3FXRA

Crystal structure of tsar in complex with sulfate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
296
Chain Sequence
b'MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
total genus 86
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA03
3PD9A 4BAYA 1EU8A 5AE4A 2HYFA 1BI3A 1PP7U 4ELPA 1B3EA 2D5WA 1FTOA 2FSWA 4HX4A 3IOUA 3B73A 3ULQB 3I53A 4OU0A 2EWNA 3VDFA 3K6UA 1IZ1A 1W5SA 3I0TA 1IIWA 4HV5A 1B6AA 5D5XB 3MUQA 2E1NA 4G7HF 3LFKA 2DAOA 5ILUA 1MRPA 2D21A 2P2AA 4BHBA 4AQ4A 3TCHA 3FM5A 3SESA 4OEUA 4ZYEA 1SD3A 2GAUA 1FNNA 1GGGA 3IOTA 3E3VA 2J5PA 1GR2A 5AA4A 1MQDA 3S9NC 1FQBA 2Y48A 3JYRA 1P4WA 5ED4A 5FGMA 3PQKA 5L9SA 3TUSA 3I71A 3CTAA 2UYFA 1TQMA 5H8HA 1LBBA 3DLNA 5AIPA 3WAEA 4ZS9A 1MXXA 5ICCA 3R0JA 3CUQC 4N9HA 4OMZA 4B09A 3C36A 3RT8A 3H03A 2ZYMA 3MVWA 1T38A 1EH3A 2PJPA 1SBPA 1URSA 3BPVA 1XCVA 3MP6A 4OXVA 2GIVA 4HQEA 4I0BA 2QQBA 4XKPA 3VFZA 3Q9VA 5TPAB 3G3HA 2P0SA 5DCMB 1QJMA 5DYHA 1R36A 2Z8DA 1FPQA 2P6TA 4OZ9A 2K86A 2DO7A 2RC4A 3D4GA 5F7VA 4HA8A 2TDXA 2MBFA 5D5UB 1I6XA 3CO7C 2PLYA 1OVTA 2XXVA 3P7IA 4IO6A 1XOCA 1R22A 1BM9A 4EMSA 1ZRFA 5LLQA 1ULYA 4FJPA 1PB7A 2O69A 2MA3A 3CR9A 3GUDA 2WWYA 1B5HA 4QFNA 3N6TA 4U22A 3TKYA 4TOZA 4JWOA 1D8JA 1UFMA 2W7YA 3I64A 2DTRA 2OZUA 2DOJA 3MQ0A 1Z1DA 1G3YA 2PMUA 1CGPA 1XSVA 1HKQA 3F8MA 2Z8FA 3QIMA 5H6QA 3WTVC 3IB2A 3ZMUA 4EJWA 3WGHA 3MAMA 3ZKKA 2H9BA 1W4MA 4IPAA 1N04A 2YPNA 1U6GA 1ZMGA 1H44A 2Z99A 1IUDA 4YAHX 4I7HA 2CO5A 3ZSFA 4R6YA 4R74A 1GVJA 1FQEA 3RTWB 3M3LA 1QUJA 4L18B 2YR2A 4GYIA 2M8CA 2XGXA 1FT9A 1DP7P 4ELRA 4AIHA 4ZZAA 2FMLA 1USTA 1VR5A 2NAZA 4TQUQ 2Q89A 4BXUA 3GXAA 1SMTA 1UTHA 2DBBA 1V4RA 1QQIA 1B4HA 3BOQA 5FFXA 3F8NA 3MP1A 4IXAA 1SFUA 2XHKA 1Z05A 4F39A 4R1HA 1L5TA 3K0VA 4ESXA 5D4SA 2UVJA 2XXWA 1Z7NE 2EFWA 5A5XB 3SZTA 2IEEA 3O6BB 1BKAA 3BJAA 2G29A 2XX9A 4M72A 1F9BA 1H0MA 3HOTA 1XGOA 3C1DA 1NNFA 1XGMA 4B8XA 5AIQA 3MVZA 4ETSA 4HCYA 1FCKA 3H6TA 2DVCA 3OEKA 4FATA 1W7PB 4LG0A 1K79A 3K6VA 2JTVA 1YG2A 5KCJA 1ON1A 4YIFA 3LA3A 1MDMA 2R6GE 1LDKB 4YKPA 2EFOA 3FIRA 2F7CA 1TT1A 3SDFA 3RTFB 1U2WA 4G6DA 1Y4TA 3SERA 2BBYA 2XD3A 3E97A 3MEXA 5CI5A 4PETA 1FYLA 3QPTA 4DE8A 4KI0E 3DFGA 3BPXA 4GXOA 1KGSA 2OAZA 1PB8A 4HS7A 1BI0A 2I49A 4LLNA 2O03A 1RNLA 3F6OA 1NL5A 1G3WA 3E13X 3KP7A 1B1XA 3RNNA 4C1UA 4H65A 1H76A 1O63A 5ILSA 5J8CA 4ESBA 1LFIA 2K4BA 1ZG3A 3ZMTA 2A6HF 2F35A 4WXJA 3V8XB 5CMMA 4QSDA 1A7LA 4YKKA 4CGZA 5ERIA 4R6KA 2I58A 5ITOA 1OR7A 4L17A 2P7VB 1OQHA 4GIZA 3K0LA 3MFKA 1TXFA 2HQNA 4RGRA 4HX8A 2XAGA 1IN6A 1MPCA 5L3CA 5I59A 1OKRA 5HBCA 1LAXA 2A3SA 1I5ZA 1M5CA 1XHYA 4RA1A 4ELQA 4JDFA 2DPUA 3WGGA 2A6EF 2DK8A 2WC2A 5ICQA 2ZNZA 5D4RA 1M5FA 3EHTA 1MQJA 3V83A 3LQQA 1JVYA 3E6DA 5KDTA 3HN0A 2XAFA 3R61A 1REPC 5CBSA 4I98B 3K02A 2HGCA 4G8MA 3W15C 3IKTA 4R9GA 3S9EA 4THIA 5KCJB 2ISZA 3CI8A 2DI3A 1BIBA 5DVIA 1JW4A 3M8EA 1LEAA 2NNYA 2VD2A 2DLLA 4MHGA 4FX0A 1US5A 1HW1A 1BBYA 2IA0A 3S2VA 1RIOH 2HEOA 3I6VA 2QJEA 2YU3A 1MM7A 2V1XA 4MEXF 1HW5A 5LGUA 3ERED 4O3CA 3C4MA 2E1CA 1FTJA 4IGTA 3M8FA 4A0XA 1ZREA 1JEVA 3DP6A 1MXYA 4H0EA 4IHTA 5FHOA 1XMKA 5F64A 3FGSA 4NWDA 2GFEA 3BP8A 4LQ2A 2W25A 4BLAA 1GHCA 4XLNF 4HDVA 1ZKBA 4I0AA 4F2QA 2HR3A 1IEJA 3EQ1A 3WTSC 1HKSA 2OK2A 2F2EA 1R23A 4GFRA 5K5RA 4M4GA 3M8UA 1LAHE 3QRFF 3N26A 3DXJF 1GVCA 4F3SA 1MY3A 4EJVA 3JW4A 5LHIA 1YS6A 4LQ5A 3MZBA 3GLBA 1H43A 4H8IA 1XS5A 4MTEA 2RC9A 2RC7A 4R75A 1AIVA 2QQ9A 1LFHA 3G3IA 3BZ6A 2YX4A 2JPBA 1MQHA 2LSOA 1Y3NA 2ELHA 1QULA 3TTRA 4A0YA 3QAXA 2B65A 3IOVA 2M87A 4FECA 3ZS6A 1FBUA 3D0SA 4MLQA 3R4KA 4POWA 5AA2B 4IJAA 3CDHA 1ZLJA 1P1NA 4RY1A 4P11A 1TNTA 3TTLA 1V3FA 1MY4A 2XXHA 4YB7A 3GXOA 5HS8A 2VGQA 3O66A 3USDA 2I3WA 4YFNF 5E20A 3OV8A 2NYXA 5AONA 1NHAA 2XX8A 2FNCA 3UK4A 4MQVA 3LUYA 2IRFG 2GHAA 4X1DA 3VE1B 4ZZDA 4OETA 1YCJA 4Y13A 4ZEIA 4HAMA 3G7WA 1O7TA 1JETA 4LB6B 3OO8A 4IGRA 1XDUA 5JFRA 3RN8A 4JB7A 1J2XA 3EYIA 1MY0A 3EN3A 4MQ9F 1OQGA 1F9NA 2H6CA 5CYVA 3T9UA 2QYOA 1P1QA 5ITPA 2F78A 4P5OA 2DE2A 3IR1A 2DSFA 3R6UA 3QK6A 2VHAA 1OMPA 2FU4A 5E18F 4IRIA 1ANFA 2STTA 4BDOA 4KA4A 3F8CA 1B7HA 3G3JA 3SETA 4ESWA 2H5YA 2O3FA 4GOTA 1D9VA 2HFBA 4DZ1A 4A12A 3JZJA 1J0RA 1QKAA 2NWJA 4UUVA 1T0FA 2KRFA 4R9FA 4HLYA 2MLKA 1NNPA 2LDUA 4L5JA 1SW1A 1OPCA 5BPIA 1J75A 4NF6A 4Q0CA 3TDUC 3RJPA 1NNTA 1MXWA 1H45A 4HF2A 3CLOA 4EJTA 4G77A 2Y7RA 3IJOB 3TGNA 4WCGA 3CUQB 2KIUA 1QZZA 4OENA 1Q35A 3OO6A 1BIYA 2DWIA 3IB1A 5IKBA 4BQAA 3ODBA 3P9IA 3GBAA 4RPNA 2ZNSA 5J8FA 3NRVA 4L9VA 1B3FA 1UTBA 3DM0A 2KIFA 2WTEA 3WAFA 1XSXA 3H4ZA 1KYZA 3EDPA 1MQIA 4RYAA 1JHHA 5DEXB 3THIA 4PFUA 1XMAA 5D8KB 4E70A 5LGTA 2O6AA 1B4ZA 4H5GA 4CXFA 3KZZA 3Q29A 3VVEA 2I4BA 3T1BA 3KEQA 5LHGA 2XXYA 4QFPA 3DELB 2QVOA 3O6GA 3ECRA 4ZEFA 5EEGA 1H3DA 4OMYA 3ZMSA 3CFXA 4QRZA 3HUGA 4I02A 3WE2A 1AH5A 1IXSB 1K78B 4LATA 3P9KA 5TP9B 4KMFA 4ASNA 3D4CA 4PZJA 3HPIA 2AL4A 4OIQF 3SEYA 4XKQA 1MD0A 4IF4A 2HTJA 1G4DA 1HSJA 4H1XA 2IJLA 2XAJA 4G6QA 5FD6A 4N9IA 4HCWA 1Y4CA 1HXDA 4S04A 2REJA 3IRQA 3P9CA 2UXAA 2YPRA 4GYGA 2COMA 3RKXA 1EH6A 4YFKF 2NXOA 3OD7A 1MH4A 4LK0F 4M74A 3IHUA 1I6QA 1QPMA 3GZ5A 2HCAA 