3JV9A

The structure of a reduced form of oxyr from n. meningitidis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
EGAFKLGLIFTVAPYLLPKLIVSLRRTAPKMPLMLEENYTHTLTESLKRGDVDAIIVAEPFQEPGIVTEPLYDEPFFVIVPKGHSFEELDAVSPRMLGEEQVLLLTEGNCMRDQVLSSCSELAAKQRIQGLTNTLQGSSINTIRHMVASGLAISVLPATALTENDHMLFSIIPFEGTPPSRRVVLAYRRNFVRPKALSAMKAAIMQSQLHGVSFIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, LysR family
publication title The structure of a reduced form of OxyR from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 46
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3jv9A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3jv9A02
2VGQA 2D5WA 1YPNA 3IAZA 4U1OA 3KSXA 3C34A 2QS2A 2DQVA 3W9VA 2OWSA 3QAXA 4DXUA 4YB6A 2RCAA 5H8HA 4KYDA 4H1XA 3A09A 4OHNA 1MQHA 4OEUA 3MZ9A 1MPCA 2O69A 1IUDA 1B3GA 1NL5A 1NNFA 1B4ZA 3T9VA 2P2AA 1IXHA 3SEYA 1JW4A 3N94A 2ZMBA 3SEXA 3CRBA 1I6BA 4FECA 4BDOA 4DXCA 4PQJA 3S9EA 1B3HA 1A55A 4NF8A 2Q2CA 1LAXA 3USDA 4EXKA 2Z8EA 3MUQA 2PBWA 1N0TA 2GHAA 2QS3A 4G2ZA 1A7LA 1H76A 4FE8A 1O63A 3C33A 3DP4A 1QW0A 1LAFE 2ZYMA 3R6UA 1FTKA 3CI8A 5H8HB 2YJPA 1JQFA 1VR5A 4ONYA 4GQOA 4OERA 2B3BA 3WAFA 2YPNA 5H8NA 4QSDA 4QF9A 1S9TA 3MPKA 4QHQA 1AL3A 3TFLA 2GFEA 1Y20A 3SEUA 3PMXA 2PMSA 1Y1ZA 4ZEDA 2HXWA 2XXIA 4PFYA 2UYEA 4NF8B 3TAJA 3PU5A 1ZMGA 4XKPA 1TT1A 4OEVA 4PETA 3LUYA 1P1UA 1NH7A 2ZNUA 3ILTB 5HPQA 4IY5A 2XX8A 4FIMA 2I3VA 1B3EA 1SVXB 1BKAA 3M3KA 3TPAA 3I6VA 1B0LA 1DSNA 2A5TB 5H8NB 4C1TA 3KN3A 3FJ7A 4PFWA 3N5LA 1USYH 5AE4A 4Z0IA 1MXYA 4Q5TA 2XD3A 3IOUA 3PD8A 1A54A 1XOCA 3KGCA 1NNPA 1FQFA 3LSFB 4R73A 3K6WA 3T96B 4C1UA 4IO6A 2OJTA 4ND9A 1LBBA 2V84A 3TQLA 1LBCA 3M8UA 5L9OA 1NMUA 1H3DA 1UIVA 3BBRA 4ZEBA 2DWAA 1D9VA 3VVDA 1JW5A 3FD3A 4LVQA 2AIXA 4F3GA 3L6GA 3FV1A 2H4IA 1L5TA 3O28A 3H03A 1SDXA 2VD2A 1MQIA 4ZZEA 1GGGA 3KEIA 1B46A 4F18A 3FZVA 2DE2A 1NH8A 3PV0E 3O66A 2DE3A 4IO4A 4GL8A 1HSEA 1M5FA 3MVWA 1FTJA 2ZYNA 3IX1A 1AOVA 2F7CA 1LB8A 2QMWA 4JXIA 3OO8A 2R71A 3VDFA 4ISUA 2WKYA 1ZTYA 1XHYA 1GR2A 1SYHA 1ZU0A 3G3KA 5F7VA 1GV8A 4H67A 3MP1A 1B5JA 1S50A 3V89B 1CB6A 3KN8A 4O3AA 4F3SA 3A3UA 3RUMA 2DVCA 5ICQA 2Q9TA 5CMCA 4EDPA 2XXVA 4LUBA 5I2NA 4NTLA 4R9FA 1FQCA 3QXMA 4R2FA 3PPRA 4E0XA 4IO7A 5CRYA 3UIFA 3CFZA 3PMVA 3TYHA 4Z7EA 5AA1A 4H5GA 3ZKLA 3CSBA 3TTNA 1SW1A 3IK6B 2O84X 2V3TA 2Y7RA 3TDJA 4C0RA 5KZTA 5I59A 3F11A 3T9HB 3T66A 1NFTA 2ONRA 4BDMA 4NF4A 2DSFA 5ITOA 3VLUA 1QKBA 1XS5A 3IO4A 5TP9B 4GVOA 3TTMA 3DLNA 1EU8A 4LQ5A 1AIVA 4ZEKA 5HM4B 4ZEIA 3UK4A 1PBQA 3GBAA 3QK6A 1VFDA 5I2NB 4EQ7A 3U8QA 3C35A 2IEEA 3FVGA 3DP8A 4H8JA 5JK4A 4X9TA 1Y3NA 4OWDA 3K00A 2F6GA 3Q26A 4NEDA 2X26A 3RT6B 4LZ7A 1FQBA 1M5BA 4EF2A 3O2AA 1D9YA 5H8QA 1XC1A 3TCFA 1M5CA 2RC8A 3MVXA 1MM6A 4KHZE 4NF6A 4XIGQ 3K0VA 2XX7A 2XX9A 2O68A 4NF4B 3K6UA 1USYE 1WVJA 3G3HA 1T0KA 1ZJLA 1B6HA 2OBGA 1B4HA 1BLFA 4HS7A 4K3FA 4QSEA 4KI0E 1DTGA 2ZXTA 2DP8A 3FXQA 4QFOA 2V3QA 4OVJA 3SKPA 1ATGA 3CG1A 4GF8A 4U22A 5CMMA 4IY6A 1NNTA 4EXLA 4FAJA 3HHGA 4MF3A 4F2QA 3T93B 5DT6A 2XXHA 4I9DA 1LGBC 3T9XB 2D21A 1O64A 2B3FA 4QFLA 3N26A 3LSLA 3EHUA 2ANJA 2I48A 1I6QA 5H8QB 3G3IA 2H99A 3OO7A 1EZPA 3K02A 1IQ7A 4NF6B 4IO5A 3DP6A 4TOZA 3EF7A 3FVOA 2NUVA 1N04A 4GD5A 3H4ZA 3OEMA 1RYXA 4RYAA 3UP9A 2DWIA 3TMGA 3I5OA 3OMBA 4U1ZA 1DPPA 2GHBA 4I8CA 2V25A 3LC8A 4NE4A 3PPPA 1H43A 1OVTA 3ONMA 1DTZA 3B6WA 4ECFA 1LAGE 2CMOA 4R74A 3TEPA 4G68C 1ELJA 2YLNA 3ZS6A 2QS4A 4XKRA 1EZOA 4BDQA 4X48A 5I57A 2Q2AA 1LCTA 2I0BA 3H7MA 4IB2A 2DWHA 4GIZA 4YKPA 4YKJA 2F7AA 3Q25A 3FXUA 5ELVA 4OENA 1VFEA 1B9JA 2E0SA 4RK9A 4N13A 2R9JA 4Q0CA 4QFNA 3FVKA 5L9MA 4FEDA 2RC9A 3IJXB 5EHMA 4R6HA 3T22A 2Z8FA 4F2OA 1EH3A 1MQGA 1QUIA 1BTJA 1N3WA 4PE5B 2B65A 3FATA 2Y7WA 5FTIA 2OZZA 5DVJA 1ZKBA 1WODA 5M2VA 2F97A 1ZLQA 4I62A 2AL5A 2O1MA 5K2YA 3W15C 3O6HA 3RTWB 2XXPA 3VXBA 2F36A 3O6GA 3U72A 2QSXA 4F1YA 1QVSA 3HV1A 5I57B 1OVBA 2X7QA 4HW8A 4H8IA 4ELQA 1OQHA 3KJTA 5FHMA 1MH4A 1UIUA 2VHAA 5I2KA 4F3BA 2LAOA 1I69A 2M8CA 4I1DA 4H5FA 1A8FA 5KDTA 3OELA 2KLFA 3FJMA 3H6TA 3EPEA 2V3UA 1VE4A 4F39A 5I84A 3QUJA 3DELB 2DOJA 4YMAA 3MVYA 4R6YA 2HAVA 1JETA 1PBPA 3B7DA 4TLLB 1D3KA 3QUFA 3MAMA 4X1BA 2OWTA 3TTRA 3CFLA 4KCDA 3SDFA 3KZGA 3C32A 2Y84A 5I2KB 5BWJA 1VSOA 3O9PA 3B6TA 3OOAA 5AA3A 3K1NA 2HQ0A 2UYFA 2NOOA 3SERA 3TELA 2O7IA 1CE2A 1MXUA 2NVUB 1MQJA 3K1PA 5KDTB 3H6UA 2ONSA 1IXIA 2UVIA 3IB2A 1LFIA 3CIJA 3OO9A 2I49A 1SW4A 2PYYA 5EYFA 1B0HA 3PPNA 3OXNA 1PDAA 4F19A 4P0GA 1HSLA 1MY0A 1SBPA 4GL0A 4Q8RA 3M3FA 2DYXA 4JWXA 3RPWA 1PEBA 4LZ8A 3IORA 2XXTA 4X1DA 3OO6A 2XXUA 2AYSA 5ITPA 4Q30B 2I6EA 1XVYA 3MQ9A 2UXAA 4WKMA 4JSDA 2F35A 3IOWA 4DE8A 4OYVA 4ZS9A 1J1NA 3RTFB 3K2DA 4L17A 4PFTA 1JEVA 1MG1A 1DOTA 5CMBA 4DZ1A 1Q35A 3LSWA 5JEIA 4ZEFA 1B32A 4KCCA 4F29A 1UTBA 2H9BA 1D4NA 2Y7PA 4YAHX 5ICTA 5F1QA 3E3KA 4GWOA 5AA2A 4ELRA 3TTKA 2O51A 1MS7A 1MH3A 4JSOA 4GLIA 1P1WA 3ZSFA 4DIGA 4IO3A 1MXXA 2HZKA 2Y7IA 1IEJA 4FJPA 2W7YA 4IGTA 4BDRA 4R2BA 1F9BA 3CR9A 5LOMA 2REJA 4U4XA 4N6PA 1SD3A 3PUZE 3VVFA 4G8MA 1KWHA 4QFKA 2O6AA 2DVZA 1OLCA 5H8SA 4R9GA 4QRZA 1R9LA 1ZIUA 3JYRA 3IB1A 3G3FA 3MWBA 4KQPA 1FCKA 1UTBB 2F6PA 1QJMA 4RK2A 4P11A 4H65A 2V93A 1N3XA 2ZNSA 2A5SA 4E0WA 4POWA 5AA2B 4AB5A 2RC7A 2Y7KA 1QULA 3Q27A 3MC2A 4ELOA 3W9WA 1B7ZA 3THIA 2VP1A 3VV5A 4MLVA 3V83A 5L8DA 2ABHA 3SEVA 1B52A 4R72A 3RQTA 2GRVA 3MVZA 3LBSA 4PFUA 4O3BA 3R26A 1Z7ME 4JWOA 3OD7A 5CBRA 3JV9A 2ZYKA 4LZ5A 1P1NA 1IZ1A 4KR5A 5L9SA 3A3CA 3EHSA 3O6IA 4RXLA 1IXGA 4RPNA 1MY4A 5DVFA 3FASA 3MP6A 2PT2A 3RLFE 5I59B 1UQWA 4ELPA 4JWYA 3VLWA 4O3CA 1RYOA 1FQDA 3V8XB 1B3LA 4AB6A 3E4RA 3N6TA 4IO2A 2PX1A 1A99A 3U94A 1FQEA 3T9UA 1LLSA 3E9XA 4FEBA 4OTEA 4G8HA 5DEXA 4RNSA 1B51A 1Y3PA 2I0CA 3Q29A 3EHTA 4XXUA 3FVNA 3G7WA 2FA7A 3KN7A 1N76A 4ESXA 1MPBA 2Z22A 4H0WA 4NMYA 3RY3A 1LAHE 3E13X 3K1MA 2XXYA 4LONB 3IOTA 3N6UA 5IKBA 4QSCA 3U1OA 1R9QA 4DCXA 5JTYA 5CC2A 1SI0A 3P7IA 2RKMA 5AA2D 3HCQA 3WAEA 4OFJA 1O7TA 5KCJA 3RT8A 3VFJA 3FJGA 4U23A 2UVJA 3CVGA 1LFGA 3G3GA 1NKXA 4MFIA 1GTKA 2PT1A 4GRKA 2DS9A 5FHNA 5DEXB 2P0SA 2QMXA 3TODA 4BLAA 1PB9A 2XXRA 4LP2B 1P1QA 4ZDMA 5I56A 3FIRA 3MZBA 3UN6A 1Q1KA 5AA4A 2BJJX 1MDQA 4UA8A 3HHFA 3O29A 4OFLA 1LCFA 5CI5A 4F22A 4MH5A 1B40A 5DYHA 5ISUA 1YCJA 4ZE9A 2ZNTA 2HFBA 4MLQA 2QL3A 3RN8A 5KCJB 4GXSB 2F5XA 2E1SA 2XHDA 3VXCA 1YTVA 2XXXA 3C36A 4UACA 2UVGA 3FUZA 4KD5A 2DWJA 1RKMA 1FQAA 1MDP1 3FXRA 1OQGA 4F31B 3AXFA 5K2XA 1B2HA 3RGYA 3TCGA 3EN3A 1TWYA 3R7XA 4F1VA 5I56B 2QPQA 1PB7A 2HCAA 5BUUA 5AA4B 1US5A 4HTGA 5FHOA 4NWDA 3C31A 1M5DA 4RY1A 2ALUA 3U93A 2F8DA 4IGRA 4YICA 2QS1A 1S7YA 3OENA 2ONKE 3ILUB 5CM6A 3HSTA 3FGSA 4BDLA 3GBBA 4HCYA 2Q8JA 1B1HA 4JDFA 4G68A 1R6ZA 4N07A 4ZZAA 3QSLA 4KYEA 5EHSA 3H3GA 1N7WA 1PC3A 5IAIA 3U92A 3PUVE 1H44A 5DTBA 5H8FA 3PUWE 3L6HA 4YB5A 1UTHA 1QKAA 4HCWA 1IITA 2XXWA 2A5TA 4RA1A 1MY2A 5B70A 3O97A 1R1NA 3MW0A 1B58A 4BDNA 3PUXE 4EUOA 1N7XA 3B6QA 3BFUA 2H5YA 1MRPA 1IXCA 3KSJA 3TKDA 1MM7A 4U2RA 1SW5A 4EF1A 1OIBA 1B05A 1DMBA 1Y1MA 3M3LA 4THIA 4OXVA 4G68B 3K6XA 3PPQA 1QUJA 2H25A 3OSRA 2I58A 1JNFA 4KPTA 1MY1A 5H8FB 2RF1A 2OLBA 3S9LC 4F1UA 1UTHB 1P1OA 3PD9A 3UORA 4FATA 1HSJA 1MQDA 4KYSA 4FORA 2IA4A 3IOVA 4RPOA 4F3PA 1JEUA 3PUYE 2Q88A 1XVXA 3C9HA 4GOTA 3SEWA 3HPIA 3SESA 2XXQA 1Y4TA 4OMBA 5CBSA 1SYIA 3V5AA 3BFTA 3TUSA 1P99A 2HZLA 3IL1B 2ZYOA 3S2VA 1OLAA 3ECRA 3SETA 3S9MC 2RCBA 3TQWA 1GVCA 4EQ9A 1B1XA 1ANFA 2Z23A 1BP5A 3G3JA 4WEPA 3K6VA 2FYIA 3QYTA 4KFQA 4XKQA 1TFDA 3C4MA 2I4BA 2HAUA 4G4PA 1IIWA 5TPAA 4POXA 3ZKKA 3Q28A 2F34A 2QJEA 2P1SA 1SQYA 4G8NA 5DVIA 2O7UA 1BIYA 3IO6A 2XD2A 5HBCA 3K01A 3IJOB 1ZBMA 3KBRA 2R6GE 1URDA 4OESA 4U21A 1MXVA 3H06B 1MY3A 3TTLA 1MXWA 4OZ9A 1B7UA 5TP9A 2I3WA 3CG3A 3KOSA 2F7BA 3CFXA 2PVUA 1B5IA 2VOZA 3CSGA 1B5HA 3GZGA 5TU0A 2FNCA 3MP8A 3K4UA 4DLDA 2X7PA 1M5EA 3H6WA 5TPAB 4U4SA 4G77A 3S4UA 3MBPA 1JW1A 2AL4A 4YMBA 1QUKA 1SW2A 1A8EA 5A5XA 4R75A 1DPEA 3QIMA 1URGA 3KFMA 4H6DA 1PB8A 1TXFA 4QFPA 4TQUQ 3VVEA 2HEUA 1AH5A 1FTOA 4LQ2A 2OCUA 4ZE8A 2QRYA 2THIA 1URSA 3LSXA 1FTMA 4OETA 4M4GA 2DXYA 2NWJA 4DXBA 1SI1A 3IR1A 4TLMB 4R6KA 4EQBA 4OQOA 3KG2A 5J1DA 1LB9A 5FTHA 3UA8A 1A40A 3I3VA 5CMKA 3PPOA 3GLBA 4YKIA 1Y9UA 3VLVA 2REGA 3VE1B 1TFAA 2UVHA 1MXZA 1I6AA 4JBZA 5A5XB 4M1VA 2D3IA 3KJ7A 1Y4CA 3KOTA 4MBPA 4XTCQ 3HO7A 3OSQA 1JVYA 4YZZA 1LFHA 1B3FA 4YU0A 4YKKA 3D4GA 4AQ4A 3PGFA 4DDDA 2G93A 1Z7NE 3MPLA 2GH9A 1MPDA 1NNKA 5I58A 4PP0A 3HN0A 4LATA 3BKIB 1LSTA 1POTA 1XT8A 2OK2A 4NF5A 2Z8DA 4P0IA 4RJZA 3D4CA 2NXOA 4GXAA 1WDNA 3S9NC 2DE4A 2ESNA 2Q89A 1FTLA 4WEDA 5B7DA 3PMWA 4LA9A 4NWCA 3LR1A 1JVXA 4JB7A 3IB0A 3JZJA 4ZECA 3ODBA 1H45A 3EQ1A 1FW0A 2O1LA 2H98A 4OFOA 1OMPA 3MJNA 1POY1 4ESWA 2F78A 4XKNA 5I58B 4WXJA 1B7HA 4GFRA 1Y3QA 4NF5B 2DXRA 1YAEA 3UGWA 3RNNA 2RINA 4DCYA 1N84A 2I4CA 3TZAA 3H6VA 4YB7A 1II5A 1EZ9A 3DM0A 2VD3A 3OEKA 5JTYB 2CZLA 3FV2A 1AMFA 1US4A 3GXAA 3TCHA 2G29A 3MZ1A
