3FXRA

Crystal structure of tsar in complex with sulfate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
total genus 86
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA03
2ZMBA 2VOZA 2DFIA 3TELA 4TQUQ 1TNSA 2H98A 2DOJA 3K6VA 1YLFA 3FUZA 2BV6A 2M8EA 4OMZA 3N6UA 1ZLQA 1PP8F 1YQAA 4RB1A 1MY1A 4BHCA 1RUOA 3MZ1A 4I0BA 3WU0A 4EF2A 4YFXF 3E3KA 3CIJA 1NL5A 2HDCA 2FU4A 4QFKA 1K78B 3MEXA 4IPAA 2LDUA 1MQDA 3M1EA 3PMWA 1S7YA 1Q35A 3RNNA 4ENNA 3GFMA 4HV5A 3GF2A 4LB6B 4I01A 4JWXA 5LRSA 3Q5FA 3C3WA 5HOOA 3BKIB 2OK2A 2RC7A 2THIA 3E6MA 3TDJA 3JYRA 1R22A 3W9VA 1TW2A 3V7CA 5AA1A 4X48A 4XKNA 1BKAA 2UYEA 1LB8A 1LAGE 2QSXA 3E3VA 3I59A 4XIGQ 4R8HA 4A5NA 1ZN2A 4FATA 1OPCA 1Q1KA 1R1NA 2ZFWA 3W6KB 2AL4A 4ESJA 2RKMA 1FBUA 3O6GA 3M7GA 3R6SA 2CQKA 2Z9OA 1ZGJA 2PG4A 1DOTA 1FYLA 3KJ7A 3PFIA 4EXLA 1YW9A 5DCMA 3RN8A 3MZBA 3BWGA 1MH3A 4BAYA 3OXNA 4U1OA 1ON1A 2R7DA 1BI1A 3TQLA 1USSA 2RNJA 3CR9A 4ESXA 5TPAB 1MY4A 5L3BA 3ZN1A 4ZEKA 2ACJA 2HKOA 2O1MA 1YYVA 1XSXA 2V1UA 2HOEA 4FJPA 5BOXA 4IO3A 4BDNA 4R73A 1FPQA 3D5LA 2I0BA 3RGYA 5K2YA 1ATGA 4EGYA 2EV6A 5BS6A 1U2WA 5HBCA 2IA4A 3G3IA 4LQ5A 3PUXE 4RA1A 3BROA 4IXAA 2VOOA 5HLIA 3TO9A 3GYHX 3G3KA 3T66A 1TQMA 3CVGA 3IO6A 3K6XA 1Z05A 4KHZE 4WXHA 3J81Z 4BQAA 2RF1A 1YW8A 4GXOA 2YSRA 4H5GA 1JNFA 2VGQA 2JTVA 2I49A 4WK8F 3K1MA 1FQEA 1OQGA 1BIYA 2RN7A 5D8KB 3RYRA 4OENA 4UHTA 4F18A 4KIFA 3V8KA 3ZMUA 3G3JA 3CDHA 2IA1A 4KDPA 1BN5A 2ZYKA 4PFYA 2F78A 4RXLA 3DFGA 4WWCA 4OFOA 4EDPA 1K78A 1W5TA 2XKPA 3REOA 3R60A 1FW0A 4H0WA 4IB2A 1VFEA 5B7DA 4GYIA 1VFDA 3DLNA 4ENMA 5CVRA 1KU7A 4HX8A 3RUMA 3A3UA 4QFOA 3VFJA 1MXUA 1MPCA 4ZEFA 1LDDA 4HCYA 3ML6A 1MY2A 5I57A 1JEUA 1DUXC 4KI0E 3O29A 2HTSA 2CG4A 2NWJA 2GH9A 3TODA 4IVNA 4XKQA 3QXMA 3Q9SA 3TAJA 5FTHA 2ZYNA 3T9UA 3QAHA 4GOTA 4L9NA 1BM9A 4Y15A 1EH8A 3HYIA 4OU0A 4PGGA 1LDKB 1ZBMA 4LG0A 2PT1A 4IGRA 1TNTA 1Z7NE 3BJAA 3ZKLA 1XMKA 2FMYA 2YR2A 1B7HA 1AOVA 1AIVA 3DV8A 1XDSA 3PUVE 4P9FA 1S3JA 3WG9A 4G7OF 4F1VA 2FNCA 2RGVA 4AWXB 1MQJA 1Z7ME 4NF8A 4FT8A 5CMCA 1IW7F 2RC8A 2STWA 2XXHA 1H9GA 2UVJA 1MJAA 2X26A 3JTGA 3G7WA 3IO4A 1IEJA 3VXBA 1B1XA 3MBPA 1W7PB 5TPAA 5E20A 3PPQA 3T8RA 2F7BA 3FIRA 2D21A 2UZKA 4NF4B 4H6DA 3Q26A 3IL2A 4M71A 1QBJA 3MZYA 1FBSA 1WSUA 5AA2B 4B09A 5CBRA 2CWEA 4BLAA 2XXIA 2ZNYA 3PUYE 1UHMA 4XLNF 1NFTA 1B46A 3FASA 1U3EM 1B7ZA 1URDA 1LFGA 2AYSA 2EFPA 3N4MA 3H6WA 5KK1A 3PPRA 3IL1B 3VVFA 1M5CA 3WTYC 3I54A 4TV7A 3OMBA 4WF2A 4A0YA 2IVMA 1JVXA 3TKYA 2PYYA 3OO8A 4LUBA 4MNUA 3KSJA 2PVUA 4YIIA 4N07A 5ICCA 1NH8A 1XT8A 2FSWA 1S9TA 2UWMA 1UTBA 1JVYA 4A6DA 2F6GA 5DUIA 1EH7A 1LB2A 2B0LA 1D8KA 4FX0A 1XHYA 4EM2A 4ZDMA 4UVAA 1H76A 3JSPA 1FTMA 2H27A 1OIBA 4G8MA 1JE8A 3L9FA 3J81K 1ANFA 1RKMA 4CO8A 4ZZEA 3EYYA 4CXFA 2OBGA 5CC2A 1SBPA 4F31B 5JFRA 3OOPA 5DTBA 1NKXA 4F1YA 3ZMVA 1WODA 4I2OA 1PDNC 4NWCA 4PETA 3GXAA 5LGNA 2ZJ2A 3MFKA 2XKOA 3QRFF 1STZA 5CLSA 2BEOA 1YS7A 4WXCA 4S04A 1HKSA 2NNNA 1GTKA 5L9SA 4F3BA 4WEDA 2QQ9A 3OV8A 2QYOA 3ILUB 3L09A 1HQCA 5F1QA 3BPVA 1P92A 1SMTA 1B0HA 3RPUA 2VHAA 3G3GA 4MHGA 4H65A 1L5TA 1YIOA 3TKDA 1LDJA 2ABHA 4BH9A 1I1SA 3LA3A 4KYEA 3BZ6A 2D5WA 3CUQC 5M2VA 2NVUB 3VOEA 3MUQA 1Y3QA 5LHIA 2DXYA 5BQTA 4DLDA 1XGMA 1DP7P 2DS9A 1YW7A 4M9SA 5F6FA 1KQ0A 4AIJA 4NEDA 4YFNF 1GV8A 4DIGA 3C31A 2D1VA 3BJOA 2RCBA 3RYPA 1YTYA 3A3CA 1Y1MA 2PT2A 4DXUA 1IXHA 5TJJA 3FMQA 5AE4A 2O03A 4U4SA 1XVXA 3J80Z 3IHUA 2JPBA 3MZ9A 3COAC 2HFHA 2PFBA 1W7PA 1RYOA 5FHOA 1O7LA 2YU3A 4PGHA 2A07F 2XXVA 4IO7A 4THIA 3GFJA 4UA8A 4WKMA 4N6PA 4FE8A 5I58B 3E13X 2F36A 5L3EA 3CRBA 2KRFA 3TQNA 4ZEDA 4YMBA 5FLXZ 5BWJA 1A04A 1P1QA 5I2NB 2G93A 3TCGA 2Y84A 1BI0A 1OMPA 1FSEA 4RGSA 1USYE 3VLVA 5I84A 2KIUA 1V3FA 5H6RA 4HDVA 4A5MA 3HRTA 2H25A 3I0TA 1IUYA 2LAOA 3SEVA 4H8IA 4CYDA 4XSXF 4FHTA 3T1BA 2YLNA 2PEXA 1MDMB 4P0GA 5EHSA 1QVSA 4NQWA 3IOUA 1SD5A 1IQ7A 5HDNA 1ZRCA 2K02A 1MQGA 2HKXA 3FVGA 2KLFA 3ONMA 1RIOH 4Q48A 4KA4A 1I1GA 2G29A 4MH5A 1US5A 2XXXA 4JK1X 4ETSA 3V8XB 4GYGA 3IWZA 3TDZC 5L8DA 2PJPA 5FO5A 1CF7A 1FZPB 1OLCA 3V89B 1B4AA 1KU3A 3IR1A 1LFIA 2QMXA 4RY1A 4F2OA 2QL3A 1TQIA 1FC3A 2Z22A 3H6TA 3LQRA 1Z6RA 1YAEA 3FV1A 3ILTB 1ZIUA 5ELVA 1JHHA 4UXNA 1WRJA 2A5YB 4AIKA 2PMSA 1SI1A 2RKHA 3CFXA 3H6UA 4BDLA 4Z0IA 4MTEA 1JETA 3RT6B 1MM7A 2Y7PA 4YB5A 4BDMA 2O7UA 1ZRFA 3HRMA 1ZYRF 2P7CB 1Y3NA 2G7UA 1BIAA 1B59A 4YKJA 1KQ8A 1J7KA 1Z1DA 4OERA 3RTFB 2DXRA 2V1DA 1BC7C 3IAZA 3K02A 1OVBA 4YKKA 4EJUA 2QS2A 4PFWA 1FWZA 2F5CA 1SYIA 1YFHA 5EYFA 3ZS6A 4NB5A 3ZQ7A 1PP7U 1XSDA 1YTVA 4JXIA 3KCCA 2V3QA 5L3FA 5J8FA 2R9JA 3TMGA 3KP6A 5E8GA 4ZZAA 3DPTA 1I6BA 1ULYA 3MP6A 3K1PA 2H09A 3K69A 3DP4A 4LK1F 3VVEA 3I4PA 1SI0A 3ZSFA 2FE3A 2XAQA 3HPIA 4DQ2A 1G3TA 2AXLA 4N13A 2ESNA 2B65A 3QIMA 3S9EA 2V84A 3RPQA 1MKMA 3QP5A 2F8DA 2EV0A 2DE4A 2F7AA 2FBKA 5LRRA 2P0SA 2MLKA 2VE8A 3UP9A 4YG2F 4EJVA 3RIRA 1QKBA 4ESWA 1OQHA 2Q8JA 1M5EA 3M3FA 2IP2A 2B3FA 3J80K 3SEYA 2H4IA 1P2FA 2RV8A 2EFWA 3U9GA 3IB2A 4FORA 4DXBA 1H43A 4AD9A 2DI3A 1MGTA 3D4GA 1R36A 1JHFA 2PQ8A 1IUDA 2I4BA 3EHSA 4HOBA 1MQHA 4JSDA 4GXSB 2QQAA 3BDDA 3MQ0A 5LLQA 1B4HA 