3FXRA

Crystal structure of tsar in complex with sulfate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 86
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA03
4NF6B 3RGYA 5DD8A 4ZEBA 5H8FA 1B7UA 2Y7WA 1MXWA 5H6RA 3TQWA 1QULA 5AA4A 3O6HA 1B1BA 1KU3A 2XV4S 4I7HA 4TV7A 5CVRA 5E17F 2RCAA 3LFKA 5H8HB 4IY6A 2K4BA 3RKYA 1IN5A 1TW3A 2IJLA 3C36A 1Z7UA 3R0AA 1YIOA 2P5KA 1H9TA 4YB7A 2VD2A 3ZMDA 3L09A 4HZFA 3R4KA 2GRVA 4OZ9A 4M6YA 1RZ4A 5E1XA 3I59A 3PD8A 1GTKA 1MJ9A 1RUOA 2IRFG 1YCJA 4H1XA 3VVDA 2RN7A 3DM0A 2FEZA 5I2KA 5DEXB 1S50A 1GHCA 1CB6A 3JV9A 3A09A 2HQRA 5ILSA 1YQAA 5DCFA 2EK5A 1IXIA 3RI4A 4OIQF 3M8EA 2XRNA 2IA2A 1IXHA 3TO7A 2HKOA 5AA2D 2KJCA 3EQ1A 4OFJA 1ZREA 3E4RA 2FXAA 4WK8F 5AONA 4XKRA 4WCGA 1DTGA 1M5EA 5LGNA 2V9VA 4ESJA 4IO5A 3PU5A 4PFYA 3VVEA 3WGGA 1B4ZA 2KIUA 4I0BA 5LEKA 5J6XA 4OQOA 1B46A 1YS6A 1PB7A 2XIGA 2NAZA 1QPMA 4KCDA 3MP1A 1P1WA 4G6QA 4OETA 3P9CA 4YAHX 4QFOA 4JBAA 3NRVA 5IT9Z 2PBWA 1YAEA 1D5VA 3Q27A 3C7JA 3M8UA 3M9AA 2PN6A 4XLPF 4FE8A 1FW0A 2DTRA 2ZKZA 4GFRA 1LEBA 1R9LA 2CW0F 1JNFA 1YTVA 2R71A 3DFGA 4POXA 5L9SA 5ILVA 3I3VA 1D9YA 1FZPB 2VBYA 3TDJA 2Z5UA 2VOZA 3KP6A 4HW0A 4BXUA 3OD7A 2ZFWA 3CUQA 2QQAA 2Z22A 1FWZA 4MNUA 2ESHA 2ACJA 4Y17A 1VR5A 2JSCA 1JETA 4ENKA 2GH9A 3K6XA 5EEGA 3ECHA 3WODF 3PPRA 4HW8A 1F5TA 2Q8KA 3GWZA 1MXVA 5BQTA 4NF4B 4EQ9A 2MA3A 4PCQA 1K6OA 4ZYDA 1XN7A 4H65A 1FSHA 4PDKA 2FF4A 1SFUA 1UTHA 2UYFA 3HPIA 5D5WB 1GV8A 5ICTA 2ESNA 3U1OA 2B3FA 3BPVA 4LA9A 4AB6A 4MLQA 3LR1A 2QJEA 1S7YA 4F3SA 1JQFA 1KQ9A 1RI7A 1ZU0A 3ZKLA 1U5TA 2HS5A 3RKWA 2E1CA 1VFEA 2I0BA 3V7RA 1P99A 1MPCA 4ELOA 2G7UA 3EDPA 4L9TA 4G8NA 3U94A 4YZZA 4AVPA 2L4AA 3WE3A 1SD3A 5CVJA 1ZIUA 2MLKA 1AMFA 1LDJA 5HLIA 2UWMA 4ZE8A 4F2OA 2F35A 3K2DA 2UVIA 1U6GA 3KP4A 1P1UA 3KCCA 4EXLA 2FRHA 2D5WA 4LJZF 1SW4A 3LBSA 4ENNA 3PPNA 3CFLA 3G3JA 4F3PA 5LEJA 1VFDA 1ZRFA 3HSFA 4LONB 3K69A 3N26A 2EV6A 2RKHA 1G3YA 1FQFA 3FXRA 5D6EA 3B6QA 2LDUA 3HOSA 4H0EA 2V84A 4R6KA 4U4XA 1NMUA 5EYFA 2V3UA 2XD3A 3PMWA 2WWYA 1QGPA 3HSRA 3TDZC 4RGSA 2OA4A 4LGWA 3E6DA 1BP5A 4XIGQ 1WWXA 3B6WA 3I5OA 4GRKA 4JSDA 3DELB 3K6UA 1TW2A 3OO8A 2XXUA 2RINA 3CFXA 3KGCA 3G7WA 2DBBA 3KSJA 4M9XA 3Q29A 2HXWA 5F6FA 4U88A 3MQ0A 4P0GA 3GUDA 2QBYB 2YX4A 2K27A 2O51A 1QUIA 3CRBA 4GL0A 4HS7A 4E70A 5LHIA 4ZEFA 1IN7A 1B6AA 3T22A 3TYHA 1EH6A 2EFPA 4L17A 4HAMA 5IT9K 3HRTA 4S05A 2HWVA 1FYMA 2RDPA 3Q25A 2X0LA 5ELVA 2I58A 1NNPA 2L3DA 3G3KA 3MVXA 5HM4B 3DPTA 4HF0A 3BKIB 3OENA 2OQGA 1NFTA 1CF7B 2R9JA 2ELHA 4QFPA 4IHSA 2LF7A 2K02A 4Q48A 3B73A 2I48A 4KN7X 3FVNA 4YKIA 5L3BA 2GZWA 1YLFA 2YX7A 3D5LA 3KETA 3T5XA 4DDDA 1EZPA 1UCRA 1KGSA 5IT3A 2EWNA 2PMSA 3CSGA 2XAFA 2Y0MA 1T2KA 1XDUA 4EM2A 4U2RA 2STWA 3R0JA 4R75A 3PPOA 2JTVA 2KIMA 3K6WA 4YB6A 2OK2A 1FTKA 1XGNA 2ZNUA 3RY3A 3TQNA 1DPPA 4D0PA 3QPTA 5KCJA 5H6QA 2PYYA 3E9XA 3JYRA 4KYDA 3MC2A 5DUKA 5JEIA 3HRUA 1SYIA 1BI1A 4EM1A 2O03A 5E8IA 3PGFA 4MQVA 4Z2YA 2NNNA 3H06B 1BBYA 1S3JA 1SI0A 1J1NA 1TFDA 4I0AA 4H67A 2A5SA 2HFBA 4H0WA 3TTRA 5TRDA 2H99A 1XCVA 3EQLF 3JAMZ 4EDPA 1UQWA 4UVAA 3PUZE 2F2EA 3D4GA 4EUOA 1BOAA 4HLYA 1IXCA 4Q8RA 2K86A 4ISUA 3FJGA 1MY4A 4GYIA 3S2WA 4ZEKA 1U5TC 2ZCWA 2Y7RA 4IF4A 3B02A 1SW2A 3FUZA 1OQGA 3SEXA 1KU2A 3OMBA 3KLOA 2HEUA 4IRGA 1ZN2A 5I57A 2YSRA 2V1UA 2RV8A 1LEAA 3T96B 3QAXA 2EFWA 3VXBA 3PUXE 2RCBA 1EZ9A 2FA5A 2A07F 3QAHA 3P7IA 4HOBA 1IQ7A 4GD5A 3IB1A 3L9FA 3OV8A 2NWJA 2TDXA 3VVFA 1V3FA 4ZH4F 1EH8A 4LK0F 4QFNA 3T0YA 1N7WA 4A0XA 4HX8A 5TP9B 1B1XA 1BM9A 3WAFA 1SD7A 3SKPA 3I0TA 2ZMEA 3L6GA 4ZE9A 2RKMA 3R60A 4KA4A 1B4HA 2QQ9A 4XKPA 1S9TA 1HBXG 1IN4A 5I58B 5E1WA 5HVQC 3MFKA 2M8CA 4IO3A 5HLGA 3IWFA 2VP1A 1B05A 2O68A 5DUIA 1K78A 2ZYKA 1J75A 2FBHA 2R7DA 2NVUB 2W24A 4DCYA 5H20A 2DOJA 2VBXA 3WTXC 2XXRA 3PMVA 4R8HA 1BI0A 3BZ6A 4KIBA 3T9HB 2DQRA 4G7HF 1HSLA 3IO4A 3JTGA 2OZZA 3BDDA 3IJXB 5LHGA 3L7WA 4I2OA 3HN0A 2QVOA 1IN6A 1FQAA 1HW1A 2QPQA 2CYYA 2O3FA 3M3FA 2KLFA 2PVUA 5E20A 5ITOA 4IY5A 1NNFA 1G4DA 3PQJA 2V3QA 1S7AA 2QENA 4EJVA 2GXGA 4IO7A 1NH8A 4F3GA 1U2WA 2F36A 3ZSFA 2CZLA 4NF8A 2O8XA 4M74A 1TWYA 3SEVA 4L0ZB 1FTOA 1TXFA 2OCUA 3F8NA 2QSXA 1GXQA 2H4IA 4CO8A 1NNKA 1WSUA 1AOYA 4WKMA 4G7ZF 4GL8A 1N7XA 3EHSA 1IAWA 4O3BA 1T0KA 5ISUA 3GVAA 5E8GA 1LB9A 1XD7A 1Y4CA 1R1NA 1T98A 3H3UA 2RC9A 2L54A 2CSOA 3MWBA 2OZUA 2YPNA 2J5OA 4CHUA 2I3WA 3FZVA 3DPLC 1IXGA 3QRFF 5HLHA 5CVVA 5EHSA 1PC3A 3I4PA 5LBQA 4HBLA 4P9FA 2CO5A 4HF2A 1T6SA 2Z8EA 4TQUQ 2XAQA 4Y15A 2G29A 1U78A 4GXSB 4P55A 2GA2A 2DQVA 3WAEA 1VE4A 1HSJA 3JAMK 2P7CB 1NHAA 2OZ6A 3E5XA 4BDMA 4RB0A 4S04A 4RK2A 1R5GA 5D4SA 1B5IA 2H25A 2NXOA 4KHZE 5J8CA 2HDCA 3T9XB 2Q88A 2AIXA 2Z99A 3FM5A 4POWA 1Y3QA 1ZLQA 4A0YA 4YKPA 4JWOA 4YU0A 4RAYA 2O7UA 3OEMA 1Y3PA 2M45A 3IRQA 2JPCA 3MUQA 1LDKB 5LHHA 3MZHA 2DVZA 2R3SA 3RTFB 1R6ZA 4ZZEA 1W7PA 2FSWA 1DDNA 2O6AA 3RTRA 3DXJF 4CICA 1XVYA 1H44A 5DTBA 2FA7A 1KU7A 1QUJA 1ZBMA 1Z6TA 3ML6A 3IAZA 4KIFA 4YMBA 1H43A 3TEPA 1FP2A 3U8QA 2EFNA 1Y1MA 2BJJX 1NL5A 1ZRDA 2RNJA 1OKRA 2CGPA 3L6HA 3BY6A 4F3BA 1RYOA 3I54A 4LLGF 1LSTA 1SBPA 2UZKA 2PJPA 1P1OA 