3FXRA

Crystal structure of tsar in complex with sulfate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
total genus 86
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxrA03
1YW7A 2RKMA 1DPEA 4NF5B 4R73A 3WTTC 1B3GA 3OOPA 2RCAA 2DXRA 1B4ZA 1JXSA 4EM0B 4GL8A 4GYGA 3M8FA 1TQPA 2F5XA 1ODDA 3G73A 3FX3A 2Z9OA 2CWEA 2XGXA 1ZGJA 4NEDA 4R6YA 3BZ6A 5JTYB 1FP1D 3R0JA 1R00A 1UIUA 3TTKA 3T66A 3O28A 1BP5A 1MZBA 3R6SA 2JT1A 3SEYA 3ECHA 3PD8A 5BOXA 1B7ZA 4G8XA 1SFEA 5HDKA 1SD6A 3E5XA 3WAEA 4QFOA 2P4WA 5CLSA 3ROUA 3SEUA 3MC2A 1ZRFA 1E2XA 1ONVA 5LRSA 2RNJA 3OEKA 4ZEIA 4IXAA 3GWZA 5CVRA 3JV9A 3KEIA 1YS6A 2HWVA 1I6XA 4BDNA 2DQRA 4JBZA 5TPAB 1Y0UA 3HRUA 4KYWA 5F64A 2AS5F 3TDZC 1ZREA 1XB4A 1ZH5A 1Q35A 1B3LA 3GX4X 2ZO4A 3EHUA 4JB7A 4N9IA 4R75A 1YLFA 4I0AA 2OAZA 1P4WA 3RTWB 1FTJA 4HQMA 5ICCA 4JWYA 5ICTA 3T9XB 2B0LA 1XGMA 2QS2A 3FASA 3VODA 1W7PD 3VFJA 1JETA 2VT3A 1FQDA 3HTSB 1DPUA 1MH3A 2HQNA 1MGTA 2XX9A 4L5JA 3C3WA 3HSRA 3FGSA 1TBXA 5IT9Z 1V3FA 4OIRF 5L9OA 1MRPA 2F7BA 3HRTA 5DCFA 3B73A 4LP2B 5L3CA 5IAIA 1K78B 4F3PA 4U4XA 1P2FA 3TCGA 4LMYA 2DK8A 5I2NA 4G8HA 2NYXA 2DWAA 2YX7A 3M8EA 1LB8A 1WDNA 1NKXA 2Q89A 3VDFA 3UN6A 4LATA 1Y4TA 2UVGA 1POTA 4GGGA 3W9WA 2DYXA 3K4UA 5TPAA 4A5NA 1XCBA 2Z23A 4EQQA 3WTYC 1N3WA 2V3QA 1W4MA 2A68F 3B7DA 3FMQA 1HKQA 4I09A 2UXXA 2VOZA 1FSHA 4KIGA 1XGNA 4L9JA 1I6QA 3T9VA 2ZMEA 1UFMA 1LNWA 3CO6C 1EU8A 3MQ0A 3QPHA 2K27A 2ZBKA 4F31B 4RAYA 3FV2A 1FTKA 3I53A 1ZBMA 3OELA 2EK5A 3WTUC 2Y7RA 4DIGA 3RYPA 1U78A 1IIWA 4U21A 2V6CA 2DPDA 3E4RA 4GLIA 2FNPA 1ZG1A 4BDOA 3MVWA 4BDRA 2Q2EA 4RS8A 3G3FA 2PFBA 1US5A 1BI2A 1MQJA 3QU3A 2Q9TA 4MH5A 3N5LA 1RUOA 2F34A 4HW8A 4GIZA 3MVYA 3ZN1A 4EGYA 1DSNA 1FTOA 3CFZA 3TTRA 3VLWA 1OYIA 4IPAA 2I49A 4ECFA 4EMSA 1QNTA 3RI4A 4RYAA 1UCRA 4EUOA 5DDGA 1RI7A 3K2ZA 1A7LA 4P5OA 5F6FA 5LGUA 1STZA 3H03A 2ESNA 4HV6A 3TO9A 5FLXZ 4JK1X 4I98B 2Q8KA 1MY4A 2MH9A 4GYIA 2MD5A 3T0YA 2I0BA 4U7BA 3TTLA 3KCCA 4Y17A 3IWFA 1AWCA 5CMKA 4K2EA 2MLGA 3O2PE 3G3ZA 3C33A 3O29A 5DEQA 3K2DA 1WVJA 2MC3A 4XXUA 3SFZA 3K1MA 2H09A 3SEWA 3FHZA 1TT1A 5I57A 2PJPA 2DLLA 3OOAA 5BMZA 3A3UA 4ELOA 3E6DA 3SXYA 4G2ZA 3I4PA 2Y7WA 1LSTA 3OO7A 4F3SA 5H8NB 2AYSA 2YX4A 2PYYA 1LEAA 1D5VA 2K7LA 4XKPA 3KZZA 5F1RA 1Z7UA 1SW2A 1R1NA 4GRKA 5LLQA 2HYGD 2R7DA 1U5TC 1B1XA 2XD3A 4GXOA 1G6NA 1YTVA 4KHZE 4MTDA 2X26A 4JSOA 3PU5A 3OXNA 4EQBA 5KVRA 2DAOA 1OVBA 4DLDA 2F2EA 2F97A 3KG2A 3TKDA 2I3VA 2V93A 3ZP5A 4RNSA 3FMRA 4FATA 5H8HA 1MY3A 4HQEA 5H8NA 5HLHA 1X3UA 4CO8A 4KCCA 3H3ZA 3HHFA 1PB9A 1XMKA 3BJOA 2Z8EA 1QULA 1AMFA 1TQMA 2L02A 5BQTA 1B7HA 2F8DA 1HSTA 1HW1A 3HHHA 3G3IA 3I0TA 1KU7A 1B5JA 2WV0A 2HFBA 3TPAA 4EJTA 2ABHA 2W25A 4NF4B 3IL2A 2AIXA 4HX7A 3VE1B 4ZYEA 2OQRA 1B7UA 3HHGA 2STTA 1WRJA 4MGRA 4KD5A 3LR1A 4BAYA 3FVGA 4BLAA 1ZLKA 4M74A 4BQAA 1FT9A 4JQFA 2YPRA 4PGGA 2F78A 1ZG3A 2I0CA 4ND9A 4OESA 3KE2A 4PP0A 4AWXB 3H6VA 3F8CA 1H76A 5F1QA 2GXBA 5ITPA 4LFUA 1LB9A 3GO5A 2K4BA 3RGYA 1OQGA 3E13X 3WTXC 4RPOA 2FSWA 3M3LA 5HS9A 5I58A 3J81K 2MH2A 4XLPF 3KZGA 2FNCA 5I59B 5CMMA 1O3QA 2M8CA 2CYYA 1JEVA 3IB1A 3LSLA 2RGVA 4F39A 4UXNA 3I58A 2Q2AA 1N76A 3IC7A 2K02A 4DXBA 5LOMA 4N9HA 2V25A 2CG4A 2DWIA 1GXPA 3TYHA 5AA3A 1FZPB 1Y1ZA 2B3BA 3M9AA 5DD8A 1TXFA 1MPDA 2EA4A 2RC8A 4ZS9A 3K02A 5JR3A 1MJBA 5CVJA 1PDAA 4EF2A 2FMYA 2ADUA 1FTMA 2A61A 4WK8F 2NS0A 2P0SA 3V7SA 1ELJA 4PETA 3GW2A 5TRDA 1KU2A 4YFNF 1UQWA 5DCMB 3IRQA 5CRYA 3WTWC 2HKXA 1HSJA 5FLXK 2ZFWA 4KICA 3JTHA 3LSXA 3PUVE 3M8UA 5AA2B 3C7JA 1T0KA 3KP3A 2MBFA 3R61A 1IXSB 4ZYDA 1B52A 4AB5A 1N7WA 4ELRA 2M87A 4U7DA 3MVXA 4KYSA 4HZFA 3FXRA 4L17A 2L4MA 1A99A 2GHAA 5AE4A 4D0PA 5HPQA 3O9PA 4YG2F 4YMAA 5LHGA 1QUIA 1YS7A 1VFDA 5AA4B 2F5EA 3JAMK 3PGFA 1VFEA 3RKYA 1B4HA 4KYDA 3TKYA 2XD2A 2RN7A 4G7OF 4QRZA 4XBFA 1MY0A 3RPWA 2V3TA 4DXCA 2PN6A 3RTRA 2HTJA 2EFWA 4RPNA 4N0BA 4KNYA 3OSQA 2DBBA 3SETA 2IA1A 4UV9A 1EH6A 2P7CB 1B5IA 1ZU0A 1CE2A 1ZMGA 4MQ9F 2VN2A 3ODBA 2QS4A 4EJUA 3GZGA 3K1NA 3U92A 3PFIA 2PEXA 3KETA 3D4GA 1FLIA 4EJOA 1MDMA 1G3WA 1FQEA 2OJTA 1BJAA 2QUFA 3TDUC 1P4XA 1O3TA 4YB5A 3UP9A 2NOOA 1MXWA 3ABUA 1TWYA 2NNNA 3WU1B 4WXCA 4TLMB 1IITA 1BI1A 1A40A 1KWHA 1B40A 2G9WA 4MBPA 1BN5A 1FYMA 1B2HA 3O6IA 2Q8JA 4JXIA 2GH9A 2AXLA 3MWMA 3U9GA 1YAEA 4IO5A 4WXDA 5FO5A 2C6YA 2ZXTA 2OLBA 3H06B 2NVUB 4RB1A 4GWOA 4NF5A 4POWA 4XTCQ 1U8RA 1NL5A 3MUQA 2A5YB 2HS5A 3UK4A 4WKMA 5ERIA 3DELB 5J8CA 2XX7A 2STWA 4H0EA 5TP9B 4HV5A 5FFZA 1YQAA 4ONYA 1ZRDA 3FM5A 3J81Z 1USYH 3ZQ7A 1TFDA 4ESFA 3ECOA 2DWHA 3QYTA 4O3BA 5K5QA 2F5FA 2P5VA 3C18A 1SQYA 1RNLA 3AAFA 3EYIA 3QP6A 4KYEA 1XC1A 2I58A 2UVIA 4RB2C 1SW5A 1XVXA 2VP1A 1IXCA 1HKTA 3UIFA 2QPQA 2CZLA 4FJPA 3MP6A 4P0IA 4O3MA 4HF1A 2A3SA 1P1NA 3MJNA 2IA0A 1ZN2A 2M8EA 1B9MA 1JW4A 3GUDA 3RTFB 1USSA 5FGMA 5AA2D 2XKOA 4CHUA 4EF1A 2OQGA 4Q48A 3QU6A 2WKYA 3LBSA 3I64A 1HBXG 2VOOA 1SI0A 2HCAA 3M3KA 2OA4A 2DE3A 5CJ9A 2O68A 3A09A 2K86A 3DKWA 4G68C 4G68B 3SESA 1S7AA 1QZZA 3R0AA 5D6FA 3B02A 3C32A 4HA8A 5I56B 4Q47A 3QUJA 1TW2A 2XXUA 4UA8A 4IO7A 4YB6A 2O84X 4NQWA 1UB9A 5I59A 2M5WA 3O6HA 3LA7A 