5FLXK 2GA1A 1XC1A 1HW1A 4HQMA 3GWZA 3HSRA 1H3DA 1LAHE 4G7HF 2DWIA 3HSTA 4OHNA 2W7YA 4ELRA 3JZJA 2JZYA 2MLGA 3HHGA 4ENJA 4R75A 4R72A 3RTWB 1JEVA 4ECFA 4R2BA 2LNBA 3RKYA 4I9DA 4CZZA 3WGIA 2XV4S 4QFNA 1FBQA 2XHKA 2DW4A 4HLXA 2F5FA 2DQRA 3VEPA 3VLWA 3TCFA 1VR5A 1B6HA 5TRDA 4S05A 1ZG3A 3MWMA 5E8IA 1MPBA 2AIXA 4RYAA 3SERA 5I59B 1SD4A 3F72A 4HW0A 1MG1A 1I6QA 1CB6A 4RPOA 5CRYA 2AL5A 2LF8A 2DYXA 2F97A 2BJJX 3Q28A 3I58A 1PC3A 3CUQA 4HF0A 1ZGAA 1QGPA 2H6BA 3R61A 4A0XA 3C34A 3LA7A 4ZYGA 4LJZF 2UVGA 2EV5A 3M9AA 4BYYA 2V79A 4OIRF 1CGPA 4I98B 2ALUA 2QBYB 2O68A 2Z8FA 2Q8KA 5DVIA 1NH7A 3SDFA 2QWWA 3TQWA 4HLYA 2ZNTA 3DELB 3KBRA 2BYVE 5H8SA 3MWBA 3WTWC 5AIPA 3TDUC 3QPHA 3PMXA 1P6RA 2D45A 1TFAA 1LJ9A 1EH3A 2IRFG 3QUJA 4FIMA 1T39A 4KNYA 4QF9A 4UNOA 4OZ9A 2BBYA 5JI6A 5FHNA 4F39A 5H20A 4HF2A 5JEIA 1XOCA 3BPXA 1RI7A 3UORA 2XUBA 1MPDA 3EHUA 4TLMB 1FY7A 2ZKZA 4R74A 1OR7A 1EV7A 4Q4ZF 3O6HA 4GCVA 5FD5A 2HYFA 1YO5C 4LLNA 5H8NB 4U0VA 3HHHA 4K2EA 1D3YA 4HS7A 1DDNA 4UV9A 3HN0A 3PV0E 2X7PA 3TPAA 3B73A 3Q29A 2DVCA 5DT6A 4LA9A 2A5SA 2F5EA 4AQ4A 1XGNA 1JW5A 6PAXA 2QJEA 3C4MA 3V4GA 2Q2AA 2Z5UA 2BE5F 3ZN0A 1FQBA 3F8BA 5LHHA 1FP2A 1ZRDA 3C9HA 4KN7X 2FMLA 3CLOA 1UCRA 3KP5A 2OWSA 5JK4A 1ZREA 4IRGA 3M8FA 1R1UA 2YPRA 2XXRA 4E0WA 4MQVA 2ZCWA 4L0ZB 1HKQA 4C1TA 1BIBA 2XAHA 3V8JA 1MQIA 5FB2A 1O3RA 3TUSA 4JWYA 4Y13A 3KZGA 3SEUA 3KN7A 2DQLA 1EZOA 1H45A 2ZNUA 4F22A 3WTSC 4Z7EA 3IWFA 1G3SA 3O2PE 3E5QA 5FGMA 3FVOA 3SZPA 2PMHA 4LGWA 4MTDA 4YFKF 1IXCA 4BHPA 5ED4A 1TLHB 3EDPA 4NMYA 2F2EA 3GO5A 2HXWA 4G4PA 3H3ZA 1S7AA 1XMAA 3PPOA 2VC0A 2VT2A 5LEKA 4ISUA 5ILSA 5I59A 3BJ6A 4YKPA 1P1WA 1MD0A 1KYWA 3S9LC 4BHBA 2FRHA 3E9XA 2ZYOA 4CGZA 2C6YA 4KCCA 3R26A 2F7CA 1TQPA 3K9TA 3ZMSA 2DE3A 4OQOA 2EFOA 3KOSA 1D8JA 1CE2A 3DQVC 2GHAA 5DEXB 4RK2A 4N9HA 5ISUA 1MS7A 3MAJA 2XXQA 3F8MA 3TEPA 2UYFA 5H8QB 2GFEA 2QS4A 3RY3A 3R0JA 4ELQA 4ESBA 2H5YA 1FNNA 2PBIA 3OSQA 1AH5A 4QFLA 1W5SA 4NF5B 3G3FA 4Q5SF 4M73A 1F4KA 1MDP1 1AWCA 1IIWA 2Q9TA 3M3LA 2Y7KA 1FQDA 3RQTA 3ISPA 4XBFA 3EPEA 2GXGA 4EM1A 2IW5A 2M1BA 1VSOA 3CUOA 1S8NA 2MH2A 3H7MA 4IJAA 2V6CA 4E0XA 4ZYEA 4F3SA 2P6SA 4GLIA 1YG2A 3LSXA 1YPNA 4FEDA 2K86A 3DP8A 4I09A 5BMZA 1OLAA 2PN6A 1Y1ZA 3JTHA 5H8NA 2NAZA 1IN4A 3LC8A 4G68C 5CVUA 4U7DA 3K0VA 2GIVA 3VVDA 1R5HA 3FWEA 2B3BA 1DMBA 5E1XA 1D5VA 1URSA 1ON2A 2A5TB 3ELKA 4GVOA 4RGRA 4MQ9F 5CVVA 4FAJA 2ESHA 2EA2A 3GXOA 1FCKA 3TCHA 2DE2A 2DWAA 1MXVA 2OU2A 1HSJA 3UIFA 4O5VA 3JAMZ 1K79A 3GW2A 1TXFA 1B7UA 1QPMA 1J0RA 4IF4A 5HS7A 2FBIA 3CFZA 2XAGA 1WQ2A 1MY3A 4PFUA 4NTLA 3WGHA 3LAPA 3G3HA 3T9VA 1BOAA 3TGNA 4EMSA 4KD5A 2IA2A 1UIUA 2CGPA 4ZE9A 1V4RA 4IY6A 4HX4A 3ABTA 2VBXA 1NNPA 2W25A 1NNTA 1A99A 1B9NA 2A6EF 3FZVA 3DM0A 3EQ1A 4U4XA 4ONYA 5LGUA 2DLLA 4LZ5A 5ICEA 2VXZA 1R6ZA 5DDGA 3M8UA 4KIGA 3V7SA 2J5PA 3I71A 3CO6C 2UVIA 2XX8A 5DV5A 4MFIA 3CG3A 1ZJLA 3IJXB 2EJRA 4G2ZA 5CMKA 1SDXA 1HKTA 3B6WA 4OTEA 3E6DA 5ERIA 2A69F 1PDAA 2HAUA 3E5XA 1XDUA 3NQOA 2Z8EA 3S2VA 4U88A 1NHAA 2HQNA 4AVPA 4M9ZA 1PBPA 3O66A 1IN7A 4QSDA 2QVOA 4PP0A 4OINF 5DEQA 3MP8A 4DCYA 4RJZA 3ZP5A 4IO2A 1MXZA 4L9TA 5HVQC 2PBWA 2DT5A 3N6TA 3L7WA 2HR3A 2V1XA 3EQLF 5ITOA 4LD5A 4KMFA 3FATA 4A6EA 3FD3A 4HYEA 1FT9A 1AL3A 3PPNA 5H8QA 3HRSA 2Z33A 3PD9A 1LCFA 3FGSA 1UFMA 4EQBA 5DCFA 3IRRA 1MXYA 1SMYF 2I48A 1QUJA 1SFUA 5K5OA 3LSLA 5B70A 5HDGA 2W24A 4IHSA 2EFNA 1FSHA 4NF5A 4MEYF 5J8CA 5HDKA 3FV2A 2PI0A 4OESA 1XGOA 2L02A 1B5IA 3BFTA 4ZYDA 1B0LA 1P1NA 4KYDA 5F1RA 1MJ9A 2X7QA 1A8FA 2Y75A 3BP8A 3AXFA 4BDOA 2CMOA 4G68B 3F6OA 4O3MA 3KP2A 4IO5A 5L3CA 1DTZA 4P55A 5AONA 1F9BA 2Y7WA 3SZTA 3F3XA 3FVNA 4I02A 4OWDA 5H8FB 1P99A 4P9UA 3U92A 1W4MA 3TO7A 1FQCA 1FTOA 1Y9UA 2F34A 4EGZA 4XKRA 5FHMA 3K0LA 2CYYA 3O97A 3C18A 3PUZE 3VDFA 2AS5F 2V3UA 2MA3A 4JDFA 1Z91A 4GF8A 4DXCA 1Q1HA 4F3GA 3TTNA 1D9VA 3RKWA 2Y48A 3I5UA 3I5OA 4F19A 4EQ7A 3N26A 2W84A 2LF7A 1B3GA 1M5DA 1REPC 1Z9CA 2GWRA 1LBCA 1IAWA 1WDNA 3PQJA 1FLIA 4LB5A 2W57A 2L01A 1H44A 4Q8RA 2XAJA 3C32A 2K27A 3UK4A 3P7IA 1ONVA 1W7PD 3OOAA 2VONA 3D4CA 1NNFA 1IN6A 3FF5A 3NRVA 3GBAA 3JAMK 3TFLA 3U72A 5AA2D 2NOOA 2KKOA 4GRKA 3WAFA 2YX7A 2LSOA 3U2RA 1B6AA 2UXNA 4CDGA 2DSFA 1HBXG 3VB2A 1HXDA 1RNLA 4Z2YA 4YICA 2ZNZA 3O2AA 4NF4A 4U23A 4ZECA 1WVJA 1USTA 2Z99A 1MDQA 1KGSA 1G3WA 1GVJA 5ITPA 1TTYA 1B3HA 3WAEA 5AA2A 1PUEE 2FNAA 3KP7A 1FOKA 3PUWE 2E1NA 1URGA 1S7OA 2E1CA 1XGSA 3ECHA 2HGCA 4XXUA 4KR5A 4YMAA 3FMSA 3L00A 2ZBKA 1ZLJA 5KVRA 1B9JA 2L4AA 3C35A 3IORA 4BNCA 2LKPA 4U22A 5F7VA 3Q9VA 1VTNC 2I3WA 4CICA 3E6CC 1N76A 1SVXB 1HW2A 1A7LA 5A2QZ 1GVCA 3VODA 3WTTC 5KZTA 1TT1A 3PMVA 2HTJA 3HOSA 4Q47A 3EF7A 4NHJA 4HW8A 3F11A 4PE5B 3FJGA 3ULQB 3O3KA 5A5XB 1J1NA 3KN3A 2NUVA 4NWDA 3H4ZA 4WXJA 2Z3YA 3KSXA 1S6LA 1QZYA 1KA8A 5D5VB 3MVWA 1S29A 5CYVA 3SFZA 4OIPF 1IXGA 4ELOA 4RB2C 2F5DA 3R7XA 4G68A 1DTGA 1GXPA 3HSFA 2OLBA 2DTRA 4O3CA 3H3UA 3PPPA 1R7JA 3HTUA 3FMRA 2VN2A 5H8FA 4DCXA 2P6TA 4O6JA 1R5GA 4HV6A 2K7LA 1N3XA 3WTVC 5IAIA 2HYGD 2OZZA 1Z7UA 1EH6A 1G4DA 2O69A 3IJOB 4GL0A 1BBYA 2NNYA 2W85A 2VE9A 3L6GA 3GFLA 3RDIA 2OWTA 1LEBA 