chains in the Genus database with same CATH superfamily
2VGQA 2D5WA 1YPNA 4X04A 3PTYA 3IAZA 4U1OA 3KSXA 3C34A 1QGXA 5ESYA 2QS2A 2DQVA 3W9VA 1FBGA 2OWSA 3QAXA 4DXUA 4YB6A 2RCAA 5H8HA 4KYDA 4H1XA 3A09A 3BIHA 4OHNA 1NV4A 1MQHA 4OEUA 3MZ9A 1MPCA 2O69A 1IUDA 1B3GA 1NL5A 1NNFA 3B8BA 1B4ZA 3T9VA 2P2AA 1IXHA 3SEYA 1JW4A 3N94A 2ZMBA 3SEXA 3CRBA 1I6BA 4FECA 4BDOA 4DXCA 1FJ9A 4PQJA 3S9EA 1EYJA 1B3HA 1A55A 4NF8A 2Q2CA 4HE1A 1LAXA 3USDA 4EXKA 2Z8EA 3MUQA 1NUXA 2PBWA 1N0TA 2GHAA 2QS3A 1DCUA 4G2ZA 1A7LA 1FPJA 1H76A 4FE8A 1O63A 3C33A 3DP4A 1QW0A 1LAFE 2ZYMA 3R6UA 1FTKA 3CI8A 5H8HB 2YJPA 1JQFA 1VR5A 2F3DA 4ONYA 4P1EA 4GQOA 4OERA 2B3BA 3WAFA 4JVCA 2PFYA 2YPNA 5H8NA 4QSDA 4QF9A 1S9TA 3MPKA 4QHQA 1AL3A 4UABA 3TFLA 2GFEA 5ET5A 1Y20A 3SEUA 3PMXA 2PMSA 1Y1ZA 4GWUA 1LBZA 3ROJA 5IZ3A 4ZEDA 2HXWA 2XXIA 4PFYA 2UYEA 4NF8B 3TAJA 4P8BA 3PU5A 1ZMGA 1XI6A 4XKPA 2P3VA 2ZZXA 1TT1A 4OEVA 4PETA 3LUYA 1P1UA 1NH7A 2ZNUA 1NV0A 2FVZA 3ILTB 5HPQA 4IY5A 4I3EA 2XX8A 4FIMA 2I3VA 1B3EA 1SVXB 1BKAA 3M3KA 3TPAA 3I6VA 3T0JA 1B0LA 1DSNA 2WYPA 2A5TB 3QMFA 1FPDA 5H8NB 4C1TA 4P9KA 3KN3A 3FJ7A 4PFWA 3N5LA 1USYH 5AE4A 4Z0IA 1MXYA 4Q5TA 2XD3A 3IOUA 3PD8A 1A54A 1XOCA 3KGCA 1NNPA 1FQFA 3LSFB 4R73A 3K6WA 1FJ6A 3T96B 4C1UA 4IO6A 2OJTA 4ND9A 1LBBA 2V84A 3TQLA 4IR8A 1LBCA 3M8UA 5L9OA 1NMUA 1H3DA 1UIVA 3BBRA 4ZEBA 2DWAA 1FSAA 1D9VA 3VVDA 1JW5A 3FD3A 4LVQA 2AIXA 4F3GA 2HPGA 3L6GA 3FV1A 2H4IA 1L5TA 3O28A 1FPIA 2OX3A 3H03A 1SDXA 2VD2A 1MQIA 4ZZEA 2KQZA 1GGGA 3KEIA 1B46A 5I3SA 4F18A 3FZVA 2DE2A 1NH8A 3PV0E 1EYIA 3O66A 1INPA 2DE3A 4IO4A 2WBBA 4GL8A 1HSEA 1M5FA 3MVWA 1FTJA 2ZYNA 3IX1A 1AOVA 2PCRA 1FBCA 2F7CA 1LB8A 2QMWA 4JXIA 5F24A 3OO8A 2R71A 4OA4A 3VDFA 4ISUA 2WKYA 1ZTYA 4P56A 1XHYA 1GR2A 1SYHA 1ZU0A 3G3KA 5F7VA 1GV8A 4H67A 3MP1A 1B5JA 1RDYA 1S50A 3V89B 2CZKA 4O7MA 4DI3D 1CB6A 3KN8A 4O3AA 4I3YA 4F3SA 3A3UA 2VPNA 2DDKA 3RUMA 2DVCA 5ICQA 2Q9TA 5CMCA 4N91A 4GX3A 4EDPA 2XXVA 4LUBA 5I2NA 4NTLA 4R9FA 1FQCA 3E79A 3QXMA 4P47A 4R2FA 3PPRA 4E0XA 4IO7A 5CRYA 3UIFA 4XFEA 3CFZA 4XF5A 3PMVA 3TYHA 4Z7EA 2FHYA 5AA1A 4H5GA 3ZKLA 4PAKA 1FBEA 3GYYA 3CSBA 3TTNA 1SW1A 1IMEA 3IK6B 2O84X 1IMCA 1NV6A 2V3TA 2Q8MA 4X8RA 2Y7RA 3TDJA 4C0RA 5KZTA 5I59A 3F11A 3T9HB 3T66A 1NFTA 2ONRA 4BDMA 4NF4A 2DSFA 5ITOA 3VLUA 1QKBA 1XS5A 3IO4A 5TP9B 4GVOA 4OVTA 3TTMA 1NI9A 4NHBA 5LTCA 3DLNA 1EU8A 4LQ5A 1AIVA 4ZEKA 5HM4B 4ZEIA 3UK4A 1PBQA 3GBAA 3QK6A 1VFDA 5I2NB 4EQ7A 3U8QA 3C35A 2IEEA 3FVGA 3DP8A 4H8JA 1NV3A 5JK4A 4X9TA 1Y3NA 4OWDA 3K00A 3MYUA 2F6GA 3KC0A 3Q26A 4NEDA 2X26A 3RT6B 4LZ7A 1FQBA 1M5BA 4EF2A 3O2AA 1D9YA 5H8QA 1XC1A 4P1LA 3TCFA 1M5CA 2RC8A 3MVXA 1MM6A 4KHZE 4NF6A 4XIGQ 3K0VA 1RDXA 2XX9A 2QVRA 2XX7A 2O68A 4GBVA 1NUWA 2GQ1A 4HE2A 4NF4B 3K6UA 1USYE 1WVJA 3G3HA 4MCOA 1T0KA 1ZJLA 1B6HA 2OBGA 1B4HA 1K9ZA 1BLFA 1DK4A 5LDZA 4HS7A 4K3FA 4QSEA 4KI0E 1DTGA 2ZXTA 2DP8A 3FXQA 4QFOA 2V3QA 2ZZVA 4OVJA 3SKPA 1ATGA 3CG1A 4GF8A 4U22A 5CMMA 4IY6A 1NNTA 4EXLA 4FAJA 3HHGA 4MF3A 4F2QA 3T93B 5DT6A 3KC1A 2XXHA 4I9DA 1LGBC 3T9XB 2D21A 1O64A 2B3FA 4QFLA 1G0IA 3N26A 3LSLA 3EHUA 2ANJA 2I48A 1FBHA 1I6QA 5H8QB 3G3IA 1LBVA 2H99A 1FRPA 3OO7A 1EZPA 3K02A 1IQ7A 4NF6B 5A5LA 4IO5A 3DP6A 4TOZA 3EF7A 3FVOA 2NUVA 1N04A 4GD5A 3H4ZA 3OEMA 1RYXA 4RYAA 3UP9A 2DWIA 3TMGA 3I5OA 3OMBA 4U1ZA 4P3LA 1DPPA 2GHBA 4I8CA 2V25A 3LC8A 4NE4A 3PPPA 1H43A 1OVTA 3ONMA 1DTZA 3B6WA 4ECFA 1LAGE 2CMOA 4R74A 3TEPA 4G68C 1ELJA 2YLNA 3ZS6A 2QS4A 4XKRA 1EZOA 4BDQA 4PBQA 4X48A 5I57A 2Q2AA 1DBZA 1LCTA 2I0BA 3H7MA 4IB2A 2DWHA 3EKIA 4XEQA 4GIZA 4YKPA 4YKJA 2F7AA 3Q25A 3FXUA 5ELVA 4OENA 1VFEA 1AWBA 1B9JA 2E0SA 4RK9A 4N13A 2R9JA 4Q0CA 4QFNA 3FVKA 5L9MA 4FEDA 2RC9A 3IJXB 5EHMA 4R6HA 3T22A 2Z8FA 4F2OA 5EYHA 1EH3A 1MQGA 1QUIA 1BTJA 1N3WA 1NV1A 4PE5B 4HE0A 2B65A 3FATA 2Y7WA 1SPIA 2OZZA 5DVJA 4O94A 5FTIA 1ZKBA 1WODA 5M2VA 2F97A 1ZLQA 4I62A 2AL5A 2O1MA 4MHFA 5K2YA 3W15C 3O6HA 3RTWB 2XXPA 3VXBA 2F36A 3O6GA 3U72A 2QSXA 4F1YA 1QVSA 3HV1A 4PFRA 5I57B 1OVBA 2X7QA 4HW8A 4H8IA 4ELQA 2F3BA 1OQHA 1FPKA 3KJTA 5FHMA 1MH4A 1UIUA 2VHAA 5I2KA 4O8MA 1LBXA 3E78A 2B4LA 4JVDA 4F3BA 2LAOA 1K9YA 1I69A 2M8CA 4I1DA 4H5FA 1FPFA 1A8FA 5KDTA 3OELA 2KLFA 3FJMA 3H6TA 3EPEA 2V3UA 1VE4A 4F39A 5I84A 3QUJA 3DELB 2DOJA 4YMAA 3MVYA 4R6YA 2HAVA 1JETA 1PBPA 3A29A 3B7DA 4TLLB 1D3KA 3QUFA 3MAMA 4X1BA 2OWTA 3TTRA 3CFLA 4KCDA 3SDFA 3KZGA 3C32A 2Y84A 5I2KB 5BWJA 1VSOA 3IFCA 3O9PA 3B6TA 3OOAA 5AA3A 3K1NA 2HQ0A 2UYFA 1FPLA 2NOOA 3SERA 3TELA 4GWXA 2O7IA 1CE2A 1MXUA 2NVUB 1IMBA 1IMDA 2XWVA 1MQJA 3K1PA 5KDTB 4NN3A 3H6UA 2ONSA 1IXIA 2UVIA 3IB2A 1LFIA 4H45A 4N81A 3CIJA 3MSTA 4O7IA 3OO9A 4H46A 2I49A 1SW4A 2PYYA 5EYFA 1B0HA 3PPNA 3OXNA 1PDAA 4F19A 4P0GA 1HSLA 1MY0A 1SBPA 4GL0A 5IZ3B 4Q8RA 3M3FA 2DYXA 4JWXA 3RPWA 3FXBA 1PEBA 1FBDA 4LZ8A 3IORA 2XXTA 4X1DA 3OO6A 4PF8A 2XXUA 2AYSA 3U65A 5ITPA 4NF0A 3NOHA 4Q30B 2I6EA 2WYKA 1XVYA 3MQ9A 2UXAA 4WKMA 4JSDA 2F35A 3IOWA 4OVQA 4DE8A 4OYVA 4ZS9A 1J1NA 3RTFB 3K2DA 1KZ8A 2HXRA 4L17A 3B50A 4PFTA 1JEVA 1MG1A 1DOTA 1IMFA 5CMBA 4DZ1A 1Q35A 3LSWA 5JEIA 4ZEFA 1B32A 4KCCA 4F29A 1UTBA 2H9BA 5I7IA 2CEYA 1D4NA 2Y7PA 1FPGA 4YAHX 5ICTA 5F1QA 3E3KA 4GWOA 5AA2A 4ELRA 4N6DA 3TTKA 2O51A 1MS7A 1MH3A 4JSOA 3HFUA 4GLIA 1JP4A 4GBWA 1P1WA 3ZSFA 4DIGA 4IO3A 1MXXA 2HZKA 2Y7IA 1IEJA 4FJPA 2W7YA 4IGTA 4BDRA 4R2BA 1F9BA 3CR9A 5LOMA 2REJA 4U4XA 4N6PA 1SD3A 3PUZE 3VVFA 4G8MA 2XWIA 1KWHA 4QFKA 4QXDA 2O6AA 2DVZA 1OLCA 5H8SA 4R9GA 4QRZA 1R9LA 1KA0A 1ZIUA 3JYRA 3IB1A 3G3FA 3MWBA 4KQPA 1FCKA 1UTBB 2F6PA 1QJMA 4RK2A 4P11A 4H65A 2V93A 1N3XA 2ZNSA 2A5SA 1YXIA 4E0WA 4PDDA 4POWA 5AA2B 4AB5A 1FBFA 4N6KA 2RC7A 2Y7KA 1QULA 1G0HA 2QFLA 3Q27A 3MC2A 4ELOA 3W9WA 1B7ZA 1D9QA 3THIA 2VP1A 3VV5A 4MLVA 3V83A 5L8DA 1FTAA 2ABHA 3SEVA 1B52A 4R72A 2KR0A 3RQTA 2GRVA 3MVZA 3LBSA 4PFUA 4O3BA 2Y5LA 2B4MA 2P3NA 3R26A 4PGNA 1Z7ME 4JWOA 3OD7A 5CBRA 3JV9A 2ZYKA 4GX6A 4LZ5A 1P1NA 1IZ1A 4KR5A 5L9SA 3A3CA 3EHSA 3O6IA 4PFBA 4RXLA 1IXGA 4RPNA 1MY4A 5DVFA 3FASA 4N8YA 3MP6A 2PT2A 3RLFE 5I59B 1UQWA 4ELPA 4JWYA 3VLWA 4O3CA 1RYOA 1FQDA 1YZ0A 3V8XB 1B3LA 4AB6A 3E4RA 3N6TA 4IO2A 2PX1A 1A99A 3U94A 1FQEA 3T9UA 5T3JA 1LLSA 3E9XA 4FEBA 4OTEA 4G8HA 5DEXA 4RNSA 1B51A 1Y3PA 2I0CA 4N4UA 3Q29A 3EHTA 4XXUA 3FVNA 3G7WA 2FA7A 3KN7A 1N76A 3IFAA 1NV5A 4ESXA 1MPBA 2Z22A 4H0WA 4NMYA 3RY3A 1LAHE 3E13X 4PFIA 3K1MA 2XXYA 4LONB 1YYZA 3IOTA 2JJKA 3N6UA 5IKBA 4QSCA 3U1OA 1R9QA 4DCXA 5JTYA 4MJOA 5CC2A 1SI0A 4MNCA 3P7IA 2RKMA 5AA2D 3HCQA 3WAEA 4OFJA 1O7TA 5KCJA 3RT8A 3VFJA 3FBPA 3FJGA 2XWKA 4U23A 2UVJA 4PE3A 3CVGA 1LFGA 3G3GA 1NKXA 2PFZA 4MFIA 4N15A 1GTKA 2PT1A 4GRKA 2DS9A 5FHNA 5DEXB 2P0SA 2QMXA 3TODA 4BLAA 1PB9A 2XXRA 4LP2B 1P1QA 4ZDMA 5I56A 3FIRA 3MZBA 3UN6A 5IGAA 1Q1KA 5AA4A 2BJJX 1MDQA 4UA8A 3HHFA 3O29A 4OANA 1RDZA 4OFLA 1LCFA 5CI5A 4F22A 3BIGA 4MH5A 4QBAA 1B40A 5DYHA 5ISUA 4MNPA 1YCJA 4ZE9A 2ZNTA 4I40A 2HFBA 4MLQA 2QL3A 3RN8A 5KCJB 4GXSB 2F5XA 2E1SA 2XHDA 4OVSA 3VXCA 1YTVA 2XXXA 3C36A 4UACA 1NUYA 2UVGA 3FUZA 5IM2A 4KD5A 2DWJA 1RKMA 1FQAA 1MDP1 3FXRA 1OQGA 4F31B 3AXFA 5K2XA 1B2HA 3RGYA 3SZPA 3TCGA 3EN3A 1TWYA 3R7XA 4F1VA 5I56B 2QPQA 1PB7A 2HCAA 5BUUA 5AA4B 1US5A 4HTGA 5FHOA 2Y5KA 4NWDA 3C31A 1M5DA 1LEVA 4RY1A 2ALUA 3U93A 2MKZA 2F8DA 4IGRA 4YICA 2QS1A 2XA5A 1S7YA 3OENA 2ONKE 3ILUB 5CM6A 3HSTA 3FGSA 4BDLA 3GBBA 4HCYA 2Q8JA 1B1HA 4JDFA 4G68A 1R6ZA 4N07A 4ZZAA 3QSLA 4N8GA 4KYEA 5EHSA 3H3GA 1N7WA 1PC3A 5IAIA 4AS4A 3U92A 3PUVE 1H44A 5DTBA 3LV0A 3PUWE 5H8FA 3L6HA 4YB5A 1UTHA 1QKAA 4PDHA 4HCWA 4PC9A 1IITA 2XXWA 2A5TA 1NV7A 4RA1A 1MY2A 5B70A 3O97A 1R1NA 1IMAA 3MW0A 4DI4B 1B58A 4BDNA 3PUXE 4N17A 4EUOA 1N7XA 3B6QA 3BFUA 2H5YA 1MRPA 2WX9A 1IXCA 3KSJA 3TKDA 1MM7A 4U2RA 2WBDA 1SW5A 1FBPA 4EF1A 1OIBA 1B05A 1CNQA 1DMBA 1Y1MA 2XWOA 3M3LA 4THIA 4OXVA 5I5PA 2CZIA 2VT5A 4G68B 3K6XA 3PPQA 1QUJA 2H25A 3OSRA 2I58A 1JNFA 4KPTA 1MY1A 4PAIA 4GX4A 5H8FB 2RF1A 2OLBA 4NAPA 4JVIA 3S9LC 4F1UA 1UTHB 1P1OA 3PD9A 3UORA 4FATA 1HSJA 5EQAA 