4YZZA

Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
336
structure length
336
Chain Sequence
NPTVRWRMSTSWPKSLDTIYGSADELCKRVGQLTDGKFEIRAFPGGELVPSAQNMDAVSNGTVECNHVLSTMYIGKNTALTFDTGLSFGLNARQHNAWIHYGGGLQQLRELYKKYNIVNHVCGNVGVQMGGWYRKEIKSTADLNGLNMRIGGIGGMVLSKLGVVPQQIPPGDIYPALEKGTIDAAEWIGPYDDEKLGFNKVAPYYYSPGWFEGSASITSMVNDKAWEALPPAYQAAFEAACGEQSMRMLANYDARNPLALRKLIAGGAKVSFFPKEVMDAVYKASQQLWTELSEKNPDFKAIYPGWKKFQEDEAGWFRVAENALDNYTFAAVARAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a TRAP transporter solute binding protein (IPR025997) from Bordetella bronchiseptica RB50 (BB0280, TARGET EFI-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site
rcsb
source organism Bordetella bronchiseptica
molecule tags Transport protein
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
total genus 133
structure length 336
sequence length 336
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4yzzA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4yzzA01
1GR2A 1ZJLA 4IY6A 2V3UA 5F1QA 4LUBA 5TPAA 3MWBA 4Z7EA 4PF8A 3OO7A 4ZEBA 3MVZA 2RCBA 4DIGA 1IEJA 3FJGA 5AA4A 2B3FA 2XD3A 2DWAA 2V93A 4OFJA 1S50A 4H8JA 5DYHA 4G8NA 1LLSA 1M5EA 1UIVA 4G68C 1JNFA 3FIRA 3L6GA 1YPNA 5CI5A 2PX1A 4PF6A 2H5YA 1EZOA 1MQGA 2GRVA 1A8EA 3T9HB 3EHSA 4HTGA 5KDTB 1B3HA 4KI0E 4EF1A 1POTA 4C1UA 1M5BA 4PFBA 3HO7A 4P8BA 4PGPA 5IKBA 3U1OA 4C0RA 4F3BA 1B7HA 3B50A 2WKYA 4PDDA 4PGNA 2I49A 3SEVA 2QRYA 3A3UA 1O63A 2XA5A 3UORA 1LBCA 4N6PA 2I6EA 2Z8DA 2WYKA 3TTRA 3OSQA 3H6TA 1LAXA 3BFTA 1A40A 1LB9A 3GYYA 1ZLQA 4IB2A 3AXFA 3K1PA 1NL5A 2DS9A 4N4UA 3MVXA 3PUXE 5AE4A 5BUUA 1A8FA 1NH8A 1O64A 4AB5A 4NN3A 2XXVA 1LBBA 2WYPA 3C4MA 3I5OA 2DVZA 3MPLA 3M3KA 3CFZA 5KCJB 3TPAA 4P0GA 2RC8A 4NF8A 3SEWA 2QL3A 4DZ1A 4Z0IA 2KLFA 3KSXA 1VE4A 4NWDA 2WX9A 4RK9A 5AA3A 2XXRA 4LZ7A 4NEDA 4N91A 3O2AA 2CEXA 3L6HA 1P1NA 1YAEA 2X7QA 1BIYA 4YMAA 3GLBA 5AA4B 3FUZA 4RPNA 2XX7A 3U8QA 1IQ7A 2DSFA 3N94A 2REJA 5I56B 4EUOA 1YCJA 3TEPA 1P1QA 2VPOA 1Y3NA 5I58A 5ITOA 1UTBB 3WAFA 5H8FA 1Y1ZA 2D21A 4F3GA 4ELQA 1URDA 4U1ZA 4OFLA 2Y7IA 1Y3PA 4P47A 4KFQA 3OEKA 4KHZE 4ISUA 5JK4A 3K02A 5CBSA 4F2OA 4O3AA 4I8CA 5KDTA 3VFJA 4ZZAA 3LSFB 2AIXA 4GXAA 1XVYA 3PMXA 2XX9A 3E13X 5I59B 3K00A 1YTVA 3FVOA 4MNPA 2E1SA 2OLBA 4IO7A 1N84A 4ZE9A 1FW0A 1UQWA 3PPRA 4YKJA 2OBGA 1BTJA 2VHAA 4OVTA 2ZNSA 2I3WA 3GXAA 1DSNA 1SI0A 4ESWA 2VOZA 3U93A 3K2DA 3A3CA 4PE5B 4IO6A 4KR5A 3G3GA 4PE3A 3PUZE 1M5CA 1LAFE 2Z22A 1H44A 5TP9B 1RKMA 2UVJA 4FE8A 2O7UA 3K0VA 4EQ7A 3CRBA 3VVFA 3PUVE 1B51A 4MHFA 4NG7A 4HS7A 1DTGA 3RY3A 1B3FA 4QFNA 4R73A 4NF8B 4Q5TA 1B3GA 3OMBA 1P1OA 4PFRA 2ZNTA 3CIJA 4IGTA 5FTIA 2Q2CA 3G7WA 4RNSA 5IGAA 5H8QA 5TPAB 3CFXA 4UABA 1H3DA 3KBRA 5EYFA 1P1WA 5CRYA 2RCAA 4EDPA 4KD5A 3TAJA 2HZLA 4RJZA 4OENA 1FTMA 2AYSA 3QIMA 2Y7RA 4BLAA 2F6GA 4MIJA 2ZYKA 3LSLA 4F18A 4PFTA 3FASA 3D4GA 1MQIA 5I56A 1NKXA 2F35A 1LFIA 3H03A 3VLWA 5CC2A 4R6KA 3RPWA 2XXUA 2O68A 2XXKA 4YICA 2XD2A 4NF4B 3QSLA 4P3LA 3IO4A 2RF1A 4N8GA 5AA2B 2Y7KA 3G3IA 4MLQA 4R72A 1B58A 4X1DA 3OOAA 1T0KA 1B05A 4F29A 1US5A 3V83A 4R75A 3HHFA 2QMXA 3ECRA 3P7IA 3QUFA 3ZKLA 1DMBA 3MP6A 4PCDA 3CFLA 4HCYA 4DXUA 3T22A 3F11A 2B3BA 4GOTA 1MH3A 3C33A 5K2XA 4LATA 4XIGQ 3GZGA 4TOZA 5AA2D 3GBAA 2I0BA 4TQUQ 3MQ9A 1MS7A 3TYHA 3N5LA 3UK4A 3ZSFA 2ZNUA 1FTJA 4OA4A 1KWHA 4N07A 2F6PA 4WEPA 3H6VA 1URGA 3H3GA 5KCJA 4XXUA 4GD5A 4I9DA 4YMBA 4O3CA 2OWTA 1B6HA 1P1UA 2UXAA 3DP6A 1Z7NE 2H98A 2DP8A 4R2BA 5CBRA 5ICTA 4DXBA 1II5A 1SYIA 3H4ZA 1SBPA 2Y84A 4R6HA 4AB6A 4YB5A 3RT6B 3UP9A 3Q26A 5H8NA 4OVJA 3ZS6A 2UVHA 4MX6A 3S9MC 3O6GA 4E0XA 4X48A 1GGGA 1OMPA 1JQFA 4OETA 3O66A 3IB0A 2XWKA 4N8YA 4BDNA 3K4UA 4DCYA 1DPEA 2I3VA 1NNTA 1EH3A 4U23A 4H65A 2REGA 4FECA 2DE2A 2V84A 3PPPA 4F3SA 5IAIA 1ZU0A 2QSXA 2Q8JA 1NNKA 3IAZA 1I69A 1JEVA 2P2AA 4R2FA 4IY5A 2M8CA 1ELJA 4X8RA 5L9OA 4U2RA 3UN6A 5I59A 3PD9A 4LZ8A 1Y1MA 2R71A 2HFBA 2AL4A 3VDFA 2VGQA 4XKPA 4PFWA 5HPQA 2Z8EA 3C36A 1PEBA 5I2KA 3KFMA 4LN5A 2I58A 2D3IA 2FA7A 3EF7A 1BLFA 3FGSA 2DWIA 1MXYA 4P9KA 2XXIA 5I57A 1L5TA 4PAIA 2UYEA 5CMMA 3KN8A 4N13A 3G3HA 2NXOA 4POWA 2RKMA 3TZAA 3ODBA 4MH5A 3U65A 1QUJA 3HCQA 1USYH 1NNFA 2F34A 3S9NC 3U92A 3O28A 2XX8A 4WKMA 3IO6A 4O8MA 1UIUA 4DI3D 4JDFA 1P99A 1Q1KA 4XF5A 1JW4A 2DWJA 3PUYE 1Y20A 3FATA 4JWYA 1HSLA 4G68B 2VD2A 5HBCA 4BDRA 3S9EA 1FQCA 2YPNA 1JW1A 3O6HA 4PETA 2F97A 1JVYA 3RUMA 2A5TB 4JSDA 3RNNA 3H6UA 2ALUA 4EQ9A 2O6AA 3VLVA 3S4UA 5JEIA 1SVXB 3UA8A 2PFZA 1B9JA 4R74A 2DOJA 3DP4A 3T9VA 3KZGA 4NF4A 1TXFA 3FXBA 1MDQA 4ECFA 3ILUB 2Q89A 5AA1A 3MUQA 1S7YA 4LVQA 4NF5B 5AA2A 4FEDA 4XFEA 1IIWA 3IK6B 1B32A 3W15C 3GBBA 1A55A 3USDA 4F19A 2W7YA 2V3QA 4ZEIA 1XHYA 1JETA 4DXCA 3BFUA 4XKQA 2XXHA 2QS1A 4YKIA 4U4XA 3TMGA 2Q88A 1UTHB 4POXA 5A5XA 2FYIA 4HW8A 4ZEDA 1WDNA 4OTEA 4ZE8A 3HPIA 4H0WA 1MXWA 1AIVA 3U72A 2UYFA 1VR5A 1MPBA 3OSRA 2V4CA 3TQLA 1B7ZA 1GVCA 1N7XA 1SW5A 2IA4A 4QHQA 1D9YA 4UACA 2ONRA 2Z23A 3RN8A 4ELRA 1WODA 2D5WA 4FJPA 3OO8A 3FVNA 3A09A 4LA9A 3KGCA 3TCFA 3M3LA 1MY1A 4PFIA 4NWCA 2RC7A 2XWVA 4ESXA 1DPPA 4K3FA 4C1TA 1Z7ME 4ZEKA 3TTKA 3KJTA 3MAMA 4GXSB 1B1XA 3SEXA 3DM0A 2F7BA 1A99A 5L9MA 1NFTA 5I2NA 3C9HA 5DEXB 3RLFE 3TTMA 3FJMA 1N7WA 3PMVA 3FJ7A 1GTKA 4U22A 4F1YA 2PMSA 2XXTA 2B65A 5ELVA 3VE1B 2YJPA 3OD7A 4YB7A 3FVKA 1ZIUA 4M4GA 1LFHA 2VPNA 1SW4A 2HEUA 4MAGA 3SKPA 4P0IA 4RY1A 1QUKA 1FQFA 3K6VA 3SEYA 3Q27A 1A54A 2F7AA 3PD8A 5EHMA 2ANJA 2AL5A 3JV9A 1H76A 1FQEA 1TWYA 4IO3A 2H25A 2Q2AA 1B5JA 2PYYA 5DVIA 4IO4A 5KZTA 2H4IA 4OERA 3LUYA 1B3LA 4OMBA 4YB6A 5DT6A 4P1EA 4ZDMA 4KYSA 2FNCA 3DELB 4LZ5A 3PPOA 5DTBA 3KN3A 4U21A 4QFLA 1VFDA 2LAOA 2ZMBA 2YLNA 3H06B 1ATGA 1MQHA 3T9XB 1SW2A 1UTHA 4AQ4A 3MP1A 5BWJA 2O51A 3E3KA 3QAXA 3TTLA 4DLDA 2HAUA 4YZZA 2V3TA 3TELA 4X9TA 2F5XA 1MY2A 3FD3A 2PFYA 2F7CA 1N76A 1TFAA 1HSJA 2R9JA 4ONYA 4ZZEA 3KG2A 2RINA 1URSA 5B7DA 4N6DA 4OEVA 1XS5A 3CSGA 1QVSA 1MXXA 3TCGA 3SESA 1SI1A 4JSOA 3MZBA 4NF0A 2QS3A 1Y4TA 2I4CA 4YKKA 1QJMA 3OEMA 1B0HA 4QFKA 1MXVA 1EU8A 3CVGA 3DLNA 3RQTA 4F22A 1FCKA 2VD3A 4IGRA 4FATA 2XXQA 3KJ7A 4QSEA 3N26A 3C31A 1LCFA 1B4HA 5CMKA 1GV8A 2NOOA 2O1LA 2HQ0A 1CE2A 5I2NB 3C35A 4G4PA 2OWSA 4G68A 1OVBA 1NNPA 1XT8A 3OENA 4XKNA 4F2QA 1FTOA 2NUVA 1B0LA 4O3BA 1I6QA 2A5TA 3PPQA 2XXPA 4XEQA 3EHUA 3LBSA 3HHGA 5L9SA 3IR1A 2ZYMA 4ELOA 3IB2A 3IL1B 3CR9A 5F7VA 2O7IA 1RYOA 3EQ1A 3MZ9A 2PT2A 5EHSA 2P0SA 3FVGA 1FQBA 2DXYA 1Y4CA 3LR1A 3ILTB 4FIMA 1S9TA 3PMWA 3V5AA 4DDDA 3G3JA 3PGFA 4H67A 1LFGA 3RT8A 5DVFA 1BKAA 5H8SA 2ZZXA 2V25A 4LQ5A 5CMCA 2QMWA 3R7XA 4OVRA 1EZPA 1B3EA 2DWHA 4OWDA 4BDLA 5I7IA 4Q30B 3C32A 1FTKA 3I3VA 5I58B 4PAKA 1F9BA 3H6WA 3HN0A 4JBZA 3T96B 1OVTA 4OFOA 4N15A 4YAHX 1N3WA 4YKPA 4GQOA 1B7UA 4FAJA 2PVUA 4OEUA 1OIBA 3VLUA 5ITPA 4ZECA 4N17A 4XKRA 4BDOA 2BJJX 4QF9A 1B5HA 4GVOA 3TUSA 1B40A 5LTCA 4XTCQ 2F36A 1J1NA 4LP2B 4Q0CA 2UVIA 1HSEA 1SYHA 1SW1A 2GFEA 2HXWA 2I4BA 3EN3A 3MJNA 3B6QA 1TFDA 3Q28A 1ZMGA 1IZ1A 3IX1A 4L17A 3VVEA 1N04A 3FXRA 4G8MA 5JTYA 1D4NA 1FQDA 3R26A 4H5GA 4BDQA 3SEUA 1QW0A 1JVXA 5M2VA 2XWIA 4DE8A 2F78A 1QKAA 1OQHA 2VP1A 2ZYNA 4OHNA 2ZZWA 5TP9A 3PUWE 3O9PA 2I48A 5ICQA 4WEDA 2HCAA 2O69A 4QFOA 4E0WA 4DI4B 3IOWA 4G77A 3K6UA 2Y7WA 4ZS9A 3UIFA 2X26A 1Q35A 4KQPA 3G3FA 3SETA 3BKIB 4HCWA 4PQJA 3LSWA 2I0CA 2XXYA 3HV1A 3MZ1A 4GIZA 1Y3QA 5H8QB 3RTFB 5B70A 1BP5A 1US4A 3QUJA 3O6IA 3N6TA 3OELA 2ZXTA 4GL8A 3O97A 1R9LA 2QPQA 2PBWA 4PBHA 3FXQA 3Q29A 1PB7A 1PB8A 3IB1A 1USYE 1JEUA 4PBQA 1B1HA 2O84X 1N0TA 3QXMA 2XHDA 1QULA 1UTBA 2HAVA 1XC1A 1MH4A 4PFUA 4R6YA 2PT1A 5K2YA 1MQJA 3S9LC 4ELPA 4G8HA 2CZLA 1LAHE 4JB7A 4MBPA 1AL3A 4LQ2A 3TTNA 2E0SA 2QS4A 5J1DA 1OQGA 3MVWA 4KPTA 1ZBMA 3W9VA 4OXVA 2QS2A 5DVJA 4UA8A 1H45A 3HSTA 3TDJA 4I1DA 4GFRA 2DVCA 3RGYA 4X04A 4P11A 3K6XA 1ZKBA 4I62A 1VFEA 1AMFA 1IUDA 4GF8A 4P1LA 4RK2A 1XOCA 3K1NA 1NH7A 2DYXA 5H8HB 1B52A 2A5SA 2GHBA 1XVXA 5IM2A 3KEIA 4PFYA 2G93A 4OVPA 4PC9A 3R6UA 2GHAA 2ABHA 1IXCA 5ISUA 3CG3A 4OVQA 1DTZA 2G29A 1IXHA 5FTHA 1I6BA 2RC9A 3CSBA 4NHBA 2OJTA 1SQYA 4TLLB 4OQOA 2NVUB 1FTLA 4MNCA 5FHNA 3MP8A 2X7PA 4IO2A 3JYRA 1MXZA 1B46A 3TKDA 4MNIA 4EF2A 4F1UA 1MM6A 3RTWB 1D3KA 3K01A 4NF5A 3FXUA 1WVJA 1MPCA 3IOVA 3SERA 5I84A 1MM7A 5HM4B 3UGWA 1B2HA 3EHTA 2NWJA 4KCCA 4H6DA 4N6KA 1MRPA 4MMPA 3E9XA 3B6WA 2XWOA 5L8DA 3TCHA 1LCTA 3T9UA 1NMUA 4MLVA 4GWOA 5IZZA 1VSOA 4O7MA 1MDP1 4H8IA 3K6WA 1CB6A 3T66A 4F31B 2R6GE 1IITA 1QKBA 3QYTA 5CMBA 4LONB 1MXUA 1PDAA 1OLAA 3I6VA 3B6TA 4F3PA 1JW5A 5CM6A 1DOTA 1O7TA 4NF6B 2Z8FA 3PU5A 2CMOA 2ONKE 4NMYA 3VVDA 3D4CA 3K1MA 4OANA 4OESA 2XXXA 2O1MA 3TQWA 4NQ8A 2ESNA 3BBRA 3M8UA 4GRKA 4TLMB 4X1BA 3OO9A 1B5IA 1M5FA 4THIA 5JTYB 2OZZA 3E4RA 3IJOB 3S2VA 4Q8RA 4MFIA 1D9VA 3W9WA 4KYDA 4WXJA 4RA1A 4NE4A 2OK2A 4RXLA 4PAFA 2DQVA 3KOTA 3PPNA 1MG1A 2OCUA 3THIA 1MY3A 3B7DA 4O94A 4F39A 4QRZA 3IOTA 3IJXB 4OZ9A 2Y7PA 3IORA 3KSJA 3PV0E 1IXGA 4KYEA 4QSCA 1LB8A 3EPEA 4MCOA 1AOVA 4MF3A 3C34A 1Y9UA 1FQAA 1EZ9A 4GL0A 4JWXA 3WAEA 4GLIA 3V8XB 2HPGA 3VXCA 4DCXA 1LGBC 3FV2A 5H8NB 1RYXA 3T93B 3G3KA 4NGUA 2DE4A 5LOMA 1SDXA 4ND9A 1MPDA 4YU0A 1M5DA 2CEYA 4EXLA 3QK6A 3MW0A 4JXIA 1MY4A 3VXBA 3DP8A 2IEEA 1R1NA 3OO6A 4M1VA 2UVGA 1A7LA 1ANFA 2ZZVA 3MPKA 5H8FB 1I6AA 4U1OA 3TODA 5TU0A 2XXWA 4JWOA 5FHMA 2QJEA 1QUIA 1AH5A 3VV5A 4NF6A 4EXKA 1IXIA 2P1SA 2ONSA 3OXNA 3ZKKA 3CI8A 3U94A 5I5PA 4H5FA 1SD3A 4FEBA 3LSXA 4U4SA 4PDHA 1PBPA 1LAGE 1PB9A 5H8HA 2ZYOA 3MVYA 1PBQA 1TT1A 4IO5A 4OYVA 1POY1 5A5XB 2H9BA 3O29A 4NTLA 1LSTA 5I2KB 4BDMA 5DEXA 4R9FA 1N3XA 4H1XA 1MQDA 3KOSA 2GH9A 3N6UA 4OVSA 3SDFA 3ONMA 3M3FA 4RPOA 2Q9TA 3LC8A 1H43A 4KCDA 1ZTYA 4EQBA 3FV1A 2DE3A 4RYAA 1OLCA 4FORA 3CG1A 2THIA 3MC2A 5I57B 5FHOA 3TFLA 4G2ZA 4MEVA 4PP0A 4NX1A 4P56A 1MY0A 4F1VA 1R6ZA 4ZEFA 2F8DA 3V89B 1PC3A 1R9QA 3IOUA 3H7MA 3KN7A 4QFPA 1B4ZA 4R9GA 3MBPA 2DXRA 3Q25A 3FZVA 3JZJA 4NAPA 2H99A 2HZKA 4QSDA