1J5YA 1FQFA 5L9MA 2EB7A 3KFWX 3V8LA 1JQFA 4JBZA 3H06B 1Y20A 3SXYA 1D4NA 1PB7A 4MLVA 1IF1A 3QU3A 1OVTA 5L9OA 5CM6A 3QAXA 2QUFA 3DKWA 2Z8DA 5ICQA 2ONSA 3KN8A 1B9MA 3VFZA 1R00A 2P5VA 3CI8A 3RT8A 2L3DA 1OKRA 5CVIA 1EZPA 2MBFA 1SQYA 4HQEA 4I62A 3WTZA 2ANJA 2GA2A 1J59A 1L3LA 4DE8A 3F22A 4QSEA 3ZMTA 4OXVA 3HV1A 3QU6A 2JT1A 2GXBA 3RPWA 3FM3A 3SKPA 2JPCA 4KQPA 4R2FA 5D5WB 3LR1A 2ISYA 5E1WA 1H0MA 1ZAOA 2E1SA 2MH9A 1WI9A 4NF6B 4G6QA 2IA0A 5D5UB 2YJPA 4Q0CA 1I6XA 3WTUC 3ERED 2KIMA 2XIGA 4B8XA 2VOPA 4R6HA 5CMBA 3K2ZA 5I58A 5D4RA 2FA5A 4G8HA 4GD5A 2H9BA 4I1DA 1RUNA 4KICA 3JV9A 3V83A 5I2NA 3LQQA 4XLPF 1SW4A 4LMYA 3USDA 5KCJB 1TWYA 3AAFA 3SHFA 4EF1A 4ON0A 1SW5A 2QM3A 4R9FA 1DPEA 4C0RA 2P5LC 2VT3A 4OIOF 5AIQA 1A8EA 1ZH5A 3O9PA 1H9TA 2V25A 3BOQA 4NE4A 2IT0A 4N0BA 1ZG1A 2O1LA 3GBBA 4IO6A 1ZARA 4UUVA 5A5XA 2ZXTA 2M87A 3Q25A 4KPTA 2V93A 5A2QK 1MDMA 3A09A 4KYSA 1XD7A 1XCBA 3NEUA 3CO7C 1N84A 5DD8A 1QW0A 2M5WA 4L9JA 4F7ZA 1HSLA 4A12A 2EFQA 4EUOA 3EETA 5DCMB 2YPNA 4ASNA 1SFEA 1GR2A 1G6NA 2K4JA 4L5JA 4G9YA 5E18F 1POY1 4RAYA 2A6HF 3MP1A 1FQAA 1POTA 2FBHA 2PMUA 3OO7A 3J7AO 1TBXA 4H1XA 2E7WA 5HLHA 1FP1D 3TOBA 2QPQA 2P7VB 1P4XA 4YU0A 3ABUA 4M72A 2XXPA 4RGUA 1BI2A 4HX7A 4OMBA 4FX4A 4HF1A 3WTXC 4EQQA 1C0WA 2UVHA 2ADUA 4F1UA 1ZU0A 4PFTA 4GGGA 4H67A 4LLGF 1MM6A 2WC2A 3GEZA 2EK5A 3JSOA 5CVJA 2E7XA 5TU0A 4P5OA 5HS9A 2P8TA 1ODDA 4WEPA 3K1NA 4U7BA 1ZG5A 1B1BA 4YKIA 1MXXA 3D0SA 3OD7A 1O3SA 4UV8A 1IXRC 4Q5TA 1BLFA 1UTHB 4GQOA 2Z23A 3FXQA 4WX9A 3G73A 1BTJA 2KJBA 3KE2A 2HAVA 4X1BA 1GHCA 1IRGA 4NF6A 3E5UA 1QJMA 1SW2A 3OO6A 3F21A 4A0ZA 3F8NA 3CTAA 3TTLA 3TTKA 1T38A 3WGGA 5TP9B 5LOMA 5H6QA 5L3GA 4KYWA 2HEUA 2DK5A 1D9YA 1I69A 3IOTA 1ZKBA 3FHZA 1Y4CA 4TLLB 2I0CA 3SEXA 3KEOA 1DSNA 2X0LA 3QOPA 2XXUA 5KCJA 3MCZA 1LCTA 2REJA 1B1HA 3P9IA 1N04A 5BPIA 2OZ6A 2XXWA 2NS0A 3RJPA 3U94A 3U1DA 1I27A 3V7RA 5JTYB 1OYIA 5IT3A 1TW3A 3PU5A 2XD3A 1ZLKA 2O6AA 4MF3A 3EN3A 4QRZA 5I57B 1UQWA 4OFLA 4AB6A 3VV5A 2Y0MA 5D4SA 2M30A 1SAXA 4L18B 1SFXA 3MVZA 4LONB 1RZ4A 1USYH 3K2DA 5JHUA 1EU8A 2D3IA 4LQ2A 4F2QA 3PGFA 1FTKA 3IOWA 2X4HA 5LBQA 4LG0B 4OEVA 2TDXA 3O6BB 2QENA 4M9XA 5E17F 1R9QA 2IJLA 3MVYA 3GUDA 1IN5A 5D8LB 3QP6A 1T0KA 5EEHA 3KETA 3OSRA 3JW4A 4H5FA 2BGCA 4ZH4F 4NF8B 2J5OA 1P4AA 4I7HA 1L0OC 1M5BA 5LEJA 3N97A 3DPLC 4WCGA 2CO5A 3KP3A 2JSCA 3PQKA 1PB8A 3O6IA 2FNPA 3OO9A 2I6EA 3W15C 3F8CA 4BDRA 1LSTA 2H6CA 1ELJA 5ICGA 3ZPLA 1GGGA 3RI4A 5CBSA 1T0FA 1YCJA 1I5ZA 4ZEIA 1E17A 2QBYA 5KDTB 1N7WA 3L6HA 3HHFA 3IKTA 3LUYA 2QQBA 2EWNA 2V9VA 4RK9A 4JSOA 4R1HA 2FXAA 3U8QA 3SEWA 4DZ1A 2O61A 1QULA 1FX7A 3BBRA 4ZS9A 5K2XA 3HUGA 2Q0OA 2IPQX 2JRTA 3I53A 3EYIA 5CMMA 2D2WA 1SW1A 2CW0F 1B58A 2M8CA 3KEQA 3FVKA 1KYZA 2CSOA 3LSTA 2O51A 4ESFA 2FOKA 1B52A 1UTHA 2REGA 2XX7A 4U0WA 3TTMA 4RAZA 1IRFA 3T9XB 1UTBB 4KFQA 3IOVA 2Y7IA 4GL8A 4U0YA 2G7HA 4OEUA 3VLUA 1LFHA 1PBQA 3R4KA 4HCWA 5FTIA 3H6VA 2NYXA 1R23A 1ZHFA 4F29A 5TP9A 2K4BA 2R71A 4XKPA 4LK0F 1B5HA 2DO7A 4ZEBA 2Q89A 2XRNA 4E70A 4Q30B 2ZYMA 3GLXA 2DBBA 1LBBA 3TOAA 4HTGA 4GIZA 2RQPA 1O7TA 3WE3A 1F1ZA 4BXUA 4LZ8A 2XVCA 3GVAA 2ISZA 5ILVA 5JTYA 4RS8A 1JGSA 5HLGA 4LATA 1UHWA 2O0YA 3HO7A 4ZZDA 1K6OA 5LHGA 3CFLA 4A2UA 4UVBA 3BY6A 3OENA 4OVJA 4MLQA 2GRVA 5BUUA 1IITA 2WTEA 4X1DA 2G9WA 3P9CA 3LBSA 1P4WA 3ZMZA 4LP2B 1Y4TA 1R1VA 1B2HA 2PLYA 3MVXA 2VODA 1FYMA 1MH4A 4I8CA 2O6GE 2XASA 4MBPA 3F6VA 1A54A 4GXAA 1ZTYA 4QLCU 2FYIA 2EA4A 4M4GA 5CI5A 1B40A 2A3SA 2HWVA 3FX3A 1BP5A 2OJTA 4ND9A 3DP7A 3QSLA 1UIVA 3ODBA 1LAFE 1QNTA 2ZXJA 2V3TA 3WODF 3KLOA 4M74A 2GHBA 1T2KA 4G8XA 1B5JA 1QUKA 2RINA 1LEAA 3ZKKA 1J9IA 4LVQA 3DP6A 4RGXA 3KZYA 2FA7A 3KOTA 5DEXA 2XAFA 3GZ6A 3C33A 3CG1A 2QMWA 4YAHX 5KDTA 4QWQA 3KZZA 4L9VA 4HDUA 1OYWA 3F8FA 4AB5A 1MRPA 4ELPA 1KU2A 2O84X 2HCAA 2RC4A 1J2XA 2QRYA 1PB9A 1II5A 4R6KA 3HCQA 2OQGA 4JB7A 2WWYA 3GZ5A 1N0TA 3TTRA 2VD3A 4PCQA 4G94A 4AIHA 1R58A 2ELHA 2GAUA 4KMUX 4RB3C 5D6EA 3T22A 4PQJA 5DVFA 4N9IA 4EVIA 3FXUA 4OETA 5FD6A 4OMYA 4XTCQ 3HSEA 1LAXA 5CJ9A 4U21A 2OA4A 2ZO4A 4HBLA 3PD8A 3BFUA 1XCVA 3GLBA 1U5TC 4X9TA 1N3WA 4YB7A 3B6QA 1QQIA 2STTA 3K6UA 3Q27A 3GFIA 3MW0A 3KP4A 2Q88A 3HIFA 3LSFB 2QLZA 3GX4X 4EJTA 3S2WA 2UXXA 3DF8A 2KJCA 4IRHA 4P11A 1CF7B 3E4RA 4YB6A 1T98A 4YZZA 3M8EA 3DEUA 2GZWA 3E97A 1DPPA 3QK6A 2A5TA 4GFRA 4IRIA 3S9NC 3ROUA 2KIFA 4PZJA 3I6VA 4MEXF 3K01A 2CFXA 4GWOA 4M6XA 4O3BA 1ZMGA 2M45A 1SD6A 1BJAA 5J6XA 5FFZA 4POWA 3SESA 4P0IA 1EZ9A 4XRFA 1B4ZA 4FEBA 4RPNA 3S9MC 1LQ1A 4R79A 4H0EA 4OFJA 1O64A 2DP8A 5IT9Z 1TFDA 4L5IA 1QO0D 4MGRA 5BPDA 3MC2A 1GXQA 1MXWA 3CSBA 2Q2EA 2DWHA 1S50A 3U93A 1Y0UA 5ICTA 2Y7RA 1QUIA 4C1UA 4G8NA 4OOIA 3KGCA 2DU9A 2FQ3A 4KIBA 3K6WA 4TOZA 2ONRA 1HSTA 2XXTA 5JR3A 5ILUA 3VE1B 3FJ7A 3IX1A 3I64A 1XB4A 3FXRA 5FFXA 3IB1A 2R3SA 3IK6B 4XSZF 4JWOA 2DPUA 5K5QA 3TYHA 3MPKA 4QHQA 2MC3A 5HM4B 5H8HB 3LSWA 1NMUA 2DAOA 1BC8C 3C7JA 1B05A 3KFMA 3FM5A 3R6UA 4LZ7A 1JW4A 1XN7A 4OYVA 2HEOA 3E6BA 1IXSB 4EXKA 2OD5A 2XD2A 4GO1A 5DUKA 4FECA 3M3KA 3MQ9A 1B51A 2F6PA 4ENKA 1G3YA 3FJMA 1VE4A 3IKVA 4QSCA 2Q2CA 2XHDA 3HRUA 