5HBCA 1FOKA 2D3IA 2XXHA 4O3MA 1FYKA 2I6EA 3H3GA 2VBZA 3K1PA 1N76A 1K7AA 2GWRA 2FE3A 3ABUA 1LLSA 5KDTA 4GO1A 2YPRA 4EMSA 3TCFA 3L00A 3LQRA 2IA4A 1B5HA 1PDAA 5KVRA 3J80Z 3R61A 5D5VB 1EV7A 3BWGA 2V79A 1FYLA 3H3ZA 4QHQA 4BDOA 5ICQA 4A12A 1Z05A 3EYYA 2QMXA 1B51A 2Z23A 5FGMA 3TOBA 2QRYA 3UN6A 1MDMA 1N3XA 3A3CA 2HAVA 3FMQA 2FYIA 5FHMA 4MH5A 1R1TA 1SAXA 3OSQA 4F1UA 3RLFE 2F7BA 3FM3A 4KN4X 1JEUA 3WTYC 1R5HA 5HDGA 4AIKA 3HRSA 3D4CA 2FNCA 2FBIA 3LUYA 2EA4A 1I27A 4HX7A 4DXUA 4HQMA 2AS5F 2GAUA 2HOEA 3UP9A 1XSVA 3RPUA 4LFUA 5CMBA 4YKKA 1YW7A 4R2FA 3FIRA 5CI5A 3BJOA 4OMZA 2DW4A 2XAHA 3CUOA 4GYGA 3O66A 4KT5C 5DCMB 1RKMA 3MVZA 4UVCA 4JB7A 1HSTA 5BS6A 4ENMA 3SZPA 4EVIA 1IF1A 4F19A 3OO7A 4EGYA 1PP7U 1HKSA 4OU0A 3BJAA 4U0VA 5DYMA 4IB2A 1XDSA 3QU3A 3WGHA 1F1ZA 5F1QA 3IR1A 2O69A 4DQ2A 3OEKA 2NRAC 2VODA 4EXKA 3PQKA 3Q5FA 2KRFA 3F8CA 2O0YA 3TO9A 3LSLA 1EZOA 1E2XA 3ZMVA 3UIFA 3DP4A 4KYEA 2EFOA 4WX9A 2XXQA 3KN7A 2RVCA 3QU6A 3ROUA 2DWHA 2Z8FA 3SDFA 3M3KA 1F9NA 3HYIA 3P9KA 3WTWC 1FLIA 4I02A 5ITPA 3TELA 1OVBA 3UK4A 2MC3A 1FQBA 1O3SA 3EHTA 5CYVA 2QM3A 3COAC 2H6BA 4RGXA 4N13A 1O3RA 1EH7A 1ZLKA 5TU0A 3ZMZA 5E18F 5D4RA 3LAPA 3RYPA 2NUVA 5I56A 1PB8A 1B3LA 4MBPA 1ZG1A 4EJTA 3RN8A 1ZG5A 2QZ8A 4QF9A 1OLAA 3VXCA 2ZBKA 4RNSA 5I2NA 3M8FA 4THIA 1PUEE 1A99A 4BDLA 2HYFA 4JWYA 1SD6A 3KP2A 4Q30B 3TTKA 2DP8A 1W4MA 2K7LA 2OQRA 5JHUA 2AL5A 2XVCA 1AWCA 1UTBA 4AD9A 3WTZA 3FATA 2BBYA 4LB5A 4MHGA 3FV2A 3GFLA 1I1SA 1I6AA 1IW7F 2A6EF 5JR3A 2YU3A 1BI2A 1ZTYA 2F6GA 4AIJA 5CC2A 4BHPA 2MH2A 5FHNA 3HUGA 4QFKA 2Y75A 5TJJA 3UA8A 1H76A 1JW5A 5L9OA 1W7PD 4IXAA 3J80K 1ZMGA 1MG1A 3J7AO 2QWWA 4CYDA 2OU2A 4LQ2A 5CBRA 1LBCA 5LRRA 2Y84A 2LKPA 2F5CA 1F4KA 1II5A 2VD3A 4LATA 1MXXA 1US5A 2OBGA 4LG0A 4N07A 2VHAA 1Y20A 3QP5A 1SVXB 3V8KA 1Z6RA 4UV9A 1I6QA 2O61A 2ADUA 2DT5A 2LAOA 3O2AA 3V89B 1SMYF 1FNNA 3AXFA 3IL1B 1O7FA 1BTJA 3GLBA 3E6BA 2D45A 1HXDA 5FD6A 2YLNA 1LB8A 1BJAA 5K2YA 3V8JA 4RPNA 2DAOA 2L4MA 2ONSA 2A5TA 3FHZA 1WQ2A 1FX7A 2AYSA 1WI9A 1DPRA 4OIRF 1Y1ZA 4ECFA 4BQAA 2CMOA 3IKTA 3W9VA 5HPQA 4HCYA 4X1BA 2DWIA 5JVTA 3G73A 2GHBA 4M9ZA 2ISZA 4I62A 1TQPA 4QFLA 1YW8A 3O28A 4YB5A 1D4NA 5CVIA 1DP7P 2XKOA 1B58A 2E7WA 4U4SA 2M5WA 2MD5A 1K79A 2H27A 1B0LA 1XSXA 5H8NB 4WEPA 3OOPA 2PFBA 5F7VA 1TQIA 2P4WA 2W25A 5EHMA 2HQNA 2JRTA 4R9FA 1R22A 1JEVA 5CRYA 4XRFA 4Y13A 1PDNC 1H45A 2XASA 4KIGA 2UYEA 4G68B 3I6VA 2GFEA 1R00A 1FQEA 3F72A 4OINF 4WWCA 2AL4A 4TLLB 3I64A 2VC0A 3F23A 2Z9OA 5CJ9A 3DKWA 3MPLA 3HTUA 2W7YA 2X7PA 3MQ9A 3SERA 1YPNA 4MQ9F 5H8QA 5JFRA 3LSFB 3QPHA 1RYXA 3C18A 4XKQA 3KJ7A 5ICEA 2RC7A 5H8SA 4BHBA 3E3KA 1GXPA 2F97A 2Q2AA 3N4MA 3GBBA 2DYXA 3FJ7A 3M7GA 2XX9A 5K5RA 3WTSC 4NF5A 1US4A 2WKYA 4U0WA 2XHDA 1BIBA 4HV5A 2JZYA 4HYEA 4Q47A 4M71A 3HOTA 1SW5A 3DP6A 3H7MA 1R1VA 3MVYA 3H6TA 2BEOA 4NWDA 2FNPA 5L3GA 1LAGE 2B65A 1MY1A 2P2AA 2HYGD 3RIRA 2H9BA 1MXYA 2ZMBA 3MBPA 4UNOA 2FU4A 2O1LA 3S2VA 3ELKA 1FSEA 4NF6A 3DP8A 2W57A 3SZTA 1USSA 1KQ8A 5AA2B 3PPQA 3FMSA 2E1SA 2PQ8A 1WKMA 4KMFA 5DEQA 4NB5A 4MLVA 1XB4A 4O3CA 5CBSA 4OIOF 2E0SA 1MGTA 5H8HA 3FXUA 4U7BA 5ILUA 5CMKA 5ICGA 4GVOA 3VLWA 1QJMA 2DXYA 3IK6B 1OIBA 5L3DA 2F78A 1POTA 3E6MA 3T1BA 4EF1A 1MH3A 3MP6A 1AL3A 3O6GA 5DEXA 1DPEA 4PQJA 1ZARA 2V1XA 3KFWX 3MPKA 4OIPF 1Q1KA 3ONMA 5L8DA 3GZ5A 2UXNA 3KOTA 1F9BA 4KICA 4LK1F 1MQIA 4IPAA 1URDA 3BPXA 1P1NA 4KR5A 3HTSB 3IB2A 1D8JA 2F34A 3R26A 2A69F 3WG9A 1BIAA 4LUBA 3HCQA 1M5FA 4M73A 1AIVA 4ENJA 3GFJA 3VOEA 4F31B 1P4WA 3CJNA 2Q8JA 2V93A 1NKXA 3CLOA 1FP1D 3P9IA 2ZNZA 3ZN0A 2X7QA 3QXMA 3GF2A 1FTLA 4OFOA 4Q5TA 3IWZA 1LVAA 3IL2A 1WDNA 5FTIA 2HEOA 3SXYA 3ABTA 1O64A 4ELQA 3JZJA 4KYWA 1R23A 4DCXA 5A5XB 2O1MA 4OESA 2RC4A 2L01A 2ZYNA 1JGSA 2L02A 5AE4A 3TKYA 2UVGA 4I1DA 4BH9A 3CR9A 2OWTA 2XUBA 1SMTA 3C3WA 4MFIA 1P4AA 2IW5A 2HR3A 3UORA 1IUYA 3KJTA 2ZJ2A 4IHTA 1FBQA 4R2BA 1X3UA 4F7ZA 5JTYB 3EUHA 3B7DA 1B9NA 1LB2A 4UV8A 4MGRA 1N3WA 2B3BA 4MEYF 4CDGA 4ELPA 4XSZF 1SD4A 1YW9A 3CO7C 1XVXA 1W5TA 5ED4A 3PD9A 3ZKKA 4FIMA 4WXCA 1B59A 3CO6C 1LCTA 1LAXA 4C1UA 1YTYA 3N5LA 4HF1A 2VT2A 1A40A 4OEUA 4L5JA 2RQPA 3VDFA 3ULQB 3FWEA 1BLFA 1B4AA 4LMYA 1OPCA 1M5CA 1LAFE 1O63A 4HX4A 1MQDA 3FVOA 4NF4A 5FB2A 5FHOA 5H8FB 3ECOA 3HSEA 3A3UA 3CSBA 1DOTA 1ONVA 2VOPA 2QS4A 3F22A 5AA4B 2A68F 1MRPA 3CVGA 2H98A 1TT1A 2V3TA 3SEUA 1BC7C 4UHTA 1SQYA 4F1VA 4YMAA 2A3SA 2P6TA 4WXDA 3LSWA 1XSDA 3BP8A 1OLCA 4LVQA 4LLNA 1ON1A 4Q0CA 4BNCA 3T8RA 4EQ7A 1USYH 5HS7A 1DTZA 3I53A 2EV0A 3I59B 2R6GE 2PX1A 3V4GA 4PFWA 3V8LA 1YG2A 2VGQA 1IIWA 1MQGA 4BHCA 5I2KB 4RPOA 3LA2A 4ZEIA 1OVTA 2XAJA 5IAIA 4KI0E 4G8MA 4IO2A 1CGPA 1L5TA 3UGWA 4RB2C 1JVXA 1LNWA 2STTA 1GGGA 1DMBA 2KJBA 3FF5A 2UXXA 3ZN1A 3KOSA 5F1RA 1D8KA 4PFUA 1ELJA 1MH4A 3TMGA 1ZH5A 3O9PA 3CIJA 3ZMTA 5D8LB 4PFTA 4EF2A 2A5YB 4U0YA 1JW1A 3PFIA 2REGA 4JWXA 3JW4A 2DO7A 2IA0A 4BLAA 3G3FA 2QS3A 4JK1X 2DI3A 3C34A 4A5MA 1T39A 1B3GA 4F18A 4JBZA 3ILTB 3U72A 5TPAA 3F3XA 3H03A 2ZNTA 4GLIA 2XKPA 2D1HA 2G7HA 3H6UA 4GCVA 2QMWA 4XTCQ 1BI3A 2DK8A 2DU9A 4WF2A 3RPQA 2CQKA 4BAYA 2IT0A 1J2XA 1OYYA 2ALUA 2XXWA 