4YZZA

Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
336
structure length
336
Chain Sequence
NPTVRWRMSTSWPKSLDTIYGSADELCKRVGQLTDGKFEIRAFPGGELVPSAQNMDAVSNGTVECNHVLSTMYIGKNTALTFDTGLSFGLNARQHNAWIHYGGGLQQLRELYKKYNIVNHVCGNVGVQMGGWYRKEIKSTADLNGLNMRIGGIGGMVLSKLGVVPQQIPPGDIYPALEKGTIDAAEWIGPYDDEKLGFNKVAPYYYSPGWFEGSASITSMVNDKAWEALPPAYQAAFEAACGEQSMRMLANYDARNPLALRKLIAGGAKVSFFPKEVMDAVYKASQQLWTELSEKNPDFKAIYPGWKKFQEDEAGWFRVAENALDNYTFAAVARAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
publication title Crystal structure of a TRAP transporter solute binding protein (IPR025997) from Bordetella bronchiseptica RB50 (BB0280, TARGET EFI-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site
rcsb
source organism Bordetella bronchiseptica
molecule tags Transport protein
total genus 133
structure length 336
sequence length 336
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4yzzA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4yzzA01
3RGYA 2D5WA 4F1VA 4OMBA 1QVSA 3MWBA 4AQ4A 1QW0A 4RK9A 4NHBA 3MZ1A 4H5GA 3C9HA 3OOAA 1P1WA 1B1XA 3MVYA 4DI3D 3K00A 4ZDMA 5DVJA 4F2OA 4NF5B 1OLCA 3L6HA 3N5LA 3TEPA 4PGNA 3CR9A 4YKJA 1ZU0A 2A5SA 4OVPA 4EQ7A 1XVYA 1LLSA 1ZBMA 2UXAA 1MQIA 1LCTA 1MPDA 5AA2D 4GWOA 1P1QA 5KZTA 1SI0A 4P3LA 1PB7A 4OENA 2IA4A 5FTHA 3OO7A 3T22A 3TMGA 4LZ8A 1US5A 4MMPA 3MPKA 3FV1A 1POY1 2XWKA 2Z8FA 3Q29A 3KEIA 2OCUA 3FV2A 3PD8A 1TT1A 1QJMA 4YU0A 2Q89A 1Y4CA 1JNFA 3TDJA 3TTKA 2XWOA 4YMBA 3S9MC 2XX9A 2XXHA 4KYDA 3U65A 1Y3PA 5I7IA 3S2VA 3IORA 3CSBA 4F2QA 4IB2A 3I5OA 4F31B 2DXRA 4QHQA 1IUDA 5CMBA 4BDMA 2V84A 4U1OA 5I59A 4QFLA 1MPBA 4GVOA 1SQYA 2RC9A 5IZZA 1BTJA 1EU8A 1MQGA 5FHNA 2OZZA 1SW4A 4R9GA 2YJPA 4DE8A 2F8DA 4F1YA 1UTBA 1XC1A 4JBZA 3H6VA 5ELVA 3PD9A 3PUYE 1WVJA 3T93B 3K6UA 4ELRA 2Y7PA 5L8DA 2HPGA 1SBPA 2QMWA 1A8FA 5H8QB 4KR5A 3GYYA 1LAFE 3VLWA 4EXLA 1SI1A 3VXBA 1B52A 3G3JA 3RTWB 3A3CA 4RPOA 2V3TA 1D4NA 2WYPA 2OWTA 2ZNTA 3TKDA 5I59B 1SYIA 3HCQA 1RKMA 1BP5A 4X48A 3VXCA 4H65A 2HQ0A 2HZKA 3KN3A 4G68C 2DE4A 3GXAA 3GBBA 1DTGA 3BFUA 4G8HA 3N26A 3LBSA 4GF8A 5KCJA 1MM6A 3H03A 4QFOA 4NF6B 3LC8A 4ZEDA 2PT2A 4F18A 4PFRA 2XXRA 3D4CA 4F3SA 3M3KA 1Y3NA 4LQ5A 4ONYA 1N76A 2Z23A 2IEEA 4QFPA 2ZYOA 4OQOA 4MIJA 2XD3A 2F7AA 3RTFB 5DEXB 4PP0A 4TLLB 1EZPA 4C1TA 3OO8A 3FJMA 2Z8DA 1NKXA 2V4CA 3RUMA 1IQ7A 3R7XA 1Y1ZA 2XXWA 1PB9A 3RNNA 1UIUA 2Q88A 3H6TA 3S9LC 3JZJA 4P9KA 3K1PA 1B32A 4C1UA 4K3FA 4PBQA 3K2DA 1TWYA 4M4GA 4X1DA 4OFLA 3JYRA 5FHMA 4R6KA 4P47A 4ZEKA 1LAGE 2UVGA 4F3PA 3LSLA 4PFUA 4KI0E 5AA3A 2H9BA 5ITOA 2VOZA 3TCFA 1JETA 2M8CA 5KDTB 5CC2A 3GZGA 2UYFA 3EF7A 2AIXA 3MC2A 2XXKA 2QSXA 1WODA 4FJPA 4F19A 4N4UA 1P1OA 1VSOA 1MXUA 1EZ9A 3MP8A 4N8YA 2O51A 4FECA 4KCDA 5ICQA 2ZZXA 1A8EA 4ISUA 1JW1A 1M5FA 4G68B 3B7DA 5IGAA 3C4MA 3H6UA 3KBRA 3T9UA 4OZ9A 2XX7A 4P0GA 2I58A 4FEDA 4N17A 5H8FB 1N84A 2UVHA 2D3IA 4N07A 2THIA 1MH4A 5CMMA 3UA8A 5EYFA 4U23A 3O29A 2RF1A 2UVJA 5H8SA 3C32A 3SEUA 3MP1A 4RNSA 1US4A 4Z7EA 4EXKA 3EPEA 2HAUA 3IJXB 4XKQA 3R26A 3QSLA 2VPNA 1LBCA 1XVXA 4O7MA 4WEPA 1TXFA 4QSEA 1FQDA 4OFOA 3W15C 3K1MA 4PDDA 5HPQA 1S9TA 1ZTYA 5F1QA 4EF1A 3ZKLA 4P0IA 3MUQA 3B6QA 1MDP1 5I56A 1ANFA 4I1DA 2XXQA 4JWYA 3WAEA 4N6PA 3CG3A 3HHFA 4F1UA 4MNIA 1I6QA 5B70A 4PFBA 4ZS9A 2XXTA 1A54A 3PUZE 2ONSA 4QFNA 1MDQA 5H8NB 1PBPA 2HEUA 4EF2A 4E0XA 5I2NA 5I2KA 2REJA 1IZ1A 3SERA 1M5EA 4JB7A 3E9XA 4OWDA 4M1VA 4WKMA 2OBGA 1VR5A 4E0WA 4NAPA 1FQFA 3E3KA 3KSJA 2UYEA 1L5TA 3MVWA 1DMBA 4OETA 4G8NA 3EHTA 4PBHA 1B3EA 4UA8A 3ZS6A 3UK4A 2X7PA 3IO6A 5TP9A 4N15A 2B3FA 4X8RA 4R9FA 4XEQA 3M3FA 3CFZA 3IR1A 3CFXA 1IXIA 3TUSA 4KD5A 2DVCA 3PV0E 3L6GA 4GRKA 4G8MA 5CM6A 3MVXA 3MQ9A 3N6TA 4U2RA 5I58A 1LB8A 3I6VA 2P1SA 3MBPA 5JTYB 4DCYA 5I2NB 4YMAA 3T66A 2ONKE 3ILTB 3OMBA 1B5IA 3VFJA 3I3VA 1QUJA 3A3UA 3VVEA 3PPQA 3FUZA 1N0TA 3KG2A 2ZMBA 1B51A 3TFLA 4R74A 5L9SA 1S50A 3QIMA 4NF0A 1USYE 1UQWA 5BUUA 4IGRA 1SD3A 1IIWA 1MY3A 2XHDA 4TQUQ 3K0VA 4LA9A 3KZGA 1QUKA 2AL5A 3OEKA 2OWSA 3V8XB 1FQCA 1H43A 3QYTA 4NF4A 2I3WA 3MP6A 3IK6B 4NWDA 5I5PA 2DS9A 2XA5A 4R2FA 3MAMA 1JW4A 1BIYA 1URDA 3IOVA 1B4HA 3IB1A 4POWA 4PQJA 1B0LA 3DM0A 1B7UA 2R6GE 3CIJA 3N94A 1QUIA 4MLQA 2F7BA 5DVIA 3FXUA 3H7MA 2F78A 4ZEIA 2E1SA 4GLIA 1HSLA 3PU5A 4EQ9A 2KLFA 1H76A 3VVDA 3ODBA 1URSA 4QF9A 1Z7NE 3PPRA 3PUVE 5DYHA 4TOZA 1YAEA 3SKPA 5I57A 2DE3A 3G3KA 2DVZA 1LFIA 2QS4A 2X26A 3RPWA 4EUOA 1YCJA 3SESA 1QULA 1AIVA 4YB6A 1LCFA 3TCHA 1LFGA 4LATA 4XKPA 3N6UA 2R9JA 3LUYA 3KOSA 2F5XA 1FTKA 3RT8A 4H0WA 1HSEA 3EHSA 4O3AA 3O6IA 3RQTA 1AH5A 3CSGA 3B50A 4THIA 3UN6A 3OO6A 3K6VA 1HSJA 1I6AA 1O64A 3GBAA 3B6TA 4ELOA 5FHOA 5EHMA 3KJ7A 3C34A 1D9YA 3JV9A 2ONRA 2F35A 1SDXA 3CVGA 3T9XB 4YKIA 4F29A 1A55A 1VFEA 4EDPA 4LUBA 3OSQA 4GIZA 5J1DA 3PGFA 1D3KA 5I84A 4PETA 1VFDA 1DOTA 1NNPA 4OESA 1O7TA 1WDNA 2XXIA 3KSXA 4PE5B 1OVTA 4YZZA 1NNKA 2XD2A 3HV1A 3C31A 2Q9TA 2QS2A 3QK6A 4R75A 2B3BA 2ALUA 3FXBA 1B7HA 2Z22A 5ITPA 3O97A 4ND9A 4P11A 1SW2A 3VVFA 4PAFA 1MH3A 4NE4A 1N7XA 3KOTA 3C36A 4ZZAA 1UTBB 3FASA 3LSFB 3S9EA 2DWAA 2V3UA 3TZAA 3H6WA 4IO6A 4FIMA 3Q28A 3PMXA 2H4IA 1JW5A 3KN7A 3V83A 1P1NA 5IKBA 2E0SA 4GD5A 4IY5A 2RCBA 3ECRA 1B46A 2GHAA 4HCWA 3B6WA 1Y20A 2O69A 3OXNA 4AB5A 4P1EA 1POTA 2B65A 4DIGA 2VGQA 1EH3A 3T96B 5TPAA 3ONMA 1XT8A 3PUWE 4QRZA 3KJTA 5H8HA 4H6DA 5DT6A 5L9MA 2HZLA 3CFLA 3V89B 1FTLA 4LVQA 4UABA 3IJOB 4LZ5A 4U22A 1FTMA 2PBWA 3P7IA 4MEVA 4FORA 3MZ9A 5KCJB 5B7DA 2NVUB 1Z7ME 4BLAA 4NTLA 1QKBA 3DELB 4HW8A 5L9OA 3PMWA 3UORA 1M5CA 4KYEA 4PDHA 1YPNA 4JSDA 2WKYA 5LTCA 1R9QA 1B6HA 3WAFA 1N7WA 4H8IA 1Y3QA 4NX1A 3H3GA 2HXWA 2XWVA 4QSCA 4GQOA 1JEUA 2RC7A 2DWIA 4KQPA 3FATA 2PYYA 2NOOA 2ANJA 4R6HA 2V25A 2CMOA 3T9HB 3LSWA 1JVXA 5H8HB 2H25A 4DXCA 1IXGA 2PMSA 2ZNSA 4L17A 1MY0A 2ABHA 4LONB 2OLBA 3G3FA 4N8GA 4ZEFA 2PX1A 1DTZA 1A99A 2I0CA 1LAXA 3IL1B 3IOWA 2DSFA 1MQJA 4RY1A 5FTIA 4GXAA 1M5DA 2LAOA 2F34A 4I9DA 4LN5A 3OENA 3OO9A 4XTCQ 3G3GA 1A40A 1FCKA 1IXCA 2X7QA 4RK2A 4GL8A 4X9TA 2REGA 1DPEA 2XWIA 3TYHA 5F7VA 4U4XA 4DCXA 3HO7A 3OD7A 4POXA 1B40A 1VE4A 5AA1A 2FNCA 3H4ZA 4IO3A 2H5YA 4OVJA 2GRVA 4FEBA 3UP9A 4F39A 4H1XA 4ZE9A 1ZJLA 1B3GA 3QAXA 4JXIA 4PCDA 5AA2A 3C33A 1UTHA 3VLVA 1QKAA 4O3BA 4RJZA 2YLNA 2R71A 1LSTA 5M2VA 4OYVA 1FQAA 3IB2A 3BBRA 1P1UA 3TQWA 5IM2A 4RA1A 3R6UA 3DP4A 4OHNA 1CE2A 4XFEA 4U21A 4KHZE 4ESWA 4ZEBA 4OVTA 3SDFA 4LQ2A 4DXBA 4OEVA 2VHAA 3FXRA 5CBSA 1IEJA 1SVXB 4ZZEA 2G93A 4OFJA 4EQBA 2I6EA 1N3WA 3EN3A 2YPNA 5I56B 3OEMA 3U92A 1SW5A 4P8BA 1S7YA 1NH8A 3OELA 4OXVA 4PF8A 3MZBA 5K2YA 3DP8A 3A09A 2RCAA 1URGA 4MNPA 4PE3A 4OVSA 4GFRA 4I8CA 4F3GA 2PFYA 3TTLA 2WX9A 3MVZA 3RN8A 1FW0A 2F36A 4YKPA 4MLVA 3V5AA 1XS5A 5I2KB 2O7UA 3IX1A 1GTKA 2ZYMA 3EHUA 4R6YA 1B0HA 4HTGA 4X04A 3TTRA 4IO7A 2FYIA 3SEWA 4IGTA 2XXPA 1RYXA 5DTBA 2O1MA 4F22A 4KCCA 4H5FA 1AMFA 2Y84A 5TP9B 4PFTA 1ZIUA 4JWOA 3S9NC 4F3BA 1FQEA 1AOVA 3TQLA 1Y9UA 4OA4A 3S4UA 2O1LA 4MHFA 2CEXA 2ZNUA 2QRYA 1B3FA 2ESNA 1B3LA 4NWCA 5I58B 2GFEA 3TTNA 2DE2A 1MXXA 4ZE8A 1BLFA 4PF6A 4HCYA 5CMKA 3QUJA 3O28A 2BJJX 4Q5TA 1TFDA 4YICA 1PC3A 2DXYA 2DWHA 3SETA 3MW0A 4NMYA 5EHSA 3FIRA 1ZLQA 1H3DA 1RYOA 4I62A 3TTMA 2F6GA 1OIBA 4PGPA 2A5TA 3U1OA 1IXHA 2NUVA 4YB7A 1Y4TA 1Y1MA 4OVRA 1R6ZA 4DXUA 4NF4B 2RKMA 2I0BA 1OMPA 3DP6A 2VPOA 2VD2A 1FQBA 4OVQA 3UGWA 1PDAA 3BFTA 4KYSA 5DVFA 3F11A 2WYKA 3U94A 1XOCA 3H06B 2ZXTA 1N04A 4DZ1A 1H45A 1ZMGA 4Q8RA 1B3HA 4WEDA 3TODA 1TFAA 3U8QA 4RYAA 5IAIA 5H8QA 4MFIA 2Y7RA 3FGSA 2PT1A 3O2AA 2F6PA 1ATGA 2A5TB 3RY3A 3TAJA 3SEYA 4RXLA 3VDFA 2XXYA 3PPNA 2O7IA 4JSOA 4YB5A 2QJEA 1MXWA 3KGCA 3FVKA 4PFYA 3IOUA 1II5A 4R72A 4XXUA 3HHGA 2W7YA 3G7WA 1PB8A 5I57B 1LBBA 1NMUA 3CG1A 3K02A 3RLFE 3FVOA 4NF6A 2QS3A 3O9PA 1B2HA 1MG1A 4Q0CA 4ELPA 4G4PA 3FD3A 3K6WA 4IY6A 4NEDA 3KFMA 1NFTA 1JVYA 2PFZA 2Y7KA 1D9VA 2VD3A 3FXQA 1I6BA 4NQ8A 1O63A 4PFWA 3EQ1A 4PFIA 1B05A 1FTJA 3FJ7A 4N91A 5DEXA 4ZECA 1M5BA 4OANA 2AL4A 2Q2CA 4XF5A 1P99A 4Z0IA 2H99A 3K4UA 1LAHE 3CRBA 1PEBA 4RPNA 3GLBA 3W9VA 1MQDA 3PPOA 4MH5A 4DLDA 4MX6A 3QXMA 4XKNA 3TPAA 1ELJA 3HPIA 1MXVA 2Y7WA 3U72A 2DWJA 1R1NA 2NWJA 2I49A 1MM7A 2VP1A 5KDTA 3IO4A 4XKRA 2Q8JA 1MY4A 1AL3A 2QS1A 2NXOA 1OVBA 1Q1KA 2H98A 4QSDA 2F97A 1OQGA 4NG7A 4LP2B 4LZ7A 4N6KA 4DDDA 4MAGA 2QMXA 5AE4A 2XX8A 5JK4A 3DLNA 4G68A 4Q30B 4TLMB 2UVIA 2FA7A 3K1NA 1B1HA 2ZZVA 2XXUA 4G77A 2O6AA 2QL3A 1NNFA 1MQHA 3FZVA 5H8FA 3E4RA 1B9JA 5K2XA 2XXXA 1SW1A 1NNTA 3K01A 2XXVA 2HCAA 4YKKA 3CI8A 3TELA 5LOMA 4GOTA 3K6XA 1DSNA 2HFBA 1KWHA 2O68A 4ELQA 2GH9A 5TPAB 2DOJA 2D21A 1MPCA 4KFQA 3ZSFA 4P1LA 3Q25A 4HS7A 4ESXA 4AB6A 1PBQA 2I3VA 1FTOA 1LFHA 1MXZA 4BDRA 1LB9A 1NH7A 1NL5A 3THIA 1N3XA 2OK2A 3IB0A 3AXFA 2ZZWA 2RINA 5A5XA 1YTVA 3U93A 1JEVA 3HSTA 4NF8A 3PPPA 3QUFA 1MXYA 5ICTA 2OJTA 3BKIB 4ECFA 4U4SA 3TCGA 2GHBA 4PAIA 1T0KA 1B5HA 3VV5A 4KPTA 3Q26A 4IO2A 1R9LA 3G3HA 5CRYA 4NN3A 2ZYKA 1SYHA 4N6DA 3FJGA 4MF3A 5H8NA 1J1NA 4FE8A 2CEYA 4FAJA 1MY2A 3C35A 4H8JA 1I69A 3ILUB 2P0SA 1OLAA 1B5JA 1DPPA 4MBPA 4R2BA 2V93A 4OERA 3VE1B 3O6HA 3HN0A 1MS7A 3M3LA 5CMCA 2Q2AA 1MY1A 1JQFA 5AA4A 5A5XB 4YAHX 1Q35A 1LGBC 4O3CA 4NF8B 3M8UA 3G3IA 3FVNA 4O8MA 4GL0A 2I48A 1A7LA 1GVCA 4XIGQ 2RC8A 3PMVA 2PVUA 3LR1A 4DI4B 2DP8A 1CB6A 3VLUA 2I4BA 1F9BA 5HBCA 3UIFA 4OTEA 2P2AA 3MPLA 5JTYA 2F7CA 4IO5A 3RT6B 3LSXA 4OEUA 4JDFA 4BDQA 4BDNA 4X1BA 1XHYA 3Q27A 1IITA 1OQHA 3OSRA 4R73A 4C0RA 4N13A 5AA2B 3KN8A 3PUXE 4QFKA 1UTHB 1MRPA 4MCOA 1B7ZA 2V3QA 3E13X 1H44A 2QPQA 3O66A 3IOTA 4BDOA 5AA4B 1GV8A 3W9WA 4IO4A 3T9VA 1EZOA 3SEVA 3FVGA 4UACA 5BWJA 4MNCA 3SEXA 4JWXA 3USDA 5TU0A 1ZKBA 4FATA 1GGGA 2DQVA 1USYH 4U1ZA 4WXJA 4BDLA 5JEIA 2CZLA 4P56A 4NGUA 2Z8EA 3O6GA 5HM4B 4NF5A 2G29A 3IAZA 1B58A 3ZKKA 2I4CA 2HAVA 2DYXA 4PAKA 4O94A 2O84X 3D4GA 1GR2A 3MJNA 2AYSA 2Y7IA 5CI5A 1B4ZA 4PC9A 5CBRA 2ZYNA 5ISUA 1BKAA 1UIVA 4H67A 4GXSB 4G2ZA
