3FXRA

Crystal structure of tsar in complex with sulfate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
total genus 86
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA03
2HYGD 1O64A 2RC8A 3RNNA 3IC7A 3ZN0A 2MD5A 2H6CA 4LLNA 2Q2CA 3VXCA 4QFNA 2HAVA 4EQBA 4LFUA 6PAXA 3OSQA 1IXCA 1ZGAA 4I1DA 2RINA 2XAQA 3H06B 2R7DA 3K01A 2EV6A 4POWA 4MTDA 2QQ9A 3CUQA 4U0WA 5D8LB 1LVAA 3DP8A 3E9XA 3LFKA 4YG2F 3ZMUA 2V84A 3HIFA 4PCQA 1GGGA 3GZGA 1FCKA 2DW4A 4NMYA 2XUBA 1FZPB 3LUYA 1Q35A 2PFBA 5HVQC 4HZFA 1ZMGA 1GXQA 1X3UA 3N97A 4XKQA 2W24A 3FJMA 3K1PA 2O51A 4L5JA 5L3BA 1XCBA 4KYWA 4G7OF 1BKAA 3H03A 2EWNA 2JT1A 4GYGA 5CLSA 4Q0CA 1JXSA 2FBKA 3V83A 3TTLA 3JYRA 3TTNA 3FVNA 2I48A 4ZEBA 4BNCA 4EQQA 4GL8A 2QBYA 4L5IA 2R9JA 3KP3A 2QSXA 4A5NA 3FATA 2F5EA 5CI5A 2HAUA 3FASA 2OQGA 3KP5A 3VFZA 2A69F 1PB8A 1U5TC 5I2KB 3CVGA 2P2AA 1ZREA 2V3QA 2VC0A 3MVZA 2CYYA 4GRKA 1VTNC 4JB7A 2QBYB 4F1UA 2PMHA 3WTYC 3I0TA 2PVUA 2FOKA 3F11A 3C36A 4LLGF 3IRRA 5DD4A 1US5A 2BYVE 4U1OA 3I59A 2EFNA 4ZE9A 5TJJA 5ICCA 5ILSA 3FUZA 4U1ZA 5L3CA 4HYEA 3I5UA 1Q1HA 3C4MA 1UIVA 4ECFA 1LLSA 2X4HA 4HA8A 3CLOA 3E6CC 2XROA 2A6EF 3RPQA 1E2XA 1OLCA 2R71A 5BPIA 1N3XA 3FVOA 2CO5A 5ILVA 4ESJA 4KIGA 2DQRA 3FJ7A 1RI7A 3V89B 4PGHA 1MXYA 1XS5A 4RNSA 1NNFA 3CUQB 3VDFA 2HQ0A 1Y1ZA 1KU9A 2WTEA 1GXPA 1J7KA 1N3WA 2ONSA 3FMRA 4S04A 3WGIA 3JSOA 3C32A 3MJNA 2ONRA 1IXHA 4F1VA 1LFGA 1MS7A 1LQ1A 5D8KB 1L0OC 2YX7A 5BS6A 3R0JA 2RF1A 3WTTC 1NNTA 4OHNA 1MY3A 1FX7A 1PP8F 5B70A 1M5BA 1Z7NE 5BOXA 5D6FA 2PBIA 4F39A 3U94A 4IHSA 2EFPA 4NB5A 2WKYA 2ZYMA 3O97A 4WEPA 1XT8A 1ZRDA 4LZ8A 4KI0E 5E20A 2DE3A 3U1DA 4OIPF 1GVJA 5LGTA 3QUJA 2M30A 4LK1F 5HOOA 1BJAA 3MPKA 1BI0A 4I62A 4C0RA 3VODA 2VOOA 5HS7A 1ONVA 1QZYA 1B4AA 2ANJA 3PFIA 1B5HA 4EM1A 2DTRA 2J5OA 1R1UA 3K4UA 4EJUA 1DSNA 1MPBA 1B3HA 4N07A 2EB7A 4Q4ZF 4LB5A 2PBWA 4GOTA 1BI1A 3DV8A 2PEXA 3RJPA 4RA1A 1W7PB 1UB9A 1HKQA 3GLXA 4HOBA 4JWYA 5B7DA 3BZ6A 4RGUA 2RGVA 1OVTA 2XKPA 5L8DA 5K2XA 1OR7A 2VE8A 5D6EA 4Q5TA 1ULYA 4XLPF 4UHTA 3TCFA 3CSBA 4Q8RA 2VBXA 2DQVA 2R7FA 3UGWA 2F7AA 1MPCA 1TLHB 2FQ3A 2NAZA 2XGXA 1AMFA 1Y4TA 4JBAA 2KIUA 4X1DA 1LB2A 3HSEA 3DPTA 1FQAA 1GHCA 3TEPA 2K02A 4RB0A 1SI1A 4X9TA 4AIJA 3Q5FA 3R61A 4JBZA 1R9LA 1MH4A 1WWXA 4CO8A 2H98A 5CRYA 2UYFA 3QAHA 2QVOA 2DE4A 5A2QK 5LEKA 1QUKA 4OEUA 2PG4A 1LCTA 1N76A 5DCMB 3DXJF 2NUVA 5I2KA 1B5JA 3HO7A 1HSTA 1FWZA 2XXXA 5JR3A 1URSA 1ZLKA 1AOYA 4QSDA 2Z3YA 5L9OA 4NHJA 3KZGA 5DVIA 5AA2B 4IGRA 4L9NA 1LGBC 2YPRA 2CW0F 3T96B 3KEQA 4QF9A 2CSOA 1K7AA 2UWMA 1LFIA 2MLGA 1IZ1A 3KE2A 4G9YA 3H6VA 1TFDA 3EYIA 4AB6A 2BEOA 5KDTA 5L3FA 2W85A 3THIA 3HSRA 3IORA 3R6UA 1STZA 4OU0A 1WSUA 3PPQA 1S8NA 1P1WA 2WC2A 3EN3A 5CMCA 1R5HA 4EUOA 5I58B 2OU2A 1U6GA 1IAWA 3R6SA 1NHAA 3WAFA 2HXWA 3SZPA 1XC1A 1LDKB 3CUQC 3HHGA 3HSTA 4OZ9A 1BC7C 2QM3A 4U7BA 4EXKA 1IRGA 4KCDA 3VVDA 4YFXF 1R1NA 3VFJA 2H4IA 3E6BA 4Z7EA 2HTJA 3MP8A 3PMXA 3WTVC 3OV8A 4ENMA 1Z6TA 1Z7UA 1LAXA 1XGOA 3CDHA 1Y20A 1KU7A 1SDXA 3I3VA 5A5XA 3IWFA 3FVKA 2H25A 5LLQA 2GZWA 4F3SA 2BE5F 4NTLA 2ZO4A 3G3JA 2F5XA 1JE8A 4RGSA 4YB5A 2IA0A 1ZJLA 3C7JA 3FMQA 1T2KA 1G3YA 2W84A 2I0CA 3JTHA 4Q48A 1PDAA 1MXUA 2OQRA 1R36A 4LB6B 3CSGA 4YIIA 4FECA 4U0YA 5FO5A 1VE4A 5I56B 2FU4A 4EMSA 1MY4A 1ZG3A 1CGPA 3MWMA 3H4ZA 5HM4B 1P6RA 1IIWA 3SDFA 5CMKA 2VT3A 2ZKZA 4P11A 3T93B 5H8FB 3PUWE 4R79A 1YS7A 4GIZA 5I59B 3E5QA 3I64A 2RCAA 4A2UA 1BLFA 3CO6C 3FD3A 3LSFB 4KHZE 5AA2D 1P4WA 1O7FA 4F3BA 2WV0A 4R75A 4HF0A 4EV0A 2WWYA 2AIXA 2XV4S 5HBCA 3WAEA 3EHTA 4BDLA 3KN8A 1F4KA 1URGA 1UHWA 3T66A 3L6HA 1XSXA 3MZ1A 2I58A 1MD0A 1QJMA 2V3TA 4YAHX 2KIMA 1S29A 2QQBA 4YU0A 1PBPA 3DP6A 2DK5A 5TPAA 3DPLC 4M4GA 4TQUQ 2H27A 2Y7RA 4OIRF 5H8SA 1WRJA 1Z91A 1Y3NA 4AQ4A 4OOIA 2VHAA 3N94A 4WKMA 1IN5A 1TBXA 5H8NB 3O2PE 2A07F 2HOEA 5CM6A 5LHIA 2UXAA 3QUFA 1B0HA 1BIBA 2LDUA 1H76A 2FE3A 1XN7A 1Y9UA 2Y0MA 3GFLA 2PI0A 2W57A 3O66A 3MVXA 1UHMA 1KYWA 1QULA 4EGYA 3V7SA 4UNOA 1OLAA 4M72A 2I0BA 4HF2A 2AL4A 3C31A 3GW2A 2QRYA 5L9SA 5D5XB 4XRFA 2NVUB 2DXYA 3GXOA 2FEZA 2QMXA 3H6TA 1SFUA 4N9HA 3FX3A 5E8GA 2IEEA 5AA3A 3I59B 4IO7A 4ZEKA 1W7PD 3RKYA 1SVXB 2G7UA 2Y7PA 1B2HA 3KJTA 2ONKE 3ZMDA 4EXLA 1ODDA 4B09A 1I6AA 3M8UA 1TW3A 3FVGA 3RKXA 1XVXA 3RUMA 4GWOA 3M3FA 3PPPA 3ZKLA 4QFLA 2VE9A 1QW0A 4G7ZF 1YQAA 3ROUA 4ENNA 1JW5A 1OVBA 1B7UA 1T0FA 1B1BA 4MQ9F 3E4RA 4EJOA 4UUVA 1WI9A 3HOTA 1B32A 1MY2A 1LCFA 1Y3PA 3MZYA 4ETSA 1ZBMA 2RC7A 4H0WA 1FNNA 3TELA 3R60A 3V4GA 3SETA 2GXGA 5L3DA 2PLYA 2R6GE 4M6YA 3DF8A 4YFNF 3FGSA 1YIOA 1B7ZA 3BJ6A 1Z9CA 1VFDA 2E7XA 2EFQA 4FX4A 3KLNA 3ECOA 5KZTA 3KLOA 1G4DA 3TAJA 3CG1A 1LJ9A 1UIUA 3TCGA 1FQCA 1FBSA 3ZP5A 3KEOA 1FBQA 1FYMA 1WODA 4ON0A 2DP8A 2FMLA 4M9ZA 3S2VA 4P55A 2REJA 1TQIA 1LEBA 1B3LA 3C3WA 2HZTA 1A8FA 2HZKA 3ULQB 1TQPA 2OZ6A 3IL1B 4RAZA 1K6OA 3K9TA 5FFXA 4HLYA 1CB6A 2D1HA 1UFMA 4F3GA 1HKTA 4R8HA 4FE8A 2QJEA 3ML6A 4LQ2A 1XSVA 4I0BA 1II5A 4DIGA 1UCRA 1TFAA 3WU1B 3O6GA 5DDGA 4F2QA 5CBSA 2A5YB 2ZNZA 3CO7C 3C18A 1YG2A 1I1GA 3OO6A 4G8MA 1GR2A 2VONA 4IO4A 3QP6A 2KRFA 5DV5A 4BDNA 1IITA 2G93A 4OIQF 