3FMRA 1B9JA 4H8JA 5BPDA 3HRMA 5DT6A 1ODDA 1LFHA 3LC8A 2QYOA 2REJA 3TZAA 2R7FA 3IC7A 3MWMA 1PBQA 3FXQA 2Z33A 2QBYA 4KFQA 3WGIA 2IEEA 2NYXA 2UXAA 3LSTA 3RTWB 3DQVC 1QQIA 3HHHA 4OXVA 1QUKA 4R74A 2DPDA 2I0CA 2O6GE 3MVWA 3KE2A 4BDQA 3HHFA 4PE5B 3RDIA 1TBXA 3VFJA 1O3QA 3W9WA 5F64A 1SFEA 2O84X 4G94A 3L2CA 4KPTA 1Y4TA 1CF7A 4ESWA 4Z0IA 3W6KB 4N9HA 3CUQB 1MY3A 2M30A 3MP8A 3DEUA 3MJNA 4YICA 2I49A 2H09A 4G7OF 3SESA 1YYVA 3EETA 3ZQ7A 3Q9SA 1J5YA 2OWSA 3O2PE 2RF1A 3QP6A 3PMXA 3MZYA 3BFUA 1FBSA 3SEWA 2G93A 5CM6A 3TCHA 5BMZA 1UTHB 4RGRA 2Y7PA 2NOOA 2XD2A 3U1DA 1I6XA 2W84A 5A2QZ 1DPUA 4O6JA 4Q4ZF 1MS7A 1XOCA 1U5TB 1STZA 3ZP5A 3FVGA 1FCKA 3FX3A 4RY1A 1J9IA 4FX0A 2VT3A 3CTAA 1A7LA 1L3LA 4QSDA 5B70A 5LRSA 4GXOA 3RPWA 2BGCA 3GXAA 3C31A 3WTTC 2V1DA 1I6BA 3QIMA 1AOVA 2V25A 1ZGJA 2IVMA 4JQFA 1LJ9A 4FATA 4H5GA 4OOIA 4YG2F 3T93B 3EPEA 1H3DA 2NS0A 3RKXA 4QSEA 1ZRCA 1B40A 3TTMA 1ZKBA 2I3VA 3G3IA 1O7LA 1XHYA 4NEDA 1MY0A 4ZDMA 3TFLA 2ZNSA 4IRHA 3MZ1A 2C6YA 2F5EA 1FPQA 3GW2A 4GXAA 3H92A 3WE2A 4ZS9A 1QO0D 3JTHA 1HSEA 3NEUA 4YFXF 4R6YA 2LF8A 2J5PA 1UB9A 4RAZA 3VEPA 1VSOA 5TP9A 4U22A 2FOKA 4X9TA 1D9VA 5L3FA 4G2ZA 3F8MA 3IRRA 5FLXZ 1S29A 3B6TA 2DXRA 3SFZA 4KNYA 3HSTA 1FT9A 4PGGA 4MTEA 5I58A 4NTLA 4UACA 2PBIA 3NQOA 1JW4A 1S6LA 4L0YB 4LLLA 3LAJA 4RXLA 3LSXA 4PP0A 2H5YA 3EF7A 2HQ0A 4EJUA 1ZHFA 1KU9A 2P6SA 4KFCA 3GZ6A 1P92A 5D5XB 1O7TA 4ZECA 4R6HA 1QKBA 1FC3A 3W6JB 3O3KA 2Q89A 2EV5A 2XX8A 4A2UA 1BN5A 2D2WA 1C0WA 2F5XA 1B7HA 3G3ZA 4KYSA 1Y3NA 2XXPA 3HHGA 2Q2EA 1U3EM 1EU8A 3F6VA 3PUVE 1UHWA 4EGZA 3M3LA 2H94A 3N6TA 2OAZA 3AAFA 1OMPA 1FTMA 1HQCA 5HS8A 2OLBA 4PGHA 4X1DA 2HZLA 3EYIA 3GO5A 3ZMUA 4HA8A 4JSOA 2PI0A 3VV5A 4DNCA 1A55A 1O3TA 5FTHA 3WU1B 2E7XA 4XBFA 5IKBA 5KCJB 3K01A 5K2XA 2QLZA 3R6UA 2F7CA 1FY7A 5J1DA 4HCWA 3WTVC 3V7SA 4LZ8A 1IUDA 3KG2A 4OVJA 3Q28A 1FBUA 2K4JA 1QVSA 5KK1A 2DWAA 4XLNF 1B2HA 4FHTA 5I59A 5A2QK 1NH7A 4H6DA 3IOWA 3ERED 3LA7A 2VN2A 3ILUB 1XGMA 4C1TA 1GR2A 4DXBA 4P11A 1H0MA 3K6VA 4F22A 4XKNA 3E6CC 4ASNA 2Y7KA 1VTNC 2ZYOA 3FASA 5CMCA 4ESXA 4DXCA 4EJOA 1KYWA 5DVFA 3F8BA 4JDFA 1NNTA 1MY2A 2XXIA 3QOPA 4F39A 2HKXA 3F6OA 4ND9A 2F8DA 1URSA 4U21A 5I57B 3TOAA 4GGGA 1KA8A 4QWQA 4YFNF 2ABHA 3T66A 3WU0A 1IEJA 2XROA 4MF3A 2W85A 3FJMA 3RJPA 4KUMA 3RYRA 4OERA 2XXYA 5L9MA 4ESBA 1B1HA 4IGRA 3P7NA 3TO6A 4ZZDA 2Q0OA 5CVUA 1ZGAA 4LB6B 3TQLA 2P8TA 3GZGA 2XHKA 3IO6A 3IORA 2HAUA 3FVKA 2ZMEB 3U93A 1A54A 2AXLA 4RB3C 2PG4A 1P2FA 3VB2A 4U7DA 3N97A 2HZKA 2Y7IA 4HDVA 3C35A 4OFLA 4HTGA 1UFMA 4L9JA 1MM6A 2XXTA 2WV0A 1MPBA 5FLXK 1B52A 5LGUA 1K78B 1TFAA 3KSXA 4F1YA 4XSXF 1LCFA 3S9LC 1TNTA 1TNSA 3MAJA 2ZYMA 4OEVA 3ISPA 1UIVA 1FTJA 4FT8A 4FX4A 4HLXA 1OMIA 1REPC 1LQ1A 3LA3A 1ZLJA 1UIUA 1SI1A 2EJRA 3GYHX 2DE4A 2B0LA 1MD0A 3DLNA 2OD5A 4M72A 4MEXF 3JSPA 3SQNA 3V5AA 4YFKF 1JXSA 4EQQA 1GVCA 3TTLA 3DV8A 2OBPA 3TCGA 1ANFA 4NMYA 1BKAA 1PP8F 5K5OA 2PMHA 1KWHA 1MJAA 2BE5F 1WRJA 2VXZA 1A04A 4NF8B 2LSOA 1T0FA 3F11A 1E17A 4ZZAA 4ZEDA 4EM0B 4P9UA 3DF8A 3C32A 4R9GA 3O6BB 2CG4A 4G4PA 3IHUA 4B09A 1Y0UA 3IOTA 4OWDA 3KLNA 1SW1A 2Z8DA 1XGOA 1M5DA 4C0RA 3ODBA 1V4RA 4G8HA 4XXUA 3QK6A 3V8XB 5AIPA 3REOA 1JHHA 5AA3A 5ICCA 1EH3A 2I4BA 1OYIA 4FORA 2GA1A 1JVYA 3OSRA 3K0VA 2HTSA 1MJBA 4ZYGA 2DK5A 1OQHA 4GIZA 1UHMA 2HGCA 1ULYA 2D1VA 4RJZA 3G3HA 4Z7EA 3K1NA 1SD5A 3F8FA 4HDUA 1S8NA 2P1SA 4NE4A 5TPAB 5DVIA 1I5ZA 1B5JA 2O7IA 2DS9A 2JT1A 3TGNA 5LLQA 1D3KA 2ONKE 1G3SA 2WTEA 5DCMA 2EA2A 2F6PA 2QS2A 1A8EA 1XMKA 2ZXTA 2MLGA 3OO6A 3QSLA 3FV1A 1IRGA 4CXFA 1I69A 1IXRC 5L3CA 3PUYE 4OHNA 1ON2A 4LQ5A 1MKMA 4H5FA 1DSNA 3TPAA 4TOZA 3KP5A 1XMAA 2JPBA 3K4UA 1N04A 2XAGA 2DQLA 3Q26A 4DLDA 5E1ZB 3E3VA 2F7AA 2Q9TA 4R72A 1KQ0A 3S4UA 1ZAOA 1Z7ME 2DVCA 4U23A 5KZTA 1W7PB 1MXZA 2DLLA 1L0OC 2IA1A 1S7OA 2GHAA 4BYYA 4YKJA 4OYVA 2DFIA 1D3YA 2FMLA 3D0SA 3KEQA 3VFZA 3O6IA 1SYHA 1B3HA 4JXIA 4RK9A 4A0ZA 1B0HA 3TTNA 3CDHA 3HV1A 5CLSA 3I58A 3PV0E 4P0IA 5HS9A 1MQHA 1IITA 4HV6A 1Q35A 4GF8A 2VC1A 3U2RA 2HZTA 3IOUA 4IO6A 4M4GA 4CZZA 4O5VA 4BDNA 1B6HA 3K9TA 4R79A 4ONYA 4I9DA 3TUSA 1PBPA 3MZBA 5LOMA 1YS7A 2YR2A 5DDGA 4CGZA 3CUQC 3MW0A 1FQCA 4I8CA 5FO5A 2FMYA 1AH5A 1P4XA 1URGA 5BWJA 2DWJA 4G77A 3IJOB 5KDTB 3KN3A 3GEZA 3N94A 3E97A 3KZYA 3ZPLA 3W15C 2VE8A 4AQ4A 2H6CA 5B7DA 2E1NA 1H9GA 1IXSB 1Q1HA 2ETHA 1LBBA 2BV6A 1KYZA 2Q2CA 3ZMSA 1QNTA 4F2QA 4OMBA 2NNYA 1B32A 3S9EA 4I09A 2D21A 3KP7A 2P5VA 4K2EA 2XX7A 3EN3A 1LAHE 2HCAA 4A5NA 1BIYA 1U8RA 1MDMB 1HKTA 3QYTA 1J0RA 2ISYA 4IJAA 4TLMB 4DIGA 4WEDA 3QUJA 1Y9UA 4KMUX 4P5OA 3C33A 3T9VA 4G8XA 3BOQA 5ICFA 4KDPA 1WVJA 3THIA 1R36A 3LWFA 3SHFA 1QKAA 2FQ3A 1A8FA 4FEBA 3U9GA 1P1QA 4FECA 1SFXA 2ZXJA 4KD5A 2GXBA 4KCCA 1CE2A 2GIVA 3OO9A 3V83A 3C9HA 3BFTA 3GFIA 5I84A 3GBAA 3GXOA 3M1EA 3MCZA 4LD5A 4EJWA 2M1BA 2QQBA 4AIHA 2G9WA 3OELA 3E5QA 5FD5A 2PT2A 2RC8A 1DUXC 1SDXA 1QZZA 3IKVA 1JE8A 1OR7A 3C1DA 1WODA 4U1ZA 1LFGA 3RQTA 4QSCA 1JHFA 2P0SA 2A6HF 1RUNA 4NWCA 2M8EA 1HW2A 3T8TA 4YIIA 2F5DA 1O57A 5BPIA 3N6UA 3IX1A 4HQEA 3PUWE 2KIFA 4A6DA 4Q5SF 4GOTA 2IPQX 1B3FA 2PT1A 4G9YA 4L5IA 4M1VA 