chains in the Genus database with same CATH superfamily
3RGYA 2D5WA 4F1VA 4OMBA 1QVSA 3MWBA 4AQ4A 1QW0A 4RK9A 4NHBA 3MZ1A 4H5GA 3C9HA 3OOAA 1P1WA 1B1XA 3MVYA 2OWZA 4DI3D 3K00A 4ZDMA 5DVJA 4F2OA 5FBPA 4NF5B 1OLCA 3L6HA 3N5LA 3TEPA 4PGNA 3CR9A 4YKJA 1ZU0A 2A5SA 4OVPA 4EQ7A 1XVYA 1LLSA 1ZBMA 2UXAA 1MQIA 1LCTA 1MPDA 5AA2D 4GWOA 1P1QA 5KZTA 1SI0A 4P3LA 1PB7A 4OENA 2IA4A 5FTHA 3OO7A 3T22A 3TMGA 4LZ8A 1US5A 4MMPA 4GBVA 3MPKA 3FV1A 1POY1 2XWKA 2Z8FA 3Q29A 3KEIA 2OCUA 3FV2A 4GWSA 3PD8A 1TT1A 1QJMA 4YU0A 2Q89A 1Y4CA 1JNFA 3TDJA 3TTKA 2XWOA 4YMBA 3S9MC 2XX9A 2XXHA 1FPEA 4KYDA 3U65A 1Y3PA 5I7IA 3S2VA 3IORA 3CSBA 4F2QA 4IB2A 3I5OA 4F31B 2DXRA 4QHQA 1IUDA 1DCUA 4GBWA 4MJOA 2Q8MA 5CMBA 4BDMA 2V84A 4U1OA 5I59A 1FPBA 4QFLA 1MPBA 4GVOA 1SQYA 1K9YA 2RC9A 1NV4A 5IZZA 1BTJA 1EU8A 1MQGA 5FHNA 2OZZA 5LDZA 1SW4A 3MYUA 3B8BA 4R9GA 4O7IA 2YJPA 4DE8A 2F8DA 4F1YA 1UTBA 1XC1A 4JBZA 3H6VA 5ELVA 3PD9A 3PUYE 1WVJA 3T93B 4AS5A 3K6UA 4ELRA 2Y7PA 5L8DA 2HPGA 1SBPA 2QMWA 1A8FA 5H8QB 4KR5A 3GYYA 1LAFE 3VLWA 4EXLA 1SI1A 3VXBA 1B52A 3G3JA 1RDYA 3RTWB 3A3CA 4RPOA 2V3TA 1D4NA 2WYPA 1FPKA 2OWTA 2ZNTA 3TKDA 5I59B 1SYIA 3HCQA 1RKMA 1BP5A 4X48A 3VXCA 4H65A 2HQ0A 2HZKA 3KN3A 4G68C 2DE4A 3GXAA 3GBBA 1DTGA 3BFUA 4G8HA 3N26A 3LBSA 4GF8A 5KCJA 1MM6A 3H03A 1EYJA 4QFOA 4NF6B 3LC8A 4ZEDA 2PT2A 4PFRA 4F18A 2XXRA 3D4CA 4F3SA 3M3KA 3NOHA 1Y3NA 4LQ5A 1NV5A 4ONYA 1N76A 2Z23A 2IEEA 4QFPA 2ZYOA 4OQOA 4MIJA 2XD3A 1SPIA 2F7AA 4I3YA 3RTFB 5DEXB 1NV3A 4PP0A 4TLLB 1EZPA 4C1TA 3OO8A 2DDKA 3FJMA 2Z8DA 1NKXA 2V4CA 3RUMA 1IQ7A 3R7XA 3SZPA 1Y1ZA 2XXWA 1PB9A 3RNNA 1UIUA 2Q88A 4HE2A 3H6TA 3S9LC 3JZJA 4P9KA 3K1PA 1B32A 4C1UA 4K3FA 4PBQA 3K2DA 1TWYA 4M4GA 4X1DA 4OFLA 3JYRA 5FHMA 4R6KA 4P47A 4ZEKA 1LAGE 2UVGA 4F3PA 3LSLA 4PFUA 5EYGA 1NV0A 4KI0E 5AA3A 2H9BA 5ITOA 2VOZA 3TCFA 1JETA 2M8CA 5KDTB 5CC2A 3GZGA 2UYFA 3EF7A 2AIXA 3MC2A 4GWYA 2XXKA 1FJ9A 2QSXA 1WODA 4FJPA 4F19A 4N4UA 1P1OA 1VSOA 1MXUA 1EZ9A 3MP8A 4N8YA 2O51A 1LBVA 4FECA 4KCDA 5ICQA 2ZZXA 1A8EA 4ISUA 1JW1A 1M5FA 4G68B 3B7DA 5IGAA 5J16A 3C4MA 3H6UA 3KBRA 3T9UA 4OZ9A 2XX7A 4P0GA 2I58A 4FEDA 4N17A 5H8FB 1N84A 2UVHA 2D3IA 4N07A 2THIA 1MH4A 5CMMA 3UA8A 5EYFA 4U23A 3O29A 2RF1A 2UVJA 5H8SA 2CZHA 3C32A 3SEUA 3MP1A 4RNSA 1US4A 4Z7EA 4EXKA 3EPEA 2HAUA 3IJXB 1LEVA 4XKQA 3R26A 3QSLA 2VPNA 1EYKA 1LBCA 1XVXA 4O7MA 4WEPA 1TXFA 4QSEA 1FQDA 4OFOA 3W15C 1YZ0A 3K1MA 4PDDA 2VT5A 5HPQA 1S9TA 1ZTYA 5F1QA 4EF1A 3ZKLA 4P0IA 3MUQA 2WEFA 3B6QA 1MDP1 5I56A 1ANFA 4I1DA 2XXQA 4JWYA 3WAEA 4N6PA 3CG3A 3HHFA 4F1UA 4MNIA 1I6QA 5B70A 4PFBA 4ZS9A 2XXTA 1A54A 3PUZE 2ONSA 3E79A 5EQ8A 4QFNA 1MDQA 5H8NB 1PBPA 2HEUA 4EF2A 4E0XA 5I2NA 5I2KA 2REJA 1IZ1A 3SERA 1M5EA 5DW8A 4JB7A 3E9XA 4OWDA 4M1VA 4WKMA 2OBGA 1VR5A 4E0WA 5ET5A 4NAPA 1FQFA 3E3KA 3KSJA 2UYEA 1L5TA 3MVWA 1DMBA 1DBZA 4OETA 4G8NA 3EHTA 4PBHA 1B3EA 4I40A 1FSAA 4UA8A 3ZS6A 3UK4A 2X7PA 3IO6A 5TP9A 4N15A 2B3FA 4X8RA 4R9FA 4XEQA 3M3FA 2KR0A 3CFZA 3IR1A 3CFXA 1IXIA 1LBXA 3TUSA 4KD5A 4HE1A 2DVCA 3PV0E 3L6GA 4GRKA 4G8MA 5CM6A 3KC1A 3MVXA 3MQ9A 3N6TA 4U2RA 5I58A 1LB8A 3I6VA 2P1SA 3MBPA 5A5LA 5JTYB 4DCYA 5I2NB 4YMAA 3T66A 2ONKE 2WBBA 3ILTB 3OMBA 1B5IA 3VFJA 3I3VA 4GWXA 1QUJA 3A3UA 3VVEA 3PPQA 3FUZA 1N0TA 3KG2A 2ZMBA 1B51A 3TFLA 4R74A 5L9SA 1S50A 3QIMA 4NF0A 1USYE 1UQWA 2HHMA 5BUUA 4IGRA 1SD3A 1IIWA 1MY3A 2XHDA 1YYZA 4TQUQ 3K0VA 4LA9A 3KZGA 1QUKA 2AL5A 3OEKA 1FPGA 2OWSA 3V8XB 1FQCA 1H43A 3QYTA 4NF4A 2I3WA 3MP6A 3IK6B 4NWDA 5I5PA 2DS9A 2XA5A 4R2FA 3MAMA 1JW4A 1VDWA 5EQ7A 1BIYA 4AS4A 1URDA 3IOVA 1B4HA 3IB1A 4POWA 4PQJA 1IMEA 1B0LA 3DM0A 1B7UA 2R6GE 3CIJA 3N94A 1QUIA 4MLQA 2F7BA 5DVIA 4HXVA 3FXUA 3H7MA 2F78A 2L5VA 4ZEIA 2E1SA 3KBZA 4GLIA 3A29A 1HSLA 3PU5A 1G0IA 4EQ9A 2KLFA 1H76A 3VVDA 3ODBA 1URSA 4QF9A 1Z7NE 3PPRA 3PUVE 5DYHA 4TOZA 1YAEA 1FTAA 1FBFA 3SKPA 5I57A 1NV7A 4GX4A 2DE3A 3G3KA 2DVZA 1LFIA 2QS4A 2X26A 5IZ1A 3RPWA 4EUOA 1YCJA 3SESA 1QULA 1AIVA 4YB6A 1LCFA 3TCHA 1LFGA 4LATA 4XKPA 3N6UA 2R9JA 3RPLA 3LUYA 3KOSA 2F5XA 1FTKA 3RT8A 4H0WA 1HSEA 3EHSA 4O3AA 3O6IA 3RQTA 2FBPA 1AH5A 3CSGA 3B50A 4THIA 3UN6A 4GWZA 3OO6A 3K6VA 1HSJA 1I6AA 1O64A 3GBAA 3B6TA 4ELOA 5FHOA 5EHMA 3KJ7A 3C34A 1D9YA 3JV9A 2ONRA 2F35A 1SDXA 3CVGA 3T9XB 4YKIA 4F29A 1A55A 1VFEA 4EDPA 1IMBA 4LUBA 3OSQA 4GIZA 5J1DA 3PGFA 1D3KA 5I84A 4PETA 1VFDA 1DOTA 1NNPA 4OESA 1O7TA 3ROJA 1WDNA 2XXIA 3KSXA 4PE5B 1OVTA 4YZZA 3T1BA 1NNKA 2XD2A 3HV1A 2FHYA 3C31A 2Q9TA 2QS2A 3QK6A 4R75A 2B3BA 2ALUA 3FXBA 1B7HA 2Z22A 5ITPA 3O97A 4ND9A 1QGXA 4P11A 1SW2A 3VVFA 4PAFA 4GWWA 1MH3A 4NE4A 1N7XA 3KOTA 3C36A 4ZZAA 1UTBB 3FASA 3LSFB 3S9EA 2DWAA 2V3UA 3TZAA 3H6WA 4IO6A 4FIMA 3Q28A 3PMXA 1LBWA 1JW5A 2H4IA 3KN7A 3V83A 1P1NA 5IKBA 2E0SA 4GD5A 4IY5A 2RCBA 3ECRA 1B46A 2GHAA 4HCWA 3B6WA 1Y20A 2O69A 3OXNA 4P1EA 4AB5A 2Q74A 1POTA 2B65A 4DIGA 2QFLA 2VGQA 1EH3A 3T96B 5TPAA 3ONMA 1XT8A 3PUWE 4HE0A 3KJTA 4QRZA 5H8HA 4H6DA 5DT6A 5L9MA 2HZLA 2GQ1A 3CFLA 3V89B 1FTLA 4LVQA 4UABA 3IJOB 4LZ5A 4U22A 1FTMA 2PBWA 3P7IA 4MEVA 4FORA 3MZ9A 5KCJB 5B7DA 2NVUB 1Z7ME 4BLAA 1D9QA 4NTLA 1QKBA 3DELB 4HW8A 1EYIA 2QVVA 5L9OA 3PMWA 3UORA 1M5CA 4KYEA 4PDHA 1YPNA 4JSDA 2WKYA 5LTCA 1R9QA 1B6HA 3WAFA 1N7WA 4H8IA 1Y3QA 4NX1A 3H3GA 2BJIA 2HXWA 5IZ3A 2XWVA 3CHGA 5ET6A 3BIHA 4QSCA 2PCRA 4GQOA 1JEUA 2RC7A 5ESYA 1NUWA 2DWIA 4GX6A 2Y5KA 4KQPA 3FATA 2PYYA 2NOOA 2ANJA 4R6HA 2V25A 2CMOA 3T9HB 1G0HA 3LSWA 1JVXA 5H8HB 2H25A 4DXCA 1IXGA 2PMSA 2ZNSA 4L17A 1MY0A 2ABHA 4LONB 2OLBA 2P3NA 3G3FA 4N8GA 4ZEFA 2PX1A 1DTZA 1A99A 2I0CA 1LAXA 3IL1B 3IOWA 2DSFA 3LV0A 1MQJA 4RY1A 3QMFA 5FTIA 4GXAA 1M5DA 4PTKA 2LAOA 1FBGA 2F34A 4I9DA 4LN5A 3OENA 3OO9A 4XTCQ 3G3GA 1A40A 1FCKA 1IXCA 2CZKA 2X7QA 4RK2A 4GL8A 4X9TA 2REGA 1DPEA 2XWIA 3TYHA 5F7VA 1IMCA 4U4XA 4DCXA 3HO7A 3OD7A 5EQ9A 4POXA 1B40A 1VE4A 5AA1A 2FNCA 3H4ZA 4IO3A 2H5YA 4OVJA 2GRVA 4FEBA 3UP9A 4F39A 4H1XA 1FBHA 4ZE9A 1ZJLA 1B3GA 3QAXA 4JXIA 4PCDA 5AA2A 3C33A 1UTHA 3VLVA 1QKAA 4O3BA 1AWBA 4RJZA 2YLNA 2R71A 1LSTA 5M2VA 3E78A 4OYVA 1FQAA 3IB2A 3BBRA 1P1UA 5IM2A 3TQWA 4RA1A 2KQZA 3R6UA 3DP4A 4OHNA 1CE2A 4XFEA 2HXRA 4U21A 4KHZE 4OVTA 4ZEBA 4ESWA 3SDFA 4LQ2A 4DXBA 4OEVA 2VHAA 1DK4A 3FXRA 5CBSA 1IEJA 1SVXB 4ZZEA 2G93A 3ISPA 4OFJA 4EQBA 2I6EA 1N3WA 1NV2A 3EN3A 2YPNA 5I56B 3OEMA 3U92A 3D1RA 1SW5A 4P8BA 1S7YA 1NH8A 4PF8A 3OELA 4OXVA 3MZBA 5EYHA 1NUZA 5K2YA 3DP8A 3A09A 2RCAA 1URGA 4MNPA 1LBYA 4PE3A 4OVSA 2P3VA 2B4MA 4GFRA 4I8CA 4JVIA 4F3GA 2PFYA 4GWUA 2WX9A 3TTLA 3MVZA 3RN8A 1FW0A 2F36A 4YKPA 1RDZA 4MLVA 3V5AA 1XS5A 5I2KB 2O7UA 3IX1A 1GTKA 2ZYMA 3EHUA 3MSTA 4R6YA 1RDXA 1B0HA 4HTGA 4X04A 3TTRA 4IO7A 2FYIA 3SEWA 4IGTA 2XXPA 1RYXA 5DTBA 2O1MA 4F22A 4KCCA 4H5FA 1AMFA 2Y84A 4G61A 5TP9B 4PFTA 1NUYA 1ZIUA 4JWOA 3S9NC 4F3BA 1FQEA 1AOVA 1NV6A 3TQLA 1Y9UA 4OA4A 3S4UA 4KXPA 1FBEA 2O1LA 2CEXA 4MHFA 2FIEA 2ZNUA 2QRYA 1B3FA 2ESNA 1LBZA 1B3LA 4H45A 4NWCA 5I58B 2GFEA 3BIGA 3TTNA 2DE2A 1MXXA 4ZE8A 1BLFA 4PF6A 4HCYA 5CMKA 3QUJA 3O28A 3HFUA 2BJJX 4Q5TA 1TFDA 4YICA 1PC3A 2DXYA 3FBPA 2DWHA 3SETA 4N81A 3MW0A 4NMYA 5EHSA 3FIRA 1ZLQA 1H3DA 1RYOA 4I62A 3TTMA 2F6GA 1OIBA 4PGPA 2A5TA 1XI6A 3U1OA 1IXHA 2NUVA 4YB7A 1Y4TA 1Y1MA 4OVRA 1R6ZA 4DXUA 4NF4B 4QBAA 2RKMA 2I0BA 1OMPA 2VPOA 3DP6A 2VD2A 1FQBA 4OVQA 3UGWA 1PDAA 3BFTA 3PTYA 4KYSA 5DVFA 3F11A 2WYKA 3U94A 1XOCA 3H06B 2ZXTA 1N04A 4DZ1A 5EQAA 1H45A 1ZMGA 4Q8RA 1B3HA 4WEDA 5ET8A 3TODA 1TFAA 3U8QA 4RYAA 5IAIA 5H8QA 4MFIA 2Y7RA 3FGSA 2PT1A 3O2AA 2F6PA 1ATGA 2A5TB 3T0JA 3RY3A 3TAJA 2R8TA 3SEYA 4RXLA 3VDFA 2XXYA 3PPNA 2O7IA 4JSOA 4YB5A 2QJEA 1KA0A 1MXWA 3KGCA 3FVKA 4PFYA 3IOUA 1FPJA 1II5A 4R72A 4XXUA 1KA1A 3HHGA 2W7YA 3G7WA 1PB8A 5I57B 1LBBA 1NMUA 3CG1A 3K02A 3RLFE 3FVOA 4NF6A 2CZIA 2QS3A 3O9PA 1B2HA 1MG1A 4Q0CA 2WBDA 4ELPA 4G4PA 3FD3A 3K6WA 4IY6A 3RPLB 4NEDA 3KFMA 1NFTA 1JVYA 2PFZA 2Y7KA 1D9VA 2VD3A 3FXQA 1I6BA 4NQ8A 1O63A 1BK4A 4PFWA 3EQ1A 4PFIA 1B05A 1FTJA 1FRPA 3FJ7A 4N91A 5DEXA 4ZECA 1M5BA 4OANA 2AL4A 2Q2CA 4XF5A 1P99A 4Z0IA 2H99A 3K4UA 1FPFA 1LAHE 3CRBA 1PEBA 4RPNA 3GLBA 3W9VA 1MQDA 1FPDA 3PPOA 4MH5A 4DLDA 3EKIA 4MX6A 3QXMA 4XKNA 3TPAA 1INPA 2F3DA 1ELJA 3HPIA 1MXVA 2Y7WA 3U72A 2DWJA 1R1NA 2NWJA 2I49A 1MM7A 2VP1A 5KDTA 3IO4A 4XKRA 2Q8JA 1MY4A 1AL3A 3IFCA 2QS1A 2NXOA 1OVBA 1Q1KA 2H98A 4QSDA 2F97A 4GX3A 4I3EA 1OQGA 4NG7A 4LP2B 4LZ7A 4N6KA 4DDDA 4MAGA 2QMXA 5AE4A 2XX8A 4JVCA 5JK4A 3DLNA 4G68A 4Q30B 1K9ZA 4TLMB 2UVIA 2FA7A 1Q9DA 3K1NA 1B1HA 2ZZVA 2XXUA 4QXDA 4G77A 2O6AA 2QL3A 1NNFA 1MQHA 3FZVA 5H8FA 3E4RA 1B9JA 5K2XA 2XXXA 1SW1A 1NNTA 3K01A 2FVZA 2XXVA 2HCAA 4YKKA 3CI8A 3TELA 5LOMA 2QVUA 4GOTA 3K6XA 1DSNA 1JP4A 2HFBA 1KWHA 2O68A 4ELQA 2GH9A 1KZ8A 5TPAB 2DOJA 2D21A 1MPCA 1FBPA 