4M9ZA 4NF6B 3LWFA 1ZLQA 3DP6A 2VBXA 2KIFA 2P6TA 4EQ7A 1UTBA 2H94A 2NXOA 1M5BA 4NF6A 4F2QA 1IN7A 2XAJA 3PPOA 3PUZE 3K1PA 3RDIA 2VC0A 3RKXA 2CO5A 2ZJ2A 4RK9A 2QLZA 3IRRA 3S9MC 4F22A 5J1DA 1LEBA 1FC3A 3SERA 1IXGA 3Q5FA 2D2WA 3BROA 3FVKA 3CFLA 1F4KA 3H7MA 3LQRA 4OU0A 1GVCA 5EYFA 2PX1A 2PVUA 1U3EM 5LGTA 4HF0A 2M45A 4UNOA 3Q25A 3IKTA 5JEIA 2GIVA 4RA1A 1YO5C 1ATGA 3N26A 5BPDA 1FQCA 1K7AA 4X1BA 5BWJA 1MXVA 3FIRA 1U5TA 2V9VA 3EQLF 3CVGA 3EHTA 4TOZA 2V1DA 2L3DA 2QMXA 1XMAA 3G3GA 2JPCA 2P2AA 3IR1A 1OLCA 5D4SA 4F1YA 3V8XB 4LUBA 2DO7A 2EFOA 3ZKLA 2M30A 3IOVA 1KYZA 3F6VA 2NWJA 5HLIA 2QZ8A 3K9TA 3V8JA 3PMVA 1M5DA 3SZPA 1GGGA 2CGPA 4IRGA 1P1WA 1OIBA 5M2VA 3E9XA 1L5TA 5J8FA 2YJPA 3IOTA 3GBBA 3K6VA 4ZEBA 2YR2A 2EB7A 5H8FA 2ELHA 3KFWX 4OETA 4L5IA 4PZJA 3TOBA 4E70A 3OMBA 5DEXB 3Q9SA 3DP7A 5E8GA 3RKWA 2HEUA 1B6HA 1D9YA 4M9SA 4A5MA 3GFMA 3LAPA 4Q8RA 2D5WA 4B09A 1QZYA 3BJ6A 5CVUA 2VBYA 4HF2A 2IW5A 4WCGA 4U4SA 3V4GA 1MM7A 3MZYA 2HKOA 2XVCA 3U1OA 2GXGA 1J7KA 2A5TA 3I5UA 3L9FA 4RK2A 2VHAA 3PUWE 2B3FA 1Y3QA 1R9QA 2QRYA 4QSDA 1FBSA 2ZKZA 2HAVA 4L0YB 4KN7X 4YKPA 4IY5A 3PD9A 1FOKA 2G29A 3C34A 1JQFA 3CO7C 1FBQA 5JI6A 2MA3A 1NNKA 4LZ5A 1OPCA 4BDLA 3FWEA 1OR7A 2DFIA 1MDQA 2OWTA 3KJ7A 3FV1A 2H9BA 2XXPA 4M6XA 4NWCA 2W24A 2X7PA 1HXDA 1XCVA 4MQVA 3RLFE 4OXVA 4FHTA 4PFUA 1Y20A 2LF8A 1URGA 4ESXA 1R36A 3JW4A 1FTLA 1IN8A 1B0HA 4TQUQ 4G7ZF 2Y7PA 1XSVA 1YW9A 2P5LC 5IKBA 5ICEA 1D3YA 1QQIA 2I6EA 3H6TA 1XGSA 5I2KB 1IW7F 5CVIA 1R1UA 5HLGA 2W85A 2R6GE 1LJ9A 3TO6A 1PB8A 4LQ5A 3HO7A 4F29A 1FYLA 5JK4A 3FATA 3MAJA 4F3GA 2HZTA 3TQNA 3CRBA 5AA1A 5E1WA 4H65A 4BDMA 5LEKA 1Z91A 4FX4A 3IX1A 1T2KA 3F21A 2XKPA 3EUHA 3DF8A 4CDGA 1BIBA 1R23A 4IO3A 3WG9A 1IN5A 1XDUA 2OU2A 3BPVA 1RIOH 1QUJA 1P99A 4KFCA 3BDDA 2ONRA 3KN3A 3ZMTA 3K6XA 1S7OA 1F5TA 2GWRA 3RPQA 3GXOA 4N13A 3CSGA 1HW2A 4LONB 3CJNA 3GZ5A 1TQIA 4OMYA 3FXQA 1DUXC 1XSDA 1OKRA 4YIIA 3SHFA 2A69F 2HOEA 4LG0A 2UYEA 3TEPA 3MZ9A 2DW4A 1T6SA 1ZGAA 1R5GA 4XSZF 1IZ1A 2RINA 4DCYA 5BUUA 3GZ6A 1SYIA 3N97A 3DV8A 3F8MA 5TP9A 4ZE9A 4U23A 5ILVA 2JRTA 1DDNA 1OLAA 4NMYA 4Y13A 4RGUA 1ZYRF 3IL1B 4O3AA 1J0RA 1SD4A 2E1NA 4E0XA 5CVVA 2WWYA 5E1XA 3SEVA 3SKPA 3HCQA 2OWSA 3QAXA 4LG0B 1G3SA 3IB2A 3BPXA 2V79A 2P6SA 4L9VA 1G4DA 5EEGA 4A6DA 1SW1A 3JAMZ 4YAHX 4EXLA 2R3SA 5CYVA 1UHMA 3H92A 4L9TA 2F35A 3MW0A 2Y7KA 1IAWA 4EJVA 2DPUA 1SBPA 3WTSC 2OBGA 3MZ1A 4R9GA 4QLCU 5HVQC 5DT6A 3LSTA 2AL5A 2XXYA 1POY1 5FHOA 1T39A 1SMYF 1E17A 4JWOA 4F1VA 3O3KA 2ZMEB 1KQ8A 1LBBA 1DP7P 4QWQA 1B05A 1SAXA 3LA3A 3QOPA 3ELKA 1T38A 4WXHA 1DMBA 4ZEFA 2DT5A 3JYRA 3RY3A 4G6DA 4I9DA 1SFXA 4NF4A 3QUFA 2QWWA 1QPMA 5HS7A 5E17F 2A5TB 5DVJA 5FHMA 2NAZA 4BHBA 1XVYA 5I2KA 1R5HA 4OHNA 1FY7A 3CLOA 4UV8A 4WWCA 3U8QA 4AIKA 4M72A 2Y84A 4U1OA 5FTHA 2UVHA 1ZAOA 3T9UA 4A0ZA 1YPNA 3HUGA 5LRRA 2FNAA 4NE4A 1JW5A 4TV7A 3GFJA 4P9FA 3L2CA 3MZBA 1B59A 3QSLA 3PUYE 3W15C 2FRHA 4IVNA 2BJJX 4L9NA 3MAMA 3K0LA 3GXAA 4GFRA 1EV7A 2HYFA 4O6JA 2J5PA 5CBSA 4PCQA 1DOTA 2ZYKA 4R2BA 1MXXA 5HOOA 2F7AA 2ZYOA 4ENNA 2KJCA 4NF8B 3K69A 3GFIA 4EM2A 4G68A 3P9KA 4Q0CA 2OBPA 3OV8A 5ICFA 3J7AO 2XHDA 3QAHA 5L3BA 4Q4ZF 4KDPA 4MFIA 1EH3A 3KZYA 2F36A 2GAUA 4OFJA 3F11A 4GD5A 1D8JA 3DXJF 2YPNA 1IXHA 1Q1KA 4KI0E 3LA2A 1Q1HA 2QL3A 3PPQA 3O6BB 3H4ZA 3TDJA 4H5FA 2O6AA 1ZTYA 4EDPA 4LZ7A 4KFQA 2Z99A 4KA4A 1V4RA 1WQ2A 2X0LA 2D45A 4LLGF 3OENA 1TTYA 2OD5A 1XN7A 4DZ1A 2JTVA 2F6PA 1OMIA 3HOTA 2HZLA 1R1TA 3BJAA 1BM9A 4QF9A 4P11A 1QJMA 3IKVA 3WTVC 3HRSA 2HTSA 1UHWA 1YTYA 2VGQA 4G77A 4XKRA 3ZS6A 2FA5A 3KP5A 2I4BA 4AVPA 3ILTB 4RY1A 2I4CA 1MKMA 3RPUA 2O69A 2JZYA 3VXBA 4OWDA 3VXCA 2ACJA 1UTHB 3E5QA 2FBIA 1JVXA 3H6UA 2CQKA 1MDMB 2IRFG 4GOTA 4C1UA 2KJBA 2D1HA 5HDGA 4FIMA 4LGWA 5DUIA 1FQBA 2ESHA 4OTEA 3REOA 5K1YA 2Z8FA 4IRIA 1N7XA 4ON0A 4ZZEA 4ZYHA 1O3RA 4JDFA 4H8IA 3FJGA 3ZN0A 2LNBA 1N84A 2PBWA 4O3CA 2THIA 5HBCA 2XAFA 1B0LA 5EHSA 3V89B 2MLKA 3S9EA 1Y1MA 3RT8A 4HDVA 1G3YA 3VLVA 4M73A 3U1DA 2PLYA 5DCMA 1RYOA 1H44A 4HW0A 4R8HA 1XSXA 4IO6A 1Z6RA 5I2NB 3ZPLA 3T93B 2FE3A 1LCTA 2E1SA 1YFHA 4ZZDA 4HYEA 3DFGA 5D5XB 3COAC 1BTJA 1O57A 1PEBA 1NFTA 3WE3A 1LLSA 2BE5F 5H6RA 2REGA 4ASNA 3GVAA 4P55A 4CICA 3TMGA 1QBJA 1YG2A 1RUNA 1PDNC 4UVAA 2EV0A 1Y3PA 3ILUB 4N07A 2BEOA 2R9JA 4MF3A 5LEJA 3M3FA 1F1ZA 4IGTA 1KU9A 1PBPA 2QJEA 3WGHA 2Z5UA 2DVCA 4RXLA 2UYFA 4ZDMA 4OIPF 4EVIA 1NMUA 1XT8A 2P7VB 1I1GA 1O7FA 1PP8F 3V5AA 4IB2A 5L3GA 3E5UA 4UHTA 2RC9A 4KUMA 3V83A 4ISUA 2Z8DA 2XXWA 5DV5A 1QO0D 1S6LA 2EWNA 3QK6A 4R72A 1PC3A 3VVEA 4FE8A 4UUVA 1U6GA 3BP8A 4G6QA 3MPKA 1O63A 4OVJA 1Z6TA 1SI1A 4C0RA 2ZYNA 2RVCA 3EHSA 5CMBA 1F9NA 4RB3C 2DE4A 3SZTA 2O61A 4U0YA 1M5FA 5ISUA 3UORA 1DTZA 1JE8A 1P92A 1YW8A 1LQ1A 1S9TA 4H67A 4U0VA 1MQIA 2F7CA 1R22A 2DE2A 4G4PA 4DCXA 5KDTB 3CUQB 2OZ6A 3MP8A 5D8LB 1YIOA 4LB5A 3RYRA 4MEXF 4ZEKA 1ZARA 3TUSA 4ESBA 1EZPA 4GXSB 5JVTA 1MXUA 4S04A 1I69A 2BGCA 2FQ3A 2H6CA 5FFXA 2UVJA 4R2FA 3I5OA 5CC2A 3VB2A 2ZNSA 5ITOA 3NEUA 3CIJA 2XXHA 2XXQA 1LFHA 1H3DA 2XASA 1S50A 3RUMA 1KYWA 3FMSA 4JBAA 2BYVE 4NWDA 1HKSA 2Q88A 4UVCA 4GVOA 1US4A 3KJTA 