1MM7A 5H8NA 3DP7A 4GWOA 3F21A 1LDDA 4L9NA 4P96A 3GFMA 1FQDA 2DE2A 5BOXA 3CG1A 4OTEA 1TTYA 2ZO4A 3KEOA 3KZGA 2RGVA 4G68A 2VONA 1PB9A 3VE1B 4E0XA 2YJPA 3K02A 4U1OA 1TQMA 1N0TA 3SEYA 4M9SA 2VBWA 3OOAA 3R7XA 3QUFA 4GQOA 4QLCU 2UVJA 5JI6A 2X26A 4L9VA 1QZYA 5I56B 5EEHA 3OXNA 5M2VA 2MBFA 1B3EA 3BBRA 4RYAA 3H6WA 5I2NB 1R58A 3TODA 2FBKA 3O97A 3MZ9A 2EFQA 3K00A 2UVHA 4AB5A 4UVBA 5J8FA 3I71A 4F29A 4RB1A 4UXNA 4IVNA 1M5BA 1UTBB 1B7ZA 4ZYHA 4OENA 2LNBA 3K2ZA 3S9NC 1PEBA 5DYHA 3E5UA 4RGUA 1R1UA 4FJPA 1RNLA 1J59A 4O3AA 2THIA 5I59B 2QUFA 4FEDA 2CWEA 3J81Z 4N6PA 4R73A 2OJTA 1G3WA 4FAJA 1P6RA 3LQQA 5HDNA 4DE8A 3HIFA 4ESFA 3WTUC 1RIOH 3G3GA 3HO7A 3E13X 4IRIA 3KP3A 1BC8C 5AIQA 4KQPA 3KFMA 2XXVA 4ON0A 5AA2A 2GQQA 3RNNA 4I98B 1QBJA 1USYE 4BDRA 2Z3YA 2ZNYA 4LG0B 4DZ1A 3TDUC 3EHUA 1XC1A 3PPPA 3MAMA 4MTDA 4LZ7A 3C4MA 4PETA 1ZJLA 3GX4X 2BYVE 2WC2A 1GVJA 1XT8A 3RT8A 3MEXA 4AWXB 5FFXA 1XS5A 3I5UA 4LP2B 3BROA 1MDQA 3S9MC 1T38A 5DD4A 4YIFA 1YO5C 3U92A 5FFZA 4IGTA 3USDA 4LZ5A 1ZG3A 4K3FA 1QW0A 1G6NA 1R9QA 3V7CA 5JK4A 1IZ1A 4N0BA 3KBRA 1MZBA 2V6CA 4I01A 2VE9A 5BUUA 2A5TB 4M6XA 1USTA 4B8XA 2PEXA 2ONRA 3VLUA 4X48A 5AA1A 3O29A 3T9UA 1POY1 3IOVA 6PAXA 4RA1A 2PMUA 5D6FA 5DVJA 2F5FA 4L18B 1MQJA 3JSOA 1XCBA 4NQWA 1G3TA 1ZYRF 4IO4A 4ELRA 1LFIA 4A6EA 5D8KB 2HFHA 3VLVA 1LGBC 3KEIA 1I1GA 3FD3A 4WXHA 4RS8A 4EQBA 3K0LA 2CFXA 2VOOA 5CMMA 5L3EA 4ZZLA 3VODA 2Y48A 1N84A 2P7VB 1IRFA 3SETA 1B9MA 3H4ZA 3K1MA 2DPUA 4ZYEA 3RT6B 3TKDA 3CFZA 4QRZA 2P5LC 4ETSA 3IB0A 2KKOA 2IP2A 5A5XA 1R7JA 1IN8A 3GLXA 4UUVA 2XXXA 3KZZA 4R1HA 1HKQA 3H6VA 2QS1A 5H8QB 1HW5A 1Z9CA 3R6SA 5K5QA 2QL3A 2DE3A 2X4HA 4UA8A 3CI8A 5DV5A 3KN8A 2COMA 1YFHA 1Z7NE 1J7KA 4G68C 2PLYA 1Z1DA 1Z91A 3ECRA 5JTYA 4NF5B 5LGTA 3RUMA 1MPDA 1W5SA 2I4CA 4PZJA 4G6DA 2ANJA 4WXJA 2M87A 2A61A 2DSFA 1MDP1 3ZS6A 2HTJA 3FGSA 2XGXA 5HDKA 1MXUA 2EB7A 3Q9VA 5ERIA 1OYWA 4EV0A 3TAJA 4NHJA 1ATGA 4E0WA 4H8IA 2MH9A 5HOOA 2FNAA 4OMYA 5D5UB 3CG3A 3BJ6A 1TLHB 1XGSA 4N9IA 5K1YA 3J81K
chains in the Genus database with same CATH superfamily
4NF6B 3RGYA 1Z21A 2MGQA 5DD8A 4ZEBA 5H8FA 1B7UA 1VQ5I 2Y7WA 1MXWA 1VQKI 5H6RA 3TQWA 2I8DA 1QULA 4NF0A 3O6HA 5AA4A 2XGDA 1B1BA 3FHNA 3L2WA 3OSGA 1KU3A 2XV4S 2Q74A 4I7HA 4TV7A 5CVRA 5E17F 1JJ8C 2RCAA 3LFKA 3MD2A 1WJDA 5H8HB 2L9RA 4IY6A 3KN7A 4NC6A 2K4BA 3LL7A 3RKYA 1IN5A 1TW3A 2IJLA 2OJED 3C36A 1Z7UA 2AQEA 3R0AA 2VKHA 1YIOA 2P5KA 1H9TA 4YB7A 4YKIA 2VD2A 3ZMDA 3L09A 2CUZA 3R4KA 4HZFA 2GRVA 4OZ9A 1RKTA 1RZ4A 1TT5B 4M6YA 3I59A 5E1XA 3ZGKA 4CA0A 2JQ7A 1GTKA 3PD8A 1MJ9A 1WZ2A 1RUOA 2IRFG 1YCJA 2WBDA 4H1XA 4AUXA 1XC5A 1A6QA 2RN7A 3DM0A 3VPRA 3VVDA 2FEZA 5I2KA 3FXBA 5DEXB 2NVTJ 4P9KA 4O7IA 2JJKA 1S50A 1GHCA 1CB6A 3ABKH 1H88C 3JV9A 3A09A 2HQRA 2OCCH 5ILSA 1YQAA 5DCFA 2EK5A 1Y8RB 5DTDA 3RI4A 1IXIA 4KJZA 4OIQF 4FE7A 3M8EA 5EQAA 2XRNA 1W0UA 1G8XA 2IA2A 3N05A 3H9GA 2GOMA 2IGKA 1IXHA 1KZHA 3TO7A 2HKOA 3G1MA 2VPOA 2F3BA 5C3EJ 2WX9A 2DA1A 3CP2A 2WB1A 5AA2D 3JREA 1FPEA 1WH5A 2KJCA 1SANA 2LY2A 3EQ1A 4OFJA 1ZREA 3E4RA 2FXAA 4WK8F 2X1CA 4QBAA 1U0JA 3KZIC 4PFBA 1D1AA 5AONA 3M4OJ 4XKRA 5EYRA 4WCGA 1DTGA 2OTLI 4C3HJ 1M5EA 5LGNA 2V9VA 4ESJA 4IO5A 3PU5A 4PFYA 1NV2A 2O7OA 3WGGA 2OF7A 3LFUA 1B4ZA 3VVEA 2KIUA 4I0BA 5LEKA 2DT6A 2AHQA 5J6XA 4OQOA 1B46A 1YS6A 1PB7A 2XIGA 2NAZA 1QPMA 1U9NA 4KCDA 3J7ZI 3MP1A 1K4SA 1P1WA 4G6QA 4OETA 1Q9DA 3P9CA 2DOEA 2VJIA 1Y0NA 4YAHX 5HNFA 4QFOA 4JBAA 3NRVA 5IT9Z 2PBWA 1YAEA 1D5VA 4E7JA 3I4MJ 3Q27A 3C7JA 3J7AY 1O4XA 3S2DJ 1V55H 3M8UA 2LH9A 4BL0B 3M9AA 2PN6A 4XLPF 4FE8A 1FW0A 2DTRA 2ZKZA 4GFRA 1LEBA 1R9LA 2CW0F 1JNFA 3LSGA 3VSLA 3DFGA 1YTVA 2R71A 4POXA 5L9SA 5ILVA 3BIHA 3I3VA 1D9YA 1A35A 2CMPA 1P7IA 1FZPB 2VBYA 4HSTA 3TDJA 2Z5UA 1JKPC 2VOZA 3KP6A 4HW0A 4DW6A 4BXUA 3OD7A 2CRGA 2ZFWA 3CUQA 2QQAA 3AFHA 4FQGA 2Z22A 1FWZA 1ZELA 4MNUA 4CYCA 1LVKA 1FJ6A 1MBGA 2ESHA 2ACJA 4N8YA 4Y17A 1VR5A 2JSCA 2ZXHA 2QEXI 1JETA 1JUMA 4ENKA 2GH9A 3K6XA 4H45A 2M9HA 3CVGA 5EEGA 3ECHA 4RM3A 3WODF 3PPRA 1F5TA 2Q8KA 3GWZA 1LBWA 1MXVA 4HW8A 1MMSA 5BQTA 4NF4B 4EQ9A 2MA3A 4PCQA 1K6OA 4ZYDA 1XN7A 4H65A 1FSHA 3L2VA 4PDKA 4DOZA 2O8KA 2FF4A 1SFUA 1UTHA 2UYFA 3HPIA 2M4KA 5D5WB 1GV8A 5ICTA 2ESNA 3U1OA 2B3FA 3BPVA 4LA9A 5DM6F 4AB6A 4MLQA 4XLFA 2TRTA 2QJEA 1YXIA 3LR1A 1S7YA 3ZRGA 4F3SA 1JQFA 1KQ9A 1RI7A 2HZDA 1ZU0A 1U5TA 1A36A 4RM2A 3ZKLA 2HS5A 3RKWA 1Z3YA 2E1CA 1VFEA 4BJTA 1SAUA 3OS1A 2I0BA 3V7RA 1P99A 1MPCA 4ELOA 2G7UA 3EDPA 4L9TA 4G8NA 1IJWC 2DJIA 2R0QC 4OWRB 4CCJA 1Y39A 4NAPA 4YZZA 5EYHA 3U94A 4AVPA 1UJ8A 2L4AA 3BTIA 3WE3A 1SD3A 1X4PA 5CVJA 1RESA 2DOAA 1ZIUA 2MLKA 1GT0C 1AMFA 2LBFB 1LDJA 3NWSA 2CV1A 2FX0A 5HLIA 2UWMA 4ZE8A 4F2OA 4M3DA 2F35A 3K2DA 3WHCA 2UVIA 1U6GA 2WV1A 3KP4A 1P1UA 2R8TA 4GX6A 3KCCA 3U21A 3SDGA 4PFIA 4EXLA 3GBGA 2FRHA 2K40A 2M0CA 3FXMA 4Y33A 3GTOJ 2D5WA 4LJZF 1SW4A 2IS4A 3LBSA 4ENNA 1N25A 3PPNA 3CFLA 3G3JA 2QF7A 4F3PA 2CW8A 4IZZA 5LEJA 1VFDA 1ZRFA 3HSFA 2D5VA 3QYEA 4LONB 2NOGA 3K69A 3RQIA 3N26A 2EV6A 1ETKA 1V54H 4AYBA 1XI6A 2FVZA 4GBVA 2RKHA 1G3YA 2VJJA 1BOBA 1FQFA 4PAFA 3FXRA 5D6EA 