWMA 3CSGA 1FYKA 4IGRA 4E70A 2WKYA 1H76A 3JW4A 3TGNA 4GRKA 2EV0A 5HOOA 3I6VA 4MTEA 1OQGA 5KCJB 5CLSA 4TLMB 4XKNA 2LF7A 2RINA 2XXTA 3MCZA 1OYWA 4HBLA 3V8JA 1HSEA 3IKTA 2OK2A 4LGWA 2Q2CA 5IAIA 5I59B 1MJ9A 2P7CB 4F29A 2FNCA 1FCKA 1D8KA 4KIBA 3RGYA 3R0AA 4WKMA 2ONRA 2M8EA 3DLNA 2K4JA 1Y4TA 1ZYRF 3EN3A 2IRFG 3UORA 1YG2A 1B1XA 1MRPA 1QVSA 3U2RA 4U7DA 3FHZA 2OU2A 2XRNA 3TTLA 4ETSA 1J1NA 1HBXG 3TYHA 4ZH4F 2CYYA 1BKAA 1UTHA 4G9YA 5I59A 1TW2A 4GF8A 4R8HA 1REPC 1LBCA 3D4GA 2OBPA 1VTNC 3VFJA 1TQMA 1QKBA 4I01A 4I09A 1FPQA 3WAFA 2ZXJA 2F97A 2HEOA 3WTYC 2QMXA 4HDUA 3RT6B 4EQBA 3G73A 1KQ8A 2A5TB 1OLAA 1WWXA 3ELKA 4I0AA 1LAFE 3ZMVA 2NVUB 2Z8FA 1AOYA 3M9AA 3Q9VA 3GFMA 5K1YA 2DYXA 2OAZA 3DF8A 5A2QZ 3KFMA 2BBYA 1SBPA 3TTRA 2XAQA 3WTUC 4YG2F 4FEBA 5KZTA 3A09A 2DVZA 4DIGA 1ZG3A 4ZE9A 1BIYA 2F36A 4XSZF 1FQEA 3OV8A 4QF9A 5HDNA 2EFWA 2FBHA 3E5QA 1FT9A 1XT8A 2UVHA 2DOJA 3LUYA 2ONSA 1MY2A 3MP6A 1AWCA 4OFLA 2L54A 2V1XA 3COAC 3PUYE 5FLXK 1SW1A 4G77A 4F18A 3K1MA 1B4AA 4U4XA 3RKWA 4MNUA 3U8QA 1MH4A 4LQ2A 1ZRDA 3I58A 4I98B 2HGCA 4OEVA 4LD5A 1NNTA 4WF2A 1FYLA 5CM6A 1IXRC 1ODDA 2MBFA 3LA7A 1LDDA 3O2PE 4YIFA 2QBYB 2FA5A 2QWWA 5K5QA 1N7XA 1TBXA 1YYVA 4C0RA 3I0TA 2O7UA 3FF5A 4OMYA 5L9SA 1SYHA 3PMXA 3KG2A 2JPBA 4BDRA 2QS3A 3K6WA 3IRRA 3TUSA 1R22A 1CE2A 1SD6A 1HW1A 4HF0A 1PB7A 2QBYA 2YJPA 2MH9A 1ZJLA 4EVIA 4ENJA 1RUNA 2M8CA 4Q30B 3OELA 4ZZAA 1HKQA 3TCGA 3H03A 3PD9A 3MZ9A 1IN8A 2ZYMA 3R60A 4X48A 1FBSA 3E5XA 1XDUA 3OSQA 1QUKA 4G4PA 3TTMA 3M3FA 4HA8A 3R6UA 3WU1B 4EXKA 2PMSA 1IN6A 4MGRA 2V84A 2XAGA 3SESA 3T8TA 5EYFA 1NL5A 1MXWA 2H98A 1SQYA 2WV0A 3HRMA 4N9IA 1N76A 2XXRA 3E6CC 4ZYGA 4M6YA 1P99A 4X1DA 4QLCU 3VDFA 1OMPA 3ABTA 5H8FB 4CXFA 3DM0A 3TO6A 2RC9A 4POXA 5E1ZB 3MZYA 4EM2A 1CF7A 4KMFA 1QO0D 2M1BA 1R7JA 3MVYA 1HKTA 3RDIA 1O3QA 1Y3QA 4U22A 4JBZA 3ZS6A 2XXHA 4DDDA 4L9JA 2DI3A 4IB2A 5LGNA 2HZLA 3KSJA 1J9IA 1LVAA 3JSPA 5H8FA 2DE3A 3IB2A 3M3LA 2V1UA 5CVRA 1MPDA 2HWVA 2DFIA 4A0XA 5CMMA 3V8KA 3RKXA 3KZZA 2FSWA 4BDQA 1Q1HA 1H45A 4OINF 2I48A 4OTEA 3Q25A 3C9HA 3QAXA 4EF2A 1J7KA 3V7SA 4KYSA 5CMKA 1ANFA 1MZBA 4ZEKA 2OJTA 4IO6A 2ELHA 4JSOA 2DVCA 4IY5A 4C1UA 2EA4A 3FVKA 5F64A 5ILSA 4P9UA 4MLVA 1S8NA 1W7PA 2P5KA 2H5YA 1B51A 2DQRA 1W5SA 4I02A 1H0MA 5L3CA 1N84A 5J6XA 3A3CA 1XOCA 4CGZA 1CGPA 2E1NA 1S7YA 4L9TA 4KCDA 1DDNA 5LRRA 2RDPA 1YW9A 4PGGA 2PJPA 3PUWE 1IF1A 3UK4A 4AB5A 1BI2A 4ASNA 1PP8F 1LLSA 3UN6A 3PPOA 2NXOA 4FHTA 1BBYA 3UP9A 4NF8A 3D5LA 2G29A 4ZZDA 1IN4A 3VVEA 5D6EA 5ERIA 3IKVA 1IXIA 4LG0B 4KICA 4LK1F 2PYYA 2F6GA 3EQ1A 3L9FA 2YPRA 5CMBA 1LDJA 2O8XA 3REOA 4Z2YA 2EB7A 4ENNA 1NNKA 4HCWA 4Y13A 1K79A 3G3FA 2DW4A 2DAOA 4LFUA 3FASA 1T2KA 1L5TA 4P0GA 1AIVA 3H3ZA 3FVNA 4OWDA 1FLIA 2P2AA 4LG0A 2VE9A 4KPTA 4LLNA 2F78A 4U23A 1QPMA 1H43A 1I69A 1FTLA 1HQCA 3ECHA 4G94A 3T93B 1DMBA 3ML6A 1KU3A 5L3DA 2DLLA 3EHSA 1XVXA 2D1HA 3C7JA 2O0YA 1ZLJA 4M9XA 4QFKA 1B9MA 1LAHE 2F7CA 2PN6A 1D3KA 1F9BA 1T39A 2X26A 2F6PA 3T96B 2I58A 3EYYA 4FE8A 3DP4A 1MJBA 3SEWA 1FZPB 3TAJA 2Y7IA 1YLFA 4H65A 4BQAA 4PFWA 3T1BA 3P9IA 4RPNA 1G3WA 3C36A 5H8SA 2YSRA 4IO5A 4PQJA 2FBIA 1STZA 4B09A 3C31A 1A99A 2DWIA 3KZGA 2QM3A 3ILTB 3MW0A 3P7IA 5ICTA 1MQHA 4FIMA 3HIFA 1N3XA 2GHAA 3LSTA 2VBZA 3IR1A 5E1WA 2Y7PA 3SKPA 2FRHA 1B52A 1Z1DA 5HS8A 4BYYA 1IEJA 3S9LC 2XGXA 3MUQA 1ZRFA 2DP8A 1O3TA 1R00A 3KE2A 4EV0A 3PFIA 2UYEA 2Q9TA 5KDTB 2KLFA 3NQOA 4M72A 1MY0A 4OERA 3OSRA 2BGCA 2Q8JA 2GQQA 2LF8A 5AA4B 4IHTA 1XSDA 3K4UA 4XXUA 3KP7A 4YFKF 1LJ9A 