1QZZA 1NNKA 1B3LA 3IC7A 1X3UA 3K00A 5J1DA 1JW1A 4RB0A 1R1TA 3N94A 2O7IA 2QZ8A 4G7ZF 1I6AA 1U5TB 3LWFA 4KUMA 1DPUA 4L0YB 4EV0A 2P5KA 1A40A 3UA8A 3ZMDA 2OAZA 2RVCA 3HTSB 4P96A 2ONKE 2I3VA 4DDDA 5K5RA 1QKAA 1K7AA 2RC9A 2QS1A 1DPRA 3KJTA 3F23A 3MJNA 2VC1A 2VBWA 1PEBA 1F9NA 4ZZLA 4HA8A 5HPQA 2ZMEB 4L17A 1HW5A 3KEIA 4Y17A 1IN8A 4U2RA 2A68F 3T96B 2ETHA 3R0AA 4JQFA 3O28A 1WKMA 4KCDA 1WWXA 2R6GE 1M5FA 5I56B 1OMIA 1MZBA 3RKXA 2DQVA 1U6GA 3IRQA 1B32A 2RCAA 3IB0A 2VBZA 3LA2A 3TZAA 5EHMA 1U8RA 3C1DA 2MD5A 4LFUA 2A61A 4DNCA 1P1OA 3KLNA 2I58A 5AA4B 3CUQB 3SETA 1U78A 1LB9A 1LGBC 4I0AA 4PDKA 3P9KA 5DD4A 3CSGA 3U1OA 2RDPA 4EJWA 1B3FA 2F5XA 3H3GA 5I2KB 4HZFA 1KWHA 3QYTA 3MZHA 1SD3A 2HFBA 3SQNA 1SYHA 1KQ9A 2QS3A 2D1HA 2FEZA 4H8JA 1MY0A 1D3KA 2P4WA 2WKYA 4WXDA 2P2AA 1FTJA 2OBPA 3OELA 2OZUA 2O3FA 1O57A 3L2CA 1MJBA 3S4UA 5IT9K 3EUHA 4IY5A 3RLFE 5DYMA 4IO4A 2L54A 1RYXA 3C36A 1O3QA 1AMFA 5K1YA 5IKBA 3T5XA 1AOYA 3I3VA 5HS8A 2CZLA 1J75A 1Z6TA 1B3EA 3RTRA 2L4MA 4HAMA 2VBYA 2DPDA 3TO6A 2XXYA 4POXA 4ZE8A 2OCUA 1FTLA 4EM0B 5ICFA 1F5TA 4QFPA 3T8TA 4R9GA 4UACA 5H8HA 3KG2A 4JBAA 4G6DA 3QUFA 1KU9A 2XGXA 3K4UA 4KT5C 3W6JB 5D6FA 1JXSA 2P1SA 5L3DA 2VP1A 3T0YA 1LNWA 5LGTA 1BI3A 1P1UA 5DVJA 5DYHA 4D0PA 2H94A 2DWJA 2HZKA 4LLLA 1Y3PA 3MAMA 4M6YA 3H92A 4EJOA 3WU1B 4IHTA 1A55A 3THIA 1SD7A 2HZLA 1E2XA 3N5LA 4BDQA 3P7NA 2HZTA 3I59B 2XROA 3WE2A 5EEGA 2HQ0A 1IZ1A 2NRAC 2F35A 1O63A 2UXAA 4KN4X 3LAJA 2E0SA 3ECOA 1U5TA 4KFCA 3VXCA 1XSVA 3UGWA 2OQRA 1IXIA 1LVAA 2VD2A 2ZNSA 4UVCA 3W9WA 2PX1A 2O8XA 1UB9A 4ZYHA 3B02A 3MPLA 1OYYA 3CJNA 2YX4A 3T9HB 1O3TA 3B6TA 2IEEA 3LFKA 4U1ZA 1XS5A 1O7FA 2ZMEA 3OEMA 4O3AA 1R9LA 2COMA 1XVYA 3DXJF 1LLSA 2HQRA 3ECRA 4CHUA 1HSEA 2NXOA 4EQ9A 5AA3A 2WV0A 5I56A 1T6SA 3HOTA 2DVZA 4OIQF 4RNSA 2H99A 1FYKA 4G77A 2DK8A 3UN6A 3V5AA 4M1VA 1YS6A 2HS5A 3GZGA 3H03A 4YIFA 3G3ZA 3QPTA 5AA4A 4IGTA 3OEKA 2XX9A 5JVTA 3T93B 5F64A 3B7DA 2I4CA 1N7XA 4R6YA 1US4A 2FF4A 5E1ZB 4K3FA 5I2KA 2R7FA 3EHTA 2GQQA 5D5XB 4F3PA
chains in the Genus database with same CATH superfamily
2ZMBA 2VOZA 1IJWC 5B1AH 1UG2A 1YXIA 4ABZA 2DFIA 3TELA 3NWSA 2KR0A 1OFCX 4TQUQ 1O4XA 1TNSA 2H98A 2OF7A 3G4SI 2DOJA 1ZKGA 4LITA 3K4JA 3K6VA 1NV6A 4JVIA 1YLFA 3FUZA 1WHUA 2BV6A 2M8EA 2CFOA 2QSGX 4UB6C 2R4GA 4OMZA 3N6UA 3KX2A 1MIJA 4N81A 1ZLQA 4J01A 3K4NA 1PP8F 1YQAA 3OOUA 4RB1A 1MY1A 4BHCA 1RUOA 3MZ1A 4I0BA 3WU0A 4EF2A 2ICWG 1R9TJ 4YFXF 3E3KA 3CIJA 2HOAA 1NL5A 3DBHB 3M1CA 2ZJPF 2HDCA 2FU4A 4QFKA 1K78B 3U1KA 3PL8A 3MEXA 4FTHA 2X9DA 4IPAA 2XPUA 1IMCA 4PBHA 2LDUA 1MQDA 3M1EA 3PMWA 3BR2A 1S7YA 3BTCA 1SFOJ 1Q35A 3RNNA 4N8GA 4ENNA 3GFMA 4HV5A 3GF2A 1NK3P 1JUMA 4LB6B 4I01A 4JWXA 4A93J 5LRSA 3Q5FA 1JTXA 4A3EJ 3C3WA 3CP8A 5HOOA 3W6VA 2OK2A 2RC7A 2THIA 3BKIB 3E6MA 3TDJA 3JYRA 1R22A 3W9VA 1TW2A 4BS9A 5M3FJ 3V7CA 3ZOBA 3S3OA 2QKMB 5AA1A 3FISA 4X48A 2FBPA 4XKNA 2VPOA 3HKZN 2MD0A 4F92B 1BKAA 1LB8A 1LAGE 3ZRGA 2UYEA 2QSXA 3E3VA 2ZJQF 3K4LA 3I59A 4XIGQ 3DTEA 5E3LA 4R8HA 4A5NA 1ZN2A 4A3BJ 4L5EA 2VL8A 1LE8B 1OPCA 4FATA 1P7JA 1Q1KA 4DGWB 2IGMA 4KJZA 1EJ9A 1R1NA 4N4UA 2ELKA 4OVRA 3FXOA 2ZFWA 3W6KB 2AL4A 4ESJA 2RKMA 1FBUA 2W7NA 3W2AA 3O6GA 3M7GA 4P1WA 2K3FA 3QYFA 2CQKA 3R6SA 1ZGJA 2PG4A 2Z9OA 2VUMJ 3S16J 2IS2A 1FYLA 1DOTA 3KJ7A 5T3JA 4CYCA 3PFIA 4EXLA 1YW9A 5DCMA 4PE3A 5IP9J 1WH5A 3RN8A 2NVXJ 3MZBA 4LQ2A 1RR7A 3BWGA 4DBQA 1MH3A 3L1PA 4BAYA 3OXNA 4DYRA 4U1OA 4M3GA 1ON1A 3FDYA 2VKVA 2R7DA 3QOEA 1BI1A 3TQLA 1D5YA 3W2VA 1A31A 1USSA 2RNJA 1X1CA 3CR9A 4XQFA 4X0GA 4E7SA 4ESXA 5TPAB 1MY4A 1DK4A 5GAEJ 4A3KJ 5L3BA 3CDLA 3ZN1A 4ZEKA 2ACJA 2HKOA 2O1MA 1YYVA 2K9QA 3HB9A 1XSXA 1MMDA 2V1UA 2ZXHA 2HOEA 4FJPA 5BOXA 4IO3A 4BDNA 1FTZA 1NG7A 4PAFA 4R73A 1FPQA 1H88C 2DA6A 3D5LA 1G2HA 4DI4B 4X8RA 2O7OA 2I0BA 3RGYA 5K2YA 1ATGA 5J1YA 3KYLA 3HOUJ 2F5VA 2ID6A 4EGYA 2EV6A 2CMPA 1U2WA 5BS6A 1LBVA 2G0EA 5HBCA 2I10A 3J7AY 2IA4A 2YU9J 3G3IA 4LQ5A 3PUXE 4RA1A 3BROA 4IXAA 1LBYA 2EILH 2VOOA 1BA5A 1I6HJ 4V2FA 5HLIA 4FETA 3TO9A 2Q1ZB 4BE1A 2DTZA 2NOGA 1IO2A 4FE7A 2LKSA 3GYHX 5IZ3B 3G3KA 3T66A 1TQMA 3S8PA 3CVGA 3IO6A 3HPHA 3K6XA 1Z05A 1D0XA 1W36C 2YUSA 4KHZE 4WXHA 3J81Z 4BQAA 2RF1A 3LV0A 1YW8A 4GXOA 2YSRA 4H5GA 1JNFA 2VGQA 2JTVA 1JUPA 2I49A 3M07A 1V5EA 4WK8F 4D1QA 3K1MA 1FQEA 1OQGA 1BIYA 5L9SA 2JMWA 2RN7A 2E34A 5D8KB 1ETYA 3RYRA 4UHTA 4OENA 4F18A 4KIFA 4PUSA 2V9PA 3K10A 1FMVA 3V8KA 3ZMUA 3CDHA 3G3JA 2IA1A 4KDPA 5FKKA 1BN5A 3K4BA 2EIMH 3EUAA 2ZYKA 3HPGA 3PM1A 4PFYA 3FXKA 1JTYA 3ZCOA 1MNEA 2PFZA 3CZ6A 2F78A 4RXLA 3DFGA 3OIOA 4WWCA 4OFOA 4M6VA 3D1NI 4EDPA 3VFJA 1K78A 5IP7J 1W5TA 3QWLA 4XONA 2XKPA 3K70C 3BG7A 3R60A 3REOA 4F52A 1KA0A 3OYNA 1FW0A 4H0WA 4IB2A 1VFEA 5B7DA 1RESA 4HNUA 4GYIA 2F6CA 1Y56A 1VFDA 3BTIA 3DLNA 4ENMA 3EPZA 2WA0A 2ZSHB 5CVRA 1KU7A 4MNPA 4HX8A 1IMEA 3RUMA 3A3UA 2F3DA 4QFOA 2HPIA 1MXUA 1CQTA 1MPCA 4ZEFA 1LDDA 2DA4A 4HCYA 1VQ6I 3ML6A 2R7ZJ 4NC8A 2HQAA 1FJLA 1VQ8I 1MY2A 5I57A 1JEUA 1MNDA 1M1EB 1WCMJ 3I55I 3SEZA 1ZR4A 1DUXC 4KI0E 3O29A 2HTSA 2CG4A 2L0KA 2LOOA 3H9JA 2GH9A 2NWJA 4IVNA 4XKQA 2HOTA 3QXMA 3Q9SA 