3BT9A 2X1EA 3B6QA 3MKYB 2LDUA 3HOSA 3OYNA 4H0EA 2V84A 4R6KA 4U4XA 1NMUA 5EYFA 4H46A 4XEQA 4V2GA 2V3UA 2XD3A 3PMWA 2WWYA 1QGPA 3HSRA 4C2UA 2KIQA 3TDZC 2B4MA 2DMPA 4RGSA 2OA4A 4LGWA 4LOCA 2QA4I 4F91B 3E6DA 1FPLA 1BP5A 4XIGQ 1WWXA 3B6WA 3I5OA 1D1CA 3OYDA 2ECBA 1ZGWA 1TW2A 1A31A 3DELB 1BR2A 2XXUA 3K6UA 3OO8A 2RINA 1MMAA 3CFXA 2R5YB 3FIWA 3G7WA 2DBBA 3KGCA 3KSJA 2BXZA 4M9XA 3Q29A 2HXWA 2MC4A 5F6FA 4U88A 3MQ0A 2R7XA 2VI6A 4P0GA 1EA3A 2IEKA 3HC7A 3GUDA 2QBYB 2YX4A 2K27A 5JLXA 4GWXA 2JWTA 1X58A 2I5UA 1QUIA 2O51A 3CRBA 1FRPA 4GL0A 4E70A 5LHIA 4HS7A 4OVQA 5T3JA 5IYBJ 4ZEFA 1IN7A 4LN5A 1B6AA 3T22A 3TYHA 1EH6A 4C2TA 2EFPA 3IP4B 4L17A 4HAMA 5IT9K 3OS2A 3SFIA 3HRTA 4S05A 1LEVA 2HWVA 2F48A 2EZLA 4BU2A 1FYMA 2RDPA 3OYEA 3Q25A 2X0LA 4NUBA 5ELVA 4B3AA 3OSFA 2L3DA 1NNPA 2I58A 3G3KA 3MVXA 2ZB9A 3DPTA 5HM4B 4B43A 4HF0A 3HJEA 2IGNA 2X1DA 1VQ4I 3ZQFA 3BKIB 3OENA 2OQGA 4I99C 5JLWA 4PAKA 2CEXA 2DMQA 1NFTA 1CF7B 2R9JA 2ELHA 4CH7A 4QFPA 4IHSA 2LF7A 2EH3A 2K02A 5IOZA 4Q48A 3B73A 3QODA 2I48A 4KN7X 3FVNA 1I3AA 5L3BA 2GZWA 1YLFA 2YX7A 3D5LA 4M3EA 3T5XA 3KETA 4DDDA 1UCRA 1KGSA 1S9HA 2KDOA 5IT3A 2EWNA 3JRGA 1XPXA 1AKHB 5J4VA 2PMSA 3CSGA 2XAFA 2Y0MA 4MNCA 1T2KA 1IV8A 1XDUA 4EM2A 4U2RA 1JKQC 2STWA 3R0JA 1EYIA 4R75A 3PPOA 1OFCX 2JTVA 4X1EA 2KIMA 3K6WA 3PIOF 3GMEA 4YB6A 2K5CA 2HPGA 2OK2A 1FTKA 1XGNA 2ZNUA 3RY3A 2X51A 3TQNA 4W97A 1DPPA 5K7FA 4D0PA 3QPTA 5KCJA 5H6QA 2PYYA 3E9XA 3JYRA 3IAS2 4KYDA 1K6YA 5DUKA 3MC2A 5JEIA 3HRUA 1SYIA 1VFCA 1BI1A 4EM1A 2JA8J 2O03A 3EUKL 5E8IA 2KL4A 1JP4A 3PGFA 4CUGA 3M8JA 1TWAJ 4MQVA 4Z2YA 5M5XJ 2HOSA 2NNNA 1A6IA 1NV0A 3H06B 1BBYA 1S3JA 1SVLA 1SI0A 1J1NA 1TFDA 4I0AA 3HB9A 3Q0WA 3KC0A 4H67A 2A5SA 2O5RA 4PF8A 2HFBA 3IFCA 4H0WA 3TTRA 5TRDA 2H99A 1XCVA 3EQLF 1LUJB 3JAMZ 4EDPA 1UQWA 5LD2C 2QSHX 4UVAA 3RKQA 3PUZE 2F2EA 3D4GA 3AG1H 4ZC3A 4EUOA 1BOAA 5H2FC 1IXCA 1LFBA 3CMAI 4HLYA 4Q8RA 5FLMJ 2K86A 3FXJA 4ISUA 3FJGA 3S3MA 1MY4A 4GYIA 1X2MA 3DKXA 3S2WA 4ZEKA 1U5TC 2ZCWA 3VYUB 2VQCA 2Y7RA 4IF4A 3B02A 1SW2A 3FUZA 3GLLA 1OQGA 3SEXA 3MKLA 4FETA 1KU2A 3X2QH 2NS7A 2W82A 2E5NA 3GTQJ 3OMBA 3KLOA 4GRIA 2HEUA 2VLAA 2CQXA 1LFPA 1ZN2A 3Q0UA 4IRGA 3CZ6A 5I57A 2YSRA 4G12A 2V1UA 3GYYA 3HG9A 2LRDA 3RPLA 2RV8A 1LEAA 3BTCA 3T96B 3QAXA 2EFWA 3VXBA 3PUXE 4KT6A 1OQYA 1K9YA 2RCBA 1EZ9A 2FA5A 4D9JA 2A07F 2IGOA 2NVXJ 3QAHA 3P7IA 4HOBA 1IQ7A 4GD5A 3IB1A 3S93A 4IOCF 3L9FA 2HQ5A 2ZXWH 4UUSB 3OV8A 2NWJA 2TDXA 2B7EA 4E6KG 3VVFA 1V3FA 4ZH4F 2PJRA 4II3A 1EH8A 2R7ZJ 4LK0F 5EGOA 3T0YA 4QFNA 1N7WA 3VWBA 4OANA 4HX8A 3WHBA 4A0XA 5TP9B 1B1XA 1BM9A 3WAFA 1SD7A 3SKPA 4QPOA 3I0TA 2ZMEA 4PSXA 1R71A 3BC8A 4BY1J 3HFUA 3L6GA 2RKMA 2VUMJ 1RDXA 4ZE9A 3R60A 4KA4A 1JKRC 4PJ0C 1CQTA 1B4HA 2QQ9A 1GV2A 1XMXA 4XKPA 1BA5A 3VSKA 1S9TA 1HBXG 1IN4A 3CMEI 5I58B 3B8BA 5E1WA 5HVQC 3MFKA 3BG3A 4RAFA 2HHMA 5IY5H 2M8CA 3OR2C 4IO3A 5HLGA 4HXVA 3IWFA 2VP1A 1B05A 2O68A 5DUIA 1K78A 3ZQGA 1J75A 2FBHA 2R7DA 2NVUB 2W24A 3U1KA 1VQ9I 2ZYKA 4DCYA 5H20A 2DOJA 2VBXA 3WTXC 2XXRA 5J1UA 3PMVA 4R8HA 1BI0A 1BW5A 3BZ6A 4KIBA 4NGUA 3T9HB 2DQRA 4G7HF 1FTTA 1HSLA 3IO4A 4F92B 1T33A 5IM2A 3JTGA 4A3FJ 3BDDA 1FOWA 4EATA 1W0TA 2OZZA 1S5LC 5LHGA 3L7WA 4I2OA 3IJXB 2EIJH 2QVOA 3S1RJ 3HN0A 1IN6A 4Y7NJ 1FQAA 1HW1A 2QPQA 2CYYA 3A2KA 2O3FA 2Q2EB 2KLFA 3TBIA 3M3FA 3ZQHA 5F1JA 2PVUA 5E20A 3CCMI 5ITOA 5CPRB 4IY5A 1YHQI 3BR6A 1NNFA 3DPUA 3OWTA 1G4DA 1ETWA 1I3QJ 3PQJA 2V3QA 4N8GA 3AG4H 3KYLA 4I6ZA 1S7AA 2QENA 4EJVA 2GXGA 1WJFA 3MKZA 1VI0A 4IO7A 2LP0A 3D5SC 1NH8A 4F3GA 1U2WA 3A4CA 3CJRB 3D1RA 4I40A 2F36A 3QQAA 3ZSFA 2CZLA 4NF8A 2O8XA 4M74A 1TWYA 3F9KA 3FBPA 3SEVA 4L0ZB 1FTOA 1NV4A 1TXFA 1IV6A 3F8NA 2ELJA 2OCUA 2QSXA 4JOMA 2KMUA 1GXQA 2N8GA 4Q0CA 2H4IA 4CO8A 2V9PA 2EQRA 1NNKA 2HVRA 1WSUA 1AOYA 4V2FA 5E3LA 2LD5A 1QHGA 4G7ZF 2XXKA 4WKMA 4HPQA 4GL8A 1N7XA 3EHSA 1IAWA 4O3BA 4IQ4A 1T0KA 5ISUA 4A3DJ 3GVAA 2WAEA 5E8GA 4Y3OA 1LB9A 1XD7A 1Y4CA 1R1NA 1T98A 3H3UA 2KR0A 3OYGA 1B72B 2RC9A 4BY7J 2L54A 2CSOA 2ZZXA 3MWBA 2OZUA 1LE8B 2J5OA 2YPNA 1WFXA 1SC7A 4CHUA 3FZVA 2I3WA 3U65A 4IOAF 3HOYJ 3DPLC 4YEJA 1HF0A 1IXGA 3QRFF 4G6TB 5HLHA 5CVVA 2AO9A 2DA5A 2LC2A 1G0IA 3G1LA 1PC3A 3I4PA 5LBQA 4HBLA 2CO5A 4P9FA 4HF2A 1T6SA 2Z8EA 4TQUQ 2XAQA 4Y15A 3W3CA 1OLTA 2G29A 4PFPA 1U78A 4GXSB 5EHSA 3CESA 4P55A 2QCOA 4XLEA 2GA2A 2DQVA 3WAEA 1E3HA 1VE4A 1HSJA 1D0XA 3JAMK 2P7CB 4H4KC 1JT0A 4A93J 1HOMA 1NHAA 5GPCA 2OZ6A 3E5XA 2JA2A 4BDMA 4RB0A 2R7VA 4S04A 1IRZA 2V4CA 1TWCJ 2FJ1A 4HNTA 1W5CC 4RK2A 1R5GA 5D4SA 1B5IA 2HVQA 2H25A 4XRMA 2NXOA 4KHZE 5EQ7A 4BEHA 2ID3A 2QSGX 4MNPA 4N6DA 3CDIA 5J8CA 4RBOA 2HDCA 3T9XB 1FPFA 5F08A 2H1KA 2Q88A 4HNUA 4GWWA 1MNDA 1WJEA 2AIXA 2Z99A 3FM5A 4POWA 1Y3QA 1YX5A 4PBHA 2CS3A 2EPFA 4A0YA 1ZLQA 4YKPA 2IAIA 4JWOA 4YU0A 4RAYA 2O7UA 3OEMA 1Y3PA 2M45A 2XPWA 3IRQA 2JPCA 3MUQA 3JR9A 2MG4A 3H5NA 1LDKB 5LHHA 3AG3H 1XS9A 1UAAA 4A3JJ 3MZHA 2DVZA 2R3SA 3RTFB 1R6ZA 4ZZEA 3MZ8A 1W7PA 2FSWA 1DDNA 2K3PA 2O6AA 3ABLH 3RTRA 2P3VA 3DXJF 4OVSA 2F5VA 1NG6A 4CICA 1XVYA 1H44A 4XQFA 5DM7F 2FA7A 3RQ4A 1KU7A 1QUJA 3LV0A 5DTBA 