4KFQA 3ZSFA 2QVRA 4P1LA 3Q25A 4HS7A 5F24A 4ESXA 4AB6A 1PBQA 2I3VA 1FTOA 2FIXA 1LFHA 1MXZA 4BDRA 1LB9A 1NH7A 1NL5A 3THIA 1N3XA 2OK2A 3IB0A 3AXFA 1YXIA 2ZZWA 2RINA 5A5XA 1YTVA 3U93A 1IMAA 1JEVA 3HSTA 4NF8A 3PPPA 3QUFA 1MXYA 5ICTA 4H46A 2OJTA 3BKIB 4ECFA 4U4SA 3TCGA 2GHBA 4PAIA 5IZ3B 1T0KA 1B5HA 3VV5A 1IMDA 4KPTA 3Q26A 4IO2A 1R9LA 3G3HA 5CRYA 4NN3A 2ZYKA 1SYHA 4N6DA 3FJGA 4MF3A 5H8NA 5ET7A 1J1NA 4FE8A 2CEYA 4FAJA 1MY2A 3IFAA 3C35A 4H8JA 1I69A 3ILUB 2P0SA 1OLAA 1B5JA 3KC0A 1DPPA 4MBPA 4R2BA 2V93A 4OERA 3VE1B 3O6HA 3HN0A 1MS7A 3M3LA 5CMCA 2Q2AA 1MY1A 1JQFA 5AA4A 5A5XB 4YAHX 1Q35A 1LGBC 4O3CA 1FPLA 4NF8B 3M8UA 3G3IA 3FVNA 4IR8A 4O8MA 4GL0A 2I48A 1A7LA 1GVCA 4XIGQ 2RC8A 3PMVA 2PVUA 3LR1A 4DI4B 2DP8A 1CB6A 3VLUA 2Y5LA 1FPIA 3LUZA 1NI9A 2I4BA 2MKZA 1F9BA 5HBCA 3UIFA 2OX3A 4OTEA 2P2AA 3MPLA 5JTYA 2F7CA 4IO5A 3RT6B 3LSXA 4OEUA 4JDFA 4BDQA 4BDNA 1CNQA 4X1BA 1XHYA 3Q27A 1IITA 1OQHA 3OSRA 4R73A 4C0RA 4N13A 5AA2B 3KN8A 3PUXE 4JVDA 4QFKA 5T3JA 1UTHB 1MRPA 4MCOA 1NV1A 1B7ZA 2V3QA 3E13X 1H44A 2QPQA 3O66A 3IOTA 1NUXA 4BDOA 1IMFA 5AA4B 1GV8A 3W9WA 4IO4A 3T9VA 1EZOA 3SEVA 3FVGA 4UACA 4MNCA 5BWJA 3SEXA 4JWXA 3USDA 5TU0A 1ZKBA 4FBPA 1FJ6A 4FATA 1GGGA 2DQVA 1USYH 2F3BA 4U1ZA 4WXJA 4BDLA 5JEIA 2CZLA 4P56A 4NGUA 2Z8EA 3O6GA 5HM4B 4NF5A 2G29A 3IAZA 1B58A 3ZKKA 2I4CA 2HAVA 2DYXA 4PAKA 4O94A 2O84X 3D4GA 1FBCA 1GR2A 1FBDA 3MJNA 2AYSA 2Y7IA 2JJKA 5CI5A 5I3SA 1B4ZA 4PC9A 5CBRA 2ZYNA 5ISUA 1BKAA 1UIVA 2B4LA 3RYDA 4H67A 4GXSB 4G2ZA
chains in the Genus database with same CATH topology
3RGYA 2D5WA 4F1VA 4OMBA 1QVSA 3MWBA 4AQ4A 1QW0A 4RK9A 4NHBA 3MZ1A 4H5GA 3C9HA 3OOAA 1P1WA 1B1XA 3MVYA 2OWZA 4DI3D 3K00A 4ZDMA 5DVJA 4F2OA 5FBPA 4NF5B 1OLCA 3L6HA 3N5LA 3TEPA 4PGNA 3CR9A 4YKJA 1ZU0A 2A5SA 4OVPA 4EQ7A 1XVYA 1LLSA 1ZBMA 2UXAA 1MQIA 1LCTA 1MPDA 5AA2D 4GWOA 1P1QA 5KZTA 1SI0A 4P3LA 1PB7A 4OENA 2IA4A 5FTHA 3OO7A 3T22A 3TMGA 4LZ8A 1US5A 4MMPA 4GBVA 3MPKA 3FV1A 1POY1 2XWKA 2Z8FA 3Q29A 3KEIA 2OCUA 3FV2A 4GWSA 3PD8A 1TT1A 1QJMA 4YU0A 2Q89A 1Y4CA 1JNFA 3TDJA 3TTKA 2XWOA 4YMBA 3S9MC 2XX9A 2XXHA 1FPEA 4KYDA 3U65A 1Y3PA 5I7IA 3S2VA 3IORA 3CSBA 4F2QA 4IB2A 3I5OA 4F31B 2DXRA 4QHQA 1IUDA 1DCUA 4GBWA 4MJOA 2Q8MA 5CMBA 4BDMA 2V84A 4U1OA 5I59A 1FPBA 4QFLA 1MPBA 4GVOA 1SQYA 1K9YA 2RC9A 1NV4A 5IZZA 1BTJA 1EU8A 1MQGA 5FHNA 2OZZA 5LDZA 1SW4A 3MYUA 4R9GA 3B8BA 4O7IA 2YJPA 4DE8A 2F8DA 4F1YA 1UTBA 1XC1A 4JBZA 3H6VA 5ELVA 3PD9A 3PUYE 1WVJA 3T93B 4AS5A 3K6UA 4ELRA 2Y7PA 5L8DA 2HPGA 1SBPA 2QMWA 1A8FA 5H8QB 4KR5A 3GYYA 1LAFE 3VLWA 4EXLA 1SI1A 3VXBA 1B52A 3G3JA 1RDYA 3RTWB 3A3CA 4RPOA 2V3TA 1D4NA 2WYPA 1FPKA 2OWTA 2ZNTA 3TKDA 5I59B 1SYIA 3HCQA 1RKMA 1BP5A 4X48A 3VXCA 4H65A 2HQ0A 2HZKA 3KN3A 4G68C 2DE4A 3GXAA 3GBBA 1DTGA 3BFUA 4G8HA 3N26A 3LBSA 4GF8A 5KCJA 1MM6A 3H03A 1EYJA 4QFOA 4NF6B 3LC8A 4ZEDA 2PT2A 4F18A 4PFRA 2XXRA 3D4CA 4F3SA 3M3KA 3NOHA 1Y3NA 4LQ5A 1NV5A 4ONYA 1N76A 2Z23A 2IEEA 4QFPA 2ZYOA 4OQOA 4MIJA 2XD3A 1SPIA 2F7AA 3RTFB 4I3YA 5DEXB 4PP0A 1NV3A 4TLLB 1EZPA 4C1TA 3OO8A 2DDKA 3FJMA 2Z8DA 1NKXA 2V4CA 3RUMA 1IQ7A 3R7XA 3SZPA 1Y1ZA 2XXWA 1PB9A 3RNNA 1UIUA 2Q88A 4HE2A 3H6TA 3S9LC 3JZJA 4P9KA 3K1PA 1B32A 4C1UA 4K3FA 4PBQA 3K2DA 1TWYA 4M4GA 4X1DA 4OFLA 3JYRA 5FHMA 4R6KA 4P47A 4ZEKA 1LAGE 2UVGA 4F3PA 3LSLA 4PFUA 5EYGA 1NV0A 4KI0E 5AA3A 2H9BA 5ITOA 2VOZA 3TCFA 1JETA 2M8CA 5KDTB 5CC2A 3GZGA 2UYFA 3EF7A 2AIXA 3MC2A 4GWYA 2XXKA 2QSXA 1FJ9A 1WODA 4FJPA 4F19A 4N4UA 1P1OA 1VSOA 1MXUA 1EZ9A 3MP8A 4N8YA 2O51A 4FECA 4KCDA 1LBVA 5ICQA 2ZZXA 1A8EA 4ISUA 1JW1A 1M5FA 4G68B 3B7DA 5IGAA 5J16A 3C4MA 3H6UA 3KBRA 3T9UA 4OZ9A 2XX7A 4P0GA 2I58A 4FEDA 4N17A 5H8FB 1N84A 2UVHA 2D3IA 4N07A 2THIA 1MH4A 5CMMA 3UA8A 5EYFA 4U23A 3O29A 2RF1A 2UVJA 5H8SA 2CZHA 3C32A 3SEUA 3MP1A 4RNSA 1US4A 4Z7EA 4EXKA 3EPEA 2HAUA 3IJXB 1LEVA 4XKQA 3R26A 3QSLA 2VPNA 1LBCA 1EYKA 1XVXA 4O7MA 4WEPA 1TXFA 4QSEA 1FQDA 4OFOA 3W15C 1YZ0A 3K1MA 4PDDA 5HPQA 2VT5A 1S9TA 1ZTYA 5F1QA 4EF1A 3ZKLA 4P0IA 3MUQA 2WEFA 3B6QA 1MDP1 5I56A 1ANFA 4I1DA 2XXQA 4JWYA 3WAEA 4N6PA 3CG3A 3HHFA 4F1UA 4MNIA 1I6QA 5B70A 4PFBA 4ZS9A 2XXTA 1A54A 3PUZE 2ONSA 3E79A 5EQ8A 4QFNA 1MDQA 5H8NB 1PBPA 2HEUA 4EF2A 4E0XA 5I2NA 5I2KA 2REJA 1IZ1A 3SERA 1M5EA 5DW8A 4JB7A 3E9XA 4OWDA 4M1VA 4WKMA 2OBGA 1VR5A 4E0WA 5ET5A 4NAPA 1FQFA 3E3KA 3KSJA 2UYEA 1L5TA 3MVWA 1DMBA 1DBZA 4OETA 4G8NA 3EHTA 4PBHA 1B3EA 4I40A 1FSAA 4UA8A 3ZS6A 3UK4A 2X7PA 3IO6A 5TP9A 4N15A 2B3FA 4X8RA 4R9FA 4XEQA 3M3FA 2KR0A 3CFZA 3IR1A 3CFXA 1IXIA 1LBXA 3TUSA 4KD5A 4HE1A 2DVCA 3PV0E 3L6GA 4GRKA 4G8MA 5CM6A 3KC1A 3MVXA 3MQ9A 3N6TA 4U2RA 5I58A 1LB8A 3I6VA 2P1SA 3MBPA 5A5LA 5JTYB 4DCYA 5I2NB 4YMAA 3T66A 2ONKE 3ILTB 2WBBA 3OMBA 1B5IA 3VFJA 3I3VA 4GWXA 1QUJA 3A3UA 3VVEA 3PPQA 3FUZA 1N0TA 3KG2A 2ZMBA 1B51A 3TFLA 4R74A 5L9SA 1S50A 3QIMA 4NF0A 1USYE 1UQWA 2HHMA 5BUUA 4IGRA 1SD3A 1IIWA 1MY3A 2XHDA 1YYZA 4TQUQ 3K0VA 4LA9A 3KZGA 1QUKA 2AL5A 3OEKA 1FPGA 2OWSA 3V8XB 1FQCA 1H43A 3QYTA 4NF4A 2I3WA 3MP6A 3IK6B 4NWDA 5I5PA 2DS9A 2XA5A 4R2FA 3MAMA 1JW4A 1VDWA 5EQ7A 1BIYA 4AS4A 1URDA 3IOVA 1B4HA 3IB1A 4POWA 4PQJA 1IMEA 1B0LA 3DM0A 1B7UA 2R6GE 3CIJA 3N94A 1QUIA 4MLQA 2F7BA 5DVIA 4HXVA 3FXUA 3H7MA 2F78A 2L5VA 4ZEIA 2E1SA 3KBZA 4GLIA 3A29A 1HSLA 3PU5A 1G0IA 4EQ9A 2KLFA 1H76A 3VVDA 3ODBA 1URSA 4QF9A 1Z7NE 3PPRA 3PUVE 5DYHA 4TOZA 1YAEA 1FTAA 3SKPA 1FBFA 5I57A 1NV7A 4GX4A 2DE3A 3G3KA 2DVZA 1LFIA 2QS4A 2X26A 3RPWA 5IZ1A 4EUOA 1YCJA 3SESA 1QULA 1AIVA 4YB6A 1LCFA 3TCHA 1LFGA 4LATA 4XKPA 3N6UA 2R9JA 3RPLA 3LUYA 3KOSA 2F5XA 1FTKA 3RT8A 4H0WA 1HSEA 3EHSA 4O3AA 3O6IA 3RQTA 2FBPA 1AH5A 3CSGA 3B50A 4THIA 3UN6A 4GWZA 3OO6A 3K6VA 1HSJA 1I6AA 1O64A 3GBAA 3B6TA 4ELOA 5FHOA 5EHMA 3KJ7A 3C34A 1D9YA 3JV9A 2ONRA 2F35A 1SDXA 3CVGA 3T9XB 4YKIA 4F29A 1A55A 1VFEA 4EDPA 1IMBA 4LUBA 3OSQA 4GIZA 5J1DA 3PGFA 1D3KA 5I84A 4PETA 1VFDA 1DOTA 1NNPA 4OESA 1O7TA 3ROJA 1WDNA 2XXIA 3KSXA 4PE5B 1OVTA 4YZZA 3T1BA 1NNKA 2XD2A 3HV1A 3C31A 2FHYA 2Q9TA 2QS2A 3QK6A 4R75A 2B3BA 2ALUA 3FXBA 1B7HA 2Z22A 5ITPA 3O97A 4ND9A 1QGXA 4P11A 1SW2A 3VVFA 4PAFA 4GWWA 1MH3A 4NE4A 1N7XA 3KOTA 3C36A 4ZZAA 1UTBB 3FASA 3LSFB 3S9EA 2DWAA 2V3UA 3TZAA 3H6WA 4IO6A 4FIMA 3Q28A 3PMXA 2H4IA 1JW5A 3KN7A 1LBWA 3V83A 1P1NA 5IKBA 2E0SA 4GD5A 4IY5A 2RCBA 3ECRA 1B46A 2GHAA 4HCWA 3B6WA 1Y20A 2O69A 3OXNA 4AB5A 4P1EA 2Q74A 1POTA 2B65A 4DIGA 2VGQA 2QFLA 1EH3A 3T96B 5TPAA 3ONMA 1XT8A 3PUWE 4QRZA 3KJTA 4HE0A 5H8HA 4H6DA 5DT6A 5L9MA 2HZLA 3CFLA 2GQ1A 3V89B 1FTLA 4LVQA 4UABA 3IJOB 4LZ5A 4U22A 1FTMA 2PBWA 3P7IA 4MEVA 4FORA 3MZ9A 5KCJB 5B7DA 2NVUB 1Z7ME 4BLAA 1D9QA 4NTLA 1QKBA 3DELB 4HW8A 1EYIA 5L9OA 2QVVA 3PMWA 3UORA 1M5CA 4KYEA 4PDHA 1YPNA 4JSDA 2WKYA 5LTCA 1R9QA 1B6HA 3WAFA 1N7WA 4H8IA 1Y3QA 4NX1A 3H3GA 2HXWA 2BJIA 5IZ3A 2XWVA 3CHGA 5ET6A 3BIHA 4QSCA 2PCRA 4GQOA 1JEUA 2RC7A 5ESYA 1NUWA 2DWIA 4GX6A 2Y5KA 4KQPA 3FATA 2PYYA 2NOOA 2ANJA 4R6HA 2V25A 2CMOA 3T9HB 1G0HA 3LSWA 1JVXA 5H8HB 2H25A 4DXCA 1IXGA 2PMSA 2ZNSA 4L17A 1MY0A 2ABHA 4LONB 2OLBA 2P3NA 3G3FA 4N8GA 4ZEFA 2PX1A 1DTZA 1A99A 2I0CA 1LAXA 3IL1B 3IOWA 2DSFA 3LV0A 1MQJA 4RY1A 3QMFA 5FTIA 4GXAA 1M5DA 4PTKA 2LAOA 1FBGA 2F34A 4I9DA 4LN5A 3OENA 3OO9A 4XTCQ 3G3GA 1A40A 1FCKA 1IXCA 2CZKA 2X7QA 4RK2A 4GL8A 4X9TA 2REGA 1DPEA 2XWIA 3TYHA 5F7VA 1IMCA 4U4XA 4DCXA 3HO7A 3OD7A 5EQ9A 4POXA 1B40A 1VE4A 5AA1A 2FNCA 3H4ZA 4IO3A 2H5YA 4OVJA 2GRVA 4FEBA 3UP9A 4F39A 4H1XA 1FBHA 4ZE9A 1ZJLA 1B3GA 3QAXA 4JXIA 4PCDA 5AA2A 3C33A 1UTHA 3VLVA 1QKAA 4O3BA 4RJZA 1AWBA 2YLNA 2R71A 1LSTA 5M2VA 3E78A 4OYVA 1FQAA 3IB2A 3BBRA 1P1UA 3TQWA 5IM2A 4RA1A 3R6UA 2KQZA 3DP4A 4OHNA 1CE2A 4XFEA 2HXRA 4U21A 4KHZE 4ESWA 4ZEBA 4OVTA 3SDFA 4LQ2A 4DXBA 4OEVA 2VHAA 1DK4A 3FXRA 5CBSA 1IEJA 1SVXB 4ZZEA 2G93A 3ISPA 4OFJA 4EQBA 2I6EA 1N3WA 1NV2A 3EN3A 2YPNA 5I56B 3OEMA 3U92A 3D1RA 1SW5A 4P8BA 1S7YA 1NH8A 3OELA 4OXVA 4PF8A 3MZBA 5EYHA 1NUZA 5K2YA 3DP8A 3A09A 2RCAA 1URGA 4MNPA 1LBYA 4PE3A 4OVSA 2P3VA 2B4MA 4GFRA 4I8CA 4F3GA 4JVIA 2PFYA 4GWUA 3TTLA 2WX9A 3MVZA 3RN8A 1FW0A 2F36A 4YKPA 1RDZA 4MLVA 3V5AA 1XS5A 5I2KB 2O7UA 3IX1A 1GTKA 2ZYMA 3EHUA 3MSTA 4R6YA 1RDXA 1B0HA 4HTGA 4X04A 3TTRA 4IO7A 2FYIA 3SEWA 4IGTA 2XXPA 1RYXA 5DTBA 2O1MA 4F22A 4KCCA 4H5FA 1AMFA 2Y84A 4G61A 5TP9B 4PFTA 1NUYA 1ZIUA 4JWOA 3S9NC 4F3BA 1FQEA 1AOVA 1NV6A 3TQLA 1Y9UA 4OA4A 3S4UA 4KXPA 2O1LA 1FBEA 2CEXA 4MHFA 2FIEA 2ZNUA 2QRYA 1B3FA 2ESNA 1LBZA 1B3LA 4H45A 4NWCA 5I58B 2GFEA 3BIGA 3TTNA 2DE2A 1MXXA 4ZE8A 1BLFA 4PF6A 4HCYA 5CMKA 3QUJA 3O28A 3HFUA 2BJJX 4Q5TA 1TFDA 4YICA 1PC3A 2DXYA 3FBPA 2DWHA 3SETA 4N81A 3MW0A 4NMYA 5EHSA 3FIRA 1ZLQA 1H3DA 1RYOA 4I62A 3TTMA 2F6GA 1OIBA 4PGPA 2A5TA 1XI6A 3U1OA 1IXHA 2NUVA 4YB7A 1Y4TA 1Y1MA 4OVRA 1R6ZA 4DXUA 4NF4B 4QBAA 2RKMA 2I0BA 1OMPA 3DP6A 2VPOA 2VD2A 1FQBA 4OVQA 3UGWA 1PDAA 3BFTA 3PTYA 4KYSA 5DVFA 3F11A 2WYKA 3U94A 1XOCA 3H06B 2ZXTA 1N04A 4DZ1A 5EQAA 1H45A 1ZMGA 4Q8RA 1B3HA 4WEDA 3TODA 5ET8A 1TFAA 3U8QA 4RYAA 5IAIA 5H8QA 4MFIA 2Y7RA 3FGSA 2PT1A 3O2AA 2F6PA 1ATGA 2A5TB 3T0JA 3RY3A 3TAJA 2R8TA 3SEYA 4RXLA 3VDFA 2XXYA 3PPNA 2O7IA 4JSOA 4YB5A 2QJEA 1KA0A 1MXWA 3KGCA 3FVKA 4PFYA 3IOUA 1FPJA 1II5A 4R72A 4XXUA 1KA1A 3HHGA 2W7YA 3G7WA 1PB8A 5I57B 1LBBA 1NMUA 3CG1A 3K02A 3RLFE 3FVOA 4NF6A 2CZIA 2QS3A 3O9PA 1B2HA 1MG1A 4Q0CA 2WBDA 4ELPA 