1MQDA 4PCDA 4KYSA 4MAGA 4FORA 2IA4A 2BJIA 3IOVA 4GWYA 4RPOA 4F3PA 1JEUA 3PUYE 2Q88A 1XVXA 4NGUA 5IZZA 3C9HA 4NX1A 4GOTA 3SEWA 3HPIA 3SESA 2XXQA 1Y4TA 4OMBA 5CBSA 1SYIA 3V5AA 1Q9DA 3BFTA 3TUSA 1P99A 2HZLA 1LBYA 3IL1B 2ZYOA 3S2VA 1OLAA 3ECRA 3SETA 3S9MC 2RCBA 3TQWA 1GVCA 4MEVA 4EQ9A 1B1XA 3RYDA 2FIXA 5EYGA 1ANFA 2Z23A 1BP5A 3G3JA 4WEPA 2R8TA 2WEFA 3K6VA 2FYIA 3QYTA 5ET7A 4KFQA 4XKQA 1TFDA 4GWWA 3C4MA 2I4BA 2HAUA 4G4PA 1IIWA 5TPAA 4POXA 3ZKKA 3Q28A 2F34A 2QJEA 2P1SA 1SQYA 5IZ1A 4G8NA 5DVIA 2O7UA 1BIYA 3IO6A 2XD2A 4KXPA 5HBCA 3K01A 3IJOB 1ZBMA 3KBRA 2R6GE 1LBWA 5EQ9A 2VPOA 2L5VA 1URDA 4OESA 4U21A 1MXVA 3H06B 1MY3A 3TTLA 1MXWA 4OZ9A 1B7UA 5TP9A 4MIJA 2I3WA 3ISPA 3CG3A 3KOSA 2F7BA 3CFXA 2PVUA 5FBPA 4MX6A 2XXKA 1B5IA 2VOZA 3CSGA 1B5HA 3GZGA 5TU0A 2FNCA 3MP8A 3K4UA 4DLDA 2X7PA 1M5EA 3H6WA 5TPAB 4U4SA 4G77A 3S4UA 3MBPA 1JW1A 2AL4A 3T1BA 4YMBA 1QUKA 1SW2A 1A8EA 5A5XA 4R75A 1DPEA 3QIMA 1BK4A 1URGA 3KFMA 4H6DA 1PB8A 1TXFA 4QFPA 4TQUQ 3VVEA 1NV2A 5ET6A 4PGPA 2HEUA 1AH5A 1FTOA 4LQ2A 1VDWA 2OCUA 4GWSA 4ZE8A 2QRYA 2THIA 1URSA 3LSXA 1FTMA 4OETA 4LN5A 4M4GA 2DXYA 2NWJA 4DXBA 1SI1A 3IR1A 4TLMB 4R6KA 2QVUA 4EQBA 4OQOA 3KG2A 5J1DA 1LB9A 5FTHA 3UA8A 1A40A 3I3VA 5CMKA 3PPOA 3GLBA 4YKIA 1Y9UA 3VLVA 2REGA 3VE1B 1TFAA 2UVHA 1MXZA 1I6AA 4JBZA 4FBPA 5A5XB 2QVVA 4M1VA 2D3IA 3KJ7A 3RPLA 1Y4CA 4G61A 4NG7A 3KOTA 4MBPA 4XTCQ 3HO7A 3OSQA 1JVYA 4YZZA 1LFHA 1B3FA 4YU0A 4YKKA 2V4CA 3D4GA 4AQ4A 4MNIA 4PTKA 3PGFA 4DDDA 2G93A 1Z7NE 3MPLA 2GH9A 1MPDA 1NNKA 5I58A 4PP0A 3HN0A 4LATA 3BKIB 1LSTA 1POTA 1XT8A 2OK2A 4NF5A 2Z8DA 4P0IA 4RJZA 2FBPA 4OVRA 3D4CA 2NXOA 4GXAA 1WDNA 4PBHA 2DE4A 2ESNA 3S9NC 2Q89A 4HXVA 1FTLA 4WEDA 5B7DA 4OVPA 3PMWA 4LA9A 3CHGA 2CZHA 4NWCA 3LR1A 4GWZA 2OWZA 4PF6A 1JVXA 2CEXA 4JB7A 3RPLB 3LUZA 3IB0A 3JZJA 3KBZA 5DW8A 4ZECA 3ODBA 1H45A 3EQ1A 1FW0A 2O1LA 4MMPA 1FPBA 5J16A 2H98A 4OFOA 1OMPA 2Q74A 3MJNA 1POY1 4ESWA 1KA1A 2F78A 4XKNA 4AS5A 5I58B 1EYKA 4WXJA 5ET8A 1FPEA 1B7HA 4GFRA 1Y3QA 4NF5B 2DXRA 1YAEA 2FIEA 3UGWA 4NQ8A 3RNNA 2RINA 4DCYA 5EQ7A 1N84A 2I4CA 3TZAA 3H6VA 4YB7A 1II5A 1EZ9A 3DM0A 2VD3A 3OEKA 3D1RA 5JTYB 2CZLA 3FV2A 2ZZWA 1AMFA 2HHMA 1US4A 3GXAA 3TCHA 1NUZA 2G29A 4PAFA 5EQ8A 3MZ1A
chains in the Genus database with same CATH topology
2VGQA 2D5WA 1YPNA 3IAZA 4U1OA 3KSXA 3C34A 2QS2A 2DQVA 3W9VA 2OWSA 3QAXA 4DXUA 4YB6A 2RCAA 5H8HA 4KYDA 4H1XA 3A09A 4OHNA 1MQHA 4OEUA 3MZ9A 1MPCA 2O69A 1IUDA 1B3GA 1NL5A 1NNFA 1B4ZA 3T9VA 2P2AA 1IXHA 3SEYA 1JW4A 3N94A 2ZMBA 3SEXA 3CRBA 1I6BA 4FECA 4BDOA 4DXCA 4PQJA 3S9EA 1B3HA 1A55A 4NF8A 2Q2CA 1LAXA 3USDA 4EXKA 2Z8EA 3MUQA 2PBWA 1N0TA 2GHAA 2QS3A 4G2ZA 1A7LA 1H76A 4FE8A 1O63A 3C33A 3DP4A 1QW0A 1LAFE 2ZYMA 3R6UA 1FTKA 3CI8A 5H8HB 2YJPA 1JQFA 1VR5A 4ONYA 4GQOA 4OERA 2B3BA 3WAFA 2YPNA 5H8NA 4QSDA 4QF9A 1S9TA 3MPKA 4QHQA 1AL3A 3TFLA 2GFEA 1Y20A 3SEUA 3PMXA 2PMSA 1Y1ZA 4ZEDA 2HXWA 2XXIA 4PFYA 2UYEA 4NF8B 3TAJA 3PU5A 1ZMGA 4XKPA 1TT1A 4OEVA 4PETA 3LUYA 1P1UA 1NH7A 2ZNUA 3ILTB 5HPQA 4IY5A 2XX8A 4FIMA 2I3VA 1B3EA 1SVXB 1BKAA 3M3KA 3TPAA 3I6VA 1B0LA 1DSNA 2A5TB 5H8NB 4C1TA 3KN3A 3FJ7A 4PFWA 3N5LA 1USYH 5AE4A 4Z0IA 1MXYA 4Q5TA 2XD3A 3IOUA 3PD8A 1A54A 1XOCA 3KGCA 1NNPA 1FQFA 3LSFB 4R73A 3K6WA 3T96B 4C1UA 4IO6A 2OJTA 4ND9A 1LBBA 2V84A 3TQLA 1LBCA 3M8UA 5L9OA 1NMUA 1H3DA 1UIVA 3BBRA 4ZEBA 2DWAA 1D9VA 3VVDA 1JW5A 3FD3A 4LVQA 2AIXA 4F3GA 3L6GA 3FV1A 2H4IA 1L5TA 3O28A 3H03A 1SDXA 2VD2A 1MQIA 4ZZEA 1GGGA 3KEIA 1B46A 4F18A 3FZVA 2DE2A 1NH8A 3PV0E 3O66A 2DE3A 4IO4A 4GL8A 1HSEA 1M5FA 3MVWA 1FTJA 2ZYNA 3IX1A 1AOVA 2F7CA 1LB8A 2QMWA 4JXIA 3OO8A 2R71A 3VDFA 4ISUA 2WKYA 1ZTYA 1XHYA 1GR2A 1SYHA 1ZU0A 3G3KA 5F7VA 1GV8A 4H67A 3MP1A 1B5JA 1S50A 3V89B 1CB6A 3KN8A 4O3AA 4F3SA 3A3UA 3RUMA 2DVCA 5ICQA 2Q9TA 5CMCA 4EDPA 2XXVA 4LUBA 5I2NA 4NTLA 4R9FA 1FQCA 3QXMA 4R2FA 3PPRA 4E0XA 4IO7A 5CRYA 3UIFA 3CFZA 3PMVA 3TYHA 4Z7EA 5AA1A 4H5GA 3ZKLA 3CSBA 3TTNA 1SW1A 3IK6B 2O84X 2V3TA 2Y7RA 3TDJA 4C0RA 5KZTA 5I59A 3F11A 3T9HB 3T66A 1NFTA 2ONRA 4BDMA 4NF4A 2DSFA 5ITOA 3VLUA 1QKBA 1XS5A 3IO4A 5TP9B 4GVOA 3TTMA 3DLNA 1EU8A 4LQ5A 1AIVA 4ZEKA 5HM4B 4ZEIA 3UK4A 1PBQA 3GBAA 3QK6A 1VFDA 5I2NB 4EQ7A 3U8QA 3C35A 2IEEA 3FVGA 3DP8A 4H8JA 5JK4A 4X9TA 1Y3NA 4OWDA 3K00A 2F6GA 3Q26A 4NEDA 2X26A 3RT6B 4LZ7A 1FQBA 1M5BA 4EF2A 3O2AA 1D9YA 5H8QA 1XC1A 3TCFA 1M5CA 2RC8A 3MVXA 1MM6A 4KHZE 4NF6A 4XIGQ 3K0VA 2XX7A 2XX9A 2O68A 4NF4B 3K6UA 1USYE 1WVJA 3G3HA 1T0KA 1ZJLA 1B6HA 2OBGA 1B4HA 1BLFA 4HS7A 4K3FA 4QSEA 4KI0E 1DTGA 2ZXTA 2DP8A 3FXQA 4QFOA 2V3QA 4OVJA 3SKPA 1ATGA 3CG1A 4GF8A 4U22A 5CMMA 4IY6A 1NNTA 4EXLA 4FAJA 3HHGA 4MF3A 4F2QA 3T93B 5DT6A 2XXHA 4I9DA 1LGBC 3T9XB 2D21A 1O64A 2B3FA 4QFLA 3N26A 3LSLA 3EHUA 2ANJA 2I48A 1I6QA 5H8QB 3G3IA 2H99A 3OO7A 1EZPA 3K02A 1IQ7A 4NF6B 4IO5A 3DP6A 4TOZA 3EF7A 3FVOA 2NUVA 1N04A 4GD5A 3H4ZA 3OEMA 1RYXA 4RYAA 3UP9A 2DWIA 3TMGA 3I5OA 3OMBA 4U1ZA 1DPPA 2GHBA 4I8CA 2V25A 3LC8A 4NE4A 3PPPA 1H43A 1OVTA 3ONMA 1DTZA 3B6WA 4ECFA 1LAGE 2CMOA 4R74A 3TEPA 4G68C 1ELJA 2YLNA 3ZS6A 2QS4A 4XKRA 1EZOA 4BDQA 4X48A 5I57A 2Q2AA 1LCTA 2I0BA 3H7MA 4IB2A 2DWHA 4GIZA 4YKPA 4YKJA 2F7AA 3Q25A 3FXUA 5ELVA 4OENA 1VFEA 1B9JA 2E0SA 4RK9A 4N13A 2R9JA 4Q0CA 4QFNA 3FVKA 5L9MA 4FEDA 2RC9A 3IJXB 5EHMA 4R6HA 3T22A 2Z8FA 4F2OA 1EH3A 1MQGA 1QUIA 1BTJA 1N3WA 4PE5B 2B65A 3FATA 2Y7WA 5FTIA 2OZZA 5DVJA 1ZKBA 1WODA 5M2VA 2F97A 1ZLQA 4I62A 2AL5A 2O1MA 5K2YA 3W15C 3O6HA 3RTWB 2XXPA 3VXBA 2F36A 3O6GA 3U72A 2QSXA 4F1YA 1QVSA 3HV1A 5I57B 1OVBA 2X7QA 4HW8A 4H8IA 4ELQA 1OQHA 3KJTA 5FHMA 1MH4A 1UIUA 2VHAA 5I2KA 4F3BA 2LAOA 1I69A 2M8CA 4I1DA 4H5FA 1A8FA 5KDTA 3OELA 2KLFA 3FJMA 3H6TA 3EPEA 2V3UA 1VE4A 4F39A 5I84A 3QUJA 3DELB 2DOJA 4YMAA 3MVYA 4R6YA 2HAVA 1JETA 1PBPA 3B7DA 4TLLB 1D3KA 3QUFA 3MAMA 4X1BA 2OWTA 3TTRA 3CFLA 4KCDA 3SDFA 3KZGA 3C32A 2Y84A 5I2KB 5BWJA 1VSOA 3O9PA 3B6TA 3OOAA 5AA3A 3K1NA 2HQ0A 2UYFA 2NOOA 3SERA 3TELA 2O7IA 1CE2A 1MXUA 2NVUB 1MQJA 3K1PA 5KDTB 3H6UA 2ONSA 1IXIA 2UVIA 3IB2A 1LFIA 3CIJA 3OO9A 2I49A 1SW4A 2PYYA 5EYFA 1B0HA 3PPNA 3OXNA 1PDAA 4F19A 4P0GA 1HSLA 1MY0A 1SBPA 4GL0A 4Q8RA 3M3FA 2DYXA 4JWXA 3RPWA 1PEBA 4LZ8A 3IORA 2XXTA 4X1DA 3OO6A 2XXUA 2AYSA 5ITPA 4Q30B 2I6EA 1XVYA 3MQ9A 2UXAA 4WKMA 4JSDA 2F35A 3IOWA 4DE8A 4OYVA 4ZS9A 1J1NA 3RTFB 3K2DA 4L17A 4PFTA 1JEVA 1MG1A 1DOTA 5CMBA 4DZ1A 1Q35A 3LSWA 5JEIA 4ZEFA 1B32A 4KCCA 4F29A 1UTBA 2H9BA 1D4NA 2Y7PA 4YAHX 5ICTA 5F1QA 3E3KA 4GWOA 5AA2A 4ELRA 3TTKA 2O51A 1MS7A 1MH3A 4JSOA 4GLIA 1P1WA 3ZSFA 4DIGA 4IO3A 1MXXA 2HZKA 2Y7IA 1IEJA 4FJPA 2W7YA 4IGTA 4BDRA 4R2BA 1F9BA 3CR9A 5LOMA 2REJA 4U4XA 4N6PA 1SD3A 3PUZE 3VVFA 4G8MA 1KWHA 4QFKA 2O6AA 2DVZA 1OLCA 5H8SA 4R9GA 4QRZA 1R9LA 1ZIUA 3JYRA 3IB1A 3G3FA 3MWBA 4KQPA 1FCKA 1UTBB 2F6PA 1QJMA 4RK2A 4P11A 4H65A 2V93A 1N3XA 2ZNSA 2A5SA 4E0WA 4POWA 5AA2B 4AB5A 2RC7A 2Y7KA 1QULA 3Q27A 3MC2A 4ELOA 3W9WA 1B7ZA 3THIA 2VP1A 3VV5A 4MLVA 3V83A 5L8DA 2ABHA 3SEVA 1B52A 4R72A 3RQTA 2GRVA 3MVZA 3LBSA 4PFUA 4O3BA 3R26A 1Z7ME 4JWOA 3OD7A 5CBRA 3JV9A 2ZYKA 4LZ5A 1P1NA 1IZ1A 4KR5A 5L9SA 3A3CA 3EHSA 3O6IA 4RXLA 1IXGA 4RPNA 1MY4A 5DVFA 3FASA 3MP6A 2PT2A 3RLFE 5I59B 1UQWA 4ELPA 4JWYA 3VLWA 4O3CA 1RYOA 1FQDA 3V8XB 1B3LA 4AB6A 3E4RA 3N6TA 4IO2A 2PX1A 1A99A 3U94A 1FQEA 3T9UA 1LLSA 3E9XA 4FEBA 4OTEA 4G8HA 5DEXA 4RNSA 1B51A 1Y3PA 2I0CA 3Q29A 3EHTA 4XXUA 3FVNA 3G7WA 2FA7A 3KN7A 1N76A 4ESXA 1MPBA 2Z22A 4H0WA 4NMYA 3RY3A 1LAHE 3E13X 3K1MA 2XXYA 4LONB 3IOTA 3N6UA 5IKBA 4QSCA 3U1OA 1R9QA 4DCXA 5JTYA 5CC2A 1SI0A 3P7IA 2RKMA 5AA2D 3HCQA 3WAEA 4OFJA 1O7TA 5KCJA 3RT8A 3VFJA 3FJGA 4U23A 2UVJA 3CVGA 1LFGA 3G3GA 1NKXA 4MFIA 1GTKA 2PT1A 4GRKA 2DS9A 5FHNA 5DEXB 2P0SA 2QMXA 3TODA 4BLAA 1PB9A 2XXRA 4LP2B 1P1QA 4ZDMA 5I56A 3FIRA 3MZBA 3UN6A 1Q1KA 5AA4A 2BJJX 1MDQA 4UA8A 3HHFA 3O29A 4OFLA 1LCFA 5CI5A 4F22A 4MH5A 1B40A 5DYHA 5ISUA 1YCJA 4ZE9A 2ZNTA 2HFBA 4MLQA 2QL3A 3RN8A 5KCJB 4GXSB 2F5XA 2E1SA 2XHDA 3VXCA 1YTVA 2XXXA 3C36A 4UACA 2UVGA 3FUZA 4KD5A 2DWJA 1RKMA 1FQAA 1MDP1 3FXRA 1OQGA 4F31B 3AXFA 5K2XA 1B2HA 3RGYA 3TCGA 3EN3A 1TWYA 3R7XA 4F1VA 5I56B 2QPQA 1PB7A 2HCAA 5BUUA 5AA4B 1US5A 4HTGA 5FHOA 4NWDA 3C31A 1M5DA 4RY1A 2ALUA 3U93A 2F8DA 4IGRA 4YICA 2QS1A 1S7YA 3OENA 2ONKE 3ILUB 5CM6A 3HSTA 3FGSA 4BDLA 3GBBA 4HCYA 2Q8JA 1B1HA 4JDFA 4G68A 1R6ZA 4N07A 4ZZAA 3QSLA 4KYEA 5EHSA 3H3GA 1N7WA 1PC3A 5IAIA 3U92A 3PUVE 1H44A 5DTBA 5H8FA 3PUWE 3L6HA 4YB5A 1UTHA 1QKAA 4HCWA 1IITA 