3TAJA 1ETWA 5FTHA 5M3MJ 2ZYNA 3BQYA 3T9UA 3QAHA 3GTGJ 4GOTA 4L9NA 1DGWY 1Z77A 3A0BC 1HLVA 1BM9A 4Y15A 1EH8A 3HYIA 4OU0A 2WY7Q 4PGGA 3KYDB 1LDKB 3DKXA 4LG0A 1ZBMA 2PT1A 4IGRA 2L9NA 1TNTA 1PYVA 1UZCA 3FK6A 1Z7NE 3BJAA 2CZKA 1XMKA 2FMYA 2YR2A 3LSGA 1B7HA 4P3LA 3ZKLA 2X85A 2M0CA 1XDSA 3DV8A 1GV2A 4PCDA 1R5ID 2Z2SB 2K40A 3PUVE 4P9FA 1S3JA 3WG9A 4G7OF 4F1VA 2FNCA 1P7IA 2RGVA 4AWXB 3S2DJ 1MQJA 1LEVA 4PTKA 1Z7ME 4NF8A 4FT8A 4DBRA 3IAM2 3PNTA 5CMCA 1IW7F 2RC8A 2STWA 2XXHA 1H9GA 3Q0VA 2UVJA 3P5JA 3LSPA 1MJAA 3EUHC 2QF7A 2NVQJ 4Y33A 3MMYB 3JTGA 2X26A 1RDYA 2XWVA 3G7WA 4I3EA 3IO4A 2IGKA 1IEJA 3C2HA 3VXBA 1B1XA 3MBPA 1W7PB 5TPAA 5E20A 3H3VK 3PPQA 3T8RA 2F7BA 3BT9A 3FIRA 1NTCA 2D21A 2WAEA 2UZKA 1NV1A 4NF4B 2VJJA 4H6DA 3Q26A 3IL2A 2QQ8A 4M71A 4XLCA 1QBJA 3MZYA 3G71I 1FBSA 1WSUA 5AA2B 4B09A 5CBRA 2CWEA 1FEXA 4BLAA 2XXIA 2ZNYA 2CZHA 2EIJH 3PUYE 1UHMA 4XLNF 4IKFA 5DTDA 4DYCA 1B46A 1NFTA 3S93A 3FASA 3B8BA 3MKLA 1U3EM 1B7ZA 4GWYA 2R5YB 1URDA 1RKTA 1LFGA 2AYSA 3VYUB 2E2HJ 2EFPA 3N4MA 1Y8QB 3H6WA 5KK1A 2JA2A 3PPRA 3IL1B 3VVFA 1M5CA 1T8IA 3C2BA 2K9LA 3L2WA 3WTYC 3HOYJ 3I54A 1T56A 4XNFA 4TV7A 4MNCA 3AG4H 1TZLA 2KRCA 4XKCA 3W3CA 3OMBA 3BR1A 4WF2A 1SC7A 4A0YA 2IVMA 1JVXA 2BJIA 3TKYA 4BEHA 2PYYA 3OO8A 4MNUA 4LUBA 2QVRA 4P1LA 2XRLA 2GM4A 4JOMA 9ANTA 3CCLI 3KSJA 2PVUA 4YIIA 4N07A 5IZ3A 4OVQA 5ICCA 1NH8A 1NUXA 1XT8A 2FSWA 3SYTA 1S9TA 2UWMA 1UTBA 1MNMC 1JVYA 4GRIA 4A6DA 2F6GA 5DUIA 1EH7A 1LB2A 2B0LA 2HHMA 2B9SA 1D8KA 4FX0A 1XHYA 4EM2A 4ZDMA 4UVAA 1H76A 2WAFA 1GV5A 3JSPA 1FTMA 2H27A 1OIBA 1VQ4I 4G8MA 1X19A 3I3LA 1JE8A 2HQ5A 3L9FA 4PAKA 3J81K 1FPGA 2HPMA 1VQ5I 1ANFA 1BK4A 1RKMA 4CO8A 4ZZEA 3EYYA 2HDDA 1XMXA 4CXFA 1FBEA 2OBGA 5CC2A 3PSIA 1SBPA 4F31B 5JFRA 3OOPA 2COBA 3ZQGA 4DZPA 3RPUD 1IMAA 1JKOC 1NKXA 5DTBA 2LH9A 4F1YA 4N4OB 3ZMVA 1WODA 4XOPA 4I2OA 1PDNC 1D0YA 4NWCA 1BR2A 4NN3A 4PETA 3GXAA 5LGNA 2ZJ2A 1NV3A 2HXRA 3MFKA 3OSGA 2XKOA 4LN5A 3QRFF 1STZA 1E0EA 2CW8A 2BEOA 1YS7A 4WXCA 5CLSA 1HKSA 2NNNA 4MFEA 5B1BH 5KHDA 3OYMA 3VDXA 1QU3A 1GTKA 4WEDA 4F3BA 2QQ9A 5GAHJ 3OV8A 1IRXA 2QYOA 4XKBA 3ILUB 1MW7A 3HM5A 3L09A 3OYLA 1HQCA 5F1QA 3BPVA 2WEFA 3CJQB 4XLAA 1P92A 1SMTA 1B0HA 2UV1A 3RPUA 5KNLA 1OCCH 2VHAA 3G3GA 2QA4I 4MHGA 4H65A 1L5TA 4GWZA 1YIOA 2VQCA 2R7QA 3TKDA 1LDJA 2ABHA 5DS9A 4BH9A 1I1SA 3LA3A 2WB1A 4KYEA 3BZ6A 2DDBA 2D5WA 2GLOA 3CUQC 2PX9A 5M2VA 2NVUB 3VOEA 3MUQA 4N6KA 4DI3D 1FSAA 1Y3QA 5LHIA 2DXYA 4CZCA 1OCOH 4MIJA 1ZR2A 3TODA 2LY1A 5BQTA 4DLDA 1Z67A 1XGMA 2VIXA 3S3MA 1DP7P 2DS9A 1YW7A 4M9SA 4ZDLA 2IGNA 3BTJA 5F6FA 1KQ0A 4AIJA 4NEDA 4YFNF 3CMMA 4DIQA 3FXJA 4RAFA 3E79A 1GV8A 4DIGA 5J4VA 2D1VA 3C31A 5M5WJ 3BJOA 3DLLF 2RCBA 4FCYA 4O94A 3RYPA 1YTYA 3A3CA 1Y1MA 2PT2A 3LSHA 4DXUA 1IXHA 5TJJA 4YRVA 3FMQA 4IOCF 5AE4A 2O03A 4U4SA 3CMAI 1XVXA 3J80Z 2JPBA 2OV7A 3IHUA 3COAC 3MZ9A 2HFHA 2PFBA 1W7PA 1W36D 2IEKA 1XPXA 1RYOA 5FHOA 1O7LA 2YU3A 4N4NB 4PGHA 2A07F 2XXVA 4IO7A 3GFJA 4QXDA 4THIA 4UA8A 1TC3C 4E7ZA 4WKMA 4N6PA 4FE8A 2R7RA 5I58B 2DA5A 4NUBA 4N8YA 3E13X 3O8HA 2N8GA 2F36A 1SPIA 3MSTA 4XN3A 5L3EA 3CRBA 2KRFA 3TQNA 4ZEDA 4YMBA 5FLXZ 1S72I 1A04A 1P1QA 5BWJA 5I2NB 2G93A 3OL4A 2R5YA 3TCGA 2EBIA 5EQ9A 2JA5J 2Y84A 3GTJJ 3M8JA 1BI0A 1Z0XA 4II2A 1OMPA 2L9SA 3KZIC 4QSCA 1FSEA 4RGSA 1USYE 3VLVA 2IS6A 5I84A 1QVUA 2XB5A 2KIUA 4NNJA 2KZVA 2DMPA 1V3FA 5H6RA 4HDVA 2VPLA 3L2UA 2E19A 3KIOA 3CCUI 4YEJA 4A5MA 2WY8Q 2M8GX 3HRTA 2H25A 2XWOA 2OTJI 3I0TA 1IUYA 2M4GA 2LAOA 3SEVA 3K6GA 4H8IA 4CYDA 4XSXF 2QVVA 4FHTA 4XORA 3T1BA 3WU2C 3KC1A 2VKDA 2PEXA 2YLNA 1MDMB 3BR6A 4P0GA 5EHSA 1QVSA 4NQWA 3IOUA 1SD5A 3JRBA 4E7LA 2QSHX 5HDNA 5C4XJ 1ZRCA 2FJ1A 1IV8A 2K02A 2L7KA 4ZYAA 1MQGA 4MJOA 3RQIA 2HKXA 3FVGA 2KLFA 3ABMH 3OWTA 3ONMA 2HVQA 4Q48A 3NARA 5B66C 5J4YA 1I1GA 4KA4A 1RIOH 1WJ5A 1A35A 4S04A 1US5A 2G29A 4MH5A 2XXXA 4JK1X 4ETSA 3V8XB 3CLQA 4GYGA 3HKZA 3IWZA 3TDZC 2PJPA 5L8DA 5FO5A 1CF7A 2CQXA 4JP0A 4KT6A 1FZPB 1Z7LA 1OLCA 3DLAA 3V89B 1B4AA 1KU3A 4BXFA 2K85A 3IR1A 2R92J 1LFIA 2QMXA 2ID3A 4E7IA 2QL3A 4NF0A 4RY1A 4F2OA 4FASD 3HOWJ 2F3BA 3D5RC 2QVUA 5HNHA 1TQIA 1FC3A 5EZHA 2Z22A 3H6TA 4AM3A 4LIVA 5DYHA 3JRDA 2DOEA 3LQRA 1Z6RA 4OAYA 1YAEA 3FV1A 1TWGJ 2EZHA 3WG7H 1ZIUA 1IDZA 3ILTB 5ELVA 1JHHA 4UXNA 1WRJA 2A5YB 3GTOJ 4AIKA 2PMSA 1SI1A 2RKHA 3CFXA 3H6UA 4BDLA 4Z0IA 4MTEA 4C2TA 1JETA 1MM7A 2Y7PA 4YB5A 3RT6B 4BDMA 3FXLA 3RSNA 3RKQA 1NV4A 1ZRFA 3H0GJ 2O7UA 2Y5LA 3HRMA 1ZYRF 3MN2A 2P7CB 2K5CA 1Y3NA 1IDYA 2G7UA 1BIAA 1B59A 5EGOB 1N77A 2K9NA 1KQ8A 1J7KA 4YKJA 1Z1DA 4OERA 3O8GA 3IP4B 3RTFB 5J16A 2DXRA 2V1DA 1BC7C 1DCUA 4LG3A 3IAZA 3K02A 1OVBA 4YKKA 4EJUA 2GOMA 1H89C 2QS2A 4PFWA 5GADJ 4HG2A 3GTPJ 2JA8J 1WJDA 1FWZA 2F5CA 2BY0A 2DYSH 1SYIA 1YFHA 5EYFA 3H36A 3ZS6A 1RDZA 2X51A 2BY3A 3HJEA 3A03A 4NB5A 3ZQ7A 1PP7U 1XSDA 1YTVA 2GQ1A 4JXIA 4BE0A 3KCCA 2V3QA 5L3FA 4O7MA 5J8FA 2R9JA 3TMGA 3KP6A 5E8GA 3BIHA 4ZZAA 5LFAA 3DPTA 2L5QA 4M3FA 1I6BA 1ULYA 3MP6A 3L2QA 3OMYA 5ESYA 3K1PA 3F9KA 2H09A 3K69A 3DP4A 4LK1F 4XEQA 3VVEA 3I4PA 3JRIA 1SI0A 5TP9A 3ZQCA 2FE3A 1H8AC 4EJTA 3ZSFA 2XAQA 