4G4PA 3FD3A 3K6WA 4IY6A 3RPLB 4NEDA 3KFMA 1NFTA 1JVYA 2PFZA 2Y7KA 1D9VA 2VD3A 3FXQA 1I6BA 4NQ8A 1O63A 4PFWA 1BK4A 3EQ1A 4PFIA 1B05A 1FTJA 1FRPA 3FJ7A 4N91A 5DEXA 4ZECA 1M5BA 4OANA 2AL4A 2Q2CA 4XF5A 1P99A 4Z0IA 2H99A 3K4UA 1LAHE 3CRBA 1FPFA 1PEBA 4RPNA 3GLBA 3W9VA 1MQDA 1FPDA 3PPOA 4MH5A 4DLDA 3EKIA 4MX6A 3QXMA 4XKNA 3TPAA 1INPA 2F3DA 1ELJA 3HPIA 1MXVA 2Y7WA 3U72A 2DWJA 1R1NA 2NWJA 2I49A 1MM7A 2VP1A 5KDTA 3IO4A 4XKRA 2Q8JA 1MY4A 1AL3A 3IFCA 2QS1A 2NXOA 1OVBA 1Q1KA 2H98A 4QSDA 2F97A 4GX3A 4I3EA 1OQGA 4NG7A 4LP2B 4LZ7A 4N6KA 4DDDA 4MAGA 2QMXA 5AE4A 2XX8A 4JVCA 5JK4A 3DLNA 4G68A 4Q30B 1K9ZA 4TLMB 2UVIA 2FA7A 1Q9DA 3K1NA 1B1HA 2ZZVA 2XXUA 4QXDA 4G77A 2O6AA 2QL3A 1NNFA 1MQHA 3FZVA 5H8FA 3E4RA 1B9JA 5K2XA 2XXXA 1SW1A 1NNTA 3K01A 2XXVA 2FVZA 2HCAA 4YKKA 3CI8A 3TELA 5LOMA 2QVUA 4GOTA 3K6XA 1DSNA 1JP4A 2HFBA 1KWHA 2O68A 4ELQA 2GH9A 1KZ8A 5TPAB 2DOJA 2D21A 1MPCA 4KFQA 1FBPA 3ZSFA 2QVRA 4P1LA 3Q25A 4HS7A 5F24A 4ESXA 4AB6A 1PBQA 2I3VA 1FTOA 2FIXA 1LFHA 1MXZA 4BDRA 1LB9A 1NH7A 1NL5A 3THIA 1N3XA 2OK2A 3IB0A 3AXFA 1YXIA 2ZZWA 2RINA 5A5XA 1YTVA 3U93A 1JEVA 3HSTA 1IMAA 4NF8A 3PPPA 3QUFA 1MXYA 5ICTA 4H46A 2OJTA 3BKIB 4ECFA 4U4SA 3TCGA 2GHBA 4PAIA 5IZ3B 1T0KA 1B5HA 3VV5A 1IMDA 4KPTA 3Q26A 4IO2A 1R9LA 3G3HA 5CRYA 4NN3A 2ZYKA 1SYHA 4N6DA 3FJGA 4MF3A 5H8NA 5ET7A 1J1NA 4FE8A 2CEYA 4FAJA 1MY2A 3IFAA 3C35A 4H8JA 1I69A 3ILUB 2P0SA 1OLAA 1B5JA 3KC0A 1DPPA 4MBPA 4R2BA 2V93A 4OERA 3VE1B 3O6HA 3HN0A 1MS7A 3M3LA 5CMCA 2Q2AA 1MY1A 1JQFA 5AA4A 5A5XB 4YAHX 1Q35A 1LGBC 4O3CA 4NF8B 1FPLA 3M8UA 3G3IA 3FVNA 4IR8A 4O8MA 4GL0A 2I48A 1A7LA 1GVCA 4XIGQ 2RC8A 3PMVA 2PVUA 3LR1A 4DI4B 2DP8A 1CB6A 3VLUA 2Y5LA 1FPIA 3LUZA 1NI9A 2I4BA 2MKZA 1F9BA 5HBCA 3UIFA 2OX3A 4OTEA 2P2AA 3MPLA 5JTYA 2F7CA 4IO5A 3RT6B 3LSXA 4OEUA 4JDFA 4BDQA 4BDNA 1CNQA 4X1BA 1XHYA 3Q27A 1IITA 1OQHA 3OSRA 4R73A 4C0RA 4N13A 5AA2B 3KN8A 3PUXE 4QFKA 4JVDA 5T3JA 1UTHB 1MRPA 4MCOA 1NV1A 1B7ZA 2V3QA 3E13X 1H44A 2QPQA 3O66A 3IOTA 4BDOA 1NUXA 1IMFA 5AA4B 1GV8A 3W9WA 4IO4A 3T9VA 1EZOA 3SEVA 3FVGA 4UACA 5BWJA 4MNCA 3SEXA 4JWXA 3USDA 5TU0A 1ZKBA 4FBPA 1FJ6A 4FATA 1GGGA 2DQVA 1USYH 4U1ZA 4WXJA 4BDLA 2F3BA 5JEIA 2CZLA 4P56A 4NGUA 2Z8EA 3O6GA 5HM4B 4NF5A 2G29A 3IAZA 1B58A 3ZKKA 2I4CA 2HAVA 2DYXA 4PAKA 4O94A 2O84X 3D4GA 1FBCA 1GR2A 1FBDA 3MJNA 2AYSA 2Y7IA 2JJKA 5CI5A 5I3SA 1B4ZA 4PC9A 5CBRA 2ZYNA 5ISUA 1BKAA 1UIVA 2B4LA 3RYDA 4H67A 4GXSB 4G2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGY A;  2D5W A;  4F1V A;  4OMB A;  1QVS A;  3MWB A;  4AQ4 A;  1QW0 A;  4RK9 A;  4NHB A;  3MZ1 A;  4H5G A;  3C9H A;  3OOA A;  1P1W A;  1B1X A;  3MVY A;  4DI3 D;  3K00 A;  4ZDM A;  5DVJ A;  4F2O A;  4NF5 B;  1OLC A;  3L6H A;  3N5L A;  3TEP A;  4PGN A;  3CR9 A;  4YKJ A;  1ZU0 A;  2A5S A;  4OVP A;  4EQ7 A;  1XVY A;  1LLS A;  1ZBM A;  2UXA A;  1MQI A;  1LCT A;  1MPD A;  5AA2 D;  4GWO A;  1P1Q A;  5KZT A;  1SI0 A;  4P3L A;  1PB7 A;  4OEN A;  2IA4 A;  5FTH A;  3OO7 A;  3T22 A;  3TMG A;  4LZ8 A;  1US5 A;  4MMP A;  3MPK A;  3FV1 A;  1POY 1;  2XWK A;  2Z8F A;  3Q29 A;  3KEI A;  2OCU A;  3FV2 A;  3PD8 A;  1TT1 A;  1QJM A;  4YU0 A;  2Q89 A;  1Y4C A;  1JNF A;  3TDJ A;  3TTK A;  2XWO A;  4YMB A;  3S9M C;  2XX9 A;  2XXH A;  4KYD A;  3U65 A;  1Y3P A;  5I7I A;  3S2V A;  3IOR A;  3CSB A;  4F2Q A;  4IB2 A;  3I5O A;  4F31 B;  2DXR A;  4QHQ A;  1IUD A;  5CMB A;  4BDM A;  2V84 A;  4U1O A;  5I59 A;  4QFL A;  1MPB A;  4GVO A;  1SQY A;  2RC9 A;  5IZZ A;  1BTJ A;  1EU8 A;  1MQG A;  5FHN A;  2OZZ A;  1SW4 A;  4R9G A;  2YJP A;  4DE8 A;  2F8D A;  4F1Y A;  1UTB A;  1XC1 A;  4JBZ A;  3H6V A;  5ELV A;  3PD9 A;  3PUY E;  1WVJ A;  3T93 B;  3K6U A;  4ELR A;  2Y7P A;  5L8D A;  2HPG A;  1SBP A;  2QMW A;  1A8F A;  5H8Q B;  4KR5 A;  3GYY A;  1LAF E;  3VLW A;  4EXL A;  1SI1 A;  3VXB A;  1B52 A;  3G3J A;  3RTW B;  3A3C A;  4RPO A;  2V3T A;  1D4N A;  2WYP A;  2OWT A;  2ZNT A;  3TKD A;  5I59 B;  1SYI A;  3HCQ A;  1RKM A;  1BP5 A;  4X48 A;  3VXC A;  4H65 A;  2HQ0 A;  2HZK A;  3KN3 A;  4G68 C;  2DE4 A;  3GXA A;  3GBB A;  1DTG A;  3BFU A;  4G8H A;  3N26 A;  3LBS A;  4GF8 A;  5KCJ A;  1MM6 A;  3H03 A;  4QFO A;  4NF6 B;  3LC8 A;  4ZED A;  2PT2 A;  4F18 A;  4PFR A;  2XXR A;  3D4C A;  4F3S A;  3M3K A;  1Y3N A;  4LQ5 A;  4ONY A;  1N76 A;  2Z23 A;  2IEE A;  4QFP A;  2ZYO A;  4OQO A;  4MIJ A;  2XD3 A;  2F7A A;  3RTF B;  5DEX B;  4PP0 A;  4TLL B;  1EZP A;  4C1T A;  3OO8 A;  3FJM A;  2Z8D A;  1NKX A;  2V4C A;  3RUM A;  1IQ7 A;  3R7X A;  1Y1Z A;  2XXW A;  1PB9 A;  3RNN A;  1UIU A;  2Q88 A;  3H6T A;  3S9L C;  3JZJ A;  4P9K A;  3K1P A;  1B32 A;  4C1U A;  4K3F A;  4PBQ A;  3K2D A;  1TWY A;  4M4G A;  4X1D A;  4OFL A;  3JYR A;  5FHM A;  4R6K A;  4P47 A;  4ZEK A;  1LAG E;  2UVG A;  4F3P A;  3LSL A;  4PFU A;  4KI0 E;  5AA3 A;  2H9B A;  5ITO A;  2VOZ A;  3TCF A;  1JET A;  2M8C A;  5KDT B;  5CC2 A;  3GZG A;  2UYF A;  3EF7 A;  2AIX A;  3MC2 A;  2XXK A;  2QSX A;  1WOD A;  4FJP A;  4F19 A;  4N4U A;  1P1O A;  1VSO A;  1MXU A;  1EZ9 A;  3MP8 A;  4N8Y A;  2O51 A;  4FEC A;  4KCD A;  5ICQ A;  2ZZX A;  1A8E A;  4ISU A;  1JW1 A;  1M5F A;  4G68 B;  3B7D A;  5IGA A;  3C4M A;  3H6U A;  3KBR A;  3T9U A;  4OZ9 A;  2XX7 A;  4P0G A;  2I58 A;  4FED A;  4N17 A;  5H8F B;  1N84 A;  2UVH A;  2D3I A;  4N07 A;  2THI A;  1MH4 A;  5CMM A;  3UA8 A;  5EYF A;  4U23 A;  3O29 A;  2RF1 A;  2UVJ A;  5H8S A;  3C32 A;  3SEU A;  3MP1 A;  4RNS A;  1US4 A;  4Z7E A;  4EXK A;  3EPE A;  2HAU A;  3IJX B;  4XKQ A;  3R26 A;  3QSL A;  2VPN A;  1LBC A;  1XVX A;  4O7M A;  4WEP A;  1TXF A;  4QSE A;  1FQD A;  4OFO A;  3W15 C;  3K1M A;  4PDD A;  5HPQ A;  1S9T A;  1ZTY A;  5F1Q A;  4EF1 A;  3ZKL A;  4P0I A;  3MUQ A;  3B6Q A;  1MDP 1;  5I56 A;  1ANF A;  4I1D A;  2XXQ A;  4JWY A;  3WAE A;  4N6P A;  3CG3 A;  3HHF A;  4F1U A;  4MNI A;  1I6Q A;  5B70 A;  4PFB A;  4ZS9 A;  2XXT A;  1A54 A;  3PUZ E;  2ONS A;  4QFN A;  1MDQ A;  5H8N B;  1PBP A;  2HEU A;  4EF2 A;  4E0X A;  5I2N A;  5I2K A;  2REJ A;  1IZ1 A;  3SER A;  1M5E A;  4JB7 A;  3E9X A;  4OWD A;  4M1V A;  4WKM A;  2OBG A;  1VR5 A;  4E0W A;  4NAP A;  1FQF A;  3E3K A;  3KSJ A;  2UYE A;  1L5T A;  3MVW A;  1DMB A;  4OET A;  4G8N A;  3EHT A;  4PBH A;  1B3E A;  4UA8 A;  3ZS6 A;  3UK4 A;  2X7P A;  3IO6 A;  5TP9 A;  4N15 A;  2B3F A;  4X8R A;  4R9F A;  4XEQ A;  3M3F A;  3CFZ A;  3IR1 A;  3CFX A;  1IXI A;  3TUS A;  4KD5 A;  2DVC A;  3PV0 E;  3L6G A;  4GRK A;  4G8M A;  5CM6 A;  3MVX A;  3MQ9 A;  3N6T A;  4U2R A;  5I58 A;  1LB8 A;  3I6V A;  2P1S A;  3MBP A;  5JTY B;  4DCY A;  5I2N B;  4YMA A;  3T66 A;  2ONK E;  3ILT B;  3OMB A;  1B5I A;  3VFJ A;  3I3V A;  1QUJ A;  3A3U A;  3VVE A;  3PPQ A;  3FUZ A;  1N0T A;  3KG2 A;  2ZMB A;  1B51 A;  3TFL A;  4R74 A;  5L9S A;  1S50 A;  3QIM A;  4NF0 A;  1USY E;  1UQW A;  5BUU A;  4IGR A;  1SD3 A;  1IIW A;  1MY3 A;  2XHD A;  4TQU Q;  3K0V A;  4LA9 A;  3KZG A;  1QUK A;  2AL5 A;  3OEK A;  2OWS A;  3V8X B;  1FQC A;  1H43 A;  3QYT A;  4NF4 A;  2I3W A;  3MP6 A;  3IK6 B;  4NWD A;  5I5P A;  2DS9 A;  2XA5 A;  4R2F A;  3MAM A;  1JW4 A;  1BIY A;  1URD A;  3IOV A;  1B4H A;  3IB1 A;  4POW A;  4PQJ A;  1B0L A;  3DM0 A;  1B7U A;  2R6G E;  3CIJ A;  3N94 A;  1QUI A;  4MLQ A;  2F7B A;  5DVI A;  3FXU A;  3H7M A;  2F78 A;  4ZEI A;  2E1S A;  4GLI A;  1HSL A;  3PU5 A;  4EQ9 A;  2KLF A;  1H76 A;  3VVD A;  3ODB A;  1URS A;  4QF9 A;  1Z7N E;  3PPR A;  3PUV E;  5DYH A;  4TOZ A;  1YAE A;  3SKP A;  5I57 A;  2DE3 A;  3G3K A;  2DVZ A;  1LFI A;  2QS4 A;  2X26 A;  3RPW A;  4EUO A;  1YCJ A;  3SES A;  1QUL A;  1AIV A;  4YB6 A;  1LCF A;  3TCH A;  1LFG A;  4LAT A;  4XKP A;  3N6U A;  2R9J A;  3LUY A;  3KOS A;  2F5X A;  1FTK A;  3RT8 A;  4H0W A;  1HSE A;  3EHS A;  4O3A A;  3O6I A;  3RQT A;  1AH5 A;  3CSG A;  3B50 A;  4THI A;  3UN6 A;  3OO6 A;  3K6V A;  1HSJ A;  1I6A A;  1O64 A;  3GBA A;  3B6T A;  4ELO A;  5FHO A;  5EHM A;  3KJ7 A;  3C34 A;  1D9Y A;  3JV9 A;  2ONR A;  2F35 A;  1SDX A;  3CVG A;  3T9X B;  4YKI A;  4F29 A;  1A55 A;  1VFE A;  4EDP A;  4LUB A;  3OSQ A;  4GIZ A;  5J1D A;  3PGF A;  1D3K A;  5I84 A;  4PET A;  1VFD A;  1DOT A;  1NNP A;  4OES A;  1O7T A;  1WDN A;  2XXI A;  3KSX A;  4PE5 B;  1OVT A;  4YZZ A;  1NNK A;  2XD2 A;  3HV1 A;  3C31 A;  2Q9T A;  2QS2 A;  3QK6 A;  4R75 A;  2B3B A;  2ALU A;  3FXB A;  1B7H A;  2Z22 A;  5ITP A;  3O97 A;  4ND9 A;  4P11 A;  1SW2 A;  3VVF A;  4PAF A;  1MH3 A;  4NE4 A;  1N7X A;  3KOT A;  3C36 A;  4ZZA A;  1UTB B;  3FAS A;  3LSF B;  3S9E A;  2DWA A;  2V3U A;  3TZA A;  3H6W A;  4IO6 A;  4FIM A;  3Q28 A;  3PMX A;  2H4I A;  1JW5 A;  3KN7 A;  3V83 A;  1P1N A;  5IKB A;  2E0S A;  4GD5 A;  4IY5 A;  2RCB A;  3ECR A;  1B46 A;  2GHA A;  4HCW A;  3B6W A;  1Y20 A;  2O69 A;  3OXN A;  4AB5 A;  4P1E A;  1POT A;  2B65 A;  4DIG A;  2VGQ A;  1EH3 A;  3T96 B;  5TPA A;  3ONM A;  1XT8 A;  3PUW E;  4QRZ A;  3KJT A;  5H8H A;  4H6D A;  5DT6 A;  5L9M A;  2HZL A;  3CFL A;  3V89 B;  1FTL A;  4LVQ A;  4UAB A;  3IJO B;  4LZ5 A;  4U22 A;  1FTM A;  2PBW A;  3P7I A;  4MEV A;  4FOR A;  3MZ9 A;  5KCJ B;  5B7D A;  2NVU B;  1Z7M E;  4BLA A;  4NTL A;  1QKB A;  3DEL B;  4HW8 A;  5L9O A;  3PMW A;  3UOR A;  1M5C