2X7PA 3F72A 5ERIA 4E70A 1EU8A 1JHFA 2C6YA 4FEBA 4F29A 2HGCA 1P1OA 1SD6A 4KN4X 3C34A 1R7JA 1LBBA 4JSOA 4BH9A 3FXQA 2B3FA 3GEZA 1B3GA 3J81Z 1ZH5A 4L9TA 2GHAA 3OOPA 1FLIA 1HKSA 2FBHA 4OTEA 4EJWA 5BWJA 2R3SA 4TV7A 2V1UA 1K79A 3FV1A 4PFUA 3O29A 1R22A 2NWJA 3DM0A 2OA4A 4B8XA 5JHUA 1YCJA 1H9TA 4NQWA 1OIBA 3R7XA 5ICEA 1B3FA 1SBPA 1SW5A 3GBAA 1IW7F 2F5CA 2YPNA 4LK0F 2ZNTA 1FC3A 1DP7P 4BDRA 2E1CA 4D0PA 3SERA 2AS5F 4RJZA 5EEHA 3LWFA 5FLXZ 3BKIB 4R9FA 1WDNA 3OOAA 2TDXA 4R6YA 2REGA 1EZ9A 3WTSC 2Y84A 3EF7A 2O8XA 1FQFA 2PT1A 2VD3A 2Q88A 3R26A 4YKPA 2B0LA 1NFTA 4QSEA 4R1HA 4ESXA 1ZGJA 2XAHA 2XAGA 3SQNA 4U4SA 4EF1A 4I8CA 3RYPA 1SD7A 1GVCA 1D9YA 3HHHA 2DS9A 3IO4A 3PD9A 3FIRA 4DDDA 2XVCA 2PQ8A 1SMTA 5TPAB 1V4RA 3S9NC 3BPVA 3EQLF 5L3EA 3J80K 2HS5A 5HLHA 3PMWA 3VOEA 4NF8A 5DEXA 2COMA 1ZIUA 3VE1B 1IXGA 4GF8A 4H67A 3IOWA 3Q9VA 3WTXC 2XXPA 3MP6A 1B5IA 4QFOA 4MHGA 1LAFE 2UYEA 4F1YA 1B4HA 5JFRA 1JVXA 2P5VA 5ICFA 2QLZA 4G77A 4MQVA 2HQNA 3K1NA 1MRPA 1K78A 1P1NA 2Q89A 1TNSA 3MEXA 1TT1A 4DNCA 3VLWA 2I4CA 2F7BA 5F1RA 4Z2YA 2H6BA 1N84A 4OYVA 3BWGA 3WTZA 3TQLA 4ELQA 3KBRA 4JQFA 4H65A 4RPOA 3D5LA 4KDPA 3T9VA 4IRGA 2XAFA 3JAMZ 1LFHA 1JW4A 1BC8C 5D5VB 5J8FA 2XXTA 4YMAA 1LDDA 2YR2A 4HCWA 5AONA 2IRFG 2ZYKA 3M9AA 3QK6A 4IO5A 2E1NA 5CYVA 5H8HA 1WQ2A 4GD5A 4LG0A 5DEQA 3EHSA 3J7AO 4YICA 4FX0A 5FHOA 3CFZA 2QWWA 4RYAA 4ZH4F 1MDMA 4IRIA 4CGZA 3G3IA 3FXUA 5BPDA 3HHFA 4GXSB 2MBFA 2DXRA 2F5FA 4XSZF 4F2OA 2P6TA 2E7WA 2XKOA 3E13X 5J8CA 5ICGA 1WVJA 4IB2A 2E1SA 1FQEA 4MLVA 1DPPA 3FF5A 3V8KA 3BROA 5F64A 4KA4A 4ZZLA 1POTA 4HX4A 1N0TA 1R58A 4E0XA 5D4RA 3IK6B 3GUDA 1SD3A 4PFYA 1S3JA 2FNAA 2P8TA 1ANFA 1JETA 2F7CA 3QIMA 1HSJA 4HV6A 4KR5A 4KPTA 2VN2A 4FATA 3QPHA 4LLLA 4ZYDA 4KYSA 2FF4A 4A5MA 4RAYA 2Q9TA 5K1YA 2HR3A 1LBCA 4O5VA 4O6JA 2V6CA 2HEOA 1J59A 2L4MA 2DK8A 3UN6A 4GYIA 3LSWA 5AA4B 2IA4A 3HPIA 2XXYA 4K2EA 1MXVA 4QRZA 3RQTA 5CVJA 1ZTYA 3TO9A 5CMBA 4ISUA 4X48A 3TMGA 4ZZEA 3RPUA 1TQMA 1U3EM 3IOUA 4AWXB 3E3KA 4EQ9A 3NQOA 4I9DA 1OYIA 2L01A 3D4GA 4MNUA 5KCJA 3ECRA 4KD5A 4ZYGA 1Z7ME 3D4CA 3GLBA 1LEAA 3H92A 3V7CA 2M45A 5HS9A 1GV8A 4ZZAA 3SEYA 3GX4X 1H9GA 2ZNYA 1DTGA 2PT2A 5I57A 1P4XA 2CFXA 1F5TA 3TTMA 1EV7A 3ZMZA 3LA2A 3RY3A 2Q8KA 3RN8A 2D3IA 4U21A 4UV9A 2D21A 3KGCA 3FM5A 1PBQA 2RV8A 3L09A 3RPWA 3WGGA 3OO7A 1IEJA 2RC4A 3FHZA 3E5XA 1FSHA 1XDUA 4KQPA 4EM2A 3D0SA 4PE5B 3CG3A 2HFBA 3TQWA 2LAOA 4N6PA 1U5TB 2ZJ2A 4MGRA 1H45A 3M1EA 3Q25A 3MVYA 4RK2A 3FV2A 3JTGA 2GWRA 1O3QA 1MJ9A 3H7MA 5JTYB 5I2NB 1A55A 4HW0A 3LSLA 4R6HA 3Q9SA 3RT6B 4C1UA 4N13A 5ILUA 1RYOA 5F7VA 3OEKA 4OQOA 1BI2A 1HW5A 1J1NA 3GZ6A 4DXBA 2V1DA 4BXUA 1NH7A 5FD5A 1B7HA 1RKMA 1US4A 3S9EA 2Z8FA 3L6GA 1ZLQA 1KYZA 2Z5UA 2M5WA 4G2ZA 1S7YA 3TODA 1YS6A 4FT8A 3W6JB 3Q28A 4H6DA 4LVQA 3UORA 2OBGA 1PUEE 4WK8F 1D5VA 1J0RA 5DVJA 2LNBA 2VT2A 4U4XA 2RC9A 1U2WA 1QQIA 1XVYA 2P5LC 3MP1A 3IAZA 2QYOA 3HTUA 4ELPA 3G3ZA 3FXRA 4G4PA 2DT5A 2Z22A 2OZUA 3I58A 4BQAA 2O6GE 3MCZA 4WX9A 4ENKA 2ZXJA 1FY7A 3GYHX 1FTLA 1R9QA 4ZE8A 4NF4B 5DD8A 3G7WA 1A8EA 5CJ9A 3TYHA 4WCGA 3K2DA 3IR1A 3T9HB 2HKOA 2IVMA 1LSTA 1FTJA 2MH9A 3E5UA 2STWA 3QAXA 2VOPA 1TXFA 2DU9A 5ICTA 2D5WA 5DYMA 5KDTB 3CR9A 4FEDA 1T0KA 1R6ZA 3U92A 3GFMA 3ZPLA 3PD8A 1SFEA 3J81K 1W5SA 4NWDA 4GL0A 3SEVA 1B46A 3LQRA 2JPCA 2ZMEA 1IN6A 2FSWA 3MFKA 1UTHA 1YTVA 4IO6A 4XXUA 3UA8A 1USTA 3KP6A 4LUBA 2L4AA 5LRRA 3TQNA 5F6FA 3ABTA 4WF2A 2XX7A 5CMMA 4P0IA 4ZS9A 2ZCWA 1O3RA 1B40A 2DQLA 5I59A 5D5UB 1NKXA 2VBYA 1B6AA 1ATGA 3LAPA 3BBRA 1MJAA 3QPTA 4MBPA 3K6VA 1ZKBA 1DUXC 1S7AA 2MA3A 5E8IA 3DELB 4G8NA 5ITPA 3EYYA 5FHNA 2VP1A 1ZRCA 1USSA 4L9JA 3V7RA 1S9TA 5FD6A 4OFOA 3G3HA 2GIVA 4AVPA 1F1ZA 5FHMA 3K02A 2GRVA 1QBJA 3K0VA 3OD7A 4ZEFA 2QQAA 4KMFA 3IRQA 4OINF 3PMVA 4YKKA 4M73A 1BI3A 1CE2A 4KYEA 3N4MA 4M74A 2L3DA 2JRTA 1XD7A 3JV9A 1PEBA 3W15C 3QU6A 1Y1MA 3ZMSA 3G3KA 2YX4A 5DCFA 1CF7B 3V8LA 3ODBA 4GVOA 3U2RA 1AOVA 5CVUA 1I6QA 2XRNA 1REPC 2V3UA 1FSEA 2UXXA 1EZPA 1QVSA 1KA8A 4JWXA 2DAOA 1IUYA 3GBBA 4DLDA 2DWIA 5EYFA 4P9UA 3TOAA 3MZHA 2V25A 1VFEA 4YMBA 5CBRA 1FTOA 4QSCA 3GWZA 3PPNA 5E18F 2KKOA 2KJBA 1B51A 2RVCA 2UXNA 3R4KA 1MGTA 3T8TA 3Q29A 4RXLA 4LP2B 1SD4A 4G6QA 5F1QA 1MQGA 2EA4A 3KP7A 3HRTA 4U88A 4CICA 1M5CA 4JXIA 4MLQA 2MH2A 3LQQA 4I7HA 4G7HF 3BDDA 5DUKA 4IHTA 4XKRA 4G8XA 2Z23A 1MKMA 3E97A 1I1SA 2XD3A 1IUDA 5E1XA 4DXUA 2F2EA 2FNCA 2PYYA 3VEPA 3RLFE 4LGWA 5LBQA 5AE4A 1JW1A 4F7ZA 4NEDA 2OD5A 1JQFA 4ND9A 2H99A 4HAMA 2CMOA 2P4WA 3MUQA 4BHPA 1KQ9A 4RB2C 4S05A 2KLFA 1G3TA 2RDPA 3HRSA 3P9IA 1B58A 3E6MA 2ISZA 4TOZA 1MDQA 4ESFA 2PN6A 4OVJA 3K0LA 3KZZA 4G8HA 3IJOB 1TNTA 1B9MA 3U9GA 1HSLA 3S9MC 4H8IA 2VOZA 4HW8A 3M3KA 4KIBA 1AH5A 3F8MA 2BV6A 4POXA 3V8JA 3IOTA 3GO5A 1ZLJA 4IY6A 1MXZA 1P2FA 3GXAA 4U2RA 2A5TA 4KMUX 1BIAA 1QPMA 1Z1DA 5LHGA 2O7UA 2NNYA 3IB0A 1W7PA 2QUFA 4Q5SF 4L18B 5E1ZB 1DPEA 2UZKA 3BFTA 2YSRA 1UTBB 3WE2A 5IT9Z 4ONYA 2ZYOA 3KP2A 2CWEA 2NXOA 4G94A 1HW1A 2RKHA 4A0XA 2L02A 3PUZE 2AYSA 3B6QA 1URDA 4O3BA 4RK9A 4EQ7A 4QLCU 3RYRA 4M9XA 1O63A 3ZQ7A 4U23A 3H3GA 2VODA 1IN4A 2ACJA 5EHMA 