1GV8A 1S6LA 3KZGA 3I4PA 5I58B 4IO5A 4KYEA 3TOAA 5J1DA 4GWOA 1B46A 2ACJA 3C3WA 1KYWA 4KYSA 1Y3QA 5I84A 1KA8A 1YS7A 2HZTA 3ZKLA 3Q28A 1MGTA 3HSRA 3F3XA 3A3UA 3DV8A 4RJZA 1W7PD 4EXKA 4F22A 3Q25A 2IVMA 3COAC 2I6EA 1B1BA 1J7KA 1YIOA 3TDZC 4CDGA 1S29A 2XUBA 1MXVA 3GZGA 3H6VA 2OQRA 1S3JA 3M9AA 5IT9Z 1WWXA 1R1VA 3VEPA 2CQKA 2DU9A 1SI1A 5CBRA 3AXFA 1RI7A 1I6BA 1LVAA 3V5AA 3VV5A 3GFMA 1B9NA 4NF8B 2ONRA 2XHDA 1LDDA 3U8QA 3PMVA 1B3GA 3NQOA 2STWA 2IT0A 1PBQA 3ABTA 4G94A 1ZRDA 3RY3A 1D5VA 4AB5A 1L3LA 3MZ1A 2K4JA 1ZGAA 3OSRA 3KLOA 1B1HA 3KSXA 5TPAA 5LHHA 2F5EA 2FOKA 5DCMA 5FD5A 1BJAA 1SI0A 1ZBMA 4KQPA 3L9FA 2L02A 1SMYF 1FTMA 3REOA 2HWVA 1USYE 2ZXTA 3JTGA 4N6PA 2VODA 2KLFA 4YMAA 4IVNA 5H8QB 1S8NA 2A5TB 4JSOA 4RK9A 2P5KA 2V3UA 4YU0A 4IB2A 5L3FA 3I58A 3FUZA 4BDMA 5L9OA 1XGNA 5I2KB 4EF2A 1O57A 1B7ZA 2ZBKA 4RS8A 2OZZA 3C35A 1ZIUA 1LSTA 3QP5A 4MLVA 1Z91A 4M6YA 1NH7A 2ZMBA 2HTSA 2WKYA 3PPRA 1SW4A 4UNOA 4LGWA 2DWAA 1JXSA 4FHTA 4DXUA 4F31B 3Q9SA 1Y9UA 1LDJA 3ZPLA 1JHFA 3IX1A 2QQAA 4O3AA 3O6HA 2I0CA 3B02A 4HTGA 3IRRA 2RDPA 4GRKA 5BMZA 3WTXC 5HM4B 1GTKA 2C6YA 2HYGD 3G3ZA 4HOBA 2HXWA 3E9XA 2D2WA 3BFTA 3RTRA 3RGYA 1LB2A 3IK6B 1FY7A 2L01A 4C0RA 2PN6A 5L3EA 5IT9K 4HBLA 4WK8F 1I1SA 3UA8A 5KK1A 5L8DA 3UP9A 4RGUA 3V8KA 2XXTA 2KJCA 1NMUA 1WVJA 1IRGA 1ZTYA 2FNPA 3VVDA 2D3IA 3ZMVA 2CYYA 2DXRA 3ZN1A 1ZG5A 3HRMA 2X26A 3I54A 3DF8A 2IA2A 1SVXB 4QSCA 3F21A 1EZPA 2G7HA 3F8BA 1FWZA 4G68C 1YFHA 4HW0A 3UORA 5AA3A 4ESFA 1ZG1A 5ICGA 2V6CA 4Q5SF 5A5XA 3SFZA 3PUWE 5DD4A 3IB0A 3S2WA 4A2UA 3OOPA 5CVVA 3C9HA 2GXBA 5FTIA 2O61A 2PFBA 1R7JA 2OBPA 2VOPA 4F3BA 1CF7B 5H8NB 4F18A 3PUVE 1P4AA 5LRRA 4UV9A 3MPLA 5AA2D 2DP8A 5JTYB 1SFEA 2THIA 1W7PA 4Q4ZF 2QLZA 2F34A 4U0YA 3MVYA 3FM3A 4PGHA 2UVGA 4IO2A 2DE3A 4P9UA 2QZ8A 5HS9A 3GLXA 2EB7A 4EDPA 2DQVA 4GF8A 3S4UA 1BC8C 1RYXA 1FYKA 2P5VA 3ZMZA 1SQYA 3TMGA 4OWDA 2F5XA 3KG2A 2XROA 2F7BA 5JK4A 5A2QZ 4XXUA 3KFMA 3RYPA 3FHZA 2DQLA 3AAFA 4JK1X 4MFIA 2NS0A 3HRTA 1UB9A 4QFLA 3M7GA 3TKDA 3MP8A 4EF1A 4R72A 5FB2A 4RAYA 2QS3A 2QMXA 4GGGA 3A3CA 3PPNA 2B3BA 5I56B 4U7DA 5HDKA 4FORA 5DD8A 3KETA 3U9GA 1XB4A 4YG2F 1YPNA 3W9WA 4OHNA 5HLGA 5JR3A 5HS7A 3RIRA 4M1VA 3TDJA 4JWYA 5FO5A 3PUXE 2XXUA 4M73A 4BDQA 3KSJA 1QVSA 4Y17A 2Z33A 3E3KA 4GD5A 4YMBA 2LKPA 2ZFWA 1R58A 3PQJA 2X7PA 1ZYRF 3VB2A 3VFJA 4GLIA 2PG4A 4KFCA 3CJNA 3T8TA 3TCGA 3B6QA 5HOOA 2P6SA 3FXRA 3K6WA 4ZECA 4OQOA 4U0WA 4JWXA 3IL2A 3SXYA 1FQAA 4AD9A 1MKMA 4DNCA 1IW7F 1R00A 1FLIA 1Y0UA 2VXZA 1MDP1 2CW0F 3IJXB 5LGNA 3C34A 1NH8A 2L4MA 1S7OA 3H06B 4BDRA 1TNSA 1AWCA 3OEMA 2W24A 4YB6A 4X48A 2LF8A 2FBHA 4PCQA 3H92A 1JW5A 1P1WA 3K00A 3MZ9A 3GZ6A 2O1MA 4KDPA 3GF2A 4L0ZB 4P96A 3C18A 2ESHA 5D6EA 5I57B 1KU2A 5L3GA 4G4PA 3WTUC 2Y7IA 3HSTA 4QSEA 3LSTA 4F1VA 4R73A 4U7BA 2DXYA 1R5GA 2FNAA 2G9WA 1B3HA 4BDLA 3VLUA 4KIFA 1HW2A 4MBPA 4OFJA 4UVAA 4ONYA 4CICA 2V84A 4JXIA 3OSQA 3VLWA 1B58A 5K5OA 4ZE8A 2DPDA 1IXRC 1XN7A 1U5TC 3QXMA 3RUMA 5LEJA 5AA1A 3TZAA 3V89B 5EYFA 4LFUA 1EV7A 2MC3A 4Z2YA 2ZYNA 4X9TA 2MLGA 2RCBA 1ONVA 2NRAC 3KJ7A 4PQJA 4YICA 1A8EA 2I48A 4WKMA 2VBYA 3CVGA 4NEDA 1A8FA 5DUKA 4LJZF 1OLCA 3MWMA 2YJPA 2Y75A 2OD5A 4U1ZA 4DCYA 4GL8A 1T98A 1DTGA 2F36A 5AA2A 1J1NA 2I3VA 3L00A 1IXCA 2EV0A 4EJUA 3PUYE 4DQ2A 5HLHA 2ABHA 3RYRA 3O97A 2OA4A 5JI6A 3EYYA 1CB6A 4H8JA 5ISUA 2QENA 4X1BA 2XXXA 5HDNA 4P0IA 3I5OA 3KE2A 2BGCA 4HYEA 1XVYA 3IKVA 3HO7A 1ELJA 1FTKA 2GQQA 2F97A 3K01A 2I0BA 2Q2AA 3U1OA 2QWWA 2XKOA 3L2CA 3PUZE 3F6VA 1IXIA 2KKOA 2F7AA 2BJJX 3BKIB 2M30A 3J7AO 1ZU0A 1O3RA 1FX7A 2VP1A 4LZ8A 4GCVA 1N0TA 1N7XA 1WODA 4KIGA 1S7AA 2E0SA 4XRFA 1R1NA 4AB6A 3HIFA 5H8SA 4K3FA 4NF4B 1HSLA 2ESNA 3C33A 2R9JA 1KU3A 4IHSA 1I1GA 2HDCA 2QSXA 1PP8F 1Y1MA 2HZKA 5DTBA 4ZEKA 1LEBA 2FMYA 4Y15A 3ZQ7A 1LCFA 5E8GA 4LUBA 5HDGA 1B0LA 1K7AA 2W57A 1A55A 1WDNA 2F5CA 1DPUA 2ZNUA 3TQWA 3U2RA 4OMBA 2BYVE 3VVFA 1P99A 1P92A 1A99A 5FHNA 4RK2A 2JRTA 5BQTA 4F3GA 1PDAA 2MH9A 5D5WB 1UHMA 2K7LA 3CUQA 4UVCA 1NFTA 1XVXA 3WTYC 2Z3YA 4NF5A 4DIGA 4RXLA 1MXZA 1ZHFA 2JPCA 3ZMDA 4TLMB 3LA2A 2EFQA 2PMSA 4RPOA 3PPPA 3U1DA 2MD5A 2Q88A 2GA1A 4ZEBA 2E7WA 5ICEA 3DP8A 4I62A 4ZYGA 4U4SA 3FMSA 1QZYA 3H6UA 3U94A 1ATGA 3OELA 1USYH 4RB3C 1KU7A 2XKPA 4ECFA 3GYHX 5DEXA 2RKHA 3KN8A 3FJMA 3OOAA 1TLHB 2A07F 4KICA 2QBYA 2Z9OA 3FMRA 4OFLA 1T0KA 3FXUA 4U0VA 2AXLA 1PB9A 3HV1A 4OFOA 1O3TA 1STZA 2V3TA 4NTLA 3EPEA 3JSOA 1JVXA 2O8XA 4JBZA 5E1WA 2Q9TA 5ILVA 3MCZA 3E6BA 1K78A 1R9LA 4YZZA 5LEKA 2PYYA 4PFYA 4UACA 3EETA 5TP9A 2AS5F 5JEIA 2R3SA 4PDKA 4F29A 4KCCA 2PT2A 1DTZA 1BI2A 4EM1A 5BOXA 2HOEA 3N97A 1B6HA 3IOWA 3TFLA 3FMQA 4BDNA 3HTUA 1DPRA 3JAMZ 3ELKA 1T39A 4AWXB 4F7ZA 2V3QA 1XT8A 2O84X 4ESJA 2G93A 4IO3A 1MPBA 3L6GA 1S50A 2ETHA 3ILUB 5I58A 2BEOA 2UXNA 3PV0E 4NF5B 4R6HA 1U3EM 1WQ2A 2PI0A 3EHUA 2ZJ2A 1ODDA 3KOSA 4JSDA 1VSOA 4G8NA 2B0LA 3HTSB 1RKMA 1IF1A 1UIVA 5HPQA 2L4AA 3RPQA 1XDSA 3TTNA 3QOPA 3KP2A 2GA2A 5EHSA 2CSOA 2DVZA 4LVQA 1FQDA 3L6HA 4KNYA 2QL3A 3F11A 3GW2A 2H98A 1FSHA 3KCCA 4O5VA 3K4UA 3TCFA 1BI1A 1A04A 2FBIA 3U72A 2V25A 1YYVA 1SW5A 2VD3A 1C0WA 3PPOA 