1U9OA 1LVKA 2Z1DA 3TP0A 4IHXA 4DQ2A 1G3TA 2AXLA 3HPIA 4N13A 1JJ8C 2ESNA 2B65A 3QIMA 3S9EA 2V84A 3RPQA 1MKMA 3QP5A 2XAUA 2EV0A 2DE4A 3FBIB 2FBKA 4MLOA 5LRRA 2F7AA 2MLKA 2VE8A 2P0SA 3HG9A 1X2NA 4YG2F 1E3HA 3RIRA 4EJVA 1QKBA 4ESWA 2HVRA 1OQHA 2Q8JA 1M5EA 3M3FA 2IP2A 2QKLB 2B3FA 3J80K 1MSEC 3CHGA 3SEYA 2H4IA 1P2FA 2RV8A 3CC7I 4XK4A 3U9GA 2EFWA 3IB2A 4FORA 1YITI 1H43A 4DXBA 4AD9A 4B1RA 2DI3A 4N6DA 4ZC3A 1MGTA 3D4GA 1R36A 1JHFA 2PQ8A 2BOLA 4PJNA 1TP4A 1IUDA 2I4BA 3EHSA 1PUFB 4HOBA 1MQHA 4JSDA 4GXSB 2QQAA 5IOYA 3BDDA 3MQ0A 5LLQA 2VT5A 5I3SA 2DA7A 1B4HA 2X1DA 3E0JB 5FLXK 4NX1A 1MBHA 2GA1A 1XC1A 1HW1A 4B48A 1YHQI 3OIQA 4HQMA 2R5ZB 2GIZA 2JVHA 2L7MP 3CD6I 4GX4A 4KITB 1ERDA 2MC4A 3GWZA 3HSRA 1H3DA 2CV1A 4G7HF 1NH3A 1LAHE 2DWIA 3IH3A 3HSTA 2W7YA 4OHNA 4ELRA 5E3NA 1SVLA 2JRMA 1SVMA 3JZJA 2JZYA 4MAGA 4PGPA 2L9VA 2MLGA 3RQ4A 3HHGA 3ZQHA 2MGQA 4ENJA 1UAAA 4R75A 4R72A 3RTWB 1JEVA 4ECFA 4Y4RA 4R2BA 2LNBA 3RKYA 4I9DA 2LP0A 4CZZA 2XV4S 3WGIA 5GPCA 1FBQA 4QFNA 3IH4A 5ET7A 5DW8A 4XRSG 2AHQA 2XHKA 4M3EA 2DW4A 4HLXA 2F5FA 3VYRB 2DQRA 3VEPA 3VLWA 3TCFA 1VR5A 1B6HA 5TRDA 3ZQLA 4S05A 3IFCA 1ZG3A 3MWMA 5E8IA 1MPBA 2AIXA 4RYAA 1RC9A 4IQ4A 3FIWA 4BDZA 1RETA 4GWXA 3SERA 5I59B 1SD4A 3F72A 4HW0A 1MG1A 1MBJA 1I6QA 1CB6A 4RPOA 5CRYA 2AL5A 2LF8A 2QSFX 2DYXA 2F97A 4XM3A 2BJJX 3Q28A 3IH2A 3I58A 1PC3A 3RPLB 3CUQA 3U65A 1LFPA 3H5NA 4HF0A 1ZGAA 5LTCA 1QGPA 2H6BA 3R61A 4A0XA 3C34A 3LA7A 2KRHA 4ZYGA 4LJZF 4CUGA 3ZQQA 2UVGA 2EV5A 3M9AA 2H1LA 4GFBA 2ME0A 4BYYA 2V79A 4OIRF 1TL8A 1CGPA 4I98B 5EGOA 2ALUA 2QBYB 2O68A 1DBZA 2Z8FA 2Q8KA 5DVIA 1NH7A 3SDFA 2DOAA 2QWWA 3TQWA 4HLYA 3VYSB 1VQ7I 2ZNTA 3DELB 4E4HA 3BCAA 3KBRA 2BYVE 3FK7A 2FIXA 5H8SA 5J3LA 3MWBA 3WTWC 1FPEA 5AIPA 3TDUC 3QPHA 3PMXA 1P6RA 2D45A 4GX3A 1TFAA 1LJ9A 1YX3A 1EH3A 5DM6F 2IRFG 4MX6A 3QUJA 1T08B 1X2MA 4FIMA 1T39A 4KNYA 4B4CA 1IQ7A 4UNOA 4OZ9A 2BBYA 2DFHA 4XLEA 5JI6A 1HF0A 2PJRA 4QF9A 4F39A 5H20A 4HF2A 5JEIA 1XOCA 3BPXA 3LMMA 2LRDA 1RI7A 3CCJI 3UORA 2XUBA 1MPDA 1EA3A 4HEA2 3DPUA 3EHUA 4TLMB 1FY7A 4BBSJ 2CQ7A 2ZKZA 4R74A 3ZXSA 2XSDC 2NS7A 1OR7A 2A6TA 4A3IJ 3WHBA 2M3AA 1EV7A 4Q4ZF 2CJJA 3UR3C 4GCVA 5FD5A 3O6HA 2HI3A 2HYFA 1YO5C 4LLNA 3S17J 1XI6A 4U0VA 3HHHA 1NV7A 4OANA 4K2EA 5H8NB 1D3YA 4HS7A 2DT7B 1ZELA 2NS8A 1DDNA 4UV9A 4IOAF 3HN0A 3PV0E 2X7PA 3TPAA 3B73A 3HEFA 2DVCA 1OLTA 1JJ6C 2I5UA 3Q29A 1LKXA 4LA9A 5DT6A 5FHNA 2A5SA 2F5EA 4AQ4A 3ABLH 1XGNA 3H1CA 6PAXA 3SJMA 1JW5A 5KAFC 3V4GA 2QJEA 2Y30A 2Q2AA 3C4MA 2Z5UA 1X4PA 2BE5F 3ZN0A 1FQBA 3F8BA 5LHHA 1FP2A 1ZRDA 3C9HA 1D0ZA 4KN7X 2BY1A 1PUFA 2FMLA 3CLOA 1UCRA 2MW8A 3KP5A 3GTKJ 1GDTA 3QODA 5FKOA 2OWSA 5JK4A 3J7ZI 1ZREA 4IRGA 3M8FA 3DEEA 1R1UA 2CW7A 2YPRA 2XXRA 1G59A 4FISA 4E0WA 4MQVA 2ZCWA 5JLXA 2VQGA 4CCKA 1HKQA 3DCFA 4L0ZB 4C1TA 4Y7NJ 3HOZJ 1BIBA 2XAHA 3V8JA 3CDIA 1MQIA 5FB2A 1O3RA 1NV5A 2E2IJ 4IZZA 3TUSA 4JWYA 1POGA 1WH7A 3ASOH 4Y13A 2R5ZA 1ACIA 3KZGA 3SEUA 2DMUA 3KN7A 2DQLA 1EZOA 2HDWA 2ZXWH 1H45A 3PPNA 3LSKA 1SEUA 2ZNUA 3WTSC 4F22A 3IWFA 1G3SA 2NXNB 5J1RA 3O2PE 1WVRA 2F4IA 2HYJA 3H9GA 3K2AA 3E5QA 5FGMA 5KAIC 3FVOA 3SZPA 4PDDA 2PMHA 4LGWA 3LSMA 4MTDA 4YFKF 2V4JC 1IXCA 2CV0A 3E7LA 4BHPA 5ED4A 3A01B 2CS3A 1TLHB 3BR0A 3EDPA 1VQKI 2F2EA 3GO5A 4NMYA 1VQ9I 2HXWA 4G4PA 3H3ZA 4BQNA 1UMQA 1S7AA 1XMAA 3C2GA 2R8TA 3PPOA 2VC0A 4MMPA 5F04A 1MSFC 2VT2A 5LEKA 1IMDA 4ISUA 5ILSA 4DW6A 5FLMJ 5CQEA 2LBFA 3SFIA 4IHYA 5I59A 2TRTA 3BJ6A 4YKPA 1P1WA 1MD0A 1KYWA 3S9LC 4BHBA 3HDDA 2FRHA 3E9XA 1BR1A 2BY2A 1WFXA 4W97A 2ZYOA 1YE9A 4MO7A 2C6YA 4CGZA 4KCCA 3R26A 1MMGA 1TQPA 2F7CA 3RPLA 3K9TA 3ZMSA 2DE3A 4OQOA 2EFOA 3OS1A 1W0TA 3Q3SA 3KOSA 1D8JA 1CE2A 3DQVC 2GHAA 5DEXB 1FPDA 4RK2A 3LL7A 4N9HA 5ISUA 1MS7A 4LIUA 3MAJA 1E3PA 2XXQA 3F8MA 3TEPA 4ANJA 2UYFA 5H8QB 2GFEA 2QS4A 3RY3A 3R0JA 5I5PA 1HCRA 4ELQA 5FLVA 4ESBA 2H5YA 1IG7A 1FNNA 2PBIA 2X48A 4AU7A 4XRMA 1RRJA 1U9NA 1W5SA 1AH5A 3S14J 2CQNA 2FOWA 1KZ8A 4I3YA 1YYZA 4QFLA 4NF5B 1TWFJ 3G3FA 4Q5SF 4I76A 4M73A 1F4KA 1QHGA 1MDP1 2F4OB 1AWCA 2XPWA 3OYGA 4NBQA 1IIWA 2Q9TA 3M3LA 2DDKA 1FQDA 2Y7KA 4XF5A 3RQTA 3ISPA 4XBFA 3EPEA 2GXGA 3BC8A 4EM1A 4H4KC 4IHWA 2IW5A 2M1BA 1VSOA 3CUOA 1S8NA 5J40A 2MH2A 5ET6A 3H7MA 4IJAA 2V6CA 4HE1A 4MIMA 4E0XA 4ZYEA 2LD5A 1UJ8A 1N25A 1G8XA 2P6SA 4HRIA 4F3SA 4GLIA 1BJZA 1YG2A 1VQPI 2CEXA 4NC7A 2F48A 1RDXA 1YPNA 3LSXA 4FEDA 2K86A 4XL9A 3DP8A 4I09A 2A05A 5BMZA 2PN6A 1B8IB 2HVSA 1OLAA 3JTHA 1Y1ZA 2F8DA 2NAZA 1IN4A 3AG3H 3LC8A 4P11A 4G68C 5CVUA 4U7DA 3K0VA 2GIVA 4J19A 3VVDA 1R5HA 3FWEA 3NAUA 4RBOA 2B3BA 1DMBA 1VQNI 3DU6A 5E1XA 1V5FA 1D5VA 3UP9A 1URSA 1ON2A 2A5TB 3ELKA 4GVOA 4RGRA 4MQ9F 5CVVA 4FAJA 2ESHA 2EA2A 3GXOA 1FCKA 3TCHA 2Q74A 4RA2A 4PSWA 2DE2A 2DWAA 1MXVA 1D1BA 2OU2A 1HSJA 4E6KG 3UIFA 3MVPA 4O5VA 3BG9A 3PTYA 2B63J 1LE8A 3JAMZ 4CA0A 1K79A 3GW2A 1Q9DA 1TXFA 1B7UA 1QPMA 1OCZH 1J0RA 4IF4A 3AL0B 5HS7A 2FBIA 3PIOF 2XAGA 1WQ2A 1MY3A 3CFZA 4PFUA 4BACA 1D9QA 2V7FA 4NTLA 3WGHA 3LAPA 1V54H 3G3HA 3T9VA 1BOAA 3TGNA 1YRNB 2DMNA 4RMNA 4EMSA 4KD5A 2IA2A 1UIUA 2CGPA 2V26A 4ZE9A 2W48A 1V4RA 4IY6A 