4G8HA 4HTGA 2AYSA 1DP7P 3FGSA 5ILUA 2O6GE 2VE8A 3CTAA 2REJA 1J0RA 2THIA 4F2QA 1XMAA 1GVCA 5AONA 5A5XB 4YFNF 4DXCA 5AA4A 4FT8A 5AIPA 2PVUA 4L5IA 1YS7A 3QP5A 2O84X 3K2ZA 3RUMA 2O68A 1KQ0A 3IJXB 2F35A 2UXXA 2GXGA 1EH3A 3HYIA 2IW5A 4MQVA 5DD4A 4OFOA 1JW1A 1MY1A 1N0TA 1QQIA 3KN8A 4LUBA 4PE5B 5ELVA 3OEMA 5A5XA 3D4CA 4G6QA 2ZBKA 4YB7A 3WG9A 1D4NA 3IOWA 3PPQA 4ON0A 5AE4A 2DWAA 5I2NB 3B6QA 4OXVA 1ZBMA 3W6KB 2H25A 4WK8F 4I62A 5LGUA 5K2XA 1LNWA 2DTRA 4LP2B 1Y3NA 1LEBA 4WXJA 3TZAA 2RF1A 3G7WA 3GX4X 2DQVA 2RKMA 4GXOA 5FD5A 3IRQA 1LFIA 2Q8KA 1H44A 2IT0A 2HDCA 1B2HA 3GUDA 2ANJA 3CUQA 4IF4A 2GZWA 2DPDA 2XHKA 1USYE 2ONKE 4ELOA 2NYXA 3O28A 2QS1A 4TQUQ 1R9QA 1JVYA 4G7OF 4CICA 2XXQA 2R7DA 4IVNA 1ZTYA 1LDKB 5B70A 2VP1A 2RN7A 4KCCA 2DK8A 2V1DA 2ABHA 5DEXA 2STWA 5H8QB 1XSVA 2A3SA 3MP1A 1KU7A 2QSXA 5AA1A 4KA4A 1Y4CA 4UVAA 3CUQB 1QW0A 3DPTA 1IXHA 4A6EA 3DP8A 3MAMA 1NFTA 4LVQA 3WE3A 3ZMDA 3VODA 2V93A 3LSXA 4OEUA 4PFTA 4OZ9A 3HTSB 4KI0E 5DEXB 5H8QA 5D5XB 1R58A 1U8RA 4IO7A 3RIRA 3T9HB 5E8IA 1B0LA 1KWHA 3WGHA 2IVMA 2VGQA 3PPPA 4OFJA 2HQ0A 2F2EA 2CMOA 3QOPA 2RC7A 3ECRA 2MD5A 3FD3A 4F3PA 2DE4A 1URDA 3R6SA 4GXSB 4OIOF
chains in the Genus database with same CATH superfamily
4H0EA 2R7XA 3A03A 4XKRA 2OCEA 3DLLF 3HSEA 4EJVA 2P3VA 1FTOA 3BFUA 4M9SA 2A07F 2OPTA 3HPGA 1OYIA 4BEHA 2B7EA 1ERDA 3IFCA 1XG1A 3SEYA 4NF0A 1VFDA 4Y3OA 1JETA 1PBQA 4QFOA 3CQZJ 2F7BA 3OIOA 2CV0A 2BW3B 1ONVA 2W7YA 2D1VA 2G7HA 1MGTA 5B3SH 2XXIA 1R6ZA 4ESXA 3QU3A 2UVIA 4UVCA 1ZGJA 4EATA 1E17A 2E71A 1GDTA 4CCLA 3MZBA 5EQ9A 4AVZA 3TUSA 4F2OA 4XBFA 3S3NA 1AMFA 1KU9A 4XFEA 5DEQA 3TCHA 4EUOA 4BEHB 4DYCA 2WV1A 4ZTFA 3ISPA 2Z5UA 3S2VA 1A5JA 4DZ1A 3MPKA 5J3LA 4RBOA 1TWAJ 5BQTA 1TC3C 1L3LA 5B66C 1VDWA 3WTWC 4E7HA 3C4MA 1LVKA 3FUZA 5L3BA 3KEQA 1JKOC 1Z3XA 4FISA 1I3AA 2V79A 2W84A 1S7AA 2H4IA 4YFXF 4YICA 4R6YA 1LCFA 4BDQA 4IO2A 2CZIA 3HOWJ 3AXFA 3MKLA 4KISA 2QVOA 2HXRA 4LIVA 5CYVA 1TTYA 3SXYA 2UYFA 2E5ZA 1PDNC 3MN2A 3K1PA 4HX4A 2A6HF 2LSOA 3FXOA 1T33A 4OIOF 4M3GA 4R9GA 5D5UB 3EF7A 2DS9A 4BKXA 1NH8A 2PT1A 2QVUA 4OIQF 3E6BA 4UNOA 1OFCX 1H9GA 3RKYA 2VONA 1MQIA 5K5OA 3EHUA 3BR0A 3UKGA 2EFNA 2RGVA 2DA1A 2WY7Q 3V83A 2KPMA 4BHBA 5DCFA 3QODA 4WCGA 2ZCWA 3TQLA 4JDFA 3GTJJ 5HS9A 3E0JB 3SZPA 4IKFA 2P5VA 5GTHC 3HKZN 4G68C 3TDUC 4BY1J 3CHGA 5GAGJ 5LD2C 3IL2A 4G68B 1YPNA 3MZ8A 4BNCA 3K4MA 4XLNF 1T38A 1MMGA 4B48A 2LY9A 5FFZA 5D4SA 4G6DA 1A8FA 4QSEA 2VJ4A 2O69A 1UFMA 2ZKZA 3KFWX 4N6DA 4EQ9A 4N13A 2EINH 4AYBA 1P1UA 1XGMA 3JRCA 3K6XA 1GV5A 1IN5A 1WH7A 1NKXA 3TP0A 1B32A 4I7HA 4PJLA 3RNNA 2L7FP 5IYDJ 2I10A 1Y1VJ 4XLFA 5EZGA 2LAOA 3O3KA 2G0EA 1XI6A 2IAIA 1B9JA 1SMTA 1A7LA 4MIMA 3LUZA 1RRJA 3GZGA 3FXUA 3NARA 2KIFA 2QL3A 3KP6A 3EKIA 5I58B 4XRSG 4CYCB 2F4IA 4CA0A 2Y0SA 3ZP5A 1R4MB 4E4HA 4DXBA 2LFBA 5J4YA 1A35A 1MBFA 3S2HJ 4O3MA 2PJRA 5ET5A 1EV7A 4YELA 1Y0NA 2J5PA 1QNTA 4ESBA 1UB9A 2RCAA 2KIUA 2QF7A 1N78A 2VKDA 2HI3A 2V4CA 3C34A 3N6TA 2EJRA 2A61A 5E18F 1C0WA 4N81A 3L6GA 2CZKA 3KC0A 2PEXA 4CSWA 4EJTA 1YQAA 1WFXA 2P5LC 4PCDA 3OYDA 3TMGA 4HW8A 5HLGA 3OXNA 3ZXSA 3OS2A 4XKWA 2ZXTA 2PJRB 3N5LA 3BR3A 4XONA 1ZLKA 3ABMH 4C2TA 1IXCA 3ROUA 3CI8A 2O1MA 1MNDA 2DDBA 2KMUA 3IWZA 1FPDA 3HXLA 2LMDA 3OR1C 2ZYKA 2V9VA 3KZYA 2DMUA 1HF0A 3QOEA 1TQIA 4EMSA 2P8TA 2I49A 4GWYA 4YMAA 1QU3A 1FQCA 4F1VA 1I6QA 1JTYA 3E13X 4C1TA 4YAHX 3CF2A 1P2FA 6PAXA 3E3KA 3IWFA 3KLNA 2VQLA 1VFEA 4RK9A 4YMBA 1RYXA 1JVXA 1SFUA 4QSCA 4P55A 2UVGA 2OCUA 2D21A 3EHTA 1GXQA 1FTJA 1FW0A 