1ZBMA 1Z6TA 2HYJA 3ML6A 3IAZA 4KIFA 4YMBA 2OUMA 1H43A 3TEPA 1FP2A 2JVGA 1ENHA 2EFNA 1Y1MA 3U8QA 2BJJX 2XWIA 4XM3A 4FBPA 3EUHC 1JJ6C 1NL5A 2L0KA 4PF6A 4A3GJ 1ZRDA 3C2GA 2RNJA 1OKRA 2LREA 2CGPA 3BY6A 3L6HA 4F3BA 2HQAA 2VIXA 1RYOA 1WHUA 3I54A 4C3JJ 2QVVA 4N4UA 4LLGF 3RZDJ 3CLQA 2L7FP 1LSTA 1SBPA 2UZKA 2PJPA 2JA7J 1P1OA 5HBCA 1FOKA 2D3IA 2XXHA 4O3MA 1FYKA 2ZMEC 2I6EA 3H3GA 2VBZA 3K1PA 3IH2A 1N76A 1K7AA 2VKEA 5KCMA 2ZSHB 2GWRA 4C9YA 4B44A 2FE3A 3ABUA 4LIUA 1JKOC 1LLSA 2DMUA 1FMVA 5CQEA 2W1OA 5FKNA 4BKXA 3HOUJ 5KDTA 1RC9A 2A5WA 4GO1A 2YPRA 4QXDA 4EMSA 2LYCA 3TCFA 3L00A 2JRMA 3CQZJ 3LQRA 2IA4A 1R9TJ 2PMZA 1MBKA 4PCDA 1B5HA 1PDAA 2H8WA 5KVRA 4A3BJ 5LTCA 3J80Z 3PO2J 3R61A 4IHVA 5D5VB 1EV7A 3BWGA 2V79A 1FYLA 3H3ZA 4QHQA 4BDOA 5ICQA 2BVLA 4A12A 4D7MA 2R7TA 1Z05A 2HNHA 3EYYA 2QMXA 4UB6C 1IMAA 1B51A 2Z23A 4P8BA 4N4NB 5FGMA 3E0JB 3O8HA 3TOBA 2JMWA 2QRYA 5IZ3B 3UN6A 1MDMA 1N3XA 3A3CA 2HI3A 2HAVA 1R4MB 3E1SA 3FMQA 1W36C 2FYIA 5FHMA 2E71A 4MH5A 1R1TA 1SAXA 3OSQA 4F1UA 3RLFE 2OCEA 2F7BA 3FM3A 4KN4X 1JEUA 4I3EA 3WTYC 1R5HA 3K4CA 1VQNI 5HDGA 4AIKA 1YITI 1P9QC 1GDTA 3HRSA 3D4CA 4JX6A 2FNCA 2FBIA 4XKBA 2DXIA 2ZZWA 3LUYA 2EA4A 5JHFA 3HKZA 5E3OA 2JK3A 1E3OC 1I27A 4HX7A 3K6GA 4DXUA 4HQMA 2AS5F 2GAUA 2HOEA 3B6AA 3HOZJ 5GTHC 1XSVA 3RPUA 3UP9A 4LFUA 5CMBA 4YKKA 1YW7A 2X6WA 4CZCA 4R2FA 3FIRA 4ZYAA 3CCEI 5CI5A 3FXLA 3BJOA 4OMZA 1DBZA 2DW4A 2ID6A 2XAHA 2RAEA 3CUOA 3DLAA 4M3BA 2ME0A 4GYGA 1KA0A 3O66A 4KT5C 5IYCJ 2LVSA 5DCMB 1RKMA 3MVZA 4UVCA 1APLC 1SVMA 1HSTA 3PSFA 5BS6A 4A3MJ 1M1EB 4ENMA 4JB7A 4HEA2 3SZPA 1K83J 2L5QA 5C44J 3PTYA 4EVIA 4D7NA 1IF1A 3C2HA 2ICWG 4F19A 3OO7A 4EGYA 3OYBA 2ZC2A 1PP7U 1HKSA 4OU0A 3BJAA 5GAGJ 4E7KA 4U0VA 4XKCA 2WY7Q 5DYMA 5KHDA 4IB2A 2X6YA 2K9SA 1XDSA 2QKLB 3QU3A 3QWLA 3WGHA 1F1ZA 5F1QA 4BUPA 3IR1A 1GUUA 1MBFA 3JRFA 2O69A 4DQ2A 3OEKA 2ELKA 3OYCA 1DK4A 2NRAC 2VODA 2A05A 4EXKA 1N78A 3MN2A 2IXSA 2K9NA 3PQKA 3Q5FA 2Y5KA 2KRFA 3F8CA 3JRBA 5GP9A 2O0YA 3TO9A 3LSLA 1EZOA 2BY2A 1E2XA 2QVUA 3ZMVA 1SFKA 3UIFA 5CQGA 3DP4A 4KYEA 2BVMA 2EFOA 4WX9A 3A01B 2XXQA 2Y5LA 2RVCA 2NVYJ 3QU6A 3ROUA 4BXXJ 2DWHA 2Z8FA 3GCMA 1X3WB 4IHXA 3SDFA 3M3KA 1F9NA 2KISA 3HYIA 3P9KA 3HM5A 3WTWC 4I02A 1FLIA 5ITPA 4XN3A 3TELA 2CJJA 1OVBA 3UK4A 2MC3A 1FQBA 1NV1A 1O3SA 3EHTA 5CYVA 2QM3A 1N77A 3COAC 4MEVA 2H6BA 5FLVA 2WA0A 4RGXA 1FPJA 4N13A 4JVCA 1O3RA 1EH7A 2VQGA 1ZLKA 5TU0A 3ZMZA 5E18F 4X8RA 5D4RA 3LAPA 3KC1A 3K7AJ 3RYPA 5F0CA 2NUVA 3H0DA 2R93J 3H9JA 5I56A 1PB8A 4XFEA 1B3LA 4MBPA 4F93B 1ZG1A 4EJTA 3RN8A 1ZG5A 2QZ8A 3TW7A 4QF9A 3GZNB 5E79C 1EJ9A 2ZBKA 1OLAA 4RNSA 3I4NJ 4HE0A 3VXCA 3M8FA 4THIA 5I2NA 2R7SA 1PUEE 1A99A 4KISA 4BDLA 2HYFA 4JWYA 1SD6A 3KP2A 4Q30B 3TTKA 2DP8A 1W4MA 2K7LA 2OQRA 5JHUA 2AL5A 1TZLA 2XVCA 4G61A 2LKXA 1AWCA 3S32A 1UTBA 4AD9A 3WTZA 3FATA 2BBYA 4LB5A 5EZHA 4MHGA 3S1MJ 3FV2A 3GFLA 1I1SA 3BG9A 2CUJA 1I6AA 1IW7F 2DA4A 3CCRI 1NV6A 3TMOA 1XTAA 2A6EF 2EIKH 2MABA 2V9KA 4MFDA 5JR3A 2YU3A 1BI2A 1FIAA 1ZTYA 4AIJA 2F6GA 2QSFX 2MH2A 4BHPA 3HUGA 5FHNA 2RREA 5FKMA 4QFKA 2Y75A 3PUBA 5TJJA 1H76A 3CCUI 3UA8A 2DFHA 1JW5A 2VQLA 5L9OA 1W7PD 4IXAA 2CV2A 3J80K 1ZMGA 1MG1A 4PC9A 3PUFA 3H9QA 1QU3A 3J7AO 2QWWA 4CYDA 2OU2A 3BR3A 4LQ2A 5CBRA 1IMBA 4Y52J 4PGNA 1QA6A 3T0JA 2WEFA 1LBCA 5LRRA 2Y84A 2LKPA 2F5CA 1F4KA 1II5A 2VD3A 4LATA 1MXXA 1US5A 2OBGA 4LG0A 4XICA 4N07A 1I50J 1WGXA 2VHAA 2VKDA 1Y20A 3IH3A 2QFLA 3OYLA 3QP5A 1EYKA 1SVXB 3ZQCA 2HOTA 3V8KA 5EQ8A 3MVPA 1Z6RA 4UV9A 5M3FJ 1I6QA 5M3MJ 2O61A 2ADUA 2DT5A 4BE1A 2LAOA 3O2AA 3V89B 4MAGA 1SMYF 4E7SA 1FNNA 4U87A 3ABMH 3AXFA 1ZR4A 1Z67A 3IL1B 1O7FA 2DOFA 1BTJA 2CZIA 3GLBA 4JVDA 3E6BA 2D45A 1RDYA 3HOWJ 1HXDA 3K10A 3RYDA 1WJAA 5FD6A 1I6HJ 2YLNA 3D1NI 1LB8A 1BJAA 5K2YA 2WYKA 3V8JA 4RPNA 2DAOA 2L4MA 4XONA 2ONSA 5FBPA 2A5TA 3KPHA 3FHZA 2E35A 1WQ2A 1WVRA 3V42A 1SFOJ 1FX7A 3BR5A 1MSFC 2AYSA 1WI9A 3A03A 4UUTA 1DPRA 4OIRF 1Y1ZA 3CHGA 4BQAA 2CMOA 3IKTA 3W9VA 4ECFA 5HPQA 4HCYA 4X1BA 2DWIA 4F55A 5JVTA 2BXYA 3G73A 2GHBA 4M9ZA 3BQYA 2ISZA 4I62A 1TQPA 4QFLA 1YW8A 3O28A 4YB5A 2CUEA 4B3XA 1D4NA 5CVIA 1DP7P 1DCUA 2G0EA 2XKOA 1B58A 2E7WA 1RETA 5FJ8J 1Z77A 4U4SA 2M5WA 2MD5A 1K79A 2H27A 1B0LA 3VYSB 2RNGA 1XSXA 5H8NB 4WEPA 3SEQA 4FE4A 3OOPA 1UG0A 2PFBA 5F7VA 1IC8A 2ZSIB 1TQIA 2P4WA 2W25A 5EHMA 1F36A 3DU6A 4NHBA 4BACA 2HQNA 2JRTA 4R9FA 1R22A 1JEVA 5CRYA 4XRFA 4Y13A 1PDNC 1H45A 2XASA 4KIGA 3RPUD 3AL0C 1PUFB 5EF6A 2UYEA 3DEEA 4G68B 1Y56A 3I6VA 2GFEA 1R00A 3W2VA 2ME6A 1FQEA 3F72A 4OINF 4WWCA 2AL4A 4TLLB 3I64A 1IMDA 5FTHA 2VC0A 5F04A 3TP0A 3F23A 2Z9OA 5CJ9A 4CSWA 3DKWA 3MPLA 3HTUA 2W7YA 2X7PA 3MQ9A 3SERA 1YPNA 2DODA 3A1YA 4MQ9F 1TWFJ 5JFRA 3LSFB 2DFFA 3QPHA 5H8QA 1FPGA 1RYXA 2BW3B 3C18A 3W2WA 4XKQA 3KJ7A 5ICEA 2RC7A 4Z6YA 5H8SA 4BHBA 3E3KA 1GXPA 2RQQA 2XGEA 2F97A 2Q2AA 3N4MA 3GBBA 4HE1A 2DYXA 2L7ZA 3FJ7A 2WBBA 3M7GA 4XN0A 2XX9A 1NV7A 3VYRB 5K5RA 3FK7A 4OAYA 3DEWA 3BR0A 3WTSC 4NF5A 1US4A 2IBDA 1UMQA 1SVOA 1UZCA 1BIBA 2M3AA 3HBLA 2JZYA 4HV5A 4U0WA 4HYEA 4Q47A 5IP6A 4M71A 1QPIA 3HOTA 4E7HA 1U8BA 1SW5A 3H1CA 3PO3J 