4A0ZA 2P7VB 2O0YA 2EJRA 1MM7A 2OCUA 3F23A 2GA2A 1D3YA 3TKDA 5HDKA 1AL3A 2XXVA 2A5SA 5LHHA 3EQ1A 2M87A 2ZMEB 1UTHB 1LDJA 2GQQA 2BJJX 4ZECA 3RDIA 3ONMA 1J2XA 2IA2A 3IL2A 3NRVA 2STTA 3A3UA 4HDUA 2XXIA 1D8JA 4ELOA 3B7DA 1IXRC 2Y75A 2A5TB 2OK2A 1R1TA 2FA7A 2ETHA 1YYVA 4H8JA 5A5XB 3U72A 2IPQX 3OEMA 4GQOA 4NF4A 5FGMA 3WU0A 3KP4A 3CRBA 4TLMB 2B65A 2CZLA 2XX9A 2I4BA 2E0SA 2O1LA 5LOMA 5H20A 4UVAA 2Q2EA 1BIYA 3RI4A 4L0YB 4G6DA 3IHUA 2GH9A 4WXDA 4KNYA 1LB8A 2PMSA 3SEWA 3L9FA 1SD5A 2OJTA 5IKBA 2Y48A 2A68F 1USYH 3K6WA 3KCCA 5ED4A 3M8EA 4UVBA 5TP9B 2DFIA 2EA2A 4O3AA 1RUNA 3KZYA 1HXDA 1OYYA 1YPNA 1MXXA 4OETA 3T22A 4DQ2A 5J1DA 3LA3A 3N26A 2NNNA 3K1MA 4U22A 1MM6A 3KG2A 2O3FA 4GLIA 4OMYA 4KCCA 3ZN1A 1J75A 1XGMA 2DPUA 1FBUA 2VBWA 4HS7A 4ZEDA 1OKRA 1F9NA 1AIVA 4LONB 2IP2A 3VLUA 1XMKA 4HDVA 3LC8A 1OMIA 5JI6A 4CZZA 1T98A 1FYLA 5I56A 4IVNA 3U8QA 2Y7KA 4GXOA 1B1XA 4F19A 2HQRA 2QPQA 4BLAA 4XKNA 1BM9A 5HDGA 1RNLA 1W5TA 2GA1A 3KOSA 3MZ9A 2ZNUA 1S7OA 4OMBA 4F22A 4CDGA 2JZYA 3I4PA 1DMBA 2ABHA 3WG9A 1XGSA 3JW4A 4DE8A 3UIFA 2XHKA 4F18A 5D4SA 4MEXF 4BHCA 1NNKA 2ZYNA 3PGFA 3PV0E 1A54A 4P5OA 2LSOA 3SXYA 3TTRA 4CHUA 3JZJA 4MTEA 5I58A 4L9VA 2THIA 1A7LA 1KQ0A 5CVRA 3QRFF 1R1VA 2OBPA 1ZYRF 3LSXA 1PC3A 1YLFA 1KQ8A 1ZN2A 3GFIA 5D5WB 3V8XB 4WXHA 4NF6B 4RY1A 3O6IA 3ZKKA 3CFLA 1M5FA 4DXCA 4PFTA 5M2VA 2A6HF 1M5DA 2F35A 4CXFA 4HX8A 1XDSA 2K86A 4YFKF 3K6UA 2O69A 3QSLA 1KU2A 5JK4A 3MWBA 1BBYA 5H6RA 4H5GA 3KEIA 4PETA 5IAIA 1ZHFA 1U78A 3P9KA 1R00A 2GAUA 2NOOA 3KSJA 3TDZC 5ELVA 3TPAA 4I01A 5TU0A 1OPCA 3I71A 4CYDA 3LSTA 2XXUA 1XCVA 1S6LA 1B59A 4LQ5A 2Z33A 2EK5A 3ABUA 3MQ0A 3SKPA 3MZBA 4LD5A 5DCMA 2O84X 1QKAA 1B4ZA 3KFMA 3V5AA 4BDQA 3OELA 4C1TA 2RQPA 1MY0A 1A99A 3FMSA 2FRHA 2HTSA 2H94A 2V79A 3JAMK 1OQHA 2P7CB 4PFWA 3ZS6A 1HW2A 4GO1A 4FIMA 2B3BA 1FT9A 4N0BA 1HQCA 3I54A 4QHQA 1PP7U 3EPEA 1ON2A 4AIHA 1FP1D 5EEGA 3B6WA 2DYXA 5K5QA 3GZ5A 2I49A 1P4AA 4OXVA 1XB4A 2EV5A 5HDNA 4KFCA 2RN7A 4I02A 3TO7A 1O3TA 2F8DA 1MDMB 1LB9A 4I09A 2YU3A 1XHYA 4RB1A 1TW2A 3IJXB 4OENA 3LA7A 4G68A 2EFWA 1FP2A 2PJPA 3ILUB 1LNWA 1E17A 5KCJB 4IRHA 3IKTA 2G29A 1KWHA 3O28A 2K4BA 2KJCA 4GCVA 4ZEIA 1OMPA 3USDA 2W25A 5CVIA 4O3CA 4KICA 4ZYHA 1SYHA 3K00A 2A61A 3JSPA 4N9IA 3DLNA 4EVIA 4ZYEA 3TUSA 2DI3A 3TOBA 3WTWC 3E3VA 1N7WA 3CJNA 4HTGA 3F8NA 3K6XA 2CQKA 5LEJA 2H9BA 1JNFA 4R72A 3TDUC 2MLKA 1EZOA 3KSXA 3O2AA 2RCBA 4RS8A 4LJZF 2G7HA 1KGSA 2PMUA 2DBBA 4HX7A 3HV1A 2BBYA 1H0MA 3BPXA 3G73A 2QENA 3W6KB 3UP9A 4DCXA 5JTYA 1H3DA 3C9HA 3F21A 1JEVA 3ZMVA 2O6AA 4YB6A 1B1HA 4PGGA 4UV8A 1B3EA 4ZZDA 3NEUA 2F6GA 3ISPA 3FWEA 1YW9A 1B52A 3PUXE 4XBFA 2MC3A 2P1SA 3C1DA 4EDPA 3N5LA 1UTBA 4Q30B 2VXZA 5AIQA 1J5YA 1W4MA 2K7LA 1YTYA 4IF4A 1IF1A 4EM0B 5IT3A 3LBSA 1D3KA 3Q26A 2V93A 1IXIA 3CI8A 4U0VA 1USYE 4KYDA 4IPAA 1XOCA 1MXWA 3A3CA 2DVCA 4A6DA 4LG0B 3F8BA 1YO5C 1QZZA 4P96A 2DLLA 3TO6A 4KFQA 2EV0A 4NE4A 3MBPA 2OAZA 2IA1A 4K3FA 2FBIA 5HPQA 3I53A 5I57B 1Y3QA 1L3LA 1ZU0A 1A40A 5E1WA 4PZJA 2K27A 1GTKA 5HLIA 3SEUA 5JVTA 2F36A 1FQDA 1LAGE 4QWQA 3HRUA 3O6BB 1HBXG 4BYYA 1FYKA 3HCQA 5DT6A 1QGPA 4U7DA 2GXBA 5DTBA 2Z99A 3VVFA 4P0GA 1MQDA 2FYIA 1RUOA 2XXRA 4H0EA 2ZXTA 2XASA 3QOPA 2QMWA 2QS2A 5FTIA 5FLXK 4JWOA 3ZMTA 3OSRA 5DYHA 1EH7A 2Q2AA 2Y7IA 3HN0A 3HUGA 1LAHE 4LATA 5IT9K 3LAJA 1TTYA 2FXAA 1B9JA 4UACA 3G3FA 2A3SA 3EETA 1TWYA 2PX1A 1ON1A 4A6EA 3G3GA 4I98B 2HKXA 1A04A 3VVEA 2XD2A 1OYWA 3EDPA 4ELRA 4HF1A 1P1QA 1BOAA 4YKJA 4WWCA 2QS3A 2JPBA 4Y13A 3TKYA 4LMYA 3GVAA 1MG1A 1JVYA 4RGRA 1QKBA 4M9SA 1EH8A 1OQGA 4FORA 2X7QA 3BJAA 1NH8A 2K4JA 2W7YA 2XX8A 3IB1A 4RPNA 2NYXA 3VXBA 3S9LC 1S50A 2OWSA 1CF7A 1KU3A 3K2ZA 3TCHA 4M1VA 3QP5A 3BY6A 5AA1A 3RTWB 3M7GA 5H8QA 4MH5A 3R0AA 4IGTA 3H3ZA 2I3WA 1DPRA 1EH3A 3PPOA 4MF3A 1MY1A 2RNJA 5H8HB 3T0YA 4PP0A 2CGPA 3WE3A 5EHSA 4R9GA 3VV5A 4YKIA 3O9PA 2XXQA 2ISYA 1POY1 5H8QB 3BOQA 2ELHA 2P5KA 3EUHA 3K69A 1B05A 2F5DA 3REOA 2VD2A 2XIGA 3KETA 4AB5A 5HLGA 3B73A 4KT5C 1PB7A 4JK1X 4JSDA 1ZG5A 3DFGA 3O3KA 1V3FA 2DO7A 5K5RA 5A2QZ 3HOSA 3WTUC 2Q0OA 1HSEA 1RIOH 3H6UA 1Z6RA 4EF2A 4NF5B 4L0ZB 1G3SA 3S4UA 4FHTA 5LGNA 2GFEA 3PPRA 3RT8A 3T8RA 1SMYF 1DTZA 4QFPA 4XKPA 2ESNA 1I6BA 1SYIA 3FZVA 1N7XA 3PU5A 2AL5A 5I2NA 4NF8B 3HSFA 3KFWX 5JEIA 2ZMBA 3KOTA 4OMZA 4EJTA 3OENA 3OO9A 3TGNA 2ZNSA 3QU3A 1O3SA 4HCYA 1SW4A 2ZBKA 5CVVA 1MDP1 2BGCA 4P9FA 1F9BA 3ZSFA 2I6EA 1NNPA 3HTSB 3F6VA 1BTJA 2O61A 3SZTA 4R2FA 3CIJA 5KK1A 4RB3C 3I5OA 5AIPA 2Z8DA 2HEUA 3IWZA 1IRFA 5BUUA 3Q27A 5DEXB 3H3UA 5ICQA 1D8KA 3RKWA 1DDNA 3VLVA 1I6XA 5ISUA 1FW0A 2NS0A 4EGZA 2HFHA 4G68C 2FMYA 2GHBA 1FTMA 4R74A 2O7IA 2DOJA 2Z8EA 4ESWA 3EHUA 4LA9A 5I84A 3MQ9A 1P92A 4OFLA 2P0SA 5K5OA 2UVGA 3MPLA 3P9CA 3ECHA 5ITOA 5H6QA 4WXJA 5L9MA 4F31B 2ADUA 4GXAA 4PQJA 2UVJA 1BP5A 2G9WA 1JGSA 2Z9OA 5DVFA 2UVIA 2Y7WA 4E0WA 1IXSB 4NWCA 1YW7A 1ZRFA 4F3PA 3A09A 2IW5A 4TLLB 4O3MA 4HBLA 2JSCA 4DCYA 4R73A 2M8EA 2DWHA 2KIFA 1IQ7A 1BN5A 1I69A 2D2WA 1RYXA 2LF7A 3L7WA 5AA4A 4HQEA 3GF2A 1SI0A 3U1OA 3U93A 3OMBA 4ENJA 2J5PA 1DPUA 3H6WA 1YFHA 3M8FA 4L17A 3COAC 1XGNA 1QO0D 