2XD2A 4MHGA 4BDLA 4KYWA 3CVGA 2ETHA 3L09A 1LBWA 1USSA 2ZNUA 3PPNA 1XVYA 3SDBA 1ETQA 4TOZA 4PCQA 2VN2A 4HX7A 2KIQA 3RJPA 5JHFA 3HSTA 4BY7J 1ZAOA 2WADA 4AS4A 1P4WA 4ZS9A 1O3RA 2KZGA 1ZHFA 1T0FC 3CFXA 1ZN2A 3HN0A 1XCBA 5KAFC 4IR8A 3T8RA 1MQJA 3V8XB 3RI4A 1BOBA 4LIUA 4L0YB 4WEDA 4E0XA 2NOOA 4M74A 4RM2A 1E0EA 4UUSB 1VQ6I 1U2WA 3C18A 1SAXA 4YB5A 3WHBA 1X2MA 3T5XA 2EZLA 2Z23A 2O3FA 4X8RA 3OYLA 2VJIA 4MFDA 1XC5A 3DEEA 2Y9ZA 1LPQA 1JJ6C 2FE3A 2I3WA 2XXUA 5CVUA 5GPAA 4LITA 4Y52J 1SD4A 1GV2A 2VXDA 1IRGA 2XAHA 4I3EA 1FY7A 3I71A 4Q47A 2FMYA 2VKEA 2XF5A 5F1RA 3OO8A 1UAAA 4IY6A 2IS6A 3TKDA 1QUJA 1QGPA 5H6QA 1GTKA 4N8YA 2KRHA 4HW0A 3VLUA 2FJ1A 1HKSA 2ELJA 1ZH5A 2Y9YA 5EEAA 4NF8B 2FHYA 3KN7A 3HHHA 3B6CA 5AIQA 2K9MA 4RJZA 2R93J 5LEJA 3MWBA 3C1DA 5CBSA 5D4RA 9ANTA 2WY8Q 4U21A 5TPAB 2F8DA 1BJAA 3C2BA 3P9CA 3FATA 2K9QA 5H6RA 3FXQA 3ZQIA 5J1RA 5FGMA 1JT0A 2DMPA 4F91B 1B1HA 1EYKA 1LB8A 2R7WA 2F4MB 1MDP1 3R4KA 1QA6A 1NV1A 1BIBA 3F11A 4NG7A 3L00A 4AIJA 2LNBA 4IEJA 3QYTA 5TISC 2DMQA 2X4HA 1YOVB 3CMYA 2VHAA 1PUEE 3BBRA 3EDPA 4P9KA 4EM1A 3MPLA 1ZGAA 4ZEFA 1CB6A 4TLLB 2G93A 2VBXA 1IQ7A 1LB9A 2QMWA 2W7NA 3LSLA 1B6HA 1ETVA 1ZTRA 3BJ6A 2LBFB 4DBRA 1TL8A 1K7AA 1DCUA 1NH7A 5EDNA 5KNLA 2IGKA 3HOZJ 3HEFA 3LSFB 3PPRA 4ZDPA 1O64A 2ZNTA 5LOMA 4RGUA 3L2VA 1JEVA 3G3IA 3BY6A 1VQKI 1BIAA 3U21A 4HRIA 4H1XA 4P3LA 2XF6A 3Q29A 1DK4A 3HHGA 2L02A 3ZMUA 4MF3A 4HE0A 4GQOA 3DV8A 1UHMA 3FX3A 2Z3YA 2Y0MA 3SQNA 1GR2A 3OYEA 4OENA 2LBFA 3WU0A 3F6VA 3VSKA 1VNDA 2DT5A 3LAPA 4DNCA 4MNIA 1U0JA 4IJAA 1JNFA 2H9BA 3OYJA 3I4NJ 2VODA 3FXMA 4CCOA 1XS9A 1XMKA 3DPLC 2BY0A 1NK3P 4ZDOA 3H3UA 4Q4ZF 1B7UA 2V3UA 4PETA 1EZPA 3SEZA 4Q0CA 3ZMSA 1SFKA 3TQWA 1AOVA 1UIVA 2G7UA 3P7NA 2PQ8A 2HPGA 3RPWA 4BBSJ 1U8BA 1PVEA 1GT0C 3VB2A 4BE0A 3MFKA 4GWSA 1X58A 1D1BA 4XLPF 5DUKA 3H6UA 4FORA 1Y3PA 1LFUP 2W1OA 2HCAA 1MH3A 3AG2H 1NUXA 3J7YJ 3EYIA 5IZ1A 4QWQA 3CFZA 2XXKA 1A6QA 1XD7A 3RSNA 3S1RJ 4E7LA 3J7AO 2OLBA 3ULQB 2R7ZJ 2K40A 4PC9A 1OJLA 2LKXA 2VD2A 1SYIA 2BYVE 4QRZA 4AWXB 3W9WA 4P11A 1IN7A 1Z21A 2FNPA 4FE4A 1ETOA 1G3SA 3VEPA 4RGRA 4RDUA 1US5A 2HZKA 1WDNA 4LG3A 4H6DA 4B3XA 3S9MC 3BZ6A 3KBRA 3H9JA 3E6MA 1V3FA 3VDXA 2KJBA 2GXBA 3E1SA 4EQQA 4ZZLA 3O9PA 4UACA 4N6PA 1MJAA 2ZFWA 3BIHA 1SMYF 1RKWA 4U87A 5BS6A 5HM4B 1UG0A 1W0UA 2E1CA 4QHQA 1GUUA 3TQNA 5GPCA 3S1MJ 1CNQA 2OX3A 1SD5A 1O57A 3RQ4A 2NXNB 3DCFA 3DQVC 5ILVA 1NV4A 2HEUA 2FEZA 3CUOA 4UA8A 4A0ZA 4C2MJ 3RLFE 2FMLA 3PNVA 3HG9A 2DT6A 2F6CA 5CQEA 5CVJA 1EH7A 3H36A 2XXVA 3IL1B 3O29A 2LR8A 4DGWB 1LBZA 3I3VA 4NF6A 3NRVA 1WJCA 4XLCA 1J59A 2IJLA 1FMVA 2CZHA 4XTCQ 1T95A 4IRGA 3IB1A 3OMYA 3GFLA 3SEUA 3U94A 2XXXA 2JUGA 4AIHA 1D9QA 1WRJA 2FOKA 1LGBC 4HSTA 1A8EA 2K27A 2CG4A 1F1ZA 3ZQGA 1J5YA 2LY1A 1HXDA 1ULYA 2VQCA 3R61A 3RPQA 2HYGD 1FBCA 1MMNA 4HCYA 2XAFA 2V3QA 3JRDA 2GH9A 2DFEA 2X85A 3FWEA 3HDDA 1FJLA 2LLKA 2A5SA 2NNYA 1XGSA 3HTUA 4LMYA 1SFEA 2IA0A 4NF6B 1BOAA 4CDGA 1Q35A 2QRYA 1RDZA 3OIQA 5EZHA 4PAIA 3VLWA 2W57A 4ZYDA 1U78A 3R0JA 5I2NA 4LLLA 2RCBA 2XSJC 4PP0A 2G9WA 4OOIA 1M5DA 3LSWA 1WVRA 5E17F 1D5VA 1PC3A 1VQPI 4U1OA 4A3BJ 4BXUA 1EYJA 4G7HF 1R6RA 3W2AA 2A68F 3BROA 3MEXA 2DDAA 2Y0SN 3PO2J 2FOWA 3QUJA 2CW7A 5IZ3A 1R1UA 1FBHA 5FRMA 3DKXA 1VSOA 2VT2A 3BOQA 3CLQA 1KU2A 3ERED 2QPQA 2VD3A 4GFRA 2CWEA 5BNGA 1G6NA 4MBPA 2ZNSA 4HEA2 5KVRA 3G3GA 1Z67A 3PQJA 2M45A 3PV0E 3NWSA 3OSFA 1URSA 4RGSA 2P1SA 4G12A 1TFDA 2ZO4A 3G3HA 1W7PD 4F39A 2RC4A 4GO1A 3R26A 2B65A 3I5OA 3M8FA 3K6UA 4QFPA 1MXYA 