chains in the Genus database with same CATH superfamily
1GR2A 1ZJLA 4IY6A 2V3UA 5F1QA 4LUBA 5TPAA 3MWBA 4Z7EA 4PF8A 3OO7A 1G0HA 4ZEBA 3ISPA 3MVZA 2RCBA 4DIGA 1IEJA 3FJGA 5AA4A 2B3FA 2XD3A 2L5VA 2DWAA 2V93A 4OFJA 4I3EA 1S50A 4H8JA 5DYHA 4G8NA 1LLSA 1M5EA 1UIVA 4G68C 2WEFA 1JNFA 3FIRA 5EYHA 3L6GA 1YPNA 5CI5A 2PX1A 4PF6A 2H5YA 1EZOA 1MQGA 2Q8MA 1LBZA 2GRVA 2KR0A 1A8EA 3T9HB 3EHSA 3A29A 3HFUA 4HTGA 5KDTB 1B3HA 1FPKA 4KI0E 4EF1A 1POTA 4C1UA 1M5BA 4PFBA 3HO7A 4P8BA 4PGPA 5IKBA 3U1OA 4C0RA 4F3BA 1B7HA 3B50A 2WKYA 5IZ1A 4PDDA 4PGNA 3CHGA 2I49A 3SEVA 2QRYA 3A3UA 1O63A 2XA5A 3UORA 1LBCA 4N6PA 2I6EA 2Z8DA 2WYKA 3TTRA 3OSQA 3H6TA 5LDZA 4MJOA 1LAXA 3BFTA 1A40A 1LB9A 3GYYA 1ZLQA 4IB2A 3AXFA 3K1PA 2FIXA 1NL5A 2DS9A 4N4UA 3MVXA 3PUXE 5AE4A 5BUUA 1A8FA 1NH8A 1O64A 4NN3A 4AB5A 2CZIA 2XXVA 1LBBA 2WBBA 2WYPA 3C4MA 3I5OA 4GBWA 2DVZA 3MPLA 3M3KA 1FBEA 3CFZA 5KCJB 3TPAA 4P0GA 2RC8A 4NF8A 3SEWA 2QL3A 4DZ1A 4Z0IA 2KLFA 3KSXA 1VE4A 4NWDA 2WX9A 4RK9A 5AA3A 2XXRA 4LZ7A 4NEDA 4N91A 2CEXA 3O2AA 3L6HA 1P1NA 4G61A 1YAEA 2X7QA 5EQ9A 1BIYA 4YMAA 3GLBA 4JVIA 5AA4B 3FUZA 4RPNA 2XX7A 3U8QA 1IQ7A 2DSFA 3N94A 2REJA 5I56B 4EUOA 3T1BA 1YCJA 3TEPA 1P1QA 2VPOA 1Y3NA 5I58A 5ITOA 1UTBB 3LUZA 3WAFA 5H8FA 1Y1ZA 2D21A 4ELQA 4F3GA 1URDA 4U1ZA 4OFLA 2Y7IA 1Y3PA 4P47A 1FPLA 4KFQA 3OEKA 4KHZE 4ISUA 5JK4A 3K02A 5CBSA 3D1RA 4F2OA 4O3AA 4I8CA 5KDTA 2B4LA 4ZZAA 3VFJA 3LSFB 2AIXA 4GXAA 1XVYA 3PMXA 2XX9A 3E13X 5I59B 3K00A 1YTVA 3FVOA 4MNPA 2E1SA 2OLBA 4IO7A 1N84A 4ZE9A 1FW0A 1NV5A 1UQWA 3PPRA 4YKJA 2OBGA 1BTJA 2VHAA 4OVTA 2ZNSA 1DCUA 2I3WA 3GXAA 1DSNA 1SI0A 4ESWA 2VOZA 3U93A 3K2DA 1FBGA 3A3CA 4PE5B 4IO6A 4KR5A 3G3GA 4PE3A 3PUZE 1M5CA 1LAFE 2CZHA 2Z22A 1H44A 5TP9B 1RKMA 2UVJA 4GWXA 4FE8A 2O7UA 3K0VA 4EQ7A 3CRBA 3VVFA 3PUVE 1B51A 4MHFA 4NG7A 4HS7A 1DTGA 3RY3A 1B3FA 4QFNA 4R73A 4NF8B 4Q5TA 1B3GA 3OMBA 1P1OA 4PFRA 3IFAA 2ZNTA 3CIJA 4I3YA 4IGTA 5FTIA 2Q2CA 3G7WA 4RNSA 5IGAA 1LBWA 5H8QA 5TPAB 3CFXA 4UABA 1H3DA 1YZ0A 3KBRA 5EYFA 1P1WA 5CRYA 2RCAA 4EDPA 4KD5A 3TAJA 2HZLA 4RJZA 1FJ6A 4OENA 1FTMA 1Q9DA 2AYSA 3QIMA 2Y7RA 4BLAA 2F6GA 4MIJA 2ZYKA 1YYZA 3LSLA 4F18A 4PFTA 2OWZA 3FASA 1LBVA 3D4GA 1MQIA 5I56A 1NKXA 2F35A 3NOHA 1LFIA 3H03A 3VLWA 5ET6A 5CC2A 4R6KA 3RPWA 2XXUA 2O68A 2XXKA 4HXVA 4YICA 2XD2A 4NF4B 3QSLA 4P3LA 3IO4A 2RF1A 4N8GA 5AA2B 4GWZA 2Y7KA 3G3IA 4MLQA 4R72A 1B58A 4X1DA 3QMFA 3OOAA 3EKIA 1B05A 1T0KA 4F29A 1US5A 3V83A 4R75A 3HHFA 2QMXA 3P7IA 3ECRA 3QUFA 3ZKLA 1DMBA 2Y5KA 3MP6A 4PCDA 3CFLA 4HCYA 4DXUA 3T22A 3F11A 3LV0A 2B3BA 4GWSA 4H45A 4GOTA 1MH3A 3C33A 4JVCA 5K2XA 5IZ3B 4LATA 4XIGQ 3GZGA 4TOZA 5AA2D 3GBAA 2I0BA 4TQUQ 3MQ9A 1MS7A 3TYHA 3N5LA 3UK4A 4QBAA 3ZSFA 2ZNUA 1FTJA 4OA4A 1KWHA 4N07A 1FRPA 2F6PA 4WEPA 2F3DA 1FPBA 3H6VA 1URGA 3H3GA 5KCJA 4XXUA 4GD5A 4I9DA 4YMBA 1FBCA 4O3CA 2OWTA 1B6HA 1P1UA 2UXAA 3DP6A 1Z7NE 2H98A 2DP8A 4R2BA 5CBRA 5ICTA 4DXBA 1II5A 1SYIA 3H4ZA 1FSAA 1SBPA 2R8TA 2Y84A 4R6HA 4AB6A 4YB5A 3RT6B 3UP9A 3Q26A 5H8NA 4OVJA 3ZS6A 4I40A 2UVHA 3B8BA 4MX6A 3S9MC 3O6GA 4E0XA 4X48A 1GGGA 1OMPA 1JQFA 4OETA 3O66A 3IB0A 2XWKA 4N8YA 4BDNA 3K4UA 1NUXA 3E78A 4DCYA 1DPEA 1EYJA 2I3VA 1NNTA 1EH3A 4U23A 4H65A 2REGA 4FECA 2DE2A 2V84A 3PPPA 4F3SA 5IAIA 1ZU0A 2QSXA 2Q8JA 1NNKA 2WBDA 3IAZA 1I69A 1JEVA 2P2AA 4R2FA 1FPGA 4IY5A 2M8CA 1BK4A 1ELJA 4X8RA 5L9OA 4U2RA 2MKZA 1KA1A 3UN6A 5I59A 3PD9A 4LZ8A 1Y1MA 2R71A 2HFBA 2AL4A 3VDFA 2VGQA 4XKPA 4PFWA 5HPQA 2Z8EA 3C36A 1PEBA 5I2KA 3KFMA 4LN5A 2I58A 2D3IA 2FA7A 1FBDA 4PTKA 3EF7A 1BLFA 3FGSA 2DWIA 1MXYA 4P9KA 2XXIA 5I57A 1L5TA 4PAIA 2UYEA 5CMMA 3KN8A 4N13A 3G3HA 2NXOA 4POWA 3KC0A 2RKMA 3TZAA 3ODBA 4MH5A 3U65A 1QUJA 3HCQA 1USYH 1NNFA 2F34A 3S9NC 3U92A 3O28A 2XX8A 4WKMA 3IO6A 4O8MA 1UIUA 4DI3D 4JDFA 1P99A 1Q1KA 4XF5A 1JW4A 2DWJA 3PUYE 1NI9A 1Y20A 3FATA 4JWYA 1HSLA 4G68B 2VD2A 1KZ8A 5HBCA 4BDRA 3S9EA 1FQCA 2YPNA 1JW1A 3O6HA 4PETA 2F97A 1JVYA 3RUMA 2A5TB 3RNNA 4JSDA 3H6UA 2ALUA 4EQ9A 2O6AA 3VLVA 3S4UA 5JEIA 1SVXB 3UA8A 2PFZA 1B9JA 4R74A 2DOJA 3DP4A 3T9VA 3KZGA 1DK4A 4NF4A 1TXFA 3FXBA 1MDQA 4ECFA 1FPEA 3ILUB 2Q89A 5AA1A 3MUQA 1S7YA 4LVQA 4NF5B 5AA2A 4FEDA 4XFEA 1IIWA 4KXPA 3IK6B 1B32A 3W15C 5I3SA 3GBBA 1A55A 3USDA 4F19A 2W7YA 2V3QA 4ZEIA 1NV3A 1XHYA 1FBPA 1JETA 4DXCA 3BFUA 4XKQA 2XXHA 2QS1A 4YKIA 4U4XA 3TMGA 2Q88A 1UTHB 4POXA 5A5XA 2FYIA 4HW8A 4H46A 4ZEDA 1WDNA 4OTEA 4ZE8A 1AWBA 3HPIA 4H0WA 1FTAA 1MXWA 1FBFA 1AIVA 3U72A 2UYFA 1VR5A 1SPIA 1MPBA 3OSRA 2V4CA 3TQLA 1B7ZA 1GVCA 1N7XA 1SW5A 2IA4A 4QHQA 1D9YA 4UACA 2ONRA 2Z23A 3RN8A 4JVDA 4ELRA 1WODA 2D5WA 4FJPA 3OO8A 3FVNA 3PTYA 3A09A 4LA9A 3KGCA 3TCFA 3M3LA 1MY1A 4PFIA 4NWCA 1IMCA 2RC7A 2XWVA 4ESXA 1DPPA 4K3FA 4C1TA 1Z7ME 4ZEKA 3TTKA 2QVUA 3KJTA 3MAMA 4GXSB 1B1XA 3SEXA 3DM0A 2F7BA 1A99A 5L9MA 1NFTA 5I2NA 5DEXB 3RLFE 1KA0A 3C9HA 3TTMA 3FJMA 1N7WA 3PMVA 3SZPA 3FJ7A 1GTKA 1EYIA 2HHMA 1NV1A 4U22A 4F1YA 2PMSA 2XXTA 1VDWA 2B65A 4IR8A 5ELVA 3VE1B 4YB7A 2YJPA 3OD7A 3FVKA 1ZIUA 2DDKA 4M4GA 1LFHA 2VPNA 1SW4A 1FPJA 2HEUA 4MAGA 3SKPA 4P0IA 4RY1A 1QUKA 1FQFA 3K6VA 3SEYA 3Q27A 1A54A 2F7AA 3PD8A 5EHMA 2ANJA 3RPLB 2AL5A 3JV9A 1H76A 1FQEA 1TWYA 4IO3A 2H25A 2Q2AA 1B5JA 2PYYA 5DVIA 4IO4A 5KZTA 2H4IA 4OERA 3LUYA 1B3LA 4OMBA 4YB6A 5DT6A 3KC1A 4P1EA 2P3VA 4ZDMA 4KYSA 2FNCA 3DELB 4LZ5A 3PPOA 5DTBA 3KN3A 4U21A 4QFLA 1VFDA 2LAOA 2ZMBA 2YLNA 3H06B 1ATGA 1MQHA 3T9XB 1SW2A 2B4MA 1UTHA 4QXDA 4AQ4A 3MP1A 5BWJA 2O51A 3E3KA 3QAXA 3TTLA 4DLDA 2HAUA 4YZZA 2V3TA 3TELA 4X9TA 2F5XA 1MY2A 2PFYA 3FD3A 2F7CA 1N76A 1TFAA 1HSJA 2R9JA 1CNQA 4ONYA 4ZZEA 3KG2A 2RINA 1URSA 5B7DA 1RDYA 4N6DA 4OEVA 1XS5A 2QVVA 3CSGA 1QVSA 1MXXA 3TCGA 3SESA 1SI1A 4JSOA 3MZBA 4NF0A 2QS3A 5A5LA 1Y4TA 1FPFA 2I4CA 4YKKA 1QJMA 2BJIA 3OEMA 1B0HA 4QFKA 1MXVA 1EU8A 3CVGA 3DLNA 3RQTA 4F22A 2PCRA 1FCKA 1NV4A 2VD3A 4HE1A 4IGRA 4FATA 2XXQA 3KJ7A 4QSEA 3N26A 3C31A 4GX6A 1LCFA 1B4HA 5CMKA 1GV8A 2NOOA 2O1LA 2HQ0A 1CE2A 5I2NB 3C35A 4G4PA 2OWSA 4G68A 1OVBA 1NNPA 1XT8A 3OENA 4XKNA 4F2QA 1FTOA 2NUVA 1B0LA 4O3BA 5ET5A 1I6QA 2A5TA 3PPQA 2XXPA 1FBHA 4XEQA 5EQ8A 3EHUA 3LBSA 3HHGA 5L9SA 1D9QA 3IR1A 2ZYMA 2F3BA 4ELOA 3RPLA 3IB2A 3IL1B 3CR9A 5F7VA 2O7IA 1RYOA 3EQ1A 3MZ9A 2PT2A 5EHSA 2P0SA 3FVGA 1NV6A 1QGXA 1FQBA 2DXYA 1Y4CA 3LR1A 3ILTB 1FPIA 4FIMA 1S9TA 3PMWA 3V5AA 4DDDA 3G3JA 1IMEA 3PGFA 4H67A 1LFGA 3RT8A 5DVFA 1BKAA 5H8SA 2ZZXA 2V25A 2FIEA 4LQ5A 5CMCA 2QMWA 3R7XA 4OVRA 1NUWA 1JP4A 1EZPA 1B3EA 2DWHA 4OWDA 4BDLA 5I7IA 4Q30B 3C32A 1FTKA 3I3VA 5I58B 4PAKA 1F9BA 3H6WA 3HN0A 4JBZA 3T96B 1OVTA 4OFOA 4N15A 4YAHX 3ROJA 1N3WA 4YKPA 4GQOA 1B7UA 4FAJA 1NV7A 1IMAA 2PVUA 4OEUA 1OIBA 1LBXA 3VLUA 5ITPA 4N17A 4ZECA 4XKRA 4BDOA 2BJJX 5J16A 4QF9A 1B5HA 4GVOA 3TUSA 1B40A 2FBPA 5LTCA 4XTCQ 2F36A 1J1NA 4LP2B 2P3NA 4Q0CA 2UVIA 1HSEA 1SYHA 1SW1A 2GFEA 2HXWA 2I4BA 3EN3A 3MJNA 3B6QA 1TFDA 3Q28A 1ZMGA 1IZ1A 3IX1A 1FPDA 4L17A 3VVEA 1N04A 3FXRA 4G8MA 5JTYA 1NV2A 3MSTA 1D4NA 1FQDA 3R26A 4H5GA 4BDQA 3SEUA 1QW0A 1JVXA 5M2VA 2GQ1A 4N81A 2XWIA 4DE8A 2F78A 1QKAA 1OQHA 2VP1A 3KBZA 2ZYNA 4OHNA 2ZZWA 5TP9A 3PUWE 3O9PA 2I48A 5ICQA 4WEDA 2HCAA 2JJKA 2O69A 4QFOA 4E0WA 4DI4B 3IOWA 4G77A 3K6UA 2Y7WA 4ZS9A 3RYDA 3UIFA 2X26A 4GWYA 1Q35A 4KQPA 3G3FA 3SETA 3BKIB 4HCWA 4PQJA 1NUZA 3LSWA 2I0CA 2XXYA 3HV1A 3MZ1A 4GIZA 1Y3QA 5H8QB 3RTFB 5B70A 1BP5A 1US4A 3QUJA 2QFLA 3O6IA 3N6TA 3OELA 2ZXTA 4GL8A 3O97A 1R9LA 2QPQA 2PBWA 5ESYA 4PBHA 3FXQA 3Q29A 5IZ3A 3IB1A 1PB7A 1PB8A 1USYE 1JEUA 4PBQA 1B1HA 2O84X 1N0TA 3QXMA 4HE2A 2XHDA 1QULA 1UTBA 2HAVA 1XC1A 1MH4A 4PFUA 4R6YA 2PT1A 5K2YA 1K9YA 1MQJA 3S9LC 4O7IA 4ELPA 4G8HA 2CZLA 1LAHE 4JB7A 4MBPA 4LQ2A 1AL3A 3TTNA 2E0SA 2QS4A 5J1DA 1OQGA 3MVWA 4KPTA 1ZBMA 4HE0A 4OXVA 2QS2A 3W9VA 3IFCA 5DVJA 4UA8A 1H45A 3HSTA 3TDJA 4I1DA 4GFRA 2DVCA 3RGYA 4X04A 4P11A 1RDZA 3K6XA 1ZKBA 4I62A 1VFEA 1AMFA 1IUDA 4GF8A 4P1LA 5EQAA 4RK2A 1G0IA 1XOCA 3K1NA 1NH7A 2DYXA 5H8HB 1B52A 2A5SA 5ET7A 2GHBA 1XVXA 5IM2A 3KEIA 4PFYA 2G93A 4OVPA 4PC9A 3R6UA 2GHAA 1YXIA 2ABHA 2VT5A 1IXCA 4FBPA 5ISUA 3CG3A 4OVQA 2CZKA 1DTZA 2G29A 4AS4A 1IXHA 5FTHA 1I6BA 2RC9A 1LBYA 3CSBA 4NHBA 2OJTA 1SQYA 4TLLB 4OQOA 2NVUB 1FTLA 4MNCA 5FHNA 1XI6A 3MP8A 2X7PA 4IO2A 3JYRA 5EQ7A 1MXZA 1B46A 3TKDA 4MNIA 4EF2A 4F1UA 1MM6A 3RTWB 1D3KA 3K01A 5FBPA 4NF5A 3FXUA 1WVJA 1MPCA 3IOVA 3SERA 5I84A 1MM7A 5HM4B 3UGWA 1B2HA 3EHTA 2NWJA 4KCCA 4H6DA 4N6KA 1MRPA 4MMPA 1IMFA 3E9XA 3B6WA 4GWUA 2XWOA 