2QBYB 3GWZA 2A5SA 2Y7WA 2LF7A 1F1ZA 4F1YA 2VE8A 2P1SA 5J6XA 2ZNTA 2MH2A 3RKYA 4NF8A 4I01A 4F19A 1LCTA 5M2VA 3QPHA 2O1LA 3GFJA 2ALUA 5F6FA 5CMCA 1O3SA 2P5LC 1B9JA 4HZFA 5D5VB 4TV7A 3J80Z 1B5JA 2H99A 3LAPA 4ZZLA 3FZVA 4HV6A 3T8RA 4FIMA 2V1DA 5D8LB 4I09A 1ZRCA 1IQ7A 4FEDA 3HHGA 3KLNA 2A5YB 1B59A 1F5TA 4FEBA 4MGRA 3TO9A 1USSA 5I2NB 1BOAA 3SEUA 1ZJLA 2ZMEB 2AYSA 4LP2B 1AOVA 4U23A 1F4KA 2NUVA 5H8QA 1I27A 1D3KA 1M5EA 1TWYA 2A5TA 2DT5A 4KIBA 4LLGF 5FFZA 2PT1A 2EJRA 2CWEA 2LNBA 2HQ0A 2ZYKA 3WTZA 2D45A 4KYDA 5I2KA 1PBPA 3G3KA 5L3BA 1B3LA 2HKOA 4NWCA 4Q8RA 3CRBA 3S9LC 1SYHA 4F2OA 2Y7KA 3HHHA 3H3GA 1QW0A 1QUKA 3KP5A 1Q1HA 1IN5A 2QRYA 4U21A 2M1BA 1ZAOA 3CSBA 4NE4A 1DPEA 2UVHA 3RI4A 2XV4S 1IN4A 5K2YA 3JTHA 2ADUA 4ZYHA 1B05A 2QPQA 2OWTA 2IA4A 3LAJA 4OOIA 3EHSA 5ELVA 1XSDA 2W84A 2IPQX 4OIRF 4OIPF 3HSEA 4U2RA 4OVJA 4PGGA 1H9TA 1URDA 2GWRA 4G2ZA 3F22A 2UYEA 1FOKA 4E0WA 2DYXA 5BPDA 2H27A 1UQWA 2GH9A 5K2XA 1MS7A 1SYIA 1N3XA 2RV8A 2M8EA 2GRVA 2EK5A 4MEYF 4I2OA 4RGSA 1KQ8A 1B32A 1ZN2A 3N6UA 2CFXA 2ZO4A 3KP4A 3N94A 4U1OA 4RB1A 1D8KA 2CMOA 1OIBA 4N07A 3R0AA 3FVKA 3MW0A 4QFKA 5F1QA 3OO7A 5L9MA 4BH9A 1EH7A 3GX4X 4LA9A 2EV6A 3O9PA 4EQ7A 2ZCWA 5CLSA 3PMWA 4G7OF 2M45A 3V7RA 4KCDA 1PDNC 3L7WA 4HLXA 2FA5A 2V1UA 4O3MA 2BE5F 4CZZA 1YW8A 1S7YA 2QUFA 2VOOA 3FV1A 4ZYDA 1B51A 4CYDA 1WSUA 4YKJA 1MZBA 3QSLA 1CF7A 3DQVC 2VT2A 4IY5A 5H8NA 2RF1A 3W9VA 2H4IA 3SEXA 1UCRA 2IP2A 2RNJA 1JGSA 1TQIA 4S05A 4XBFA 1S9TA 5JTYA 1J9IA 1O64A 2HAVA 4IY6A 2XD2A 5H8FB 1AMFA 4GXSB 1B52A 3C31A 5E17F 3B6TA 1U5TB 2HZLA 3WTWC 1R1TA 1U78A 1A54A 4Z0IA 1H9GA 2L54A 1IITA 2XXRA 1LB8A 3CSGA 1HSEA 1RZ4A 4YIIA 4LZ7A 3H6WA 5L3DA 3FJGA 6PAXA 3T0YA 2EFNA 4G7ZF 1O7FA 3BROA 1URGA 2NVUB 2V93A 5FTHA 3HRUA 1D4NA 3F72A 1P2FA 3K2DA 2BV6A 5CC2A 3QUFA 1WRJA 3I59B 1MXUA 2VT3A 4R2FA 1B4AA 1TTYA 2FRHA 1AOYA 5I56A 2HS5A 3MQ9A 3TPAA 4GL0A 3R7XA 3O2AA 4AIJA 4KT5C 1IXGA 1MY1A 4XLPF 4GVOA 2F8DA 3ONMA 3QYTA 3ABUA 3V7SA 3WU0A 4AIKA 4P9FA 4A6EA 5DDGA 1LNWA 4O3BA 4OYVA 3F8FA 3MAJA 4L9JA 3BJOA 3ROUA 5H20A 4LZ5A 5B70A 3T9XB 2H6BA 2ANJA 4NB5A 2JSCA 3Q27A 2YX7A 3KN3A 3TYHA 5H6RA 2EV5A 2REGA 2PVUA 1TFAA 1QO0D 1KWHA 4IRGA 4KD5A 4KHZE 4KYWA 1TW3A 1MG1A 3PFIA 1Z7ME 1LFGA 3LSLA 1PC3A 2FQ3A 1VFDA 2VBZA 1MY2A 3T5XA 1G3SA 1VTNC 4I9DA 1P4XA 5DYMA 3FASA 2VBXA 4C1TA 5E8IA 1O7LA 4ND9A 4RAZA 4NHJA 3B6WA 4XSZF 4ISUA 2H09A 3R6SA 2OZ6A 5LOMA 3S9MC 5TU0A 4WXHA 5AA4B 2P4WA 3B7DA 3VXBA 3PGFA 4Z7EA 4DXCA 5I57A 2GHBA 2RQPA 4QLCU 1GXPA 3E5UA 2Z8EA 1N84A 1XD7A 2OU2A 1QNTA 3I5UA 4FT8A 3A09A 5H8HB 3V8JA 2F5FA 2OCUA 3MWBA 5K5QA 3CFZA 3SEWA 1US4A 2FA7A 3UIFA 1LQ1A 3GBBA 3FVNA 3LWFA 4EQQA 3EUHA 1J59A 1P1OA 3K1MA 3OMBA 4M6XA 1EZOA 5ICFA 1P1UA 2HAUA 2Q2EA 2RKMA 4UXNA 2NNNA 3IO4A 3M1EA 3TAJA 4H67A 3IC7A 4LK1F 3GO5A 1IN8A 1FTLA 4EGYA 5HVQC 1FBQA 2AIXA 3DP4A 1TW2A 3Q5FA 3V7CA 4PP0A 2VN2A 2HFHA 3K69A 1IN7A 2CGPA 2DK5A 2ISYA 1Z6RA 2O6GE 4OIOF 3VODA 4FAJA 4BHCA 4P55A 4RB0A 3KP3A 1I69A 3GVAA 1OMIA 2O7IA 2VC0A 3RPWA 4L5IA 4MF3A 1Z7UA 1QBJA 2UXXA 2P7CB 4U4XA 1JW1A 2Y0MA 2Z23A 4M9XA 4EJOA 1FQCA 4OTEA 2ONKE 2XXQA 3CO6C 4XSXF 1OYWA 2RGVA 1MPDA 3WE3A 2OQGA 4Q30B 4N13A 1BLFA 4LD5A 1UIUA 4I8CA 2E7XA 1RUNA 3TO6A 2Q8JA 1L0OC 2A69F 2HKXA 4KN4X 5KZTA 5FLXZ 1HKTA 3RDIA 3KFWX 2Z5UA 3DPTA 4HX7A 4U88A 2H25A 3TELA 3L09A 1SW2A 3W6JB 3F23A 1XC1A 2OJTA 2VOZA 1MJ9A 2PBIA 3N4MA 5A2QK 3FF5A 2D1VA 2JT1A 5E1ZB 3VOEA 3EQLF 2E1SA 3CG3A 1JNFA 4KPTA 4NF4A 1QGPA 3LC8A 3C32A 3TOBA 3FV2A 2YSRA 3MZYA 4NQWA 4EM2A 3OO9A 4EGZA 5DT6A 3SEVA 2EA4A 4L9NA 5TJJA 4WX9A 1OVBA 3UN6A 2GZWA 3MZHA 2FYIA 1UTHB 2H94A 3E5XA 4RGXA 2ZKZA 3T22A 2L3DA 5K1YA 4MNUA 1BIAA 1BP5A 1RUOA 2DFIA 1RYOA 4YB5A 5B7DA 4XTCQ 1BN5A 1EH8A 3HSFA 1NKXA 3LSFB 4TLLB 5E1XA 5CVIA 2G7UA 1R6ZA 5CMBA 3QU6A 3T9HB 3WTTC 3SZPA 4WWCA 2O7UA 2F5DA 2OLBA 1ZLQA 3TTMA 3FJ7A 3HYIA 3MPKA 2F6GA 4KN7X 2ZYOA 3FATA 2DQRA 1M5DA 3G3FA 3FX3A 2EA2A 3LSWA 3TO7A 1T6SA 2V79A 2QS1A 3CIJA 2Y84A 1SD6A 5IT3A 4JBAA 1DUXC 1SD5A 1G6NA 2QMWA 1P6RA 1Q1KA 4CHUA 4LG0B 5CVRA 1DSNA 1MDMB 3IORA 2HEUA 3CG1A 2YLNA 1Y3PA 2A61A 1X3UA 1YLFA 2UVIA 4ZEDA 1FQFA 3K6XA 1EZ9A 1WKMA 1FYMA 3P7NA 3OENA 3RLFE 3E6CC 3IWFA 1Z9CA 1VFEA 4M71A 4H5FA 4GO1A 5DCFA 3LQRA 4QHQA 1TQPA 1B0HA 1YTYA 3HCQA 2KIMA 3JSPA 5FLXK 2R7FA 2X0LA 4F1UA 4ZZEA 4PE5B 4FX4A 2XX7A 3SQNA 1NNKA 2Z22A 3FVGA 2AL5A 2W85A 3T66A 3IAZA 2O68A 3E6MA 2XRNA 1GXQA 1HQCA 2RN7A 2Q8KA 1BTJA 4FE8A 4G9YA 5FHMA 4NMYA 1YW7A 1ZLKA 3K1PA 2FF4A 3K1NA 3O6IA 5CVUA 1PEBA 4XKNA 1A40A 4RB2C 1IAWA 4P0GA 2VONA 2DW4A 4YKIA 4WF2A 1FSEA 4KMUX 1AL3A 4XKRA 1MM6A 2LAOA 5I59B 3HRSA 1LAFE 3M3FA 5HLIA 3RKWA 3FXQA 3KN7A 5BUUA 1T2KA 3DP7A 3TQNA 4QWQA 4BNCA 4IO7A 2UZKA 4KR5A 3T96B 5KDTB 1U8RA 1VE4A 3KOTA 3KEIA 2CG4A 4R79A 1DOTA 1N3WA 4L9TA 3R60A 3DKWA 4EXLA 3C7JA 2ZNYA 3FVOA 1FZPB 4A5MA 2DS9A 4KFQA 3BJ6A 4LLLA 4G68A 5CMKA 1ZARA 2RINA 3W6KB 4BHPA 3KP6A 3JV9A 3HHFA 1FW0A 4ZDMA 2ONSA 4YFXF 4GQOA 3T9VA 4HF1A 1SAXA 1LB9A 1KU9A 3MJNA 2JZYA 1HBXG 4Q48A 2KJBA 4ENKA 4HW8A 4EVIA 2FEZA 1DDNA 3GEZA 3IO6A 4HQMA 1FC3A 4ENMA 4A5NA 3ZN0A 