5C4XJ 4RAZA 3QYBA 2MLGA 3FV1A 4NC8A 5EQAA 2QEXI 1II5A 2MLKA 4RLFA 1R36A 5ICGA 5BPDA 3F72A 2X1CA 2NAZA 2DOFA 1YW7A 4GL8A 3I5UA 2IS2A 4KN4X 3CO7C 2I0CA 3O66A 4MH5A 2DTZA 2Q88A 3VXBA 3ASOH 2D45A 1KA8A 2IBDA 5HDGA 2OJED 2KRCA 2XGCA 1KYWA 1R1TA 4ESFA 1TW3A 1UMQA 4HQMA 1D0XA 4KUMA 4LONB 1SD7A 2B0LA 3FBPA 2K5CA 5ESYA 3CUQC 3Q26A 4OMZA 3KOSA 5EEGA 4H5GA 1WJBA 5FHOA 1S7EA 2OA4A 2F5CA 4BL0B 1H8AC 3QQAA 3I59A 1FQDA 2Y7KA 3KJTA 1JUPA 1QRYA 4PGPA 3SERA 1BC7C 3DP7A 3LA3A 4R72A 3WHCA 2PMZA 2L9VA 3BR6A 4X0GA 3IC7A 3E6DA 5BWJA 2CFXA 3U92A 2QYOA 1XN7A 1ZU0A 3PUZE 3G1OA 3FK6A 2E2HJ 4GRIA 2L01A 3ZKKA 4F31B 3CDIA 4GCVA 5M5WJ 5J16A 3AG1H 1JKPC 2O7OA 3A01A 1AL3A 1JXSA 2DDKA 1JUSA 2JVHA 4H8JA 4N4UA 2D5WA 2E35A 2CUJA 4P8BA 2J5OA 3I59B 5CKTA 2KJCA 5A5XA 3IH4A 3MMYB 3U72A 1FSEA 3EUHA 3LSKA 4FX0A 4NC7A 4EEFG 3BQYA 4O7MA 4GYIA 4LA9A 3GLLA 3W3CA 1G0IA 1B5HA 2VT3A 1OLCA 4BH9A 5K7FA 3PSIA 2BY3A 2P3NA 1MM7A 3HUGA 5D5WB 1YJ9I 1O63A 1NV0A 2LKSA 4HZFA 3H0DA 1VQ7I 4IRIA 4JB7A 1ELJA 2DCEA 4POWA 2M7AA 3MWMA 3RT8A 1X19A 1PUFA 4KNYA 4F22A 2DMNA 2K02A 1LEAA 2BW3A 3RY3A 3IOTA 1MDMB 3M8EA 3BR1A 3BG9A 4M6XA 4BGDA 4G2ZA 4QBAA 1MBGA 2WBBA 3K6GA 4D9JA 1NV3A 1M5EA 2F34A 2A69F 5FTHA 1LFPA 4KJZA 3G4SI 1WPKA 3PMWA 1HSJA 4GX4A 4RPOA 3PL8A 4RNSA 1XHYA 3HUGB 3OO6A 3E4RA 2F5EA 2QJEA 1T0KA 1I6HJ 4XKQA 4A12A 1YJWI 1LQ1A 4EDPA 1BA5A 2LREA 1BI3A 2W00A 4Y7NJ 5C4JJ 1PUFB 1TWYA 1FNNA 4GWUA 3CCLI 4JWXA 4NQ8A 4R74A 2FQ4A 3Q5FA 4KIGA 2QQ9A 1MDMA 1ZK8A 3B50A 1Z91A 4HV6A 4IRHA 1IRZA 3SFIA 1RETA 2HQ5A 2ISYA 4N91A 2QQBA 3BJOA 1RUOA 2O5RA 3TW7A 1NV6A 2XD3A 4HF2A 1RESA 2O7IA 1BI0A 2XKPA 4KMUX 3QAHA 4JVIA 4F3SA 3H06B 5LDZA 2QCOA 3CDLA 3F9KA 4BU2A 3V89B 2V7FA 3H6TA 4F1YA 5H8HA 1Y0UA 3HM5A 3SDFA 4YRVA 3O6IA 3MKWB 5GAEJ 4Z0IA 3HRUA 2Q2EA 1FP1D 1OCTC 3EPZA 4L18B 1SW2A 4W97A 5L9MA 3DKYA 2ACJA 1MPBA 3BP8A 4S05A 2XB5A 1AU7A 1E3PA 2JRTA 3BR2A 1LBYA 3GBAA 3HOSA 1JHFA 2I8DA 2UZKA 2JUCA 2P4WA 3PMVA 4BAYA 1U6GA 3F8FA 5I84A 4PGNA 1FTTA 4JVDA 3J7ZI 1A04A 5FKMA 3WODF 1OQHA 4IGTA 1ZG5A 3HO7A 2JJ7A 2BY1A 4BJ6C 1SI0A 4ELQA 5DD8A 5H8HB 2ECCA 4UUVA 1YZ0A 1WJAA 2DA3A 1TWCJ 2V25A 4G68A 3QUFA 2Q2EB 1XGOA 4ZZEA 3KN3A 2QSFX 2YX7A 5L9OA 4A0YA 2R9JA 2Q0OA 1K61A 1SI1A 1U9OA 2Y30A 4G61A 1X4OA 3KP5A 1WVJA 1HSTA 5J1DA 2MD0A 4AD9A 2X51A 3PQKA 1FOWA 4AYBN 2PFZA 2DJNA 2Y84A 4CUGA 5CRYA 5F1QA 4I40A 1AH5A 4JVCA 4FBPA 2CW8A 3IAM2 3PTYA 4CCJA 4MEXF 1R1NA 1FWZA 2HVSA 5AA2A 4RM3A 3KX2A 4PAFA 2Y69H 5I58A 3SFZA 3S3OA 5DS9A 5CI5A 4FECA 4IO9F 2GHBA 2OD5A 4P96A 1N04A 3R7XA 2R7RA 1IJWC 3QU6A 1RNLA 1NMUA 5DT6A 3DTIA 2DT7B 5J1UA 3WTTC 5FB2A 4OHNA 4HOBA 4PBQA 4ZDMA 2DA4A 1YX3A 3KOTA 5HODA 2BXYA 2XGEA 1LBBA 4R75A 1EZ9A 2IA4A 3KYLA 1D0ZA 2DFFA 2EQRA 3ESWB 3F21A 3GTMJ 5JTYA 2IEEA 4II3A 3BDDA 4CCKA 2ZZWA 2QKLB 3ZMZA 1DSNA 2VJJA 3RZDJ 2DXRA 3LR1A 5AA2B 5C44J 1Q1KA 2M30A 4RA2A 4LZ5A 4KYEA 2LOOA 3EQLF 4YIIA 3CC7I 1IDYA 1FBUA 3F8BA 1KA1A 3JCUC 4ENMA 1KYZA 3D0SA 1G3YA 4DZJA 5FD6A 2CSOA 3LSPA 1A36A 1P1OA 2XA5A 2JA2A 4G8NA 4M4GA 5IM2A 1U5TC 5L3FA 5LLQA 2WTEA 3N05A 4IX7A 1O4XA 1FJ6A 2EWNA 4I6ZA 2Z8EA 3KBZA 2ADUA 2JZYA 5ICFA 1X1AA 3V7RA 1FX7A 3J80Z 1NUZA 4ISUA 4XMYA 4BBRJ 1VQ4I 2VXZA 1MBJA 3HC7A 2E7WA 2XVCA 2CS3A 2Y75A 2XWIA 2DU9A 4I0BA 5TU0A 2KRFA 1YITI 3IO6A 5F7VA 1AWBA 4DBQA 4B3AA 4FATA 3CJRB 3LNQA 2CQNA 5IYBJ 5BPIA 3TOBA 2LD5A 1F9NA 3B73A 4A6DA 1LFBA 4BDNA 3CO6C 1QULA 2ZSIB 3BLYA 3M1EA 2BOLA 3MZ1A 4ENKA 2VQGA 4RA1A 3TCGA 1FPJA 3MSTA 3PIOF 3FVGA 2DODA 2BV6A 