2LSOA 2D1VA 1IUDA 3HN0A 4KT5C 2Z22A 3J80K 2Y0MA 1FYKA 3BKIB 1W5SA 2ANJA 1QKBA 3F72A 3IO6A 4L18B 4RB0A 3TOAA 4EGZA 4XRFA 1II5A 1QVSA 4M1VA 2GQQA 4YMBA 3S9LC 5H20A 3H6WA 4IJAA 3CUQC 2FA7A 5FHNA 1VE4A 1C0WA 5E18F 1IN6A 4FEDA 1FW0A 3WE2A 2KIMA 2ONKE 2R7FA 3JTGA 1LFIA 4XIGQ 4OINF 4DQ2A 2X7QA 4OZ9A 5K5OA 4ZEDA 5E8IA 4MHGA 5AONA 2QQ9A 3L6HA 4M6YA 2FYIA 3MPLA 2RF1A 1EZOA 1BKAA 2VC1A 4OFOA 3HSTA 1B4AA 2XRNA 2XUBA 1EH7A 1SW4A 3Q27A 4IGRA 4P0GA 1QUKA 3EQ1A 2ZNZA 3DPLC 2NUVA 1L0OC 5I84A 4RGSA 4LLLA 2Y7IA 1KU3A 4G8NA 5H8SA 4I62A 3I54A 3DQVC 3KOSA 2EFQA 1FP2A 2HEOA 3TFLA 3KP7A 5ICQA 2O0YA 2XAHA 1D9VA 3TTNA 2V1XA 3U72A 1JW1A 4ELPA 1D8KA 3F6OA 1MXZA 2GZWA 1REPC 4IHSA 3AXFA 1GV8A 2CSOA 4F1UA 3E3VA 1B9JA 3UA8A 4KIFA 1K6OA 2ZNTA 1YYVA 1H0MA 4G7HF 4R74A 5BPIA 4BH9A 1IN4A 1ZG5A 1O7LA 2O1LA 3B6TA 1JEUA 3LFKA 1IEJA 2RC4A 1NHAA 4IHTA 5KZTA 2JSCA 1B3EA 3FD3A 1R6ZA 4HX8A 1ANFA 3VFZA 2VD3A 1A04A 4PE5B 4U2RA 4AQ4A 1EH8A 4QFPA 3L09A 4BDQA 1XOCA 3KP6A 1FWZA 5A2QZ 3C31A 4I02A 2PQ8A 3O66A 5E1ZB 2OZZA 3IK6B 4FECA 5ILSA 2QBYA 3I6VA 1J9IA 4YICA 3GYHX 1Z7NE 5H8QA 5CMCA 5CBRA 1CF7A 2RCBA 4R6HA 1VSOA 2ZCWA 3IHUA 3ZKKA 5ED4A 1USYE 3HSEA 3B6QA 4AB6A 3MVZA 4RGXA 2O51A 1CF7B 4P9UA 3ONMA 4UVBA 1JVYA 3G3JA 2WTEA 4LVQA 1DPPA 1N3XA 2VODA 5H8QB 3PMWA 3RQTA 2O7UA 1OYWA 4DE8A 2ZXJA 4X48A 2DOJA 4G9YA 2DK5A 1N0TA 3VVFA 4YIFA 1XGOA 4QFKA 2BV6A 1F9BA 1J59A 2IEEA 2REJA 1EZ9A 3OO9A 2PT1A 4I7HA 3HYIA 1ZKBA 3Q26A 4IO2A 1H9TA 3WGIA 1AH5A 2E7WA 1LAXA 1ZJLA 4N6PA 3R4KA 1LDKB 2VE8A 1D3KA 4F3BA 3QXMA 2W57A 1S29A 3WU0A 3H3UA 1T98A 4ELQA 3VOEA 4Q5SF 1HQCA 3DEUA 3BY6A 4WEDA 3KBRA 2ALUA 1KGSA 3ULQB 3IB0A 1I27A 3CTAA 1BI0A 1LB2A 4R1HA 1MQHA 3EF7A 3HTUA 2H99A 1HW5A 3TZAA 3TODA 2KKOA 1IRGA 4CYDA 4U88A 3P7IA 4FORA 4A6EA 4AIJA 4LA9A 2PMSA 1MXYA 3KN7A 1WI9A 1LCFA 3FVNA 4H6DA 3FJ7A 2K4JA 3MQ9A 2O7IA 4XKNA 4R6KA 1G3TA 3R6UA 2D21A 4NF8A 4PDKA 3T9HB 1SD7A 3DP8A 1B1BA 4QHQA 2G93A 3F8FA 3L00A 4FX0A 2UZKA 2LKPA 4O5VA 3FZVA 2AL4A 3TELA 3FM3A 1GR2A 3G3KA 3ML6A 2P8TA 4H1XA 1BLFA 4ENJA 1N04A 3CI8A 3OO6A 3WAFA 4ZECA 5JTYA 3PUXE 1LFGA 2RDPA 3E6CC 1B46A 2XAQA 3CG3A 3QIMA 3TO7A 3L7WA 4X9TA 3KLOA 2L01A 3RIRA 1BC7C 4EJWA 1NH7A 5TU0A 2FOKA 3SQNA 1RYXA 4Q30B 3VLUA 2XXTA 4FAJA 2J5OA 2QSXA 3F23A 1FX7A 1Z9CA 5L9SA 2P5KA 4KR5A 1D4NA 3H3GA 1GTKA 3DM0A 4P96A 1TNTA 5KDTA 5I56A 4HDUA 3I59B 2QM3A 1W5TA 3HSFA 3FF5A 1NNFA 1AIVA 5E20A 2NRAC 1Y9UA 5ELVA 4QFNA 4Y15A 2YSRA 3IOWA 2XXRA 2KIUA 1PUEE 3MEXA 4K3FA 4QSEA 2LF7A 3BOQA 3P7NA 4ZZAA 2OZUA 2H98A 1BBYA 2I48A 2FU4A 2Y48A 1B6AA 5A5XB 4KIBA 1T0FA 5HDNA 2RV8A 1GHCA 3ZMZA 3QRFF 1QKAA 4BYYA 2DSFA 4XKQA 4EV0A 2UXNA 1O64A 3JZJA 1MPCA 4OOIA 2BBYA 4H5GA 2QMWA 2A07F 4KQPA 1B58A 5L8DA 3TQLA 2LDUA 4PFWA 2TDXA 5H8HB 2XROA 5CM6A 4OEVA 3K00A 4C1TA 2UWMA 2V84A 1KQ9A 3S4UA 3U93A 5KCJB 1P1UA 3S2VA 4PFYA 4TLLB 3F8NA 1MY1A 5FTIA 1URDA 2GHBA 2ZYMA 3TCFA 2GRVA 1L3LA 1PP7U 3IJOB 4M71A 4KMUX 3HOSA 5L3FA 5LHIA 1CGPA 5FD6A 2CMOA 1B1HA 3FJMA 4GXAA 4HAMA 3RJPA 3LSWA 3O6GA 3ZSFA 4R9FA 2DI3A 2HXWA 4EXKA 2H6BA 1NNTA 4G94A 3RNNA 4YZZA 1FNNA 2E0SA 1TNSA 4ESJA 4FEBA 1IQ7A 3E3KA 2VBWA 5I57B 1LDDA 1Z7ME 3FVOA 3KP4A 4OMZA 2G7HA 1URSA 2Q2CA 1Y4CA 5A2QK 2HFHA 2DU9A 1HSEA 5KK1A 3G7WA 5FD5A 1SVXB 4LQ2A 4ZE8A 3MWBA 1M5CA 1LBCA 4OQOA 4EQ9A 3W6KB 3LAJA 4IY6A 3EPEA 4LK1F 1WKMA 1R9LA 2EFPA 1AOVA 4AD9A 2F6GA 2R71A 3C9HA 1TLHB 2QQBA 2VE9A 3D0SA 3MBPA 1AL3A 5I58B 5JFRA 3NRVA 1IF1A 1MDP1 3IORA 4L0ZB 4Z0IA 3N6TA 5ICGA 3E6BA 1ULYA 4HLXA 4OMBA 1FSEA 2IA4A 2IP2A 3V7RA 2OK2A 2XXIA 1A8EA 1MD0A 3JSOA 2QVOA 2EV6A 3PPPA 1VTNC 3ABTA 3HPIA 1FPQA 4NTLA 1ON2A 1KQ0A 1MM6A 2COMA 2HGCA 1NH8A 2ISYA 2A5SA 2V3UA 1BIYA 1BC8C 3T96B 2EFNA 2GA2A 4G8MA 1I6BA 2DQVA 2L54A 2LAOA 4A2UA 4OFLA 1Z1DA 1Z05A 3DP4A 2VD2A 1VR5A 3TAJA 2QENA 3R7XA 3G3HA 1HSLA 3FUZA 3OSRA 2FBKA 1LVAA 1OVTA 3CSBA 4LJZF 5B7DA 1OMPA 3ZMDA 1R7JA 5D5VB 3GEZA 3V8KA 5DEXA 3ZMVA 1ZHFA 2EA2A 1O7TA 1NNPA 3BFUA 3LSFB 1LAGE 1XD7A 4F7ZA 4YU0A 3Q9VA 1J2XA 1MH4A 1K79A 1P6RA 1SD3A 3C35A 3SEXA 4WX9A 1LGBC 4ENMA 3ERED 4HBLA 4YKJA 3U94A 2M1BA 3MZHA 4F19A 3PV0E 2GFEA 4I01A 1P4AA 2E1CA 3GBAA 5AIPA 4YKIA 3R60A 4H0WA 5H8FB 3TTMA 1A8FA 1MQDA 1XDSA 3T8RA 5IT3A 2QS3A 3PQJA 1USTA 4CGZA 3KEQA 1AOYA 3MFKA 4HS7A 1DPRA 1SYHA 2XIGA 4F18A 4IO4A 5K2XA 2WC2A 1FCKA 2UXAA 4ZYGA 3VEPA 3KEOA 3V7CA 4LK0F 4U22A 3C1DA 4GQOA 4NHJA 1O3SA 3CUOA 1ZRCA 3LQQA 2F5CA 4DNCA 5AIQA 3C36A 1J5YA 3R26A 2ZNUA 1JHHA 1XS5A 1ON1A 3EDPA 3M1EA 2ISZA 5K5RA 1SFUA 3TQWA 4JWXA 2O3FA 1B9NA 5CI5A 1SD5A 5IT9K 2DTRA 2A6EF 1P1OA 2FF4A 2EV5A 1ZLJA 1I6AA 3PPRA 4ENKA 1MY2A 3Q29A 5L3EA 5EHMA 4MTEA 5D4RA 2PBIA 1B3FA 1UIVA 3E97A 5K2YA 1W7PB 3P9IA 3P9CA 3V8LA 4A12A 3W6JB 2HQRA 1J75A 3Q28A 1YCJA 2W84A 3K0VA 3T22A 1UTHA 1PB7A 3THIA 3OD7A 1B5HA 4X1DA 2G7UA 3NQOA 2PMUA 4DDDA 3IO4A 1OQHA 1XHYA 4XLNF 3TCHA 3BBRA 2Z33A 1IUYA 3DPTA 3IAZA 1S7YA 4OIQF 2PG4A 2DS9A 1S8NA 1QGPA 4MEYF 3U2RA 5D5UB 2I3WA 2FBHA 3EN3A 1S3JA 3F3XA 2Y75A 1JNFA 4DXUA 1WWXA 5H6QA 1FQAA 5AA4A 1W7PA 2YU3A 2GA1A 3MCZA 5AA2A 4HCYA 2QQAA 3KGCA 3N4MA 