1XMAA 2L54A 1ZARA 1PB9A 5CC2A 1T39A 1Z05A 3T9XB 1K78B 1SFXA 3I6VA 1AWCA 2M1BA 1QUIA 2QL3A 3F8FA 4IJAA 1U5TA 3MW0A 2JTVA 1VR5A 3WGHA 4HLXA 2H5YA 3BFUA 2Q8JA 4WEDA 3P7IA 3PQKA 2D1VA 3S2WA 2ZFWA 5FFZA 3BJOA 4H5FA 3M3LA 2QZ8A 5FB2A 2XXHA 3HYIA 1JHHA 4I2OA 4NF6A 1R5GA 1O7TA 5LGUA 3DP7A 1MQHA 1MZBA 3F8CA 4FAJA 1B0LA 1IN7A 4LZ7A 1VSOA 1U8RA 3MC2A 4MEYF 3IO6A 5LRSA 4R6KA 4BDOA 2DWJA 3N6TA 4WXCA 3TDJA 4HQMA 1FPQA 3CUOA 4OESA 1SAXA 4OEVA 4AIKA 1H43A 4HV5A 2F34A 4Z0IA 3W9WA 2DWAA 1YAEA 4LZ5A 4RGXA 3DKWA 2RKMA 5KVRA 4H1XA 3KJ7A 1NMUA 4YIFA 3KN3A 1B6HA 3ERED 1DOTA 3C33A 4GFRA 4THIA 2O03A 1ZAOA 4MFIA 3L00A 2HWVA 4ASNA 2OZZA 3GFJA 3ELKA 1PDNC 1N04A 3AXFA 3QYTA 1Q1KA 2LF8A 4A0YA 3RTRA 3E6DA 2X0LA 1P99A 3MVWA 4KUMA 1SW1A 2FNPA 1L5TA 1O57A 3WODF 2VBZA 2VC1A 1FTKA 4FJPA 3O6HA 4XTCQ 3F22A 4ZDMA 3RTFB 2DPDA 1MQJA 4YB7A 2XHDA 1G3WA 1MH3A 2AXLA 3DP4A 1QNTA 4BAYA 3MAJA 4X1BA 5FTHA 1O7LA 1MPDA 1C0WA 4OWDA 5AA2A 2F6PA 2D45A 1JEUA 2OLBA 2P6SA 3FM3A 4NF5A 1WKMA 3TFLA 3L2CA 4IXAA 1MQIA 1I5ZA 4UA8A 4A12A 5BQTA 1I27A 3BP8A 2EFOA 1Y0UA 2IJLA 4I0AA 4Y17A 2DSFA 2FA5A 4XLNF 1IN8A 3J80Z 3CFXA 3RGYA 2X26A 4BDMA 3T5XA 4IY5A 4IO2A 1M5EA 1SW2A 3F6OA 5J6XA 4YZZA 4G68B 1G6NA 3IKVA 3TZAA 2F78A 2VGQA 1R23A 4R2BA 1P1UA 1ZG1A 4UXNA 2IT0A 5BMZA 2H09A 3FJGA 1ELJA 5H8NA 1D4NA 2UVHA 3IX1A 2XAJA 3T9UA 1YW8A 4PDKA 4ESBA 2I3VA 4M71A 1Y4CA 4BHBA 2HYFA 2V1XA 3ILTB 3C35A 1T6SA 3PUVE 3N6UA 4GGGA 3B6TA 4M6XA 4QFKA 3B02A 1XSDA 3LR1A 2HDCA 2NRAC 2YJPA 4OFJA 4JDFA 4EJVA 2ESHA 2O1MA 2QS4A 4OIOF 3HRMA 1MJBA 1FQBA 3OXNA 2O68A 3CTAA 1B9NA 3MAMA 3VB2A 3KN7A 1EH6A 1T38A 2F97A 3SESA 4IO3A 4XIGQ 5H8FA 3F3XA 3PQJA 3RIRA 5L3GA 4Y15A 1D9VA 3QXMA 1J9IA 2YLNA 5HS8A 3T1BA 2DVZA 4AD9A 1FOKA 3IOVA 4OERA 5K2YA 2ALUA 3OO8A 2HZLA 3PUYE 2V9VA 1H44A 4UVCA 4KIFA 2XXWA 3UK4A 3DEUA 1UQWA 4DZ1A 4Q47A 3SFZA 2HCAA 3IB2A 3AAFA 2CG4A 1RZ4A 4KN7X 5TP9A 2OWTA 1NL5A 3SHFA 2DE2A 5DUIA 3P7NA 2M8CA 2QS1A 1QUJA 5E17F 3TTKA 1SQYA 5TRDA 3DQVC 4XSXF 2LKPA 3SEXA 3W9VA
chains in the Genus database with same CATH superfamily
2FUG2 2HYGD 1O64A 2RC8A 3RNNA 3DTKA 3IC7A 3ZN0A 2MD5A 2H6CA 1ZTRA 5IZ3B 4LLNA 3PIOF 3H3VK 2QEXI 2Q2CA 3VXCA 2BOLA 2CZKA 3IFCA 4QFNA 3E78A 2HAVA 4EQBA 3NAUA 4LFUA 3GTJJ 6PAXA 1DCUA 3OSQA 1IXCA 1ZGAA 4BBRJ 4I1DA 5I5PA 2RINA 2XAQA 4EEFG 1P7IA 2R7DA 3H06B 3K01A 3UA8A 2EV6A 4POWA 4MTDA 2QQ9A 3CUQA 4E7JA 4HPQA 4U0WA 5D8LB 1FPBA 5IM2A 5M3FJ 1LVAA 3DP8A 3E9XA 3LFKA 4YG2F 3HZJA 1D0ZA 2DXIA 1X2MA 1RPWA 3ASNH 3ZMUA 2V84A 1NV2A 3HIFA 4PCQA 1GGGA 3GZGA 4Y52J 1D0YA 2DW4A 2XUBA 1FZPB 1FCKA 3LUYA 1Q35A 4NMYA 1FIAA 4N4UA 3CCJI 2PFBA 5HVQC 1TL8A 4HZFA 3RQ4A 1IO2A 1GXQA 1ZMGA 1EYKA 5F1JA 1B8IA 2BW3A 4NQWB 1X3UA 4NNJA 3BR5A 3N97A 1MW7A 1YE9A 4XKQA 4OA4A 2W24A 3FJMA 3K1PA 2O51A 2M7BA 4L5JA 5L3BA 1XCBA 2VLAA 4KYWA 2WY7Q 4G7OF 1BKAA 5EGOB 3H03A 2EWNA 2JT1A 4GYGA 1MNEA 5CLSA 1JXSA 4Q0CA 2DOFA 2FBKA 4PTKA 3V83A 3TTLA 3JYRA 2M34A 4MIJA 3TTNA 3DBLB 4A3LJ 3FVNA 2I48A 4OVPA 4BNCA 4ZEFA 4EQQA 2H8RA 3PL8A 4GL8A 2QBYA 4L5IA 2R9JA 3KP3A 3MYUA 1WH7A 1GLNA 2QSXA 4A5NA 4M3BA 1P9QC 3FATA 2F5EA 5CI5A 2JA2A 2HAUA 2MKZA 2JJKA 3FASA 2OQGA 3KP5A 3VFZA 3CHGA 5LD2C 2A69F 1LFUP 1PB8A 1U5TC 1MBEA 3FIWA 4MJOA 5E3LA 5I2KB 3CVGA 2P2AA 4XICA 5TGTA 1ZREA 2B7EA 2V3QA 1MNMC 2VC0A 3MVZA 2CYYA 4GRKA 1VTNC 4JB7A 2QBYB 4F1UA 1I50J 2PMHA 3I0TA 3WTYC 2OTLI 2X6OA 2FOKA 2PVUA 3QMFA 4XRSG 3F11A 3C36A 4LLGF 3IRRA 2VJ4A 5DD4A 2BYVE 1US5A 4U1OA 4RM3A 3I59A 2EFNA 4ZE9A 2XWKA 2WAEA 2VJIA 1F36A 5TJJA 3DU6A 5ICCA 4BE1A 5ILSA 3FUZA 2E5NA 1Q1VA 5L3CA 4HYEA 1VQLI 4U1ZA 3I5UA 1Q1HA 3SJMA 3C4MA 5EQ9A 1UIVA 4ECFA 1LLSA 2K5CA 2X4HA 4HA8A 3CLOA 2NVXJ 3E6CC 2XROA 2A6EF 3RPQA 1E2XA 1XPXA 1T8IA 5BPIA 2L7ZA 3RSNA 2M0MA 2L9VA 1N3XA 2R71A 3FVOA 4BXFA 2CO5A 5ILVA 4ESJA 4KIGA 3HBLA 1SC7A 2DQRA 3NARA 3FJ7A 1JGGA 1RI7A 3V89B 3TBIA 4PGHA 1MXYA 3S3NA 1XS5A 4RNSA 1NNFA 3CUQB 2F5VA 3DTIA 3VDFA 1KZ8A 4BDZA 2HQ0A 2N8GA 1Y1ZA 1KU9A 2WTEA 4V2FA 1GXPA 1FSAA 2DFEA 1J7KA 1N3WA 3FK6A 3I4MJ 1SVOA 2ONSA 3FMRA 4S04A 3WGIA 3I9V2 3JSOA 3F9KA 5JLXA 3C32A 2CQ7A 2EZIA 3MJNA 3GTOJ 2ONRA 1IXHA 4F1VA 2Y9ZA 1LFGA 1OJLA 1MS7A 4O7MA 1LQ1A 3DLLF 5D8KB 5K7HA 1L0OC 2YX7A 5BS6A 4PC9A 1IG7A 3R0JA 5GTHC 1BA5A 2RF1A 3WTTC 1NNTA 2CQXA 1SEUA 2ZFUA 1MY3A 4OHNA 1FX7A 1PP8F 4GWXA 1M5BA 5B70A 1EKEA 1Z7NE 1VQKI 5BOXA 5D6FA 2PBIA 1MMSA 4F39A 3U94A 4IHSA 3BZCA 2EFPA 4NB5A 3VWBA 3F0CA 1A35A 2WKYA 2XC7A 2VL8A 1FBCA 2ZYMA 3O97A 1FIPA 4WEPA 1XT8A 1ZRDA 1NUYA 4LZ8A 4KI0E 3ABLH 2DJIA 5E20A 3JREA 2DE3A 3U1DA 4OIPF 1GVJA 5LGTA 3QUJA 4BL0B 2M30A 4LK1F 5HOOA 1BJAA 1VQNI 3MPKA 1BI0A 3A29A 4I62A 5ET6A 2B9SA 4C0RA 3VODA 2VOOA 5HS7A 1ONVA 1QZYA 1B4AA 2ANJA 3PFIA 1B5HA 2K9SA 4EM1A 5GAHJ 3IV5A 1R9TJ 1RDYA 2DTRA 4YIRX 2J5OA 1R1UA 4E7SA 5ET7A 1A36A 3K4UA 2K9NA 4EJUA 1DSNA 1MPBA 1B3HA 4N07A 2EB7A 2AQFA 2RREA 2MFZA 3FXKA 4Q4ZF 4LB5A 3HEFA 2MGQA 2L7MP 2PBWA 1B8IB 4GOTA 1BI1A 2ID6A 2ICWG 3ABKH 2PEXA 3DV8A 3RJPA 2HOTA 4RA1A 5EYRA 1W7PB 1UB9A 1HKQA 3GLXA 4HOBA 4JWYA 5B7DA 3BZ6A 4RGUA 2RGVA 1OVTA 2XKPA 1NV5A 5L8DA 5K2XA 1OR7A 2Q8MA 1IV8A 5FKOA 5FLVA 2VE8A 5D6EA 4LOCA 2CUJA 4Q5TA 1ULYA 2BY3A 4XLPF 4PAKA 4UHTA 3JRAA 3TCFA 3CSBA 4Q8RA 2VBXA 4QSHA 3RPUD 4C9YA 2DQVA 2M4GA 2R7FA 3UGWA 4N6DA 2LK2A 2XXKA 1NV4A 4BEHB 3L2VA 4NGUA 1NV1A 4PFIA 2F7AA 2ZC2A 5IY5H 1MPCA 2MYSA 4ZDPA 1TLHB 2FQ3A 2NAZA 2XGXA 1AMFA 1Y4TA 4JBAA 2KIUA 4X1DA 1LB2A 3HSEA 3Q0UA 3DPTA 3OYEA 1GHCA 1FQAA 3TEPA 2K02A 4RB0A 3U21A 2LOOA 2XGEA 1SI1A 3NWSA 2HDWA 1ACIA 1W5CC 1FJLA 2R7XA 4X9TA 1OLTA 4AIJA 2BZTA 3Q5FA 4GX6A 2FOWA 3R61A 4OWRB 2XPWA 3CCLI 1MH4A 1R9LA 1WWXA 4JBZA 4CO8A 2H98A 5F24A 1WPKA 5CRYA 2V26A 3QAHA 2UYFA 2QVOA 2DE4A 2DOAA 5A2QK 3CMAI 5LEKA 1ITYA 1QUKA 2PG4A 4NX1A 4OEUA 1LCTA 1N76A 5DCMB 5DS9A 3KEYA 3CMEI 2E1OA 3DXJF 2NUVA 4PJLA 1B5JA 3HO7A 2ZXHA 1HSTA 5I2KA 1FWZA 2XXXA 3CMMA 5JR3A 1URSA 1ZLKA 1AOYA 4QSDA 2NXNB 4RDUA 2Z3YA 5L9OA 2IGMA 1LFPA 4D9JA 1ZR4A 1QVTA 4NHJA 3KZGA 5DVIA 5AA2B 4IGRA 3LSGA 4L9NA 1TWCJ 1LGBC 2YPRA 2CW0F 1ENHA 3T96B 3KEQA 4QF9A 1D1AA 2CSOA 1K7AA 1FOWA 2UWMA 2DT7B 1Z77A 1IMFA 2MLGA 2LC2A 1IZ1A 1LFIA 3KE2A 4G9YA 3H6VA 1TWFJ 2HHMA 2LYCA 1TFDA 3EYIA 4AB6A 2BEOA 5EG0A 3L2WA 5KDTA 5L3FA 2CW7A 2W85A 2DN0A 2R5ZA 3THIA 2ELJA 4DYQA 3HSRA 3IORA 3R6UA 1STZA 3G71I 3D5RC 2EINH 4C2UA 4OU0A 1WSUA 2DMQA 3DBRB 3PPQA 4G12A 1S8NA 1P1WA 2L9SA 2WC2A 4B3AA 3LNQA 1R5HA 3EN3A 5CMCA 4EUOA 5I58B 3HG9A 2OU2A 1JJ8C 1U6GA 5C3EJ 1IAWA 3R6SA 1NHAA 3WAFA 2HXWA 3SZPA 3PO3J 1XC1A 1LDKB 3CUQC 1RETA 2HOSA 3HHGA 1JKQC 3HSTA 4GWUA 4OZ9A 2BY0A 4AYBN 1BC7C 2QM3A 4U7BA 4ITVA 3CJQB 1IRGA 4KCDA 3VVDA 4EXKA 1VF9A 2LREA 4YFXF 5IP6A 1R1NA 4ZTJA 3VFJA 2H4IA 3E6BA 3V42A 1KA0A 4Z7EA 2HTJA 2MW8A 3MP8A 3PMXA 3WTVC 3OV8A 4ENMA 1Z6TA 1Z7UA 2KHMA 1LAXA 1FMWA 1XGOA 4QBAA 3CDHA 1Y20A 1KU7A 2A5WA 5IYCJ 1SDXA 3I3VA 3IWFA 3S15J 3FVKA 3C2BA 5A5XA 2H25A 4MLOA 5LLQA 2GZWA 4XEQA 2BE5F 2DMUA 1ETXA 4NTLA 4F3SA 2ZO4A 3G3JA 3RCOA 2VB6A 1JI8A 2F5XA 1JE8A 1YXIA 4RGSA 4YB5A 2IA0A 2XB5A 2LFBA 3X2QH 1YI2I 1ZJLA 4AS5A 3C7JA 3FMQA 3FK7A 1T2KA 1G3YA 2W84A 4B1RA 2I0CA 3JTHA 1JUSA 4Q48A 1O4XA 1PDAA 1MXUA 2HZDA 1R36A 2OQRA 3IP4B 4LB6B 3CSGA 4YIIA 4FECA 4U0YA 1N78A 5FO5A 4X0GA 1VE4A 2W48A 5I56B 2FU4A 1X1PA 4EMSA 1I39A 1ZG3A 1MY4A 2MC4A 1CGPA 3MWMA 3H4ZA 5HM4B 2V4JC 3ZQHA 2VPNA 2XWIA 1P6RA 1LUJB 1IIWA 3SDFA 4BQOA 2VT3A 5EDNA 1IMDA 5CMKA 4XKCA 3CJRB 4BE0A 2JA5J 2ZKZA 5HLTA 1BK4A 3LSPA 2LMDA 4P11A 3T93B 5H8FB 3EPZA 2QFLA 3PUWE 4R79A 1YS7A 4B3XA 2BXYA 4GIZA 4IQJA 3E5QA 2DFFA 5I59B 2EIKH 3I64A 4XK4A 4A2UA 1BLFA 3QPSA 3CO6C 1WJFA 2XAUA 4F52A 2RCAA 3FD3A 3MKYB 3LSFB 4KHZE 4JOMA 1R49A 5AA2D 1P4WA 1O7FA 2E2JJ 4F3BA 4MCOA 1JTXA 2WV0A 4HF0A 4EV0A 4R75A 2WWYA 2AIXA 5J16A 1PVEA 2XV4S 1H8AC 2HYJA 5HBCA 1RESA 2L0KA 3EHTA 3WAEA 3KN8A 4CYCB 1F4KA 1URGA 3FBIB 4BDLA 1UHWA 3T66A 5GPAA 1XSXA 4XKWA 3L6HA 3MZ1A 4II2A 2I58A 3KYLA 1MD0A 3OOUA 1QJMA 3LFUA 2V3TA 4YAHX 2KIMA 1S29A 2QQBA 2M2EA 4X8RA 4YU0A 1PBPA 3DP6A 2DK5A 3QYEA 3DPLC 5TPAA 4M4GA 4TQUQ 3OYIA 2H27A 2Y7RA 4OIRF 5H8SA 1WRJA 1Z91A 1Y3NA 3OR1C 3W2WA 3L2QA 4OOIA 2VHAA 3BG9A 2ZZWA 3N94A 1R4MB 1FPKA 1IN5A 1TBXA 4WKMA 3O2PE 5H8NB 2A07F 2HOEA 4Y4RA 5CM6A 1MBFA 1ORKA 2WADA 4QTRA 5LHIA 2UXAA 3QUFA 4GWSA 1B0HA 1BIBA 3MKZA 3EUAA 1NI9A 1OCPA 2LDUA 4AUXA 1H76A 4P47A 2FE3A 4M6VA 4UUSA 3BG3A 1XN7A 1Y9UA 2Y0MA 3GFLA 2PI0A 2W57A 2MABA 3OYJA 3O66A 3MVXA 1UHMA 4XORA 1ETKA 1KYWA 1QULA 4EGYA 3V7SA 3WG7H 4UNOA 3U1KA 1OLAA 4M72A 2I0BA 4HF2A 4M3GA 2AL4A 2BHZA 2ME0A 3C31A 3S1NJ 1H89C 2W7NA 5F04A 3DTEA 2A6TA 3GW2A 2CV0A 2QRYA 4OVRA 2DA4A 5D5XB 5L9SA 4XRFA 2NVUB 4PK4A 3S17J 3GXOA 1YYZA 2DXYA 4F93B 1ETVA 3ZQLA 2FEZA 2QMXA 3H6TA 4N9HA 4Y33A 3FX3A 5E8GA 3S1RJ 1SFUA 5J4YA 2IEEA 3I59B 3B8BA 4IO7A 2CRGA 1IGNA 4ZEKA 1W7PD 2O7OA 3RKYA 1SVXB 2G7UA 2Y7PA 4MMPA 2TRTA 1B2HA 2PMZA 3ZMDA 4DOZA 1JKOC 2ONKE 3KJTA 1ODDA 4EXLA 4B09A 1I6AA 3BR1A 3M8UA 1TW3A 3FVGA 4QXDA 3RKXA 1XVXA 3RUMA 5T3JA 4BJ5C 3BTLA 3M3FA 3PPPA 4GWOA 3ZKLA 5I3SA 4P56A 4BJ6C 4QFLA 3M1CA 1K9ZA 2VE9A 1HOMA 2CQNA 1QW0A 4G7ZF 1YQAA 3ROUA 4ENNA 3HKZA 1JW5A 1OVBA 1B7UA 1T0FA 1B1BA 4MQ9F 3E4RA 3QQAA 4EJOA 4UUVA 1WI9A 1WHUA 3HOTA 5K7FA 1B32A 1LCFA 1MY2A 3HL2A 1Y3PA 3MZYA 2FQ4A 4ETSA 2GLOA 1ZBMA 2VKDA 2RC7A 1FNNA 3CF2A 4H0WA 4OANA 4UABA 2KMUA 3TELA 1JTYA 3JRDA 4J19A 5C4XJ 3R60A 3V4GA 3SETA 2GXGA 5L3DA 3GBGA 2PLYA 2R5YA 5GAEJ 1ZR2A 4M6YA 3DF8A 4YFNF 2R6GE 3FGSA 3ZQIA 2NVYJ 1YIOA 1B7ZA 3BJ6A 2VASA 1Z9CA 1VFDA 2E7XA 2EFQA 1OR7C 4FX4A 3KLNA 1Y8QB 2EQRA 1HA8A 3ECOA 5KZTA 3KLOA 1G4DA 1G0HA 3TAJA 1FBDA 3CG1A 2OC6A 4LN5A 1LJ9A 1UIUA 1IMCA 3TCGA 2LLKA 1FQCA 4ANJA 1FBSA 3ZP5A 3KEOA 1FBQA 1FYMA 4A3BJ 4XNFA 2LR8A 1WODA 3S14J 4ON0A 2DP8A 1SAUA 4GBVA 2FMLA 4M9ZA 3RPLA 4FBPA 3S2VA 5GPCA 1A6QA 3OMYA 4P55A 3BR3A 2REJA 4N6KA 1IMBA 2X51A 1TQIA 4BUPA 1LEBA 1B3LA 1I6HJ 4N17A 3C3WA 5EYHA 5TISC 2HZTA 4DJAA 2L2OA 1A8FA 2HZKA 1V54H 1TQPA 3ULQB 1LBZA 1Y56A 2OZ6A 3IL1B 4RAZA 1K6OA 3K9TA 5FFXA 4HLYA 1CB6A 2D1HA 1PYVA 1UFMA 4IHXA 4F3GA 4CH7A 1HKTA 4R8HA 4FE8A 2KDOA 1ETWA 3LSMA 4XLHA 3A0BC 2QJEA 3ML6A 4LG3A 4LQ2A 1XSVA 4I0BA 2H1KA 1II5A 4DIGA 3LMMA 