1I50J 1Y8RB 4HX4A 3ABTA 4BXXJ 2VBXA 4PBQA 2BVLA 2Q2EB 3K4KA 4AUXA 3JRHA 1NNPA 2W25A 4P8BA 5FBPA 4A69C 1NNTA 1A99A 1B9NA 2A6EF 3FZVA 3DM0A 3EQ1A 2VPRA 4AS4A 2O8KA 4P47A 1TT5B 4OVPA 4U4XA 3PUFA 4GDFA 4ONYA 5LGUA 2DLLA 4LZ5A 5ICEA 3A01A 2VXZA 1R6ZA 5DDGA 3M8UA 4KIGA 3V7SA 4P1EA 4OVSA 1VF9A 2J5PA 1JKQC 2LVSA 3I71A 3CO6C 1DQUA 2UVIA 4II3A 2EINH 2XX8A 4IR8A 2E60A 5DV5A 1KZHA 1R4NB 4CH7A 1FRPA 1ZJLA 3CG3A 3IJXB 2FUG2 4MFIA 1NI9A 1ZGWA 2JWTA 2EJRA 2LMDA 4G2ZA 1E3OC 2DOFA 5CMKA 4QPOA 5K7HA 3PO3J 1ETKA 4B44A 1HKTA 1SDXA 3B6WA 4OTEA 3E6DA 5ERIA 2A69F 1PDAA 2HAUA 3E5XA 1XDUA 3NQOA 2Z8EA 3S2VA 4U88A 5K7ZA 2AO9A 1NHAA 4X04A 2HQNA 4AVPA 4OA4A 4M9ZA 1PBPA 3W2WA 3O66A 1IN7A 4QSDA 2QVOA 4PP0A 4OINF 5DEQA 3MP8A 4DCYA 4RJZA 3ZP5A 4J00A 1W0UA 4IO2A 1MXZA 4L9TA 5HVQC 5E79C 2PBWA 2DT5A 4JX5A 3N6TA 3L7WA 2HR3A 2V1XA 3EQLF 5ITOA 3HZJA 4LD5A 4KMFA 3ABKH 4A6EA 4OAZA 3FATA 3BLYA 4HYEA 1FTTA 1FT9A 1AL3A 3FD3A 2DT6A 3M4OJ 3HRSA 3SDGA 2Z33A 3CCVI 1LCFA 1UFMA 3FGSA 3PD9A 5DCFA 4EQBA 3IRRA 3CMYA 1SMYF 1MXYA 2I48A 2AQFA 1QUJA 2WADA 1SFUA 5K5OA 3LSLA 5B70A 2IGOA 5HDGA 2W24A 4IHSA 2EFNA 1FSHA 4NF5A 4MEYF 5J8CA 5HDKA 2HXIA 4ZTJA 2PI0A 1G0HA 3FV2A 4OESA 4X6AJ 4MFDA 1XGOA 2L02A 2VKHA 1B5IA 3BFTA 4ZYDA 1B0LA 1P1NA 4KYDA 5IZZA 5F1RA 1MJ9A 3DEWA 3RCOA 1A8FA 2Y75A 2X7QA 3BP8A 1YZ0A 1FPFA 3AXFA 2DFEA 2VJ5A 4BDOA 2CMOA 4G68B 3F6OA 4O3MA 3KP2A 4IO5A 5L3CA 1DTZA 3NWTA 2HZDA 4P55A 5AONA 1F9BA 2Y7WA 3HGGA 3SZTA 3F3XA 3B6AA 3LUZA 3FVNA 4I02A 4OWDA 5H8FB 1P99A 4P9UA 3U92A 2ZZXA 1W4MA 3TO7A 2ZB9A 1FQCA 1FTOA 1Y9UA 2F34A 4EGZA 4XKRA 5FHMA 3K0LA 2CYYA 3O97A 2M9HA 3C18A 3PUZE 3VDFA 2AS5F 2V3UA 4S0HB 2CU7A 2MA3A 1B8IA 4JDFA 1Z91A 2PFYA 4GF8A 4O7IA 4DXCA 1Q1HA 1OCRH 5LD2C 3TTNA 4F3GA 1D9VA 3RKWA 3B50A 1FOXA 1YJNI 2PCRA 2Y48A 4CCOA 2XGCA 3I5UA 2CH0A 3I5OA 4F19A 2DCEA 4EQ7A 3N26A 2W84A 4I99C 3AKZA 2LF7A 2VQHA 1OQYA 2KHMA 1B3GA 1M5DA 1REPC 1Z9CA 5FROA 2GWRA 1LBCA 1IAWA 1WDNA 3PQJA 1FLIA 4LB5A 1TWCJ 2W57A 3G2BA 2L01A 3JRGA 1H44A 1WJEA 5JLWA 4Q8RA 2XAJA 3C32A 5CPRB 1YIJI 2IBDA 2K27A 3VWBA 3UK4A 3P7IA 1ONVA 1W7PD 2ZC2A 3OOAA 4ZTFA 4HSTA 4BGDA 2XPVA 2VONA 1YRNA 5IP6A 1WJFA 3GLLA 4G61A 1NG6A 3D4CA 1NNFA 1IN6A 3FF5A 3NRVA 2CV2A 4PJ0C 3GBAA 3JAMK 4V2GA 3CF5F 3TFLA 2NOOA 3U72A 5AA2D 2KKOA 4GRKA 3WAFA 2YX7A 2LSOA 4BUPA 3GTMJ 3U2RA 1B6AA 2UXNA 4CDGA 2DSFA 4HE0A 3HXLA 3MKWB 1R6RA 1HBXG 4IL6C 2LY2A 1QRYA 3VB2A 1JT6A 1HXDA 5FKLA 3I9V2 1RNLA 4Z2YA 3EKIA 4YICA 2ZNZA 3O2AA 4NF4A 4U23A 4ZECA 1WVJA 1USTA 2Z99A 3GTLJ 1IC8A 1MDQA 1KGSA 1G3WA 1VQOI 1GVJA 5ITPA 1TTYA 3PFYA 5F08A 1B3HA 4PF6A 3WAEA 5AA2A 1PUEE 4F3QA 2FNAA 3KP7A 4M3DA 1FOKA 2E1NA 1APLC 2E5ZA 4IO9F 3PUWE 4UABA 5FKNA 1URGA 1AOVA 4A3FJ 1S7OA 1ENHA 3OY9A 2E1CA 1UG0A 1XGSA 3ECHA 4LOCA 2HGCA 4MNIA 1OR7C 2CUFA 4XXUA 2M2EA 4KR5A 4YMAA 3FMSA 2XF5A 1X4OA 2ZBKA 3L00A 1ZLJA 2R7WA 2GXAA 4OWRB 2LFBA 5KVRA 4AYBN 1B9JA 2L4AA 3C35A 3IORA 4BNCA 2LKPA 4U22A 5F7VA 1AHDP 3Q9VA 3RZDJ 1VTNC 4A3CJ 2I3WA 4CICA 3K70D 2K9MA 3E6CC 3CC2I 1N76A 1SVXB 1LPQA 1HW2A 1A7LA 5A2QZ 1X1BA 1GVCA 3VODA 1FPLA 3WTTC 5KZTA 1TT1A 3PMVA 2HTJA 2CEYA 2ECBA 3HOSA 4Q47A 3EF7A 4NHJA 4E7HA 4HW8A 3JRFA 3F11A 4PE5B 5ET8A 3JREA 3FJGA 5EYHA 4BQQA 3QQAA 3ULQB 1SFKA 3O3KA 2WBDA 5A5XB 1J1NA 2AXTC 4P56A 3KN3A 2QCOA 2NUVA 4NWDA 3H4ZA 2Y31A 4WXJA 2Z3YA 3KSXA 1S6LA 1QZYA 1WPKA 1KA8A 2BHZA 5D5VB 3MVWA 5HLTA 1S29A 5CYVA 3SFZA 1GVDA 4OIPF 1IXGA 4ELOA 4RB2C 3HOXJ 2F5DA 3R7XA 2LREA 4G68A 1LUJB 1S9HA 1DTGA 5C3EJ 1WGXA 1GXPA 1OISA 1ZTRA 3HSFA 2DTRA 1Z3YA 2OLBA 2M7AA 4O3CA 3H3UA 1JKRC 3PPPA 1R7JA 3GMEA 3FMRA 3HTUA 2VN2A 5GP9A 2BZTA 1R49A 5H8FA 4CCLA 4DCXA 2E5NA 2P6TA 4O6JA 1JKPC 2BVMA 4BQOA 1R5GA 4HV6A 2K7LA 5IOZA 1WJAA 2X6YA 2YS9A 1X1AA 4UUSB 1N3XA 2JVGA 3WTVC 3ERMA 5IAIA 2HYGD 5EZGA 2OZZA 1Z7UA 1EH6A 2MFZA 2GOXB 3OYBA 1G4DA 2XWKA 2X1EA 1FBCA 1QGXA 2O69A 1BBYA 3IJOB 4GL0A 5EQ7A 2NNYA 1N78A 2W85A 2VE9A 2DXIA 3L6GA 2ZSIB 3GFLA 3RDIA 2IAIA 2OWTA 1LEBA 2KQZA 1J5YA 3KYCB 3AG2H 1FQFA 5L9MA 2EB7A 1HDPA 3KFWX 3V8LA 1K9YA 1JQFA 4JBZA 3H06B 1Y20A 1NV2A 2DJIA 3SXYA 2LC2A 1D4NA 1PB7A 4MLVA 1IF1A 3QU3A 1OVTA 5L9OA 5CM6A 1YI2I 3QAXA 2QUFA 3DKWA 2Z8DA 5ICQA 2JN6A 2ONSA 3KN8A 1B9MA 3VFZA 1R00A 2P5VA 1GT0C 3CI8A 2L3DA 3RT8A 2JUCA 1OKRA 5CVIA 1EZPA 3H0DA 2HNHA 2MBFA 1T0FC 2E35A 1SQYA 4HQEA 3S3NA 3WTZA 2ANJA 4I62A 2GA2A 1J59A 4MEVA 2XGEA 1L3LA 2DYRH 4DE8A 3F22A 4QSEA 4AS5A 3ZMTA 4OXVA 3HV1A 3QU6A 2JT1A 2GXBA 2NVYJ 3FM3A 3RPWA 3SKPA 2JPCA 4KQPA 4R2FA 1B72B 5D5WB 1FIAA 4GBWA 3UKGA 3LR1A 2ISYA 5E1WA 2WYPA 1H0MA 1ZAOA 2E1SA 2MH9A 1WI9A 4NF6B 4G6QA 3DTIA 4I6ZA 2R7TA 4PGNA 3FKJA 1FBFA 2IA0A 5D5UB 2YJPA 4Q0CA 1I6XA 3OYAA 2JA7J 2JA6J 3WTUC 3ERED 3OSQA 2KIMA 2XIGA 1IGNA 4B8XA 2VOPA 1VFCA 4R6HA 3OYHA 5CMBA 4JVDA 3K2ZA 5I58A 3G6EI 1HC8A 1IMBA 2WBBA 5D4RA 2DN0A 2FA5A 4IHVA 3D1RA 4G8HA 4GD5A 2H9BA 4G6TB 2R93J 1RUNA 4I1DA 2LK2A 3OR2C 5TISC 4KICA 3BG6A 2CUEA 2XC7A 3JV9A 3V83A 5I2NA 3LQQA 4XLPF 1SW4A 2KFDA 4LMYA 3USDA 5KCJB 5J47A 2ELJA 1TWYA 3AAFA 3SHFA 4EF1A 4B3XA 4ON0A 3T0JA 1IUFA 1SW5A 2QM3A 