2E34A 4LJZF 1IMAA 2RQQA 3C33A 4AQ4A 3K02A 3FK7A 1J2XA 4F3QA 4RB2C 3OL4A 2M5WA 4LOCA 3ZQHA 4BUPA 3RYRA 1R5GA 4RK2A 4RXLA 2R7OA 1SFXA 3I4PA 2HNHA 4CZCA 1QZZA 2H8RA 1O7TA 2NUVA 1HSLA 1A55A 3S9EA 2Z8DA 1I27A 3P9KA 3W2WA 3OL3A 3RQTA 1MNMC 2RC8A 1B3HA 3M8JA 4QSDA 5FTIA 2LYCA 5ICCA 1FIAA 3ZN0A 2VBWA 3WTVC 4ESJA 2AL5A 3PD8A 4UUSA 3TDJA 1OR7C 2BHYA 1WQ2A 2I4CA 2JRMA 4U0YA 4JXIA 5TJJA 1PDAA 3VE1B 3ZOBA 4NNJA 2F5DA 3RPUD 2DWJA 1H89C 4P1LA 1LBXA 3DXJF 1YX5A 1YCJA 1S9TA 4RB3C 1ZRCA 3S4UA 4OU0A 2P0WA 2PFYA 1FBPA 2DO7A 1KZ8A 3IUOA 1T0FA 3LQRA 1DU0A 1FPGA 3CJNA 2ZMEA 4BS9A 2ISZA 2COMA 4A69C 1FTKA 4RY1A 5F24A 3VV5A 4NF5B 3H1CA 2R71A 4RB0A 3DEUA 2XX8A 2XHDA 1BN5A 1TT5B 2L7KA 3FMRA 1HDPA 2LP0A 3OIPA 1I1GA 2V9PA 2R92J 1BP5A 4UHTA 2VBYA 2FUG2 3LBSA 1Y56A 4XL9A 1RI7A 3BJAA 3ECOA 3MQ0A 5TPAA 1ZELA 5J8FA 2ME0A 1VQ8I 3BWGA 2BVMA 4YZZA 3K7AJ 2OF7A 1JW5A 3CG1A 2W4SA 2NWJA 4Z7EA 4PSXA 1NHAA 4NF5A 1BR2A 3K0VA 3ILUB 1Q1VA 1DOTA 1B3GA 1Y20A 3KP3A 3MKYB 1Y1MA 5EEHA 2A05A 3HGYA 1X3ZB 3I64A 1TLHB 3OWTA 3A3UA 1H9TA 3MVXA 4K2EA 4LQ5A 4HV5A 3H9QA 1S6LA 2HTJA 1TWHJ 4AIKA 2XWVA 1QGXA 5M2VA 1D1CA 2UUZA 4WWCA 2HFBA 1DQUA 2DYRH 2R7QA 3OSGA 2CGPA 4NF4B 4GWOA 3FMQA 3J80K 1Z9CA 4THIA 4JK1X 2VB6A 3OYBA 4M3FA 1NNFA 2MYSA 3PJRA 2REGA 4MX6A 1FBEA 4N4NB 1FPEA 5LRSA 4Y15A 2EFQA 4FQGA 3C3WA 5ITPA 2JMWA 3U9GA 3RTWB 3J81K 3CG3A 4WXDA 4B44A 4ONYA 4CCNA 1FIPA 1FQFA 4MMPA 5CVVA 2ZYNA 4ZE8A 3GW2A 4ANJA 3CRBA 2GLOA 3BCBA 3LSIA 1UJ8A 2OWTA 4P5OA 2ZMBA 5JTYB 1S7OA 2XIGA 3C35A 4XOTA 1SW5A 2E2IJ 3T22A 4M9ZA 1IMFA 4J19A 2BJJX 5H8NB 2CW0F 3KC1A 2HZTA 3U1OA 1I5ZA 3F22A 2R5ZA 3GWZA 1YO5C 3ZQ7A 1P4AA 2EPFA 4CYDA 2IGOA 2TDXA 3RYPA 1MXZA 2EZKA 5ITOA 5E3MA 2Q74A 1EH8A 5D8LB 4N8GA 4XR6A 3IJOB 4ELRA 1K83J 1TQPA 2CU7A 3LQQA 2B3BA 1LAGE 2GRVA 1IXSB 3H4ZA 2VIXA 5DDGA 3B7DA 4GLIA 4MEVA 3ZSFA 2E1MC 3Q0UA 3PUXE 3DBHB 3SZTA 5DTBA 5I57A 4NMYA 5I56B 1BI1A 3M3YJ 5LHIA 5H8NA 2HAUA 3M8UA 5CBRA 3AG3H 4XKPA 4U0VA 2YX4A 2R5ZB 3VXCA 3L6HA 2LH9A 1X1BA 2MH2A 3G2BA 3TCFA 3CP2A 2EFOA 4XSXF 2JA7J 1OKRA 5H20A 2AS5F 4NC6A 2XGDA 1BW5A 3E9XA 3IAS2 2W25A 3JV9A 4HQEA 2X48A 2EBIA 4N07A 4HF1A 4I1DA 2ESNA 3A2KA 4AS5A 3CLOA 1P6RA 2NOJB 2R0QC 4R1HA 3GEZA 3U1KA 2PG4A 1MBKA 4BQNA 2Z1DA 1PB9A 1APLC 5I57B 4JX4A 3ZQQA 3IFAA 3IH3A 5I56A 3MD2A 5BOXA 4L9VA 3JZJA 1SVOA 4LLGF 3TKYA 4NWCA 3P5JA 4YU0A 5FHMA 1V54H 2BHZA 4ZC3A 5K5RA 1H3DA 4H8IA 2K3FA 2OC6A 3RN8A 3E78A 2EV5A 3M4OJ 4E7KA 1MS7A 3BPXA 3K6VA 3PU5A 2I5UA 1NH3A 2K7LA 2VPRA 2ZYOA 4G6TB 2R5YA 5E20A 1BM9A 2DA2A 4EGZA 3HOTA 4XK4A 2GOXB 4PFPA 3VWBA 4F3GA 2JA6J 3T0YA 1JTXA 3BG6A 3FJGA 2DQLA 3F8NA 3TODA 1B59A 3M7GA 1U9NA 5DCMA 5ED4A 2KISA 3WTXC 1P92A 1RZ4A 3LAJA 4M3DA 1MSEC 5FKKA 1J09A 3DTEA 2Z9OA 1WSUA 4PFOA 1FSAA 3FHNA 3IO4A 3KP2A 5DTDA 1PP7U 4H46A 3W2VA 4D1QA 3MAJA 1FPLA 4DCYA 1JHHA 2WA0A 3ABUA 2XWKA 1EU8A 1IZ1A 4O7IA 4D0PA 1US4A 4R2FA 1T6SA 2PMHA 5LTCA 4L9NA 1FTAA 2H6BA 5HDKA 5IY5H 1OIBA 5J8CA 3WGGA 3H3VK 1Z6TA 3TOAA 5D8KB 1B58A 1W5CC 3FMSA 4WX9A 4OETA 4JQFA 5IP9J 4WXCA 4O6JA 1B4ZA 5IT9Z 3GZ6A 4NUBA 3KSXA 4R6KA 1YTVA 4U88A 3CCQI 3FJ7A 1Z7NE 1Y6IA 3O6GA 4M3BA 3FXKA 1MY3A 4KDPA 2MC3A 1XTAA 3HZJA 2H27A 4O94A 5HS7A 1XSXA 3HSRA 2ZXWH 4C3HJ 4IOCF 1WCMJ 3B6TA 4R6HA 1Y9UA 1ETWA 3JAMZ 1JKQC 1RDYA 4DE8A 2O61A 1MY4A 1QJMA 3USDA 5HLIA 1UHWA 2X6WA 3KJ7A 1YAEA 5FFXA 4RB1A 4AC0A 1IMEA 1KQ9A 2L4MA 1O3SA 3RKQA 3A0HC 1MNEA 4OVQA 3I55I 2LTPA 2IS1A 2X9DA 2LKPA 1D5YA 1QPIA 3IH2A 4UB8C 1NNPA 1B3EA 4I8CA 1FQBA 3HSFA 