2XXWA 2A5TA 4RA1A 1MY2A 5B70A 3O97A 1R1NA 3MW0A 1B58A 4BDNA 3PUXE 4EUOA 1N7XA 3B6QA 3BFUA 2H5YA 1MRPA 1IXCA 3KSJA 3TKDA 1MM7A 4U2RA 1SW5A 4EF1A 1OIBA 1B05A 1DMBA 1Y1MA 3M3LA 4THIA 4OXVA 4G68B 3K6XA 3PPQA 1QUJA 2H25A 3OSRA 2I58A 1JNFA 4KPTA 1MY1A 5H8FB 2RF1A 2OLBA 3S9LC 4F1UA 1UTHB 1P1OA 3PD9A 3UORA 4FATA 1HSJA 1MQDA 4KYSA 4FORA 2IA4A 3IOVA 4RPOA 4F3PA 1JEUA 3PUYE 2Q88A 1XVXA 3C9HA 4GOTA 3SEWA 3HPIA 3SESA 2XXQA 1Y4TA 4OMBA 5CBSA 1SYIA 3V5AA 3BFTA 3TUSA 1P99A 2HZLA 3IL1B 2ZYOA 3S2VA 1OLAA 3ECRA 3SETA 3S9MC 2RCBA 3TQWA 1GVCA 4EQ9A 1B1XA 1ANFA 2Z23A 1BP5A 3G3JA 4WEPA 3K6VA 2FYIA 3QYTA 4KFQA 4XKQA 1TFDA 3C4MA 2I4BA 2HAUA 4G4PA 1IIWA 5TPAA 4POXA 3ZKKA 3Q28A 2F34A 2QJEA 2P1SA 1SQYA 4G8NA 5DVIA 2O7UA 1BIYA 3IO6A 2XD2A 5HBCA 3K01A 3IJOB 1ZBMA 3KBRA 2R6GE 1URDA 4OESA 4U21A 1MXVA 3H06B 1MY3A 3TTLA 1MXWA 4OZ9A 1B7UA 5TP9A 2I3WA 3CG3A 3KOSA 2F7BA 3CFXA 2PVUA 1B5IA 2VOZA 3CSGA 1B5HA 3GZGA 5TU0A 2FNCA 3MP8A 3K4UA 4DLDA 2X7PA 1M5EA 3H6WA 5TPAB 4U4SA 4G77A 3S4UA 3MBPA 1JW1A 2AL4A 4YMBA 1QUKA 1SW2A 1A8EA 5A5XA 4R75A 1DPEA 3QIMA 1URGA 3KFMA 4H6DA 1PB8A 1TXFA 4QFPA 4TQUQ 3VVEA 2HEUA 1AH5A 1FTOA 4LQ2A 2OCUA 4ZE8A 2QRYA 2THIA 1URSA 3LSXA 1FTMA 4OETA 4M4GA 2DXYA 2NWJA 4DXBA 1SI1A 3IR1A 4TLMB 4R6KA 4EQBA 4OQOA 3KG2A 5J1DA 1LB9A 5FTHA 3UA8A 1A40A 3I3VA 5CMKA 3PPOA 3GLBA 4YKIA 1Y9UA 3VLVA 2REGA 3VE1B 1TFAA 2UVHA 1MXZA 1I6AA 4JBZA 5A5XB 4M1VA 2D3IA 3KJ7A 1Y4CA 3KOTA 4MBPA 4XTCQ 3HO7A 3OSQA 1JVYA 4YZZA 1LFHA 1B3FA 4YU0A 4YKKA 3D4GA 4AQ4A 3PGFA 4DDDA 2G93A 1Z7NE 3MPLA 2GH9A 1MPDA 1NNKA 5I58A 4PP0A 3HN0A 4LATA 3BKIB 1LSTA 1POTA 1XT8A 2OK2A 4NF5A 2Z8DA 4P0IA 4RJZA 3D4CA 2NXOA 4GXAA 1WDNA 3S9NC 2DE4A 2ESNA 2Q89A 1FTLA 4WEDA 5B7DA 3PMWA 4LA9A 4NWCA 3LR1A 1JVXA 4JB7A 3IB0A 3JZJA 4ZECA 3ODBA 1H45A 3EQ1A 1FW0A 2O1LA 2H98A 4OFOA 1OMPA 3MJNA 1POY1 4ESWA 2F78A 4XKNA 5I58B 4WXJA 1B7HA 4GFRA 1Y3QA 4NF5B 2DXRA 1YAEA 3UGWA 3RNNA 2RINA 4DCYA 1N84A 2I4CA 3TZAA 3H6VA 4YB7A 1II5A 1EZ9A 3DM0A 2VD3A 3OEKA 5JTYB 2CZLA 3FV2A 1AMFA 1US4A 3GXAA 3TCHA 2G29A 3MZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGQ A;  2D5W A;  1YPN A;  3IAZ A;  4U1O A;  3KSX A;  3C34 A;  2QS2 A;  2DQV A;  3W9V A;  2OWS A;  3QAX A;  4DXU A;  4YB6 A;  2RCA A;  5H8H A;  4KYD A;  4H1X A;  3A09 A;  4OHN A;  1MQH A;  4OEU A;  3MZ9 A;  1MPC A;  2O69 A;  1IUD A;  1B3G A;  1NL5 A;  1NNF A;  1B4Z A;  3T9V A;  2P2A A;  1IXH A;  3SEY A;  1JW4 A;  3N94 A;  2ZMB A;  3SEX A;  3CRB A;  1I6B A;  4FEC A;  4BDO A;  4DXC A;  4PQJ A;  3S9E A;  1B3H A;  1A55 A;  4NF8 A;  2Q2C A;  1LAX A;  3USD A;  4EXK A;  2Z8E A;  3MUQ A;  2PBW A;  1N0T A;  2GHA A;  2QS3 A;  4G2Z A;  1A7L A;  1H76 A;  4FE8 A;  1O63 A;  3C33 A;  3DP4 A;  1QW0 A;  1LAF E;  2ZYM A;  3R6U A;  1FTK A;  3CI8 A;  5H8H B;  2YJP A;  1JQF A;  1VR5 A;  4ONY A;  4GQO A;  4OER A;  2B3B A;  3WAF A;  2YPN A;  5H8N A;  4QSD A;  4QF9 A;  1S9T A;  3MPK A;  4QHQ A;  1AL3 A;  3TFL A;  2GFE A;  1Y20 A;  3SEU A;  3PMX A;  2PMS A;  1Y1Z A;  4ZED A;  2HXW A;  2XXI A;  4PFY A;  2UYE A;  4NF8 B;  3TAJ A;  3PU5 A;  1ZMG A;  4XKP A;  1TT1 A;  4OEV A;  4PET A;  3LUY A;  1P1U A;  1NH7 A;  2ZNU A;  3ILT B;  5HPQ A;  4IY5 A;  2XX8 A;  4FIM A;  2I3V A;  1B3E A;  1SVX B;  1BKA A;  3M3K A;  3TPA A;  3I6V A;  1B0L A;  1DSN A;  2A5T B;  5H8N B;  4C1T A;  3KN3 A;  3FJ7 A;  4PFW A;  3N5L A;  1USY H;  5AE4 A;  4Z0I A;  1MXY A;  4Q5T A;  2XD3 A;  3IOU A;  3PD8 A;  1A54 A;  1XOC A;  3KGC A;  1NNP A;  1FQF A;  3LSF B;  4R73 A;  3K6W A;  3T96 B;  4C1U A;  4IO6 A;  2OJT A;  4ND9 A;  1LBB A;  2V84 A;  3TQL A;  1LBC A;  3M8U A;  5L9O A;  1NMU A;  1H3D A;  1UIV A;  3BBR A;  4ZEB A;  2DWA A;  1D9V A;  3VVD A;  1JW5 A;  3FD3 A;  4LVQ A;  2AIX A;  4F3G A;  3L6G A;  3FV1 A;  2H4I A;  1L5T A;  3O28 A;  3H03 A;  1SDX A;  2VD2 A;  1MQI A;  4ZZE A;  1GGG A;  3KEI A;  1B46 A;  4F18 A;  3FZV A;  2DE2 A;  1NH8 A;  3PV0 E;  3O66 A;  2DE3 A;  4IO4 A;  4GL8 A;  1HSE A;  1M5F A;  3MVW A;  1FTJ A;  2ZYN A;  3IX1 A;  1AOV A;  2F7C A;  1LB8 A;  2QMW A;  4JXI A;  3OO8 A;  2R71 A;  3VDF A;  4ISU A;  2WKY A;  1ZTY A;  1XHY A;  1GR2 A;  1SYH A;  1ZU0 A;  3G3K A;  5F7V A;  1GV8 A;  4H67 A;  3MP1 A;  1B5J A;  1S50 A;  3V89 B;  1CB6 A;  3KN8 A;  4O3A A;  4F3S A;  3A3U A;  3RUM A;  2DVC A;  5ICQ A;  2Q9T A;  5CMC A;  4EDP A;  2XXV A;  4LUB A;  5I2N A;  4NTL A;  4R9F A;  1FQC A;  3QXM A;  4R2F A;  3PPR A;  4E0X A;  4IO7 A;  5CRY A;  3UIF A;  3CFZ A;  3PMV A;  3TYH A;  4Z7E A;  5AA1 A;  4H5G A;  3ZKL A;  3CSB A;  3TTN A;  1SW1 A;  3IK6 B;  2O84 X;  2V3T A;  2Y7R A;  3TDJ A;  4C0R A;  5KZT A;  5I59 A;  3F11 A;  3T9H B;  3T66 A;  1NFT A;  2ONR A;  4BDM A;  4NF4 A;  2DSF A;  5ITO A;  3VLU A;  1QKB A;  1XS5 A;  3IO4 A;  5TP9 B;  4GVO A;  3TTM A;  3DLN A;  1EU8 A;  4LQ5 A;  1AIV A;  4ZEK A;  5HM4 B;  4ZEI A;  3UK4 A;  1PBQ A;  3GBA A;  3QK6 A;  1VFD A;  5I2N B;  4EQ7 A;  3U8Q A;  3C35 A;  2IEE A;  3FVG A;  3DP8 A;  4H8J A;  5JK4 A;  4X9T A;  1Y3N A;  4OWD A;  3K00 A;  2F6G A;  3Q26 A;  4NED A;  2X26 A;  3RT6 B;  4LZ7 A;  1FQB A;  1M5B A;  4EF2 A;  3O2A A;  1D9Y A;  5H8Q A;  1XC1 A;  3TCF A;  1M5C A;  2RC8 A;  3MVX A;  1MM6 A;  4KHZ E;  4NF6 A;  4XIG Q;  3K0V A;  2XX7 A;  2XX9 A;  2O68 A;  4NF4 B;  3K6U A;  1USY E;  1WVJ A;  3G3H A;  1T0K A;  1ZJL A;  1B6H A;  2OBG A;  1B4H A;  1BLF A;  4HS7 A;  4K3F A;  4QSE A;  4KI0 E;  1DTG A;  2ZXT A;  2DP8 A;  3FXQ A;  4QFO A;  2V3Q A;  4OVJ A;  3SKP A;  1ATG A;  3CG1 A;  4GF8 A;  4U22 A;  5CMM A;  4IY6 A;  1NNT A;  4EXL A;  4FAJ A;  3HHG A;  4MF3 A;  4F2Q A;  3T93 B;  5DT6 A;  2XXH A;  4I9D A;  1LGB C;  3T9X B;  2D21 A;  1O64 A;  2B3F A;  4QFL A;  3N26 A;  3LSL A;  3EHU A;  2ANJ A;  2I48 A;  1I6Q A;  5H8Q B;  3G3I A;  2H99 A;  3OO7 A;  1EZP A;  3K02 A;  1IQ7 A;  4NF6 B;  4IO5 A;  3DP6 A;  4TOZ A;  3EF7 A;  3FVO A;  2NUV A;  1N04 A;  4GD5 A;  3H4Z A;  3OEM A;  1RYX A;  4RYA A;  3UP9 A;  2DWI A;  3TMG A;  3I5O A;  3OMB A;  4U1Z A;  1DPP A;  2GHB A;  4I8C A;  2V25 A;  3LC8 A;  4NE4 A;  3PPP A;  1H43 A;  1OVT A;  3ONM A;  1DTZ A;  3B6W A;  4ECF A;  1LAG E;  2CMO A;  4R74 A;  3TEP A;  4G68 C;  1ELJ A;  2YLN A;  3ZS6 A;  2QS4 A;  4XKR A;  1EZO A;  4BDQ A;  4X48 A;  5I57 A;  2Q2A A;  1LCT A;  2I0B A;  3H7M A;  4IB2 A;  2DWH A;  4GIZ A;  4YKP A;  4YKJ A;  2F7A A;  3Q25 A;  3FXU A;  5ELV A;  4OEN A;  1VFE A;  1B9J A;  2E0S A;  4RK9 A;  4N13 A;  2R9J A;  4Q0C A;  4QFN A;  3FVK A;  5L9M A;  4FED A;  2RC9 A;  3IJX B;  5EHM A;  4R6H A;  3T22 A;  2Z8F A;  4F2O A;  1EH3 A;  1MQG A;  1QUI A;  1BTJ A;  1N3W A;  4PE5 B;  2B65 A;  3FAT A;  2Y7W A;  5FTI A;  2OZZ A;  5DVJ A;  1ZKB A;  1WOD A;  5M2V A;  2F97 A;  1ZLQ A;  4I62 A;  2AL5 A;  2O1M A;  5K2Y A;  3W15 C;  3O6H A;  3RTW B;  2XXP A;  3VXB A;  2F36 A;  3O6G A;  3U72 A;  2QSX A;  4F1Y A;  1QVS A;  3HV1 A;  5I57 B;  1OVB A;  2X7Q A;  4HW8 A;  4H8I A;  4ELQ A;  1OQH A;  3KJT A;  5FHM A;  1MH4 A;  1UIU A;  2VHA A;  5I2K A;  4F3B A;  2LAO A;  1I69 A;  2M8C A;  4I1D A;  4H5F A;  1A8F A;  5KDT A;  3OEL A;  2KLF A;  3FJM A;  3H6T A;  3EPE A;  2V3U A;  1VE4 A;  4F39 A;  5I84 A;  3QUJ A;  3DEL B;  2DOJ A;  4YMA A;  3MVY A;  4R6Y A;  2HAV A;  1JET A;  1PBP A;  3B7D A;  4TLL B;  1D3K A;  3QUF A;  3MAM A;  4X1B A;  2OWT A;  3TTR A;  3CFL A;  4KCD A;  3SDF A;  3KZG A;  3C32 A;  2Y84 A;  5I2K B;  5BWJ A;  1VSO A;  3O9P A;  3B6T A;  3OOA A;  5AA3 A;  3K1N A;  2HQ0 A;  2UYF A;  2NOO A;  3SER A;  3TEL A;  2O7I A;  1CE2 A;  1MXU A;  2NVU B;  1MQJ A;  3K1P A;  5KDT B;  3H6U A;  2ONS A;  1IXI A;  2UVI A;  3IB2 A;  1LFI A;  3CIJ A;  3OO9 A;  2I49 A;  1SW4 A;  2PYY A;  5EYF A;  1B0H A;  3PPN A;  3OXN A;  1PDA A;  4F19 A;  4P0G A;  1HSL A;  1MY0 A;  1SBP A;  4GL0 A;  4Q8R A;  3M3F A;  2DYX A;  4JWX A;  3RPW A;  1PEB A;  4LZ8 A;  3IOR A;  2XXT A;  4X1D A;  3OO6 A;  2XXU A;  2AYS A;  5ITP A;  4Q30 B;  2I6E A;  1XVY A;  3MQ9 A;  2UXA A;  4WKM A;  4JSD A;  2F35 A;  3IOW A;  4DE8 A;  4OYV A;  4ZS9 A;  1J1N A;  3RTF B;  3K2D A;  4L17 A;  4PFT A;  1JEV A;  1MG1 A;  1DOT A;  5CMB A;  4DZ1 A;  1Q35 A;  3LSW A;  5JEI A;  4ZEF A;  1B32 A;  4KCC A;  4F29 A;  1UTB A;  2H9B A;  1D4N A;  2Y7P A;  4YAH X;  5ICT A;  5F1Q A;  3E3K A;  4GWO A;  5AA2 A;  4ELR A;  3TTK A;  2O51 A;  1MS7 A;  1MH3 A;  4JSO A;  4GLI A;  