2VONA 4M4GA 3HRMA 3K6UA 4I0BA 4YKKA 2O03A 3L6GA 3SDFA 1LAHE 3MP1A 1MJAA 4IF4A 2O1MA 4MLQA 3J80Z 1WSUA 1LAFE 4HCWA 1R58A 1IXIA 3B6WA 2QS1A 4CXFA 3OEMA 4HTGA 4BXUA 1IRFA 1MS7A 2A6HF 1PBQA 2IA2A 3ZMSA 2HQ0A 2DQLA 5TJJA 5EEHA 1H9GA 2VBZA 4PGHA 2L4AA 2YLNA 4IRHA 3FXUA 4MLVA 5F7VA 1RZ4A 5DD4A 5ILUA 4FT8A 2FXAA 1GVJA 1I5ZA 1ZIUA 1GXQA 3KFMA 4HOBA 2VXZA 4F2OA 4A0YA 2XAGA 2ZMBA 2D3IA 5B70A 4NB5A 4QFLA 3T5XA 4BHCA 2PI0A 4ETSA 4OERA 4HX4A 3QPTA 4BNCA 3GLXA 1U2WA 1WODA 4AIHA 1I1SA 1R1VA 2F5DA 1B3HA 2PMHA 3BWGA 4WF2A 3O2AA 3VVDA 3D4CA 5KCJA 4MNUA 2ZNYA 3GFLA 3DLNA 1U5TB 4E0WA 4I1DA 3WODF 2Z3YA 3IJXB 3ECRA 1FQFA 4M9XA 3QP5A 2DWJA 3USDA 4JSDA 2RKHA 3N6UA 3I3VA 2O6GE 1TFAA 3F22A 4LZ8A 4PFTA 1MQGA 2IT0A 1SMTA 3LUYA 4XSXF 2P1SA 3K6WA 3KSXA 1H43A 2QYOA 2ETHA 4GCVA 1TW3A 3C4MA 4LB6B 4PQJA 4LD5A 2DVZA 5HS8A 5A5XA 4WXJA 2XX8A 2IJLA 2HR3A 3CUQA 1MJ9A 5DUKA 2ONSA 1BI3A 1DTGA 1MPBA 2HAUA 1CB6A 5D5WB 1A54A 3A3CA 5D6EA 4Z2YA 3I71A 3ISPA 3EYYA 4Z7EA 2CW0F 1Y3NA 3I59A 3GF2A 3PPNA 3WGGA 2H5YA 3N94A 1RKMA 2HZKA 4THIA 5LBQA 4A0XA 2HDCA 2Q0OA 4I8CA 3OO8A 2KLFA 4WEPA 2V1UA 3T1BA 5BS6A 3VV5A 3E6MA 3JSPA 2IPQX 1IXRC 2DXYA 4R79A 2W7YA 3CG1A 3KOTA 3M7GA 4BHPA 1K78A 1UTBB 3CR9A 4YFXF 3CDHA 1B51A 4ZZLA 4KN4X 4ESWA 2QBYB 4KCDA 2IVMA 1H45A 4POXA 4B8XA 3RT6B 4RJZA 1OYYA 2XXVA 3HV1A 3S2WA 4HLYA 5L9MA 2VT2A 5DTBA 2JPBA 4UACA 2DP8A 3O97A 2PT2A 2XV4S 3KN8A 3KLNA 5DYMA 1M5EA 5FB2A 3WTZA 1QW0A 1B32A 3TGNA 5LGNA 3BFTA 2X4HA 4OIOF 2EJRA 4RAZA 3T8TA 4GF8A 5DYHA 4OYVA 3HIFA 2OCUA 3LC8A 1JGSA 3GLBA 1FBUA 2XHKA 1BIAA 3ZMUA 4ZH4F 3K01A 3F8BA 2B65A 5L3DA 4KMFA 5D8KB 2H25A 1BOAA 1LDJA 2VOPA 5DVFA 3UGWA 2NNYA 3IOUA 4CZZA 4YFKF 2H4IA 2H27A 3RN8A 2CFXA 5LHHA 3D5LA 3IWZA 4S05A 2FEZA 4OENA 4GO1A 3KP2A 4QSCA 3EETA 4U1ZA 3W9VA 2RC7A 1SDXA 2XXXA 3S9NC 2E7XA 2O8XA 4LLNA 2FMLA 3PMXA 2RQPA 4U0WA 4Q5TA 3KSJA 4RGRA 5HM4B 2KRFA 3CFXA 1P1QA 1J1NA 1JHFA 5J6XA 6PAXA 4GL0A 5JHUA 5DVIA 1KA8A 3PQKA 4OEUA 4KPTA 4YB7A 4I2OA 1A55A 1MG1A 4H8JA 4EM1A
chains in the Genus database with same CATH superfamily
4CSWA 1YW7A 2RKMA 1DPEA 4NF5B 4R73A 3WTTC 2XWIA 2JVHA 3BR2A 1IMBA 1B3GA 3OOPA 1XS9A 3K7AJ 2RCAA 2RNGA 2DXRA 1B4ZA 3EUHC 4EM0B 1JXSA 4GL8A 4NN3A 2XWVA 4GYGA 3M8FA 1OLTA 1TQPA 2F5XA 5GAEJ 3BCAA 1A36A 2KFDA 3O8HA 1ODDA 3G73A 2XGEA 3X2QH 3FX3A 2Z9OA 2CWEA 2XGXA 1ZGJA 3L2VA 1YJNI 4NEDA 1DGRM 4R6YA 3BZ6A 5JTYB 1FP1D 3R0JA 1R00A 1UIUA 3TTKA 4RA2A 3T66A 3O28A 2TCTA 1BP5A 1MZBA 2HDWA 3R6SA 3K70D 2JT1A 3G4SI 3SEYA 2VPRA 3ECHA 3OIQA 3PD8A 5BOXA 1B7ZA 5DM7F 4G8XA 1SFEA 5HDKA 3CCJI 1SD6A 3E5XA 3WAEA 2CH0A 2HU9A 1LFUP 1JI8A 2ZSHB 4QFOA 2P4WA 5CLSA 1DBZA 3T0JA 3ROUA 3VYRB 2LP0A 4BEHB 4Y33A 4XEQA 3SEUA 3MC2A 2BOLA 3VYSB 2DA6A 4BDYA 1ZRFA 1G8XA 5K7HA 1E2XA 2R4GA 1ONVA 5LRSA 2RNJA 3OEKA 1T8IA 2BY2A 1QGXA 2X1EA 3DLAA 4ZEIA 4IXAA 3GWZA 5CVRA 3JV9A 1ORKA 3KEIA 2OCEA 1YS6A 2HWVA 2KDOA 5KAFC 4Z6YA 1TL8A 5EQAA 4A3DJ 2JA2A 2R7TA 1I6XA 2GLOA 2WEFA 5IYBJ 4O7MA 4BDNA 2DQRA 2L9RA 4JBZA 5TPAB 1Y0UA 3HRUA 4KYWA 5F64A 2AS5F 2DMPA 3RSNA 3TDZC 1ZREA 1XB4A 2KHMA 4HE0A 1ZH5A 1GT0C 1Q35A 3PIOF 1B3LA 3GX4X 2DCEA 2ZO4A 3EHUA 4JB7A 4N9IA 4R75A 3RPLB 1YLFA 1OCTC 4I0AA 2CZIA 2OAZA 1P4WA 3E0JB 2H1KA 1FTJA 1JTYA 1NUZA 3RTWB 2JRMA 4HQMA 5ICCA 4JWYA 5ICTA 3RCOA 3T9XB 2B0LA 1XGMA 2QS2A 3FASA 3VODA 2DMQA 1W7PD 4N6DA 3EKIA 1JKQC 4QPOA 3CC7I 3VFJA 1JETA 2VT3A 1FQDA 3HTSB 1DPUA 1MH3A 2HQNA 1MGTA 3TL4X 2ECBA 2B63J 2XX9A 4L5JA 3OOUA 3RPLA 3C3WA 3HSRA 3FGSA 3PFYA 1TBXA 5IT9Z 1V3FA 2BY3A 1YX5A 4OIRF 3MN2A 5L9OA 3FDYA 1MRPA 2L9VA 3SEQA 4XLHA 2F7BA 4H4KC 3HRTA 5DCFA 5F0HA 3B73A 3JR9A 4LP2B 5L3CA 5IAIA 1K78B 4F3PA 4U4XA 3U65A 1P2FA 3TCGA 4LMYA 2DK8A 3BTIA 3TP0A 4GFBA 4FTHA 1JUMA 5I2NA 4G8HA 1NG7A 2NYXA 4FISA 5TGTA 2DWAA 2YX7A 3M8EA 1LB8A 1WDNA 1NKXA 2Q89A 3G1MA 3VDFA 3UN6A 1TWHJ 2DMNA 1R49A 4LATA 1Y4TA 3SJMA 2UVGA 1POTA 2CZKA 4GGGA 3W9WA 2V9PA 2DYXA 3OYLA 3K4UA 5TPAA 3LMMA 4A5NA 1XCBA 3OSGA 4EQQA 3WTYC 1N3WA 2V3QA 2Z23A 3HFUA 1ENHA 1W4MA 2A68F 4IX7A 3B7DA 2LREA 3FMQA 1HKQA 1X2NA 5KAIC 4I09A 2UXXA 4QTRA 3FXMA 2VOZA 1FSHA 4KIGA 1XGNA 4L9JA 3JRAA 1I6QA 5EG0A 2FIEA 2ZMEA 3T9VA 1UFMA 4A3FJ 2IGOA 1LNWA 3VPRA 1INPA 3CO6C 1EU8A 3MQ0A 3QPHA 2K27A 2ZBKA 5IP9J 4N6KA 4F31B 4RAYA 4Y7NJ 3FV2A 1FTKA 5GPAA 1FTTA 3I53A 1ZBMA 3OELA 4IL6C 1UZCA 2EK5A 3WTUC 2Y7RA 2NVTJ 4MMPA 3RYPA 1U78A 4DIGA 1IIWA 4JVIA 4U21A 2V6CA 2DPDA 3E4RA 1JUSA 4GLIA 2FNPA 1ZG1A 4BDOA 3S2HJ 3MVWA 3VVEA 4BDRA 2Q2EA 4W97A 4RS8A 2BY0A 3G3FA 2PFBA 1US5A 1BI2A 5F1JA 4XOPA 1MQJA 3QU3A 2Q9TA 4XM3A 4MH5A 3N5LA 1RUOA 2F34A 4HW8A 4GIZA 3A1YA 3HB9A 3ZN1A 3MVYA 3BT9A 4EGYA 1DSNA 1FTOA 3CFZA 3TTRA 3VLWA 1WVRA 2LKSA 3H5AA 1OYIA 4IPAA 4OAYA 2I49A 4ECFA 2Z16A 4EMSA 2LY9A 1QNTA 1DU0A 3RI4A 4RYAA 1UCRA 4EUOA 5DDGA 1RI7A 3K2ZA 1JGGA 1A7LA 4P5OA 5F6FA 1ZK8A 5LGUA 1STZA 1SC7A 2ESNA 3H03A 4HV6A 1YITI 3TO9A 5FLXZ 4B44A 4JK1X 4A3GJ 4RM2A 3GTPJ 3BR0A 4I98B 2Q8KA 1MY4A 1D9QA 2IEKA 2VJIA 2MH9A 4GYIA 2MD5A 3T0YA 2I0BA 1QVTA 5F24A 1RR8C 4U7BA 3TTLA 3CDLA 3KCCA 4Y17A 3IWFA 1AWCA 4HSTA 