A;  4KYE A;  4PDH A;  1YPN A;  4JSD A;  2WKY A;  5LTC A;  1R9Q A;  1B6H A;  3WAF A;  1N7W A;  4H8I A;  1Y3Q A;  4NX1 A;  3H3G A;  2HXW A;  2XWV A;  4QSC A;  4GQO A;  1JEU A;  2RC7 A;  2DWI A;  4KQP A;  3FAT A;  2PYY A;  2NOO A;  2ANJ A;  4R6H A;  2V25 A;  2CMO A;  3T9H B;  3LSW A;  1JVX A;  5H8H B;  2H25 A;  4DXC A;  1IXG A;  2PMS A;  2ZNS A;  4L17 A;  1MY0 A;  2ABH A;  4LON B;  2OLB A;  3G3F A;  4N8G A;  4ZEF A;  2PX1 A;  1DTZ A;  1A99 A;  2I0C A;  1LAX A;  3IL1 B;  3IOW A;  2DSF A;  1MQJ A;  4RY1 A;  5FTI A;  4GXA A;  1M5D A;  2LAO A;  2F34 A;  4I9D A;  4LN5 A;  3OEN A;  3OO9 A;  4XTC Q;  3G3G A;  1A40 A;  1FCK A;  1IXC A;  2X7Q A;  4RK2 A;  4GL8 A;  4X9T A;  2REG A;  1DPE A;  2XWI A;  3TYH A;  5F7V A;  4U4X A;  4DCX A;  3HO7 A;  3OD7 A;  4POX A;  1B40 A;  1VE4 A;  5AA1 A;  2FNC A;  3H4Z A;  4IO3 A;  2H5Y A;  4OVJ A;  2GRV A;  4FEB A;  3UP9 A;  4F39 A;  4H1X A;  4ZE9 A;  1ZJL A;  1B3G A;  3QAX A;  4JXI A;  4PCD A;  5AA2 A;  3C33 A;  1UTH A;  3VLV A;  1QKA A;  4O3B A;  4RJZ A;  2YLN A;  2R71 A;  1LST A;  5M2V A;  4OYV A;  1FQA A;  3IB2 A;  3BBR A;  1P1U A;  3TQW A;  5IM2 A;  4RA1 A;  3R6U A;  3DP4 A;  4OHN A;  1CE2 A;  4XFE A;  4U21 A;  4KHZ E;  4ESW A;  4ZEB A;  4OVT A;  3SDF A;  4LQ2 A;  4DXB A;  4OEV A;  2VHA A;  3FXR A;  5CBS A;  1IEJ A;  1SVX B;  4ZZE A;  2G93 A;  4OFJ A;  4EQB A;  2I6E A;  1N3W A;  3EN3 A;  2YPN A;  5I56 B;  3OEM A;  3U92 A;  1SW5 A;  4P8B A;  1S7Y A;  1NH8 A;  3OEL A;  4OXV A;  4PF8 A;  3MZB A;  5K2Y A;  3DP8 A;  3A09 A;  2RCA A;  1URG A;  4MNP A;  4PE3 A;  4OVS A;  4GFR A;  4I8C A;  4F3G A;  2PFY A;  3TTL A;  2WX9 A;  3MVZ A;  3RN8 A;  1FW0 A;  2F36 A;  4YKP A;  4MLV A;  3V5A A;  1XS5 A;  5I2K B;  2O7U A;  3IX1 A;  1GTK A;  2ZYM A;  3EHU A;  4R6Y A;  1B0H A;  4HTG A;  4X04 A;  3TTR A;  4IO7 A;  2FYI A;  3SEW A;  4IGT A;  2XXP A;  1RYX A;  5DTB A;  2O1M A;  4F22 A;  4KCC A;  4H5F A;  1AMF A;  2Y84 A;  5TP9 B;  4PFT A;  1ZIU A;  4JWO A;  3S9N C;  4F3B A;  1FQE A;  1AOV A;  3TQL A;  1Y9U A;  4OA4 A;  3S4U A;  2O1L A;  4MHF A;  2CEX A;  2ZNU A;  2QRY A;  1B3F A;  2ESN A;  1B3L A;  4NWC A;  5I58 B;  2GFE A;  3TTN A;  2DE2 A;  1MXX A;  4ZE8 A;  1BLF A;  4PF6 A;  4HCY A;  5CMK A;  3QUJ A;  3O28 A;  2BJJ X;  4Q5T A;  1TFD A;  4YIC A;  1PC3 A;  2DXY A;  2DWH A;  3SET A;  3MW0 A;  4NMY A;  5EHS A;  3FIR A;  1ZLQ A;  1H3D A;  1RYO A;  4I62 A;  3TTM A;  2F6G A;  1OIB A;  4PGP A;  2A5T A;  3U1O A;  1IXH A;  2NUV A;  4YB7 A;  1Y4T A;  1Y1M A;  4OVR A;  1R6Z A;  4DXU A;  4NF4 B;  2RKM A;  2I0B A;  1OMP A;  3DP6 A;  2VPO A;  2VD2 A;  1FQB A;  4OVQ A;  3UGW A;  1PDA A;  3BFT A;  4KYS A;  5DVF A;  3F11 A;  2WYK A;  3U94 A;  1XOC A;  3H06 B;  2ZXT A;  1N04 A;  4DZ1 A;  1H45 A;  1ZMG A;  4Q8R A;  1B3H A;  4WED A;  3TOD A;  1TFA A;  3U8Q A;  4RYA A;  5IAI A;  5H8Q A;  4MFI A;  2Y7R A;  3FGS A;  2PT1 A;  3O2A A;  2F6P A;  1ATG A;  2A5T B;  3RY3 A;  3TAJ A;  3SEY A;  4RXL A;  3VDF A;  2XXY A;  3PPN A;  2O7I A;  4JSO A;  4YB5 A;  2QJE A;  1MXW A;  3KGC A;  3FVK A;  4PFY A;  3IOU A;  1II5 A;  4R72 A;  4XXU A;  3HHG A;  2W7Y A;  3G7W A;  1PB8 A;  5I57 B;  1LBB A;  1NMU A;  3CG1 A;  3K02 A;  3RLF E;  3FVO A;  4NF6 A;  2QS3 A;  3O9P A;  1B2H A;  1MG1 A;  4Q0C A;  4ELP A;  4G4P A;  3FD3 A;  3K6W A;  4IY6 A;  4NED A;  3KFM A;  1NFT A;  1JVY A;  2PFZ A;  2Y7K A;  1D9V A;  2VD3 A;  3FXQ A;  1I6B A;  4NQ8 A;  1O63 A;  4PFW A;  3EQ1 A;  4PFI A;  1B05 A;  1FTJ A;  3FJ7 A;  4N91 A;  5DEX A;  4ZEC A;  1M5B A;  4OAN A;  2AL4 A;  2Q2C A;  4XF5 A;  1P99 A;  4Z0I A;  2H99 A;  3K4U A;  1LAH E;  3CRB A;  1PEB A;  4RPN A;  3GLB A;  3W9V A;  1MQD A;  3PPO A;  4MH5 A;  4DLD A;  4MX6 A;  3QXM A;  4XKN A;  3TPA A;  1ELJ A;  3HPI A;  1MXV A;  2Y7W A;  3U72 A;  2DWJ A;  1R1N A;  2NWJ A;  2I49 A;  1MM7 A;  2VP1 A;  5KDT A;  3IO4 A;  4XKR A;  2Q8J A;  1MY4 A;  1AL3 A;  2QS1 A;  2NXO A;  1OVB A;  1Q1K A;  2H98 A;  4QSD A;  2F97 A;  1OQG A;  4NG7 A;  4LP2 B;  4LZ7 A;  4N6K A;  4DDD A;  4MAG A;  2QMX A;  5AE4 A;  2XX8 A;  5JK4 A;  3DLN A;  4G68 A;  4Q30 B;  4TLM B;  2UVI A;  2FA7 A;  3K1N A;  1B1H A;  2ZZV A;  2XXU A;  4G77 A;  2O6A A;  2QL3 A;  1NNF A;  1MQH A;  3FZV A;  5H8F A;  3E4R A;  1B9J A;  5K2X A;  2XXX A;  1SW1 A;  1NNT A;  3K01 A;  2XXV A;  2HCA A;  4YKK A;  3CI8 A;  3TEL A;  5LOM A;  4GOT A;  3K6X A;  1DSN A;  2HFB A;  1KWH A;  2O68 A;  4ELQ A;  2GH9 A;  5TPA B;  2DOJ A;  2D21 A;  1MPC A;  4KFQ A;  3ZSF A;  4P1L A;  3Q25 A;  4HS7 A;  4ESX A;  4AB6 A;  1PBQ A;  2I3V A;  1FTO A;  1LFH A;  1MXZ A;  4BDR A;  1LB9 A;  1NH7 A;  1NL5 A;  3THI A;  1N3X A;  2OK2 A;  3IB0 A;  3AXF A;  2ZZW A;  2RIN A;  5A5X A;  1YTV A;  3U93 A;  1JEV A;  3HST A;  4NF8 A;  3PPP A;  3QUF A;  1MXY A;  5ICT A;  2OJT A;  3BKI B;  4ECF A;  4U4S A;  3TCG A;  2GHB A;  4PAI A;  1T0K A;  1B5H A;  3VV5 A;  4KPT A;  3Q26 A;  4IO2 A;  1R9L A;  3G3H A;  5CRY A;  4NN3 A;  2ZYK A;  1SYH A;  4N6D A;  3FJG A;  4MF3 A;  5H8N A;  1J1N A;  4FE8 A;  2CEY A;  4FAJ A;  1MY2 A;  3C35 A;  4H8J A;  1I69 A;  3ILU B;  2P0S A;  1OLA A;  1B5J A;  1DPP A;  4MBP A;  4R2B A;  2V93 A;  4OER A;  3VE1 B;  3O6H A;  3HN0 A;  1MS7 A;  3M3L A;  5CMC A;  2Q2A A;  1MY1 A;  1JQF A;  5AA4 A;  5A5X B;  4YAH X;  1Q35 A;  1LGB C;  4O3C A;  4NF8 B;  3M8U A;  3G3I A;  3FVN A;  4O8M A;  4GL0 A;  2I48 A;  1A7L A;  1GVC A;  4XIG Q;  2RC8 A;  3PMV A;  2PVU A;  3LR1 A;  4DI4 B;  2DP8 A;  1CB6 A;  3VLU A;  2I4B A;  1F9B A;  5HBC A;  3UIF A;  4OTE A;  2P2A A;  3MPL A;  5JTY A;  2F7C A;  4IO5 A;  3RT6 B;  3LSX A;  4OEU A;  4JDF A;  4BDQ A;  4BDN A;  4X1B A;  1XHY A;  3Q27 A;  1IIT A;  1OQH A;  3OSR A;  4R73 A;  4C0R A;  4N13 A;  5AA2 B;  3KN8 A;  3PUX E;  4QFK A;  1UTH B;  1MRP A;  4MCO A;  1B7Z A;  2V3Q A;  3E13 X;  1H44 A;  2QPQ A;  3O66 A;  3IOT A;  4BDO A;  5AA4 B;  1GV8 A;  3W9W A;  4IO4 A;  3T9V A;  1EZO A;  3SEV A;  3FVG A;  4UAC A;  5BWJ A;  4MNC A;  3SEX A;  4JWX A;  3USD A;  5TU0 A;  1ZKB A;  4FAT A;  1GGG A;  2DQV A;  1USY H;  4U1Z A;  4WXJ A;  4BDL A;  5JEI A;  2CZL A;  4P56 A;  4NGU A;  2Z8E A;  3O6G A;  5HM4 B;  4NF5 A;  2G29 A;  3IAZ A;  1B58 A;  3ZKK A;  2I4C A;  2HAV A;  2DYX A;  4PAK A;  4O94 A;  2O84 X;  3D4G A;  1GR2 A;  3MJN A;  2AYS A;  2Y7I A;  5CI5 A;  1B4Z A;  4PC9 A;  5CBR A;  2ZYN A;  5ISU A;  1BKA A;  1UIV A;  4H67 A;  4GXS B;  4G2Z A; 
#chains in the Genus database with same CATH topology
 3RGY A;  2D5W A;  4F1V A;  4OMB A;  1QVS A;  3MWB A;  4AQ4 A;  1QW0 A;  4RK9 A;  4NHB A;  3MZ1 A;  4H5G A;  3C9H A;  3OOA A;  1P1W A;  1B1X A;  3MVY A;  2OWZ A;  4DI3 D;  3K00 A;  4ZDM A;  5DVJ A;  4F2O A;  5FBP A;  4NF5 B;  1OLC A;  3L6H A;  3N5L A;  3TEP A;  4PGN A;  3CR9 A;  4YKJ A;  1ZU0 A;  2A5S A;  4OVP A;  4EQ7 A;  1XVY A;  1LLS A;  1ZBM A;  2UXA A;  1MQI A;  1LCT A;  1MPD A;  5AA2 D;  4GWO A;  1P1Q A;  5KZT A;  1SI0 A;  4P3L A;  1PB7 A;  4OEN A;  2IA4 A;  5FTH A;  3OO7 A;  3T22 A;  3TMG A;  4LZ8 A;  1US5 A;  4MMP A;  4GBV A;  3MPK A;  3FV1 A;  1POY 1;  2XWK A;  2Z8F A;  3Q29 A;  3KEI A;  2OCU A;  3FV2 A;  4GWS A;  3PD8 A;  1TT1 A;  1QJM A;  4YU0 A;  2Q89 A;  1Y4C A;  1JNF A;  3TDJ A;  3TTK A;  2XWO A;  4YMB A;  3S9M C;  2XX9 A;  2XXH A;  1FPE A;  4KYD A;  3U65 A;  1Y3P A;  5I7I A;  3S2V A;  3IOR A;  3CSB A;  4F2Q A;  4IB2 A;  3I5O A;  4F31 B;  2DXR A;  4QHQ A;  1IUD A;  1DCU A;  4GBW A;  4MJO A;  2Q8M A;  5CMB A;  4BDM A;  2V84 A;  4U1O A;  5I59 A;  1FPB A;  4QFL A;  1MPB A;  4GVO A;  1SQY A;  1K9Y A;  2RC9 A;  1NV4 A;  5IZZ A;  1BTJ A;  1EU8 A;  1MQG A;  5FHN A;  2OZZ A;  5LDZ A;  1SW4 A;  3MYU A;  3B8B A;  4R9G A;  4O7I A;  2YJP A;  4DE8 A;  2F8D A;  4F1Y A;  1UTB A;  1XC1 A;  4JBZ A;  3H6V A;  5ELV A;  3PD9 A;  3PUY E;  1WVJ A;  3T93 B;  4AS5 A;  3K6U A;  4ELR A;  2Y7P A;  5L8D A;  2HPG A;  1SBP A;  2QMW A;  1A8F A;  5H8Q B;  4KR5 A;  3GYY A;  1LAF E;  3VLW A;  4EXL A;  1SI1 A;  3VXB A;  1B52 A;  3G3J A;  1RDY A;  3RTW B;  3A3C A;  4RPO A;  2V3T A;  1D4N A;  2WYP A;  1FPK A;  2OWT A;  2ZNT A;  3TKD A;  5I59 B;  1SYI A;  3HCQ A;  1RKM A;  1BP5 A;  4X48 A;  3VXC A;  4H65 A;  2HQ0 A;  2HZK A;  3KN3 A;  4G68 C;  2DE4 A;  3GXA A;  3GBB A;  1DTG A;  3BFU A;  4G8H A;  3N26 A;  3LBS A;  4GF8 A;  5KCJ A;  1MM6 A;  3H03 A;  1EYJ A;  4QFO A;  4NF6 B;  3LC8 A;  4ZED A;  2PT2 A;  4PFR A;  4F18 A;  2XXR A;  3D4C A;  4F3S A;  3M3K A;  3NOH A;  1Y3N A;  4LQ5 A;  1NV5 A;  4ONY A;  1N76 A;  2Z23 A;  2IEE A;  4QFP A;  2ZYO A;  4OQO A;  4MIJ A;  2XD3 A;  1SPI A;  2F7A A;  4I3Y A;  3RTF B;  5DEX B;  1NV3 A;  4PP0 A;  4TLL B;  1EZP A;  4C1T A;  3OO8 A;  2DDK A;  3FJM A;  2Z8D A;  1NKX A;  2V4C A;  3RUM A;  1IQ7 A;  3R7X A;  3SZP A;  1Y1Z A;  2XXW A;  1PB9 A;  3RNN A;  1UIU A;  2Q88 A;  4HE2 A;  3H6T A;  3S9L C;  3JZJ A;  4P9K A;  3K1P A;  1B32 A;  4C1U A;  4K3F A;  4PBQ A;  3K2D A;  1TWY A;  4M4G A;  4X1D A;  4OFL A;  3JYR A;  5FHM A;  4R6K A;  4P47 A;  4ZEK A;  1LAG E;  2UVG A;  4F3P A;  3LSL A;  4PFU A;  5EYG A;  1NV0 A;  4KI0 E;  5AA3 A;  2H9B A;  5ITO A;  2VOZ A;  3TCF A;  1JET A;  2M8C A;  5KDT B;  5CC2 A;  3GZG A;  2UYF