3PD8A 1FP2A 3I3VA 3KBRA 4DXBA 2A68F 4POXA 3TTKA 3RQTA 4HF0A 2D1HA 4M9SA 3PMXA 4R2BA 1E2XA 4ENNA 1Z6TA 3G3GA 5F1RA 4Q47A 5KVRA 2I4CA 3SKPA 2QM3A 4ZE9A 2XASA 3E5QA 1B2HA 2Y7PA 3IL1B 4PFTA 4WEPA 5I2NA 3BBRA 3EF7A 3KJTA 1R5HA 5EHMA 4CO8A 1OYIA 2ZMEA 1N7WA 2QS2A 1LAGE 1IUYA 3V8LA 5DUIA 4QF9A 3V4GA 2O0YA 3RPUA 4GXAA 2PMHA 2EFPA 2K27A 4PFWA 3MBPA 4EV0A 3VXCA 2XXIA 3U92A 4WXCA 5CRYA 5CJ9A 1CE2A 2HQRA 1BC7C 3D5LA 4LB5A 3MC2A 3PU5A 2VE9A 4OESA 2R71A 2CZLA 3HOSA 5DVJA 4H6DA 3FD3A 2PEXA 1DMBA 1R9QA 2XAHA 4IRHA 3UGWA 2DWHA 4OINF 3O2PE 3E4RA 3TEPA 5LBQA 3LBSA 4A0ZA 3BDDA 1B9MA 1Y1ZA 4G68B 5JVTA 4OERA 4JQFA 1DPPA 1PUEE 4DDDA 1LJ9A 1M5BA 2XIGA 3J81Z 2WV0A 3G73A 5ICTA 3O3KA 3QU3A 3QUJA 2IA1A 3BY6A 1YTVA 1II5A 1MJBA 1E17A 3MVXA 4EUOA 3O29A 3T93B 1N76A 5IAIA 5BWJA 2PX1A 4D0PA 2J5OA 4F3PA 1TBXA 2F6PA 3BFUA 2XAQA 3Q26A 4Q5TA 1UHWA 4AVPA 4O6JA 3TQLA 4KUMA 1B7UA 2V9VA 1LBCA 3KEOA 2P8TA 1MJAA 1WI9A 1XGSA 4UV8A 4M9ZA 5EEHA 3VLVA 4WXDA 3WGIA 4MH5A 5DVFA 4DCXA 4QFOA 1ON2A 3GFLA 1W5TA 5LRSA 1JQFA 3H3ZA 3K9TA 2DWJA 2VC1A 2FBKA 1KQ9A 5JHUA 3ML6A 1G3TA 1MH3A 4L0YB 5TRDA 4LMYA 3U93A 4HDUA 2FE3A 3JAMK 5DV5A 1SD7A 2B3FA 4G8HA 2R7DA 3KGCA 4NF6B 3BWGA 3NEUA 1POY1 1JE8A 3WG9A 4MTDA 1MDQA 3LR1A 1ZH5A 3LA7A 1OYYA 4G8XA 2PBWA 1SD4A 3CUOA 3ECHA 4BYYA 1LGBC 4N0BA 2VBWA 1Y20A 1ZGJA 2NOOA 5CM6A 1QUIA 3KZYA 4EQBA 1YO5C 5H8FA 1D3YA 3M3KA 4UHTA 1YQAA 1U5TA 3QAHA 2RVCA 4LONB 4UVBA 3WU1B 1OLAA 3IWZA 1UTBB 2FXAA 5DEQA 4IO4A 4I1DA 2OWSA 3O28A 3R26A 4E0XA 3ISPA 3DEUA 3RT6B 1SDXA 1R1UA 5D6FA 4H0WA 1J5YA 1YAEA 3H3UA 2Q2CA 2X4HA 5BS6A 3CFLA 2OBGA 3QP6A 3WODF 3TODA 3J81K 3LSXA 3ZP5A 3PPQA 4DLDA 3ILTB 4ZH4F 2QS4A 2RC8A 2XXPA 2GXGA 3I59A 4ON0A 2ZXJA 2Q0OA 2RCAA 4ENJA 2IW5A 1FBSA 1SFXA 1O3QA 5CVJA 4EM0B 1JEUA 2O51A 4RNSA 1QKBA 1B40A 3N5LA 1D9YA 3K2ZA 4UA8A 1I6AA 1XCBA 3J80K 3FWEA 4A6DA 3SHFA 1IXHA 3OXNA 1IRFA 2PQ8A 2X7QA 1KQ0A 4EQ9A 1LLSA 4WEDA 2UWMA 2K02A 4OEVA 1B5IA 3GFIA 1YW9A 1MQGA 4ELOA 1TFDA 1FP1D 4K2EA 2XVCA 3ECOA 2DE4A 1HSTA 1POTA 3H7MA 1K6OA 2M5WA 4XIGQ 3DPLC 4R8HA
chains in the Genus database with same CATH superfamily
3PD9A 4BAYA 1EU8A 5AE4A 2HYFA 4UUSA 3N05A 4OA4A 1BI3A 1PP7U 4ELPA 1B3EA 2D5WA 1FTOA 2FSWA 1Y6IA 1W0TA 4HX4A 1WJDA 3IOUA 3B73A 3ULQB 3I53A 4OU0A 2EWNA 3VDFA 2BHYA 4A3BJ 3K6UA 2R0QC 1IZ1A 1W5SA 3I0TA 1V5FA 2WAQA 4IQJA 1IIWA 4HV5A 1B6AA 5D5XB 3MUQA 2E1NA 4G7HF 3LFKA 4FBPA 2DAOA 5ILUA 5ET5A 1MRPA 1OCTC 1GV2A 9ANTA 2D21A 2P2AA 4E7ZA 3RCOA 4KJZA 4BHBA 4AQ4A 4H46A 3KC1A 3JRCA 3FM5A 3SESA 3TCHA 4GWXA 4OEUA 4ZYEA 1SD3A 3A0HC 3TBIA 2GAUA 1RRJA 1FNNA 3IFCA 3S2HJ 2EBIA 1GGGA 3IOTA 3E3VA 2J5PA 1GR2A 5AA4A 3WG7H 2L7MP 2Y31A 3C2GA 1FQBA 1MQDA 2Y48A 1DK4A 2F3BA 4JVDA 3S9NC 2LR8A 4G6TB 1P4WA 5ED4A 5FGMA 2GXAA 3JYRA 3PQKA 5L9SA 3TUSA 4GX6A 3I71A 2DJNA 5IYCJ 3CTAA 4Y52J 5HNHA 1S72I 2UYFA 1TQMA 4IO9F 5H8HA 1LBBA 3DLNA 1IMAA 4P8BA 5AIPA 3WAEA 4ZS9A 1MXXA 5ICCA 3R0JA 2KRHA 3CUQC 4N9HA 4OMZA 4B09A 3C36A 3RT8A 4CCNA 3H03A 2ZYMA 3MVWA 1T38A 5FBPA 4V2FA 1EH3A 4N8GA 3ZRGA 3MKZA 2ECBA 2PJPA 1SBPA 3BPVA 1XCVA 4CA0A 1URSA 3MP6A 4OXVA 4UY8I 3AG4H 2GIVA 3NAUA 4HQEA 4I0BA 2QQBA 4XKPA 3OSFA 3VFZA 3Q9VA 5TPAB 3G3HA 2P0SA 5DCMB 1QJMA 1EYJA 5F24A 5DYHA 1R36A 2QVUA 2Z8DA 1FPQA 2KL4A 2P6TA 4OZ9A 1X1CA 2K86A 4PFPA 2DO7A 2RC4A 3D4GA 5F7VA 1A5JA 2ZC2A 4HA8A 2TDXA 2MBFA 5D5UB 1I6XA 3CO7C 1HCRA 2PLYA 1LEVA 1OVTA 2XXVA 3P7IA 4IO6A 1XOCA 1W0UA 1R22A 1BM9A 4EMSA 1LE8B 5LLQA 1ZRFA 4PBHA 2A05A 1OFCX 1ULYA 1KZ8A 4FJPA 5GAEJ 2QSGX 1E0EA 1OCOH 2LG4A 5EYGA 2HDDA 1PB7A 2O69A 2MA3A 1YIJI 4IHYA 1X58A 4A3FJ 4O7IA 3LMMA 4PTKA 3OMYA 3CCSI 3CR9A 2CUJA 3GUDA 2WWYA 1B5HA 4QFNA 3N6TA 1KZHA 4U22A 4RLQA 3TKYA 4S0HB 3TMOA 1ERDA 4TOZA 4JWOA 1D8JA 1UFMA 1SFOJ 2W7YA 1GV5A 2D5VA 2HQAA 3I64A 2DTRA 3K4LA 5FRMA 2OZUA 3HL2A 1Z77A 3LSRA 4BGDA 2BW3A 2E34A 2W00A 2DOJA 1H88C 4NDLA 5K7ZA 3MQ0A 1Z1DA 3QYBA 5J3LA 1G3YA 2PMUA 1CGPA 2BZTA 1R4MB 1XSVA 1HKQA 3F8MA 1FBEA 2Z8FA 4A69C 5H6QA 3QIMA 3WTVC 1MBJA 5J16A 3IB2A 3ZMUA 4BE1A 2ME0A 4XLFA 5JHFA 3FBPA 4CCKA 3WGHA 4EJWA 1TL8A 3MAMA 2B4MA 1BJZA 2H9BA 5FLMJ 1W4MA 4XFEA 3ZKKA 4IPAA 1N04A 1X2NA 2YPNA 1U6GA 1ZMGA 1I6HJ 5EGOA 2XF7A 2PCRA 1Z0XA 1X4OA 1H44A 4NNJA 2Z99A 1NI9A 1OQYA 1IUDA 2QVVA 4I7HA 2CO5A 4YAHX 3ZSFA 4R6YA 1E3OC 1GVJA 1FQEA 3H9GA 2QGUA 1QGXA 4HCWA 3M3LA 4P56A 4R74A 3RTWB 1QUJA 4AVZA 4L18B 2YR2A 4GYIA 2BY3A 2M8CA 2DODA 1WH7A 2BXYA 2CQQA 1FT9A 2XGXA 3K70D 1DP7P 4AIHA 4ELRA 4ZZAA 2FMLA 1USTA 4CCJA 4DJAA 1Y1WJ 1VR5A 4O8MA 2CMPA 2NAZA 4TQUQ 2Q89A 4BXUA 3GXAA 1SMTA 1UTHA 1I3QJ 2DBBA 2W4SA 1V4RA 3CESA 1QQIA 4XKCA 4UB6C 1B4HA 3BOQA 5EZHA 2TCTA 5FFXA 3F8NA 3MP1A 4IXAA 1SFUA 2PFZA 4I6ZA 2MABA 2XHKA 1Z05A 4F39A 2X6WA 4R1HA 1L5TA 1YZ0A 3K0VA 4ESXA 5D4SA 2UVJA 2XXWA 2DOAA 1Z7NE 2EFWA 3W2AA 3SZTA 5A5XB 2IEEA 3O6BB 3VYTB 1BKAA 3BJAA 2G29A 2XX9A 2DT6A 4M72A 2LYCA 1H0MA 1F9BA 3HOTA 1XGOA 3C1DA 3CZ6A 1XGMA 5EDNA 3C2BA 1NNFA 4B8XA 4NHBA 4PFOA 5AIQA 1JJ8C 3MVZA 4ETSA 3MSTA 4HCYA 1FCKA 3H6TA 2M0MA 1NV2A 2DVCA 1TZLA 3OEKA 4FATA 1W7PB 3NARA 4LG0A 1K79A 3K6VA 2JTVA 1YG2A 4NX1A 5KCJA 1ON1A 4YIFA 3LA3A 1MDMA 3AL0C 2R6GE 1LDKB 4YKPA 2EFOA 3FIRA 2XWOA 3PO3J 4V19K 2F7CA 4KXPA 3BIHA 2OPTA 1TT1A 4BJ6C 4N8YA 3RTFB 3SDFA 3CF5F 2QSFX 1JUPA 4XORA 2Z2SB 1U2WA 4G6DA 3MD2A 1Y4TA 3SERA 2BBYA 2JK3A 4BKXA 2XD3A 4GBWA 3E97A 3MEXA 5CI5A 4PETA 1FYLA 3QPTA 1IG7A 4DE8A 1VQPI 4KI0E 3DFGA 3BPXA 4GXOA 2VQHA 1KGSA 2DA4A 2JJ7A 2OAZA 5EEAA 1RR8C 3TP0A 1PB8A 1BI0A 2I49A 4LLNA 4HS7A 2O03A 1RNLA 2V1NA 4FTHA 4P1WA 3F6OA 1NL5A 1G3WA 3E13X 1BW5A 3KP7A 2R7VA 4J00A 3M07A 1B1XA 3RNNA 4C1UA 4H65A 4X8RA 2QKLB 1H76A 1O63A 5ILSA 5J8CA 4ESBA 2VPLA 4DBQA 3HPGA 1LFIA 4YICA 2DA1A 3J7AY 2K4BA 2HDWA 1VQ6I 1ZG3A 3ZMTA 2A6HF 4LIUA 3A03A 2F35A 4WXJA 3V8XB 3MMYB 5CMMA 4ZC3A 4QSDA 3LOCA 1A7LA 5C4XJ 4YKKA 4CGZA 5ERIA 1EF4A 4LG3A 2R4GA 2I58A 4R6KA 5ESYA 5ITOA 1VQ8I 1OR7A 5IYDJ 1DU6A 4L17A 2ZZXA 1T8IA 2EQRA 2P7VB 4GRIA 1OQHA 3K0LA 3MFKA 1TXFA 4GIZA 4P1LA 2HQNA 3G1OA 3FDYA 2XB5A 4HX8A 2XAGA 4RGRA 1IN6A 1MPCA 5L3CA 4NC6A 5I59A 2DA7A 1OKRA 5HBCA 1LAXA 2A3SA 1I5ZA 1M5CA 1XHYA 2VKHA 3QMFA 4RA1A 4ELQA 4JDFA 4F31B 2DPUA 4GWWA 3WGGA 4RLFA 3WHBA 2A6EF 2DK8A 2WC2A 1ORKA 2KMUA 5ICQA 1FJLA 2ZNZA 3QPLA 5D4RA 2R92J 1M5FA 1MQJA 3EHTA 3V83A 3LQQA 1JVYA 5F0FA 1R5ID 3E6DA 4N4UA 5KNLA 3HN0A 5I7IA 5KDTA 3ZOBA 2XAFA 3R61A 1REPC 5CBSA 4I98B 3K02A 2HGCA 4G8MA 4PFRA 3W15C 3IKTA 2XPVA 4D1QA 2GM4A 1FEXA 4R9GA 2ID6A 4THIA 5KCJB 2ISZA 3CI8A 3S9EA 2DI3A 1BIBA 5DVIA 1JW4A 3M8EA 1LEAA 2NNYA 3BR6A 1H89C 2VD2A 1ACIA 2DLLA 4MHGA 4FX0A 1US5A 3T9XB 1HW1A 1BBYA 2IA0A 3S2VA 1RIOH 1NH3A 1N75A 2HEOA 3I6VA 1ENHA 2E19A 2QJEA 2YU3A 1MM7A 3I56I 2V1XA 4MEXF 1HW5A 1IRZA 5LGUA 2KHMA 1BK4A 3ERED 5ET7A 4O3CA 4JP0A 1TWFJ 2VQLA 2E1CA 1FTJA 3C4MA 3M8FA 4IGTA 4A0XA 1ZREA 1JEVA 4A3CJ 3OS0A 3DP6A 4M3DA 3ZQHA 1MXYA 4H0EA 2FOWA 4IHTA 1E3PA 2ICWG 3ZQQA 4XRMA 1FOWA 4B48A 1XMKA 5F64A 1ZR4A 5FHOA 3FGSA 4NWDA 3BLYA 2GFEA 3BP8A 2WYPA 3G4SI 4LQ2A 2W25A 4BLAA 1GHCA 4XLNF 4ZDLA 4HDVA 1VF9A 1ZKBA 4I0AA 2Z1DA 4F2QA 2HR3A 1IEJA 2FVZA 4A93J 3EQ1A 3WTSC 1HKSA 4II3A 4IEJA 2OK2A 2F2EA 2Y5KA 1R23A 2JJKA 4GFRA 3K4MA 5K5RA 4M4GA 4XRSG 3M8UA 4ZTJA 1LAHE 3QRFF 2XWVA 4M6VA 3N26A 3DXJF 1GVCA 1DU0A 1FBPA 2OJED 2V7FA 5F27A 1P7JA 4EJVA 3OYDA 1MY3A 4F3SA 3JW4A 1TWHJ 5LHIA 1YS6A 2V4JC 2MG4A 1I39A 4LQ5A 3MZBA 3GLBA 1H43A 4H8IA 1XG1A 1XS5A 4MTEA 2CUEA 2RC9A 2RC7A 3JRFA 4R75A 4AS4A 1AIVA 3TEDA 2QQ9A 2CV1A 1LFHA 2Y69H 1VQMI 3G3IA 3DTKA 4I76A 2KIQA 3BZ6A 5JLWA 2YX4A 2JPBA 1LKXA 4PF6A 1MQHA 4PAKA 4II2A 2LSOA 1VQKI 1Y3NA 2R7TA 2CJJA 2ELHA 1QULA 5IZ1A 2XWKA 4A0YA 3QAXA 3TTRA 2B65A 3IOVA 2M87A 4NBQA 4FECA 2XDVA 4A3MJ 4AC0A 3K4BA 3ZS6A 1FBUA 2F5VA 3D0SA 2MGQA 2IS1A 4MLQA 3R4KA 4POWA 5AA2B 4IJAA 3CDHA 1ZLJA 2XF6A 4ANJA 4DW6A 3HOWJ 3S15J 1P1NA 4RY1A 2X1CA 2GOMA 1TNTA 4P11A 3TTLA 1V3FA 1MY4A 2XXHA 4YB7A 3GXOA 1D1CA 5HS8A 2VGQA 3O66A 1RPWA 2I3WA 4YFNF 3USDA 2XPUA 2KQZA 5E20A 3OV8A 3I4NJ 2NYXA 5AONA 1NHAA 2B4LA 2FNCA 2XX8A 4MEVA 2LKXA 2LP0A 4MQVA 2IRFG 2JN6A 1FPIA 3LUYA 3WU2C 1HF0A 2UV1A 3G6EI 2GHAA 4X1DA 1GLNA 3VE1B 4ZZDA 5E79C 3CMEI 4IOCF 4OETA 1YCJA 3BTLA 4Y13A 2HI3A 4ZEIA 3TP3A 3SYTA 3ABMH 1JTYA 4HAMA 3G7WA 2IGKA 1O7TA 1JETA 4LB6B 3OO8A 4IGRA 1XDUA 5JFRA 1YOVB 2L9NA 2DA6A 4JB7A 3RN8A 1J2XA 4MAGA 1WH5A 3EYIA 1MY0A 4ZDOA 3CLQA 4MQ9F 3EN3A 4GWUA 1OQGA 1F9NA 2H6CA 5IZZA 5DM6F 4BE2A 1NV4A 4PFIA 3GZNB 4E7SA 1SEUA 5CYVA 3T9UA 4B44A 2QYOA 1P1QA 5ITPA 1WI3A 1V55H 3Q0VA 3ESWB 2F78A 1VI0A 2QFLA 4P5OA 2DE2A 4QSHA 2DSFA 3IR1A 3R6UA 4E7IA 3QK6A 4F93B 4M3EA 2VHAA 4HNVA 1OMPA 1FPDA 3DEEA 3VPRA 2FU4A 5E18F 2I10A 2ZXIA 4IRIA 2EILH 4JOMA 3GTGJ 2STTA 1ANFA 1G0IA 4KA4A 3F8CA 3RZDJ 5CPRB 1JT0A 3VWBA 1B7HA 4H4KC 1FPKA 3G3JA 3SETA 3VDXA 4ESWA 2H5YA 2O3FA 3QWLA 4GOTA 2B9SA 1D9VA 2HFBA 2IS4A 4DZ1A 4A12A 2B63J 3JZJA 2DDAA 3W2WA 1J0RA 4BY7J 1QKAA 2NWJA 4FCYA 1T0FA 2KRFA 3S93A 4UUVA 4R9FA 4HLYA 2MLKA 3HZJA 1NNPA 1QHGA 2LDUA 4L5JA 1SW1A 4C3IJ 2MKZA 1OPCA 3NWSA 4CZCA 5BPIA 4CYCA 3KZIC 1J75A 4NF6A 4Q0CA 2WAEA 4PK4A 3TDUC 4HE2A 4E7HA 2DA3A 3RJPA 3F0CA 3AFHA 1MXWA 1NNTA 2RNGA 5IGAA 2CFOA 2DCEA 4BEHA 5IP7J 4HF2A 3HOVJ 3KIOA 1H45A 2V26A 3CLOA 4EJTA 4DI4B 4G77A 2NVXJ 2Y7RA 3SFIA 3IJOB 3TGNA 4WCGA 3CUQB 2KIUA 1QZZA 1ETYA 4OENA 1MMGA 1Q35A 3OO6A 3TTNA 4BQOA 1BIYA 2DWIA 2JRMA 4DYQA 1OCCH 3IB1A 4BQAA 3ODBA 5IKBA 3P9IA 1DCUA 1I3AA 3GBAA 4RPNA 1JT6A 2ZNSA 5J8FA 5EQAA 3EUHC 3NRVA 4L9VA 2XWIA 1B3FA 4XMYA 3GTQJ 1UTBA 3DM0A 2VLAA 2KIFA 1FTTA 3A29A 1K9ZA 2WTEA 3IH3A 3SDBA 2WB1A 3WAFA 2QVRA 2JMWA 1XSXA 4YEJA 5GTIC 3H4ZA 2QKMB 1KYZA 3EDPA 1MQIA 4RYAA 3EUAA 2CZKA 2JA5J 1JHHA 2LTPA 5DEXB 3THIA 1MNMC 4PFUA 1XMAA 5D8KB 2XGCA 4E70A 5IOYA 5LGTA 2IS6A 1B4ZA 2O6AA 2Q74A 4GX3A 4H5GA 4JX5A 4CXFA 3KZZA 1WVRA 1YXIA 3Q29A 3VVEA 2DOEA 1Y39A 2MFZA 1IV8A 2I4BA 3T1BA 3KEQA 5LHGA 2R7OA 2XXYA 4Y3OA 3ONQA 3FXKA 3B8BA 4QFPA 3L2WA 3DELB 3MN2A 3OYAA 2QVOA 3O6GA 1MBFA 2PMZN 3PNTA 3ECRA 1T95A 5EEGA 4ZEFA 1H3DA 3NWTA 1W36D 4OMYA 3ZMSA 3CFXA 4QRZA 2YUSA 1DP3A 3HUGA 4I02A 2DMUA 3WE2A 1AH5A 1G8XA 2HPMA 1LBWA 1IXSB 1K78B 4LATA 3HFUA 3D5RC 5EZGA 4EEFG 4XN3A 3P9KA 1ZR2A 5TP9B 