1VF9A 5CMKA 2V1NA 2DJNA 2R7UA 4K2EA 2MLGA 1IMDA 2L5QA 5J3LA 3O2PE 3G3ZA 3C33A 1RDZA 5DEQA 3O29A 3K2DA 1WVJA 2MC3A 1ETYA 4XXUA 3SFZA 3K1MA 1CQTA 2H09A 4F91B 1NV0A 3SEWA 3FHZA 1TT1A 1UJ8A 4N81A 4DYQA 5I57A 1VZ0A 2PJPA 5J40A 2DLLA 3OOAA 5BMZA 2JWTA 3A3UA 4ELOA 3E6DA 3SXYA 4G2ZA 3I4PA 2Y7WA 1LSTA 1W0TA 3OO7A 4PAIA 4F3SA 2MSYA 5H8NB 2AYSA 4IGRA 1X4OA 2IXSA 2YX4A 2EZIA 3OYBA 1Y1WJ 2XPWA 2PYYA 2AO9A 1LEAA 2WY7Q 1D5VA 4QXDA 2K7LA 4XKPA 3KZZA 3TW7A 3J7ZI 2O7OA 1Z7UA 3CP2A 5F1RA 1SW2A 1KONA 2F3DA 1R1NA 4MFDA 3O8GA 4GRKA 1NK3P 4Y4RA 2HYGD 3K4JA 5LLQA 2R7DA 1Y56A 1U5TC 2FQ4A 1B1XA 2XD3A 4GXOA 1G6NA 3PO2J 1OCPA 1YTVA 3LBSA 4MTDA 1IV8A 4KHZE 2X26A 4NDLA 4JSOA 2CW8A 2B9SA 3PU5A 3OXNA 4EQBA 2DFFA 2DAOA 5KVRA 1TWAJ 2D5VA 1OVBA 2F3BA 4DLDA 1U9NA 2A5WA 2F2EA 2F97A 3KG2A 4UB6C 2I3VA 4CUGA 3ZP5A 2V93A 3FMRA 4RNSA 3TKDA 4FATA 5H8HA 1MY3A 2IGMA 3CZ6A 4HQEA 2L5VA 5H8NA 3GYYA 1BJZA 3VYUB 5HLHA 1X3UA 4CO8A 4C2UA 4KCCA 3H3ZA 3HHFA 1PB9A 1XMKA 3BJOA 2Y9ZA 2F4OB 3L2WA 2Z8EA 2H8WA 3JRHA 3AL0B 5DS9A 3L2QA 3GZNB 1QULA 1AMFA 1TQMA 2L02A 5BQTA 1UG2A 2HDDA 2JJ7A 1B7HA 1W5CC 3ZCOA 2F8DA 1HSTA 4AIDA 1HW1A 3CESA 3HHHA 3RQIA 3UR3C 1FJLA 3G3IA 2EBIA 2PMZA 3I0TA 3QOEA 1KU7A 1B5JA 2WV0A 2LKXA 4JYKA 5C4XJ 2HFBA 3TPAA 1ETWA 4EJTA 2W25A 3D5SC 2ABHA 4NF4B 3IL2A 5JVGF 4M3FA 2AIXA 4QIWN 4EATA 4HX7A 5IZ1A 3VE1B 1A5JA 4ZYEA 2OQRA 1B7UA 3S8PA 3HHGA 1WRJA 2STTA 4MGRA 4D5CA 3PJRA 2DYRH 4A93J 2L7FP 4KD5A 3LR1A 3BLYA 4XR6A 3DTEA 4BAYA 2IBDA 3RZOJ 4MIMA 1ZLKA 4M74A 3FVGA 1D0ZA 4BQAA 4BLAA 3BG3A 1FT9A 4JQFA 2YPRA 4PGGA 2F78A 1ZG3A 2I0CA 4ND9A 4OESA 3KE2A 4PP0A 2OC6A 2RREA 4AWXB 4NF0A 3H6VA 3F8CA 2XC7A 4YRVA 3D1NI 1H76A 5F1QA 2GXBA 5ITPA 3OS1A 3CHGA 4LFUA 2L2OA 1LB9A 3GO5A 4ABZA 2K4BA 3RGYA 3WU2C 4XRMA 2JA7J 1OQGA 3E13X 3WTXC 5LDZA 1E0EA 2QVRA 4RPOA 2FSWA 5EG0B 3M3LA 2NS8A 5HS9A 5I58A 3J81K 1SEUA 3EPZA 1MBEA 3CCQI 3MKLA 2MH2A 3K70C 2M4KA 4XLPF 5ET7A 2CQNA 2NS7A 2AHQA 3QQAA 3KZGA 2FNCA 5EYHA 5I59B 5CMMA 1SANA 1O3QA 2M8CA 2CYYA 2F4IA 5EGOB 1JEVA 3IB1A 3LSLA 2RGVA 4F39A 4UXNA 3I58A 2Q2AA 3ERMA 1N76A 3IC7A 2K02A 4DXBA 4DYCA 3RZDJ 4ZJZA 1ERDA 1MBJA 5LOMA 1OR7C 4N9HA 2V25A 3OYAA 1Z0XA 2CG4A 2DWIA 1GXPA 2VKVA 3BR1A 4NC8A 3TYHA 2AQEA 5AA3A 1FZPB 3ZQHA 4DBQA 2K3PA 4N4UA 1RKWA 5ET5A 1U8BA 1Y1ZA 2B3BA 3M9AA 3GTJJ 5DD8A 1TXFA 2R5ZB 3M8JA 4BS9A 1MPDA 2EA4A 2RC8A 4ZS9A 3K02A 5JR3A 1LBZA 4FE4A 1MJBA 3MKWB 5CVJA 3CD6I 3BZKA 1PDAA 4EF2A 2FMYA 4O94A 2ADUA 1VQOI 4E7ZA 1O4XA 5LFAA 1FTMA 2XSJC 1FPEA 2E19A 2A61A 4WK8F 2NS0A 3PNYA 3V7SA 3GTGJ 1HC8A 1ELJA 2P0SA 4NQ8A 1X1AA 2ZFUA 3GW2A 5TRDA 4CH7A 4PETA 4XIDA 1KU2A 4YFNF 3J7YJ 1UQWA 5GAGJ 1H88C 5DCMB 1IDYA 1W1WE 3IRQA 3WTWC 5CRYA 2HKXA 1HSJA 1R4MB 2FOWA 2HOAA 5FLXK 3H35A 2ZFWA 4KICA 3JTHA 3LSXA 4XFEA 3H9JA 3PUVE 3M8UA 5AA2B 3C7JA 1T0KA 1TWFJ 1HLVA 3KP3A 2MBFA 3R61A 1Y6IA 1IXSB 1WCMJ 4ZYDA 4MNPA 1B52A 1HF0A 4AB5A 1N7WA 4ELRA 2M87A 4U7DA 3MVXA 4KYSA 2LVSA 4HZFA 3FXRA 5K7ZA 4L17A 3FISA 1H89C 2L4MA 1A99A 1MIJA 2GHAA 2OJED 5AE4A 4II2A 4D0PA 3DU5A 5HPQA 3O9PA 4YG2F 4YMAA 5LHGA 1MBKA 1QUIA 1YS7A 1VFDA 5AA4B 1FBHA 2F5EA 5F0FA 2P3NA 2ELJA 5I5PA 3JAMK 2VUMJ 5FKLA 2JA5J 1Q9DA 3PGFA 1VFEA 3RKYA 2ICWG 3ESWB 1B4HA 4KYDA 5K7FA 3TKYA 2XD2A 2RN7A 4G7OF 4QRZA 4XBFA 3ZQIA 1MY0A 3RPWA 4JOMA 2V3TA 4DXCA 1NTCA 4XLFA 2PN6A 3RTRA 2HTJA 2EFWA 3QPSA 4RPNA 1WZ2A 4N0BA 4KNYA 3QYEA 1W0UA 3OSQA 2DBBA 3SETA 3TEDA 1B8IA 2KP6A 2IA1A 4UV9A 4PFIA 2HOTA 1EH6A 4KJZA 2P7CB 3BQZA 1G0IA 1B5IA 1ZU0A 4NAPA 2BW3A 1CE2A 5CPRB 1ZMGA 2VN2A 4MQ9F 1I6HJ 4HRIA 3ODBA 4IQJA 2QS4A 4EJUA 3GZGA 2VXDA 3K1NA 3U92A 1VQ9I 3PFIA 2PEXA 3KETA 2R7ZJ 3D4GA 1FLIA 4EJOA 4DIQA 1MDMA 1G3WA 1FQEA 1GUUA 2OJTA 1BJAA 3JRDA 2QUFA 1Z7LA 3TDUC 1P4XA 2K9NA 1O3TA 3P5JA 4YB5A 3UP9A 3H36A 5EZHA 1OFCX 3ABUA 4RM3A 3L2UA 1MXWA 1TWYA 2NNNA 3WU1B 3L1PA 4I99C 4WXCA 4TLMB 1IITA 1BI1A 1A40A 2ZXWH 1KWHA 3F0CA 1B40A 2G9WA 4MBPA 3HPGA 1BN5A 1FYMA 1B2HA 3O6IA 2Q8JA 4JXIA 2GH9A 2AXLA 1GV5A 2RAEA 3MWMA 5F27A 3U9GA 3F9KA 1YAEA 3PL8A 4IO5A 4WXDA 5FO5A 1SFOJ 2C6YA 3H9GA 2ZXTA 2OLBA 2K9LA 3H06B 2WAFA 2NVUB 1IV6A 5ET8A 4RB1A 4GWOA 4NF5A 4POWA 4XTCQ 1U8RA 4XK4A 3K4LA 1NL5A 3MUQA 2A5YB 2HS5A 3UK4A 4WKMA 4NHBA 2ME0A 5ERIA 3DELB 5J8CA 2XX7A 2EIMH 4H0EA 2STWA 5CQGA 3ZXSA 4XMYA 3FKJA 5TP9B 2HPIA 4HV5A 5FFZA 1YQAA 4ONYA 2WYKA 1M1EB 1ZRDA 3FM5A 1IC8A 3J81Z 3OWTA 1USYH 3ZQ7A 1GVDA 3DBHB 4ESFA 1TFDA 3ECOA 2DWHA 3QYTA 1OCOH 4O3BA 2BHZA 3CJTB 2F5FA 2P5VA 3C18A 5K5QA 2P81A 1SQYA 4N15A 1RNLA 3AAFA 3EYIA 3QP6A 4FBPA 4KYEA 3CJRB 1XC1A 1MW7A 1YI2I 2I58A 2UVIA 4RB2C 1SW5A 4OVQA 1XVXA 2VP1A 3LV0A 1IXCA 1HKTA 3UIFA 2QPQA 3FK6A 3TMOA 1K9ZA 3M07A 2CZLA 4FJPA 3MP6A 3NAUA 4O3MA 4P0IA 4HF1A 2A3SA 5EEAA 1P1NA 2IA0A 2W00A 3MJNA 3WG7H 4BKXA 1ZN2A 2M8EA 3S1NJ 3AKZA 1B9MA 2K5CA 1VQLI 3GUDA 1T56A 4D7NA 2BVMA 1JW4A 3RTFB 1USSA 5FGMA 5AA2D 2L7KA 2VIXA 2XKOA 4FETA 4CHUA 4H46A 4EF1A 2OQGA 4Q48A 3QU6A 2WKYA 3M4OJ 3I64A 2V26A 2OX3A 1BOBA 1HBXG 2VOOA 1SI0A 2HCAA 3M3KA 2OA4A 2DE3A 5CJ9A 5ESYA 4UUSA 2O68A 3A09A 2K86A 3DKWA 4G68C 4G68B 2PJRA 4DW6A 