1P1W A;  3ZSF A;  4DIG A;  4IO3 A;  1MXX A;  2HZK A;  2Y7I A;  1IEJ A;  4FJP A;  2W7Y A;  4IGT A;  4BDR A;  4R2B A;  1F9B A;  3CR9 A;  5LOM A;  2REJ A;  4U4X A;  4N6P A;  1SD3 A;  3PUZ E;  3VVF A;  4G8M A;  1KWH A;  4QFK A;  2O6A A;  2DVZ A;  1OLC A;  5H8S A;  4R9G A;  4QRZ A;  1R9L A;  1ZIU A;  3JYR A;  3IB1 A;  3G3F A;  3MWB A;  4KQP A;  1FCK A;  1UTB B;  2F6P A;  1QJM A;  4RK2 A;  4P11 A;  4H65 A;  2V93 A;  1N3X A;  2ZNS A;  2A5S A;  4E0W A;  4POW A;  5AA2 B;  4AB5 A;  2RC7 A;  2Y7K A;  1QUL A;  3Q27 A;  3MC2 A;  4ELO A;  3W9W A;  1B7Z A;  3THI A;  2VP1 A;  3VV5 A;  4MLV A;  3V83 A;  5L8D A;  2ABH A;  3SEV A;  1B52 A;  4R72 A;  3RQT A;  2GRV A;  3MVZ A;  3LBS A;  4PFU A;  4O3B A;  3R26 A;  1Z7M E;  4JWO A;  3OD7 A;  5CBR A;  3JV9 A;  2ZYK A;  4LZ5 A;  1P1N A;  1IZ1 A;  4KR5 A;  5L9S A;  3A3C A;  3EHS A;  3O6I A;  4RXL A;  1IXG A;  4RPN A;  1MY4 A;  5DVF A;  3FAS A;  3MP6 A;  2PT2 A;  3RLF E;  5I59 B;  1UQW A;  4ELP A;  4JWY A;  3VLW A;  4O3C A;  1RYO A;  1FQD A;  3V8X B;  1B3L A;  4AB6 A;  3E4R A;  3N6T A;  4IO2 A;  2PX1 A;  1A99 A;  3U94 A;  1FQE A;  3T9U A;  1LLS A;  3E9X A;  4FEB A;  4OTE A;  4G8H A;  5DEX A;  4RNS A;  1B51 A;  1Y3P A;  2I0C A;  3Q29 A;  3EHT A;  4XXU A;  3FVN A;  3G7W A;  2FA7 A;  3KN7 A;  1N76 A;  4ESX A;  1MPB A;  2Z22 A;  4H0W A;  4NMY A;  3RY3 A;  1LAH E;  3E13 X;  3K1M A;  2XXY A;  4LON B;  3IOT A;  3N6U A;  5IKB A;  4QSC A;  3U1O A;  1R9Q A;  4DCX A;  5JTY A;  5CC2 A;  1SI0 A;  3P7I A;  2RKM A;  5AA2 D;  3HCQ A;  3WAE A;  4OFJ A;  1O7T A;  5KCJ A;  3RT8 A;  3VFJ A;  3FJG A;  4U23 A;  2UVJ A;  3CVG A;  1LFG A;  3G3G A;  1NKX A;  4MFI A;  1GTK A;  2PT1 A;  4GRK A;  2DS9 A;  5FHN A;  5DEX B;  2P0S A;  2QMX A;  3TOD A;  4BLA A;  1PB9 A;  2XXR A;  4LP2 B;  1P1Q A;  4ZDM A;  5I56 A;  3FIR A;  3MZB A;  3UN6 A;  1Q1K A;  5AA4 A;  2BJJ X;  1MDQ A;  4UA8 A;  3HHF A;  3O29 A;  4OFL A;  1LCF A;  5CI5 A;  4F22 A;  4MH5 A;  1B40 A;  5DYH A;  5ISU A;  1YCJ A;  4ZE9 A;  2ZNT A;  2HFB A;  4MLQ A;  2QL3 A;  3RN8 A;  5KCJ B;  4GXS B;  2F5X A;  2E1S A;  2XHD A;  3VXC A;  1YTV A;  2XXX A;  3C36 A;  4UAC A;  2UVG A;  3FUZ A;  4KD5 A;  2DWJ A;  1RKM A;  1FQA A;  1MDP 1;  3FXR A;  1OQG A;  4F31 B;  3AXF A;  5K2X A;  1B2H A;  3RGY A;  3TCG A;  3EN3 A;  1TWY A;  3R7X A;  4F1V A;  5I56 B;  2QPQ A;  1PB7 A;  2HCA A;  5BUU A;  5AA4 B;  1US5 A;  4HTG A;  5FHO A;  4NWD A;  3C31 A;  1M5D A;  4RY1 A;  2ALU A;  3U93 A;  2F8D A;  4IGR A;  4YIC A;  2QS1 A;  1S7Y A;  3OEN A;  2ONK E;  3ILU B;  5CM6 A;  3HST A;  3FGS A;  4BDL A;  3GBB A;  4HCY A;  2Q8J A;  1B1H A;  4JDF A;  4G68 A;  1R6Z A;  4N07 A;  4ZZA A;  3QSL A;  4KYE A;  5EHS A;  3H3G A;  1N7W A;  1PC3 A;  5IAI A;  3U92 A;  3PUV E;  1H44 A;  5DTB A;  5H8F A;  3PUW E;  3L6H A;  4YB5 A;  1UTH A;  1QKA A;  4HCW A;  1IIT A;  2XXW A;  2A5T A;  4RA1 A;  1MY2 A;  5B70 A;  3O97 A;  1R1N A;  3MW0 A;  1B58 A;  4BDN A;  3PUX E;  4EUO A;  1N7X A;  3B6Q A;  3BFU A;  2H5Y A;  1MRP A;  1IXC A;  3KSJ A;  3TKD A;  1MM7 A;  4U2R A;  1SW5 A;  4EF1 A;  1OIB A;  1B05 A;  1DMB A;  1Y1M A;  3M3L A;  4THI A;  4OXV A;  4G68 B;  3K6X A;  3PPQ A;  1QUJ A;  2H25 A;  3OSR A;  2I58 A;  1JNF A;  4KPT A;  1MY1 A;  5H8F B;  2RF1 A;  2OLB A;  3S9L C;  4F1U A;  1UTH B;  1P1O A;  3PD9 A;  3UOR A;  4FAT A;  1HSJ A;  1MQD A;  4KYS A;  4FOR A;  2IA4 A;  3IOV A;  4RPO A;  4F3P A;  1JEU A;  3PUY E;  2Q88 A;  1XVX A;  3C9H A;  4GOT A;  3SEW A;  3HPI A;  3SES A;  2XXQ A;  1Y4T A;  4OMB A;  5CBS A;  1SYI A;  3V5A A;  3BFT A;  3TUS A;  1P99 A;  2HZL A;  3IL1 B;  2ZYO A;  3S2V A;  1OLA A;  3ECR A;  3SET A;  3S9M C;  2RCB A;  3TQW A;  1GVC A;  4EQ9 A;  1B1X A;  1ANF A;  2Z23 A;  1BP5 A;  3G3J A;  4WEP A;  3K6V A;  2FYI A;  3QYT A;  4KFQ A;  4XKQ A;  1TFD A;  3C4M A;  2I4B A;  2HAU A;  4G4P A;  1IIW A;  5TPA A;  4POX A;  3ZKK A;  3Q28 A;  2F34 A;  2QJE A;  2P1S A;  1SQY A;  4G8N A;  5DVI A;  2O7U A;  1BIY A;  3IO6 A;  2XD2 A;  5HBC A;  3K01 A;  3IJO B;  1ZBM A;  3KBR A;  2R6G E;  1URD A;  4OES A;  4U21 A;  1MXV A;  3H06 B;  1MY3 A;  3TTL A;  1MXW A;  4OZ9 A;  1B7U A;  5TP9 A;  2I3W A;  3CG3 A;  3KOS A;  2F7B A;  3CFX A;  2PVU A;  1B5I A;  2VOZ A;  3CSG A;  1B5H A;  3GZG A;  5TU0 A;  2FNC A;  3MP8 A;  3K4U A;  4DLD A;  2X7P A;  1M5E A;  3H6W A;  5TPA B;  4U4S A;  4G77 A;  3S4U A;  3MBP A;  1JW1 A;  2AL4 A;  4YMB A;  1QUK A;  1SW2 A;  1A8E A;  5A5X A;  4R75 A;  1DPE A;  3QIM A;  1URG A;  3KFM A;  4H6D A;  1PB8 A;  1TXF A;  4QFP A;  4TQU Q;  3VVE A;  2HEU A;  1AH5 A;  1FTO A;  4LQ2 A;  2OCU A;  4ZE8 A;  2QRY A;  2THI A;  1URS A;  3LSX A;  1FTM A;  4OET A;  4M4G A;  2DXY A;  2NWJ A;  4DXB A;  1SI1 A;  3IR1 A;  4TLM B;  4R6K A;  4EQB A;  4OQO A;  3KG2 A;  5J1D A;  1LB9 A;  5FTH A;  3UA8 A;  1A40 A;  3I3V A;  5CMK A;  3PPO A;  3GLB A;  4YKI A;  1Y9U A;  3VLV A;  2REG A;  3VE1 B;  1TFA A;  2UVH A;  1MXZ A;  1I6A A;  4JBZ A;  5A5X B;  4M1V A;  2D3I A;  3KJ7 A;  1Y4C A;  3KOT A;  4MBP A;  4XTC Q;  3HO7 A;  3OSQ A;  1JVY A;  4YZZ A;  1LFH A;  1B3F A;  4YU0 A;  4YKK A;  3D4G A;  4AQ4 A;  3PGF A;  4DDD A;  2G93 A;  1Z7N E;  3MPL A;  2GH9 A;  1MPD A;  1NNK A;  5I58 A;  4PP0 A;  3HN0 A;  4LAT A;  3BKI B;  1LST A;  1POT A;  1XT8 A;  2OK2 A;  4NF5 A;  2Z8D A;  4P0I A;  4RJZ A;  3D4C A;  2NXO A;  4GXA A;  1WDN A;  3S9N C;  2DE4 A;  2ESN A;  2Q89 A;  1FTL A;  4WED A;  5B7D A;  3PMW A;  4LA9 A;  4NWC A;  3LR1 A;  1JVX A;  4JB7 A;  3IB0 A;  3JZJ A;  4ZEC A;  3ODB A;  1H45 A;  3EQ1 A;  1FW0 A;  2O1L A;  2H98 A;  4OFO A;  1OMP A;  3MJN A;  1POY 1;  4ESW A;  2F78 A;  4XKN A;  5I58 B;  4WXJ A;  1B7H A;  4GFR A;  1Y3Q A;  4NF5 B;  2DXR A;  1YAE A;  3UGW A;  3RNN A;  2RIN A;  4DCY A;  1N84 A;  2I4C A;  3TZA A;  3H6V A;  4YB7 A;  1II5 A;  1EZ9 A;  3DM0 A;  2VD3 A;  3OEK A;  5JTY B;  2CZL A;  3FV2 A;  1AMF A;  1US4 A;  3GXA A;  3TCH A;  2G29 A;  3MZ1 A; 
#chains in the Genus database with same CATH topology
 2VGQ A;  2D5W A;  1YPN A;  4X04 A;  3PTY A;  3IAZ A;  4U1O A;  3KSX A;  3C34 A;  1QGX A;  5ESY A;  2QS2 A;  2DQV A;  3W9V A;  1FBG A;  2OWS A;  3QAX A;  4DXU A;  4YB6 A;  2RCA A;  5H8H A;  4KYD A;  4H1X A;  3A09 A;  3BIH A;  4OHN A;  1NV4 A;  1MQH A;  4OEU A;  3MZ9 A;  1MPC A;  2O69 A;  1IUD A;  1B3G A;  1NL5 A;  1NNF A;  3B8B A;  1B4Z A;  3T9V A;  2P2A A;  1IXH A;  3SEY A;  1JW4 A;  3N94 A;  2ZMB A;  3SEX A;  3CRB A;  1I6B A;  4FEC A;  4BDO A;  4DXC A;  1FJ9 A;  4PQJ A;  3S9E A;  1EYJ A;  1B3H A;  1A55 A;  4NF8 A;  2Q2C A;  4HE1 A;  1LAX A;  3USD A;  4EXK A;  2Z8E A;  3MUQ A;  1NUX A;  2PBW A;  1N0T A;  2GHA A;  2QS3 A;  1DCU A;  4G2Z A;  1A7L A;  1FPJ A;  1H76 A;  4FE8 A;  1O63 A;  3C33 A;  3DP4 A;  1QW0 A;  1LAF E;  2ZYM A;  3R6U A;  1FTK A;  3CI8 A;  5H8H B;  2YJP A;  1JQF A;  1VR5 A;  2F3D A;  4ONY A;  4P1E A;  4GQO A;  4OER A;  2B3B A;  3WAF A;  4JVC A;  2PFY A;  2YPN A;  5H8N A;  4QSD A;  4QF9 A;  1S9T A;  3MPK A;  4QHQ A;  1AL3 A;  4UAB A;  3TFL A;  2GFE A;  5ET5 A;  1Y20 A;  3SEU A;  3PMX A;  2PMS A;  1Y1Z A;  4GWU A;  1LBZ A;  3ROJ A;  5IZ3 A;  4ZED A;  2HXW A;  2XXI A;  4PFY A;  2UYE A;  4NF8 B;  3TAJ A;  4P8B A;  3PU5 A;  1ZMG A;  1XI6 A;  4XKP A;  2P3V A;  2ZZX A;  1TT1 A;  4OEV A;  4PET A;  3LUY A;  1P1U A;  1NH7 A;  2ZNU A;  1NV0 A;  2FVZ A;  3ILT B;  5HPQ A;  4IY5 A;  4I3E A;  2XX8 A;  4FIM A;  2I3V A;  1B3E A;  1SVX B;  1BKA A;  3M3K A;  3TPA A;  3I6V A;  3T0J A;  1B0L A;  1DSN A;  2WYP A;  2A5T B;  3QMF A;  1FPD A;  5H8N B;  4C1T A;  4P9K A;  3KN3 A;  3FJ7 A;  4PFW A;  3N5L A;  1USY H;  5AE4 A;  4Z0I A;  1MXY A;  4Q5T A;  2XD3 A;  3IOU A;  3PD8 A;  1A54 A;  1XOC A;  3KGC A;  1NNP A;  1FQF A;  3LSF B;  4R73 A;  3K6W A;  1FJ6 A;  3T96 B;  4C1U A;  4IO6 A;  2OJT A;  4ND9 A;  1LBB A;  2V84 A;  3TQL A;  4IR8 A;  1LBC A;  3M8U A;  5L9O A;  1NMU A;  1H3D A;  1UIV A;  3BBR A;  4ZEB A;  2DWA A;  1FSA A;  1D9V A;  3VVD A;  1JW5 A;  3FD3 A;  4LVQ A;  2AIX A;  4F3G A;  2HPG A;  3L6G A;  3FV1 A;  2H4I A;  1L5T A;  3O28 A;  1FPI A;  2OX3 A;  3H03 A;  1SDX A;  2VD2 A;  1MQI A;  4ZZE A;  2KQZ A;  1GGG A;  3KEI A;  1B46 A;  5I3S A;  4F18 A;  3FZV A;  2DE2 A;  1NH8 A;  3PV0 E;  1EYI A;  3O66 A;  1INP A;  2DE3 A;  4IO4 A;  2WBB A;  4GL8 A;  1HSE A;  1M5F A;  3MVW A;  1FTJ A;  2ZYN A;  3IX1 A;  1AOV A;  2PCR A;  1FBC A;  2F7C A;  1LB8 A;  2QMW A;  4JXI A;  5F24 A;  3OO8 A;  2R71 A;  4OA4 A;  3VDF A;  4ISU A;  2WKY A;  1ZTY A;  4P56 A;  1XHY A;  1GR2 A;  1SYH A;  1ZU0 A;  3G3K A;  5F7V A;  1GV8 A;  4H67 A;  3MP1 A;  1B5J A;  1RDY A;  1S50 A;  3V89 B;  2CZK A;  4O7M A;  4DI3 D;  1CB6 A;  3KN8 A;  4O3A A;  4I3Y A;  4F3S A;  3A3U A;  2VPN A;  2DDK A;  3RUM A;  2DVC A;  5ICQ A;  2Q9T A;  5CMC A;  4N91 A;  4GX3 A;  4EDP A;  2XXV A;  4LUB A;  5I2N A;  4NTL A;  4R9F A;  1FQC A;  3E79 A;  3QXM A;  4P47 A;  4R2F A;  3PPR A;  4E0X A;  4IO7 A;  5CRY A;  3UIF A;  4XFE A;  3CFZ A;  4XF5 A;  3PMV A;  3TYH A;  4Z7E A;  2FHY A;  5AA1 A;  4H5G A;  3ZKL A;  4PAK A;  1FBE A;  3GYY A;  3CSB A;  3TTN A;  1SW1 A;  1IME A;  3IK6 B;  2O84 X;  1IMC A;  1NV6 A;  2V3T A;  2Q8M A;  4X8R A;  2Y7R A;  3TDJ A;  4C0R A;  5KZT A;  5I59 A;  3F11 A;  3T9H B;  3T66 A;  1NFT A;  2ONR A;  4BDM A;  4NF4 A;  2DSF A;  5ITO A;  3VLU A;  1QKB A;  1XS5 A;  3IO4 A;  5TP9 B;  4GVO A;  4OVT A;  3TTM A;  1NI9 A;  4NHB A;  5LTC A;  3DLN A;  1EU8 A;  4LQ5 A;  1AIV A;  4ZEK A;  5HM4 B;  4ZEI A;  3UK4 A;  1PBQ A;  3GBA A;  3QK6 A;  1VFD A;  5I2N B;  4EQ7 A;  3U8Q A;  3C35 A;  2IEE A;  3FVG A;  3DP8 A;  4H8J A;  1NV3 A;  5JK4 A;  4X9T A;  1Y3N A;  4OWD A;  3K00 A;  3MYU A;  2F6G A;  3KC0 A;  3Q26 A;  4NED A;  2X26 A;  3RT6 B;  4LZ7 A;  1FQB A;  1M5B A;  4EF2 A;  3O2A A;  1D9Y A;  5H8Q A;  1XC1 A;  4P1L A;  3TCF A;  1M5C A;  2RC8 A;  3MVX A;  1MM6 A;  4KHZ E;  4NF6 A;  4XIG Q;  3K0V A;  1RDX A;  2XX9 A;  2QVR A;  2XX7 A;  2O68 A;  4GBV A;  1NUW A;  2GQ1 A;  4HE2 A;  4NF4 B;  3K6U A;  1USY E;  1WVJ A;  3G3H A;  4MCO A;  1T0K A;  1ZJL A;  1B6H A;  2OBG A;  1B4H A;  1K9Z A;  1BLF A;  1DK4 A;  5LDZ A;  4HS7 A;  4K3F A;  4QSE A;  4KI0 E;  1DTG A;  2ZXT A;  2DP8 A;  3FXQ A;  4QFO A;  2V3Q A;  2ZZV A;  4OVJ A;  3SKP A;  1ATG A;  3CG1 A;  4GF8 A;  4U22 A;  5CMM A;  4IY6 A;  1NNT A;  4EXL A;  4FAJ A;  3HHG A;  4MF3 A;  4F2Q A;  3T93 B;  5DT6 A;  3KC1 A;  2XXH A;  4I9D A;  1LGB C;  3T9X B;  2D21 A;  1O64 A;  2B3F A;  4QFL A;  1G0I A;  3N26 A;  3LSL A;  3EHU A;  2ANJ A;  2I48 A;  1FBH A;  1I6Q A;  5H8Q B;  3G3I A;  1LBV A;  2H99 A;  1FRP A;  3OO7 A;  1EZP A;  3K02 A;  1IQ7 A;  4NF6 B;  5A5L A;  4IO5 A;  3DP6 A;  4TOZ A;  3EF7 A;  3FVO A;  2NUV A;  1N04 A;  4GD5 A;  3H4Z A;  3OEM A;  1RYX A;  4RYA A;  3UP9 A;  2DWI A;  3TMG A;  3I5O A;  3OMB A;  4U1Z A;  4P3L A;  1DPP A;  2GHB A;  4I8C A;  2V25 A;  3LC8 A;  4NE4 A;  3PPP A;  1H43 A;  1OVT A;  3ONM A;  1DTZ A;  3B6W A;  4ECF A;  1LAG E;  2CMO A;  4R74 A;  3TEP A;  4G68 C;  1ELJ A;  2YLN A;  3ZS6 A;  2QS4 A;  4XKR A;  1EZO A;  4BDQ A;  4PBQ A;  4X48 A;  5I57 A;  2Q2A A;  1DBZ A;  1LCT A;  2I0B A;  3H7M A;  4IB2 A;  2DWH A;  3EKI A;  4XEQ A;  4GIZ A;  4YKP A;  4YKJ A;  2F7A A;  3Q25 A;  3FXU A;  5ELV A;  4OEN A;  1VFE A;  1AWB A;  1B9J A;  2E0S A;  4RK9 A;  4N13 A;  2R9J A;  4Q0C A;  4QFN A;  3FVK A;  5L9M A;  4FED A;  2RC9 A;  3IJX B;  5EHM A;  4R6H A;  3T22 A;  2Z8F A;  4F2O A;  5EYH A;  1EH3 A;  1MQG A;  1QUI A;  1BTJ A;  1N3W A;  1NV1 A;  4PE5 B;  4HE0 A;  2B65 A;  3FAT A;  2Y7W A;  1SPI A;  2OZZ A;  5DVJ A;  4O94 A;  5FTI A;  1ZKB A;  1WOD A;  5M2V A;  2F97 A;  1ZLQ A;  4I62 A;  2AL5 A;  2O1M A;  4MHF A;  5K2Y A;  3W15 C;  3O6H A;  3RTW B;  2XXP A;  3VXB A;  2F36 A;  3O6G A;  3U72 A;  2QSX A;  4F1Y A;  1QVS A;  3HV1 A;  4PFR A;  5I57 B;  1OVB A;  2X7Q A;  4HW8 A;  4H8I A;  4ELQ A;  2F3B A;  1OQH A;  1FPK A;  3KJT A;  5FHM A;  1MH4 A;  1UIU A;  2VHA A;  5I2K A;  4O8M A;  1LBX A;  3E78 A;  2B4L A;  4JVD A;  4F3B A;  2LAO A;  1K9Y A;  1I69 A;  2M8C A;  4I1D A;  4H5F A;  1FPF A;  1A8F A;  5KDT A;  3OEL A;  2KLF A;  3FJM A;  3H6T A;  3EPE A;  2V3U A;  1VE4 A;  4F39 A;  5I84 A;  3QUJ A;  3DEL B;  2DOJ A;  4YMA A;  3MVY A;  4R6Y A;  2HAV A;  1JET A;  1PBP A;  3A29 A;  3B7D A;  4TLL B;  1D3K A;  3QUF A;  3MAM A;  4X1B A;  2OWT A;  3TTR A;  3CFL A;  4KCD A;  3SDF A;  3KZG A;  3C32 A;  2Y84 A;  5I2K B;  5BWJ A;  1VSO A;  3IFC A;  3O9P A;  3B6T A;  3OOA A;  5AA3 A;  3K1N A;  2HQ0 A;  2UYF A;  1FPL A;  2NOO A;  3SER A;  3TEL A;  4GWX A;  2O7I A;  1CE2 A;  1MXU A;  2NVU B;  1IMB A;  1IMD A;  2XWV A;  1MQJ A;  3K1P A;  5KDT B;  4NN3 A;  3H6U A;  2ONS A;  1IXI A;  2UVI A;  3IB2 A;  1LFI A;  4H45 A;  4N81 A;  3CIJ A;  3MST A;  4O7I A;  3OO9 A;  4H46 A;  2I49 A;  1SW4 A;  2PYY A;  5EYF A;  1B0H A;  3PPN A;  3OXN A;  1PDA A;  4F19 A;  4P0G A;  1HSL A;  1MY0 A;  1SBP A;  4GL0 A;  5IZ3 B;  4Q8R A;  3M3F A;  2DYX A;  4JWX A;  3RPW A;  3FXB A;  1PEB A;  1FBD A;  4LZ8 A;  3IOR A;  2XXT A;  4X1D A;  3OO6 A;  4PF8 A;  2XXU A;  2AYS A;  3U65 A;  5ITP A;  4NF0 A;  3NOH A;  4Q30 B;  2I6E A;  2WYK A;  1XVY A;  3MQ9 A;  2UXA A;  4WKM A;  4JSD A;  2F35 A;  3IOW A;  4OVQ A;  4DE8 A;  4OYV A;  4ZS9 A;  1J1N A;  3RTF B;  3K2D A;  1KZ8 A;  2HXR A;  4L17 A;  3B50 A;  4PFT A;  1JEV A;  1MG1 A;  1DOT A;  1IMF A;  5CMB A;  4DZ1 A;  1Q35 A;  3LSW A;  5JEI A;  4ZEF A;  1B32 A;  4KCC A;  4F29 A;  1UTB A;  2H9B A;  5I7I A;  2CEY A;  1D4N A;  2Y7P A;  1FPG A;  4YAH X;  5ICT A;  5F1Q A;  3E3K A;  4GWO A;  5AA2 A;  4ELR A;  4N6D A;  3TTK A;  2O51 A;  1MS7 A;  1MH3 A;  4JSO A;  3HFU A;  4GLI A;  1JP4 A;  4GBW A;  1P1W A;  3ZSF A;  4DIG A;  4IO3 A;  1MXX A;  2HZK A;  2Y7I A;  1IEJ A;  4FJP A;  2W7Y A;  4IGT A;  4BDR A;  4R2B A;  1F9B A;  3CR9 A;  5LOM A;  2REJ A;  4U4X A;  4N6P A;  1SD3 A;  3PUZ E;  3VVF A;  4G8M A;  2XWI A;  1KWH A;  4QFK A;  4QXD A;  2O6A A;  2DVZ A;  1OLC A;  5H8S A;  4R9G A;  4QRZ A;  1R9L A;  1KA0 A;  1ZIU A;  3JYR A;  3IB1 A;  3G3F A;  3MWB A;  4KQP A;  1FCK A;  1UTB B;  2F6P A;  1QJM A;  4RK2 A;  4P11 A;  4H65 A;  2V93 A;  1N3X A;  2ZNS A;  2A5S A;  1YXI A;  4E0W A;  4PDD A;  4POW A;  5AA2 B;  4AB5 A;  1FBF A;  4N6K A;  2RC7 A;  2Y7K A;  1QUL A;  1G0H A;  2QFL A;  3Q27 A;  3MC2 A;  4ELO A;  3W9W A;  1B7Z A;  1D9Q A;  3THI A;  2VP1 A;  3VV5 A;  4MLV A;  3V83 A;  5L8D A;  1FTA A;  2ABH A;  3SEV A;  1B52 A;  4R72 A;  2KR0 A;  3RQT A;  2GRV A;  3MVZ A;  3LBS A;  4PFU A;  4O3B A;  2Y5L A;  2B4M A;  2P3N A;  3R26 A;  4PGN A;  1Z7M E;  4JWO A;  3OD7 A;  5CBR A;  3JV9 A;  2ZYK A;  4GX6 A;  4LZ5 A;  1P1N A;  1IZ1 A;  4KR5 A;  5L9S A;  3A3C A;  3EHS A;  3O6I A;  4PFB A;  4RXL A;  1IXG A;  4RPN A;  1MY4 A;  5DVF A;  3FAS A;  4N8Y A;  3MP6 A;  2PT2 A;  3RLF E;  5I59 B;  1UQW A;  4ELP A;  4JWY A;  3VLW A;  4O3C A;  1RYO A;  1FQD A;  1YZ0 A;  3V8X B;  1B3L A;  4AB6 A;  3E4R A;  3N6T A;  4IO2 A;  2PX1 A;  1A99 A;  3U94 A;  1FQE A;  3T9U A;  5T3J A;  1LLS A;  3E9X A;  4FEB A;  4OTE A;  4G8H A;  5DEX A;  4RNS A;  1B51 A;  1Y3P A;  2I0C A;  4N4U A;  3Q29 A;  3EHT A;  4XXU A;  3FVN A;  3G7W A;  2FA7 A;  3KN7 A;  1N76 A;  3IFA A;  1NV5 A;  4ESX A;  1MPB A;  2Z22 A;  4H0W A;  4NMY A;  3RY3 A;  1LAH E;  3E13 X;  4PFI A;  3K1M A;  2XXY A;  4LON B;  1YYZ A;  3IOT A;  2JJK A;  3N6U A;  5IKB A;  4QSC A;  3U1O A;  1R9Q A;  4DCX A;  5JTY A;  4MJO A;  5CC2 A;  1SI0 A;  4MNC A;  3P7I A;  2RKM A;  5AA2 D;  3HCQ A;  3WAE A;  4OFJ A;  1O7T A;  5KCJ A;  3RT8 A;  3VFJ A;  3FBP A;  3FJG A;  2XWK A;  4U23 A;  2UVJ A;  4PE3 A;  3CVG A;  1LFG A;  3G3G A;  1NKX A;  2PFZ A;  4MFI A;  4N15 A;  1GTK A;  2PT1 A;  4GRK A;  2DS9 A;  5FHN A;  5DEX B;  2P0S A;  2QMX A;  3TOD A;  4BLA A;  1PB9 A;  2XXR A;  4LP2 B;  1P1Q A;  4ZDM A;  5I56 A;  3FIR A;  3MZB A;  3UN6 A;  5IGA A;  1Q1K A;  5AA4 A;  2BJJ X;  1MDQ A;  4UA8 A;  3HHF A;  3O29 A;  4OAN A;  1RDZ A;  4OFL A;  1LCF A;  5CI5 A;  4F22 A;  3BIG A;  4MH5 A;  4QBA A;  1B40 A;  5DYH A;  5ISU A;  4MNP A;  1YCJ A;  4ZE9 A;  2ZNT A;  4I40 A;  2HFB A;  4MLQ A;  2QL3 A;  3RN8 A;  5KCJ B;  4GXS B;  2F5X A;  2E1S A;  2XHD A;  4OVS A;  3VXC A;  1YTV A;  2XXX A;  3C36 A;  4UAC A;  1NUY A;  2UVG A;  3FUZ A;  5IM2 A;  4KD5 A;  2DWJ A;  1RKM A;  1FQA A;  1MDP 1;  3FXR A;  1OQG A;  4F31 B;  3AXF A;  5K2X A;  1B2H A;  3RGY A;  3SZP A;  3TCG A;  3EN3 A;  1TWY A;  3R7X A;  4F1V A;  5I56 B;  2QPQ A;  1PB7 A;  2HCA A;  5BUU A;  5AA4 B;  1US5 A;  4HTG A;  5FHO A;  2Y5K A;  4NWD A;  3C31 A;  1M5D A;  1LEV A;  4RY1 A;  2ALU A;  3U93 A;  2MKZ A;  2F8D A;  4IGR A;  4YIC A;  2QS1 