5FROA 3H5AA 1UCRA 2QGUA 3WU1B 2PJRB 1TFAA 3O6GA 3ROJA 2E71A 5DDGA 2KDZA 2FHYA 2IS6A 1K6YA 4F2QA 5CBSA 2A5YB 2ZNZA 3CO7C 4AQ4A 3HJEA 3C18A 1YG2A 1I1GA 3OO6A 4G8MA 1GR2A 1RKWA 2VONA 3QP6A 4IO4A 2KRFA 5DV5A 1GDTA 2Y9YA 4LIUA 4BDNA 1IITA 2G93A 4OIQF 2X7PA 3F72A 3TW6A 5ERIA 3ASOH 1V55H 4E70A 1LPQA 4DI3D 1EU8A 1JHFA 2C6YA 4FEBA 4F29A 2HGCA 1P1OA 1SD6A 2WY8Q 4KN4X 1G2HA 3C34A 1R7JA 1LBBA 3ZQGA 4JSOA 4A69C 4RBOA 4BH9A 2KZGA 5E3MA 3FXQA 2B3FA 3GEZA 1CQTA 3J81Z 1B3GA 4XIDA 2R0QC 1ZH5A 4L9TA 1D0XA 2GHAA 2DOEA 5E79C 3J7AY 1VQ7I 1N77A 3OOPA 1FLIA 2UUZA 1HKSA 2FBHA 2Q1ZB 5EEAA 4EJWA 4OTEA 5BWJA 3BQYA 2R3SA 3DEWA 4TV7A 1K79A 2V1UA 2JA8J 1FPJA 3FV1A 4PFUA 3O29A 1Z0XA 3L2RA 5DM7F 1R22A 2NWJA 3DM0A 4QPQA 5FKLA 4FASD 2OA4A 4B8XA 1RDZA 1WJBA 3DLAA 5JHUA 1YCJA 4ZEBA 1OCOH 1H9TA 3PUFA 4NQWA 1OIBA 5FKMA 2CU7A 2Y2ZA 5ICEA 3R7XA 1B3FA 4CCKA 2CEYA 2XGDA 4JX4A 1SBPA 1SW5A 3GBAA 5A5LA 1IW7F 2F5CA 2YPNA 4LK0F 2ZNTA 3LV0A 1FC3A 1WI3A 1DP7P 4BDRA 2DDBA 2E1CA 2KL4A 1MNDA 4D0PA 2AS5F 2VPLA 2GM4A 1X1AA 3SERA 5IOZA 4RJZA 3ESWB 5EEHA 3LWFA 5FLXZ 3BKIB 4X1EA 4R9FA 2CUEA 1WDNA 3OOAA 2TDXA 1JT0A 4R6YA 1G0IA 1NV6A 2REGA 1EZ9A 3RKQA 2IS4A 3WTSC 2Y84A 3EF7A 2O8XA 2XSDC 1FQFA 2PT1A 2VD3A 2Q88A 3R26A 4YKPA 2B0LA 1NFTA 4N15A 3BTCA 4QSEA 4R1HA 4ESXA 1ZGJA 5EZHA 2XAHA 2XAGA 5F0FA 3SQNA 4C2TA 4U4SA 4EF1A 1PUFA 4I8CA 3RYPA 1SD7A 3GTLJ 4XRMA 1D9YA 1GVCA 1IJWC 4P1EA 3HHHA 1FTAA 4L5EA 2DS9A 3M07A 3IO4A 3PD9A 4YRVA 3FIRA 5FRNA 4I99C 3FBPA 4DDDA 2X6XA 1W36C 2XVCA 3DCFA 2PQ8A 1SMTA 2KLOA 5TPAB 1V4RA 3OYCA 2ZJPF 3BPVA 3EQLF 5JHFA 3S9NC 5L3EA 1EYIA 3J80K 2HS5A 5HLHA 3PMWA 3VOEA 4NF8A 5IYDJ 5DEXA 2COMA 2R7UA 1ZIUA 3VE1B 2FIEA 1IXGA 4GF8A 3O8GA 4H67A 2K85A 3A01A 3IOWA 5E3NA 4OVTA 1GUUA 3Q9VA 4PJ0C 3ZCOA 3WTXC 3M3YJ 3ONQA 4CCOA 1NH3A 2XXPA 4JYKA 4Y3OA 3MP6A 2KQZA 1KZHA 2R7ZJ 1B5IA 4QFOA 3CF5F 4MHGA 1LAFE 2UYEA 4F1YA 1B4HA 4O94A 4B4CA 5JFRA 1WJAA 2L7FP 2R4GA 2P5VA 1YRNB 5ICFA 5IOYA 1JVXA 2QLZA 2P3VA 4G77A 4MQVA 5IP9J 4I3YA 2HQNA 3K1NA 1MRPA 1K78A 1P1NA 1K4TA 2Q89A 3PJRA 1TNSA 3MEXA 4E6KG 1TT1A 4DNCA 3VLWA 2I4CA 3MMYB 3J7YJ 2F7BA 3BR0A 1DGWY 3VDXA 2B63J 1T33A 5F1RA 1WZ2A 2F4MB 2X48A 4Z2YA 1D1BA 3QOEA 4BDYA 3E79A 1PJRA 2H6BA 1N84A 4OYVA 2KRHA 3BWGA 3WTZA 3IH4A 3HOYJ 3TQLA 4ELQA 3KBRA 4JQFA 1R5ID 1TT5B 1TWHJ 4GX4A 4H65A 3A03A 3CZ6A 4RPOA 3D5LA 4KDPA 2NVTJ 3T9VA 3BTIA 4IRGA 2XAFA 1BR1A 3JAMZ 1LFHA 1YZ0A 1JW4A 4GWYA 1BC8C 5D5VB 2ELKA 5J8FA 1T56A 4IO9F 2XXTA 4YMAA 1LDDA 2YR2A 4BQQA 4HCWA 5AONA 2IRFG 3E0JB 2ZYKA 3M9AA 3B50A 3QK6A 4IO5A 3WHBA 3OYLA 2E1NA 4ZJZA 5CYVA 5H8HA 5B3SH 3BR6A 1WQ2A 4GD5A 4LG0A 5DEQA 2LVSA 3EHSA 3J7AO 1NV3A 3TP0A 4YICA 4FX0A 5FHOA 3CFZA 1K83J 2QWWA 4RYAA 4ZH4F 3CC4I 4PDDA 1MDMA 4IRIA 4XL9A 2GOXB 5JVGF 2JA7J 4CGZA 3G3IA 3FXUA 5BPDA 3HHFA 2K40A 2EZKA 2MBFA 3E7LA 4GXSB 2DXRA 2Z2SB 2F5FA 4XSZF 3GCMA 4F2OA 2P6TA 3H35A 4RM2A 2E7WA 2VJJA 2XKOA 3E13X 5J8CA 5ICGA 2R7TA 3HGYA 3PNTA 1WVJA 2JVGA 1MSEC 4IB2A 3S1QJ 4C3HJ 3I56I 2E1SA 3QYFA 4PF8A 2R5YB 1FQEA 4MLVA 4MX6A 1DPPA 4AVZA 3FF5A 5FKKA 3TW7A 1VDWA 3V8KA 3BROA 3DBHB 1NV7A 4IEJA 5F64A 5ESYA 1FBHA 3DKYA 2KZVA 4UUTA 4KA4A 4XM3A 3HPHA 4ZZLA 1POTA 1T0FC 4HX4A 1N0TA 2TCTA 5B5EC 2WAFA 1R58A 1IDYA 4E0XA 5D4RA 3IK6B 3DKXA 3GUDA 1SD3A 4PFYA 1S3JA 2FNAA 2P8TA 3GZNB 1ANFA 1JETA 2F7CA 1HSJA 4HV6A 3NOHA 1R4NB 3QIMA 4KR5A 1G8XA 4KPTA 2VN2A 3AFHA 4FATA 1V5GA 3QPHA 3K4MA 4LLLA 4ZYDA 4KYSA 2ZSHB 2FF4A 4A5MA 1TWAJ 4RAYA 4E7ZA 5K1YA 2HR3A 1LBCA 2Q9TA 4O5VA 1JKRC 4O6JA 2V6CA 4JVIA 4MO7A 2HEOA 1J59A 3M4OJ 2CW8A 2L4MA 2M4KA 1QU3A 3KBZA 2DK8A 3UN6A 2E1MB 4GYIA 2VQHA 3LSWA 5AA4B 2IA4A 3HPIA 2XXYA 4K2EA 4P3LA 4C3JJ 1B72A 3LSKA 5EF6A 1MXVA 4QRZA 2LBFA 5CVJA 4XONA 1ZTYA 3TO9A 3RQTA 5CMBA 4ISUA 4X48A 3TMGA 1JKPC 4ZZEA 3RPUA 1TQMA 1U3EM 2V4CA 4AWXB 3E3KA 4HNVA 3IOUA 4EQ9A 3NQOA 2LY1A 4I9DA 4FETA 1OYIA 2L01A 3D4GA 4MNUA 5KCJA 1WH5A 3ECRA 2OF7A 4KD5A 4ZYGA 2JQ7A 1Z7ME 3D4CA 3GLBA 1LEAA 3H92A 3V7CA 4CCNA 2X6WA 4IOCF 3CC2I 2OTJI 2M45A 5HS9A 1GV8A 4BBSJ 4PFRA 4ZZAA 3SEYA 1UHSA 3GX4X 1APLC 1H9GA 2ZNYA 5F08A 1DTGA 1LEVA 2DDKA 2PT2A 1P4XA 5I57A 2CFXA 1UMQA 1F5TA 1BJZA 3KYCB 3OS0A 4NAPA 3TTMA 1EV7A 4CZCA 3ZMZA 3LA2A 4MEVA 3RY3A 2Q8KA 2DTZA 2D3IA 4U21A 3RN8A 4UV9A 1FBGA 2D21A 4H46A 3LSHA 4HE1A 3KGCA 3AG2H 1N75A 1X1BA 3FM5A 1PBQA 2RV8A 3L09A 3RPWA 3WGGA 3OO7A 1IEJA 1X58A 2RC4A 1VQ8I 4DZPA 3FHZA 3E5XA 1FSHA 1IMAA 1XDUA 4KQPA 2DCEA 4FTHA 3RPLB 4EM2A 3D0SA 4PE5B 3CG3A 1IRZA 2HFBA 3TQWA 4XR6A 4E7LA 2LAOA 4N6PA 1U5TB 2ZJ2A 4MGRA 4HXVA 1H45A 3M1EA 2VIXA 5KCMA 1Z21A 2CMPA 3Q25A 2ECBA 2JWTA 2JA6J 3MVYA 2E60A 4RK2A 3PIPF 3FV2A 3JTGA 2GWRA 1O3QA 1MJ9A 5J4VA 3H7MA 5JTYB 1A55A 5I2NB 4HW0A 1FPFA 3LSLA 4R6HA 2F48A 2JUGA 2KT0A 3Q9SA 1Z67A 4PCDA 1GV2A 3RT6B 1FOYA 3A1YA 4C1UA 4ABZA 4N13A 5ILUA 2IS2A 1RYOA 5F7VA 2RAEA 3OEKA 4OQOA 1BI2A 1HW5A 1J1NA 2JJ7A 3GZ6A 4MFDA 2V1DA 1ZGWA 4DXBA 4BXUA 1NH7A 2WB1A 2JVHA 5FD5A 1B7HA 1RKMA 1US4A 2XDVA 2Z8FA 3S9EA 2IS1A 3L6GA 1ZLQA 1KYZA 2Z5UA 2M5WA 3K2AA 4G2ZA 1S7YA 1RC9A 3PUBA 1FBEA 2EIJH 4B47A 1F43A 