2E0SA 1IUYA 5DUIA 3GLXA 3ZMTA 4M71A 3OEKA 3GYHX 3KEIA 2R3SA 4U7BA 2GBYA 5BUUA 3OOPA 1W1WE 2JSPA 3G1LA 1S5LC 4E7ZA 4PF8A 1G2HA 1B40A 4LN5A 2GA1A 5C3EJ 2XXWA 2L4AA 4GL0A 4HAMA 2P7VB 4DW6A 1UTBB 5IKBA 3RTFB 2ZZVA 2OV7A 4AIDA 4GGGA 4GWZA 2FD5A 1ZLQA 4PFUA 3W9VA 4BDMA 3N6UA 1VFCA 1A31A 2DE2A 3U1DA 1UELB 2EV6A 3FISA 4Y17A 2IEKA 5ET8A 2WAQN 2L2OA 3HPHA 3FJMA 3E97A 1MW7A 1ACIA 3EPEA 4ZJZA 4GD5A 3VSLA 3U93A 1MG1A 2UV1A 2W24A 3V42A 4UXNA 2LDUA 2VOPA 1ZG1A 1YXIA 3K00A 1SVLA 3JAMK 3ZGKA 2XAUA 1Z7UA 1X3UA 3UNGC 1UIUA 2YLNA 4A2UA 2AL4A 4X1EA 2ZJRF 3I56I 2O9LA 2VLAA 1RIOH 2VOZA 4KT6A 3Q27A 1BC8C 4JSDA 3DKWA 3A01B 4XN3A 2XAJA 4RAYA 4Q5SF 1KA0A 4DQ2A 1GHCA 1RPWA 3K4NA 1B7HA 3OO9A 1ZARA 2X7QA 2B3FA 3MJNA 4IHSA 3THIA 2V9KA 4JBAA 1Y8QB 3UA8A 4G8XA 2F3DA 3DTKA 3VYSB 4PUSA 3CP8A 2OQRA 1K78A 3Q28A 5HBCA 1IRXA 4OVTA 3G3JA 3OR2C 3D5SC 4KIFA 3BG7A 2WC2A 2A6TA 3AG4H 4NB5A 4DIQA 3VVDA 4ZECA 2VPNA 2M3AA 2GA2A 2HYFA 3OOUA 2HQNA 2RVCA 2Z2SB 3E7LA 3KYCB 1BTJA 4EGYA 2C6YA 1W36D 2WYKA 1MQGA 1POTA 4HPQA 1KZHA 5K7ZA 3FVOA 4U1ZA 2V26A 2BZTA 4ZYHA 4H0WA 4OMBA 5E3OA 2VC1A 4MIJA 4QPOA 3FM5A 3ZR8X 1ON2A 3PM1A 3BKIB 1IV8A 2ZJ2A 2YUSA 4DXUA 2CJJA 3N94A 2CQXA 1K78B 3MC2A 4G7ZF 1MDQA 3DFGA 2OUMA 1A54A 3C2HA 3ZPLA 5EG0B 2F7AA 5L8DA 1B3FA 4X04A 3CCUI 5DYMA 2O1LA 4D7NA 4GFBA 3WTZA 3AL0B 1FBFA 3LL7A 3RZOJ 2OTJI 3H6VA 4RS8A 3QXMA 1XB4A 2EFPA 4OAYA 3S93A 4XQFA 1I3QJ 5M3MJ 4E7SA 1U5TA 3GFIA 1FSHA 1MXUA 3MP8A 1YS6A 1G3TA 3FIRA 3LFUA 1FOKA 3H92A 4YB6A 1AKHB 2NVQJ 3FBIB 2IXSA 3BTLA 3NOHA 1VI0A 4PGHA 1ZMGA 4K3FA 3WAEA 3JRFA 3K01A 2IGNA 4FTHA 3K4KA 3LFKA 5EG0A 3I9V2 1SW4A 2DPUA 4M73A 2XRLA 3VVFA 1LFHA 3N97A 3PO3J 3JYRA 4P9FA 4KR5A 4GIZA 4FAJA 4H4KC 4HSRA 4P0IA 3Q0WA 1LCTA 1MIJA 3E3VA 3CD6I 1OMIA 2A5YB 1HLVA 4N4OB 3IORA 3V4GA 1PB8A 4N0BA 3EUKL 3KP4A 2P6TA 2QQAA 4XRFA 4EJUA 2K9SA 1P4XA 3TMOA 2HPMA 1YTYA 1RYOA 2K9LA 2AIXA 2XV4S 4F52A 2DXYA 3IAZA 1FJ9A 3T66A 2KIMA 2H6CA 3V8LA 3OMBA 4XEQA 3KYDB 2RQPA 5ET7A 2IPQX 4NQWA 3S2WA 2CO5A 4R79A 2DWHA 5J4VA 2AO9A 4LB5A 2V4JC 5H2FC 4BE1A 2M0MA 1XC1A 1W4MA 1U3EM 5TGTA 3B02A 1IITA 2ID3A 2QVVA 1LB2A 2HDWA 3H9GA 3TL4X 2JA8J 5HPQA 4U0WA 2ELKA 3GZ5A 5CJ9A 1UTHB 3QPTA 4HYEA 4DLDA 4AB6A 1AHDP 2QUFA 4A5MA 5D5VB 5TRDA 1K9ZA 3RPLA 1PJRA 4KQPA 1EA3A 4J00A 1VQ5I 1JQFA 2HQRA 1TWGJ 2WAQA 2KP6A 2Z22A 4LZ7A 4NQWB 2L9NA 5B7DA 2CEYA 4A3DJ 2WEFA 4OVRA 4MQ9F 3K1NA 2X7PA 2V1NA 1DPEA 4F3BA 3F23A 1F36A 1T98A 1N25A 3KCCA 5IYCJ 3G1MA 3SEQA 4IOAF 1N3WA 4PDKA 1WODA 4MEYF 2YPNA 3HFUA 3GXOA 2VPOA 3F6OA 1USYH 2A5TA 2TCTA 1MKMA 2XSDC 1JGSA 2XXPA 3X2QH 3N4MA 1FTMA 2OBGA 1TZLA 4H67A 1DTGA 2RV8A 1FPFA 4OYVA 1DGRM 4FEDA 1QZYA 4KXPA 3I54A 3OYCA 3HPIA 3GTQJ 3KZIC 1W5TA 1OCRH 4YKKA 4PK4A 1QKAA 5GAHJ 1D3YA 4I2OA 3V5AA 1I6AA 1YYZA 1L0OC 4H5FA 4RAGA 1EZOA 3O2AA 2RKHA 1KONA 3ABLH 3VFZA 1FP2A 1B7ZA 1RKMA 2W48A 3BZCA 2Y7RA 4YKJA 4OIRF 2FVZA 2GQ1A 2D2WA 3S2DJ 2CEXA 2Z33A 4NGUA 2HXOA 4EJWA 2WWYA 1B05A 2O03A 1RR7A 3WU2C 3OYIA 3D1RA 3W15C 2QGUA 4WXHA 3CSBA 2EA2A 1OPCA 2OZUA 3NEUA 3WE2A 3SJMA 3ODBA 1I6BA 1EH6A 2PBWA 1ZKBA 2JTVA 4XORA 1M5BA 2FQ3A 3FBNB 1OLTA 3H7MA 4NHBA 3K4LA 1OVBA 2FBKA 2WBDA 5B1BH 2L5VA 1E3HA 1NV7A 2ESHA 2F4OB 1FPKA 5DVJA 1V5GA 2FYIA 4LATA 4A3GJ 4PDDA 1VQLI 4F93B 3VYTB 2UXNA 3S1NJ 5DVFA 3QPHA 4OVSA 5ISUA 2XKOA 5FROA 3UGWA 2Y5KA 1ON1A 2DBBA 4NHJA 4Q48A 5K7HA 2JQ7A 3HCQA 2YR2A 4EXLA 4UV8A 2XX7A 1B5IA 5T3JA 5JR3A 4OIPF 1G4DA 1R5ID 3BG5A 2R7VA 5LHGA 4Y4RA 1OCPA 4B4CA 4BJTA 1P1QA 1PBPA 