3DP6A 3H7MA 3TL4X 2VB6A 3FBIB 1R1VA 3MVYA 3H6TA 2Q8MA 1EZPA 2BEOA 2ZJPF 2FNPA 4NWDA 4M6VA 5L3GA 5I5PA 1LAGE 2XPVA 1FBPA 1MNEA 2GXAA 4DI3D 4V19K 1TC3C 2B65A 1MY1A 4ZTFA 3OL3A 1V5GA 2R7QA 2HYGD 1IRXA 3RIRA 2P2AA 3LSIA 2H9BA 2HDDA 5F0HA 1MXYA 2ZMBA 2KQZA 3MBPA 4UNOA 2FU4A 2B9SA 2O1LA 3IFAA 3S2VA 3FXOA 1BR4A 3ELKA 5IP9J 2P3NA 1IDZA 1FSEA 4NF6A 3DP8A 3JRAA 2W57A 3HGYA 4FISA 2XB5A 3SZTA 1USSA 3S3NA 4MJOA 4CCNA 1FJLA 1KQ8A 2HXRA 3PPQA 5AA2B 3FMSA 1A55A 2XSDC 2E1SA 1NK3P 2PQ8A 1WKMA 4KMFA 3H5AA 5DEQA 4NB5A 4MLVA 4NX1A 4BGDA 2M7AA 1XB4A 3JRIA 4O3CA 5CBSA 4OIOF 3A0BC 1EYJA 2E0SA 1MGTA 2VPNA 3SJMA 1JGGA 5M5YJ 5H8HA 3FXUA 4NBQA 4U7BA 5ILUA 5CMKA 5ICGA 4GVOA 3LSJA 5EYGA 2MYSA 3ASOH 3VLWA 1QJMA 2DXYA 3IK6B 2E2HJ 3OYIA 3H5RA 3WG7H 2DA2A 4BQQA 5FRMA 4DGWB 3S3OA 5L3DA 3OYAA 1OIBA 2F78A 1POTA 3E6MA 3T1BA 1UG2A 4EF1A 5FKOA 1MH3A 1CNQA 2PFYA 3MP6A 5KAIC 1AL3A 3O6GA 5DEXA 1DPEA 4PQJA 1UHSA 1Z0XA 1ZARA 2V1XA 3KFWX 3NAUA 3IAM2 4UB8C 4OIPF 1Q1KA 3MPKA 2HU9A 3ONMA 5L8DA 3GZ5A 2UXNA 4B4CA 2DA6A 3KOTA 1F9BA 4KICA 1LFUP 4LK1F 1MQIA 3M07A 4IPAA 2PCRA 5DW8A 3PL8A 1H8AC 1URDA 4MMPA 4MHFA 3BPXA 1P1NA 4KR5A 3HTSB 3IB2A 1FOXA 1D8JA 2F34A 2R5ZA 1ETVA 3R26A 2JN6A 1UELB 2A69F 2MW8A 3LSMA 1Q1VA 3WG9A 1BIAA 4LUBA 4NQWB 3HCQA 1MBJA 4M73A 1M5FA 1WJ5A 2CZKA 1AIVA 1OCCH 4ENJA 3GFJA 3VOEA 4F31B 2KHMA 1P4WA 3CJNA 2V93A 1NKXA 3CLOA 2Q8JA 1FP1D 3P9IA 2ZNZA 3ZN0A 1WJBA 4N4OB 2X7QA 3QXMA 3GF2A 1FTLA 4OFOA 4Q5TA 2DYRH 2F4MB 3IWZA 1LVAA 3IL2A 5M5WJ 1WDNA 2HEOA 5FTIA 3SXYA 3ABTA 4NDLA 1O64A 4ELQA 1YYZA 3JZJA 5EEAA 4KYWA 1R23A 4DCXA 4MLOA 2MSYA 5A5XB 3K70C 4PTKA 5GADJ 2KRCA 2O1MA 4OESA 2RC4A 2L01A 4HG2A 2ZYNA 1JGSA 2L02A 5AE4A 3K4NA 3TKYA 1YZ0A 2UVGA 4I1DA 4AVZA 4BH9A 3CR9A 2OWTA 4YIRX 2WAQN 5F0FA 2XUBA 1ETQA 5EG0B 1SMTA 3C3WA 4YRVA 4MFIA 1P4AA 2IW5A 2HR3A 3UORA 1IUYA 3KJTA 2ZJ2A 3FXKA 3L2QA 4IHTA 1FBQA 2L2OA 1MW7A 3S15J 4R2BA 1X3UA 3A02A 1FOYA 4F7ZA 5JTYB 5A5LA 1E0EA 3EUHA 2DFEA 3OIOA 3B7DA 1B9NA 1B8IB 4AIDA 1LB2A 5I3SA 4UV8A 5IZZA 4MGRA 1N3WA 2B3BA 4XR6A 3DU5A 2DDKA 4MEYF 4CDGA 2V6EA 1OCZH 1YRNB 4XSZF 4ELPA 1SD4A 1YW9A 3CO7C 2ZJQF 1W5TA 2BOLA 5ED4A 1XVXA 3PD9A 3ZKKA 2P81A 5IP7J 4FIMA 5I7IA 4HSRA 1B59A 3OR1C 4WXCA 1INPA 2TCTA 1T0FC 1FSAA 3CO6C 4XKVA 1LCTA 1LAXA 4C1UA 4XOTA 1R4NB 1YTYA 2GLOA 4GX4A 2E36A 4YELA 3N5LA 4HF1A 2VT2A 2VJ4A 3G2BA 4RLFA 1A40A 4OEUA 4L5JA 2RQPA 3VDFA 1TWGJ 2R4GA 3ULQB 3FWEA 1BLFA 1B4AA 4LMYA 4PAIA 3ZCOA 1OPCA 3LSRA 5JVGF 1LAFE 2DDBA 4HX4A 1M5CA 1MQDA 1O63A 5FB2A 3FVOA 5C4JJ 4NF4A 5KAFC 5FHOA 5H8FB 3ECOA 3HSEA 3A3UA 2V7FA 3CSBA 1DOTA 1ONVA 2VOPA 2QS4A 3F22A 5AA4B 2A68F 1MRPA 1VQPI 2Q1ZB 4ZJZA 2H98A 3CC4I 1E3PA 1TT1A 2V3TA 3SEUA 1JT6A 1PYVA 3LNQA 1BC7C 4UHTA 1SQYA 3BZKA 1X1CA 3EPZA 1FIPA 4F1VA 4YMAA 2A3SA 2JUGA 2P6TA 1IUFA 1K61A 4WXDA 3LSWA 4JSDA 1XSDA 2DDAA 3ZQQA 1X1PA 3BP8A 4F52A 4LLNA 1ON1A 1OLCA 4BNCA 4DBQA 3T8RA 4LVQA 4P1LA 3L1PA 1USYH 5HS7A 4EQ7A 3H35A 1MBHA 3FKJA 4X0GA 2WBMA 1FBHA 1ETOA 1DTZA 4N91A 1YOVB 3I53A 2EV0A 4JP0A 3I59B 4JX4A 3TEDA 1IG7A 2R6GE 4CCLA 3M3YJ 2PX1A 3V4GA 4PFWA 3V8LA 5C4XJ 9ANTA 2FQ4A 1YG2A 3BR2A 2VGQA 1IIWA 1MQGA 4BHCA 5I2KB 3PNYA 1OCRH 4RPOA 1T95A 1NTCA 2LBFA 3LA2A 4ZEIA 3DTIA 2XAJA 1OVTA 5IAIA 4KI0E 1JTXA 4G8MA 4IO2A 2M34A 1CGPA 1IO2A 2QKMB 1L5TA 3UGWA 2KQRA 4RB2C 1JVXA 3CJTB 1LNWA 2STTA 1GGGA 1DMBA 2KJBA 3FF5A 2UXXA 3ZN1A 3KOSA 3RSNA 5F1RA 1D8KA 4PFUA 1X2NA 1ELJA 1MH4A 3TMGA 1ZH5A 3O9PA 3CIJA 3ZMTA 2Y0SN 5D8LB 4PFTA 2A5YB 4U0YA 1JW1A 3PFIA 3BG5A 2REGA 4JWXA 4EF2A 3JW4A 4D1QA 1T8IA 2DO7A 2IA0A 3BG7A 4MNIA 1OCPA 2Y9YA 4BDZA 4BLAA 2L9VA 1DP3A 1TT0A 3G3FA 5ET5A 2QS3A 4JK1X 2DI3A 2L9NA 3C34A 1FPDA 4A5MA 2V4JC 1T39A 4OA4A 1GVDA 1B3GA 4F18A 4JBZA 3ILTB 3U72A 3HZJA 5TPAA 3ZR8X 4DI4B 3F3XA 3H03A 4FASD 2ZNTA 4GLIA 4PDDA 2XKPA 2D1HA 2G7HA 1HDPA 1JUSA 2NOJB 4GCVA 3H6UA 1J09A 2QMWA 4W1UA 4XTCQ 1BI3A 2DK8A 2DU9A 4WF2A 3RPQA 2CQKA 4BAYA 4C2MJ 1J2XA 1OYYA 4C3IJ 2IT0A 3KYDB 2ALUA 2XXWA 3FMRA 1B9JA 4H8JA 4E7LA 5BPDA 2R5YA 3HRMA 3VDXA 3HOVJ 5DT6A 3IV5A 1ODDA 1YJ9I 4PJJA 1LFHA 2F4OB 3LC8A 1DGWY 1A5JA 2L7KA 2QYOA 4I76A 2REJA 3TZAA 2R7FA 3IC7A 3MWMA 2LG4A 5J1YA 2XRLA 2W00A 4UABA 1PBQA 3FXQA 2Z33A 2QBYA 1SPIA 4KFQA 3WGIA 3S1QJ 2IEEA 1KA1A 2NYXA 3S17J 2UXAA 3LSTA 3Q0VA 3PJRA 3RTWB 3DQVC 1QQIA 4N6KA 3HHHA 4OXVA 1POGA 3G6EI 1QUKA 4R74A 3BR1A 2DPDA 2I0CA 2O6GE 3MVWA 2DN0A 3KE2A 1U9OA 3HHFA 4BDQA 4PE5B 3RDIA 1TBXA 2DMNA 3VFJA 4IL6C 1O3QA 2OPTA 5F64A 4B1RA 3W9WA 1SFEA 3WU2C 2O84X 4G94A 3L2CA 4KPTA 1Y4TA 1CF7A 3F0CA 4ESWA 1TL8A 4HRIA 3W6KB 4Z0IA 4N9HA 2CUFA 3CUQB 1MY3A 1XG1A 2IS1A 2M30A 3MP8A 3ONQA 3UKGA 4CYCB 3B6CA 3DEUA 3MJNA 4YICA 1AKHA 1QRYA 2I49A 5ESYA 1V5EA 2Y0SA 2H09A 4G7OF 3SESA 1YYVA 3EETA 3BG6A 3HPHA 3Q9SA 3ZQ7A 3LSPA 1J5YA 2OWSA 3O2PE 2FIXA 5GPAA 2RF1A 3QP6A 5ET8A 3PMXA 1YE9A 4JX5A 4FTHA 3MZYA 3BFUA 2KFDA 4XORA 3SYTA 1FBSA 3SEWA 1NH3A 5B3SH 2G93A 3TCHA 5BMZA 5CM6A 2BY3A 4E7ZA 1UTHB 4RGRA 1Y1WJ 4M3GA 2FIEA 2Y7PA 3CD6I 2NOOA 2XD2A 3K4LA 3QYBA 3U1DA 1I6XA 3J7YJ 3CMYA 2W84A 5A2QZ 1DPUA 4O6JA 2L7MP 