A;  2XA5 A;  1S7Y A;  3OEN A;  2ONK E;  3ILU B;  5CM6 A;  3HST A;  3FGS A;  4BDL A;  3GBB A;  4HCY A;  2Q8J A;  1B1H A;  4JDF A;  4G68 A;  1R6Z A;  4N07 A;  4ZZA A;  3QSL A;  4N8G A;  4KYE A;  5EHS A;  3H3G A;  1N7W A;  1PC3 A;  5IAI A;  4AS4 A;  3U92 A;  3PUV E;  1H44 A;  5DTB A;  3LV0 A;  3PUW E;  5H8F A;  3L6H A;  4YB5 A;  1UTH A;  1QKA A;  4PDH A;  4HCW A;  4PC9 A;  1IIT A;  2XXW A;  2A5T A;  1NV7 A;  4RA1 A;  1MY2 A;  5B70 A;  3O97 A;  1R1N A;  1IMA A;  3MW0 A;  4DI4 B;  1B58 A;  4BDN A;  3PUX E;  4N17 A;  4EUO A;  1N7X A;  3B6Q A;  3BFU A;  2H5Y A;  1MRP A;  2WX9 A;  1IXC A;  3KSJ A;  3TKD A;  1MM7 A;  4U2R A;  2WBD A;  1SW5 A;  1FBP A;  4EF1 A;  1OIB A;  1B05 A;  1CNQ A;  1DMB A;  1Y1M A;  2XWO A;  3M3L A;  4THI A;  4OXV A;  5I5P A;  2CZI A;  2VT5 A;  4G68 B;  3K6X A;  3PPQ A;  1QUJ A;  2H25 A;  3OSR A;  2I58 A;  1JNF A;  4KPT A;  1MY1 A;  4PAI A;  4GX4 A;  5H8F B;  2RF1 A;  2OLB A;  4NAP A;  4JVI A;  3S9L C;  4F1U A;  1UTH B;  1P1O A;  3PD9 A;  3UOR A;  4FAT A;  1HSJ A;  5EQA A;  1MQD A;  4PCD A;  4KYS A;  4MAG A;  4FOR A;  2IA4 A;  2BJI A;  3IOV A;  4GWY A;  4RPO A;  4F3P A;  1JEU A;  3PUY E;  2Q88 A;  1XVX A;  4NGU A;  5IZZ A;  3C9H A;  4NX1 A;  4GOT A;  3SEW A;  3HPI A;  3SES A;  2XXQ A;  1Y4T A;  4OMB A;  5CBS A;  1SYI A;  3V5A A;  1Q9D A;  3BFT A;  3TUS A;  1P99 A;  2HZL A;  1LBY A;  3IL1 B;  2ZYO A;  3S2V A;  1OLA A;  3ECR A;  3SET A;  3S9M C;  2RCB A;  3TQW A;  1GVC A;  4MEV A;  4EQ9 A;  1B1X A;  3RYD A;  2FIX A;  5EYG A;  1ANF A;  2Z23 A;  1BP5 A;  3G3J A;  4WEP A;  2R8T A;  2WEF A;  3K6V A;  2FYI A;  3QYT A;  5ET7 A;  4KFQ A;  4XKQ A;  1TFD A;  4GWW A;  3C4M A;  2I4B A;  2HAU A;  4G4P A;  1IIW A;  5TPA A;  4POX A;  3ZKK A;  3Q28 A;  2F34 A;  2QJE A;  2P1S A;  1SQY A;  5IZ1 A;  4G8N A;  5DVI A;  2O7U A;  1BIY A;  3IO6 A;  2XD2 A;  4KXP A;  5HBC A;  3K01 A;  3IJO B;  1ZBM A;  3KBR A;  2R6G E;  1LBW A;  5EQ9 A;  2VPO A;  2L5V A;  1URD A;  4OES A;  4U21 A;  1MXV A;  3H06 B;  1MY3 A;  3TTL A;  1MXW A;  4OZ9 A;  1B7U A;  5TP9 A;  4MIJ A;  2I3W A;  3ISP A;  3CG3 A;  3KOS A;  2F7B A;  3CFX A;  2PVU A;  5FBP A;  4MX6 A;  2XXK A;  1B5I A;  2VOZ A;  3CSG A;  1B5H A;  3GZG A;  5TU0 A;  2FNC A;  3MP8 A;  3K4U A;  4DLD A;  2X7P A;  1M5E A;  3H6W A;  5TPA B;  4U4S A;  4G77 A;  3S4U A;  3MBP A;  1JW1 A;  2AL4 A;  3T1B A;  4YMB A;  1QUK A;  1SW2 A;  1A8E A;  5A5X A;  4R75 A;  1DPE A;  3QIM A;  1BK4 A;  1URG A;  3KFM A;  4H6D A;  1PB8 A;  1TXF A;  4QFP A;  4TQU Q;  3VVE A;  1NV2 A;  5ET6 A;  4PGP A;  2HEU A;  1AH5 A;  1FTO A;  4LQ2 A;  1VDW A;  2OCU A;  4GWS A;  4ZE8 A;  2QRY A;  2THI A;  1URS A;  3LSX A;  1FTM A;  4OET A;  4LN5 A;  4M4G A;  2DXY A;  2NWJ A;  4DXB A;  1SI1 A;  3IR1 A;  4TLM B;  4R6K A;  2QVU A;  4EQB A;  4OQO A;  3KG2 A;  5J1D A;  1LB9 A;  5FTH A;  3UA8 A;  1A40 A;  3I3V A;  5CMK A;  3PPO A;  3GLB A;  4YKI A;  1Y9U A;  3VLV A;  2REG A;  3VE1 B;  1TFA A;  2UVH A;  1MXZ A;  1I6A A;  4JBZ A;  4FBP A;  5A5X B;  2QVV A;  4M1V A;  2D3I A;  3KJ7 A;  3RPL A;  1Y4C A;  4G61 A;  4NG7 A;  3KOT A;  4MBP A;  4XTC Q;  3HO7 A;  3OSQ A;  1JVY A;  4YZZ A;  1LFH A;  1B3F A;  4YU0 A;  4YKK A;  2V4C A;  3D4G A;  4AQ4 A;  4MNI A;  4PTK A;  3PGF A;  4DDD A;  2G93 A;  1Z7N E;  3MPL A;  2GH9 A;  1MPD A;  1NNK A;  5I58 A;  4PP0 A;  3HN0 A;  4LAT A;  3BKI B;  1LST A;  1POT A;  1XT8 A;  2OK2 A;  4NF5 A;  2Z8D A;  4P0I A;  4RJZ A;  2FBP A;  4OVR A;  3D4C A;  2NXO A;  4GXA A;  1WDN A;  4PBH A;  2DE4 A;  2ESN A;  3S9N C;  2Q89 A;  4HXV A;  1FTL A;  4WED A;  5B7D A;  4OVP A;  3PMW A;  4LA9 A;  3CHG A;  2CZH A;  4NWC A;  3LR1 A;  4GWZ A;  2OWZ A;  4PF6 A;  1JVX A;  2CEX A;  4JB7 A;  3RPL B;  3LUZ A;  3IB0 A;  3JZJ A;  3KBZ A;  5DW8 A;  4ZEC A;  3ODB A;  1H45 A;  3EQ1 A;  1FW0 A;  2O1L A;  4MMP A;  1FPB A;  5J16 A;  2H98 A;  4OFO A;  1OMP A;  2Q74 A;  3MJN A;  1POY 1;  4ESW A;  1KA1 A;  2F78 A;  4XKN A;  4AS5 A;  5I58 B;  1EYK A;  4WXJ A;  5ET8 A;  1FPE A;  1B7H A;  4GFR A;  1Y3Q A;  4NF5 B;  2DXR A;  1YAE A;  2FIE A;  3UGW A;  4NQ8 A;  3RNN A;  2RIN A;  4DCY A;  5EQ7 A;  1N84 A;  2I4C A;  3TZA A;  3H6V A;  4YB7 A;  1II5 A;  1EZ9 A;  3DM0 A;  2VD3 A;  3OEK A;  3D1R A;  5JTY B;  2CZL A;  3FV2 A;  2ZZW A;  1AMF A;  2HHM A;  1US4 A;  3GXA A;  3TCH A;  1NUZ A;  2G29 A;  4PAF A;  5EQ8 A;  3MZ1 A; 
#chains in the Genus database with same CATH homology
 2VGQ A;  2D5W A;  1YPN A;  3IAZ A;  4U1O A;  3KSX A;  3C34 A;  2QS2 A;  2DQV A;  3W9V A;  2OWS A;  3QAX A;  4DXU A;  4YB6 A;  2RCA A;  5H8H A;  4KYD A;  4H1X A;  3A09 A;  4OHN A;  1MQH A;  4OEU A;  3MZ9 A;  1MPC A;  2O69 A;  1IUD A;  1B3G A;  1NL5 A;  1NNF A;  1B4Z A;  3T9V A;  2P2A A;  1IXH A;  3SEY A;  1JW4 A;  3N94 A;  2ZMB A;  3SEX A;  3CRB A;  1I6B A;  4FEC A;  4BDO A;  4DXC A;  4PQJ A;  3S9E A;  1B3H A;  1A55 A;  4NF8 A;  2Q2C A;  1LAX A;  3USD A;  4EXK A;  2Z8E A;  3MUQ A;  2PBW A;  1N0T A;  2GHA A;  2QS3 A;  4G2Z A;  1A7L A;  1H76 A;  4FE8 A;  1O63 A;  3C33 A;  3DP4 A;  1QW0 A;  1LAF E;  2ZYM A;  3R6U A;  1FTK A;  3CI8 A;  5H8H B;  2YJP A;  1JQF A;  1VR5 A;  4ONY A;  4GQO A;  4OER A;  2B3B A;  3WAF A;  2YPN A;  5H8N A;  4QSD A;  4QF9 A;  1S9T A;  3MPK A;  4QHQ A;  1AL3 A;  3TFL A;  2GFE A;  1Y20 A;  3SEU A;  3PMX A;  2PMS A;  1Y1Z A;  4ZED A;  2HXW A;  2XXI A;  4PFY A;  2UYE A;  4NF8 B;  3TAJ A;  3PU5 A;  1ZMG A;  4XKP A;  1TT1 A;  4OEV A;  4PET A;  3LUY A;  1P1U A;  1NH7 A;  2ZNU A;  3ILT B;  5HPQ A;  4IY5 A;  2XX8 A;  4FIM A;  2I3V A;  1B3E A;  1SVX B;  1BKA A;  3M3K A;  3TPA A;  3I6V A;  1B0L A;  1DSN A;  2A5T B;  5H8N B;  4C1T A;  3KN3 A;  3FJ7 A;  4PFW A;  3N5L A;  1USY H;  5AE4 A;  4Z0I A;  1MXY A;  4Q5T A;  2XD3 A;  3IOU A;  3PD8 A;  1A54 A;  1XOC A;  3KGC A;  1NNP A;  1FQF A;  3LSF B;  4R73 A;  3K6W A;  3T96 B;  4C1U A;  4IO6 A;  2OJT A;  4ND9 A;  1LBB A;  2V84 A;  3TQL A;  1LBC A;  3M8U A;  5L9O A;  1NMU A;  1H3D A;  1UIV A;  3BBR A;  4ZEB A;  2DWA A;  1D9V A;  3VVD A;  1JW5 A;  3FD3 A;  4LVQ A;  2AIX A;  4F3G A;  3L6G A;  3FV1 A;  2H4I A;  1L5T A;  3O28 A;  3H03 A;  1SDX A;  2VD2 A;  1MQI A;  4ZZE A;  1GGG A;  3KEI A;  1B46 A;  4F18 A;  3FZV A;  2DE2 A;  1NH8 A;  3PV0 E;  3O66 A;  2DE3 A;  4IO4 A;  4GL8 A;  1HSE A;  1M5F A;  3MVW A;  1FTJ A;  2ZYN A;  3IX1 A;  1AOV A;  2F7C A;  1LB8 A;  2QMW A;  4JXI A;  3OO8 A;  2R71 A;  3VDF A;  4ISU A;  2WKY A;  1ZTY A;  1XHY A;  1GR2 A;  1SYH A;  1ZU0 A;  3G3K A;  5F7V A;  1GV8 A;  4H67 A;  3MP1 A;  1B5J A;  1S50 A;  3V89 B;  1CB6 A;  3KN8 A;  4O3A A;  4F3S A;  3A3U A;  3RUM A;  2DVC A;  5ICQ A;  2Q9T A;  5CMC A;  4EDP A;  2XXV A;  4LUB A;  5I2N A;  4NTL A;  4R9F A;  1FQC A;  3QXM A;  4R2F A;  3PPR A;  4E0X A;  4IO7 A;  5CRY A;  3UIF A;  3CFZ A;  3PMV A;  3TYH A;  4Z7E A;  5AA1 A;  4H5G A;  3ZKL A;  3CSB A;  3TTN A;  1SW1 A;  3IK6 B;  2O84 X;  2V3T A;  2Y7R A;  3TDJ A;  4C0R A;  5KZT A;  5I59 A;  3F11 A;  3T9H B;  3T66 A;  1NFT A;  2ONR A;  4BDM A;  4NF4 A;  2DSF A;  5ITO A;  3VLU A;  1QKB A;  1XS5 A;  3IO4 A;  5TP9 B;  4GVO A;  3TTM A;  3DLN A;  1EU8 A;  4LQ5 A;  1AIV A;  4ZEK A;  5HM4 B;  4ZEI A;  3UK4 A;  1PBQ A;  3GBA A;  3QK6 A;  1VFD A;  5I2N B;  4EQ7 A;  3U8Q A;  3C35 A;  2IEE A;  3FVG A;  3DP8 A;  4H8J A;  5JK4 A;  4X9T A;  1Y3N A;  4OWD A;  3K00 A;  2F6G A;  3Q26 A;  4NED A;  2X26 A;  3RT6 B;  4LZ7 A;  1FQB A;  1M5B A;  4EF2 A;  3O2A A;  1D9Y A;  5H8Q A;  1XC1 A;  3TCF A;  1M5C A;  2RC8 A;  3MVX A;  1MM6 A;  4KHZ E;  4NF6 A;  4XIG Q;  3K0V A;  2XX7 A;  2XX9 A;  2O68 A;  4NF4 B;  3K6U A;  1USY E;  1WVJ A;  3G3H A;  1T0K A;  1ZJL A;  1B6H A;  2OBG A;  1B4H A;  1BLF A;  4HS7 A;  4K3F A;  4QSE A;  4KI0 E;  1DTG A;  2ZXT A;  2DP8 A;  3FXQ A;  4QFO A;  2V3Q A;  4OVJ A;  3SKP A;  1ATG A;  3CG1 A;  4GF8 A;  4U22 A;  5CMM A;  4IY6 A;  1NNT A;  4EXL A;  4FAJ A;  3HHG A;  4MF3 A;  4F2Q A;  3T93 B;  5DT6 A;  2XXH A;  4I9D A;  1LGB C;  3T9X B;  2D21 A;  1O64 A;  2B3F A;  4QFL A;  3N26 A;  3LSL A;  3EHU A;  2ANJ A;  2I48 A;  1I6Q A;  5H8Q B;  3G3I A;  2H99 A;  3OO7 A;  1EZP A;  3K02 A;  1IQ7 A;  4NF6 B;  4IO5 A;  3DP6 A;  4TOZ A;  3EF7 A;  3FVO A;  2NUV A;  1N04 A;  4GD5 A;  3H4Z A;  3OEM A;  1RYX A;  4RYA A;  3UP9 A;  2DWI A;  3TMG A;  3I5O A;  3OMB A;  4U1Z A;  1DPP A;  