5L8DA 1NUYA 4GWWA 3TCHA 1LCTA 3T9UA 1NMUA 4MLVA 4GWOA 5IZZA 1VSOA 4O7MA 3BIHA 1MDP1 1NV0A 4H8IA 3K6WA 1CB6A 3T66A 4F31B 2R6GE 1IITA 1QKBA 3QYTA 5CMBA 4LONB 1MXUA 1PDAA 1OLAA 3I6VA 3B6TA 4F3PA 1JW5A 5CM6A 1FJ9A 1DOTA 1O7TA 4NF6B 2OX3A 2Z8FA 3PU5A 2CMOA 2ONKE 4NMYA 3VVDA 3D4CA 3K1MA 4GBVA 4OANA 4OESA 2XXXA 2O1MA 3TQWA 4NQ8A 2ESNA 3BBRA 3M8UA 4GRKA 4TLMB 4X1BA 3OO9A 1B5IA 1M5FA 5EYGA 4THIA 5JTYB 2OZZA 3E4RA 3IJOB 4GX4A 3S2VA 4Q8RA 4MFIA 1D9VA 3BIGA 3W9WA 4KYDA 4WXJA 4RA1A 4NE4A 2OK2A 4PAFA 4RXLA 2DQVA 3KOTA 3PPNA 1MG1A 2OCUA 3THIA 1MY3A 3B7DA 4O94A 4F39A 4QRZA 3MYUA 3IOTA 3IJXB 4OZ9A 2Y7PA 3IORA 3KSJA 3PV0E 2QVRA 1IXGA 4KYEA 4QSCA 3T0JA 1LB8A 3EPEA 4MCOA 4GX3A 1AOVA 3E79A 4MF3A 3C34A 1Y9UA 1FQAA 1EZ9A 4GL0A 4JWXA 3WAEA 2Y5LA 2FHYA 1K9ZA 4GLIA 3V8XB 2HPGA 3VXCA 4DCXA 1LGBC 1RDXA 3FV2A 5H8NB 1RYXA 3T93B 3G3KA 4NGUA 2DE4A 5LOMA 1SDXA 4ND9A 1MPDA 4YU0A 1M5DA 2CEYA 4EXLA 3QK6A 3MW0A 2FVZA 4JXIA 1MY4A 1IMDA 3VXBA 3DP8A 5DW8A 2IEEA 1R1NA 3OO6A 4M1VA 2UVGA 1A7LA 1ANFA 2ZZVA 3MPKA 5H8FB 1I6AA 4U1OA 3TODA 5TU0A 2XXWA 4JWOA 5FHMA 2QJEA 1QUIA 1AH5A 3VV5A 4NF6A 4AS5A 2Q74A 4EXKA 1IXIA 2P1SA 2ONSA 3OXNA 3ZKKA 3CI8A 5T3JA 3U94A 5I5PA 4H5FA 1SD3A 4FEBA 3LSXA 4U4SA 4PDHA 1PBPA 1LAGE 1PB9A 5H8HA 2ZYOA 1EYKA 3MVYA 1PBQA 1TT1A 4IO5A 4OYVA 1INPA 1POY1 5A5XB 1DBZA 2H9BA 3O29A 4NTLA 1LSTA 5I2KB 4R9FA 5DEXA 4BDMA 1N3XA 4H1XA 1MQDA 3KOSA 2GH9A 3FBPA 3N6UA 4OVSA 5ET8A 3SDFA 3ONMA 3M3FA 4RPOA 2Q9TA 3LC8A 1H43A 4KCDA 1ZTYA 4EQBA 5F24A 3FV1A 2DE3A 4RYAA 1OLCA 2HXRA 4FORA 3CG1A 2THIA 3MC2A 5I57B 1IMBA 5FHOA 3TFLA 4G2ZA 4MEVA 4PP0A 4NX1A 2KQZA 4P56A 1MY0A 4F1VA 1R6ZA 4ZEFA 2F8DA 3V89B 1PC3A 1LEVA 1R9QA 3IOUA 3H7MA 3KN7A 4QFPA 1B4ZA 4R9GA 3MBPA 2DXRA 3Q25A 3FZVA 3JZJA 4NAPA 2H99A 2HZKA 4QSDA
chains in the Genus database with same CATH topology
1GR2A 1ZJLA 4IY6A 2V3UA 5F1QA 4LUBA 5TPAA 3MWBA 4Z7EA 4PF8A 3OO7A 1G0HA 4ZEBA 3ISPA 3MVZA 2RCBA 4DIGA 1IEJA 3FJGA 5AA4A 2B3FA 2XD3A 2L5VA 2DWAA 2V93A 4OFJA 4I3EA 1S50A 4H8JA 5DYHA 4G8NA 1LLSA 1M5EA 1UIVA 4G68C 2WEFA 1JNFA 3FIRA 5EYHA 3L6GA 1YPNA 5CI5A 2PX1A 4PF6A 2H5YA 1EZOA 1MQGA 2Q8MA 1LBZA 2GRVA 2KR0A 1A8EA 3T9HB 3EHSA 3A29A 3HFUA 4HTGA 5KDTB 1B3HA 1FPKA 4KI0E 4EF1A 1POTA 4C1UA 1M5BA 4PFBA 3HO7A 4P8BA 4PGPA 5IKBA 3U1OA 4C0RA 4F3BA 1B7HA 3B50A 2WKYA 5IZ1A 4PDDA 4PGNA 3CHGA 2I49A 3SEVA 2QRYA 3A3UA 1O63A 2XA5A 3UORA 1LBCA 4N6PA 2I6EA 2Z8DA 3TTRA 2WYKA 3OSQA 3H6TA 5LDZA 4MJOA 1LAXA 3BFTA 1A40A 1LB9A 3GYYA 1ZLQA 4IB2A 3AXFA 3K1PA 2FIXA 1NL5A 2DS9A 4N4UA 3MVXA 3PUXE 5AE4A 5BUUA 1A8FA 1NH8A 1O64A 4AB5A 4NN3A 2CZIA 2XXVA 1LBBA 2WBBA 2WYPA 3C4MA 3I5OA 4GBWA 2DVZA 3MPLA 3M3KA 1FBEA 3CFZA 5KCJB 3TPAA 4P0GA 2RC8A 4NF8A 3SEWA 2QL3A 4DZ1A 4Z0IA 2KLFA 3KSXA 1VE4A 4NWDA 2WX9A 4RK9A 5AA3A 2XXRA 4LZ7A 4NEDA 4N91A 3O2AA 2CEXA 3L6HA 1P1NA 4G61A 1YAEA 2X7QA 5EQ9A 1BIYA 4YMAA 3GLBA 4JVIA 5AA4B 3FUZA 4RPNA 2XX7A 3U8QA 1IQ7A 2DSFA 3N94A 2REJA 5I56B 4EUOA 3T1BA 1YCJA 3TEPA 1P1QA 2VPOA 1Y3NA 5I58A 5ITOA 1UTBB 3LUZA 3WAFA 5H8FA 1Y1ZA 2D21A 4F3GA 4ELQA 1URDA 4U1ZA 4OFLA 2Y7IA 1Y3PA 4P47A 1FPLA 4KFQA 3OEKA 4KHZE 4ISUA 5JK4A 3K02A 5CBSA 3D1RA 4F2OA 4O3AA 4I8CA 5KDTA 3VFJA 4ZZAA 2B4LA 3LSFB 2AIXA 4GXAA 1XVYA 3PMXA 2XX9A 3E13X 5I59B 3K00A 1YTVA 3FVOA 4MNPA 2E1SA 2OLBA 4IO7A 1N84A 4ZE9A 1FW0A 1NV5A 1UQWA 3PPRA 4YKJA 2OBGA 1BTJA 2VHAA 4OVTA 2ZNSA 1DCUA 2I3WA 3GXAA 1DSNA 1SI0A 4ESWA 2VOZA 3U93A 3K2DA 3A3CA 1FBGA 4PE5B 4IO6A 4KR5A 3G3GA 4PE3A 3PUZE 1M5CA 1LAFE 2CZHA 2Z22A 1H44A 5TP9B 1RKMA 2UVJA 4GWXA 4FE8A 2O7UA 3K0VA 4EQ7A 3CRBA 3VVFA 3PUVE 1B51A 4MHFA 4HS7A 4NG7A 1DTGA 3RY3A 1B3FA 4QFNA 4R73A 4NF8B 4Q5TA 1B3GA 3OMBA 1P1OA 4PFRA 3IFAA 2ZNTA 3CIJA 4I3YA 4IGTA 5FTIA 2Q2CA 3G7WA 4RNSA 5IGAA 1LBWA 5H8QA 5TPAB 3CFXA 4UABA 1H3DA 3KBRA 1YZ0A 5EYFA 1P1WA 5CRYA 2RCAA 4EDPA 4KD5A 3TAJA 2HZLA 4RJZA 1FJ6A 4OENA 1FTMA 1Q9DA 2AYSA 3QIMA 2Y7RA 4BLAA 2F6GA 4MIJA 2ZYKA 1YYZA 3LSLA 4F18A 4PFTA 2OWZA 3FASA 1LBVA 3D4GA 1MQIA 5I56A 1NKXA 2F35A 3NOHA 1LFIA 3H03A 3VLWA 5CC2A 5ET6A 4R6KA 3RPWA 2XXUA 2O68A 2XXKA 4HXVA 4YICA 2XD2A 4NF4B 3QSLA 4P3LA 3IO4A 2RF1A 4N8GA 5AA2B 4GWZA 2Y7KA 3G3IA 4MLQA 4R72A 1B58A 4X1DA 3QMFA 3OOAA 1T0KA 1B05A 3EKIA 4F29A 1US5A 3V83A 4R75A 3HHFA 2QMXA 3ECRA 3P7IA 3QUFA 3ZKLA 1DMBA 3MP6A 2Y5KA 4PCDA 3CFLA 4HCYA 4DXUA 3T22A 3F11A 3LV0A 2B3BA 4GWSA 4H45A 4GOTA 1MH3A 3C33A 4JVCA 5K2XA 5IZ3B 4LATA 4XIGQ 3GZGA 4TOZA 5AA2D 3GBAA 2I0BA 4TQUQ 3MQ9A 1MS7A 3TYHA 3N5LA 3UK4A 4QBAA 3ZSFA 2ZNUA 1FTJA 4OA4A 1KWHA 4N07A 1FRPA 2F6PA 4WEPA 2F3DA 1FPBA 3H6VA 1URGA 3H3GA 5KCJA 4XXUA 4GD5A 4I9DA 4YMBA 1FBCA 4O3CA 2OWTA 1B6HA 1P1UA 2UXAA 3DP6A 1Z7NE 2H98A 2DP8A 4R2BA 5CBRA 5ICTA 4DXBA 1II5A 1SYIA 3H4ZA 1FSAA 1SBPA 2R8TA 2Y84A 4R6HA 4AB6A 4YB5A 3RT6B 3UP9A 3Q26A 5H8NA 4OVJA 3ZS6A 4I40A 2UVHA 3B8BA 4MX6A 3S9MC 3O6GA 4E0XA 4X48A 1GGGA 1OMPA 1JQFA 4OETA 3O66A 3IB0A 2XWKA 4N8YA 4BDNA 3K4UA 1NUXA 3E78A 4DCYA 1DPEA 1EYJA 2I3VA 1NNTA 1EH3A 4U23A 4H65A 2REGA 4FECA 2DE2A 2V84A 3PPPA 4F3SA 5IAIA 1ZU0A 2QSXA 2Q8JA 1NNKA 3IAZA 2WBDA 1I69A 1JEVA 2P2AA 4R2FA 1FPGA 4IY5A 2M8CA 1BK4A 1ELJA 4X8RA 5L9OA 4U2RA 2MKZA 1KA1A 3UN6A 5I59A 3PD9A 4LZ8A 1Y1MA 2R71A 2HFBA 2AL4A 3VDFA 2VGQA 4XKPA 4PFWA 5HPQA 2Z8EA 3C36A 1PEBA 5I2KA 3KFMA 4LN5A 2I58A 2D3IA 2FA7A 1FBDA 4PTKA 3EF7A 1BLFA 3FGSA 2DWIA 1MXYA 4P9KA 2XXIA 5I57A 1L5TA 4PAIA 2UYEA 5CMMA 3KN8A 4N13A 3G3HA 2NXOA 4POWA 3KC0A 2RKMA 3TZAA 3ODBA 4MH5A 3U65A 1QUJA 3HCQA 1USYH 1NNFA 2F34A 3S9NC 3U92A 3O28A 2XX8A 4WKMA 3IO6A 4O8MA 1UIUA 4DI3D 4JDFA 1P99A 1Q1KA 4XF5A 1JW4A 2DWJA 3PUYE 1NI9A 1Y20A 3FATA 4JWYA 1HSLA 4G68B 2VD2A 1KZ8A 5HBCA 4BDRA 3S9EA 1FQCA 2YPNA 1JW1A 3O6HA 4PETA 2F97A 1JVYA 3RUMA 2A5TB 4JSDA 3RNNA 3H6UA 2ALUA 4EQ9A 2O6AA 3VLVA 3S4UA 5JEIA 1SVXB 3UA8A 2PFZA 1B9JA 4R74A 2DOJA 3DP4A 3T9VA 3KZGA 1DK4A 4NF4A 1TXFA 3FXBA 1MDQA 4ECFA 1FPEA 3ILUB 2Q89A 5AA1A 3MUQA 1S7YA 4LVQA 4NF5B 5AA2A 4FEDA 4XFEA 1IIWA 4KXPA 3IK6B 1B32A 3W15C 5I3SA 3GBBA 1A55A 3USDA 4F19A 2W7YA 2V3QA 4ZEIA 1NV3A 1XHYA 1FBPA 1JETA 4DXCA 3BFUA 4XKQA 2XXHA 2QS1A 4YKIA 4U4XA 3TMGA 2Q88A 1UTHB 4POXA 5A5XA 2FYIA 4HW8A 4H46A 4ZEDA 1WDNA 4OTEA 4ZE8A 1AWBA 3HPIA 4H0WA 1FTAA 1MXWA 1FBFA 1AIVA 3U72A 2UYFA 1VR5A 1SPIA 1MPBA 3OSRA 2V4CA 3TQLA 1B7ZA 1GVCA 1N7XA 1SW5A 2IA4A 4QHQA 1D9YA 4UACA 2ONRA 2Z23A 3RN8A 4JVDA 4ELRA 1WODA 2D5WA 4FJPA 3OO8A 3FVNA 3PTYA 3A09A 4LA9A 3KGCA 3TCFA 3M3LA 1MY1A 4PFIA 4NWCA 1IMCA 2RC7A 2XWVA 4ESXA 1DPPA 4K3FA 4C1TA 1Z7ME 4ZEKA 3TTKA 3KJTA 3MAMA 4GXSB 2QVUA 1B1XA 3SEXA 3DM0A 2F7BA 1A99A 5L9MA 1NFTA 5I2NA 3C9HA 1KA0A 5DEXB 3RLFE 3TTMA 3FJMA 1N7WA 3PMVA 3SZPA 3FJ7A 1GTKA 1EYIA 2HHMA 1NV1A 4U22A 4F1YA 2PMSA 2XXTA 1VDWA 2B65A 4IR8A 5ELVA 3VE1B 2YJPA 3OD7A 4YB7A 3FVKA 1ZIUA 2DDKA 4M4GA 1LFHA 2VPNA 1SW4A 1FPJA 2HEUA 4MAGA 3SKPA 4P0IA 4RY1A 1QUKA 1FQFA 3K6VA 3SEYA 3Q27A 1A54A 2F7AA 3PD8A 5EHMA 2ANJA 3RPLB 2AL5A 3JV9A 1H76A 1FQEA 1TWYA 4IO3A 2H25A 2Q2AA 1B5JA 2PYYA 5DVIA 4IO4A 5KZTA 2H4IA 4OERA 3LUYA 1B3LA 4OMBA 4YB6A 5DT6A 3KC1A 4P1EA 2P3VA 4ZDMA 4KYSA 2FNCA 3DELB 4LZ5A 3PPOA 5DTBA 3KN3A 4U21A 4QFLA 1VFDA 2LAOA 2ZMBA 2YLNA 3H06B 1ATGA 1MQHA 3T9XB 1SW2A 2B4MA 1UTHA 4QXDA 4AQ4A 3MP1A 5BWJA 2O51A 3E3KA 3QAXA 3TTLA 4DLDA 2HAUA 4YZZA 2V3TA 3TELA 4X9TA 2F5XA 1MY2A 3FD3A 2PFYA 2F7CA 1N76A 1TFAA 1HSJA 2R9JA 4ONYA 1CNQA 4ZZEA 3KG2A 2RINA 1URSA 5B7DA 1RDYA 4N6DA 4OEVA 1XS5A 2QVVA 3CSGA 1QVSA 1MXXA 3TCGA 3SESA 1SI1A 4JSOA 3MZBA 4NF0A 2QS3A 5A5LA 1Y4TA 1FPFA 2I4CA 4YKKA 1QJMA 2BJIA 3OEMA 1B0HA 4QFKA 1MXVA 1EU8A 3CVGA 3DLNA 3RQTA 4F22A 2PCRA 1FCKA 2VD3A 1NV4A 4HE1A 4IGRA 4FATA 2XXQA 3KJ7A 4QSEA 3N26A 3C31A 4GX6A 1LCFA 1B4HA 5CMKA 1GV8A 2NOOA 2O1LA 2HQ0A 1CE2A 5I2NB 3C35A 4G4PA 2OWSA 4G68A 1OVBA 1NNPA 1XT8A 3OENA 4XKNA 4F2QA 1FTOA 2NUVA 1B0LA 4O3BA 5ET5A 1I6QA 2A5TA 3PPQA 2XXPA 1FBHA 4XEQA 5EQ8A 3EHUA 3LBSA 3HHGA 5L9SA 1D9QA 3IR1A 2ZYMA 2F3BA 4ELOA 3RPLA 3IB2A 3IL1B 3CR9A 5F7VA 2O7IA 1RYOA 3EQ1A 3MZ9A 2PT2A 5EHSA 2P0SA 3FVGA 1NV6A 1QGXA 1FQBA 2DXYA 1Y4CA 3LR1A 3ILTB 1FPIA 4FIMA 1S9TA 3PMWA 3V5AA 4DDDA 3G3JA 3PGFA 4H67A 1IMEA 1LFGA 3RT8A 5DVFA 1BKAA 5H8SA 2ZZXA 2V25A 2FIEA 4LQ5A 5CMCA 2QMWA 3R7XA 4OVRA 1NUWA 1JP4A 1EZPA 1B3EA 2DWHA 4OWDA 4BDLA 5I7IA 4Q30B 3C32A 1FTKA 3I3VA 5I58B 4PAKA 1F9BA 3H6WA 3HN0A 4JBZA 3T96B 1OVTA 4OFOA 4N15A 4YAHX 3ROJA 1N3WA 4YKPA 4GQOA 1B7UA 4FAJA 1NV7A 1IMAA 2PVUA 4OEUA 1OIBA 3VLUA 5ITPA 1LBXA 4ZECA 4N17A 4XKRA 4BDOA 2BJJX 5J16A 4QF9A 1B5HA 4GVOA 3TUSA 1B40A 2FBPA 5LTCA 4XTCQ 2F36A 1J1NA 4LP2B 4Q0CA 2P3NA 2UVIA 1HSEA 1SYHA 1SW1A 2GFEA 2HXWA 2I4BA 3EN3A 3MJNA 3B6QA 1TFDA 3Q28A 1ZMGA 1IZ1A 3IX1A 1FPDA 4L17A 3VVEA 1N04A 3FXRA 4G8MA 5JTYA 1NV2A 3MSTA 1D4NA 1FQDA 3R26A 4H5GA 4BDQA 3SEUA 1QW0A 1JVXA 5M2VA 2GQ1A 4N81A 2XWIA 4DE8A 2F78A 1QKAA 1OQHA 2VP1A 3KBZA 2ZYNA 4OHNA 2ZZWA 5TP9A 3PUWE 3O9PA 2I48A 5ICQA 4WEDA 2HCAA 2JJKA 2O69A 4QFOA 4E0WA 4DI4B 3IOWA 4G77A 3K6UA 2Y7WA 4ZS9A 3RYDA 3UIFA 2X26A 4GWYA 1Q35A 4KQPA 3G3FA 3SETA 3BKIB 4HCWA 4PQJA 1NUZA 3LSWA 2I0CA 2XXYA 3HV1A 3MZ1A 4GIZA 1Y3QA 5H8QB 3RTFB 5B70A 1BP5A 1US4A 3QUJA 2QFLA 3O6IA 3N6TA 