3TODA 1YS6A 1SVLA 4FT8A 3W6JB 3Q28A 1R6RA 2AO9A 4H6DA 4LVQA 3UORA 4MIMA 4B43A 1A6IA 2OBGA 3CESA 1BR2A 4YEJA 4N81A 2E34A 1PUEE 2H1LA 3S1MJ 4WK8F 1OCRH 4HG2A 4ZYAA 1D5VA 1J0RA 3OIQA 2LNBA 5DVJA 1POGA 2VT2A 5GADJ 1Z7LA 1ETOA 4U4XA 1X4PA 3WHCA 2RC9A 2AXTC 1U2WA 1QQIA 2VPRA 3IAM2 1FPIA 1XVYA 4PBHA 1GVDA 4DBRA 2P5LC 3HKZN 3MP1A 1S5LC 2XF6A 2OV7A 3IAZA 5EYGA 5C4JJ 2QYOA 3HTUA 4ELPA 3G3ZA 3FXRA 4G4PA 2DT5A 3H0DA 2Z22A 2OZUA 3I58A 3K4BA 4BQAA 5CKTA 2O6GE 3CCQI 3MCZA 5FKNA 4WX9A 2Y5LA 4ENKA 4BU2A 4JP0A 2ZXJA 4DZJA 2KP6A 3JRGA 1FY7A 3GYHX 1FTLA 1R9QA 2QCOA 4B44A 4ZE8A 4NF4B 2ZJRF 5DD8A 1Y6IA 4I40A 2EILH 3G7WA 1A8EA 5CJ9A 3TYHA 3HB9A 4WCGA 3K2DA 3IR1A 3T9HB 4IHVA 5EJCA 1T08B 2HKOA 2IVMA 1LSTA 1FTJA 5GAGJ 2MH9A 3E5UA 3PNYA 3W2VA 2STWA 3QAXA 2VOPA 1TXFA 2DU9A 5ICTA 2D5WA 5DYMA 2FVZA 5KDTB 3CR9A 1V5EA 4FEDA 1T0KA 1R6ZA 3U92A 1S72I 3GFMA 3ZPLA 1JJ6C 3PO2J 1SFEA 2E1MC 3PD8A 1IDZA 4UB8C 3HXLA 3J81K 5IPAA 1W5SA 4NWDA 4GL0A 3SEVA 1B46A 5LTCA 1YJWI 3LQRA 4CYCA 2JPCA 2ZMEA 1IN6A 2FSWA 3S32A 2JMWA 3MFKA 1BL0A 1X2NA 1UTHA 1USTA 3KP6A 3OS2A 1YTVA 4IO6A 4LUBA 2L4AA 5LRRA 5GTIC 3JRIA 4OAYA 3TQNA 1P7JA 3BG7A 1A5JA 5F6FA 9ANTA 3ABTA 4WF2A 4F92B 3OSGA 2XX7A 5CMMA 4P0IA 4ZS9A 3W3CA 2ZCWA 2EZHA 1O3RA 2DQLA 3C2GA 1B40A 5I59A 4DW6A 5D5UB 1LFBA 2F4OB 2VBYA 3JRBA 1B6AA 1U9NA 1ATGA 1NKXA 3LAPA 3K4LA 3BBRA 2O5RA 1MJAA 2M9HA 3QPTA 1W0UA 2YUSA 4MBPA 1X3ZB 1ZKBA 1S7AA 2MA3A 5E8IA 1DUXC 1RDXA 1VFCA 3DELB 3K6VA 4G8NA 5ITPA 2HXRA 3EYYA 4O7IA 5FHNA 1WJEA 2VP1A 4IL6C 3MVPA 3VPRA 1USSA 1ZRCA 3A2KA 4L9JA 2PJRA 3V7RA 3AG1H 1S9TA 2ZZVA 5FD6A 2XB0X 4OFOA 3G3HA 2GIVA 1F1ZA 4AVPA 3MZ8A 5FHMA 2ZB9A 3K02A 2IGOA 3MKLA 1BR4A 1QBJA 2GRVA 5HNFA 2ID3A 4CUGA 1Y1WJ 2QQAA 4KMFA 3K0VA 3CC7I 3OD7A 2R7RA 5KNLA 4OVQA 4XFEA 3K70D 4IOAF 3IRQA 2BXZA 5M5XJ 4OINF 3PTYA 3KIOA 4ZDOA 3PMVA 4YKKA 4M73A 1BI3A 1CE2A 2Y0SA 3HOUJ 1FMVA 4KYEA 3N4MA 4M74A 2L3DA 2JRTA 4NC6A 1XD7A 1FTTA 2XA5A 3JV9A 1PEBA 3W15C 3BZKA 3QU6A 4U87A 1Y1MA 3ZMSA 2F3BA 2P3NA 3G3KA 2YX4A 3H5RA 1ETQA 3ZQQA 2F6CA 2KFDA 5DCFA 4KT6A 3V8LA 1CF7B 3ODBA 4GVOA 3U2RA 1AOVA 5CVUA 1I6QA 2XRNA 1REPC 2V3UA 1FSEA 1OQYA 2I8DA 2UXXA 4I76A 2R5ZB 4BE2A 1D5YA 1EZPA 2NOJB 5IZ3A 3G4SI 3RQIA 1KA8A 1ETYA 2V1NA 3IUOA 4AIDA 3CCEI 1QVSA 2DAOA 4JWXA 2D5VA 1IUYA 3GBBA 4DLDA 3LSJA 2DWIA 3H36A 5EYFA 5B66C 1U9OA 3TOAA 4P9UA 3L1PA 3MZHA 2V25A 2CS3A 1VFEA 1RR7A 1W1WE 1QGXA 4F91B 4PBQA 4YMBA 5CBRA 1FTOA 4NG7A 4QSCA 3GWZA 3PPNA 5E18F 2KKOA 2KJBA 3A0HC 4N8GA 1B51A 2K9LA 4PAFA 1E0EA 2RVCA 2UXNA 3R4KA 5M5WJ 3WU2C 1MGTA 2AHQA 3T8TA 5CQEA 3Q29A 4H45A 2DA5A 4RXLA 1FPLA 4LP2B 3QWLA 1SD4A 4G6QA 5F1QA 1MQGA 2EA4A 3KP7A 3HRTA 1AU7A 4U88A 4CICA 1M5CA 4JXIA 4PSXA 4MLQA 2MH2A 3LQQA 3VSKA 4I7HA 4G7HF 3BDDA 4UY8I 3H9QA 5DUKA 4IHTA 4XKRA 4G8XA 2Z23A 4XXUA 1MKMA 3E97A 5KAFC 1I1SA 2XD3A 4O8MA 2KPMA 1IUDA 5E1XA 3H0GJ 5FBPA 4DXUA 1HCRA 4FQGA 2Q74A 2F2EA 1H88C 2FNCA 3A02A 2PYYA 2VQGA 3VEPA 4LGWA 5LBQA 3RLFE 2FBPA 1X1DA 5AE4A 1JW1A 2K3PA 4F7ZA 4NEDA 2HDDA 2OD5A 1JQFA 4ND9A 2H99A 4PGNA 4HAMA 2CMOA 2P4WA 3MUQA 4BHPA 1KQ9A 4RB2C 4NQ8A 1VQPI 4S05A 2KLFA 4XMYA 1G3TA 1S9HA 2RDPA 3HRSA 3P9IA 3E6MA 4A3FJ 1TC3C 2ISZA 1B58A 2VXDA 4ESFA 2PN6A 1MDQA 2HOAA 3K0LA 4OVJA 3KZZA 1FJ6A 4G8HA 1WCMJ 3IJOB 1TNTA 5B1BH 3OYNA 1B9MA 3U9GA 4BQNA 1R71A 1HSLA 1V5FA 3S9MC 4H8IA 3CCRI 2VOZA 3M3KA 4HW8A 1DBZA 4KIBA 1AH5A 3F8MA 1X3WB 2BV6A 5DTDA 5M3MJ 4A3EJ 2Y69H 5BNGA 4POXA 3V8JA 3CP8A 2R7SA 2VKEA 5ET5A 5IYBJ 2L7KA 3ZR8X 3I55I 3IOTA 3GO5A 1ZLJA 4V19K 4IY6A 1MXZA 1P2FA 3GXAA 4U2RA 1IMEA 2A5TA 2L5QA 3BQZA 4KMUX 1BIAA 1HC8A 2ZXIA 1QPMA 1Z1DA 5LHGA 2O7UA 2NNYA 3IB0A 1W7PA 2QUFA 1YIJI 3OIPA 5J1YA 5J47A 4Q5SF 3UKGA 4L18B 5E1ZB 1DPEA 3PM1A 3SYTA 3OYKA 2UZKA 3BFTA 2YSRA 1UTBB 2CZIA 3AG3H 2MG4A 1YX5A 3WE2A 5IT9Z 4ONYA 2ZYOA 2IEKA 3KP2A 2CWEA 2QSGX 4G94A 4BY1J 1HW1A 2RKHA 4A0XA 2NXOA 2QA4I 2BVMA 2L02A 4HEA2 3PUZE 2AYSA 3B6QA 1URDA 4O3BA 3CCYA 2VKHA 1HDDC 1SFOJ 2F4IA 4RK9A 4EQ7A 4QLCU 3RYRA 2R7QA 4M9XA 1O63A 3ZQ7A 4U23A 2CQQA 3H3GA 2VODA 1IN4A 4JX5A 3J7ZI 4A3JJ 2R7VA 2ACJA 5EHMA 3SEQA 2HXOA 4A0ZA 3CP2A 5HNHA 2P7VB 2K3FA 2O0YA 2EJRA 4LIVA 1MM7A 3FXBA 2OCUA 4D5FA 3IAS2 3CJTB 3F23A 2GA2A 3HOWJ 2LP0A 1K4SA 1D3YA 3TKDA 3LUZA 5HDKA 1AL3A 2XXVA 2ZZXA 2A5SA 4KITB 4IR8A 1FOXA 2ZSIB 5EQ8A 2V9KA 3VYTB 5LHHA 3EQ1A 2LTPA 2M87A 2ZMEB 1UTHB 1LDJA 2GQQA 2BJJX 4ZECA 2XSJC 1VNDA 3RDIA 3TL4X 5IP7J 3SDBA 4IKFA 3ONMA 3CMYA 4MHFA 4KJZA 3W6VA 1FPDA 1J2XA 1ZELA 5J1RA 3CCUI 2OCEA 2IA2A 3IL2A 1MMAA 2OCCH 3NRVA 4CCMA 2STTA 4A3GJ 3A3UA 4HDUA 2XXIA 2FD5A 1D8JA 2A05A 3FKIJ 4ELOA 3B7DA 1IXRC 2Y75A 4NC7A 2A5TB 2XRLA 2OK2A 1R1TA 1UAAA 2ETHA 1YYVA 2FA7A 4H8JA 5A5XB 3U72A 1QHGA 2EH3A 2IPQX 3OEMA 5J3LA 4GQOA 2JK3A 2G0EA 3I3LA 4XOTA 1AKHB 3BIGA 1MMDA 4NF4A 5FGMA 1VQMI 2BVLA 1IRXA 3WU0A 5FLMJ 3MN2A 3KP4A 4RAGA 3CRBA 4TLMB 3BLYA 3FXOA 2B65A 3KC1A 2CZLA 2XX9A 2HVSA 2I4BA 2E0SA 2O1LA 5LOMA 2B4LA 5H20A 3DU5A 4UVAA 1OCTC 1ERDA 2Q2EA 1BIYA 3RI4A 4L0YB 5FRMA 3ERMA 2HQAA 2XWVA 3BC8A 4G6DA 4A3DJ 3IHUA 3BTJA 2GH9A 3LSIA 4WXDA 