A;  3EF7 A;  2AIX A;  3MC2 A;  4GWY A;  2XXK A;  1FJ9 A;  2QSX A;  1WOD A;  4FJP A;  4F19 A;  4N4U A;  1P1O A;  1VSO A;  1MXU A;  1EZ9 A;  3MP8 A;  4N8Y A;  2O51 A;  1LBV A;  4FEC A;  4KCD A;  5ICQ A;  2ZZX A;  1A8E A;  4ISU A;  1JW1 A;  1M5F A;  4G68 B;  3B7D A;  5IGA A;  5J16 A;  3C4M A;  3H6U A;  3KBR A;  3T9U A;  4OZ9 A;  2XX7 A;  4P0G A;  2I58 A;  4FED A;  4N17 A;  5H8F B;  1N84 A;  2UVH A;  2D3I A;  4N07 A;  2THI A;  1MH4 A;  5CMM A;  3UA8 A;  5EYF A;  4U23 A;  3O29 A;  2RF1 A;  2UVJ A;  5H8S A;  2CZH A;  3C32 A;  3SEU A;  3MP1 A;  4RNS A;  1US4 A;  4Z7E A;  4EXK A;  3EPE A;  2HAU A;  3IJX B;  1LEV A;  4XKQ A;  3R26 A;  3QSL A;  2VPN A;  1EYK A;  1LBC A;  1XVX A;  4O7M A;  4WEP A;  1TXF A;  4QSE A;  1FQD A;  4OFO A;  3W15 C;  1YZ0 A;  3K1M A;  4PDD A;  2VT5 A;  5HPQ A;  1S9T A;  1ZTY A;  5F1Q A;  4EF1 A;  3ZKL A;  4P0I A;  3MUQ A;  2WEF A;  3B6Q A;  1MDP 1;  5I56 A;  1ANF A;  4I1D A;  2XXQ A;  4JWY A;  3WAE A;  4N6P A;  3CG3 A;  3HHF A;  4F1U A;  4MNI A;  1I6Q A;  5B70 A;  4PFB A;  4ZS9 A;  2XXT A;  1A54 A;  3PUZ E;  2ONS A;  3E79 A;  5EQ8 A;  4QFN A;  1MDQ A;  5H8N B;  1PBP A;  2HEU A;  4EF2 A;  4E0X A;  5I2N A;  5I2K A;  2REJ A;  1IZ1 A;  3SER A;  1M5E A;  5DW8 A;  4JB7 A;  3E9X A;  4OWD A;  4M1V A;  4WKM A;  2OBG A;  1VR5 A;  4E0W A;  5ET5 A;  4NAP A;  1FQF A;  3E3K A;  3KSJ A;  2UYE A;  1L5T A;  3MVW A;  1DMB A;  1DBZ A;  4OET A;  4G8N A;  3EHT A;  4PBH A;  1B3E A;  4I40 A;  1FSA A;  4UA8 A;  3ZS6 A;  3UK4 A;  2X7P A;  3IO6 A;  5TP9 A;  4N15 A;  2B3F A;  4X8R A;  4R9F A;  4XEQ A;  3M3F A;  2KR0 A;  3CFZ A;  3IR1 A;  3CFX A;  1IXI A;  1LBX A;  3TUS A;  4KD5 A;  4HE1 A;  2DVC A;  3PV0 E;  3L6G A;  4GRK A;  4G8M A;  5CM6 A;  3KC1 A;  3MVX A;  3MQ9 A;  3N6T A;  4U2R A;  5I58 A;  1LB8 A;  3I6V A;  2P1S A;  3MBP A;  5A5L A;  5JTY B;  4DCY A;  5I2N B;  4YMA A;  3T66 A;  2ONK E;  2WBB A;  3ILT B;  3OMB A;  1B5I A;  3VFJ A;  3I3V A;  4GWX A;  1QUJ A;  3A3U A;  3VVE A;  3PPQ A;  3FUZ A;  1N0T A;  3KG2 A;  2ZMB A;  1B51 A;  3TFL A;  4R74 A;  5L9S A;  1S50 A;  3QIM A;  4NF0 A;  1USY E;  1UQW A;  2HHM A;  5BUU A;  4IGR A;  1SD3 A;  1IIW A;  1MY3 A;  2XHD A;  1YYZ A;  4TQU Q;  3K0V A;  4LA9 A;  3KZG A;  1QUK A;  2AL5 A;  3OEK A;  1FPG A;  2OWS A;  3V8X B;  1FQC A;  1H43 A;  3QYT A;  4NF4 A;  2I3W A;  3MP6 A;  3IK6 B;  4NWD A;  5I5P A;  2DS9 A;  2XA5 A;  4R2F A;  3MAM A;  1JW4 A;  1VDW A;  5EQ7 A;  1BIY A;  4AS4 A;  1URD A;  3IOV A;  1B4H A;  3IB1 A;  4POW A;  4PQJ A;  1IME A;  1B0L A;  3DM0 A;  1B7U A;  2R6G E;  3CIJ A;  3N94 A;  1QUI A;  4MLQ A;  2F7B A;  5DVI A;  4HXV A;  3FXU A;  3H7M A;  2F78 A;  2L5V A;  4ZEI A;  2E1S A;  3KBZ A;  4GLI A;  3A29 A;  1HSL A;  3PU5 A;  1G0I A;  4EQ9 A;  2KLF A;  1H76 A;  3VVD A;  3ODB A;  1URS A;  4QF9 A;  1Z7N E;  3PPR A;  3PUV E;  5DYH A;  4TOZ A;  1YAE A;  1FTA A;  1FBF A;  3SKP A;  5I57 A;  1NV7 A;  4GX4 A;  2DE3 A;  3G3K A;  2DVZ A;  1LFI A;  2QS4 A;  2X26 A;  5IZ1 A;  3RPW A;  4EUO A;  1YCJ A;  3SES A;  1QUL A;  1AIV A;  4YB6 A;  1LCF A;  3TCH A;  1LFG A;  4LAT A;  4XKP A;  3N6U A;  2R9J A;  3RPL A;  3LUY A;  3KOS A;  2F5X A;  1FTK A;  3RT8 A;  4H0W A;  1HSE A;  3EHS A;  4O3A A;  3O6I A;  3RQT A;  2FBP A;  1AH5 A;  3CSG A;  3B50 A;  4THI A;  3UN6 A;  4GWZ A;  3OO6 A;  3K6V A;  1HSJ A;  1I6A A;  1O64 A;  3GBA A;  3B6T A;  4ELO A;  5FHO A;  5EHM A;  3KJ7 A;  3C34 A;  1D9Y A;  3JV9 A;  2ONR A;  2F35 A;  1SDX A;  3CVG A;  3T9X B;  4YKI A;  4F29 A;  1A55 A;  1VFE A;  4EDP A;  1IMB A;  4LUB A;  3OSQ A;  4GIZ A;  5J1D A;  3PGF A;  1D3K A;  5I84 A;  4PET A;  1VFD A;  1DOT A;  1NNP A;  4OES A;  1O7T A;  3ROJ A;  1WDN A;  2XXI A;  3KSX A;  4PE5 B;  1OVT A;  4YZZ A;  3T1B A;  1NNK A;  2XD2 A;  3HV1 A;  2FHY A;  3C31 A;  2Q9T A;  2QS2 A;  3QK6 A;  4R75 A;  2B3B A;  2ALU A;  3FXB A;  1B7H A;  2Z22 A;  5ITP A;  3O97 A;  4ND9 A;  1QGX A;  4P11 A;  1SW2 A;  3VVF A;  4PAF A;  4GWW A;  1MH3 A;  4NE4 A;  1N7X A;  3KOT A;  3C36 A;  4ZZA A;  1UTB B;  3FAS A;  3LSF B;  3S9E A;  2DWA A;  2V3U A;  3TZA A;  3H6W A;  4IO6 A;  4FIM A;  3Q28 A;  3PMX A;  1LBW A;  1JW5 A;  2H4I A;  3KN7 A;  3V83 A;  1P1N A;  5IKB A;  2E0S A;  4GD5 A;  4IY5 A;  2RCB A;  3ECR A;  1B46 A;  2GHA A;  4HCW A;  3B6W A;  1Y20 A;  2O69 A;  3OXN A;  4P1E A;  4AB5 A;  2Q74 A;  1POT A;  2B65 A;  4DIG A;  2QFL A;  2VGQ A;  1EH3 A;  3T96 B;  5TPA A;  3ONM A;  1XT8 A;  3PUW E;  4HE0 A;  3KJT A;  4QRZ A;  5H8H A;  4H6D A;  5DT6 A;  5L9M A;  2HZL A;  2GQ1 A;  3CFL A;  3V89 B;  1FTL A;  4LVQ A;  4UAB A;  3IJO B;  4LZ5 A;  4U22 A;  1FTM A;  2PBW A;  3P7I A;  4MEV A;  4FOR A;  3MZ9 A;  5KCJ B;  5B7D A;  2NVU B;  1Z7M E;  4BLA A;  1D9Q A;  4NTL A;  1QKB A;  3DEL B;  4HW8 A;  1EYI A;  2QVV A;  5L9O A;  3PMW A;  3UOR A;  1M5C A;  4KYE A;  4PDH A;  1YPN A;  4JSD A;  2WKY A;  5LTC A;  1R9Q A;  1B6H A;  3WAF A;  1N7W A;  4H8I A;  1Y3Q A;  4NX1 A;  3H3G A;  2BJI A;  2HXW A;  5IZ3 A;  2XWV A;  3CHG A;  5ET6 A;  3BIH A;  4QSC A;  2PCR A;  4GQO A;  1JEU A;  2RC7 A;  5ESY A;  1NUW A;  2DWI A;  4GX6 A;  2Y5K A;  4KQP A;  3FAT A;  2PYY A;  2NOO A;  2ANJ A;  4R6H A;  2V25 A;  2CMO A;  3T9H B;  1G0H A;  3LSW A;  1JVX A;  5H8H B;  2H25 A;  4DXC A;  1IXG A;  2PMS A;  2ZNS A;  4L17 A;  1MY0 A;  2ABH A;  4LON B;  2OLB A;  2P3N A;  3G3F A;  4N8G A;  4ZEF A;  2PX1 A;  1DTZ A;  1A99 A;  2I0C A;  1LAX A;  3IL1 B;  3IOW A;  2DSF A;  3LV0 A;  1MQJ A;  4RY1 A;  3QMF A;  5FTI A;  4GXA A;  1M5D A;  4PTK A;  2LAO A;  1FBG A;  2F34 A;  4I9D A;  4LN5 A;  3OEN A;  3OO9 A;  4XTC Q;  3G3G A;  1A40 A;  1FCK A;  1IXC A;  2CZK A;  2X7Q A;  4RK2 A;  4GL8 A;  4X9T A;  2REG A;  1DPE A;  2XWI A;  3TYH A;  5F7V A;  1IMC A;  4U4X A;  4DCX A;  3HO7 A;  3OD7 A;  5EQ9 A;  4POX A;  1B40 A;  1VE4 A;  5AA1 A;  2FNC A;  3H4Z A;  4IO3 A;  2H5Y A;  4OVJ A;  2GRV A;  4FEB A;  3UP9 A;  4F39 A;  4H1X A;  1FBH A;  4ZE9 A;  1ZJL A;  1B3G A;  3QAX A;  4JXI A;  4PCD A;  5AA2 A;  3C33 A;  1UTH A;  3VLV A;  1QKA A;  4O3B A;  1AWB A;  4RJZ A;  2YLN A;  2R71 A;  1LST A;  5M2V A;  3E78 A;  4OYV A;  1FQA A;  3IB2 A;  3BBR A;  1P1U A;  5IM2 A;  3TQW A;  4RA1 A;  2KQZ A;  3R6U A;  3DP4 A;  4OHN A;  1CE2 A;  4XFE A;  2HXR A;  4U21 A;  4KHZ E;  4OVT A;  4ZEB A;  4ESW A;  3SDF A;  4LQ2 A;  4DXB A;  4OEV A;  2VHA A;  1DK4 A;  3FXR A;  5CBS A;  1IEJ A;  1SVX B;  4ZZE A;  2G93 A;  3ISP A;  4OFJ A;  4EQB A;  2I6E A;  1N3W A;  1NV2 A;  3EN3 A;  2YPN A;  5I56 B;  3OEM A;  3U92 A;  3D1R A;  1SW5 A;  4P8B A;  1S7Y A;  1NH8 A;  4PF8 A;  3OEL A;  4OXV A;  3MZB A;  5EYH A;  1NUZ A;  5K2Y A;  3DP8 A;  3A09 A;  2RCA A;  1URG A;  4MNP A;  1LBY A;  4PE3 A;  4OVS A;  2P3V A;  2B4M A;  4GFR A;  4I8C A;  4JVI A;  4F3G A;  2PFY A;  4GWU A;  2WX9 A;  3TTL A;  3MVZ A;  3RN8 A;  1FW0 A;  2F36 A;  4YKP A;  1RDZ A;  4MLV A;  3V5A A;  1XS5 A;  5I2K B;  2O7U A;  3IX1 A;  1GTK A;  2ZYM A;  3EHU A;  3MST A;  4R6Y A;  1RDX A;  1B0H A;  4HTG A;  4X04 A;  3TTR A;  4IO7 A;  2FYI A;  3SEW A;  4IGT A;  2XXP A;  1RYX A;  5DTB A;  2O1M A;  4F22 A;  4KCC A;  4H5F A;  1AMF A;  2Y84 A;  4G61 A;  5TP9 B;  4PFT A;  1NUY A;  1ZIU A;  4JWO A;  3S9N C;  4F3B A;  1FQE A;  1AOV A;  1NV6 A;  3TQL A;  1Y9U A;  4OA4 A;  3S4U A;  4KXP A;  1FBE A;  2O1L A;  2CEX A;  4MHF A;  2FIE A;  2ZNU A;  2QRY A;  1B3F A;  2ESN A;  1LBZ A;  1B3L A;  4H45 A;  4NWC A;  5I58 B;  2GFE A;  3BIG A;  3TTN A;  2DE2 A;  1MXX A;  4ZE8 A;  1BLF A;  4PF6 A;  4HCY A;  5CMK A;  3QUJ A;  3O28 A;  3HFU A;  2BJJ X;  4Q5T A;  1TFD A;  4YIC A;  1PC3 A;  2DXY A;  3FBP A;  2DWH A;  3SET A;  4N81 A;  3MW0 A;  4NMY A;  5EHS A;  3FIR A;  1ZLQ A;  1H3D A;  1RYO A;  4I62 A;  3TTM A;  2F6G A;  1OIB A;  4PGP A;  2A5T A;  1XI6 A;  3U1O A;  1IXH A;  2NUV A;  4YB7 A;  1Y4T A;  1Y1M A;  4OVR A;  1R6Z A;  4DXU A;  4NF4 B;  4QBA A;  2RKM A;  2I0B A;  1OMP A;  2VPO A;  3DP6 A;  2VD2 A;  1FQB A;  4OVQ A;  3UGW A;  1PDA A;  3BFT A;  3PTY A;  4KYS A;  5DVF A;  3F11 A;  2WYK A;  3U94 A;  1XOC A;  3H06 B;  2ZXT A;  1N04 A;  4DZ1 A;  5EQA A;  1H45 A;  1ZMG A;  4Q8R A;  1B3H A;  4WED A;  5ET8 A;  3TOD A;  1TFA A;  3U8Q A;  4RYA A;  5IAI A;  5H8Q A;  4MFI A;  2Y7R A;  3FGS A;  2PT1 A;  3O2A A;  2F6P A;  1ATG A;  2A5T B;  3T0J A;  3RY3 A;  3TAJ A;  2R8T A;  3SEY A;  4RXL A;  3VDF A;  2XXY A;  3PPN A;  2O7I A;  4JSO A;  4YB5 A;  2QJE A;  1KA0 A;  1MXW A;  3KGC A;  3FVK A;  4PFY A;  3IOU A;  1FPJ A;  1II5 A;  4R72 A;  4XXU A;  1KA1 A;  3HHG A;  2W7Y A;  3G7W A;  1PB8 A;  5I57 B;  1LBB A;  1NMU A;  3CG1 A;  3K02 A;  3RLF E;  3FVO A;  4NF6 A;  2CZI A;  2QS3 A;  3O9P A;  1B2H A;  1MG1 A;  4Q0C A;  2WBD A;  4ELP A;  4G4P A;  3FD3 A;  3K6W A;  4IY6 A;  3RPL B;  4NED A;  3KFM A;  1NFT A;  1JVY A;  2PFZ A;  2Y7K A;  1D9V A;  2VD3 A;  3FXQ A;  1I6B A;  4NQ8 A;  1O63 A;  1BK4 A;  4PFW A;  3EQ1 A;  4PFI A;  1B05 A;  1FTJ A;  1FRP A;  3FJ7 A;  4N91 A;  5DEX A;  4ZEC A;  1M5B A;  4OAN A;  2AL4 A;  2Q2C A;  4XF5 A;  1P99 A;  4Z0I A;  2H99 A;  3K4U A;  1FPF A;  1LAH E;  3CRB A;  1PEB A;  4RPN A;  3GLB A;  3W9V A;  1MQD A;  1FPD A;  3PPO A;  