3OELA 2ZXTA 4GL8A 3O97A 1R9LA 2QPQA 2PBWA 5ESYA 4PBHA 3FXQA 3Q29A 5IZ3A 1PB7A 1PB8A 3IB1A 1USYE 1JEUA 4PBQA 1B1HA 2O84X 1N0TA 3QXMA 4HE2A 2XHDA 1QULA 1UTBA 2HAVA 1XC1A 1MH4A 4PFUA 4R6YA 2PT1A 5K2YA 1K9YA 1MQJA 3S9LC 4O7IA 4ELPA 4G8HA 2CZLA 1LAHE 4JB7A 4MBPA 1AL3A 4LQ2A 3TTNA 2E0SA 2QS4A 5J1DA 1OQGA 3MVWA 4KPTA 1ZBMA 3W9VA 4OXVA 2QS2A 4HE0A 5DVJA 3IFCA 4UA8A 1H45A 3HSTA 3TDJA 4I1DA 4GFRA 2DVCA 3RGYA 4X04A 4P11A 1RDZA 3K6XA 1ZKBA 4I62A 1VFEA 1AMFA 1IUDA 4GF8A 4P1LA 5EQAA 4RK2A 1G0IA 1XOCA 3K1NA 1NH7A 2DYXA 5H8HB 1B52A 2A5SA 5ET7A 2GHBA 1XVXA 5IM2A 3KEIA 4PFYA 2G93A 4OVPA 4PC9A 3R6UA 2GHAA 1YXIA 2ABHA 2VT5A 1IXCA 5ISUA 4FBPA 3CG3A 4OVQA 2CZKA 1DTZA 2G29A 4AS4A 1IXHA 5FTHA 1I6BA 2RC9A 1LBYA 3CSBA 4NHBA 2OJTA 1SQYA 4TLLB 4OQOA 2NVUB 1FTLA 4MNCA 5FHNA 1XI6A 3MP8A 2X7PA 4IO2A 3JYRA 5EQ7A 1MXZA 1B46A 3TKDA 4MNIA 4EF2A 4F1UA 1MM6A 3RTWB 1D3KA 3K01A 5FBPA 4NF5A 3FXUA 1WVJA 1MPCA 3IOVA 3SERA 5I84A 1MM7A 5HM4B 3UGWA 1B2HA 3EHTA 2NWJA 4KCCA 4H6DA 4N6KA 1MRPA 4MMPA 1IMFA 3E9XA 3B6WA 4GWUA 2XWOA 5L8DA 1NUYA 3TCHA 4GWWA 1LCTA 3T9UA 1NMUA 4MLVA 4GWOA 5IZZA 1VSOA 4O7MA 3BIHA 1MDP1 1NV0A 4H8IA 3K6WA 1CB6A 3T66A 4F31B 2R6GE 1IITA 1QKBA 3QYTA 5CMBA 4LONB 1MXUA 1PDAA 1OLAA 3I6VA 3B6TA 4F3PA 1JW5A 5CM6A 1FJ9A 1DOTA 1O7TA 4NF6B 2OX3A 2Z8FA 3PU5A 2CMOA 2ONKE 4NMYA 3VVDA 3D4CA 3K1MA 4GBVA 4OANA 4OESA 2XXXA 2O1MA 3TQWA 4NQ8A 2ESNA 3BBRA 3M8UA 4GRKA 4TLMB 4X1BA 3OO9A 1B5IA 1M5FA 5EYGA 4THIA 5JTYB 2OZZA 3E4RA 3IJOB 4GX4A 3S2VA 4Q8RA 4MFIA 1D9VA 3BIGA 3W9WA 4KYDA 4WXJA 4RA1A 4NE4A 2OK2A 4RXLA 4PAFA 2DQVA 3KOTA 3PPNA 1MG1A 2OCUA 3THIA 1MY3A 3B7DA 4O94A 4F39A 4QRZA 3MYUA 3IOTA 3IJXB 4OZ9A 2Y7PA 3IORA 3KSJA 3PV0E 2QVRA 1IXGA 4KYEA 4QSCA 3T0JA 1LB8A 3EPEA 4MCOA 4GX3A 1AOVA 3E79A 4MF3A 3C34A 1Y9UA 1FQAA 1EZ9A 4GL0A 4JWXA 3WAEA 2Y5LA 2FHYA 1K9ZA 4GLIA 3V8XB 2HPGA 3VXCA 4DCXA 1LGBC 1RDXA 3FV2A 5H8NB 1RYXA 3T93B 3G3KA 4NGUA 2DE4A 5LOMA 1SDXA 4ND9A 1MPDA 4YU0A 1M5DA 2CEYA 4EXLA 3QK6A 3MW0A 2FVZA 4JXIA 1MY4A 3VXBA 1IMDA 3DP8A 5DW8A 2IEEA 1R1NA 3OO6A 4M1VA 2UVGA 1A7LA 1ANFA 2ZZVA 3MPKA 5H8FB 1I6AA 4U1OA 3TODA 5TU0A 2XXWA 4JWOA 5FHMA 2QJEA 1QUIA 1AH5A 3VV5A 4NF6A 4AS5A 2Q74A 4EXKA 1IXIA 2P1SA 2ONSA 3OXNA 3ZKKA 3CI8A 3U94A 5T3JA 5I5PA 4H5FA 1SD3A 4FEBA 3LSXA 4U4SA 4PDHA 1PBPA 1LAGE 1PB9A 5H8HA 2ZYOA 3MVYA 1EYKA 1PBQA 1TT1A 4IO5A 4OYVA 1POY1 5A5XB 1INPA 1DBZA 2H9BA 3O29A 4NTLA 1LSTA 5I2KB 4BDMA 5DEXA 4R9FA 1N3XA 4H1XA 1MQDA 3KOSA 2GH9A 3FBPA 3N6UA 4OVSA 5ET8A 3SDFA 3ONMA 3M3FA 4RPOA 2Q9TA 3LC8A 1H43A 4KCDA 1ZTYA 4EQBA 5F24A 3FV1A 2DE3A 4RYAA 1OLCA 2HXRA 4FORA 3CG1A 2THIA 3MC2A 5I57B 1IMBA 5FHOA 3TFLA 4G2ZA 4MEVA 4PP0A 4NX1A 2KQZA 4P56A 1MY0A 4F1VA 1R6ZA 4ZEFA 2F8DA 3V89B 1PC3A 1LEVA 1R9QA 3IOUA 3H7MA 3KN7A 4QFPA 1B4ZA 4R9GA 3MBPA 2DXRA 3Q25A 3FZVA 3JZJA 4NAPA 2H99A 2HZKA 4QSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GR2 A;  1ZJL A;  4IY6 A;  2V3U A;  5F1Q A;  4LUB A;  5TPA A;  3MWB A;  4Z7E A;  4PF8 A;  3OO7 A;  4ZEB A;  3MVZ A;  2RCB A;  4DIG A;  1IEJ A;  3FJG A;  5AA4 A;  2B3F A;  2XD3 A;  2DWA A;  2V93 A;  4OFJ A;  1S50 A;  4H8J A;  5DYH A;  4G8N A;  1LLS A;  1M5E A;  1UIV A;  4G68 C;  1JNF A;  3FIR A;  3L6G A;  1YPN A;  5CI5 A;  2PX1 A;  4PF6 A;  2H5Y A;  1EZO A;  1MQG A;  2GRV A;  1A8E A;  3T9H B;  3EHS A;  4HTG A;  5KDT B;  1B3H A;  4KI0 E;  4EF1 A;  1POT A;  4C1U A;  1M5B A;  4PFB A;  3HO7 A;  4P8B A;  4PGP A;  5IKB A;  3U1O A;  4C0R A;  4F3B A;  1B7H A;  3B50 A;  2WKY A;  4PDD A;  4PGN A;  2I49 A;  3SEV A;  2QRY A;  3A3U A;  1O63 A;  2XA5 A;  3UOR A;  1LBC A;  4N6P A;  2I6E A;  2Z8D A;  2WYK A;  3TTR A;  3OSQ A;  3H6T A;  1LAX A;  3BFT A;  1A40 A;  1LB9 A;  3GYY A;  1ZLQ A;  4IB2 A;  3AXF A;  3K1P A;  1NL5 A;  2DS9 A;  4N4U A;  3MVX A;  3PUX E;  5AE4 A;  5BUU A;  1A8F A;  1NH8 A;  1O64 A;  4AB5 A;  4NN3 A;  2XXV A;  1LBB A;  2WYP A;  3C4M A;  3I5O A;  2DVZ A;  3MPL A;  3M3K A;  3CFZ A;  5KCJ B;  3TPA A;  4P0G A;  2RC8 A;  4NF8 A;  3SEW A;  2QL3 A;  4DZ1 A;  4Z0I A;  2KLF A;  3KSX A;  1VE4 A;  4NWD A;  2WX9 A;  4RK9 A;  5AA3 A;  2XXR A;  4LZ7 A;  4NED A;  4N91 A;  3O2A A;  2CEX A;  3L6H A;  1P1N A;  1YAE A;  2X7Q A;  1BIY A;  4YMA A;  3GLB A;  5AA4 B;  3FUZ A;  4RPN A;  2XX7 A;  3U8Q A;  1IQ7 A;  2DSF A;  3N94 A;  2REJ A;  5I56 B;  4EUO A;  1YCJ A;  3TEP A;  1P1Q A;  2VPO A;  1Y3N A;  5I58 A;  5ITO A;  1UTB B;  3WAF A;  5H8F A;  1Y1Z A;  2D21 A;  4F3G A;  4ELQ A;  1URD A;  4U1Z A;  4OFL A;  2Y7I A;  1Y3P A;  4P47 A;  4KFQ A;  3OEK A;  4KHZ E;  4ISU A;  5JK4 A;  3K02 A;  5CBS A;  4F2O A;  4O3A A;  4I8C A;  5KDT A;  3VFJ A;  4ZZA A;  3LSF B;  2AIX A;  4GXA A;  1XVY A;  3PMX A;  2XX9 A;  3E13 X;  5I59 B;  3K00 A;  1YTV A;  3FVO A;  4MNP A;  2E1S A;  2OLB A;  4IO7 A;  1N84 A;  4ZE9 A;  1FW0 A;  1UQW A;  3PPR A;  4YKJ A;  2OBG A;  1BTJ A;  2VHA A;  4OVT A;  2ZNS A;  2I3W A;  3GXA A;  1DSN A;  1SI0 A;  4ESW A;  2VOZ A;  3U93 A;  3K2D A;  3A3C A;  4PE5 B;  4IO6 A;  4KR5 A;  3G3G A;  4PE3 A;  3PUZ E;  1M5C A;  1LAF E;  2Z22 A;  1H44 A;  5TP9 B;  1RKM A;  2UVJ A;  4FE8 A;  2O7U A;  3K0V A;  4EQ7 A;  3CRB A;  3VVF A;  3PUV E;  1B51 A;  4MHF A;  4NG7 A;  4HS7 A;  1DTG A;  3RY3 A;  1B3F A;  4QFN A;  4R73 A;  4NF8 B;  4Q5T A;  1B3G A;  3OMB A;  1P1O A;  4PFR A;  2ZNT A;  3CIJ A;  4IGT A;  5FTI A;  2Q2C A;  3G7W A;  4RNS A;  5IGA A;  5H8Q A;  5TPA B;  3CFX A;  4UAB A;  1H3D A;  3KBR A;  5EYF A;  1P1W A;  5CRY A;  2RCA A;  4EDP A;  4KD5 A;  3TAJ A;  2HZL A;  4RJZ A;  4OEN A;  1FTM A;  2AYS A;  3QIM A;  2Y7R A;  4BLA A;  2F6G A;  4MIJ A;  2ZYK A;  3LSL A;  4F18 A;  4PFT A;  3FAS A;  3D4G A;  1MQI A;  5I56 A;  1NKX A;  2F35 A;  1LFI A;  3H03 A;  3VLW A;  5CC2 A;  4R6K A;  3RPW A;  2XXU A;  2O68 A;  2XXK A;  4YIC A;  2XD2 A;  4NF4 B;  3QSL A;  4P3L A;  3IO4 A;  2RF1 A;  4N8G A;  5AA2 B;  2Y7K A;  3G3I A;  4MLQ A;  4R72 A;  1B58 A;  4X1D A;  3OOA A;  1T0K A;  1B05 A;  4F29 A;  1US5 A;  3V83 A;  4R75 A;  3HHF A;  2QMX A;  3ECR A;  3P7I A;  3QUF A;  3ZKL A;  1DMB A;  3MP6 A;  4PCD A;  3CFL A;  4HCY A;  4DXU A;  3T22 A;  3F11 A;  2B3B A;  4GOT A;  1MH3 A;  3C33 A;  5K2X A;  4LAT A;  4XIG Q;  3GZG A;  4TOZ A;  5AA2 D;  3GBA A;  2I0B A;  4TQU Q;  3MQ9 A;  1MS7 A;  3TYH A;  3N5L A;  3UK4 A;  3ZSF A;  2ZNU A;  1FTJ A;  4OA4 A;  1KWH A;  4N07 A;  2F6P A;  4WEP A;  3H6V A;  1URG A;  3H3G A;  5KCJ A;  4XXU A;  4GD5 A;  4I9D A;  4YMB A;  4O3C A;  2OWT A;  1B6H A;  1P1U A;  2UXA A;  3DP6 A;  1Z7N E;  2H98 A;  2DP8 A;  4R2B A;  5CBR A;  5ICT A;  4DXB A;  1II5 A;  1SYI A;  3H4Z A;  1SBP A;  2Y84 A;  4R6H A;  4AB6 A;  4YB5 A;  3RT6 B;  3UP9 A;  3Q26 A;  5H8N A;  4OVJ A;  3ZS6 A;  2UVH A;  4MX6 A;  3S9M C;  3O6G A;  4E0X A;  4X48 A;  1GGG A;  1OMP A;  1JQF A;  4OET A;  3O66 A;  3IB0 A;  2XWK A;  4N8Y A;  4BDN A;  3K4U A;  4DCY A;  1DPE A;  2I3V A;  1NNT A;  1EH3 A;  4U23 A;  4H65 A;  2REG A;  4FEC A;  2DE2 A;  2V84 A;  3PPP A;  4F3S A;  5IAI A;  1ZU0 A;  2QSX A;  2Q8J A;  1NNK A;  3IAZ A;  1I69 A;  1JEV A;  2P2A A;  4R2F A;  4IY5 A;  2M8C A;  1ELJ A;  4X8R A;  5L9O A;  4U2R A;  3UN6 A;  5I59 A;  3PD9 A;  4LZ8 A;  1Y1M A;  2R71 A;  2HFB A;  2AL4 A;  3VDF A;  2VGQ A;  4XKP A;  4PFW A;  5HPQ A;  2Z8E A;  3C36 A;  1PEB A;  5I2K A;  3KFM A;  4LN5 A;  2I58 A;  2D3I A;  2FA7 A;  3EF7 A;  1BLF A;  3FGS A;  2DWI A;  1MXY A;  4P9K A;  2XXI A;  5I57 A;  1L5T A;  4PAI A;  2UYE A;  5CMM A;  3KN8 A;  4N13 A;  3G3H A;  2NXO A;  4POW A;  2RKM A;  3TZA A;  3ODB A;  4MH5 A;  3U65 A;  1QUJ A;  3HCQ A;  1USY H;  1NNF A;  2F34 A;  3S9N C;  3U92 A;  3O28 A;  2XX8 A;  4WKM A;  3IO6 A;  4O8M A;  1UIU A;  4DI3 D;  4JDF A;  1P99 A;  1Q1K A;  4XF5 A;  1JW4 A;  2DWJ A;  3PUY E;  1Y20 A;  3FAT A;  4JWY A;  1HSL A;  4G68 B;  2VD2 A;  5HBC A;  4BDR A;  3S9E A;  1FQC A;  2YPN A;  1JW1 A;  3O6H A;  4PET A;  2F97 A;  1JVY A;  3RUM A;  2A5T B;  4JSD A;  3RNN A;  3H6U A;  2ALU A;  4EQ9 A;  2O6A A;  3VLV A;  3S4U A;  5JEI A;  1SVX B;  3UA8 A;  2PFZ A;  1B9J A;  4R74 A;  2DOJ A;  3DP4 A;  3T9V A;  3KZG A;  4NF4 A;  1TXF A;  3FXB A;  1MDQ A;  4ECF A;  3ILU B;  2Q89 A;  5AA1 A;  3MUQ A;  1S7Y A;  4LVQ A;  4NF5 B;  5AA2 A;  4FED A;  4XFE A;  1IIW A;  3IK6 B;  1B32 A;  3W15 C;  3GBB A;  1A55 A;  3USD A;  4F19 A;  2W7Y A;  2V3Q A;  4ZEI A;  1XHY A;  1JET A;  4DXC A;  3BFU A;  4XKQ A;  2XXH A;  2QS1 A;  4YKI A;  4U4X A;  3TMG A;  2Q88 A;  1UTH B;  4POX A;  5A5X A;  2FYI A;  4HW8 A;  4ZED A;  1WDN A;  4OTE A;  4ZE8 A;  3HPI A;  4H0W A;  1MXW A;  1AIV A;  3U72 A;  2UYF A;  1VR5 A;  1MPB A;  3OSR A;  2V4C A;  3TQL A;  1B7Z A;  1GVC A;  1N7X A;  1SW5 A;  2IA4 A;  4QHQ A;  1D9Y A;  4UAC A;  2ONR A;  2Z23 A;  3RN8 A;  4ELR A;  1WOD A;  2D5W A;  4FJP A;  3OO8 A;  3FVN A;  3A09 A;  4LA9 A;  3KGC A;  3TCF A;  3M3L A;  1MY1 A;  4PFI A;  4NWC A;  2RC7 A;  2XWV A;  4ESX A;  1DPP A;  4K3F A;  4C1T A;  1Z7M E;  4ZEK A;  3TTK A;  3KJT A;  3MAM A;  4GXS B;  1B1X A;  3SEX A;  3DM0 A;  2F7B A;  1A99 A;  5L9M A;  1NFT A;  