3G1OA 4D7NA 3HM5A 1FBPA 4KNYA 1LB8A 2PMSA 3SEWA 4NDLA 3L9FA 1OCCH 1LBYA 1SD5A 2OJTA 5IKBA 2Y48A 2A68F 1USYH 3K6WA 3KCCA 5KAIC 2Y30A 5ED4A 1MBHA 3K10A 3PFYA 3M8EA 4UVBA 2ZMEC 5TP9B 2DFIA 2EA2A 2K9MA 4O3AA 2OUMA 1RUNA 3KZYA 5J1UA 4XLFA 4CCLA 5EG0B 1HXDA 1OYYA 1YPNA 1TT0A 1MXXA 4OETA 5F27A 3T22A 4GX3A 5I7IA 4DQ2A 5J1DA 1WFXA 2O8KA 3LA3A 3OSFA 2NNNA 3K1MA 2QVRA 1MM6A 3KG2A 3N26A 4U22A 2O3FA 4GLIA 4CA0A 4OMYA 2L9NA 4C3IJ 2R93J 4KCCA 3ZN1A 1J75A 1XGMA 4FE7A 1FBUA 2VBWA 5C44J 2ME6A 4XLAA 1BOBA 2DPUA 4HS7A 4ZEDA 1OKRA 1F9NA 1VZ0A 2VPOA 4LONB 1AIVA 2IP2A 3VLUA 1XMKA 4HDVA 1E3OC 2VQCA 1OMIA 5JI6A 3LC8A 1E3PA 4CZZA 2ZXWH 1T98A 3BG5A 1FYLA 5I56A 2EZLA 1WVRA 4IVNA 2I10A 3U8QA 2Y7KA 4GXOA 1B1XA 1QZEA 4GFBA 2DMTA 4ZC3A 4F19A 3MSTA 2HQRA 2QPQA 4BLAA 4NN3A 1UG2A 4XKNA 4NC8A 3TEDA 2EBIA 1OFCX 1BM9A 5HDGA 1RNLA 4RLFA 3E1SA 1W5TA 2GA1A 1WJ5A 2IGKA 3KOSA 3MZ9A 2CV2A 2ZNUA 5EGOA 4RA2A 1S7OA 4OMBA 4F22A 3K70C 4CDGA 1MMNA 2JZYA 3I4PA 2R7WA 2X1CA 1SFKA 1DMBA 3WG9A 1XGSA 2BW3B 3JW4A 5CQGA 2ABHA 2Q2EB 4DE8A 3Q0WA 4Z6YA 3S2HJ 4FCYA 3UIFA 2XHKA 1DK4A 2QSHX 3K6GA 2ECCA 1MSFC 5D4SA 4MEXF 3CDIA 1Z3YA 4BHCA 3H9JA 1LBWA 1NNKA 2ZYNA 3PGFA 3PV0E 1A54A 3SDGA 4P5OA 5FJ8J 2LSOA 2DJNA 3SXYA 1AKHA 4CHUA 3JZJA 3TTRA 4MTEA 5I58A 4L9VA 2THIA 1A7LA 1KQ0A 5CVRA 3QRFF 3K4CA 1LBXA 1R1VA 4PFBA 2OBPA 3S16J 1ZYRF 2HVQA 3PSFA 3LSXA 1PC3A 1YLFA 3OIOA 4IHWA 1ZN2A 2CUZA 2GOMA 5D5WB 3GFIA 1KQ8A 3V8XB 2WX9A 5F0HA 4WXHA 4NF6B 4RY1A 3O6IA 3ZKKA 3CFLA 4P1LA 1M5FA 4DXCA 4HE2A 1NG6A 1QRYA 2E36A 2VJ5A 4FE4A 4PFTA 5M2VA 2A6HF 1M5DA 2F35A 2OX3A 2XF7A 4CXFA 4GDFA 4A3IJ 4HX8A 1XDSA 2K86A 4YFKF 3K6UA 2YU9J 5J40A 1NUXA 2WA0A 1KU2A 2O69A 2E35A 3QSLA 5JK4A 3MWBA 1BBYA 5H6RA 4C2MJ 3KEIA 4H5GA 2DA6A 4PETA 1ZHFA 5IAIA 1U78A 3P9KA 1R00A 2GAUA 1RRJA 4N4OB 2NOOA 3KSJA 5JLWA 3TDZC 2QKLB 5ELVA 3TPAA 4I01A 5TU0A 1MBKA 1OPCA 3I71A 4CYDA 1IV6A 2O9LA 3LSTA 2XXUA 1XCVA 4HSRA 1S6LA 1B59A 4LQ5A 2Z33A 2EK5A 3ABUA 3MQ0A 3SKPA 1UG0A 3MZBA 2DODA 4LD5A 4CSWA 5DCMA 2NVQJ 1QKAA 2O84X 1B4ZA 4XN3A 3KFMA 1VQ5I 3V5AA 2E5ZA 3OELA 4BDQA 4C1TA 2RQPA 3K4JA 1OCZH 3BR2A 1MY0A 4JVCA 1A99A 3FMSA 2CJJA 4B48A 2FRHA 2HTSA 2H94A 2V79A 3JAMK 1OQHA 3BIHA 2P7CB 4HRIA 4PFWA 3ZS6A 1HW2A 1XI6A 1NTCA 4GO1A 4FIMA 3GTGJ 1LKXA 1FT9A 2B3BA 4N0BA 4RMNA 1HQCA 3I54A 4W1UA 1PP7U 4QHQA 3EPEA 3JRHA 4E4HA 1ON2A 4PGPA 4AIHA 1WJDA 1FP1D 3NWTA 5EEGA 4F55A 3B6WA 1XX5A 2Z16A 2EPFA 3G2BA 5K5QA 3GZ5A 2DYXA 1DQUA 1P4AA 2I49A 2FX0A 1XB4A 2EV5A 4OXVA 5HDNA 2JUCA 4KFCA 1TP4A 2RN7A 4S0HB 4W97A 1FPGA 1JP4A 2PFYA 4BS9A 4I02A 3TO7A 1O3TA 4XQFA 1DU0A 4NBQA 2F8DA 1MDMB 1LB9A 4I09A 2YU3A 1T95A 1XHYA 4RB1A 3O8HA 1TW2A 3RZOJ 3IJXB 1NG7A 4HE0A 4OENA 1ZK8A 3LA7A 1AWBA 4G68A 2EFWA 1FP2A 2PJPA 2QQ8A 3ILUB 1LNWA 4Y7NJ 2Z1DA 1E17A 3GTPJ 3VYRB 5KCJB 4IRHA 3OWTA 3IKTA 2G29A 1KWHA 3O28A 2K4BA 2OWZA 2KJCA 4GCVA 4ZEIA 2WBBA 1OMPA 3S93A 3EUKL 3USDA 2W25A 5CVIA 2XPUA 4O3CA 4KICA 3AG4H 4ZYHA 3G6EI 1W36D 2WBMA 1SYHA 3K00A 3KZIC 2A61A 3JSPA 3AL0C 4N9IA 2DMPA 2P0WA 3DLNA 4EVIA 4ZYEA 3TUSA 2DI3A 3TOBA 2WV1A 1SPIA 3VYSB 5LDZA 1NUWA 1UJ8A 3E3VA 3WTWC 3CJNA 1N7WA 4HTGA 3F8NA 3K6XA 2CQKA 5LEJA 2H9BA 1JNFA 4R72A 4DI4B 2RQQA 4TOZA 3TDUC 3CD6I 2MLKA 2OPTA 4C30A 4OVSA 3KC0A 3KSXA 3O2AA 2RCBA 1VI0A 1EZOA 4RS8A 4LJZF 2PX9A 3C2HA 1YHQI 3IH3A 3HOZJ 2G7HA 1KGSA 2PMUA 2DBBA 4HX7A 3HV1A 4XN0A 2BBYA 1H0MA 3BPXA 2IXSA 5KHDA 3G73A 2QENA 3W6KB 3UP9A 4DCXA 5JTYA 1H3DA 3C9HA 3F21A 2X9DA 5B1AH 2E19A 1J09A 4IX7A 4AS4A 1INPA 1JEVA 4IQ4A 1HDPA 3ZMVA 2O6AA 4D5CA 3FHNA 4YB6A 1B1HA 4X6AJ 1Y39A 1S7EA 1E3HA 2FJ1A 3ZQCA 3P5JA 4AM3A 4PGGA 4UV8A 1B3EA 1GV5A 4ZZDA 3NEUA 4LITA 2F6GA 3A01B 3H5NA 3ISPA 3FWEA 1YW9A 2HNHA 1B52A 3PUXE 3BG6A 3FXLA 4XBFA 3D1NI 2MC3A 2XWOA 2P1SA 3C1DA 1EF4A 1D1CA 4EDPA 2L9RA 3OY9A 1UTBA 3N5LA 1Z3XA 4Q30B 1KONA 2VXZA 5AIQA 5CPRB 1J5YA 1W4MA 2CH0A 2K7LA 5IGAA 4IF4A 1YTYA 4PDHA 1IF1A 4EM0B 5IT3A 2QVUA 3LBSA 1D3KA 3Q26A 2V93A 1BW5A 1IXIA 3CI8A 3OYGA 2M7AA 4U0VA 1USYE 4KYDA 4IPAA 1XOCA 1MXWA 3A3CA 2P81A 4A93J 1UZCA 2DVCA 5DM6F 1AA7A 4A6DA 4LG0B 3F8BA 1YO5C 1QZZA 4P96A 2DLLA 3TO6A 2CV1A 2EV0A 3GTKJ 4KFQA 4NE4A 1CNQA 2Y31A 3MBPA 2OAZA 1RKTA 2IA1A 2PCRA 4K3FA 2FBIA 4N8YA 5HPQA 3I53A 4BGDA 5I57B 1Y3QA 1L3LA 4M3DA 2HVRA 1ZU0A 2WB1N 1A40A 3JCUC 1I3QJ 5E1WA 4PZJA 1MBGA 2K27A 1GTKA 2LG4A 1DU6A 5HLIA 4MNPA 3SEUA 5JVTA 3IFAA 2F36A 1FQDA 5LFAA 1LAGE 4QWQA 3HRUA 3O6BB 1HBXG 4N91A 4BYYA 5M5YJ 3QYBA 1FYKA 3HCQA 5DT6A 1QGPA 4U7DA 2GXBA 3Q3SA 5DTBA 2Z99A 3HPGA 3VVFA 4P0GA 1MQDA 2FYIA 2WAQN 1RUOA 2XXRA 4H0EA 4BACA 4E7KA 4RAFA 2ZXTA 2XASA 3QOPA 2QMWA 2QS2A 5FTIA 4PFPA 5FLXK 4JWOA 3ZMTA 3OSRA 5DYHA 1EH7A 2Q2AA 2Y7IA 3HN0A 3HUGA 1YJNI 4F18A 2LBFB 1LAHE 4LATA 5IT9K 3BCAA 2DYRH 1EA3A 5DW8A 1QHHD 3LAJA 1TTYA 2FXAA 1FRPA 2WEFA 4XLEA 1B9JA 4UACA 1MBJA 4ZTFA 3G3FA 1MMGA 2A3SA 3EETA 1TWYA 2PX1A 1ON1A 1YOVB 4A6EA 4I98B 2HKXA 1A04A 3VVEA 2XD2A 1OYWA 3EDPA 3UNGC 2BY2A 4ELRA 4A3MJ 2WYKA 4HF1A 3N05A 1BOAA 1YJ9I 1P1QA 1EYJA 4WWCA 4YKJA 2QS3A 2JPBA 3CQZJ 4BXXJ 1DP3A 3GLLA 4PJMA 3JRCA