4KMFA 4ASNA 2E1MC 3D4CA 4PZJA 1NK3P 2AL4A 3HPIA 3PTYA 2K40A 4OIQF 5IP6A 3SEYA 4XKQA 1RDXA 3Q0WA 1MD0A 4IF4A 2H1KA 4HE0A 2HTJA 3CJRB 1G4DA 1B72B 1HSJA 4H1XA 4CYCB 2IJLA 2XAJA 3RPLA 4G6QA 1X4PA 4DOZA 4N9IA 1Y8RB 2JA2A 2OUMA 5FD6A 3CCMI 1HXDA 1YRNA 4S04A 1Y4CA 3IRQA 4IHXA 2REJA 3P9CA 1MMSA 2YPRA 4GYGA 2COMA 2UXAA 1ETVA 3RKXA 1EH6A 4YFKF 2NXOA 3OD7A 1MH4A 4LK0F 4M74A 3BT9A 3IHUA 1I6QA 1QPMA 3GZ5A 2HCAA 1GV8A 2VKVA 1RC9A 1S6LA 3KZGA 2VQCA 4F52A 3DKYA 3I4PA 5I58B 4IO5A 4KYEA 3TOAA 3ZXSA 5J1DA 4GWOA 3RQ4A 2ACJA 3C3WA 2E2HJ 1B46A 1KYWA 4KYSA 1Y3QA 5I84A 1KA8A 1YS7A 2HZTA 3ZKLA 3Q28A 2DA5A 2VPRA 2HXIA 2LOOA 1MGTA 3HSRA 2WEFA 1V5EA 2GBYA 3HOYJ 3F3XA 4FE4A 2CUFA 3A3UA 2JA8J 3KBZA 3DV8A 1PUFA 2BJIA 4RJZA 1W7PD 1D0YA 3RKQA 1D9QA 4EXKA 3CDLA 4F22A 3Q25A 2IVMA 3COAC 3PUFA 1B1BA 2I6EA 1J7KA 1YIOA 3TDZC 5M3FJ 4CDGA 1S29A 2O9LA 2XUBA 1XTAA 4V2GA 1MXVA 3GZGA 3H6VA 2OQRA 1S3JA 4O94A 3M9AA 2L0KA 5IT9Z 1WWXA 4NGUA 1R1VA 3VEPA 4HE1A 2CQKA 4D5CA 5IM2A 2DU9A 4ZYAA 1OR7C 1SI1A 3AXFA 5CBRA 2WV1A 1WCMJ 1RI7A 1P7IA 1I6BA 1LVAA 4N15A 3OWTA 3V5AA 3VV5A 3GFMA 3B50A 2HOSA 1B9NA 1NTCA 1U0JA 1FBDA 4NF8B 2ONRA 2XHDA 1LDDA 3U8QA 2ZFUA 3PMVA 1B3GA 2CU7A 3NQOA 2STWA 2K85A 2IT0A 3OYCA 4BDZA 3KYLA 1PBQA 3ABTA 4C3HJ 4G94A 4NAPA 2IEKA 1ZRDA 2ZZWA 3RY3A 4DYCA 3ERMA 1D5VA 4AB5A 1L3LA 4KT6A 3MZ1A 2K4JA 4A3GJ 1WJEA 1ZGAA 2LBFA 3MVPA 3OSRA 3CCQI 3KLOA 1B1HA 3KSXA 5TPAA 5LHHA 2F5EA 2FOKA 5DCMA 5FD5A 1BJAA 4DZPA 1SI0A 4FETA 1ZBMA 4KQPA 2RAEA 3L9FA 1NV6A 4IZZA 2L02A 1SMYF 1SFKA 1FTMA 3REOA 1LBYA 2HWVA 2JVHA 1USYE 3JTGA 2ZXTA 4N6PA 1FBCA 2VODA 2KLFA 1FRPA 4O7MA 3DEWA 2QF7A 4IVNA 4YMAA 1LE8A 5H8QB 1D5YA 2VXDA 3LSPA 1S8NA 3HKZN 2A5TB 4JSOA 2P5KA 3CMMA 2JQ7A 2V3UA 3FV2A 5L3FA 3I58A 3FUZA 4IB2A 4YU0A 4BDMA 5L9OA 4PCDA 1XGNA 4J19A 4ZDPA 5I2KB 4EF2A 1O57A 1B7ZA 2ZBKA 1LFBA 3LSGA 4RS8A 4PAFA 2OZZA 3D1NI 3C35A 2ME6A 1ZIUA 1FSAA 4EATA 1LSTA 3QP5A 2AHQA 1AU7A 1FOXA 4MLVA 1Z91A 4M6YA 1OCZH 1NH7A 2ZMBA 5HODA 1PUFB 2HTSA 2WKYA 3PPRA 2HVQA 2L7ZA 2LC2A 2P81A 2V9PA 2Y2ZA 3V42A 5IOZA 1SC7A 4UNOA 1SW4A 4LGWA 4D9JA 1JXSA 4FHTA 3I55I 2DWAA 2R8TA 4DXUA 3Q9SA 1TP4A 3IUOA 3OYMA 2R7ZJ 1LDJA 3ZPLA 1Y9UA 1MBEA 1JHFA 3IX1A 2QQAA 4O3AA 3KJTA 1IMFA 3O6HA 2I0CA 3B02A 4HTGA 3IRRA 3QYFA 2RDPA 4GRKA 5BMZA 3WTXC 4RMNA 5HM4B 3OOUA 1GTKA 2C6YA 2HYGD 2CS3A 5FJ8J 2K9SA 3G3ZA 4HOBA 2HXWA 2HOAA 2VPOA 3E9XA 2D2WA 1WJBA 3BFTA 3RTRA 1FPJA 2CV2A 3RGYA 3NOHA 1LB2A 3OIPA 3ZQFA 3IK6B 1FY7A 2L01A 4C0RA 2PN6A 5L3EA 4XN0A 5IT9K 4HBLA 4WK8F 5FLVA 1I1SA 1RESA 5KK1A 5L8DA 3UA8A 3UP9A 4RGUA 3V8KA 2XXTA 2KJCA 1NMUA 1WVJA 1IRGA 1ZTYA 2OWZA 2LBFB 2FNPA 1ZGWA 3VVDA 3K4NA 2DOFA 3DPUA 2D3IA 4MFEA 3ZMVA 1BOBA 2PFYA 2CYYA 4QBAA 3HG9A 2DXRA 3ZN1A 4BQQA 2Q1ZB 2CW7A 2L2OA 1ZG5A 1S7EA 2JWTA 2HU9A 3HRMA 2X26A 2HNHA 3I54A 3DF8A 3PJRA 2IA2A 4OVSA 1SVXB 4QSCA 3F21A 4MJOA 1EZPA 2M2EA 3U21A 3DU5A 2G7HA 4OVRA 3F8BA 1FWZA 3FXMA 1YFHA 2AQEA 4G68C 4HW0A 3UORA 5J1RA 5AA3A 4I3YA 5DTDA 4ESFA 1I50J 1WJCA 1NUYA 1ZG1A 5ICGA 2V6CA 4Q5SF 5A5XA 4PJNA 1UELB 1MSEC 3SFZA 1VQ9I 3PUWE 5DD4A 3IB0A 2LY2A 3S2WA 1EJ9A 4A2UA 3OOPA 5CVVA 1GDTA 4GX4A 3C9HA 2GXBA 1D0XA 5FTIA 1UMQA 2O61A 3E79A 2PFBA 1R7JA 4XEQA 2OBPA 1IDZA 1IGNA 2VOPA 4NN3A 4F3BA 1CF7B 5H8NB 2BY1A 3HEFA 2A5WA 5GPCA 2DMQA 5C4JJ 3PUVE 1S9HA 4F18A 1P4AA 5LRRA 4UV9A 3MPLA 5AA2D 2DP8A 3OYFA 5JTYB 3HC7A 1SFEA 3A1YA 2THIA 1W7PA 4Q4ZF 3CCVI 2QLZA 4BXXJ 2F34A 4U0YA 3MVYA 3FM3A 4PGHA 2UVGA 1X2MA 4MIMA 2FIXA 4IO2A 5JLXA 3G1MA 4P9UA 1W5CC 2DE3A 2QZ8A 5HS9A 3GLXA 2EB7A 3ZQGA 1FBFA 5ET6A 4EDPA 5LTCA 2ZMEC 2DQVA 4GF8A 3S4UA 1BC8C 1RYXA 3PNYA 5EF6A 2P5VA 1FYKA 2MYSA 3ZMZA 1SQYA 4PUSA 1RDZA 3TMGA 3E7LA 4OWDA 2F5XA 3KG2A 2XROA 2F7BA 1IDYA 1QPIA 5JK4A 5A2QZ 4XXUA 1OISA 3DPLC 2K3FA 3RYPA 3FHZA 1LFUP 3KFMA 2DQLA 3AAFA 2KRCA 4MCOA 1MMAA 2DN0A 4JK1X 4MFIA 5IY5H 2NS0A 3HRTA 1UB9A 3VYSB 4BJ5C 2BOLA 2Y9YA 3M7GA 3MP8A 4QFLA 3TKDA 4EF1A 4R72A 4XF5A 5FB2A 2VUMJ 4N91A 4RAYA 3VSLA 2QMXA 4GGGA 2QS3A 2GLOA 3A3CA 3PPNA 2B3BA 5I56B 4U7DA 3PIOF 5HDKA 4FORA 3LL7A 5DD8A 3KETA 3U9GA 1XB4A 4YG2F 1YPNA 3W9WA 2NVQJ 4OHNA 5HLGA 1LUJB 3S3OA 2R5YB 3QQAA 5HS7A 5JR3A 1WJAA 1IRXA 3RIRA 2XC7A 4M1VA 3MKYB 1JKPC 2EIJH 3AKZA 3TDJA 3FBNB 5FO5A 3PUXE 4JWYA 2CEYA 2XXUA 4M73A 4BDQA 3W2VA 5J1YA 3FK7A 3KSJA 1QVSA 4Y17A 1A31A 2Z33A 3E3KA 3BR0A 4GD5A 3SJMA 4YMBA 4MNCA 1DQUA 2LKPA 3BG9A 1Z7LA 2ZFWA 1MNDA 1R58A 3PQJA 3L2RA 2X7PA 1ZYRF 3VB2A 3VFJA 4GLIA 2PG4A 4Z6YA 4KFCA 4OAYA 3CJNA 3T8TA 3TCGA 3K4CA 5FKKA 3B6QA 5HOOA 5IPAA 2DMTA 2P6SA 4PGPA 3R26A 3FXRA 1N77A 2X1EA 3K6WA 4ZECA 4OQOA 4U0WA 4XONA 4JWXA 2IXSA 3A0BC 1YE9A 3SXYA 3IL2A 4F92B 1FQAA 3E0JB 2LK2A 4AD9A 2BY0A 1MKMA 3ROJA 4DNCA 2EH3A 1H8AC 4B3XA 1FPLA 3I9V2 1IW7F 1R00A 1FLIA 4DI3D 1V5GA 1Y0UA 2VXZA 4BBSJ 1MDP1 2CW0F 3IJXB 3BC8A 5LGNA 3OL4A 3C34A 1NH8A 2L4MA 1OLTA 1F36A 3H5AA 1FMWA 4PFBA 1S7OA 1EYKA 2ELJA 2X6XA 3H06B 4BDRA 1TNSA 2Y0SN 4MNIA 1AWCA 5F1JA 1HDPA 1ZKGA 2W24A 2X48A 3OEMA 4YB6A 4X48A 2LF8A 2FBHA 4PCQA 3H92A 1JW5A 4XLAA 5J1UA 1P1WA 3K00A 1ETOA 3MZ9A 1KONA 3GZ6A 3PIPF 