5I2N A;  3C9H A;  5DEX B;  3RLF E;  3TTM A;  3FJM A;  1N7W A;  3PMV A;  3FJ7 A;  1GTK A;  4U22 A;  4F1Y A;  2PMS A;  2XXT A;  2B65 A;  5ELV A;  3VE1 B;  2YJP A;  3OD7 A;  4YB7 A;  3FVK A;  1ZIU A;  4M4G A;  1LFH A;  2VPN A;  1SW4 A;  2HEU A;  4MAG A;  3SKP A;  4P0I A;  4RY1 A;  1QUK A;  1FQF A;  3K6V A;  3SEY A;  3Q27 A;  1A54 A;  2F7A A;  3PD8 A;  5EHM A;  2ANJ A;  2AL5 A;  3JV9 A;  1H76 A;  1FQE A;  1TWY A;  4IO3 A;  2H25 A;  2Q2A A;  1B5J A;  2PYY A;  5DVI A;  4IO4 A;  5KZT A;  2H4I A;  4OER A;  3LUY A;  1B3L A;  4OMB A;  4YB6 A;  5DT6 A;  4P1E A;  4ZDM A;  4KYS A;  2FNC A;  3DEL B;  4LZ5 A;  3PPO A;  5DTB A;  3KN3 A;  4U21 A;  4QFL A;  1VFD A;  2LAO A;  2ZMB A;  2YLN A;  3H06 B;  1ATG A;  1MQH A;  3T9X B;  1SW2 A;  1UTH A;  4AQ4 A;  3MP1 A;  5BWJ A;  2O51 A;  3E3K A;  3QAX A;  3TTL A;  4DLD A;  2HAU A;  4YZZ A;  2V3T A;  3TEL A;  4X9T A;  2F5X A;  1MY2 A;  3FD3 A;  2PFY A;  2F7C A;  1N76 A;  1TFA A;  1HSJ A;  2R9J A;  4ONY A;  4ZZE A;  3KG2 A;  2RIN A;  1URS A;  5B7D A;  4N6D A;  4OEV A;  1XS5 A;  3CSG A;  1QVS A;  1MXX A;  3TCG A;  3SES A;  1SI1 A;  4JSO A;  3MZB A;  4NF0 A;  2QS3 A;  1Y4T A;  2I4C A;  4YKK A;  1QJM A;  3OEM A;  1B0H A;  4QFK A;  1MXV A;  1EU8 A;  3CVG A;  3DLN A;  3RQT A;  4F22 A;  1FCK A;  2VD3 A;  4IGR A;  4FAT A;  2XXQ A;  3KJ7 A;  4QSE A;  3N26 A;  3C31 A;  1LCF A;  1B4H A;  5CMK A;  1GV8 A;  2NOO A;  2O1L A;  2HQ0 A;  1CE2 A;  5I2N B;  3C35 A;  4G4P A;  2OWS A;  4G68 A;  1OVB A;  1NNP A;  1XT8 A;  3OEN A;  4XKN A;  4F2Q A;  1FTO A;  2NUV A;  1B0L A;  4O3B A;  1I6Q A;  2A5T A;  3PPQ A;  2XXP A;  4XEQ A;  3EHU A;  3LBS A;  3HHG A;  5L9S A;  3IR1 A;  2ZYM A;  4ELO A;  3IB2 A;  3IL1 B;  3CR9 A;  5F7V A;  2O7I A;  1RYO A;  3EQ1 A;  3MZ9 A;  2PT2 A;  5EHS A;  2P0S A;  3FVG A;  1FQB A;  2DXY A;  1Y4C A;  3LR1 A;  3ILT B;  4FIM A;  1S9T A;  3PMW A;  3V5A A;  4DDD A;  3G3J A;  3PGF A;  4H67 A;  1LFG A;  3RT8 A;  5DVF A;  1BKA A;  5H8S A;  2ZZX A;  2V25 A;  4LQ5 A;  5CMC A;  2QMW A;  3R7X A;  4OVR A;  1EZP A;  1B3E A;  2DWH A;  4OWD A;  4BDL A;  5I7I A;  4Q30 B;  3C32 A;  1FTK A;  3I3V A;  5I58 B;  4PAK A;  1F9B A;  3H6W A;  3HN0 A;  4JBZ A;  3T96 B;  1OVT A;  4OFO A;  4N15 A;  4YAH X;  1N3W A;  4YKP A;  4GQO A;  1B7U A;  4FAJ A;  2PVU A;  4OEU A;  1OIB A;  3VLU A;  5ITP A;  4ZEC A;  4N17 A;  4XKR A;  4BDO A;  2BJJ X;  4QF9 A;  1B5H A;  4GVO A;  3TUS A;  1B40 A;  5LTC A;  4XTC Q;  2F36 A;  1J1N A;  4LP2 B;  4Q0C A;  2UVI A;  1HSE A;  1SYH A;  1SW1 A;  2GFE A;  2HXW A;  2I4B A;  3EN3 A;  3MJN A;  3B6Q A;  1TFD A;  3Q28 A;  1ZMG A;  1IZ1 A;  3IX1 A;  4L17 A;  3VVE A;  1N04 A;  3FXR A;  4G8M A;  5JTY A;  1D4N A;  1FQD A;  3R26 A;  4H5G A;  4BDQ A;  3SEU A;  1QW0 A;  1JVX A;  5M2V A;  2XWI A;  4DE8 A;  2F78 A;  1QKA A;  1OQH A;  2VP1 A;  2ZYN A;  4OHN A;  2ZZW A;  5TP9 A;  3PUW E;  3O9P A;  2I48 A;  5ICQ A;  4WED A;  2HCA A;  2O69 A;  4QFO A;  4E0W A;  4DI4 B;  3IOW A;  4G77 A;  3K6U A;  2Y7W A;  4ZS9 A;  3UIF A;  2X26 A;  1Q35 A;  4KQP A;  3G3F A;  3SET A;  3BKI B;  4HCW A;  4PQJ A;  3LSW A;  2I0C A;  2XXY A;  3HV1 A;  3MZ1 A;  4GIZ A;  1Y3Q A;  5H8Q B;  3RTF B;  5B70 A;  1BP5 A;  1US4 A;  3QUJ A;  3O6I A;  3N6T A;  3OEL A;  2ZXT A;  4GL8 A;  3O97 A;  1R9L A;  2QPQ A;  2PBW A;  4PBH A;  3FXQ A;  3Q29 A;  1PB7 A;  1PB8 A;  3IB1 A;  1USY E;  1JEU A;  4PBQ A;  1B1H A;  2O84 X;  1N0T A;  3QXM A;  2XHD A;  1QUL A;  1UTB A;  2HAV A;  1XC1 A;  1MH4 A;  4PFU A;  4R6Y A;  2PT1 A;  5K2Y A;  1MQJ A;  3S9L C;  4ELP A;  4G8H A;  2CZL A;  1LAH E;  4JB7 A;  4MBP A;  1AL3 A;  4LQ2 A;  3TTN A;  2E0S A;  2QS4 A;  5J1D A;  1OQG A;  3MVW A;  4KPT A;  1ZBM A;  3W9V A;  4OXV A;  2QS2 A;  5DVJ A;  4UA8 A;  1H45 A;  3HST A;  3TDJ A;  4I1D A;  4GFR A;  2DVC A;  3RGY A;  4X04 A;  4P11 A;  3K6X A;  1ZKB A;  4I62 A;  1VFE A;  1AMF A;  1IUD A;  4GF8 A;  4P1L A;  4RK2 A;  1XOC A;  3K1N A;  1NH7 A;  2DYX A;  5H8H B;  1B52 A;  2A5S A;  2GHB A;  1XVX A;  5IM2 A;  3KEI A;  4PFY A;  2G93 A;  4OVP A;  4PC9 A;  3R6U A;  2GHA A;  2ABH A;  1IXC A;  5ISU A;  3CG3 A;  4OVQ A;  1DTZ A;  2G29 A;  1IXH A;  5FTH A;  1I6B A;  2RC9 A;  3CSB A;  4NHB A;  2OJT A;  1SQY A;  4TLL B;  4OQO A;  2NVU B;  1FTL A;  4MNC A;  5FHN A;  3MP8 A;  2X7P A;  4IO2 A;  3JYR A;  1MXZ A;  1B46 A;  3TKD A;  4MNI A;  4EF2 A;  4F1U A;  1MM6 A;  3RTW B;  1D3K A;  3K01 A;  4NF5 A;  3FXU A;  1WVJ A;  1MPC A;  3IOV A;  3SER A;  5I84 A;  1MM7 A;  5HM4 B;  3UGW A;  1B2H A;  3EHT A;  2NWJ A;  4KCC A;  4H6D A;  4N6K A;  1MRP A;  4MMP A;  3E9X A;  3B6W A;  2XWO A;  5L8D A;  3TCH A;  1LCT A;  3T9U A;  1NMU A;  4MLV A;  4GWO A;  5IZZ A;  1VSO A;  4O7M A;  1MDP 1;  4H8I A;  3K6W A;  1CB6 A;  3T66 A;  4F31 B;  2R6G E;  1IIT A;  1QKB A;  3QYT A;  5CMB A;  4LON B;  1MXU A;  1PDA A;  1OLA A;  3I6V A;  3B6T A;  4F3P A;  1JW5 A;  5CM6 A;  1DOT A;  1O7T A;  4NF6 B;  2Z8F A;  3PU5 A;  2CMO A;  2ONK E;  4NMY A;  3VVD A;  3D4C A;  3K1M A;  4OAN A;  4OES A;  2XXX A;  2O1M A;  3TQW A;  4NQ8 A;  2ESN A;  3BBR A;  3M8U A;  4GRK A;  4TLM B;  4X1B A;  3OO9 A;  1B5I A;  1M5F A;  4THI A;  5JTY B;  2OZZ A;  3E4R A;  3IJO B;  3S2V A;  4Q8R A;  4MFI A;  1D9V A;  3W9W A;  4KYD A;  4WXJ A;  4RA1 A;  4NE4 A;  2OK2 A;  4RXL A;  4PAF A;  2DQV A;  3KOT A;  3PPN A;  1MG1 A;  2OCU A;  3THI A;  1MY3 A;  3B7D A;  4O94 A;  4F39 A;  4QRZ A;  3IOT A;  3IJX B;  4OZ9 A;  2Y7P A;  3IOR A;  3KSJ A;  3PV0 E;  1IXG A;  4KYE A;  4QSC A;  1LB8 A;  3EPE A;  4MCO A;  1AOV A;  4MF3 A;  3C34 A;  1Y9U A;  1FQA A;  1EZ9 A;  4GL0 A;  4JWX A;  3WAE A;  4GLI A;  3V8X B;  2HPG A;  3VXC A;  4DCX A;  1LGB C;  3FV2 A;  5H8N B;  1RYX A;  3T93 B;  3G3K A;  4NGU A;  2DE4 A;  5LOM A;  1SDX A;  4ND9 A;  1MPD A;  4YU0 A;  1M5D A;  2CEY A;  4EXL A;  3QK6 A;  3MW0 A;  4JXI A;  1MY4 A;  3VXB A;  3DP8 A;  2IEE A;  1R1N A;  3OO6 A;  4M1V A;  2UVG A;  1A7L A;  1ANF A;  2ZZV A;  3MPK A;  5H8F B;  1I6A A;  4U1O A;  3TOD A;  5TU0 A;  2XXW A;  4JWO A;  5FHM A;  2QJE A;  1QUI A;  1AH5 A;  3VV5 A;  4NF6 A;  4EXK A;  1IXI A;  2P1S A;  2ONS A;  3OXN A;  3ZKK A;  3CI8 A;  3U94 A;  5I5P A;  4H5F A;  1SD3 A;  4FEB A;  3LSX A;  4U4S A;  4PDH A;  1PBP A;  1LAG E;  1PB9 A;  5H8H A;  2ZYO A;  3MVY A;  1PBQ A;  1TT1 A;  4IO5 A;  4OYV A;  1POY 1;  5A5X B;  2H9B A;  3O29 A;  4NTL A;  1LST A;  5I2K B;  4BDM A;  5DEX A;  4R9F A;  1N3X A;  4H1X A;  1MQD A;  3KOS A;  2GH9 A;  3N6U A;  4OVS A;  3SDF A;  3ONM A;  3M3F A;  4RPO A;  2Q9T A;  3LC8 A;  1H43 A;  4KCD A;  1ZTY A;  4EQB A;  3FV1 A;  2DE3 A;  4RYA A;  1OLC A;  4FOR A;  3CG1 A;  2THI A;  3MC2 A;  5I57 B;  5FHO A;  3TFL A;  4G2Z A;  4MEV A;  4PP0 A;  4NX1 A;  4P56 A;  1MY0 A;  4F1V A;  1R6Z A;  4ZEF A;  2F8D A;  3V89 B;  1PC3 A;  1R9Q A;  3IOU A;  3H7M A;  3KN7 A;  4QFP A;  1B4Z A;  4R9G A;  3MBP A;  2DXR A;  3Q25 A;  3FZV A;  3JZJ A;  4NAP A;  2H99 A;  2HZK A;  4QSD A; 
#chains in the Genus database with same CATH topology
 1GR2 A;  1ZJL A;  4IY6 A;  2V3U A;  5F1Q A;  4LUB A;  5TPA A;  3MWB A;  4Z7E A;  4PF8 A;  3OO7 A;  1G0H A;  4ZEB A;  3ISP A;  3MVZ A;  2RCB A;  4DIG A;  1IEJ A;  3FJG A;  5AA4 A;  2B3F A;  2XD3 A;  2L5V A;  2DWA A;  2V93 A;  4OFJ A;  4I3E A;  1S50 A;  4H8J A;  5DYH A;  4G8N A;  1LLS A;  1M5E A;  1UIV A;  4G68 C;  2WEF A;  1JNF A;  3FIR A;  5EYH A;  3L6G A;  1YPN A;  5CI5 A;  2PX1 A;  4PF6 A;  2H5Y A;  1EZO A;  1MQG A;  2Q8M A;  1LBZ A;  2GRV A;  2KR0 A;  1A8E A;  3T9H B;  3EHS A;  3A29 A;  3HFU A;  4HTG A;  5KDT B;  1B3H A;  1FPK A;  4KI0 E;  4EF1 A;  1POT A;  4C1U A;  1M5B A;  4PFB A;  3HO7 A;  4P8B A;  4PGP A;  5IKB A;  3U1O A;  4C0R A;  4F3B A;  1B7H A;  3B50 A;  2WKY A;  5IZ1 A;  4PDD A;  4PGN A;  3CHG A;  2I49 A;  3SEV A;  2QRY A;  3A3U A;  1O63 A;  2XA5 A;  3UOR A;  1LBC A;  4N6P A;  2I6E A;  2Z8D A;  2WYK A;  3TTR A;  3OSQ A;  3H6T A;  5LDZ A;  4MJO A;  1LAX A;  3BFT A;  1A40 A;  1LB9 A;  3GYY A;  1ZLQ A;  4IB2 A;  3AXF A;  3K1P A;  2FIX A;  1NL5 A;  2DS9 A;  4N4U A;  3MVX A;  3PUX E;  5AE4 A;  5BUU A;  1A8F A;  1NH8 A;  1O64 A;  4NN3 A;  4AB5 A;  2CZI A;  2XXV A;  1LBB A;  2WBB A;  2WYP A;  3C4M A;  3I5O A;  4GBW A;  2DVZ A;  3MPL A;  3M3K A;  1FBE A;  3CFZ A;  5KCJ B;  3TPA A;  4P0G A;  2RC8 A;  4NF8 A;  3SEW A;  2QL3 A;  4DZ1 A;  4Z0I A;  2KLF A;  3KSX A;  1VE4 A;  4NWD A;  2WX9 A;  4RK9 A;  5AA3 A;  2XXR A;  4LZ7 A;  4NED A;  4N91 A;  2CEX A;  3O2A A;  3L6H A;  1P1N A;  4G61 A;  1YAE A;  2X7Q A;  5EQ9 A;  1BIY A;  4YMA A;  3GLB A;  4JVI A;  5AA4 B;  3FUZ A;  4RPN A;  2XX7 A;  3U8Q A;  1IQ7 A;  2DSF A;  3N94 A;  2REJ A;  5I56 B;  4EUO A;  3T1B A;  1YCJ A;  3TEP A;  1P1Q A;  2VPO A;  1Y3N A;  5I58 A;  5ITO A;  1UTB B;  3LUZ A;  3WAF A;  5H8F A;  1Y1Z A;  2D21 A;  4ELQ A;  4F3G A;  1URD A;  4U1Z A;  4OFL A;  2Y7I A;  1Y3P A;  4P47 A;  1FPL A;  4KFQ A;  3OEK A;  4KHZ E;  4ISU A;  5JK4 A;  3K02 A;  5CBS A;  3D1R A;  4F2O A;  4O3A A;  4I8C A;  5KDT A;  2B4L A;  4ZZA A;  3VFJ A;  3LSF B;  2AIX A;  4GXA A;  1XVY A;  3PMX A;  2XX9 A;  3E13 X;  5I59 B;  3K00 A;  1YTV A;  3FVO A;  4MNP A;  2E1S A;  2OLB A;  4IO7 A;  1N84 A;  4ZE9 A;  1FW0 A;  1NV5 A;  1UQW A;  3PPR A;  4YKJ A;  2OBG A;  1BTJ A;  2VHA A;  4OVT A;  2ZNS A;  1DCU A;  2I3W A;  3GXA A;  1DSN A;  1SI0 A;  4ESW A;  2VOZ A;  3U93 A;  3K2D A;  1FBG A;  3A3C A;  4PE5 B;  4IO6 A;  4KR5 A;  3G3G A;  4PE3 A;  3PUZ E;  1M5C A;  1LAF E;  2CZH A;  2Z22 A;  1H44 A;  5TP9 B;  1RKM A;  2UVJ A;  4GWX A;  4FE8 A;  2O7U A;  3K0V A;  4EQ7 A;  3CRB A;  3VVF A;  3PUV E;  1B51 A;  4MHF A;  4NG7 A;  4HS7 A;  1DTG A;  3RY3 A;  1B3F A;  4QFN A;  4R73 A;  4NF8 B;  4Q5T A;  1B3G A;  3OMB A;  1P1O A;  4PFR A;  3IFA A;  2ZNT A;  3CIJ A;  4I3Y A;  4IGT A;  5FTI A;  2Q2C A;  3G7W A;  4RNS A;  5IGA A;  1LBW A;  5H8Q A;  5TPA B;  3CFX A;  4UAB A;  1H3D A;  1YZ0 A;  3KBR A;  5EYF A;  1P1W A;  5CRY A;  2RCA A;  4EDP A;  4KD5 A;  3TAJ A;  2HZL A;  4RJZ A;  1FJ6 A;  4OEN A;  1FTM A;  1Q9D A;  2AYS A;  3QIM A;  2Y7R A;  4BLA A;  2F6G A;  4MIJ A;  2ZYK A;  1YYZ A;  3LSL A;  4F18 A;  4PFT A;  2OWZ A;  3FAS A;  1LBV A;  3D4G A;  1MQI A;  5I56 A;  1NKX A;  2F35 A;  3NOH A;  1LFI A;  3H03 A;  3VLW A;  5ET6 A;  5CC2 A;  4R6K A;  3RPW A;  2XXU A;  2O68 A;  2XXK A;  4HXV A;  4YIC A;  2XD2 A;  4NF4 B;  3QSL A;  4P3L A;  3IO4 A;  2RF1 A;  4N8G A;  5AA2 B;  4GWZ A;  2Y7K A;  3G3I A;  4MLQ A;  4R72 A;  1B58 A;  4X1D A;  3QMF A;  3OOA A;  3EKI A;  1B05 A;  1T0K A;  4F29 A;  1US5 A;  3V83 A;  4R75 A;  3HHF A;  2QMX A;  3P7I A;  3ECR A;  3QUF A;  3ZKL A;  1DMB A;  2Y5K A;  3MP6 A;  4PCD A;  3CFL A;  4HCY A;  4DXU A;  3T22 A;  3F11 A;  3LV0 A;  2B3B A;  4GWS A;  4H45 A;  4GOT A;  1MH3 A;  3C33 A;  4JVC A;  5K2X A;  5IZ3 B;  4LAT A;  4XIG Q;  3GZG A;  4TOZ A;  5AA2 D;  3GBA A;  2I0B A;  4TQU Q;  3MQ9 A;  1MS7 A;  3TYH A;  3N5L A;  3UK4 A;  4QBA A;  3ZSF A;  2ZNU A;  1FTJ A;  4OA4 A;  1KWH A;  4N07 A;  1FRP A;  2F6P A;  4WEP A;  2F3D A;  1FPB A;  3H6V A;  1URG A;  3H3G A;  5KCJ A;  4XXU A;  4GD5 A;  4I9D A;  4YMB A;  1FBC A;  4O3C A;  2OWT A;  1B6H A;  1P1U A;  2UXA A;  3DP6 A;  1Z7N E;  2H98 A;  2DP8 A;  4R2B A;  5CBR A;  5ICT A;  4DXB A;  1II5 A;  1SYI A;  3H4Z A;  1FSA A;  1SBP A;  2R8T A;  2Y84 A;  4R6H A;  4AB6 A;  4YB5 A;  3RT6 B;  3UP9 A;  3Q26 A;  5H8N A;  4OVJ A;  3ZS6 A;  4I40 A;  2UVH A;  3B8B A;  4MX6 A;  3S9M C;  3O6G A;  4E0X A;  4X48 A;  1GGG A;  1OMP A;  1JQF A;  4OET A;  3O66 A;  3IB0 A;  2XWK A;  4N8Y A;  4BDN A;  3K4U A;  1NUX A;  3E78 A;  4DCY A;  1DPE A;  1EYJ A;  2I3V A;  1NNT A;  1EH3 A;  4U23 A;  4H65 A;  2REG A;  4FEC A;  2DE2 A;  2V84 A;  3PPP A;  4F3S A;  5IAI A;  1ZU0 A;  2QSX A;  2Q8J A;  1NNK A;  2WBD A;  3IAZ A;  1I69 A;  1JEV A;  2P2A A;  4R2F A;  1FPG A;  4IY5 A;  2M8C A;  1BK4 A;  1ELJ A;  4X8R A;  5L9O A;  4U2R A;  2MKZ A;  1KA1 A;  3UN6 A;  5I59 A;  3PD9 A;  4LZ8 A;  1Y1M A;  2R71 A;  2HFB A;  2AL4 A;  3VDF A;  2VGQ A;  4XKP A;  4PFW A;  5HPQ A;  2Z8E A;  3C36 A;  1PEB A;  5I2K A;  3KFM A;  4LN5 A;  2I58 A;  2D3I A;  2FA7 A;  1FBD A;  4PTK A;  3EF7 A;  1BLF A;  3FGS A;  2DWI A;  1MXY A;  4P9K A;  2XXI A;  5I57 A;  1L5T A;  4PAI A;  2UYE A;  5CMM A;  3KN8 A;  4N13 A;  3G3H A;  2NXO A;  4POW A;  3KC0 A;  2RKM A;  3TZA A;  3ODB A;  4MH5 A;  3U65 A;  1QUJ A;  3HCQ A;  1USY H;  1NNF A;  2F34 A;  3S9N C;  3U92 A;  3O28 A;  2XX8 A;  4WKM A;  3IO6 A;  4O8M A;  1UIU A;  4DI3 D;  4JDF A;  1P99 A;  1Q1K A;  4XF5 A;  1JW4 A;  2DWJ A;  3PUY E;  1NI9 A;  1Y20 A;  3FAT A;  4JWY A;  1HSL A;  4G68 B;  2VD2 A;  1KZ8 A;  5HBC A;  4BDR A;  3S9E A;  1FQC A;  2YPN A;  1JW1 A;  3O6H A;  4PET A;  2F97 A;  1JVY A;  3RUM A;  2A5T B;  3RNN A;  4JSD A;  3H6U A;  2ALU A;  4EQ9 A;  2O6A A;  3VLV A;  3S4U A;  5JEI A;  1SVX B;  3UA8 A;  2PFZ A;  1B9J A;  4R74 A;  2DOJ A;  3DP4 A;  3T9V A;  3KZG A;  1DK4 A;  4NF4 A;  1TXF A;  3FXB A;  1MDQ A;  4ECF A;  1FPE A;  3ILU B;  2Q89 A;  5AA1 A;  3MUQ A;  1S7Y A;  4LVQ A;  4NF5 B;  5AA2 A;  4FED A;  4XFE A;  1IIW A;  4KXP A;  3IK6 B;  1B32 A;  3W15 C;  5I3S A;  3GBB A;  1A55 A;  3USD A;  4F19 A;  2W7Y A;  2V3Q A;  4ZEI A;  1NV3 A;  1XHY A;  1FBP A;  1JET A;  4DXC A;  3BFU A;  4XKQ A;  2XXH A;  2QS1 A;  4YKI A;  4U4X A;  3TMG A;  2Q88 A;  1UTH B;  4POX A;  5A5X A;  2FYI A;  4HW8 A;  4H46 A;  4ZED A;  1WDN A;  4OTE A;  4ZE8 A;  1AWB A;  3HPI A;  4H0W A;  1FTA A;  1MXW A;  1FBF A;  1AIV A;  3U72 A;  2UYF A;  1VR5 A;  1SPI A;  1MPB A;  3OSR A;  2V4C A;  3TQL A;  1B7Z A;  1GVC A;  1N7X A;  1SW5 A;  2IA4 A;  4QHQ A;  1D9Y A;  4UAC A;  2ONR A;  2Z23 A;  3RN8 A;  4JVD A;  4ELR A;  1WOD A;  2D5W A;  4FJP A;  3OO8 A;  3FVN A;  3PTY A;  3A09 A;  4LA9 A;  3KGC A;  3TCF A;  3M3L A;  1MY1 A;  4PFI A;  4NWC A;  1IMC A;  2RC7 A;  2XWV A;  4ESX A;  1DPP A;  4K3F A;  4C1T A;  1Z7M E;  4ZEK A;  3TTK A;  2QVU A;  3KJT A;  3MAM A;  4GXS B;  1B1X A;  3SEX A;  3DM0 A;  2F7B A;  1A99 A;  5L9M A;  1NFT A;  5I2N A;  5DEX B;  3RLF E;  1KA0 A;  3C9H A;  3TTM A;  3FJM A;  1N7W A;  3PMV A;  3SZP A;  3FJ7 A;  1GTK A;  1EYI A;  2HHM A;  1NV1 A;  4U22 A;  4F1Y A;  2PMS A;  2XXT A;  1VDW A;  2B65 A;  4IR8 A;  5ELV A;  3VE1 B;  4YB7 A;  2YJP A;  3OD7 A;  3FVK A;  1ZIU A;  2DDK A;  4M4G A;  1LFH A;  2VPN A;  1SW4 A;  1FPJ A;  2HEU A;  4MAG A;  3SKP A;  4P0I A;  4RY1 A;  1QUK A;  1FQF A;  3K6V A;  3SEY A;  3Q27 A;  1A54 A;  2F7A A;  3PD8 A;  5EHM A;  2ANJ A;  3RPL B;  2AL5 A;  3JV9 A;  1H76 A;  1FQE A;  1TWY A;  4IO3 A;  2H25 A;  2Q2A A;  1B5J A;  2PYY A;  5DVI A;  4IO4 A;  5KZT A;  2H4I A;  4OER A;  3LUY A;  1B3L A;  4OMB A;  4YB6 A;  5DT6 A;  3KC1 A;  4P1E A;  2P3V A;  4ZDM A;  4KYS A;  2FNC A;  3DEL B;  4LZ5 A;  3PPO A;  5DTB A;  3KN3 A;  4U21 A;  4QFL A;  1VFD A;  2LAO A;  2ZMB A;  2YLN A;  3H06 B;  1ATG A;  1MQH A;  3T9X B;  1SW2 A;  2B4M A;  1UTH A;  4QXD A;  4AQ4 A;  3MP1 A;  5BWJ A;  2O51 A;  3E3K A;  3QAX A;  3TTL A;  4DLD A;  2HAU A;  4YZZ A;  2V3T A;  3TEL A;  4X9T A;  2F5X A;  1MY2 A;  2PFY A;  3FD3 A;  2F7C A;  1N76 A;  1TFA A;  1HSJ A;  2R9J A;  1CNQ A;  4ONY A;  4ZZE A;  3KG2 A;  2RIN A;  1URS A;  5B7D A;  1RDY A;  4N6D A;  4OEV A;  1XS5 A;  2QVV A;  3CSG A;  1QVS A;  1MXX A;  3TCG A;  3SES A;  1SI1 A;  4JSO A;  3MZB A;  4NF0 A;  2QS3 A;  5A5L A;  1Y4T A;  1FPF A;  2I4C A;  4YKK A;  1QJM A;  2BJI A;  3OEM A;  1B0H A;  4QFK A;  1MXV A;  1EU8 A;  3CVG A;  3DLN A;  3RQT A;  4F22 A;  2PCR A;  1FCK A;  1NV4 A;  2VD3 A;  4HE1 A;  4IGR A;  4FAT A;  2XXQ A;  3KJ7 A;  4QSE A;  3N26 A;  3C31 A;  4GX6 A;  1LCF A;  1B4H A;  5CMK A;  1GV8 A;  2NOO A;  2O1L A;  2HQ0 A;  1CE2 A;  5I2N B;  3C35 A;  4G4P A;  2OWS A;  4G68 A;  1OVB A;  1NNP A;  1XT8 A;  3OEN A;  4XKN A;  4F2Q A;  1FTO A;  2NUV A;  1B0L A;  4O3B A;  5ET5 A;  1I6Q A;  2A5T A;  3PPQ A;  2XXP A;  1FBH A;  4XEQ A;  5EQ8 A;  3EHU A;  3LBS A;  3HHG A;  5L9S A;  1D9Q A;  3IR1 A;  2ZYM A;  2F3B A;  4ELO A;  3RPL A;  3IB2 A;  3IL1 B;  3CR9 A;  5F7V A;  2O7I A;  1RYO A;  3EQ1 A;  3MZ9 A;  2PT2 A;  5EHS A;  2P0S A;  3FVG A;  1NV6 A;  1QGX A;  1FQB A;  2DXY A;  1Y4C A;  3LR1 A;  3ILT B;  1FPI A;  4FIM A;  1S9T A;  3PMW A;  3V5A A;  4DDD A;  3G3J A;  1IME A;  3PGF A;  4H67 A;  1LFG A;  3RT8 A;  5DVF A;  1BKA A;  5H8S A;  2ZZX A;  2V25 A;  2FIE A;  4LQ5 A;  5CMC A;  2QMW A;  3R7X A;  4OVR A;  1NUW A;  1JP4 A;  1EZP A;  1B3E A;  2DWH A;  4OWD A;  4BDL A;  5I7I A;  4Q30 B;  3C32 A;  1FTK A;  3I3V A;  5I58 B;  4PAK A;  1F9B A;  3H6W A;  3HN0 A;  4JBZ A;  3T96 B;  1OVT A;  4OFO A;  4N15 A;  4YAH X;  3ROJ A;  1N3W A;  4YKP A;  4GQO A;  1B7U A;  4FAJ A;  1NV7 A;  1IMA A;  2PVU A;  4OEU A;  1OIB A;  1LBX A;  3VLU A;  5ITP A;  4N17 A;  4ZEC A;  4XKR A;  4BDO A;  2BJJ X;  5J16 A;  4QF9 A;  1B5H A;  4GVO A;  3TUS A;  1B40 A;  2FBP A;  5LTC A;  4XTC Q;  2F36 A;  1J1N A;  4LP2 B;  2P3N A;  4Q0C A;  2UVI A;  1HSE A;  1SYH A;  1SW1 A;  2GFE A;  2HXW A;  2I4B A;  3EN3 A;  3MJN A;  3B6Q A;  1TFD A;  3Q28 A;  1ZMG A;  1IZ1 A;  3IX1 A;  1FPD A;  4L17 A;  3VVE A;  1N04 A;  3FXR A;  4G8M A;  5JTY A;  1NV2 A;  3MST A;  1D4N A;  1FQD A;  3R26 A;  4H5G A;  4BDQ A;  3SEU A;  1QW0 A;  1JVX A;  5M2V A;  2GQ1 A;  4N81 A;  2XWI A;  4DE8 A;  2F78 A;  1QKA A;  1OQH A;  2VP1 A;  3KBZ A;  2ZYN A;  4OHN A;  2ZZW A;  5TP9 A;  3PUW E;  3O9P A;  2I48 A;  5ICQ A;  4WED A;  2HCA A;  2JJK A;  2O69 A;  4QFO A;  4E0W A;  4DI4 B;  3IOW A;  4G77 A;  3K6U A;  2Y7W A;  4ZS9 A;  3RYD A;  3UIF A;  2X26 A;  4GWY A;  1Q35 A;  4KQP A;  3G3F A;  3SET A;  3BKI B;  4HCW A;  4PQJ A;  1NUZ A;  3LSW A;  2I0C A;  2XXY A;  3HV1 A;  3MZ1 A;  4GIZ A;  1Y3Q A;  5H8Q B;  3RTF B;  5B70 A;  1BP5 A;  1US4 A;  3QUJ A;  2QFL A;  3O6I A;  3N6T A;  3OEL A;  2ZXT A;  4GL8 A;  3O97 A;  1R9L A;  2QPQ A;  2PBW A;  5ESY A;  4PBH A;  3FXQ A;  3Q29 A;  5IZ3 A;  3IB1 A;  1PB7 A;  1PB8 A;  1USY E;  1JEU A;  4PBQ A;  1B1H A;  2O84 X;  1N0T A;  3QXM A;  4HE2 A;  2XHD A;  1QUL A;  1UTB A;  2HAV