4MH5 A;  4DLD A;  3EKI A;  4MX6 A;  3QXM A;  4XKN A;  3TPA A;  1INP A;  2F3D A;  1ELJ A;  3HPI A;  1MXV A;  2Y7W A;  3U72 A;  2DWJ A;  1R1N A;  2NWJ A;  2I49 A;  1MM7 A;  2VP1 A;  5KDT A;  3IO4 A;  4XKR A;  2Q8J A;  1MY4 A;  1AL3 A;  3IFC A;  2QS1 A;  2NXO A;  1OVB A;  1Q1K A;  2H98 A;  4QSD A;  2F97 A;  4GX3 A;  4I3E A;  1OQG A;  4NG7 A;  4LP2 B;  4LZ7 A;  4N6K A;  4DDD A;  4MAG A;  2QMX A;  5AE4 A;  2XX8 A;  4JVC A;  5JK4 A;  3DLN A;  4G68 A;  4Q30 B;  1K9Z A;  4TLM B;  2UVI A;  2FA7 A;  1Q9D A;  3K1N A;  1B1H A;  2ZZV A;  2XXU A;  4QXD A;  4G77 A;  2O6A A;  2QL3 A;  1NNF A;  1MQH A;  3FZV A;  5H8F A;  3E4R A;  1B9J A;  5K2X A;  2XXX A;  1SW1 A;  1NNT A;  3K01 A;  2FVZ A;  2XXV A;  2HCA A;  4YKK A;  3CI8 A;  3TEL A;  5LOM A;  2QVU A;  4GOT A;  3K6X A;  1DSN A;  1JP4 A;  2HFB A;  1KWH A;  2O68 A;  4ELQ A;  2GH9 A;  1KZ8 A;  5TPA B;  2DOJ A;  2D21 A;  1MPC A;  1FBP A;  4KFQ A;  3ZSF A;  2QVR A;  4P1L A;  3Q25 A;  4HS7 A;  5F24 A;  4ESX A;  4AB6 A;  1PBQ A;  2I3V A;  1FTO A;  2FIX A;  1LFH A;  1MXZ A;  4BDR A;  1LB9 A;  1NH7 A;  1NL5 A;  3THI A;  1N3X A;  2OK2 A;  3IB0 A;  3AXF A;  1YXI A;  2ZZW A;  2RIN A;  5A5X A;  1YTV A;  3U93 A;  1IMA A;  1JEV A;  3HST A;  4NF8 A;  3PPP A;  3QUF A;  1MXY A;  5ICT A;  4H46 A;  2OJT A;  3BKI B;  4ECF A;  4U4S A;  3TCG A;  2GHB A;  4PAI A;  5IZ3 B;  1T0K A;  1B5H A;  3VV5 A;  1IMD A;  4KPT A;  3Q26 A;  4IO2 A;  1R9L A;  3G3H A;  5CRY A;  4NN3 A;  2ZYK A;  1SYH A;  4N6D A;  3FJG A;  4MF3 A;  5H8N A;  5ET7 A;  1J1N A;  4FE8 A;  2CEY A;  4FAJ A;  1MY2 A;  3IFA A;  3C35 A;  4H8J A;  1I69 A;  3ILU B;  2P0S A;  1OLA A;  1B5J A;  3KC0 A;  1DPP A;  4MBP A;  4R2B A;  2V93 A;  4OER A;  3VE1 B;  3O6H A;  3HN0 A;  1MS7 A;  3M3L A;  5CMC A;  2Q2A A;  1MY1 A;  1JQF A;  5AA4 A;  5A5X B;  4YAH X;  1Q35 A;  1LGB C;  4O3C A;  1FPL A;  4NF8 B;  3M8U A;  3G3I A;  3FVN A;  4IR8 A;  4O8M A;  4GL0 A;  2I48 A;  1A7L A;  1GVC A;  4XIG Q;  2RC8 A;  3PMV A;  2PVU A;  3LR1 A;  4DI4 B;  2DP8 A;  1CB6 A;  3VLU A;  2Y5L A;  1FPI A;  3LUZ A;  1NI9 A;  2I4B A;  2MKZ A;  1F9B A;  5HBC A;  3UIF A;  2OX3 A;  4OTE A;  2P2A A;  3MPL A;  5JTY A;  2F7C A;  4IO5 A;  3RT6 B;  3LSX A;  4OEU A;  4JDF A;  4BDQ A;  4BDN A;  1CNQ A;  4X1B A;  1XHY A;  3Q27 A;  1IIT A;  1OQH A;  3OSR A;  4R73 A;  4C0R A;  4N13 A;  5AA2 B;  3KN8 A;  3PUX E;  4JVD A;  4QFK A;  5T3J A;  1UTH B;  1MRP A;  4MCO A;  1NV1 A;  1B7Z A;  2V3Q A;  3E13 X;  1H44 A;  2QPQ A;  3O66 A;  3IOT A;  1NUX A;  4BDO A;  1IMF A;  5AA4 B;  1GV8 A;  3W9W A;  4IO4 A;  3T9V A;  1EZO A;  3SEV A;  3FVG A;  4UAC A;  4MNC A;  5BWJ A;  3SEX A;  4JWX A;  3USD A;  5TU0 A;  1ZKB A;  4FBP A;  1FJ6 A;  4FAT A;  1GGG A;  2DQV A;  1USY H;  2F3B A;  4U1Z A;  4WXJ A;  4BDL A;  5JEI A;  2CZL A;  4P56 A;  4NGU A;  2Z8E A;  3O6G A;  5HM4 B;  4NF5 A;  2G29 A;  3IAZ A;  1B58 A;  3ZKK A;  2I4C A;  2HAV A;  2DYX A;  4PAK A;  4O94 A;  2O84 X;  3D4G A;  1FBC A;  1GR2 A;  1FBD A;  3MJN A;  2AYS A;  2Y7I A;  2JJK A;  5CI5 A;  5I3S A;  1B4Z A;  4PC9 A;  5CBR A;  2ZYN A;  5ISU A;  1BKA A;  1UIV A;  2B4L A;  3RYD A;  4H67 A;  4GXS B;  4G2Z A; 
#chains in the Genus database with same CATH homology
 3RGY A;  2D5W A;  4F1V A;  4OMB A;  1QVS A;  3MWB A;  4AQ4 A;  1QW0 A;  4RK9 A;  4NHB A;  3MZ1 A;  4H5G A;  3C9H A;  3OOA A;  1P1W A;  1B1X A;  3MVY A;  2OWZ A;  4DI3 D;  3K00 A;  4ZDM A;  5DVJ A;  4F2O A;  5FBP A;  4NF5 B;  1OLC A;  3L6H A;  3N5L A;  3TEP A;  4PGN A;  3CR9 A;  4YKJ A;  1ZU0 A;  2A5S A;  4OVP A;  4EQ7 A;  1XVY A;  1LLS A;  1ZBM A;  2UXA A;  1MQI A;  1LCT A;  1MPD A;  5AA2 D;  4GWO A;  1P1Q A;  5KZT A;  1SI0 A;  4P3L A;  1PB7 A;  4OEN A;  2IA4 A;  5FTH A;  3OO7 A;  3T22 A;  3TMG A;  4LZ8 A;  1US5 A;  4MMP A;  4GBV A;  3MPK A;  3FV1 A;  1POY 1;  2XWK A;  2Z8F A;  3Q29 A;  3KEI A;  2OCU A;  3FV2 A;  4GWS A;  3PD8 A;  1TT1 A;  1QJM A;  4YU0 A;  2Q89 A;  1Y4C A;  1JNF A;  3TDJ A;  3TTK A;  2XWO A;  4YMB A;  3S9M C;  2XX9 A;  2XXH A;  1FPE A;  4KYD A;  3U65 A;  1Y3P A;  5I7I A;  3S2V A;  3IOR A;  3CSB A;  4F2Q A;  4IB2 A;  3I5O A;  4F31 B;  2DXR A;  4QHQ A;  1IUD A;  1DCU A;  4GBW A;  4MJO A;  2Q8M A;  5CMB A;  4BDM A;  2V84 A;  4U1O A;  5I59 A;  1FPB A;  4QFL A;  1MPB A;  4GVO A;  1SQY A;  1K9Y A;  2RC9 A;  1NV4 A;  5IZZ A;  1BTJ A;  1EU8 A;  1MQG A;  5FHN A;  2OZZ A;  5LDZ A;  1SW4 A;  3MYU A;  4R9G A;  3B8B A;  4O7I A;  2YJP A;  4DE8 A;  2F8D A;  4F1Y A;  1UTB A;  1XC1 A;  4JBZ A;  3H6V A;  5ELV A;  3PD9 A;  3PUY E;  1WVJ A;  3T93 B;  4AS5 A;  3K6U A;  4ELR A;  2Y7P A;  5L8D A;  2HPG A;  1SBP A;  2QMW A;  1A8F A;  5H8Q B;  4KR5 A;  3GYY A;  1LAF E;  3VLW A;  4EXL A;  1SI1 A;  3VXB A;  1B52 A;  3G3J A;  1RDY A;  3RTW B;  3A3C A;  4RPO A;  2V3T A;  1D4N A;  2WYP A;  1FPK A;  2OWT A;  2ZNT A;  3TKD A;  5I59 B;  1SYI A;  3HCQ A;  1RKM A;  1BP5 A;  4X48 A;  3VXC A;  4H65 A;  2HQ0 A;  2HZK A;  3KN3 A;  4G68 C;  2DE4 A;  3GXA A;  3GBB A;  1DTG A;  3BFU A;  4G8H A;  3N26 A;  3LBS A;  4GF8 A;  5KCJ A;  1MM6 A;  3H03 A;  1EYJ A;  4QFO A;  4NF6 B;  3LC8 A;  4ZED A;  2PT2 A;  4F18 A;  4PFR A;  2XXR A;  3D4C A;  4F3S A;  3M3K A;  3NOH A;  1Y3N A;  4LQ5 A;  1NV5 A;  4ONY A;  1N76 A;  2Z23 A;  2IEE A;  4QFP A;  2ZYO A;  4OQO A;  4MIJ A;  2XD3 A;  1SPI A;  2F7A A;  3RTF B;  4I3Y A;  5DEX B;  4PP0 A;  1NV3 A;  4TLL B;  1EZP A;  4C1T A;  3OO8 A;  2DDK A;  3FJM A;  2Z8D A;  1NKX A;  2V4C A;  3RUM A;  1IQ7 A;  3R7X A;  3SZP A;  1Y1Z A;  2XXW A;  1PB9 A;  3RNN A;  1UIU A;  2Q88 A;  4HE2 A;  3H6T A;  3S9L C;  3JZJ A;  4P9K A;  3K1P A;  1B32 A;  4C1U A;  4K3F A;  4PBQ A;  3K2D A;  1TWY A;  4M4G A;  4X1D A;  4OFL A;  3JYR A;  5FHM A;  4R6K A;  4P47 A;  4ZEK A;  1LAG E;  2UVG A;  4F3P A;  3LSL A;  4PFU A;  5EYG A;  1NV0 A;  4KI0 E;  5AA3 A;  2H9B A;  5ITO A;  2VOZ A;  3TCF A;  1JET A;  2M8C A;  5KDT B;  5CC2 A;  3GZG A;  2UYF A;  3EF7 A;  2AIX A;  3MC2 A;  4GWY A;  2XXK A;  2QSX A;  1FJ9 A;  1WOD A;  4FJP A;  4F19 A;  4N4U A;  1P1O A;  1VSO A;  1MXU A;  1EZ9 A;  3MP8 A;  4N8Y A;  2O51 A;  4FEC A;  4KCD A;  1LBV A;  5ICQ A;  2ZZX A;  1A8E A;  4ISU A;  1JW1 A;  1M5F A;  4G68 B;  3B7D A;  5IGA A;  5J16 A;  3C4M A;  3H6U A;  3KBR A;  3T9U A;  4OZ9 A;  2XX7 A;  4P0G A;  2I58 A;  4FED A;  4N17 A;  5H8F B;  1N84 A;  2UVH A;  2D3I A;  4N07 A;  2THI A;  1MH4 A;  5CMM A;  3UA8 A;  5EYF A;  4U23 A;  3O29 A;  2RF1 A;  2UVJ A;  5H8S A;  2CZH A;  3C32 A;  3SEU A;  3MP1 A;  4RNS A;  1US4 A;  4Z7E A;  4EXK A;  3EPE A;  2HAU A;  3IJX B;  1LEV A;  4XKQ A;  3R26 A;  3QSL A;  2VPN A;  1LBC A;  1EYK A;  1XVX A;  4O7M A;  4WEP A;  1TXF A;  4QSE A;  1FQD A;  4OFO A;  3W15 C;  1YZ0 A;  3K1M A;  4PDD A;  5HPQ A;  2VT5 A;  1S9T A;  1ZTY A;  5F1Q A;  4EF1 A;  3ZKL A;  4P0I A;  3MUQ A;  2WEF A;  3B6Q A;  1MDP 1;  5I56 A;  1ANF A;  4I1D A;  2XXQ A;  4JWY A;  3WAE A;  4N6P A;  3CG3 A;  3HHF A;  4F1U A;  4MNI A;  1I6Q A;  5B70 A;  4PFB A;  4ZS9 A;  2XXT A;  1A54 A;  3PUZ E;  2ONS A;  3E79 A;  5EQ8 A;  4QFN A;  1MDQ A;  5H8N B;  1PBP A;  2HEU A;  4EF2 A;  4E0X A;  5I2N A;  5I2K A;  2REJ A;  1IZ1 A;  3SER A;  1M5E A;  5DW8 A;  4JB7 A;  3E9X A;  4OWD A;  4M1V A;  4WKM A;  2OBG A;  1VR5 A;  4E0W A;  5ET5 A;  4NAP A;  1FQF A;  3E3K A;  3KSJ A;  2UYE A;  1L5T A;  3MVW A;  1DMB A;  1DBZ A;  4OET A;  4G8N A;  3EHT A;  4PBH A;  1B3E A;  4I40 A;  1FSA A;  4UA8 A;  3ZS6 A;  3UK4 A;  2X7P A;  3IO6 A;  5TP9 A;  4N15 A;  2B3F A;  4X8R A;  4R9F A;  4XEQ A;  3M3F A;  2KR0 A;  3CFZ A;  3IR1 A;  3CFX A;  1IXI A;  1LBX A;  3TUS A;  4KD5 A;  4HE1 A;  2DVC A;  3PV0 E;  3L6G A;  4GRK A;  4G8M A;  5CM6 A;  3KC1 A;  3MVX A;  3MQ9 A;  3N6T A;  4U2R A;  5I58 A;  1LB8 A;  3I6V A;  2P1S A;  3MBP A;  5A5L A;  5JTY B;  4DCY A;  5I2N B;  4YMA A;  3T66 A;  2ONK E;  3ILT B;  2WBB A;  3OMB A;  1B5I A;  3VFJ A;  3I3V A;  4GWX A;  1QUJ A;  3A3U A;  3VVE A;  3PPQ A;  3FUZ A;  1N0T A;  3KG2 A;  2ZMB A;  1B51 A;  3TFL A;  4R74 A;  5L9S A;  1S50 A;  3QIM A;  4NF0 A;  1USY E;  1UQW A;  2HHM A;  5BUU A;  4IGR A;  1SD3 A;  1IIW A;  1MY3 A;  2XHD A;  1YYZ A;  4TQU Q;  3K0V A;  4LA9 A;  3KZG A;  1QUK A;  2AL5 A;  3OEK A;  1FPG A;  2OWS A;  3V8X B;  1FQC A;  1H43 A;  3QYT A;  4NF4 A;  2I3W A;  3MP6 A;  3IK6 B;  4NWD A;  5I5P A;  2DS9 A;  2XA5 A;  4R2F A;  3MAM A;  1JW4 A;  1VDW A;  5EQ7 A;  1BIY A;  4AS4 A;  1URD A;  3IOV A;  1B4H A;  3IB1 A;  4POW A;  4PQJ A;  1IME A;  1B0L A;  3DM0 A;  1B7U A;  2R6G E;  3CIJ A;  3N94 A;  1QUI A;  4MLQ A;  2F7B A;  5DVI A;  4HXV A;  3FXU A;  3H7M A;  2F78 A;  2L5V A;  4ZEI A;  2E1S A;  3KBZ A;  4GLI A;  3A29 A;  1HSL A;  3PU5 A;  1G0I A;  4EQ9 A;  2KLF A;  1H76 A;  3VVD A;  3ODB A;  1URS A;  4QF9 A;  1Z7N E;  3PPR A;  3PUV E;  5DYH A;  4TOZ A;  1YAE A;  1FTA A;  3SKP A;  1FBF A;  5I57 A;  1NV7 A;  4GX4 A;  2DE3 A;  3G3K A;  2DVZ A;  1LFI A;  2QS4 A;  2X26 A;  3RPW A;  5IZ1 A;  4EUO A;  1YCJ A;  3SES A;  1QUL A;  1AIV A;  4YB6 A;  1LCF A;  3TCH A;  1LFG A;  4LAT A;  4XKP A;  3N6U A;  2R9J A;  3RPL A;  3LUY A;  3KOS A;  2F5X A;  1FTK A;  3RT8 A;  4H0W A;  1HSE A;  3EHS A;  