3H35A 3OIPA 4R9FA 1DPEA 1EYJA 4C0RA 2P5LC 2VLAA 4EATA 3L2VA 2DMTA 4XKVA 1I39A 2VT3A 4OIOF 5AIQA 1A8EA 1ZH5A 3O9PA 1H9TA 2V25A 3BZKA 3BOQA 5EYRA 4NE4A 4Y52J 2IT0A 4N0BA 1ZG1A 2O1LA 3GBBA 4IO6A 2KISA 2ME6A 1NUWA 1ZARA 2R7VA 4UUVA 2DA3A 5A5XA 2XF7A 2ZXTA 2M87A 2BW3B 3Q25A 4KPTA 2V93A 5A2QK 1MDMA 1MBKA 1VNDA 2JQ7A 3A09A 4KYSA 1XD7A 1XCBA 3NEUA 3CO7C 1N84A 1WZ2A 5DD8A 1QW0A 2KDZA 2M5WA 1K6YA 4HPQA 4L9JA 4XR6A 1FJ9A 4F7ZA 3I56I 1HSLA 1V55H 4A12A 2LR8A 2EFQA 4AIDA 4CYCB 4EUOA 3EETA 5DCMB 4GWWA 2YPNA 4ASNA 1SFEA 1GR2A 2MKZA 1G6NA 2K4JA 4PFBA 4L5JA 4G9YA 5E18F 1POY1 2HXOA 4RAYA 1DU6A 2A6HF 3MP1A 1FQAA 1POTA 2FBHA 2PMUA 2MYSA 3OO7A 2W4SA 1MBEA 3J7AO 1TBXA 4H1XA 2E7WA 5HLHA 1FP1D 3TOBA 2QPQA 2P0WA 2P7VB 1P4XA 4YU0A 4B43A 2KMUA 3ABUA 4M72A 2Y0SN 2XXPA 4D7MA 4RGUA 1BI2A 3TW6A 4HX7A 4OMBA 4FX4A 3MYUA 2WX9A 4HF1A 1HOMA 3WTXC 4EQQA 1C0WA 2E71A 2ADUA 1JGGA 2UVHA 4F1UA 2OC6A 1ZU0A 5KCMA 1KA1A 4PFTA 4GGGA 4H67A 4LLGF 1LBZA 2HU9A 5CKTA 1MM6A 2WC2A 3GEZA 2EK5A 4ZJZA 3JSOA 5CVJA 2E7XA 4PK4A 2WAQN 5C44J 3PO2J 5F24A 3S2HJ 1FBHA 4RM3A 2H8RA 5TU0A 4P5OA 5HS9A 2CUJA 2P8TA 3HUGB 3L2RA 2IS4A 1ODDA 4WEPA 3K1NA 4U7BA 1ZG5A 1B1BA 4C3JJ 4YKIA 4HE2A 4BJ5C 1MXXA 3D0SA 3OD7A 1O3SA 2K3PA 4UV8A 1IXRC 1VDWA 4Q5TA 2M34A 1BLFA 4BKXA 1UTHB 2VJ4A 2KT0A 4GQOA 2Z23A 3FXQA 4WX9A 1B72A 3G73A 1BTJA 2KJBA 3KE2A 5E3OA 2HAVA 4X1BA 3DTKA 4YELA 4AVZA 1GHCA 1IRGA 4NF6A 3E5UA 1QJMA 1SW2A 4D9JA 3OO6A 3HC7A 1AA7A 3F21A 4A0ZA 5GTIC 5IGAA 3F8NA 3IUOA 4D5FA 3BTLA 3CTAA 2BXZA 3TTLA 1QVTA 2Y9ZA 2R7OA 1MMAA 3TTKA 2QEXI 1T38A 3WGGA 5TP9B 5LOMA 1ZK8A 5H6QA 5H2FC 5L3GA 4KYWA 2HEUA 2KPMA 2DK5A 1D9YA 2CRGA 1I69A 3IOTA 1ZKBA 3FHZA 1Y4CA 4PF8A 2I0CA 4TLLB 3SEXA 3KEOA 2IXSA 1DSNA 4RAGA 2X0LA 2X6XA 3QOPA 2XXKA 5BNGA 2MABA 4FQGA 2XXUA 2GBYA 4PAIA 5KCJA 3MCZA 1LCTA 2REJA 1LFUP 2V9KA 1B1HA 3P9IA 1N04A 5BPIA 2OZ6A 1EYIA 2XXWA 3KBZA 2NS0A 4XOTA 1J09A 3RJPA 3U1DA 1I27A 2Z16A 3V7RA 2O9LA 3U94A 5JTYB 1A5JA 4UY8I 1OYIA 5IT3A 4N17A 1TW3A 5DM7F 3CCMI 3PU5A 2XD3A 1ZLKA 2O6AA 4MF3A 3EN3A 4QRZA 4PSXA 5I57B 1UQWA 3CF2A 4OFLA 4AB6A 3VV5A 2LG4A 2Y0MA 5D4SA 4CCJA 2M30A 1SAXA 3FBNB 4ITVA 4L18B 1SFXA 3A02A 3MVZA 4BDYA 4LONB 1RZ4A 4A3GJ 1USYH 1IV6A 3K2DA 2B4LA 2EZKA 5JHUA 1EU8A 2D3IA 3KC0A 1BR4A 2BW3A 4QPQA 1K61A 1K83J 3AL0C 3PGFA 3KPHA 1FTKA 1JT0A 3IOWA 2X4HA 1YJ9I 1ZQ3P 5LBQA 1X1DA 3AFHA 4LG0B 4OEVA 2TDXA 3O6BB 2QENA 2Y9YA 4M9XA 5E17F 1R9QA 4JVCA 2IJLA 1YOVB 3MVYA 4U87A 2RREA 2XDVA 3GUDA 2JJ7A 3HGYA 1IN5A 5D8LB 1AU7A 3QP6A 1T0KA 1Y6IA 5EEHA 3S1MJ 3KETA 3OSRA 3CC4I 3JW4A 2LY9A 3DU5A 4H5FA 2BGCA 2O5RA 4ZH4F 4NF8B 2VKEA 2J5OA 1P4AA 3ZQFA 4I7HA 1L0OC 3S1NJ 1FBGA 1M5BA 5LEJA 3N97A 3DPLC 4WCGA 2CO5A 3KP3A 2JSCA 2R7XA 3PQKA 2X6WA 3PSFA 3PIPF 1PB8A 4GWSA 3O6IA 2FNPA 2DODA 4PJJA 3OO9A 2I6EA 3W15C 3F8CA 3VPRA 5IYBJ 4BDRA 1LSTA 2H6CA 1IMFA 1ELJA 5ICGA 3PUBA 4QBAA 2H8WA 2PMZN 3ZPLA 2FVZA 1GGGA 3RI4A 5IM2A 5CBSA 5IZ1A 1T0FA 1YCJA 4BY1J 1I5ZA 4ZEIA 1E17A 3OYCA 2QBYA 2VB6A 5KDTB 1N7WA 2WBMA 1HA8A 4N15A 3PNVA 3L6HA 3HHFA 3IKTA 1OCTC 3LUYA 2QQBA 2EWNA 2V9VA 4RK9A 4JSOA 2MSYA 2FXAA 3Q0UA 4R1HA 3U8QA 3SEWA 4DZ1A 2O61A 1QULA 1FX7A 1FMWA 3BBRA 4ZS9A 2D5VA 5K2XA 1FTAA 3HUGA 2Q0OA 2IPQX 2JRTA 3I53A 3EYIA 1XS9A 5CMMA 2D2WA 1SW1A 4QTRA 5J1UA 2CW0F 3SZGA 4PFIA 2E1OA 1WI3A 4BEHB 1B58A 2M8CA 3KEQA 3ZQIA 1KYZA 2CSOA 3FVKA 3LSTA 2XSJC 5EG0B 2O51A 4ESFA 2FOKA 1B52A 1UTHA 2REGA 2XX7A 4U0WA 3TTMA 2Y69H 4RAZA 1IRFA 1XTAA 2JUGA 1UTBB 3T9XB 5LDZA 4KFQA 4AYBA 3IOVA 2Y7IA 4GL8A 1I3AA 4U0YA 2G7HA 3FHNA 3OS2A 4OEUA 3VLUA 2V4CA 1LFHA 4XRSA 4RDUA 1PBQA 4DJAA 4V19K 3R4KA 2H1KA 4HCWA 5FTIA 3H6VA 1KONA 4UB8C 3CJRB 2NYXA 1R23A 3X2QH 1ZHFA 4F29A 4Z7EA 1S5LC 5IPAA 2K4BA 3H9QA 2R71A 4XKPA 1JUSA 3EUKL 2L7FP 2L2OA 5FRNA 4LK0F 4D7NA 2XWIA 1DU0A 1B5HA 2DO7A 4ZEBA 2Q89A 2AQEA 2XRNA 3LFUA 4C2MJ 4E70A 4Q30B 3GYYA 1ETVA 2HOSA 5EYGA 4NGUA 1Z3XA 2ZYMA 3GLXA 5HNFA 2DBBA 1LBBA 3TOAA 4HTGA 2CZIA 2RQPA 4JX6A 4GIZA 1O7TA 3U21A 3BCBA 3G1MA 2VASA 1F1ZA 2L9RA 3WE3A 4BXUA 4E7JA 1FPJA 4LZ8A 4NC6A 2XVCA 3GVAA 4XKWA 5ILVA 1YJWI 2ISZA 5JTYA 2LYCA 3AG1H 4RS8A 3BR3A 1JGSA 5HLGA 4LATA 2KQRA 1UHWA 2O0YA 3HO7A 4ZZDA 1K6OA 5LHGA 3CFLA 4A2UA 3D5SC 4UVBA 3BY6A 3BR5A 3OENA 4OVJA 3WHCA 5TGTA 4MLQA 2W00A 2GRVA 5BUUA 1IITA 2WTEA 4Y3OA 2G9WA 3DKYA 3P9CA 5FKMA 2Y5KA 3LBSA 4X1DA 1P4WA 3ZMZA 4LP2B 1Y4TA 1R1VA 2EZIA 1B2HA 2PLYA 5GPAA 3MVXA 1PVEA 2VODA 1FYMA 1MH4A 1TWHJ 3MZ8A 5H8QA 4I8CA 2O6GE 2DMQA 2XASA 1X1PA 3H5RA 4MBPA 3F6VA 1QHHD 1X3ZB 3MD2A 4NG7A 1A54A 4GXAA 1ZTYA 1WJBA 4QLCU 2OWZA 2FYIA 5EQAA 2F4MB 2ZJRF 3OL3A 2EA4A 4XLHA 3CCYA 4M4GA 5CI5A 1I3QJ 1B40A 2OX3A 2A3SA 2HWVA 3FX3A 1BP5A 2OJTA 4ND9A 5A5LA 3DP7A 4DOZA 3OSFA 3QSLA 1UIVA 3DWLE 1INPA 4E7KA 3ODBA 1LAFE 1QNTA 2ZXJA 2V3TA 4N91A 3G1LA 1MBGA 3WODF 3JRCA 3BIGA 3KLOA 1BW5A 4M74A 2GHBA 4KISA 1T2KA 4G8XA 1B5JA 1QUKA 5ET5A 2RINA 1LEAA 3ZKKA 3CMEI 1J9IA 4LVQA 5F27A 4GX6A 1BW6A 3DP6A 2W1OA 3KZYA 4RGXA 2FA7A 3KOTA 5DEXA 2XAFA 3GZ6A 4AC0A 3C33A 1IRZA 3CG1A 3B6CA 2QMWA 4YAHX 5KDTA 4QWQA 3KZZA 3MKYB 4L9VA