5CQEA 4KDPA 2O1MA 3GF2A 4L0ZB 4P96A 4PDDA 3C18A 2CH0A 2ESHA 3M1CA 5D6EA 1KU2A 4N4NB 5I57B 2G0EA 5L3GA 4G4PA 4P3LA 5HNFA 3K6GA 3WTUC 1RDYA 1TWCJ 2XXKA 3LSTA 2Y7IA 3HSTA 4RAFA 4QSEA 4R73A 4U7BA 2DXYA 2GQ1A 4F1VA 1R5GA 2FNAA 2AQFA 2G9WA 4CSWA 1B3HA 4N6KA 4BBRJ 4BDLA 3VLUA 2HYJA 2QA4I 4KIFA 3JRHA 4IHWA 1HW2A 4MBPA 4F55A 4OFJA 4UVAA 4A3DJ 4ONYA 3S1MJ 3FXBA 4CICA 3M3YJ 2V84A 3OSQA 4JXIA 3VLWA 1B58A 5K5OA 4ZE8A 2DPDA 2L9VA 3H3VK 1NV3A 2VJ4A 1IXRC 1XN7A 1U5TC 1Z67A 3BTJA 3QXMA 2R7QA 3RUMA 3BG6A 5FROA 5LEJA 5AA1A 2IGOA 4JYKA 3TZAA 3P5JA 3GTJJ 3V89B 2Q2EB 4RDUA 5EYFA 1NV1A 4LFUA 1EV7A 2MC3A 4Z2YA 4CCLA 2ZYNA 4X9TA 3FHNA 2MLGA 3S3MA 2DDKA 2FHYA 1ONVA 2NRAC 2RCBA 2Z16A 3KJ7A 1A8EA 4LN5A 4X0GA 4PQJA 3CCRI 2I48A 4WKMA 2VBYA 4MHFA 3CVGA 4NEDA 3LV0A 2F4IA 1A8FA 5DUKA 2Q8MA 4LJZF 1OLCA 3MWMA 2PJRB 2YJPA 1JUMA 2Y75A 2OD5A 4U1ZA 2E2JJ 3ZR8X 4GL8A 1T98A 1O4XA 1NK2P 1DTGA 2F36A 4DCYA 5AA2A 1J1NA 3PNVA 2I3VA 3L00A 1IXCA 2EV0A 4EJUA 4PC9A 3PUYE 1OCRH 4DQ2A 5HLHA 2ABHA 3RYRA 3O97A 2OA4A 5JI6A 2ZZVA 3EYYA 1CB6A 4H8JA 5ISUA 2DMNA 2QENA 1LBZA 2F4OB 2OCCH 3FIWA 4X1BA 2XXXA 5HDNA 4P0IA 3I5OA 3KE2A 2BGCA 4HYEA 4M3GA 5LFAA 1XVYA 3IKVA 3HO7A 1Z3YA 1UG2A 1ELJA 2LH9A 1FTKA 1D0ZA 1Z3XA 3ABKH 4MLOA 5F08A 1RKWA 1WGXA 2GQQA 2F97A 3K01A 2I0BA 2Q2AA 3U1OA 4RM2A 3VYUB 1HC8A 1N25A 2QWWA 2XKOA 1MBKA 3G1LA 3L2CA 3PUZE 3CCUI 3F6VA 2AO9A 3IH2A 3ZQLA 2KKOA 2OTJI 1IXIA 2F7AA 2BJJX 3BKIB 4AIDA 2M30A 3J7AO 1ZU0A 1O3RA 1FX7A 2VP1A 3U1KA 4LZ8A 4GCVA 1N0TA 5T3JA 1N7XA 4DGWB 1WODA 4KIGA 1S7AA 2E0SA 4XRFA 1R1NA 2VQGA 4HSTA 1V54H 4AB6A 3HIFA 5H8SA 4K3FA 4NF4B 3BZKA 1HSLA 1LFPA 3LFUA 4NQWB 2ESNA 3PFYA 3CCEI 3C33A 4B4CA 2R9JA 1YJWI 1KU3A 4IHSA 1I1GA 2HDCA 5GTHC 2QSXA 1PP8F 3BG5A 1Y1MA 2HZKA 5DTBA 4OVTA 4W97A 4ZEKA 3FK6A 3CCYA 2FMYA 1UHSA 4PSWA 1LEBA 2HZDA 4Y15A 3ZQ7A 1LCFA 4HXVA 5JTYA 2M4GA 4GBVA 5E8GA 4LUBA 1RR7A 1G59A 5HDGA 1FBHA 1B0LA 1K7AA 3DTEA 1MSFC 4G12A 5GAGJ 1QHHD 2IS2A 2W57A 1A55A 1WDNA 2F5CA 1DPUA 2KQRA 1CQTA 2ZNUA 5DS9A 1A6IA 3TQWA 3U2RA 4MX6A 2BYVE 4OMBA 2X6YA 2PMZA 1ZELA 1P92A 1P99A 4JX4A 1AHDP 3VVFA 1A99A 5FHNA 4RK2A 2JRTA 5BQTA 2FBPA 3FBIB 2JA7J 3B6AA 4F3GA 3OIOA 5KAIC 2MH9A 5D5WB 1FPBA 1PDAA 1UHMA 2K7LA 3CUQA 3DBRB 4ZJZA 3UNGC 4YIRX 3L1PA 2YU9J 4XIDA 4UVCA 1NFTA 1XVXA 4NC8A 4XOTA 1YJNI 3WTYC 2OX3A 2Z3YA 1MIJA 2E71A 3OR2C 4NF5A 4RXLA 4DIGA 1MXZA 1ZHFA 2JPCA 3K4JA 4E7LA 3ZMDA 4TLMB 3LA2A 2EFQA 2PMSA 4RPOA 4XRSA 3PPPA 1UG0A 3U1DA 2MD5A 2Q88A 5EQ9A 1YYZA 2NS8A 2GA1A 4C9YA 4ZEBA 2E7WA 3KX2A 5ICEA 3DP8A 3HOUJ 4ZYGA 4I62A 3FMSA 1QZYA 3IAS2 5F0CA 2KISA 3H6UA 4U4SA 3U94A 1ATGA 4YELA 5DW8A 1TT5B 3OELA 3I4MJ 1USYH 1U9NA 4RB3C 1KU7A 2XKPA 4ECFA 2NS7A 3GYHX 5DEXA 3E78A 2RKHA 3KN8A 3FJMA 4Y4RA 3OYEA 3OOAA 1TLHB 2KR0A 3GTPJ 2A07F 2CW8A 4KICA 2QBYA 3DLAA 2Z9OA 3FMRA 4OFLA 1T0KA 3FXUA 4U0VA 1ZQ3P 2AXLA 1PB9A 3FXOA 3HV1A 1O3TA 4OFOA 1STZA 2V3TA 1YJ9I 4NTLA 3EPEA 2NOGA 1UJ8A 2X1DA 2O8XA 3JSOA 1JVXA 4MFDA 4JBZA 5E1WA 2Q9TA 5ILVA 3MCZA 3E6BA 4NQ8A 1K78A 4C3JJ 4E6KG 3GTOJ 2ELKA 3TL4X 5LEKA 1R9LA 2PYYA 4PFYA 4UACA 3EETA 1Y0NA 5EG0B 3CF2A 3IH4A 5TP9A 2AS5F 4IOAF 5JEIA 2R3SA 3QPSA 4PDKA 4CUGA 4F29A 2KDZA 4IX7A 4KCCA 4NG7A 2PT2A 4D7NA 4PAIA 1DTZA 1D1AA 4FISA 1BI2A 4EM1A 1FPGA 1B72A 3QODA 5BOXA 2HOEA 1E3HA 3N97A 1B6HA 3IOWA 3FMQA 3TFLA 4BDNA 5EYHA 3HTUA 1DPRA 2VB6A 3JAMZ 3ELKA 1T39A 1Q1VA 4AWXB 4F7ZA 2W48A 2V3QA 1XT8A 3H35A 1QU3A 2O84X 4ESJA 1YITI 3RSNA 2DDBA 2G93A 4IO3A 4PF8A 1MPBA 3A4CA 3L6GA 3H5NA 3OYBA 1S50A 2ETHA 3ILUB 5I58A 2BEOA 4GWZA 3H36A 2UXNA 1IO2A 1QRYA 4NF0A 3PV0E 2M4KA 2VKDA 4NF5B 4R6HA 1U3EM 3O8GA 1WQ2A 2PI0A 3EHUA 2ZJ2A 1ODDA 1U9OA 3M4OJ 1SPIA 3KOSA 4JSDA 1VSOA 4G8NA 2B0LA 3HTSB 1RKMA 1IF1A 1UIVA 5HPQA 4XM3A 2L4AA 4JVIA 3OYGA 3UK4A 4XL9A 3RPQA 1XDSA 2R5ZB 3QOPA 3KP2A 2GA2A 3A01B 2CSOA 2DVZA 4LVQA 5EHSA 1FQDA 2XA5A 3L6HA 3H9JA 4KNYA 2QL3A 3F11A 3GW2A 2H98A 3GYYA 5CQGA 3HPHA 1FSHA 3KCCA 3ASOH 3HKZA 4O5VA 2CZHA 3K4UA 3TCFA 1BI1A 1SAUA 1A04A 1VNDA 2FBIA 3U72A 2V25A 1YYVA 1SW5A 2VD3A 5GPAA 1C0WA 3PPOA 2QBYB 3GWZA 2A5SA 3UKGA 2Y7WA 2LF7A 1F1ZA 2EPFA 2VE8A 2P1SA 4F1YA 5J6XA 4BUPA 2ZNTA 3OYJA 2MH2A 1VDWA 3RKYA 4XQFA 1VQ4I 4NF8A 4I01A 2KZGA 4F19A 1LCTA 2O5RA 3PM1A 4IR8A 5M2VA 2M7AA 3QPHA 1R71A 2O1LA 3GFJA 2ALUA 5F6FA 5CMCA 1O3SA 2P5LC 2FQ4A 1B9JA 2DYRH 4HZFA 5M5YJ 5D5VB 3FXLA 3FISA 4TV7A 3J80Z 1B5JA 2VKEA 2R7UA 2H99A 3LAPA 4ZZLA 3GTMJ 3FZVA 4HV6A 3T8RA 5KAFC 2V1DA 5D8LB 4FIMA 4I09A 3OYKA 1K4TA 1ZRCA 2NVTJ 1IQ7A 3K2AA 4FEDA 3HHGA 2XGEA 3KLNA 4PBQA 2A5YB 1B59A 1F5TA 1X1AA 4BY1J 4XLHA 4FEBA 4MGRA 2QQ8A 3TO9A 1USSA 3DU6A 5M5XJ 4IKFA 5I2NB 1BOAA 1VQOI 3SEUA 1ZJLA 2ZMEB 2AYSA 2P3NA 2W1OA 4LP2B 1AOVA 3M8JA 4U23A 1R4NB 3BQZA 4M3FA 1F4KA 4MIJA 1K83J 2NUVA 5H8QA 4B47A 1I27A 1HDDC 1D3KA 1M5EA 1TWYA 2A5TA 2DT5A 4KIBA 1P9QC 4I99C 4LLGF 5FFZA 1YHQI 3RZOJ 2EJRA 2RQQA 2CWEA 2LNBA 2VJ5A 2HQ0A 3WTZA 2ZYKA 2D45A 4KYDA 5I2KA 1PBPA 3G3KA 5J4YA 5L3BA 1B3LA 1JP4A 2HKOA 1S5LC 2H1LA 4NWCA 4Q8RA 3CRBA 3S9LC 1CNQA 1IMEA 2KDOA 1SYHA 3CD6I 5IZ3B 4F2OA 2Y7KA 3HHHA 3H3GA 