4O3A A;  3O6I A;  3RQT A;  2FBP A;  1AH5 A;  3CSG A;  3B50 A;  4THI A;  3UN6 A;  4GWZ A;  3OO6 A;  3K6V A;  1HSJ A;  1I6A A;  1O64 A;  3GBA A;  3B6T A;  4ELO A;  5FHO A;  5EHM A;  3KJ7 A;  3C34 A;  1D9Y A;  3JV9 A;  2ONR A;  2F35 A;  1SDX A;  3CVG A;  3T9X B;  4YKI A;  4F29 A;  1A55 A;  1VFE A;  4EDP A;  1IMB A;  4LUB A;  3OSQ A;  4GIZ A;  5J1D A;  3PGF A;  1D3K A;  5I84 A;  4PET A;  1VFD A;  1DOT A;  1NNP A;  4OES A;  1O7T A;  3ROJ A;  1WDN A;  2XXI A;  3KSX A;  4PE5 B;  1OVT A;  4YZZ A;  3T1B A;  1NNK A;  2XD2 A;  3HV1 A;  3C31 A;  2FHY A;  2Q9T A;  2QS2 A;  3QK6 A;  4R75 A;  2B3B A;  2ALU A;  3FXB A;  1B7H A;  2Z22 A;  5ITP A;  3O97 A;  4ND9 A;  1QGX A;  4P11 A;  1SW2 A;  3VVF A;  4PAF A;  4GWW A;  1MH3 A;  4NE4 A;  1N7X A;  3KOT A;  3C36 A;  4ZZA A;  1UTB B;  3FAS A;  3LSF B;  3S9E A;  2DWA A;  2V3U A;  3TZA A;  3H6W A;  4IO6 A;  4FIM A;  3Q28 A;  3PMX A;  2H4I A;  1JW5 A;  3KN7 A;  1LBW A;  3V83 A;  1P1N A;  5IKB A;  2E0S A;  4GD5 A;  4IY5 A;  2RCB A;  3ECR A;  1B46 A;  2GHA A;  4HCW A;  3B6W A;  1Y20 A;  2O69 A;  3OXN A;  4AB5 A;  4P1E A;  2Q74 A;  1POT A;  2B65 A;  4DIG A;  2VGQ A;  2QFL A;  1EH3 A;  3T96 B;  5TPA A;  3ONM A;  1XT8 A;  3PUW E;  4QRZ A;  3KJT A;  4HE0 A;  5H8H A;  4H6D A;  5DT6 A;  5L9M A;  2HZL A;  3CFL A;  2GQ1 A;  3V89 B;  1FTL A;  4LVQ A;  4UAB A;  3IJO B;  4LZ5 A;  4U22 A;  1FTM A;  2PBW A;  3P7I A;  4MEV A;  4FOR A;  3MZ9 A;  5KCJ B;  5B7D A;  2NVU B;  1Z7M E;  4BLA A;  1D9Q A;  4NTL A;  1QKB A;  3DEL B;  4HW8 A;  1EYI A;  5L9O A;  2QVV A;  3PMW A;  3UOR A;  1M5C A;  4KYE A;  4PDH A;  1YPN A;  4JSD A;  2WKY A;  5LTC A;  1R9Q A;  1B6H A;  3WAF A;  1N7W A;  4H8I A;  1Y3Q A;  4NX1 A;  3H3G A;  2HXW A;  2BJI A;  5IZ3 A;  2XWV A;  3CHG A;  5ET6 A;  3BIH A;  4QSC A;  2PCR A;  4GQO A;  1JEU A;  2RC7 A;  5ESY A;  1NUW A;  2DWI A;  4GX6 A;  2Y5K A;  4KQP A;  3FAT A;  2PYY A;  2NOO A;  2ANJ A;  4R6H A;  2V25 A;  2CMO A;  3T9H B;  1G0H A;  3LSW A;  1JVX A;  5H8H B;  2H25 A;  4DXC A;  1IXG A;  2PMS A;  2ZNS A;  4L17 A;  1MY0 A;  2ABH A;  4LON B;  2OLB A;  2P3N A;  3G3F A;  4N8G A;  4ZEF A;  2PX1 A;  1DTZ A;  1A99 A;  2I0C A;  1LAX A;  3IL1 B;  3IOW A;  2DSF A;  3LV0 A;  1MQJ A;  4RY1 A;  3QMF A;  5FTI A;  4GXA A;  1M5D A;  4PTK A;  2LAO A;  1FBG A;  2F34 A;  4I9D A;  4LN5 A;  3OEN A;  3OO9 A;  4XTC Q;  3G3G A;  1A40 A;  1FCK A;  1IXC A;  2CZK A;  2X7Q A;  4RK2 A;  4GL8 A;  4X9T A;  2REG A;  1DPE A;  2XWI A;  3TYH A;  5F7V A;  1IMC A;  4U4X A;  4DCX A;  3HO7 A;  3OD7 A;  5EQ9 A;  4POX A;  1B40 A;  1VE4 A;  5AA1 A;  2FNC A;  3H4Z A;  4IO3 A;  2H5Y A;  4OVJ A;  2GRV A;  4FEB A;  3UP9 A;  4F39 A;  4H1X A;  1FBH A;  4ZE9 A;  1ZJL A;  1B3G A;  3QAX A;  4JXI A;  4PCD A;  5AA2 A;  3C33 A;  1UTH A;  3VLV A;  1QKA A;  4O3B A;  4RJZ A;  1AWB A;  2YLN A;  2R71 A;  1LST A;  5M2V A;  3E78 A;  4OYV A;  1FQA A;  3IB2 A;  3BBR A;  1P1U A;  3TQW A;  5IM2 A;  4RA1 A;  3R6U A;  2KQZ A;  3DP4 A;  4OHN A;  1CE2 A;  4XFE A;  2HXR A;  4U21 A;  4KHZ E;  4ESW A;  4ZEB A;  4OVT A;  3SDF A;  4LQ2 A;  4DXB A;  4OEV A;  2VHA A;  1DK4 A;  3FXR A;  5CBS A;  1IEJ A;  1SVX B;  4ZZE A;  2G93 A;  3ISP A;  4OFJ A;  4EQB A;  2I6E A;  1N3W A;  1NV2 A;  3EN3 A;  2YPN A;  5I56 B;  3OEM A;  3U92 A;  3D1R A;  1SW5 A;  4P8B A;  1S7Y A;  1NH8 A;  3OEL A;  4OXV A;  4PF8 A;  3MZB A;  5EYH A;  1NUZ A;  5K2Y A;  3DP8 A;  3A09 A;  2RCA A;  1URG A;  4MNP A;  1LBY A;  4PE3 A;  4OVS A;  2P3V A;  2B4M A;  4GFR A;  4I8C A;  4F3G A;  4JVI A;  2PFY A;  4GWU A;  3TTL A;  2WX9 A;  3MVZ A;  3RN8 A;  1FW0 A;  2F36 A;  4YKP A;  1RDZ A;  4MLV A;  3V5A A;  1XS5 A;  5I2K B;  2O7U A;  3IX1 A;  1GTK A;  2ZYM A;  3EHU A;  3MST A;  4R6Y A;  1RDX A;  1B0H A;  4HTG A;  4X04 A;  3TTR A;  4IO7 A;  2FYI A;  3SEW A;  4IGT A;  2XXP A;  1RYX A;  5DTB A;  2O1M A;  4F22 A;  4KCC A;  4H5F A;  1AMF A;  2Y84 A;  4G61 A;  5TP9 B;  4PFT A;  1NUY A;  1ZIU A;  4JWO A;  3S9N C;  4F3B A;  1FQE A;  1AOV A;  1NV6 A;  3TQL A;  1Y9U A;  4OA4 A;  3S4U A;  4KXP A;  2O1L A;  1FBE A;  2CEX A;  4MHF A;  2FIE A;  2ZNU A;  2QRY A;  1B3F A;  2ESN A;  1LBZ A;  1B3L A;  4H45 A;  4NWC A;  5I58 B;  2GFE A;  3BIG A;  3TTN A;  2DE2 A;  1MXX A;  4ZE8 A;  1BLF A;  4PF6 A;  4HCY A;  5CMK A;  3QUJ A;  3O28 A;  3HFU A;  2BJJ X;  4Q5T A;  1TFD A;  4YIC A;  1PC3 A;  2DXY A;  3FBP A;  2DWH A;  3SET A;  4N81 A;  3MW0 A;  4NMY A;  5EHS A;  3FIR A;  1ZLQ A;  1H3D A;  1RYO A;  4I62 A;  3TTM A;  2F6G A;  1OIB A;  4PGP A;  2A5T A;  1XI6 A;  3U1O A;  1IXH A;  2NUV A;  4YB7 A;  1Y4T A;  1Y1M A;  4OVR A;  1R6Z A;  4DXU A;  4NF4 B;  4QBA A;  2RKM A;  2I0B A;  1OMP A;  3DP6 A;  2VPO A;  2VD2 A;  1FQB A;  4OVQ A;  3UGW A;  1PDA A;  3BFT A;  3PTY A;  4KYS A;  5DVF A;  3F11 A;  2WYK A;  3U94 A;  1XOC A;  3H06 B;  2ZXT A;  1N04 A;  4DZ1 A;  5EQA A;  1H45 A;  1ZMG A;  4Q8R A;  1B3H A;  4WED A;  3TOD A;  5ET8 A;  1TFA A;  3U8Q A;  4RYA A;  5IAI A;  5H8Q A;  4MFI A;  2Y7R A;  3FGS A;  2PT1 A;  3O2A A;  2F6P A;  1ATG A;  2A5T B;  3T0J A;  3RY3 A;  3TAJ A;  2R8T A;  3SEY A;  4RXL A;  3VDF A;  2XXY A;  3PPN A;  2O7I A;  4JSO A;  4YB5 A;  2QJE A;  1KA0 A;  1MXW A;  3KGC A;  3FVK A;  4PFY A;  3IOU A;  1FPJ A;  1II5 A;  4R72 A;  4XXU A;  1KA1 A;  3HHG A;  2W7Y A;  3G7W A;  1PB8 A;  5I57 B;  1LBB A;  1NMU A;  3CG1 A;  3K02 A;  3RLF E;  3FVO A;  4NF6 A;  2CZI A;  2QS3 A;  3O9P A;  1B2H A;  1MG1 A;  4Q0C A;  2WBD A;  4ELP A;  4G4P A;  3FD3 A;  3K6W A;  4IY6 A;  3RPL B;  4NED A;  3KFM A;  1NFT A;  1JVY A;  2PFZ A;  2Y7K A;  1D9V A;  2VD3 A;  3FXQ A;  1I6B A;  4NQ8 A;  1O63 A;  4PFW A;  1BK4 A;  3EQ1 A;  4PFI A;  1B05 A;  1FTJ A;  1FRP A;  3FJ7 A;  4N91 A;  5DEX A;  4ZEC A;  1M5B A;  4OAN A;  2AL4 A;  2Q2C A;  4XF5 A;  1P99 A;  4Z0I A;  2H99 A;  3K4U A;  1LAH E;  3CRB A;  1FPF A;  1PEB A;  4RPN A;  3GLB A;  3W9V A;  1MQD A;  1FPD A;  3PPO A;  4MH5 A;  4DLD A;  3EKI A;  4MX6 A;  3QXM A;  4XKN A;  3TPA A;  1INP A;  2F3D A;  1ELJ A;  3HPI A;  1MXV A;  2Y7W A;  3U72 A;  2DWJ A;  1R1N A;  2NWJ A;  2I49 A;  1MM7 A;  2VP1 A;  5KDT A;  3IO4 A;  4XKR A;  2Q8J A;  1MY4 A;  1AL3 A;  3IFC A;  2QS1 A;  2NXO A;  1OVB A;  1Q1K A;  2H98 A;  4QSD A;  2F97 A;  4GX3 A;  4I3E A;  1OQG A;  4NG7 A;  4LP2 B;  4LZ7 A;  4N6K A;  4DDD A;  4MAG A;  2QMX A;  5AE4 A;  2XX8 A;  4JVC A;  5JK4 A;  3DLN A;  4G68 A;  4Q30 B;  1K9Z A;  4TLM B;  2UVI A;  2FA7 A;  1Q9D A;  3K1N A;  1B1H A;  2ZZV A;  2XXU A;  4QXD A;  4G77 A;  2O6A A;  2QL3 A;  1NNF A;  1MQH A;  3FZV A;  5H8F A;  3E4R A;  1B9J A;  5K2X A;  2XXX A;  1SW1 A;  1NNT A;  3K01 A;  2XXV A;  2FVZ A;  2HCA A;  4YKK A;  3CI8 A;  3TEL A;  5LOM A;  2QVU A;  4GOT A;  3K6X A;  1DSN A;  1JP4 A;  2HFB A;  1KWH A;  2O68 A;  4ELQ A;  2GH9 A;  1KZ8 A;  5TPA B;  2DOJ A;  2D21 A;  1MPC A;  4KFQ A;  1FBP A;  3ZSF A;  2QVR A;  4P1L A;  3Q25 A;  4HS7 A;  5F24 A;  4ESX A;  4AB6 A;  1PBQ A;  2I3V A;  1FTO A;  2FIX A;  1LFH A;  1MXZ A;  4BDR A;  1LB9 A;  1NH7 A;  1NL5 A;  3THI A;  1N3X A;  2OK2 A;  3IB0 A;  3AXF A;  1YXI A;  2ZZW A;  2RIN A;  5A5X A;  1YTV A;  3U93 A;  1JEV A;  3HST A;  1IMA A;  4NF8 A;  3PPP A;  3QUF A;  1MXY A;  5ICT A;  4H46 A;  2OJT A;  3BKI B;  4ECF A;  4U4S A;  3TCG A;  2GHB A;  4PAI A;  5IZ3 B;  1T0K A;  1B5H A;  3VV5 A;  1IMD A;  4KPT A;  3Q26 A;  4IO2 A;  1R9L A;  3G3H A;  5CRY A;  4NN3 A;  2ZYK A;  1SYH A;  4N6D A;  3FJG A;  4MF3 A;  5H8N A;  5ET7 A;  1J1N A;  4FE8 A;  2CEY A;  4FAJ A;  1MY2 A;  3IFA A;  3C35 A;  4H8J A;  1I69 A;  3ILU B;  2P0S A;  1OLA A;  1B5J A;  3KC0 A;  1DPP A;  4MBP A;  4R2B A;  2V93 A;  4OER A;  3VE1 B;  3O6H A;  3HN0 A;  1MS7 A;  3M3L A;  5CMC A;  2Q2A A;  1MY1 A;  1JQF A;  5AA4 A;  5A5X B;  4YAH X;  1Q35 A;  1LGB C;  4O3C A;  4NF8 B;  1FPL A;  3M8U A;  3G3I A;  3FVN A;  4IR8 A;  4O8M A;  4GL0 A;  2I48 A;  1A7L A;  1GVC A;  4XIG Q;  2RC8 A;  3PMV A;  2PVU A;  3LR1 A;  4DI4 B;  2DP8 A;  1CB6 A;  3VLU A;  2Y5L A;  1FPI A;  3LUZ A;  1NI9 A;  2I4B A;  2MKZ A;  1F9B A;  5HBC A;  3UIF A;  2OX3 A;  4OTE A;  2P2A A;  3MPL A;  5JTY A;  2F7C A;  4IO5 A;  3RT6 B;  3LSX A;  4OEU A;  4JDF A;  4BDQ A;  4BDN A;  1CNQ A;  4X1B A;  1XHY A;  3Q27 A;  1IIT A;  1OQH A;  3OSR A;  4R73 A;  4C0R A;  4N13 A;  5AA2 B;  3KN8 A;  3PUX E;  4QFK A;  4JVD A;  5T3J A;  1UTH B;  1MRP A;  4MCO A;  1NV1 A;  1B7Z A;  2V3Q A;  3E13 X;  1H44 A;  2QPQ A;  3O66 A;  3IOT A;  4BDO A;  1NUX A;  1IMF A;  5AA4 B;  1GV8 A;  3W9W A;  4IO4 A;  3T9V A;  1EZO A;  3SEV A;  3FVG A;  4UAC A;  5BWJ A;  4MNC A;  3SEX A;  4JWX A;  3USD A;  5TU0 A;  1ZKB A;  4FBP A;  1FJ6 A;  4FAT A;  1GGG A;  2DQV A;  1USY H;  4U1Z A;  4WXJ A;  4BDL A;  2F3B A;  5JEI A;  2CZL A;  4P56 A;  4NGU A;  2Z8E A;  3O6G A;  5HM4 B;  4NF5 A;  2G29 A;  3IAZ A;  1B58 A;  3ZKK A;  2I4C A;  2HAV A;  2DYX A;  4PAK A;  4O94 A;  2O84 X;  3D4G A;  1FBC A;  1GR2 A;  1FBD A;  3MJN A;  2AYS A;  2Y7I A;  2JJK A;  5CI5 A;  5I3S A;  1B4Z A;  4PC9 A;  5CBR A;  2ZYN A;  5ISU A;  1BKA A;  1UIV A;  2B4L A;  3RYD A;  4H67 A;  4GXS B;  4G2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...