A;  1XC1 A;  1MH4 A;  4PFU A;  4R6Y A;  2PT1 A;  5K2Y A;  1K9Y A;  1MQJ A;  3S9L C;  4O7I A;  4ELP A;  4G8H A;  2CZL A;  1LAH E;  4JB7 A;  4MBP A;  4LQ2 A;  1AL3 A;  3TTN A;  2E0S A;  2QS4 A;  5J1D A;  1OQG A;  3MVW A;  4KPT A;  1ZBM A;  4HE0 A;  4OXV A;  2QS2 A;  3W9V A;  3IFC A;  5DVJ A;  4UA8 A;  1H45 A;  3HST A;  3TDJ A;  4I1D A;  4GFR A;  2DVC A;  3RGY A;  4X04 A;  4P11 A;  1RDZ A;  3K6X A;  1ZKB A;  4I62 A;  1VFE A;  1AMF A;  1IUD A;  4GF8 A;  4P1L A;  5EQA A;  4RK2 A;  1G0I A;  1XOC A;  3K1N A;  1NH7 A;  2DYX A;  5H8H B;  1B52 A;  2A5S A;  5ET7 A;  2GHB A;  1XVX A;  5IM2 A;  3KEI A;  4PFY A;  2G93 A;  4OVP A;  4PC9 A;  3R6U A;  2GHA A;  1YXI A;  2ABH A;  2VT5 A;  1IXC A;  4FBP A;  5ISU A;  3CG3 A;  4OVQ A;  2CZK A;  1DTZ A;  2G29 A;  4AS4 A;  1IXH A;  5FTH A;  1I6B A;  2RC9 A;  1LBY A;  3CSB A;  4NHB A;  2OJT A;  1SQY A;  4TLL B;  4OQO A;  2NVU B;  1FTL A;  4MNC A;  5FHN A;  1XI6 A;  3MP8 A;  2X7P A;  4IO2 A;  3JYR A;  5EQ7 A;  1MXZ A;  1B46 A;  3TKD A;  4MNI A;  4EF2 A;  4F1U A;  1MM6 A;  3RTW B;  1D3K A;  3K01 A;  5FBP A;  4NF5 A;  3FXU A;  1WVJ A;  1MPC A;  3IOV A;  3SER A;  5I84 A;  1MM7 A;  5HM4 B;  3UGW A;  1B2H A;  3EHT A;  2NWJ A;  4KCC A;  4H6D A;  4N6K A;  1MRP A;  4MMP A;  1IMF A;  3E9X A;  3B6W A;  4GWU A;  2XWO A;  5L8D A;  1NUY A;  4GWW A;  3TCH A;  1LCT A;  3T9U A;  1NMU A;  4MLV A;  4GWO A;  5IZZ A;  1VSO A;  4O7M A;  3BIH A;  1MDP 1;  1NV0 A;  4H8I A;  3K6W A;  1CB6 A;  3T66 A;  4F31 B;  2R6G E;  1IIT A;  1QKB A;  3QYT A;  5CMB A;  4LON B;  1MXU A;  1PDA A;  1OLA A;  3I6V A;  3B6T A;  4F3P A;  1JW5 A;  5CM6 A;  1FJ9 A;  1DOT A;  1O7T A;  4NF6 B;  2OX3 A;  2Z8F A;  3PU5 A;  2CMO A;  2ONK E;  4NMY A;  3VVD A;  3D4C A;  3K1M A;  4GBV A;  4OAN A;  4OES A;  2XXX A;  2O1M A;  3TQW A;  4NQ8 A;  2ESN A;  3BBR A;  3M8U A;  4GRK A;  4TLM B;  4X1B A;  3OO9 A;  1B5I A;  1M5F A;  5EYG A;  4THI A;  5JTY B;  2OZZ A;  3E4R A;  3IJO B;  4GX4 A;  3S2V A;  4Q8R A;  4MFI A;  1D9V A;  3BIG A;  3W9W A;  4KYD A;  4WXJ A;  4RA1 A;  4NE4 A;  2OK2 A;  4PAF A;  4RXL A;  2DQV A;  3KOT A;  3PPN A;  1MG1 A;  2OCU A;  3THI A;  1MY3 A;  3B7D A;  4O94 A;  4F39 A;  4QRZ A;  3MYU A;  3IOT A;  3IJX B;  4OZ9 A;  2Y7P A;  3IOR A;  3KSJ A;  3PV0 E;  2QVR A;  1IXG A;  4KYE A;  4QSC A;  3T0J A;  1LB8 A;  3EPE A;  4MCO A;  4GX3 A;  1AOV A;  3E79 A;  4MF3 A;  3C34 A;  1Y9U A;  1FQA A;  1EZ9 A;  4GL0 A;  4JWX A;  3WAE A;  2Y5L A;  2FHY A;  1K9Z A;  4GLI A;  3V8X B;  2HPG A;  3VXC A;  4DCX A;  1LGB C;  1RDX A;  3FV2 A;  5H8N B;  1RYX A;  3T93 B;  3G3K A;  4NGU A;  2DE4 A;  5LOM A;  1SDX A;  4ND9 A;  1MPD A;  4YU0 A;  1M5D A;  2CEY A;  4EXL A;  3QK6 A;  3MW0 A;  2FVZ A;  4JXI A;  1MY4 A;  1IMD A;  3VXB A;  3DP8 A;  5DW8 A;  2IEE A;  1R1N A;  3OO6 A;  4M1V A;  2UVG A;  1A7L A;  1ANF A;  2ZZV A;  3MPK A;  5H8F B;  1I6A A;  4U1O A;  3TOD A;  5TU0 A;  2XXW A;  4JWO A;  5FHM A;  2QJE A;  1QUI A;  1AH5 A;  3VV5 A;  4NF6 A;  4AS5 A;  2Q74 A;  4EXK A;  1IXI A;  2P1S A;  2ONS A;  3OXN A;  3ZKK A;  3CI8 A;  5T3J A;  3U94 A;  5I5P A;  4H5F A;  1SD3 A;  4FEB A;  3LSX A;  4U4S A;  4PDH A;  1PBP A;  1LAG E;  1PB9 A;  5H8H A;  2ZYO A;  1EYK A;  3MVY A;  1PBQ A;  1TT1 A;  4IO5 A;  4OYV A;  1INP A;  1POY 1;  5A5X B;  1DBZ A;  2H9B A;  3O29 A;  4NTL A;  1LST A;  5I2K B;  4R9F A;  5DEX A;  4BDM A;  1N3X A;  4H1X A;  1MQD A;  3KOS A;  2GH9 A;  3FBP A;  3N6U A;  4OVS A;  5ET8 A;  3SDF A;  3ONM A;  3M3F A;  4RPO A;  2Q9T A;  3LC8 A;  1H43 A;  4KCD A;  1ZTY A;  4EQB A;  5F24 A;  3FV1 A;  2DE3 A;  4RYA A;  1OLC A;  2HXR A;  4FOR A;  3CG1 A;  2THI A;  3MC2 A;  5I57 B;  1IMB A;  5FHO A;  3TFL A;  4G2Z A;  4MEV A;  4PP0 A;  4NX1 A;  2KQZ A;  4P56 A;  1MY0 A;  4F1V A;  1R6Z A;  4ZEF A;  2F8D A;  3V89 B;  1PC3 A;  1LEV A;  1R9Q A;  3IOU A;  3H7M A;  3KN7 A;  4QFP A;  1B4Z A;  4R9G A;  3MBP A;  2DXR A;  3Q25 A;  3FZV A;  3JZJ A;  4NAP A;  2H99 A;  2HZK A;  4QSD A; 
#chains in the Genus database with same CATH homology
 1GR2 A;  1ZJL A;  4IY6 A;  2V3U A;  5F1Q A;  4LUB A;  5TPA A;  3MWB A;  4Z7E A;  4PF8 A;  3OO7 A;  1G0H A;  4ZEB A;  3ISP A;  3MVZ A;  2RCB A;  4DIG A;  1IEJ A;  3FJG A;  5AA4 A;  2B3F A;  2XD3 A;  2L5V A;  2DWA A;  2V93 A;  4OFJ A;  4I3E A;  1S50 A;  4H8J A;  5DYH A;  4G8N A;  1LLS A;  1M5E A;  1UIV A;  4G68 C;  2WEF A;  1JNF A;  3FIR A;  5EYH A;  3L6G A;  1YPN A;  5CI5 A;  2PX1 A;  4PF6 A;  2H5Y A;  1EZO A;  1MQG A;  2Q8M A;  1LBZ A;  2GRV A;  2KR0 A;  1A8E A;  3T9H B;  3EHS A;  3A29 A;  3HFU A;  4HTG A;  5KDT B;  1B3H A;  1FPK A;  4KI0 E;  4EF1 A;  1POT A;  4C1U A;  1M5B A;  4PFB A;  3HO7 A;  4P8B A;  4PGP A;  5IKB A;  3U1O A;  4C0R A;  4F3B A;  1B7H A;  3B50 A;  2WKY A;  5IZ1 A;  4PDD A;  4PGN A;  3CHG A;  2I49 A;  3SEV A;  2QRY A;  3A3U A;  1O63 A;  2XA5 A;  3UOR A;  1LBC A;  4N6P A;  2I6E A;  2Z8D A;  3TTR A;  2WYK A;  3OSQ A;  3H6T A;  5LDZ A;  4MJO A;  1LAX A;  3BFT A;  1A40 A;  1LB9 A;  3GYY A;  1ZLQ A;  4IB2 A;  3AXF A;  3K1P A;  2FIX A;  1NL5 A;  2DS9 A;  4N4U A;  3MVX A;  3PUX E;  5AE4 A;  5BUU A;  1A8F A;  1NH8 A;  1O64 A;  4AB5 A;  4NN3 A;  2CZI A;  2XXV A;  1LBB A;  2WBB A;  2WYP A;  3C4M A;  3I5O A;  4GBW A;  2DVZ A;  3MPL A;  3M3K A;  1FBE A;  3CFZ A;  5KCJ B;  3TPA A;  4P0G A;  2RC8 A;  4NF8 A;  3SEW A;  2QL3 A;  4DZ1 A;  4Z0I A;  2KLF A;  3KSX A;  1VE4 A;  4NWD A;  2WX9 A;  4RK9 A;  5AA3 A;  2XXR A;  4LZ7 A;  4NED A;  4N91 A;  3O2A A;  2CEX A;  3L6H A;  1P1N A;  4G61 A;  1YAE A;  2X7Q A;  5EQ9 A;  1BIY A;  4YMA A;  3GLB A;  4JVI A;  5AA4 B;  3FUZ A;  4RPN A;  2XX7 A;  3U8Q A;  1IQ7 A;  2DSF A;  3N94 A;  2REJ A;  5I56 B;  4EUO A;  3T1B A;  1YCJ A;  3TEP A;  1P1Q A;  2VPO A;  1Y3N A;  5I58 A;  5ITO A;  1UTB B;  3LUZ A;  3WAF A;  5H8F A;  1Y1Z A;  2D21 A;  4F3G A;  4ELQ A;  1URD A;  4U1Z A;  4OFL A;  2Y7I A;  1Y3P A;  4P47 A;  1FPL A;  4KFQ A;  3OEK A;  4KHZ E;  4ISU A;  5JK4 A;  3K02 A;  5CBS A;  3D1R A;  4F2O A;  4O3A A;  4I8C A;  5KDT A;  3VFJ A;  4ZZA A;  2B4L A;  3LSF B;  2AIX A;  4GXA A;  1XVY A;  3PMX A;  2XX9 A;  3E13 X;  5I59 B;  3K00 A;  1YTV A;  3FVO A;  4MNP A;  2E1S A;  2OLB A;  4IO7 A;  1N84 A;  4ZE9 A;  1FW0 A;  1NV5 A;  1UQW A;  3PPR A;  4YKJ A;  2OBG A;  1BTJ A;  2VHA A;  4OVT A;  2ZNS A;  1DCU A;  2I3W A;  3GXA A;  1DSN A;  1SI0 A;  4ESW A;  2VOZ A;  3U93 A;  3K2D A;  3A3C A;  1FBG A;  4PE5 B;  4IO6 A;  4KR5 A;  3G3G A;  4PE3 A;  3PUZ E;  1M5C A;  1LAF E;  2CZH A;  2Z22 A;  1H44 A;  5TP9 B;  1RKM A;  2UVJ A;  4GWX A;  4FE8 A;  2O7U A;  3K0V A;  4EQ7 A;  3CRB A;  3VVF A;  3PUV E;  1B51 A;  4MHF A;  4HS7 A;  4NG7 A;  1DTG A;  3RY3 A;  1B3F A;  4QFN A;  4R73 A;  4NF8 B;  4Q5T A;  1B3G A;  3OMB A;  1P1O A;  4PFR A;  3IFA A;  2ZNT A;  3CIJ A;  4I3Y A;  4IGT A;  5FTI A;  2Q2C A;  3G7W A;  4RNS A;  5IGA A;  1LBW A;  5H8Q A;  5TPA B;  3CFX A;  4UAB A;  1H3D A;  3KBR A;  1YZ0 A;  5EYF A;  1P1W A;  5CRY A;  2RCA A;  4EDP A;  4KD5 A;  3TAJ A;  2HZL A;  4RJZ A;  1FJ6 A;  4OEN A;  1FTM A;  1Q9D A;  2AYS A;  3QIM A;  2Y7R A;  4BLA A;  2F6G A;  4MIJ A;  2ZYK A;  1YYZ A;  3LSL A;  4F18 A;  4PFT A;  2OWZ A;  3FAS A;  1LBV A;  3D4G A;  1MQI A;  5I56 A;  1NKX A;  2F35 A;  3NOH A;  1LFI A;  3H03 A;  3VLW A;  5CC2 A;  5ET6 A;  4R6K A;  3RPW A;  2XXU A;  2O68 A;  2XXK A;  4HXV A;  4YIC A;  2XD2 A;  4NF4 B;  3QSL A;  4P3L A;  3IO4 A;  2RF1 A;  4N8G A;  5AA2 B;  4GWZ A;  2Y7K A;  3G3I A;  4MLQ A;  4R72 A;  1B58 A;  4X1D A;  3QMF A;  3OOA A;  1T0K A;  1B05 A;  3EKI A;  4F29 A;  1US5 A;  3V83 A;  4R75 A;  3HHF A;  2QMX A;  3ECR A;  3P7I A;  3QUF A;  3ZKL A;  1DMB A;  3MP6 A;  2Y5K A;  4PCD A;  3CFL A;  4HCY A;  4DXU A;  3T22 A;  3F11 A;  3LV0 A;  2B3B A;  4GWS A;  4H45 A;  4GOT A;  1MH3 A;  3C33 A;  4JVC A;  5K2X A;  5IZ3 B;  4LAT A;  4XIG Q;  3GZG A;  4TOZ A;  5AA2 D;  3GBA A;  2I0B A;  4TQU Q;  3MQ9 A;  1MS7 A;  3TYH A;  3N5L A;  3UK4 A;  4QBA A;  3ZSF A;  2ZNU A;  1FTJ A;  4OA4 A;  1KWH A;  4N07 A;  1FRP A;  2F6P A;  4WEP A;  2F3D A;  1FPB A;  3H6V A;  1URG A;  3H3G A;  5KCJ A;  4XXU A;  4GD5 A;  4I9D A;  4YMB A;  1FBC A;  4O3C A;  2OWT A;  1B6H A;  1P1U A;  2UXA A;  3DP6 A;  1Z7N E;  2H98 A;  2DP8 A;  4R2B A;  5CBR A;  5ICT A;  4DXB A;  1II5 A;  1SYI A;  3H4Z A;  1FSA A;  1SBP A;  2R8T A;  2Y84 A;  4R6H A;  4AB6 A;  4YB5 A;  3RT6 B;  3UP9 A;  3Q26 A;  5H8N A;  4OVJ A;  3ZS6 A;  4I40 A;  2UVH A;  3B8B A;  4MX6 A;  3S9M C;  3O6G A;  4E0X A;  4X48 A;  1GGG A;  1OMP A;  1JQF A;  4OET A;  3O66 A;  3IB0 A;  2XWK A;  4N8Y A;  4BDN A;  3K4U A;  1NUX A;  3E78 A;  4DCY A;  1DPE A;  1EYJ A;  2I3V A;  1NNT A;  1EH3 A;  4U23 A;  4H65 A;  2REG A;  4FEC A;  2DE2 A;  2V84 A;  3PPP A;  4F3S A;  5IAI A;  1ZU0 A;  2QSX A;  2Q8J A;  1NNK A;  3IAZ A;  2WBD A;  1I69 A;  1JEV A;  2P2A A;  4R2F A;  1FPG A;  4IY5 A;  2M8C A;  1BK4 A;  1ELJ A;  4X8R A;  5L9O A;  4U2R A;  2MKZ A;  1KA1 A;  3UN6 A;  5I59 A;  3PD9 A;  4LZ8 A;  1Y1M A;  2R71 A;  2HFB A;  