5IZ3B 1S7AA 4II3A 2JQ7A 4CCKA 2CQQA 1SPIA 3SESA 1D0XA 1LUJB 1IUFA 1QZZA 3R0AA 5D6FA 4LIUA 3B02A 1Y0NA 1VQ5I 2UV1A 3OYEA 3LL7A 4HA8A 3C32A 4J19A 5I56B 2M34A 4Q47A 5I7IA 3QUJA 1TW2A 4YEJA 3ZQCA 2XXUA 4UA8A 4IO7A 4YB6A 5TISC 2O84X 4NQWA 1UB9A 2GOMA 1AA7A 5I59A 5JTYA 2XGDA 2M5WA 1HDDC 3O6HA 2X6YA 3LA7A 4M9ZA 4NF6B 3LWFA 1EJ9A 1ZLQA 3DP6A 2VBXA 2KIFA 1VQKI 1QPIA 1UELB 1UMQA 2P6TA 1XI6A 4EQ7A 1IMFA 3C2HA 3CF2A 1UTBA 3E78A 2H94A 2NXOA 1FBCA 4B47A 2HXIA 1M5BA 3SYTA 4FASD 4NF6A 1DP3A 4F2QA 1IN7A 1G0HA 2XAJA 2W82A 3PPOA 3PUZE 3A4CA 3LSMA 3OR1C 3K1PA 3RDIA 1E3PA 2VC0A 3IP4B 1FBEA 2XDVA 3RKXA 2CO5A 2X85A 3QYFA 2ZJ2A 3CCRI 2Y9YA 1ACIA 2QLZA 4AYBN 2E35A 3IRRA 4RK9A 4DI4B 3S9MC 4F22A 5J1DA 4MJOA 1LEBA 1FC3A 3SERA 1IXGA 3Q5FA 5C3EJ 2D2WA 1T0FC 2LRDA 1BR1A 3BROA 3FVKA 2KRCA 2R7OA 3CFLA 1F4KA 1OCRH 2MYSA 4PDHA 1CNQA 3H7MA 3LQRA 4OU0A 1GVCA 2E2HJ 5DTDA 5EYFA 2PX1A 2PVUA 1U3EM 2FVZA 4AVZA 4PGNA 5LGTA 4X6AJ 2WAEA 4HF0A 2HOSA 1POGA 2E5ZA 2M45A 2OF7A 4M3EA 4UNOA 2Y0SA 3IKTA 3Q25A 5JEIA 2GIVA 4RA1A 1FBFA 1YO5C 1ATGA 3N26A 4FQGA 5BPDA 1VDWA 3GTLJ 1FQCA 1K7AA 4X1BA 3VSLA 1NV3A 5BWJA 1MXVA 3FIRA 2MGQA 1U5TA 2V9VA 3EQLF 3CVGA 3EHTA 2WAQN 4TOZA 1QZEA 2V1DA 1TZLA 2L3DA 4M3DA 4MIJA 2QMXA 1XMAA 1ETVA 2JPCA 3BG5A 2P2AA 3B8BA 3G3GA 3IR1A 1NUXA 1OLCA 5D4SA 4CYCA 3BIHA 3V8XB 4F1YA 4JP0A 1W36D 4LUBA 2DO7A 2EFOA 4GWUA 3ZKLA 2M30A 1JKOC 3NWTA 4IHVA 3IOVA 1KYZA 3F6VA 2E2JJ 2NWJA 5HLIA 5GP9A 4B43A 2QZ8A 4PGPA 3K9TA 1D0YA 3V8JA 3PMVA 1M5DA 3SZPA 1GGGA 1MNDA 4IRGA 2CGPA 2K3FA 1P1WA 1OIBA 5M2VA 3E9XA 3RQ4A 1L5TA 1OQYA 1FPLA 4PAKA 5GADJ 5J8FA 2YJPA 3IOTA 3GBBA 2COBA 4BQNA 3K6VA 2YR2A 2EB7A 4ZEBA 5H8FA 4MEVA 5M5XJ 2ELHA 3BTCA 3KFWX 4KITB 4L5IA 4PZJA 4OETA 3TOBA 4E70A 3OMBA 5DEXB 4DYRA 3Q9SA 3DP7A 5E8GA 1LFPA 3RKWA 3I55I 2HEUA 1A6IA 1B6HA 1D9YA 4M9SA 4A5MA 1ITYA 3MVPA 4JX4A 3GFMA 3LAPA 4Q8RA 2D5WA 4B09A 1QZYA 3BJ6A 3CMMA 5JLWA 5CVUA 2VBYA 3KYLA 4HF2A 2IW5A 2V7FA 3OYNA 4WCGA 4U4SA 3JREA 5FRNA 3V4GA 1MM7A 2KR0A 2EZLA 3MZYA 2HKOA 2XVCA 3U1OA 3S32A 2GXGA 1J7KA 2F5VA 2A5TA 3I5UA 3PTYA 2E5NA 3L9FA 4N4NB 4LITA 3FKIJ 2VHAA 4PAFA 4RK2A 3PUWE 2B3FA 2LC2A 4DGWB 1R9QA 4U87A 1Y3QA 2QRYA 5FRMA 1FBSA 2ZKZA 4QSDA 2HAVA 4L0YB 2VT5A 4KN7X 4YKPA 4IY5A 3LOCA 3PD9A 1FOKA 1WJEA 2Z1DA 2G29A 3C34A 5EJCA 1JQFA 3CJQB 1FBQA 5JI6A 2MA3A 3CO7C 3BTLA 1NNKA 4LZ5A 1OPCA 1FOXA 4MNIA 4BDLA 3FWEA 1OR7A 2DFIA 1Y39A 2DMTA 2JUCA 1MDQA 2OWTA 4GRIA 3KJ7A 4DOZA 3FV1A 2H9BA 2MD0A 2XXPA 1QHGA 4M6XA 4NWCA 2W24A 2X7PA 1HXDA 1XCVA 2K9QA 4MQVA 1UAAA 2XWKA 3RLFE 4XRSA 3GCMA 2OTLI 4FHTA 1WJFA 4OXVA 4PFUA 1Y20A 2LF8A 2WY8Q 1URGA 1R36A 3JW4A 1FTLA 4PBHA 4ESXA 1IN8A 4BJ5C 1B0HA 4G7ZF 4TQUQ 1MBFA 4OVRA 2Y7PA 1XSVA 1YW9A 2P5LC 4BE1A 5IKBA 5ICEA 1D3YA 1JP4A 1QQIA 4C2TA 2I6EA 3H6TA 1XGSA 5I2KB 1IW7F 5CVIA 1R1UA 4XKCA 5HLGA 2W85A 2R6GE 4IEJA 1LJ9A 1UG0A 3TO6A 1PB8A 4LQ5A 3HO7A 4F29A 1FYLA 5JK4A 3FATA 3MAJA 3PM1A 4F3GA 2HZTA 4D9JA 3G1LA 3TQNA 5B5EC 1W36C 4IHWA 3CRBA 5E1WA 1VQNI 4H65A 5AA1A 4BDMA 5LEKA 1Z91A 4FX4A 3IX1A 3FXJA 3VSKA 1T2KA 1XPXA 1G2HA 3F21A 3EUHA 2MFZA 2XF7A 2XKPA 3DF8A 2Y30A 4CDGA 3BG7A 1BIBA 1R23A 3CCEI 4IO3A 3SZGA 3GLLA 2EINH 2Y5KA 1N75A 3WG9A 1IN5A 2LH9A 1XDUA 2OU2A 4ITVA 3BPVA 1RIOH 1QUJA 1P99A 4KFCA 3BDDA 3S3NA 2ONRA 3KN3A 3W3CA 4M3BA 4YELA 3ZMTA 4XNFA 3CP8A 3K6XA 1S7OA 3DKYA 2QF7A 1F5TA 2GWRA 3RPQA 2V4JC 1IG7A 3GXOA 3ZQLA 1MSFC 4N13A 3CSGA 2IS6A 2P0WA 1HW2A 4PF6A 5FKOA 4LONB 3CJNA 3GZ5A 1LEVA 1TQIA 3FXQA 1DUXC 2PX9A 5KCMA 1XSDA 4OMYA 1OKRA 5EZGA 4YIIA 2HOEA 2A69F 4LG0A 3SHFA 2UYEA 3TEPA 3MZ9A 2DW4A 5J47A 1T6SA 1ZGAA 1R5GA 4XSZF 1IZ1A 1G59A 1DU6A 2RINA 4DCYA 2VQCA 5BUUA 2DOFA 3FBNB 3GZ6A 5LTCA 1SYIA 5EYGA 3N97A 3DV8A 3F8MA 5TP9A 3GTOJ 4ZE9A 4U23A 5ILVA 2JRTA 2NOJB 1DDNA 1OLAA 4NMYA 4CCOA 1BR2A 4Y13A 4RGUA 1ZYRF 1E3HA 3IL1B 4O3AA 1J0RA 1SD4A 3DCFA 1DK4A 2E1NA 4RLQA 5E3NA 3MMYB 4PUSA 4E0XA 5CVVA 2M9HA 4XLCA 2WWYA 2DDAA 5E1XA 3SEVA 1GV2A 3SKPA 3HCQA 2OWSA 4E7KA 3E79A 3QAXA 1UHSA 2WBMA 3W6VA 4LG0B 3CDIA 2R92J 1G3SA 3IB2A 3BPXA 3WHCA 2V79A 2P6SA 4L9VA 5EEGA 4A6DA 1G4DA 1SW1A 3JAMZ 4YAHX 5EQ9A 4EXLA 2H1LA 2R3SA 4P1WA 4Y52J 5CYVA 1UHMA 3H92A 5EQ8A 4L9TA 2F35A 1F36A 4D7MA 3MW0A 2L9NA 2Y7KA 5IYDJ 1IAWA 5IM2A 4M3GA 4EJVA 5FLMJ 4XLAA 2L9SA 5FKMA 2DPUA 1SBPA 2KISA 3WTSC 4XORA 2OBGA 3MZ1A 4R9GA 4HNUA 4QLCU 5HVQC 2R7SA 2ZC2A 1MMAA 5DT6A 3LSTA 1LE8A 2AL5A 4A3KJ 2XXYA 2LD5A 3CC2I 3PSIA 1POY1 5FHOA 3FXKA 1T39A 1SMYF 1E17A 3K6GA 3B50A 2MG4A 5J16A 4JWOA 4F1VA 3O3KA 2ZMEB 1KQ8A 1LBBA 1DP7P 4QWQA 1B05A 4GWYA 1SAXA 2O9LA 1VFCA 1ZELA 2XF5A 3LA3A 2E1MC 4HE2A 3QOPA 3ELKA 2KPMA 1PYVA 1T38A 4E6KG 4F93B 4WXHA 5IP6A 1DMBA 4O7IA 4ZEFA 4X0GA 2DT5A 3JYRA 1IMCA 3KC0A 1JKPC 3RY3A 4G6DA 4I9DA 1SFXA 4DZJA 1FBGA 4NF4A 3QUFA 2QWWA 5IOYA 3C2GA 1K4TA 1QPMA 5HS7A 5E17F 1FIAA 5J4VA 2A5TB 4PSXA 5DVJA 5FHMA 2NAZA 4BHBA 3IH4A 5E3OA 1XVYA 3SDBA 5I2KA 1R5HA 4UB8C 5LD2C 4OHNA 1FY7A 2IS2A 3CLOA 4UV8A 3HZJA 4WWCA 3QYBA 3U8QA 4AIKA 4M72A 2Y84A 1GLNA 3CLQA 3CCLI 4U1OA 5FTHA 2UVHA 2VASA 2XRLA 1ZAOA 3T9UA 4A0ZA 