4MFIA 3ZKLA 2Q89A 1F4KA 1SDXA 2Q1ZB 1FQAA 1FYMA 4KFQA 5IT9K 3ZCOA 2OZZA 2HXIA 2IA2A 1XDSA 2NS8A 3PUBA 5FRNA 3LOCA 5IT3A 3OD7A 1JE8A 3NAUA 3S1QJ 3JTGA 2XXYA 3TDZC 1MXXA 4NAPA 4CO8A 2I3VA 3QWLA 3SEVA 2O6AA 4R9FA 4E0WA 3NWTA 2I6EA 2PCRA 2HTSA 1IUDA 3GFJA 5D6FA 2ZMEB 3N26A 1MXVA 4C2UA 1XPXA 2R7UA 3M3KA 1VR5A 2K4BA 4GOTA 4HS7A 1F43A 1S3JA 2CQKA 5CC2A 3SETA 2CZLA 2VKVA 3S9NC 1HW2A 4R2BA 5TP9B 4FJPA 3IB0A 2XPWA 4UVBA 4XIDA 4XRMA 3J81Z 4ZEBA 2R4GA 2ZNZA 2OTLI 3OYHA 1YFHA 4IL6C 2O51A 4QXDA 1J75A 5K2YA 4ABZA 1ETKA 3H5NA 1Z7ME 4Y33A 4O5VA 5HVQC 2Y2ZA 1YW8A 2ZNYA 2UXAA 4KYDA 2HKXA 2KDZA 2QENA 1RC9A 2FBPA 5I2KB 1SEUA 1USTA 5A2QK 3WGIA 3V7CA 2A6EF 1E2XA 2E7XA 4HNVA 1CF7B 1Z6RA 3A02A 1EF4A 1FTZA 2L9SA 1MM6A 3IOUA 2KL4A 4ECFA 4F19A 3FXJA 1WI3A 3TPAA 2VI6A 2BEOA 5TP9A 3VLVA 3ASNH 3BC8A 1GVDA 2ZJQF 3M07A 1UQWA 3F8CA 5LGTA 4IPAA 2MG4A 4TV7A 3SZGA 2VJ5A 5JK4A 1I1SA 3CIJA 1IRFA 3FKIJ 3GXAA 4JWOA 2IA1A 4GXAA 2TRTA 1XCVA 2DOAA 2BE5F 1WI9A 1P1WA 3KIOA 4F7ZA 4ZEIA 4AVPA 1SC7A 3KLOA 1YIOA 1M5CA 3Q9SA 4NF4A 5EYHA 1M5FA 2EIMH 2HHMA 4KN7X 3TO9A 4PJ0C 1IXGA 3BT9A 4JX6A 3ZN1A 2HOEA 5B5EC 2VC0A 4XNFA 4XIGQ 1POGA 1N77A 4ELPA 5KAIC 2F48A 1RDXA 4XICA 1TXFA 3HV1A 4EJOA 1B9NA 2ZMEC 1D9VA 3QSLA 4Z6YA 1MSFC 3L2CA 1DPRA 4CCMA 1MPCA 3OO7A 2HS5A 2QZ8A 1IUFA 5JEIA 2JJKA 2HDDA 2L9RA 1XGNA 3SHFA 3DBLB 1G0HA 3IX1A 1LUJB 3AFHA 3FV2A 1R1VA 3T9VA 4IO3A 2Y5LA 1B1BA 5J1YA 3WTSC 5HNHA 1VQ9I 1X1CA 2PMUA 4PJNA 1VE4A 3O97A 4NE4A 1N7WA 3KGCA 2HAVA 1B5JA 3IP4B 3TBIA 1W7PB 1FC3A 2Y48A 1K4SA 3MVWA 5AA3A 3FXBA 3GTGJ 4X6AJ 1DTZA 2NRAC 3OYFA 4IO4A 4MJOA 2RNJA 4CZZA 1K6OA 1I6XA 2DOEA 5DM6F 3ZQFA 1SFOJ 4NWDA 4A3IJ 3MVZA 1MD0A 2XPVA 5CVIA 3GZNB 2NOGA 2RAEA 3CESA 3CCJI 1ZKGA 2XROA 1O7LA 1WHUA 4P56A 4A3MJ 1JEUA 3CFLA 2H94A 1OYYA 3DEWA 4IQ4A 1B46A 4HE2A 1B72A 3K69A 3CR9A 2B4MA 5ICEA 1TFAA 3SEXA 2HR3A 2PT2A 5AA2D 1LFGA 2M34A 2FF4A 3E5UA 2KKOA 3JRIA 4QFLA 3O6HA 2FXAA 4BHCA 3HOUJ 1DUXC 5GTIC 4LB6B 3B6WA 4Q8RA 1Z05A 4L5JA 3O8GA 4EF1A 2I0BA 4PFBA 4D5FA 3F3XA 2QS4A 4OESA 2X0LA 4V2GA 3T9UA 5DV5A 3K9TA 4QFNA 2PX9A 3SDGA 4IZZA 3A1YA 2FA7A 3AL0C 4MHFA 3BQZA 1WJEA 2CRGA 3DU5A 3IHUA 2H1LA 2OQGA 4XLEA 4S04A 2D3IA 3HOYJ 4H45A 2QQ8A 1V4RA 2GFEA 4DCXA 2VOOA 4HLXA 4NEDA 5FLXZ 3S8PA 5I7IA 2Y7WA 2CMPA 1O7FA 2AQEA 3HOVJ 5E8GA 4D5CA 5JLWA 2R5YB 2H1KA 2AQFA 2OZ6A 2FNAA 3LSJA 5DYHA 3KEOA 2GOMA 5JHUA 4O3AA 2MGQA 2GWRA 2XUBA 4A5NA 4B8XA 3RPUA 4XKVA 2K86A 4A3LJ 4ZEDA 4II2A 4PJMA 5DCMB 1XMXA 1TNTA 2QLZA 3FXRA 4OWRB 5HLHA 1R49A 2A5WA 2XF7A 4IXAA 1URGA 1JUMA 1R5HA 3K0LA 3QP6A 3C32A 4KD5A 4MAGA 4YKPA 2Q2AA 3KETA 1BJZA 1D9YA 2WBMA 3OOAA 2EK5A 4PE3A 4YKIA 3G6EI 1R4NB 1IC8A 3DP6A 3EUHC 4BQQA 1B6AA 2O8KA 2Y31A 3FM3A 1GXPA 2E60A 4PSWA 4XLHA 1IW7F 5ICQA 4XLAA 5FO5A 4N17A 3G3ZA 2NS0A 3IOVA 3OYKA 3MZHA 2PLYA 1LEVA 5LEKA 3K2DA 1QUIA 4NTLA 2MFZA 1FPBA 1FOYA 5LHHA 2EILH 4OQOA 5JI6A 2I4BA 2R6GE 1SPIA 4G8MA 2DK5A 3ONMA 4C3JJ 4U2RA 1OCOH 2CH0A 2Z99A 4XKCA 2JK3A 4EM0B 2OWSA 2GAUA 2F3BA 4XN0A 1POY1 5E1XA 1SD3A 4V19K 2HXWA 5EHMA 3LA2A 1F5TA 3UIFA 4BDOA 4HDVA 3GTOJ 2F5XA 3TTNA 3PNYA 3TEDA 3IK6B 3F8MA 3FKJA 2PI0A 4DI3D 2ALUA 2W85A 4QPQA 1PYVA 4J01A 1S50A 1OVTA 4JYKA 2JT1A 4OA4A 4R73A 4ESWA 5A5LA 3HRTA 1R23A 5F0CA 3PUVE 3RQIA 2CFOA 3VOEA 1GGGA 5KK1A 3HHFA 4UV9A 3QIMA 1SVXB 3TTKA 2AXLA 1YRNA 2P0SA 3PUFA 2WAEA 4WEPA 4HNUA 4JP0A 4BHPA 2ZXHA 1FRPA 1QHGA 5KDTA 3E79A 3H3GA 1FBQA 2R7FA 1IIWA 4XOPA 5DVIA 1Y1ZA 4BACA 2FU4A 1QBJA 4A93J 2F5FA 3EUAA 2H09A 