4Q4ZF 1MS7A 3JRHA 2BZTA 1XOCA 1U5TB 4NG7A 5ET7A 1STZA 2EZIA 3ZP5A 3DTKA 3FVGA 1W1WE 4A3IJ 1FCKA 3FX3A 3I56I 4RY1A 1J9IA 3QOEA 1Z7LA 4FX0A 1EKEA 2VT3A 3CTAA 1A7LA 1QZEA 4XKWA 4PFRA 1L3LA 2LR8A 4QSDA 1OR7C 1NI9A 5B70A 5LRSA 4GXOA 1R6RA 2GBYA 4GDFA 4XLHA 2BGCA 3PIPF 3RPWA 3GXAA 4XLCA 4DBRA 3C31A 2XGCA 3GTJJ 3WTTC 2V1DA 1I6BA 3QIMA 1AOVA 2PFZA 2V25A 4RMNA 1ZGJA 2IVMA 4Y4RA 4JQFA 2ZXTA 2EINH 1LJ9A 4FATA 3H3VK 4H5GA 4OOIA 4YG2F 3T93B 2XWVA 3EPEA 1H3DA 2NS0A 3OL4A 4GRKA 4PFOA 3RKXA 4QSEA 4MFEA 1ZRCA 1B40A 3TTMA 1WCMJ 1ZKBA 2I3VA 2WYPA 2CQQA 3OYJA 3G3IA 3HXLA 1O7LA 1ACIA 1XHYA 1MY0A 4NEDA 2W4SA 4ZDMA 2OC6A 4LIVA 2ZNSA 3TFLA 2M8GX 4IRHA 5BNGA 3FK6A 3MZ1A 2VQHA 2C6YA 2F5EA 1FPQA 1FPIA 2VASA 3CMMA 3GW2A 3L2RA 3H92A 3WE2A 3KEYA 1S72I 4GXAA 4ZS9A 4II2A 1QO0D 3JTHA 1HSEA 3TTLA 3NEUA 2UV1A 4YFXF 4UUSA 3AKZA 4A3KJ 4R6YA 1TP4A 2LF8A 1ETYA 2J5PA 1UB9A 3CC2I 2WKYA 5FRNA 4DYRA 4RAZA 1W36D 3VEPA 1VSOA 1BR1A 2X6OA 5TP9A 4U22A 2FOKA 3CF2A 5B5EC 3QPLA 2WB1N 4X9TA 1D9VA 5L3FA 3QMFA 4G2ZA 2E1MB 2XF7A 3F8MA 1XX5A 3IRRA 4NC7A 5FLXZ 1S29A 3B6TA 1RPWA 2DXRA 3SFZA 4KNYA 3HSTA 1NK2P 1FT9A 4PGGA 4MTEA 5I58A 4NTLA 2YUSA 2GOXB 4N17A 4UACA 2PBIA 3NQOA 2X6XA 5B1BH 4QTRA 3DLLF 1JW4A 4N15A 1S6LA 4L0YB 4LLLA 2KPMA 3LAJA 3FISA 4XOPA 2XDVA 4RXLA 3H0GJ 1D9QA 3LSXA 4GX3A 4PP0A 2R92J 5FROA 2H5YA 3EF7A 2NS8A 4AU7A 4EJUA 1ZHFA 2HQ0A 2B63J 1D5YA 1KU9A 2P6SA 4KFCA 3GZ6A 1P92A 2LOOA 3K2AA 5CKTA 5D5XB 1ZR2A 1O7TA 4ZECA 4R6HA 1QKBA 3ASNH 2V1NA 1FC3A 3BQZA 4OAZA 3W6JB 3BLYA 3O3KA 4IEJA 2Q89A 2EV5A 1RR8C 2XX8A 2KZGA 4A2UA 1BN5A 2D2WA 5B1AH 1C0WA 2F5XA 2OWZA 1B7HA 3G3ZA 2M0MA 1FBFA 1FBCA 4BBSJ 4XNFA 3BTJA 1Y3NA 4KYSA 2MD0A 2XXPA 2F4IA 3HHGA 2Q2EA 2IGMA 4GBWA 1R49A 1U3EM 1EU8A 4P1EA 3F6VA 3PUVE 2XF5A 1UHWA 3MSTA 4EGZA 3M3LA 2H94A 1LBXA 2EBIA 3N6TA 3ROJA 2OAZA 3AAFA 1MMNA 3PNVA 1HQCA 5HS8A 4A3EJ 1FTMA 3UR3C 1OMPA 5CC2A 1YJWI 2OLBA 4BJ5C 2E19A 4PGHA 5GAEJ 4O94A 5EJCA 4X1DA 2HZLA 2E1OA 2LK2A 3EYIA 3E79A 1YX3A 2XAUA 3GO5A 3SEZA 3ZMUA 2WY8Q 3TP3A 4HA8A 4JSOA 2PI0A 4DYQA 2VPLA 2CH0A 1MMDA 2DCEA 4DNCA 5LFAA 3WU1B 1O3TA 2E7XA 4LITA 4XBFA 4A3LJ 4AS5A 5IKBA 5KCJB 3K01A 5K2XA 2QLZA 3R6UA 1IMFA 1FY7A 1AHDP 2F7CA 4OVRA 5J1DA 4HCWA 1Z3XA 3OIQA 2JVHA 2LTPA 3V7SA 5J4YA 3WTVC 2R5ZB 1IUDA 4LZ8A 4MCOA 3KG2A 2KP6A 4OVJA 3Q28A 1FBUA 5IYDJ 1P7JA 1QVUA 2K4JA 1QVSA 5KK1A 4IKFA 2DWAA 1ZK8A 4XLNF 1YJNI 4P47A 2K9LA 1PVEA 1B72A 1B2HA 3IUOA 1HA8A 4FHTA 1LE8A 5I59A 5A2QK 1NH7A 1D0YA 4H6DA 1NUWA 5DS9A 3VYTB 3ERED 4XK4A 3IOWA 2XB0X 3LA7A 3CCQI 2VN2A 3ILUB 1XGMA 3OIPA 4C1TA 2EZKA 1GR2A 4IO9F 4P11A 4DXBA 1R5ID 1H0MA 3K6VA 4F22A 4XKNA 3E6CC 4ASNA 1JI8A 2Y7KA 1VTNC 2ZYOA 3FASA 5CMCA 5EDNA 4ZDPA 4ESXA 4DXCA 1BW6A 4DYCA 3CF5F 4EJOA 1KYWA 2A6TA 5DVFA 3F8BA 4JDFA 4FCYA 1BJZA 5IZ1A 1NNTA 2F3DA 1MY2A 2XXIA 3QOPA 4F39A 1HCRA 2HKXA 3F6OA 4ND9A 2F8DA 1URSA 1OISA 4U21A 5I57B 3TOAA 4GGGA 1KA8A 2LMDA 4PDHA 3NWTA 3HGGA 4QWQA 4CCMA 2W48A 4YFNF 3RPLB 5EQ9A 2PX9A 3G4SI 2ABHA 3T66A 3WU0A 1IEJA 2XROA 4BE0A 4MF3A 2W85A 3FJMA 3RJPA 4KUMA 3RYRA 4OERA 2B4LA 4I3YA 2XXYA 5L9MA 4ESBA 2ECCA 1B1HA 2X48A 4IGRA 1ETXA 3P7NA 3TO6A 4ZZDA 1LBVA 2XF6A 2MFZA 2Q0OA 4XRSG 4NN3A 5CVUA 1ZGAA 4IQJA 2PJRB 4PJLA 5EGOB 2QGUA 1X19A 3KX2A 4LB6B 1G0HA 3E78A 2P8TA 3TQLA 3GZGA 2XHKA 2M4GA 3IO6A 4AYBN 4DIQA 4RA2A 3IORA 2HAUA 3FVKA 2ZMEB 3U93A 1A54A 2AXLA 4RB3C 2PG4A 1P2FA 2KT0A 3VB2A 4U7DA 3N97A 2HZKA 2Y7IA 4BE2A 4HDVA 3OMYA 1MMGA 3C35A 4OFLA 4HTGA 3JRCA 5TISC 1UFMA 4L9JA 1BL0A 4J01A 1AWBA 1MM6A 1FTZA 2XXTA 1LKXA 2WV0A 1ZKGA 2ZJRF 1MPBA 4GWUA 2O9LA 5FLXK 1B52A 5LGUA 2K9MA 1K78B 1TFAA 3KSXA 4F1YA 4XSXF 1LCFA 2DTZA 3JRDA 3S9LC 1TNTA 1IMCA 1TNSA 3MAJA 3ZOBA 2XWKA 2ZYMA 4OEVA 2JA6J 3ISPA 4XMYA 4PJMA 3ZQLA 1UIVA 1FTJA 1F43A 4AS4A 4FT8A 4FX4A 4HLXA 1OMIA 1REPC 1LQ1A 3CP8A 2XWOA 3LA3A 1ZLJA 1UIUA 1HC8A 2WADA 1SI1A 2EJRA 2E34A 3GYHX 5IGAA 1FMWA 2Y31A 1IGNA 2HPIA 2DE4A 2B0LA 1AU7A 1MD0A 3DLNA 2OD5A 4M72A 4MEXF 5J3LA 3JSPA 3SQNA 3V5AA 4YFKF 1JXSA 4A3CJ 4UY8I 2BY1A 1MBEA 2ZFUA 4EQQA 3DV8A 3I55I 1HLVA 1GVCA 2OBPA 3C2BA 1NV5A 3TCGA 1WI3A 3BCAA 3PFYA 1ANFA 4NMYA 1BKAA 1PP8F 5K5OA 2M2EA 1TWHJ 2PMHA 1WJCA 1G2HA 1KWHA 1MJAA 2BE5F 2QVRA 1WRJA 4JYKA 2VXZA 1OCOH 1A04A 4NF8B 2NXNB 2LSOA 5IZ3A 1T0FA 3F11A 1E17A 4XF5A 4ZZAA 4ZEDA 2LY1A 4EM0B 4P9UA 3DBRB 3DF8A 3M1CA 3C32A 4R9GA 3O6BB 3EUAA 2CG4A 3FKIJ 3IHUA 1LBZA 4G4PA 2I10A 4B09A 1Y0UA 4F3QA 3IOTA 4OWDA 3KLNA 1SW1A 2Z8DA 1XGOA 2EILH 1M5DA 4C0RA 3ODBA 1V4RA 2KZVA 2IS6A 1NUYA 4G8HA 4XXUA 3QK6A 4B48A 5AIPA 2H1LA 3V8XB 2Z2SB 3REOA 1JHHA 5AA3A 5ICCA 1EH3A 2I4BA 1OYIA 4FORA 2GA1A 1JUPA 1JVYA 3OSRA 3K0VA 2P0WA 2HTSA 1MJBA 4ZYGA 1D0ZA 2DK5A 3S16J 1OQHA 1UHMA 2HGCA 4GIZA 1ULYA 2D1VA 4AM3A 3G3HA 3CC7I 2ZZVA 4RJZA 4Z7EA 3K1NA 1SD5A 4BJ6C 3LSHA 3F8FA 4HDUA 1S8NA 2P1SA 4NE4A 5TPAB 5DVIA 1I5ZA 1B5JA 2O7IA 2DS9A 2JT1A 2XPUA 3TGNA 5LLQA 2H8RA 1D3KA 2ONKE 2R7OA 1OCTC 2HOAA 1G3SA 2WTEA 5DCMA 2EA2A 2F6PA 2QS2A 3A0HC 1XMKA 1A8EA 1QGXA 5J40A 2R7RA 2MLGA 5LDZA 4ITVA 3ZXSA 1NG7A 3OO6A 3QSLA 1AA7A 3LOCA 1IRGA