1YPNA 1N78A 3HUGA 5LRRA 2FNAA 4NE4A 1JW5A 1QVUA 3HM5A 1E3OC 3S17J 4TV7A 1IO2A 1TWGJ 2E36A 3GFJA 4P9FA 3L2CA 3MZBA 1B59A 3OYJA 3PUYE 3QSLA 2FRHA 4IVNA 3W15C 2BJJX 4L9NA 3MAMA 3K0LA 2FX0A 2HYJA 2I10A 3GXAA 1ZQ3P 4GFRA 2LTPA 1EV7A 5E3MA 2HYFA 4O6JA 2J5PA 1VQ6I 3TW6A 5J1RA 5CBSA 4PCQA 1DOTA 1MBHA 4BY1J 2BXYA 2HXRA 4P56A 5HNFA 2ZYKA 4R2BA 1MXXA 5HOOA 2F7AA 2ZYOA 4HNVA 3KYCB 4ENNA 4DJAA 2PCRA 2KJCA 4NF8B 4OVPA 3K69A 2R7XA 3GFIA 5EQ7A 4EM2A 4G68A 3P9KA 3I3LA 3A0HC 4Q0CA 2E60A 4JX6A 2OBPA 3RKQA 3OV8A 5E79C 5ICFA 3HL2A 3J7AO 3WAFA 3S15J 2XHDA 3QAHA 4BL0B 5L3BA 4BY7J 4Q4ZF 4KDPA 4MFIA 2BZTA 1EH3A 3KZYA 3Q0WA 2F36A 2GAUA 4OFJA 2L7MP 4OANA 3F11A 4NC6A 4GD5A 2Q74A 1D8JA 3DXJF 2YPNA 1IXHA 2ZXHA 3K10A 1Q1KA 4KI0E 3LA2A 1Q1HA 2CS3A 2QL3A 2QSFX 4IOAF 3PPQA 2KZVA 3O6BB 3H4ZA 3TDJA 1PVEA 1A31A 4H5FA 2O6AA 1ZTYA 1V5FA 2OCCH 4EDPA 4LZ7A 4KFQA 1JT6A 2KL4A 2Z99A 4XKBA 3SEZA 3JRCA 5FKKA 4KA4A 1V4RA 1WQ2A 1LBVA 2NVYJ 2X0LA 2D45A 4LLGF 4HEA2 2O5RA 3OENA 1TTYA 2OD5A 1XN7A 4DZ1A 2JTVA 2F6PA 1OMIA 3HOTA 2HZLA 1R1TA 3BJAA 1BM9A 2LBFB 4QF9A 4P11A 1QJMA 2DXIA 3IKVA 3WTVC 1K9YA 5IGAA 3HRSA 2HTSA 3CCSI 2W1OA 1UHWA 1YTYA 2VGQA 4I3YA 4G77A 4XKRA 3ZS6A 4C3IJ 5EF6A 3QPLA 2WYPA 2FA5A 2X51A 3KP5A 3Q0VA 2I4BA 1P7IA 2DA2A 4GDFA 4PFPA 4AVPA 1B72A 3ILTB 4RY1A 4F55A 1QA6A 2I4CA 1MKMA 3RPUA 2O69A 3IAS2 2JZYA 3VXBA 1OISA 4OWDA 3VXCA 4P8BA 1EYIA 2ACJA 2LY2A 1UTHB 4LIVA 3SDGA 3E5QA 2FBIA 1A6QA 3TBIA 1JVXA 3H6UA 2CQKA 2M7AA 3BR6A 1MDMB 2IRFG 4GOTA 4C1UA 2KJBA 2RQQA 3GTMJ 3CMAI 1FPJA 4GWSA 4A3CJ 2D1HA 2ID6A 5HDGA 3IFAA 4FIMA 4LGWA 2KQRA 5DUIA 1FQBA 2ESHA 3ZRGA 2XA5A 5J4YA 1U9OA 3REOA 5K1YA 4OTEA 2QEXI 4IRIA 2XF6A 1PUFA 4ON0A 5C4JJ 1N7XA 4ZYHA 2Z8FA 1VQPI 1O3RA 4ZZEA 4RMNA 4XL9A 4JDFA 1P7JA 1RETA 4H8IA 3FJGA 3ZN0A 2LNBA 1RDYA 1N84A 2PBWA 4O3CA 2THIA 3KPHA 4JX5A 4B4CA 5HBCA 2XAFA 1B0LA 4LG3A 4A3LJ 5EHSA 3V89B 4IZZA 1SVOA 2MLKA 4N4OB 3S9EA 1Y1MA 1TT5B 3RT8A 4HDVA 3HOVJ 1G3YA 3OS0A 3VLVA 4M73A 3U1DA 3ZQQA 4C2MJ 5DCMA 2PLYA 1RYOA 3CMYA 1H44A 2FHYA 2JA6J 4HW0A 2NOOA 4R8HA 1XSXA 4IO6A 1Z6RA 2M0CA 5I2NB 3ZPLA 3T93B 2FE3A 2KIQA 1LCTA 2E1SA 4UY8I 1K4SA 4GWWA 2VKEA 1YFHA 4ZZDA 3A2KA 4HYEA 3DFGA 5D5XB 3COAC 1BTJA 2EQRA 1O57A 1PEBA 1NFTA 3WE3A 1LLSA 2BE5F 5H6RA 2REGA 5CKTA 4ASNA 3AG2H 3GVAA 2VJ5A 3OL3A 4P55A 4CICA 3TMGA 2MABA 1QBJA 1YG2A 2LG4A 1RUNA 1PDNC 4UVAA 2O8KA 2EV0A 2DT6A 3I4NJ 1Y3PA 3ILUB 4N07A 2BEOA 2XB5A 2R9JA 4MF3A 4BU2A 5LEJA 3M3FA 3IV5A 1OCZH 1OCCH 1YOVB 1OJLA 1F1ZA 2JN6A 1BW6A 4XRSG 2XSDC 3MKZA 4IGTA 1KU9A 1PBPA 2QJEA 3IH3A 3WGHA 3CCVI 2Z5UA 1X3ZB 2DVCA 4RXLA 1AU7A 2UYFA 2CMPA 4ZDMA 4PFBA 4OIPF 4EVIA 1NMUA 1XT8A 2P7VB 1I1GA 1O7FA 1PP8F 3V5AA 4H45A 4UUSB 4IB2A 2QGUA 5L3GA 3E5UA 4UHTA 4BDZA 2RC9A 4N17A 4KUMA 2LYCA 4ISUA 1YJWI 3V83A 2Z8DA 1XX5A 1TWCJ 2X6WA 4BXXJ 2XXWA 5DV5A 1QO0D 1S6LA 2DA4A 2EWNA 3QK6A 1PC3A 3QMFA 3OL4A 4FE8A 4R72A 4UUVA 1U6GA 3BP8A 4G6QA 2ZJPF 3MPKA 2M8GX 3G2BA 1LPQA 1RESA 1O63A 1R6RA 4OVJA 1Z6TA 2ID3A 1SI1A 1FEXA 3DBLB 3NARA 4C0RA 2ZYNA 5B1BH 2RVCA 2XB0X 3EHSA 1I39A 4A3IJ 1F43A 1F9NA 4RB3C 2DE4A 5CMBA 2HZDA 3SZTA 2O61A 1EYKA 2R5ZA 1XG1A 4A3EJ 4U0YA 1M5FA 4EEFG 4YIRX 3ROJA 5IZZA 5ISUA 3UORA 1DTZA 2Y69H 1JE8A 1P92A 1YW8A 1LQ1A 3CF5F 1S9TA 2DA3A 4H67A 4U0VA 1MQIA 4PDDA 2F7CA 3IFCA 1R22A 5M3FJ 3WHBA 2DE2A 2ZJQF 4G4PA 1Z77A 2QVUA 4DCXA 5KDTB 1X58A 2EILH 2CUEA 4PJLA 3FK7A 3CUQB 2OZ6A 4A3JJ 3MP8A 5D8LB 1JTXA 1YIOA 3DWLE 4LB5A 3RYRA 4MEXF 4ZEKA 4F3QA 2HVRA 1S9HA 1NV6A 1ZARA 3TUSA 1WI3A 1KZHA 4ESBA 2JSPA 1YRNB 1EZPA 4GXSB 9ANTA 4PC9A 5JVTA 1MXUA 4S04A 1I69A 2BGCA 2WAQA 2FQ3A 3OY9A 3D1RA 2H6CA 5FFXA 2YUSA 2UVJA 2DOEA 2M0MA 4R2FA 3I5OA 5CC2A 3VB2A 2ZNSA 5ITOA 3NEUA 4ZTFA 3CIJA 2XXHA 2XXQA 1LFHA 3LSKA 2XASA 3H1CA 1H3DA 1S50A 3AG3H 1KYWA 3FMSA 4JBAA 3RUMA 3FHNA 2BYVE 3VVFA 3MYUA 4NWDA 1WFXA 1HKSA 1BK4A 2Q88A 4UVCA 4GVOA 4RDUA 1US4A 3LSJA 5E3LA 3KJTA 2LSOA 1R9TJ 4IR8A 2D1VA 4PJMA 1YJ9I 4PCDA 2FJ1A 2ZSIB 4PFRA 4PE3A 4GX6A 1FPIA 1IUDA 4CZCA 1Z3XA 4KT5C 2Z22A 3J80K 5F04A 2Y0MA 3OS2A 1FYKA 3HN0A 3BKIB 1IMEA 1W5SA 1JJ8C 2ANJA 1QKBA 3F72A 4NQWB 2Q8MA 3IO6A 4L18B 4RB0A 3TOAA 3LSRA 4XRFA 4EGZA 1II5A 2BVLA 3DKXA 4QSHA 1QVSA 4M1VA 2CFOA 3GTQJ 2GQQA 4YMBA 3S1RJ 2DFEA 1R4NB 3S9LC 5H20A 3H6WA 4IJAA 3CUQC 4J01A 2FA7A 4X04A 5FHNA 1VE4A 2NOGA 1C0WA 2X1DA 4BJTA 4G61A 5E18F 3OMYA 1IN6A 3ABLH 4FEDA 3PNTA 1FW0A 3WE2A 2KIMA 1K61A 2PJRB 2ONKE 2R7FA 4BJ6C 2JK3A 3JTGA 3ASNH 1LFIA 1FIPA 4XIGQ 4OINF 4ZC3A 1U0JA 4QPQA 4DQ2A 4P3LA 4D1QA 4E7JA 2X7QA 5J1YA 4OZ9A 4KT6A 5K5OA 4XICA 3I9V2 4ZEDA 2QKMB 1LFBA 5E8IA 4MHGA 5AONA 2QQ9A 3N05A 3V42A 3L6HA 1NK2P 5A5LA 4M6YA 2FYIA 3MPLA 3MZ8A 4I6ZA 3ZOBA 2RF1A 2ELKA 3Q3SA 1BKAA 2VC1A 4PFOA 2WBDA 4OFOA 1EZOA 3HSTA 2XUBA 2XRNA 1B4AA 1EH7A 4CCMA 1SW4A 1ETKA 2ZB9A 4IKFA 1QUKA 3Q27A 2DA1A 3EQ1A 4P0GA 3DPUA 2ZNZA 1NH3A 3DPLC 2NUVA 1L0OC 4P1EA 5I84A 4RGSA 4LLLA 2Y7IA 3G1OA 1KU3A 4G8NA 4E7SA 5H8SA 4I62A 3I54A 1KA0A 3DQVC 3KOSA 2HPMA 4OVTA 2EFQA 1FP2A 2HEOA 3TFLA 2OPTA 1J09A 3KP7A 1FPKA 3G71I 2O0YA 5ICQA 3FBPA 2XAHA 1D9VA 