3RTRA 1IG7A 2QS2A 1X3WB 1IAWA 4ND9A 3JRHA 2GIVA 1ZIUA 3T9XB 4PZJA 2M8GX 4MTDA 1XS5A 4HLYA 2X1DA 1MQDA 5BMZA 3GMEA 5L3EA 2ME6A 4RYAA 4ZDLA 2H99A 2NNNA 4P1WA 3OY9A 2HYJA 1ZREA 1UTBA 3MBPA 5FBPA 2JPCA 1HA8A 3QPSA 1EJ9A 1FEXA 5F6FA 3Q3SA 3TO7A 3JTHA 4X1BA 2YU3A 1B0HA 3PGFA 3S32A 4S0HB 1TNSA 4U4SA 1T08B 3W6JB 4GWXA 2E5NA 1MBEA 2LK2A 4HXVA 1Z3YA 4ZYEA 3BTCA 1DPUA 4KT5C 2L3DA 4HX8A 3OYGA 3T0JA 3CMMA 4M1VA 4PFYA 4L0ZB 4GYGA 2HKOA 3H6WA 5CMCA 2AHQA 3OENA 1I39A 1OCCH 2L5QA 3QYFA 3FZVA 4D7MA 3GTPJ 2MA3A 4BXFA 2M87A 3GLBA 1UCRA 3LSMA 1A40A 5FHNA 5I2KA 2HFHA 2E1SA 4I3YA 3GVAA 1PEBA 5F0HA 2EIJH 3Q0VA 1DGWY 1BLFA 1B3LA 4NN3A 2ZB9A 5I3SA 3O6BB 1LAXA 3MQ9A 2D5VA 2DMTA 2XASA 3GF2A 3JSOA 1HW5A 1JW4A 4JWYA 5EHSA 4EQ7A 2IP2A 2RNGA 1WJ5A 3AAFA 3WG7H 4OAZA 5LBQA 3EETA 2VL8A 3DBRB 2DSFA 1OR7A 4MNPA 1P9QC 2DXIA 4UB6C 3CDHA 1IMCA 1ATGA 5L3GA 4F92B 1S29A 3MKZA 3CC2I 3BPVA 2V3TA 2P6SA 2V6CA 1I50J 2JSCA 1S9HA 3QK6A 4L17A 4OVJA 4MLQA 3U65A 4RGXA 5FLVA 1B4HA 1YI2I 4N9HA 1D8JA 4Q5TA 4X9TA 5JVTA 1P1NA 4MO7A 1R9LA 4CHUA 1RKTA 2ZFUA 1DPPA 1GVJA 1V5EA 2PBIA 5JFRA 3TEPA 3CMEI 3LC8A 1LSTA 2OWZA 1WKMA 4F1UA 2PFBA 3G3KA 2STTA 1VQNI 3BFTA 3DELB 4O3BA 4AU7A 4KFCA 1NV5A 3TFLA 4FX4A 1TT1A 3ZQLA 3CCMI 2NS7A 2PX1A 2XX9A 4KHZE 3HRSA 5KCJA 2KQRA 4HNTA 3I53A 1FBDA 4I9DA 1KGSA 3QRFF 4LZ8A 5M5YJ 4GVOA 5F0FA 3L7WA 1UG2A 3LWFA 4LK0F 3TELA 3H5AA 1U5TB 4BLAA 4PJJA 2UVJA 4N15A 2ID6A 2VASA 5HLTA 2UWMA 1FYKA 4M6VA 3CSGA 3GBBA 3B6AA 1BL0A 4IGRA 3VYRB 3LV0A 4DI4B 3CCSI 4E70A 1AKHA 5M3FJ 1UZCA 3ZQCA 2NVXJ 1BK4A 2Q8MA 2WKYA 1NTCA 1H76A 2YU9J 3JW4A 3TGNA 4GRKA 4YEJA 2EV0A 2LY2A 2QA4I 5HOOA 3I6VA 3HBLA 4MTEA 1OQGA 2FIXA 1IMBA 5CLSA 5KCJB 4TLMB 4XKNA 5IGAA 3LSHA 5KHDA 2LF7A 1WJDA 2RINA 3ZRGA 2XXTA 3MCZA 4RAFA 1OYWA 4HBLA 3V8JA 4A3JJ 1HSEA 3OS1A 3IKTA 2OK2A 4LGWA 4BE2A 2Q2CA 4B43A 5IAIA 5I59B 1MJ9A 2KHMA 2P7CB 4F29A 2FNCA 1FCKA 3H0GJ 1D8KA 4KIBA 3RGYA 3R0AA 4WKMA 2ONRA 2M8EA 3DLNA 4FCYA 1R71A 3SYTA 2K4JA 1Y4TA 1ZYRF 2XPUA 1IV6A 3EN3A 2IRFG 3UORA 1YG2A 1B1XA 1MRPA 3J7AY 3U2RA 4U7DA 1QVSA 3FHZA 2OU2A 2XRNA 3TTLA 4ETSA 1J1NA 1HBXG 3TYHA 1P7JA 3F0CA 5F08A 4ZH4F 2CYYA 1T56A 1BKAA 4E7JA 1UTHA 2NVTJ 4G9YA 5I59A 1TW2A 4GF8A 4CH7A 1A6IA 4QIWN 3RPLB 4R8HA 5J40A 1REPC 1LBCA 3D4GA 2OBPA 1VTNC 3VFJA 4AUXA 1TQMA 1QKBA 4I01A 4BDZA 4I09A 1FPQA 2X6OA 1Y39A 3WAFA 2ZXJA 2F97A 2LG4A 5E3NA 2HEOA 3WTYC 2QMXA 4P47A 5B1AH 4HDUA 3RT6B 2EH3A 4EQBA 2VKHA 1NG7A 3G73A 2VUMJ 1KQ8A 2A5TB 4NX1A 3JRBA 1WWXA 3ELKA 4I0AA 1OLAA 1LAFE 3ZMVA 2NVUB 3JRGA 3KPHA 2Z8FA 2KT0A 3K2AA 1AOYA 3M9AA 3Q9VA 4I99C 3GFMA 5K1YA 4ITVA 2LC2A 2OAZA 3DF8A 3I3LA 5A2QZ 2DYXA 2BBYA 3KFMA 1SBPA 3TTRA 2XAQA 1Z7LA 5EYRA 3WTUC 1S72I 2M2EA 4YG2F 4FEBA 4UUTA 3H5RA 1VQMI 2HOTA 4FE7A 3A09A 2DVZA 5KZTA 4DIGA 1ZG3A 3DPUA 4AM3A 1DU6A 4ZE9A 1BIYA 2F36A 4XSZF 2JA5J 2WX9A 2GM4A 1FQEA 1FMWA 3OV8A 4QF9A 4E6KG 5HDNA 2EFWA 2FBHA 3E5QA 1FT9A 3M1CA 1XT8A 3L2UA 4IHWA 2UVHA 2DOJA 3LUYA 2ONSA 1Z0XA 2DFHA 1MY2A 3MP6A 1AWCA 1IDZA 2BJIA 2QSGX 4OFLA 2L54A 2V1XA 4XKBA 3COAC 3PUYE 3BTJA 5EQ7A 1DP3A 5FLXK 1SW1A 4G77A 4F18A 3O8HA 3K1MA 1B4AA 2MABA 4U4XA 3RKWA 1Y8RB 4MNUA 2HOSA 3U8QA 1MMSA 2E36A 1MH4A 5EGOB 4LQ2A 1ZRDA 2DA6A 3I58A 4I98B 2HGCA 1FPIA 4OEVA 1LKXA 4LD5A 5HNFA 1NNTA 4WF2A 1FYLA 5CM6A 5J47A 1IXRC 1ODDA 2MBFA 3LA7A 1LDDA 3O2PE 4YIFA 3OYMA 2FA5A 2QWWA 3BCAA 5K5QA 4F55A 2QBYB 1N7XA 1GV8A 4L5EA 1TBXA 1YYVA 4C0RA 3I0TA 1JKRC 1RR8C 2O7UA 3FF5A 4OMYA 2ECBA 2E1MB 5FLMJ 5CQGA 5L9SA