1QW0A 1QUKA 3KP5A 1NV7A 1Q1HA 1IN5A 3H9QA 2QRYA 4U21A 2E35A 2M1BA 1ZAOA 3CSBA 4NE4A 3OY9A 1DPEA 2O7OA 4Y33A 3RI4A 2JA6J 2UVHA 2XV4S 1IN4A 3H0GJ 3HB9A 4UB8C 2BXZA 5K2YA 3JTHA 1X3ZB 2CQNA 4HPQA 2ADUA 3TW7A 4ZYHA 2OCEA 3AG3H 3S2DJ 3GLLA 4FE7A 1B05A 2QPQA 3BTIA 2OWTA 2IA4A 3LAJA 4OOIA 5LD2C 3EHSA 5E3NA 4ZTFA 1IV6A 1FTZA 5ELVA 2WADA 3DLLF 4E4HA 1XSDA 2W84A 2E5ZA 2IPQX 4C2UA 4OIRF 4OIPF 3PUBA 3HSEA 4U2RA 3GBGA 3HXLA 2E5NA 4PGGA 1K4SA 1H9TA 1URDA 4OVJA 2GWRA 4G2ZA 3OSGA 3F22A 2UYEA 3HBLA 1FOKA 4E0WA 4PJLA 5TISC 5BPDA 1PJRA 2H27A 1JI8A 1X3WB 1NUWA 2DYXA 4MMPA 1UQWA 2GH9A 5K2XA 1MS7A 1SYIA 1N3XA 2RV8A 2M8EA 3K4KA 2GRVA 2EK5A 4MEYF 4I2OA 4RGSA 1KQ8A 2CQXA 3LUZA 4LITA 1B32A 1ZN2A 1UAAA 4XKBA 5GP9A 4QTRA 2CFXA 3N6UA 4AUXA 2ZO4A 3KP4A 2QSHX 3N94A 3LSKA 4U1OA 4RB1A 1D8KA 2GOXB 3AL0B 2CMOA 4KITB 2R7WA 4FASD 3A2KA 1OIBA 4N07A 3R0AA 3FVKA 3MW0A 4N4OB 4QFKA 5F1QA 5E3MA 3OO7A 5L9MA 4BH9A 4E7JA 1EH7A 4AS5A 2ZB9A 3GX4X 4LA9A 2EV6A 1G0HA 3O9PA 2K9MA 4EQ7A 2ZCWA 5CLSA 3PMWA 1DGWY 2L9SA 5J40A 2DFFA 1HA8A 4G7OF 2VT5A 2M45A 2ECCA 3V7RA 4KCDA 1PDNC 3L7WA 1VQ7I 1ETWA 3BCAA 4HLXA 2R93J 2FA5A 2Y5LA 2V1UA 4O3MA 1SVLA 2BE5F 4CZZA 1YW8A 1JKOC 3F9KA 1S7YA 2L7FP 2QUFA 2VOOA 3S14J 2RREA 3FV1A 4ZYDA 1B51A 4CYDA 1WSUA 4YKJA 1MZBA 4C2MJ 5M5WJ 3CHGA 1CF7A 3DQVC 2VT2A 3QSLA 4IY5A 5H8NA 3BG3A 3CC7I 3K70C 2RF1A 3W9VA 4QIWN 2H4IA 4BU2A 1UCRA 3SEXA 2IP2A 2RNJA 1JGSA 1FOYA 1TQIA 3BCBA 4XBFA 3BZCA 4S05A 1S9TA 2XF5A 1JTXA 4LIVA 1J9IA 2F3DA 1O64A 2HAVA 4IY6A 2XD2A 1MBHA 5H8FB 1AMFA 4GXSB 1B52A 3C31A 5E17F 1HLVA 1G2HA 2E2IJ 3B6TA 1QVTA 1U5TB 5B3SH 3HGGA 5B66C 2HZLA 3WTWC 1R1TA 2R7RA 1U78A 2LLKA 1A54A 4A3KJ 4Z0IA 1H9GA 4N81A 2L54A 3OYLA 1JKRC 1IITA 3CMYA 2XXRA 1LB8A 3CSGA 3D1RA 1HSEA 1RZ4A 3SEZA 4YIIA 4LZ7A 2MC4A 3BR1A 3H6WA 5EYRA 5L3DA 3FJGA 4AYBN 6PAXA 3T0YA 1ETXA 2EFNA 1O7FA 2X85A 3BROA 4G7ZF 2F4MB 2NVUB 1URGA 2V93A 5FTHA 3E1SA 2JUGA 3HRUA 1D4NA 3F72A 1P2FA 2XAUA 1KA1A 2BV6A 3K2DA 2VASA 4RK9A 5CC2A 2DFHA 3QUFA 2CZIA 3Q3SA 1WRJA 3I59B 1MXUA 2VT3A 3S32A 4R2FA 1B4AA 1TTYA 4PE3A 2FRHA 5K7HA 1AOYA 4GFBA 2WX9A 5I56A 4XNFA 2CV0A 1IC8A 2XGDA 4AM3A 1FIAA 2HS5A 1VQ5I 1UZCA 3MQ9A 4GL0A 3TPAA 4GDFA 3R7XA 3O2AA 3S1NJ 4AIJA 4KT5C 1IXGA 1MY1A 2PT1A 2R5YA 2Y0SA 4XLPF 4GVOA 2F8DA 3ONMA 2MW8A 5J47A 3QYTA 3ABUA 2Y9ZA 3DWLE 3V7SA 1D1BA 3H5RA 2KPMA 2O8KA 4I3EA 2CQ7A 3WU0A 4AIKA 1X1PA 4P9FA 4A6EA 2R7XA 1NUXA 5DDGA 1LNWA 3S8PA 3B6CA 1IJWC 4N17A 4O3BA 4OYVA 3F8FA 3CJQB 3MAJA 4LZ5A 4L9JA 3BJOA 3ROUA 1WJFA 5H20A 5B5EC 1PVEA 1JGGA 4CCMA 2JVGA 2WBBA 2H8RA 1GVDA 3UR3C 2H6BA 3PSFA 3S16J 2ANJA 3IFAA 4NB5A 3FXJA 2JSCA 3Q27A 2YX7A 1JKQC 3KN3A 3TYHA 5H6RA 4UUSB 2EV5A 2REGA 2VJJA 2PVUA 1FJ6A 1Z21A 1TFAA 1QO0D 1KWHA 4IRGA 4KD5A 4KHZE 4KYWA 1K61A 1TW3A 1MG1A 2IBDA 3PFIA 1Z7ME 4J01A 2EINH 5BNGA 1LFGA 3LSLA 1PC3A 2FQ3A 3LSJA 1VFDA 2OTLI 2VBZA 1MY2A 3T5XA 1G3SA 1VTNC 4I9DA 1WJ5A 1P4XA 5DYMA 3FASA 5B1BH 2VBXA 2FD5A 2NXNB 4C1TA 3S17J 2ZXHA 4XLCA 1O7LA 4XKWA 5E8IA 4ND9A 4RAZA 4RAGA 4NHJA 3B6WA 4XSZF 4A3IJ 1T0FC 4ISUA 2H09A 3GTKJ 3R6SA 3RYDA 2OZ6A 5A5LA 1LBVA 5LOMA 3S9MC 1X1DA 2EZKA 5TU0A 4WXHA 3OYHA 5AA4B 2P4WA 3B7DA 3VXBA 3PGFA 4Z7EA 4DXCA 5I57A 2GHBA 3OO9A 2RQPA 2Y30A 4QLCU 3HOXJ 2HHMA 1GXPA 3E5UA 2QEXI 2Z8EA 2M34A 1BR1A 1N84A 1XD7A 2OU2A 5JVGF 1WHUA 1QNTA 3I5UA 4FT8A 1YX5A 2FX0A 2NOJB 4PJ0C 3V8JA 3A09A 5H8HB 2F5FA 2OCUA 1SANA 4XLEA 1FBGA 2ZSHB 3MWBA 5K5QA 3CFZA 3SEWA 1US4A 4E7KA 2FA7A 3UIFA 1LQ1A 1FPFA 1VQLI 1DBZA 3GBBA 1ZK8A 2K9LA 3FVNA 3LWFA 4EQQA 1WFXA 3EUHA 3AG2H 2E36A 5C3EJ 1J59A 1P1OA 3HM5A 2HXRA 5B1AH 2AXTC 1APLC 3K1MA 3OMBA 2WAQN 4M6XA 1EZOA 5ICFA 1P1UA 2HAUA 2Q2EA 5EQ7A 3CP2A 1JJ6C 2RKMA 3KPHA 4D5FA 4UXNA 1BA5A 1B8IA 2NNNA 1J09A 1EA3A 3S3NA 3IO4A 5EJCA 3M1EA 5CKTA 4IHVA 2IGNA 2L5VA 3TAJA 4H67A 3K7AJ 3IC7A 4ABZA 4LK1F 3GO5A 1IN8A 1FTLA 2HQ5A 2V9KA 3KC0A 4EGYA 1XPXA 5HVQC 1FBQA 3IAM2 5C44J 1R9TJ 1R49A 2PJRA 2AIXA 3DP4A 3C2HA 1TW2A 3K10A 3JRAA 4UABA 2LY1A 3V7CA 3JREA 2VN2A 3Q5FA 4PP0A 2HFHA 3K69A 2LRDA 5HLTA 1IN7A 2DJIA 2ZJRF 2X6OA 3A02A 2CGPA 2DK5A 2ISYA 1Z6RA 2O6GE 4OIOF 3VODA 4FAJA 1IMDA 1NG7A 4BHCA 3CC4I 1XMXA 4P55A 4RB0A 3KP3A 2M7BA 3GVAA 1OMIA 4BACA 2VC0A 3GCMA 1I69A 2O7IA 3RPWA 3KYCB 2K3PA 4L5IA 4CCOA 4MF3A 1Y8QB 1Z7UA 1QBJA 2UXXA 4KISA 2P7CB 4U4XA 1JW1A 2Y0MA 2Z23A 2BW3B 2X9DA 4M9XA 3T0JA 4EJOA 1FQCA 4OTEA 2ONKE 2XXQA 3CO6C 3KYDB 1OYWA 2RGVA 4XSXF 1MPDA 1QVUA 3WE3A 2OQGA 4Q30B 4FQGA 4N13A 1X1BA 4LD5A 1BLFA 1OCPA 2E7XA 4B1RA 1RUNA 3TO6A 1UIUA 4I8CA 1L0OC 2A69F 2HKXA 4KN4X 2Q8JA 5FLXZ 5KZTA 1HKTA 3RDIA 3KFWX 2Z5UA 3DPTA 4HX7A 2ZSIB 4U88A 1Q9DA 4BE0A 2H25A 3TELA 3L09A 1SW2A 3W6JB 1GUUA 3F23A 1XC1A 5EGOB 5F0HA 3SZGA 4OWRB 2OJTA 2VOZA 1MJ9A 2N8GA 2PBIA 2XSJC 4U87A 5A2QK 3FF5A 3N4MA 2WBDA 2D1VA 3G71I 3L2VA 4XR6A 2JT1A 5E1ZB 1NG6A 2MD0A 4DZJA 3VOEA 3EQLF 2E1SA 3CG3A 1JNFA 4W1UA 4KPTA 4NF4A 1QGPA 3MKWB 3LC8A 3C32A 2M0CA 3LSIA 2E1OA 2I8DA 2YSRA 3MZYA 2LFBA 4NQWA 5FKNA 3TOBA 1FIPA 4EM2A 4EGZA 5DT6A 2EA4A 4L9NA 5IYBJ 3LNQA 3SEVA 5TJJA 2KFDA 4WX9A 1AWBA 1OVBA 3UN6A 2GZWA