2GHB A;  4I8C A;  2V25 A;  3LC8 A;  4NE4 A;  3PPP A;  1H43 A;  1OVT A;  3ONM A;  1DTZ A;  3B6W A;  4ECF A;  1LAG E;  2CMO A;  4R74 A;  3TEP A;  4G68 C;  1ELJ A;  2YLN A;  3ZS6 A;  2QS4 A;  4XKR A;  1EZO A;  4BDQ A;  4X48 A;  5I57 A;  2Q2A A;  1LCT A;  2I0B A;  3H7M A;  4IB2 A;  2DWH A;  4GIZ A;  4YKP A;  4YKJ A;  2F7A A;  3Q25 A;  3FXU A;  5ELV A;  4OEN A;  1VFE A;  1B9J A;  2E0S A;  4RK9 A;  4N13 A;  2R9J A;  4Q0C A;  4QFN A;  3FVK A;  5L9M A;  4FED A;  2RC9 A;  3IJX B;  5EHM A;  4R6H A;  3T22 A;  2Z8F A;  4F2O A;  1EH3 A;  1MQG A;  1QUI A;  1BTJ A;  1N3W A;  4PE5 B;  2B65 A;  3FAT A;  2Y7W A;  5FTI A;  2OZZ A;  5DVJ A;  1ZKB A;  1WOD A;  5M2V A;  2F97 A;  1ZLQ A;  4I62 A;  2AL5 A;  2O1M A;  5K2Y A;  3W15 C;  3O6H A;  3RTW B;  2XXP A;  3VXB A;  2F36 A;  3O6G A;  3U72 A;  2QSX A;  4F1Y A;  1QVS A;  3HV1 A;  5I57 B;  1OVB A;  2X7Q A;  4HW8 A;  4H8I A;  4ELQ A;  1OQH A;  3KJT A;  5FHM A;  1MH4 A;  1UIU A;  2VHA A;  5I2K A;  4F3B A;  2LAO A;  1I69 A;  2M8C A;  4I1D A;  4H5F A;  1A8F A;  5KDT A;  3OEL A;  2KLF A;  3FJM A;  3H6T A;  3EPE A;  2V3U A;  1VE4 A;  4F39 A;  5I84 A;  3QUJ A;  3DEL B;  2DOJ A;  4YMA A;  3MVY A;  4R6Y A;  2HAV A;  1JET A;  1PBP A;  3B7D A;  4TLL B;  1D3K A;  3QUF A;  3MAM A;  4X1B A;  2OWT A;  3TTR A;  3CFL A;  4KCD A;  3SDF A;  3KZG A;  3C32 A;  2Y84 A;  5I2K B;  5BWJ A;  1VSO A;  3O9P A;  3B6T A;  3OOA A;  5AA3 A;  3K1N A;  2HQ0 A;  2UYF A;  2NOO A;  3SER A;  3TEL A;  2O7I A;  1CE2 A;  1MXU A;  2NVU B;  1MQJ A;  3K1P A;  5KDT B;  3H6U A;  2ONS A;  1IXI A;  2UVI A;  3IB2 A;  1LFI A;  3CIJ A;  3OO9 A;  2I49 A;  1SW4 A;  2PYY A;  5EYF A;  1B0H A;  3PPN A;  3OXN A;  1PDA A;  4F19 A;  4P0G A;  1HSL A;  1MY0 A;  1SBP A;  4GL0 A;  4Q8R A;  3M3F A;  2DYX A;  4JWX A;  3RPW A;  1PEB A;  4LZ8 A;  3IOR A;  2XXT A;  4X1D A;  3OO6 A;  2XXU A;  2AYS A;  5ITP A;  4Q30 B;  2I6E A;  1XVY A;  3MQ9 A;  2UXA A;  4WKM A;  4JSD A;  2F35 A;  3IOW A;  4DE8 A;  4OYV A;  4ZS9 A;  1J1N A;  3RTF B;  3K2D A;  4L17 A;  4PFT A;  1JEV A;  1MG1 A;  1DOT A;  5CMB A;  4DZ1 A;  1Q35 A;  3LSW A;  5JEI A;  4ZEF A;  1B32 A;  4KCC A;  4F29 A;  1UTB A;  2H9B A;  1D4N A;  2Y7P A;  4YAH X;  5ICT A;  5F1Q A;  3E3K A;  4GWO A;  5AA2 A;  4ELR A;  3TTK A;  2O51 A;  1MS7 A;  1MH3 A;  4JSO A;  4GLI A;  1P1W A;  3ZSF A;  4DIG A;  4IO3 A;  1MXX A;  2HZK A;  2Y7I A;  1IEJ A;  4FJP A;  2W7Y A;  4IGT A;  4BDR A;  4R2B A;  1F9B A;  3CR9 A;  5LOM A;  2REJ A;  4U4X A;  4N6P A;  1SD3 A;  3PUZ E;  3VVF A;  4G8M A;  1KWH A;  4QFK A;  2O6A A;  2DVZ A;  1OLC A;  5H8S A;  4R9G A;  4QRZ A;  1R9L A;  1ZIU A;  3JYR A;  3IB1 A;  3G3F A;  3MWB A;  4KQP A;  1FCK A;  1UTB B;  2F6P A;  1QJM A;  4RK2 A;  4P11 A;  4H65 A;  2V93 A;  1N3X A;  2ZNS A;  2A5S A;  4E0W A;  4POW A;  5AA2 B;  4AB5 A;  2RC7 A;  2Y7K A;  1QUL A;  3Q27 A;  3MC2 A;  4ELO A;  3W9W A;  1B7Z A;  3THI A;  2VP1 A;  3VV5 A;  4MLV A;  3V83 A;  5L8D A;  2ABH A;  3SEV A;  1B52 A;  4R72 A;  3RQT A;  2GRV A;  3MVZ A;  3LBS A;  4PFU A;  4O3B A;  3R26 A;  1Z7M E;  4JWO A;  3OD7 A;  5CBR A;  3JV9 A;  2ZYK A;  4LZ5 A;  1P1N A;  1IZ1 A;  4KR5 A;  5L9S A;  3A3C A;  3EHS A;  3O6I A;  4RXL A;  1IXG A;  4RPN A;  1MY4 A;  5DVF A;  3FAS A;  3MP6 A;  2PT2 A;  3RLF E;  5I59 B;  1UQW A;  4ELP A;  4JWY A;  3VLW A;  4O3C A;  1RYO A;  1FQD A;  3V8X B;  1B3L A;  4AB6 A;  3E4R A;  3N6T A;  4IO2 A;  2PX1 A;  1A99 A;  3U94 A;  1FQE A;  3T9U A;  1LLS A;  3E9X A;  4FEB A;  4OTE A;  4G8H A;  5DEX A;  4RNS A;  1B51 A;  1Y3P A;  2I0C A;  3Q29 A;  3EHT A;  4XXU A;  3FVN A;  3G7W A;  2FA7 A;  3KN7 A;  1N76 A;  4ESX A;  1MPB A;  2Z22 A;  4H0W A;  4NMY A;  3RY3 A;  1LAH E;  3E13 X;  3K1M A;  2XXY A;  4LON B;  3IOT A;  3N6U A;  5IKB A;  4QSC A;  3U1O A;  1R9Q A;  4DCX A;  5JTY A;  5CC2 A;  1SI0 A;  3P7I A;  2RKM A;  5AA2 D;  3HCQ A;  3WAE A;  4OFJ A;  1O7T A;  5KCJ A;  3RT8 A;  3VFJ A;  3FJG A;  4U23 A;  2UVJ A;  3CVG A;  1LFG A;  3G3G A;  1NKX A;  4MFI A;  1GTK A;  2PT1 A;  4GRK A;  2DS9 A;  5FHN A;  5DEX B;  2P0S A;  2QMX A;  3TOD A;  4BLA A;  1PB9 A;  2XXR A;  4LP2 B;  1P1Q A;  4ZDM A;  5I56 A;  3FIR A;  3MZB A;  3UN6 A;  1Q1K A;  5AA4 A;  2BJJ X;  1MDQ A;  4UA8 A;  3HHF A;  3O29 A;  4OFL A;  1LCF A;  5CI5 A;  4F22 A;  4MH5 A;  1B40 A;  5DYH A;  5ISU A;  1YCJ A;  4ZE9 A;  2ZNT A;  2HFB A;  4MLQ A;  2QL3 A;  3RN8 A;  5KCJ B;  4GXS B;  2F5X A;  2E1S A;  2XHD A;  3VXC A;  1YTV A;  2XXX A;  3C36 A;  4UAC A;  2UVG A;  3FUZ A;  4KD5 A;  2DWJ A;  1RKM A;  1FQA A;  1MDP 1;  3FXR A;  1OQG A;  4F31 B;  3AXF A;  5K2X A;  1B2H A;  3RGY A;  3TCG A;  3EN3 A;  1TWY A;  3R7X A;  4F1V A;  5I56 B;  2QPQ A;  1PB7 A;  2HCA A;  5BUU A;  5AA4 B;  1US5 A;  4HTG A;  5FHO A;  4NWD A;  3C31 A;  1M5D A;  4RY1 A;  2ALU A;  3U93 A;  2F8D A;  4IGR A;  4YIC A;  2QS1 A;  1S7Y A;  3OEN A;  2ONK E;  3ILU B;  5CM6 A;  3HST A;  3FGS A;  4BDL A;  3GBB A;  4HCY A;  2Q8J A;  1B1H A;  4JDF A;  4G68 A;  1R6Z A;  4N07 A;  4ZZA A;  3QSL A;  4KYE A;  5EHS A;  3H3G A;  1N7W A;  1PC3 A;  5IAI A;  3U92 A;  3PUV E;  1H44 A;  5DTB A;  5H8F A;  3PUW E;  3L6H A;  4YB5 A;  1UTH A;  1QKA A;  4HCW A;  1IIT A;  2XXW A;  2A5T A;  4RA1 A;  1MY2 A;  5B70 A;  3O97 A;  1R1N A;  3MW0 A;  1B58 A;  4BDN A;  3PUX E;  4EUO A;  1N7X A;  3B6Q A;  3BFU A;  2H5Y A;  1MRP A;  1IXC A;  3KSJ A;  3TKD A;  1MM7 A;  4U2R A;  1SW5 A;  4EF1 A;  1OIB A;  1B05 A;  1DMB A;  1Y1M A;  3M3L A;  4THI A;  4OXV A;  4G68 B;  3K6X A;  3PPQ A;  1QUJ A;  2H25 A;  3OSR A;  2I58 A;  1JNF A;  4KPT A;  1MY1 A;  5H8F B;  2RF1 A;  2OLB A;  3S9L C;  4F1U A;  1UTH B;  1P1O A;  3PD9 A;  3UOR A;  4FAT A;  1HSJ A;  1MQD A;  4KYS A;  4FOR A;  2IA4 A;  3IOV A;  4RPO A;  4F3P A;  1JEU A;  3PUY E;  2Q88 A;  1XVX A;  3C9H A;  4GOT A;  3SEW A;  3HPI A;  3SES A;  2XXQ A;  1Y4T A;  4OMB A;  5CBS A;  1SYI A;  3V5A A;  3BFT A;  3TUS A;  1P99 A;  2HZL A;  3IL1 B;  2ZYO A;  3S2V A;  1OLA A;  3ECR A;  3SET A;  3S9M C;  2RCB A;  3TQW A;  1GVC A;  4EQ9 A;  1B1X A;  1ANF A;  2Z23 A;  1BP5 A;  3G3J A;  4WEP A;  3K6V A;  2FYI A;  3QYT A;  4KFQ A;  4XKQ A;  1TFD A;  3C4M A;  2I4B A;  2HAU A;  4G4P A;  1IIW A;  5TPA A;  4POX A;  3ZKK A;  3Q28 A;  2F34 A;  2QJE A;  2P1S A;  1SQY A;  4G8N A;  5DVI A;  2O7U A;  1BIY A;  3IO6 A;  2XD2 A;  5HBC A;  3K01 A;  3IJO B;  1ZBM A;  3KBR A;  2R6G E;  1URD A;  4OES A;  4U21 A;  1MXV A;  3H06 B;  1MY3 A;  3TTL A;  1MXW A;  4OZ9 A;  1B7U A;  5TP9 A;  2I3W A;  3CG3 A;  3KOS A;  2F7B A;  3CFX A;  2PVU A;  1B5I A;  2VOZ A;  3CSG A;  1B5H A;  3GZG A;  5TU0 A;  2FNC A;  3MP8 A;  3K4U A;  4DLD A;  2X7P A;  1M5E A;  3H6W A;  5TPA B;  4U4S A;  4G77 A;  3S4U A;  3MBP A;  1JW1 A;  2AL4 A;  4YMB A;  1QUK A;  1SW2 A;  1A8E A;  5A5X A;  4R75 A;  1DPE A;  3QIM A;  1URG A;  3KFM A;  4H6D A;  1PB8 A;  1TXF A;  4QFP A;  4TQU Q;  3VVE A;  2HEU A;  1AH5 A;  1FTO A;  4LQ2 A;  2OCU A;  4ZE8 A;  2QRY A;  2THI A;  1URS A;  3LSX A;  1FTM A;  4OET A;  4M4G A;  2DXY A;  2NWJ A;  4DXB A;  1SI1 A;  3IR1 A;  4TLM B;  4R6K A;  4EQB A;  4OQO A;  3KG2 A;  5J1D A;  1LB9 A;  5FTH A;  3UA8 A;  1A40 A;  3I3V A;  5CMK A;  3PPO A;  3GLB A;  4YKI A;  1Y9U A;  3VLV A;  2REG A;  3VE1 B;  1TFA A;  2UVH A;  1MXZ A;  1I6A A;  4JBZ A;  5A5X B;  4M1V A;  2D3I A;  3KJ7 A;  1Y4C A;  3KOT A;  4MBP A;  4XTC Q;  3HO7 A;  3OSQ A;  1JVY A;  4YZZ A;  1LFH A;  1B3F A;  4YU0 A;  4YKK A;  3D4G A;  4AQ4 A;  3PGF A;  4DDD A;  2G93 A;  1Z7N E;  3MPL A;  2GH9 A;  1MPD A;  1NNK A;  5I58 A;  4PP0 A;  3HN0 A;  4LAT A;  3BKI B;  1LST A;  1POT A;  1XT8 A;  2OK2 A;  4NF5 A;  2Z8D A;  4P0I A;  4RJZ A;  3D4C A;  2NXO A;  4GXA A;  1WDN A;  3S9N C;  2DE4 A;  2ESN A;  2Q89 A;  1FTL A;  4WED A;  5B7D A;  3PMW A;  4LA9 A;  4NWC A;  3LR1 A;  1JVX A;  4JB7 A;  3IB0 A;  3JZJ A;  4ZEC A;  3ODB A;  1H45 A;  3EQ1 A;  1FW0 A;  2O1L A;  2H98 A;  4OFO A;  1OMP A;  3MJN A;  1POY 1;  4ESW A;  2F78 A;  4XKN A;  5I58 B;  4WXJ A;  1B7H A;  4GFR A;  1Y3Q A;  4NF5 B;  2DXR A;  1YAE A;  3UGW A;  3RNN A;  2RIN A;  4DCY A;  1N84 A;  2I4C A;  3TZA A;  3H6V A;  4YB7 A;  1II5 A;  1EZ9 A;  3DM0 A;  2VD3 A;  3OEK A;  5JTY B;  2CZL A;  3FV2 A;  1AMF A;  1US4 A;  3GXA A;  3TCH A;  2G29 A;  3MZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...