4ANJA 3TTNA 2V1XA 1T08B 3U72A 1JW1A 5I3SA 1D8KA 4ELPA 3F6OA 4BXFA 1K6YA 1MXZA 1NI9A 2GZWA 1REPC 4IHSA 3AXFA 2DA7A 3DTIA 1FOYA 3G6EI 1GV8A 3JRFA 2CSOA 4G12A 3KBZA 3E3VA 2V9KA 4F1UA 1B9JA 3EUKL 2R5YA 3UA8A 4KIFA 4XOTA 3OYMA 1K6OA 2ZNTA 1YYVA 1H0MA 4G7HF 4R74A 5BPIA 4BH9A 1NV2A 1IN4A 1ZG5A 1O7LA 2OUMA 2O1LA 2JVGA 3B6TA 3LSPA 5IOZA 1JEUA 3LFKA 1IEJA 2RC4A 1NHAA 4IHTA 1TC3C 5KZTA 2DN0A 2JSCA 2W48A 1B3EA 3FD3A 2LR8A 5GAHJ 1R6ZA 4HX8A 1ANFA 3VFZA 1AWBA 2VD3A 2KRHA 5F0CA 1A04A 1TP4A 1X3WB 3DLLF 1RRJA 4PE5B 2DJIA 4U2RA 2E2IJ 4AQ4A 1EH8A 2IS4A 4QFPA 3L09A 2HXOA 3OIOA 4BDQA 1XOCA 3KP6A 1FWZA 5A2QZ 3C31A 1K83J 1SFKA 4I02A 2PQ8A 3O66A 2KDZA 4BEHA 4BGDA 5E1ZB 2QFLA 3OR2C 2QKLB 2OZZA 2OV7A 3IK6B 3GMEA 4FECA 5ILSA 4B3XA 5FLVA 3K4KA 2CV2A 2QBYA 3I6VA 3BG9A 5KNLA 1J9IA 4YICA 3GYHX 1X4PA 3CCUI 2WB1N 4C30A 4AC0A 3B6CA 1Z7NE 5H8QA 4E4HA 5CMCA 3FIWA 1S5LC 5CBRA 2K40A 1CF7A 1XTAA 2RCBA 4R6HA 1QU3A 1YRNA 1VSOA 2ZCWA 1WHUA 3IHUA 3ZKKA 5ED4A 1USYE 3HSEA 3B6QA 4AB6A 3KYDB 3MVZA 4RGXA 3CCMI 2O51A 1CF7B 4P9UA 3ONMA 4UVBA 1JVYA 3G3JA 2WTEA 2W7NA 3W2AA 1DPPA 4LVQA 1N3XA 2VODA 5H8QB 3TP3A 3PMWA 1IRXA 1IRZA 2GBYA 2O7UA 1OYWA 3RQTA 4DE8A 2QQ8A 1SVMA 2ZXJA 2DOJA 4G9YA 2DK5A 1KA1A 1N0TA 3MKYB 4HE1A 4YIFA 1B72B 1XGOA 3A01B 4QFKA 1EYJA 2BV6A 2LK2A 1F9BA 1ZR4A 1J59A 2IEEA 2REJA 1EZ9A 1NUYA 3OO9A 2PT1A 4I7HA 3HYIA 1ZKBA 3Q26A 4BBSJ 1MMSA 4IO2A 1H9TA 2VLAA 2L7ZA 3WGIA 1AH5A 2E7WA 3BR3A 1LAXA 1ZJLA 4N6PA 3R4KA 5FKNA 5BNGA 1LDKB 2VE8A 2ZJRF 1D3KA 4F3BA 3QXMA 2W57A 1S29A 3WU0A 3H3UA 1T98A 2WV1A 4ELQA 2K9MA 2HVQA 3VOEA 4Q5SF 1H8AC 1HQCA 2GOXB 1N77A 3BCBA 3DEUA 3BY6A 4D5FA 4WEDA 3IH2A 3KBRA 2Q1ZB 2ALUA 1KGSA 5M5WJ 3ULQB 3IB0A 1I27A 3CTAA 1BI0A 3ZQGA 1LB2A 1FPBA 3QWLA 4R1HA 1MQHA 3EF7A 3HTUA 1WJDA 2H99A 1HW5A 1YX3A 1LVKA 3TZAA 3H0DA 1D1BA 2KKOA 3TODA 1IRGA 4CYDA 1WJAA 4U88A 1FTAA 2KT0A 3P7IA 1BR4A 3K4CA 4A6EA 4AIJA 1S7EA 4FORA 4OA4A 1LKXA 2FUG2 2XPVA 3H9QA 4LA9A 2PMSA 3M3YJ 1MXYA 3KN7A 2VI6A 1WI9A 1ZR2A 1LCFA 3MSTA 3LNQA 2X6OA 3FVNA 1SVLA 4H6DA 3FJ7A 1QRYA 2K4JA 3MQ9A 2O7IA 2E1MB 2CQ7A 2V4CA 4XKNA 4R6KA 1G3TA 3R6UA 2VB6A 2D21A 3OYFA 4PDKA 4NF8A 4I40A 3HOUJ 3T9HB 1SD7A 3A01A 2R93J 3DP8A 1B1BA 5HODA 2ZZXA 4QHQA 2G93A 3F8FA 3L00A 3LFUA 4FX0A 2LKPA 3EUAA 4O5VA 4BQOA 2UZKA 1R71A 3FZVA 1FPGA 2AL4A 5DW8A 3TELA 3FM3A 2ECCA 1GR2A 3G3KA 3S16J 5ET6A 2CJJA 3ML6A 2P8TA 4H1XA 1BLFA 4ENJA 1Z3YA 3I4MJ 1N04A 5B3SH 2WBBA 3CI8A 3OO6A 4ZECA 3PUXE 1LFGA 4MNCA 2RDPA 3E6CC 3BQYA 1B46A 2XAQA 3ABKH 3OYHA 3CG3A 3QIMA 4N8YA 3TO7A 2KLOA 3L7WA 2P3VA 4GBWA 4X9TA 1V54H 3KLOA 1NG6A 2CEYA 2MKZA 1PJRA 2L01A 3RIRA 5F08A 1BC7C 4EJWA 1NH7A 3AG1H 5TU0A 5GTIC 2FOKA 4GBVA 3SQNA 1FOWA 1RYXA 4Q30B 1T95A 3VLUA 3IUOA 4BQQA 2GQ1A 3ASOH 2XXTA 4FAJA 3PO3J 3RYDA 4PF8A 2J5OA 2QSXA 2M7BA 3F23A 2EZHA 1FX7A 2AQFA 1RC9A 3HJEA 1Z9CA 4XF5A 5L9SA 2P5KA 4KR5A 1D4NA 3H3GA 1GTKA 3DM0A 4I76A 2LBFA 5B1AH 4P96A 1TNTA 2YS9A 2HQ5A 5I56A 4HDUA 5KDTA 3I59B 2QM3A 1W5TA 3HSFA 2GXAA 3PUFA 2DOAA 1VQ7I 3NWSA 1AKHA 3FF5A 1NNFA 1AIVA 5E20A 3CCYA 2NRAC 1Y9UA 5ELVA 3CQZJ 3ZGKA 4Y15A 4OAZA 4QFNA 5J1UA 5KHDA 4V2FA 2YSRA 2R7VA 1QHHD 3IOWA 2XXRA 2KIUA 1PUEE 2V6EA 3MEXA 4K3FA 2BY1A 1I50J 4QSEA 3BOQA 2LF7A 2IGKA 3P7NA 1WH5A 4ZZAA 1Z21A 2OZUA 2H98A 1D1CA 5EDNA 1DCUA 1BBYA 2MC4A 2EH3A 2FU4A 2I48A 2NVXJ 2Y48A 2ZZWA 3HPHA 2WADA 1B6AA 4X8RA 5A5XB 4KIBA 1T0FA 5HDNA 2B7EA 2EPFA 2CV1A 4MX6A 2RV8A 1GHCA 4A69C 3S1QJ 3ZMZA 1YE9A 1AHDP 2XWOA 3QRFF 1QKAA 4BYYA 2DSFA 2HPGA 1NV5A 4XKQA 2VPNA 4EV0A 2UXNA 2DDBA 3K4NA 1O64A 3JZJA 1MPCA 4OOIA 2BBYA 3B6AA 4H5GA 4C9YA 2R5YB 3BC8A 5GPCA 2A07F 2QMWA 4KQPA 1B58A 5L8DA 3TQLA 2LDUA 4PFWA 1XMXA 2TDXA 3IAM2 3W2WA 5M3MJ 2XROA 2JA8J 5H8HB 5CM6A 4OEVA 3K00A 3D5RC 4C1TA 4MHFA 2UWMA 2V84A 1KQ9A 3A0BC 3S4UA 4B1RA 1WPKA 5EYRA 4V2GA 3U93A 4IHXA 5KCJB 2BHYA 1LBYA 1P1UA 3S2VA 2B4MA 1Z67A 2YU9J 3F8NA 1MY1A 2CUFA 4PFYA 4TLLB 2QSGX 3A29A 4CCJA 5FTIA 1URDA 4FCYA 2GHBA 2ZYMA 3TCFA 2GRVA 2K9SA 1L3LA 1WJBA 1PP7U 3IJOB 4M71A 3QODA 4KMUX 4M6VA 3HOSA 4XN3A 5L3FA 5LHIA 5FD6A 3S3OA 1CGPA 1B1HA 2CMOA 3FJMA 4GXAA 4NGUA 4HAMA 3RJPA 3LSWA 3O6GA 3ZSFA 4R9FA 2DI3A 2HXWA 4EXKA 2KMUA 2KZGA 3JRIA 4V19K 2H6BA 4NX1A 4GWXA 1YHQI 1NNTA 1N25A 4G94A 3RNNA 4YZZA 2GM4A 1FNNA 2E0SA 1TNSA 4ESJA 1HCRA 4FEBA 1YXIA 2EZKA 1APLC 1IQ7A 3E3KA 2FBPA 2VBWA 5I57B 1LDDA 1Z7ME 2F6CA 3FVOA 2XPUA 3KP4A 4OMZA 4IHYA 2G7HA 2VPLA 1URSA 1JKRC 4QBAA 3PNVA 2ZMEC 2Q2CA 3Q0UA 1Y4CA 5A2QK 2HFHA 2DU9A 1T33A 1HSEA 4NNJA 5KK1A 3G7WA 3MD2A 1ETXA 1Y8RB 1V5GA 5FD5A 1SVXB 4BACA 1A35A 4LQ2A 3MWBA 1M5CA 1LBCA 2PFYA 4OQOA 4ZE8A 4EQ9A 3W6KB 1MBGA 3LSIA 3BG6A 4DBRA 1VI0A 2LMDA 2XAUA 3U21A 2VQLA 3DBRB 3LAJA 4XKVA 4W1UA 4LK1F 3K2AA 3EPEA 4IY6A 1WKMA 1R9LA 2EFPA 4C3JJ 2VPOA 1AOVA 4AD9A 2F6GA 2R71A 3C9HA 1TLHB 2QQBA 2IAIA 2VE9A 3D0SA 1Y1VJ 3MBPA 1AL3A 2DMUA 5I58B 1DGWY 4PK4A 1ETOA 3NRVA 2CRGA 5JFRA 1IF1A 2L0KA 2HVSA 1MDP1 3IORA 4L0ZB 5JHFA 4Z0IA 2CUJA 3BZCA 3N6TA 3RPUD 5ICGA 3E6BA 1ULYA 3HG9A 5FROA 2Y0SN 4HLXA 4OMBA 3C2BA 5IP7J 4AS5A 1FSEA 2IA4A 2IP2A 3V7RA