2AL4 A;  3VDF A;  2VGQ A;  4XKP A;  4PFW A;  5HPQ A;  2Z8E A;  3C36 A;  1PEB A;  5I2K A;  3KFM A;  4LN5 A;  2I58 A;  2D3I A;  2FA7 A;  1FBD A;  4PTK A;  3EF7 A;  1BLF A;  3FGS A;  2DWI A;  1MXY A;  4P9K A;  2XXI A;  5I57 A;  1L5T A;  4PAI A;  2UYE A;  5CMM A;  3KN8 A;  4N13 A;  3G3H A;  2NXO A;  4POW A;  3KC0 A;  2RKM A;  3TZA A;  3ODB A;  4MH5 A;  3U65 A;  1QUJ A;  3HCQ A;  1USY H;  1NNF A;  2F34 A;  3S9N C;  3U92 A;  3O28 A;  2XX8 A;  4WKM A;  3IO6 A;  4O8M A;  1UIU A;  4DI3 D;  4JDF A;  1P99 A;  1Q1K A;  4XF5 A;  1JW4 A;  2DWJ A;  3PUY E;  1NI9 A;  1Y20 A;  3FAT A;  4JWY A;  1HSL A;  4G68 B;  2VD2 A;  1KZ8 A;  5HBC A;  4BDR A;  3S9E A;  1FQC A;  2YPN A;  1JW1 A;  3O6H A;  4PET A;  2F97 A;  1JVY A;  3RUM A;  2A5T B;  4JSD A;  3RNN A;  3H6U A;  2ALU A;  4EQ9 A;  2O6A A;  3VLV A;  3S4U A;  5JEI A;  1SVX B;  3UA8 A;  2PFZ A;  1B9J A;  4R74 A;  2DOJ A;  3DP4 A;  3T9V A;  3KZG A;  1DK4 A;  4NF4 A;  1TXF A;  3FXB A;  1MDQ A;  4ECF A;  1FPE A;  3ILU B;  2Q89 A;  5AA1 A;  3MUQ A;  1S7Y A;  4LVQ A;  4NF5 B;  5AA2 A;  4FED A;  4XFE A;  1IIW A;  4KXP A;  3IK6 B;  1B32 A;  3W15 C;  5I3S A;  3GBB A;  1A55 A;  3USD A;  4F19 A;  2W7Y A;  2V3Q A;  4ZEI A;  1NV3 A;  1XHY A;  1FBP A;  1JET A;  4DXC A;  3BFU A;  4XKQ A;  2XXH A;  2QS1 A;  4YKI A;  4U4X A;  3TMG A;  2Q88 A;  1UTH B;  4POX A;  5A5X A;  2FYI A;  4HW8 A;  4H46 A;  4ZED A;  1WDN A;  4OTE A;  4ZE8 A;  1AWB A;  3HPI A;  4H0W A;  1FTA A;  1MXW A;  1FBF A;  1AIV A;  3U72 A;  2UYF A;  1VR5 A;  1SPI A;  1MPB A;  3OSR A;  2V4C A;  3TQL A;  1B7Z A;  1GVC A;  1N7X A;  1SW5 A;  2IA4 A;  4QHQ A;  1D9Y A;  4UAC A;  2ONR A;  2Z23 A;  3RN8 A;  4JVD A;  4ELR A;  1WOD A;  2D5W A;  4FJP A;  3OO8 A;  3FVN A;  3PTY A;  3A09 A;  4LA9 A;  3KGC A;  3TCF A;  3M3L A;  1MY1 A;  4PFI A;  4NWC A;  1IMC A;  2RC7 A;  2XWV A;  4ESX A;  1DPP A;  4K3F A;  4C1T A;  1Z7M E;  4ZEK A;  3TTK A;  3KJT A;  3MAM A;  4GXS B;  2QVU A;  1B1X A;  3SEX A;  3DM0 A;  2F7B A;  1A99 A;  5L9M A;  1NFT A;  5I2N A;  3C9H A;  1KA0 A;  5DEX B;  3RLF E;  3TTM A;  3FJM A;  1N7W A;  3PMV A;  3SZP A;  3FJ7 A;  1GTK A;  1EYI A;  2HHM A;  1NV1 A;  4U22 A;  4F1Y A;  2PMS A;  2XXT A;  1VDW A;  2B65 A;  4IR8 A;  5ELV A;  3VE1 B;  2YJP A;  3OD7 A;  4YB7 A;  3FVK A;  1ZIU A;  2DDK A;  4M4G A;  1LFH A;  2VPN A;  1SW4 A;  1FPJ A;  2HEU A;  4MAG A;  3SKP A;  4P0I A;  4RY1 A;  1QUK A;  1FQF A;  3K6V A;  3SEY A;  3Q27 A;  1A54 A;  2F7A A;  3PD8 A;  5EHM A;  2ANJ A;  3RPL B;  2AL5 A;  3JV9 A;  1H76 A;  1FQE A;  1TWY A;  4IO3 A;  2H25 A;  2Q2A A;  1B5J A;  2PYY A;  5DVI A;  4IO4 A;  5KZT A;  2H4I A;  4OER A;  3LUY A;  1B3L A;  4OMB A;  4YB6 A;  5DT6 A;  3KC1 A;  4P1E A;  2P3V A;  4ZDM A;  4KYS A;  2FNC A;  3DEL B;  4LZ5 A;  3PPO A;  5DTB A;  3KN3 A;  4U21 A;  4QFL A;  1VFD A;  2LAO A;  2ZMB A;  2YLN A;  3H06 B;  1ATG A;  1MQH A;  3T9X B;  1SW2 A;  2B4M A;  1UTH A;  4QXD A;  4AQ4 A;  3MP1 A;  5BWJ A;  2O51 A;  3E3K A;  3QAX A;  3TTL A;  4DLD A;  2HAU A;  4YZZ A;  2V3T A;  3TEL A;  4X9T A;  2F5X A;  1MY2 A;  3FD3 A;  2PFY A;  2F7C A;  1N76 A;  1TFA A;  1HSJ A;  2R9J A;  4ONY A;  1CNQ A;  4ZZE A;  3KG2 A;  2RIN A;  1URS A;  5B7D A;  1RDY A;  4N6D A;  4OEV A;  1XS5 A;  2QVV A;  3CSG A;  1QVS A;  1MXX A;  3TCG A;  3SES A;  1SI1 A;  4JSO A;  3MZB A;  4NF0 A;  2QS3 A;  5A5L A;  1Y4T A;  1FPF A;  2I4C A;  4YKK A;  1QJM A;  2BJI A;  3OEM A;  1B0H A;  4QFK A;  1MXV A;  1EU8 A;  3CVG A;  3DLN A;  3RQT A;  4F22 A;  2PCR A;  1FCK A;  2VD3 A;  1NV4 A;  4HE1 A;  4IGR A;  4FAT A;  2XXQ A;  3KJ7 A;  4QSE A;  3N26 A;  3C31 A;  4GX6 A;  1LCF A;  1B4H A;  5CMK A;  1GV8 A;  2NOO A;  2O1L A;  2HQ0 A;  1CE2 A;  5I2N B;  3C35 A;  4G4P A;  2OWS A;  4G68 A;  1OVB A;  1NNP A;  1XT8 A;  3OEN A;  4XKN A;  4F2Q A;  1FTO A;  2NUV A;  1B0L A;  4O3B A;  5ET5 A;  1I6Q A;  2A5T A;  3PPQ A;  2XXP A;  1FBH A;  4XEQ A;  5EQ8 A;  3EHU A;  3LBS A;  3HHG A;  5L9S A;  1D9Q A;  3IR1 A;  2ZYM A;  2F3B A;  4ELO A;  3RPL A;  3IB2 A;  3IL1 B;  3CR9 A;  5F7V A;  2O7I A;  1RYO A;  3EQ1 A;  3MZ9 A;  2PT2 A;  5EHS A;  2P0S A;  3FVG A;  1NV6 A;  1QGX A;  1FQB A;  2DXY A;  1Y4C A;  3LR1 A;  3ILT B;  1FPI A;  4FIM A;  1S9T A;  3PMW A;  3V5A A;  4DDD A;  3G3J A;  3PGF A;  4H67 A;  1IME A;  1LFG A;  3RT8 A;  5DVF A;  1BKA A;  5H8S A;  2ZZX A;  2V25 A;  2FIE A;  4LQ5 A;  5CMC A;  2QMW A;  3R7X A;  4OVR A;  1NUW A;  1JP4 A;  1EZP A;  1B3E A;  2DWH A;  4OWD A;  4BDL A;  5I7I A;  4Q30 B;  3C32 A;  1FTK A;  3I3V A;  5I58 B;  4PAK A;  1F9B A;  3H6W A;  3HN0 A;  4JBZ A;  3T96 B;  1OVT A;  4OFO A;  4N15 A;  4YAH X;  3ROJ A;  1N3W A;  4YKP A;  4GQO A;  1B7U A;  4FAJ A;  1NV7 A;  1IMA A;  2PVU A;  4OEU A;  1OIB A;  3VLU A;  5ITP A;  1LBX A;  4ZEC A;  4N17 A;  4XKR A;  4BDO A;  2BJJ X;  5J16 A;  4QF9 A;  1B5H A;  4GVO A;  3TUS A;  1B40 A;  2FBP A;  5LTC A;  4XTC Q;  2F36 A;  1J1N A;  4LP2 B;  4Q0C A;  2P3N A;  2UVI A;  1HSE A;  1SYH A;  1SW1 A;  2GFE A;  2HXW A;  2I4B A;  3EN3 A;  3MJN A;  3B6Q A;  1TFD A;  3Q28 A;  1ZMG A;  1IZ1 A;  3IX1 A;  1FPD A;  4L17 A;  3VVE A;  1N04 A;  3FXR A;  4G8M A;  5JTY A;  1NV2 A;  3MST A;  1D4N A;  1FQD A;  3R26 A;  4H5G A;  4BDQ A;  3SEU A;  1QW0 A;  1JVX A;  5M2V A;  2GQ1 A;  4N81 A;  2XWI A;  4DE8 A;  2F78 A;  1QKA A;  1OQH A;  2VP1 A;  3KBZ A;  2ZYN A;  4OHN A;  2ZZW A;  5TP9 A;  3PUW E;  3O9P A;  2I48 A;  5ICQ A;  4WED A;  2HCA A;  2JJK A;  2O69 A;  4QFO A;  4E0W A;  4DI4 B;  3IOW A;  4G77 A;  3K6U A;  2Y7W A;  4ZS9 A;  3RYD A;  3UIF A;  2X26 A;  4GWY A;  1Q35 A;  4KQP A;  3G3F A;  3SET A;  3BKI B;  4HCW A;  4PQJ A;  1NUZ A;  3LSW A;  2I0C A;  2XXY A;  3HV1 A;  3MZ1 A;  4GIZ A;  1Y3Q A;  5H8Q B;  3RTF B;  5B70 A;  1BP5 A;  1US4 A;  3QUJ A;  2QFL A;  3O6I A;  3N6T A;  3OEL A;  2ZXT A;  4GL8 A;  3O97 A;  1R9L A;  2QPQ A;  2PBW A;  5ESY A;  4PBH A;  3FXQ A;  3Q29 A;  5IZ3 A;  1PB7 A;  1PB8 A;  3IB1 A;  1USY E;  1JEU A;  4PBQ A;  1B1H A;  2O84 X;  1N0T A;  3QXM A;  4HE2 A;  2XHD A;  1QUL A;  1UTB A;  2HAV A;  1XC1 A;  1MH4 A;  4PFU A;  4R6Y A;  2PT1 A;  5K2Y A;  1K9Y A;  1MQJ A;  3S9L C;  4O7I A;  4ELP A;  4G8H A;  2CZL A;  1LAH E;  4JB7 A;  4MBP A;  1AL3 A;  4LQ2 A;  3TTN A;  2E0S A;  2QS4 A;  5J1D A;  1OQG A;  3MVW A;  4KPT A;  1ZBM A;  3W9V A;  4OXV A;  2QS2 A;  4HE0 A;  5DVJ A;  3IFC A;  4UA8 A;  1H45 A;  3HST A;  3TDJ A;  4I1D A;  4GFR A;  2DVC A;  3RGY A;  4X04 A;  4P11 A;  1RDZ A;  3K6X A;  1ZKB A;  4I62 A;  1VFE A;  1AMF A;  1IUD A;  4GF8 A;  4P1L A;  5EQA A;  4RK2 A;  1G0I A;  1XOC A;  3K1N A;  1NH7 A;  2DYX A;  5H8H B;  1B52 A;  2A5S A;  5ET7 A;  2GHB A;  1XVX A;  5IM2 A;  3KEI A;  4PFY A;  2G93 A;  4OVP A;  4PC9 A;  3R6U A;  2GHA A;  1YXI A;  2ABH A;  2VT5 A;  1IXC A;  5ISU A;  4FBP A;  3CG3 A;  4OVQ A;  2CZK A;  1DTZ A;  2G29 A;  4AS4 A;  1IXH A;  5FTH A;  1I6B A;  2RC9 A;  1LBY A;  3CSB A;  4NHB A;  2OJT A;  1SQY A;  4TLL B;  4OQO A;  2NVU B;  1FTL A;  4MNC A;  5FHN A;  1XI6 A;  3MP8 A;  2X7P A;  4IO2 A;  3JYR A;  5EQ7 A;  1MXZ A;  1B46 A;  3TKD A;  4MNI A;  4EF2 A;  4F1U A;  1MM6 A;  3RTW B;  1D3K A;  3K01 A;  5FBP A;  4NF5 A;  3FXU A;  1WVJ A;  1MPC A;  3IOV A;  3SER A;  5I84 A;  1MM7 A;  5HM4 B;  3UGW A;  1B2H A;  3EHT A;  2NWJ A;  4KCC A;  4H6D A;  4N6K A;  1MRP A;  4MMP A;  1IMF A;  3E9X A;  3B6W A;  4GWU A;  2XWO A;  5L8D A;  1NUY A;  3TCH A;  4GWW A;  1LCT A;  3T9U A;  1NMU A;  4MLV A;  4GWO A;  5IZZ A;  1VSO A;  4O7M A;  3BIH A;  1MDP 1;  1NV0 A;  4H8I A;  3K6W A;  1CB6 A;  3T66 A;  4F31 B;  2R6G E;  1IIT A;  1QKB A;  3QYT A;  5CMB A;  4LON B;  1MXU A;  1PDA A;  1OLA A;  3I6V A;  3B6T A;  4F3P A;  1JW5 A;  5CM6 A;  1FJ9 A;  1DOT A;  1O7T A;  4NF6 B;  2OX3 A;  2Z8F A;  3PU5 A;  2CMO A;  2ONK E;  4NMY A;  3VVD A;  3D4C A;  3K1M A;  4GBV A;  4OAN A;  4OES A;  2XXX A;  2O1M A;  3TQW A;  4NQ8 A;  2ESN A;  3BBR A;  3M8U A;  4GRK A;  4TLM B;  4X1B A;  3OO9 A;  1B5I A;  1M5F A;  5EYG A;  4THI A;  5JTY B;  2OZZ A;  3E4R A;  3IJO B;  4GX4 A;  3S2V A;  4Q8R A;  4MFI A;  1D9V A;  3BIG A;  3W9W A;  4KYD A;  4WXJ A;  4RA1 A;  4NE4 A;  2OK2 A;  4RXL A;  4PAF A;  2DQV A;  3KOT A;  3PPN A;  1MG1 A;  2OCU A;  3THI A;  1MY3 A;  3B7D A;  4O94 A;  4F39 A;  4QRZ A;  3MYU A;  3IOT A;  3IJX B;  4OZ9 A;  2Y7P A;  3IOR A;  3KSJ A;  3PV0 E;  2QVR A;  1IXG A;  4KYE A;  4QSC A;  3T0J A;  1LB8 A;  3EPE A;  4MCO A;  4GX3 A;  1AOV A;  3E79 A;  4MF3 A;  3C34 A;  1Y9U A;  1FQA A;  1EZ9 A;  4GL0 A;  4JWX A;  3WAE A;  2Y5L A;  2FHY A;  1K9Z A;  4GLI A;  3V8X B;  2HPG A;  3VXC A;  4DCX A;  1LGB C;  1RDX A;  3FV2 A;  5H8N B;  1RYX A;  3T93 B;  3G3K A;  4NGU A;  2DE4 A;  5LOM A;  1SDX A;  4ND9 A;  1MPD A;  4YU0 A;  1M5D A;  2CEY A;  4EXL A;  3QK6 A;  3MW0 A;  2FVZ A;  4JXI A;  1MY4 A;  3VXB A;  1IMD A;  3DP8 A;  5DW8 A;  2IEE A;  1R1N A;  3OO6 A;  4M1V A;  2UVG A;  1A7L A;  1ANF A;  2ZZV A;  3MPK A;  5H8F B;  1I6A A;  4U1O A;  3TOD A;  5TU0 A;  2XXW A;  4JWO A;  5FHM A;  2QJE A;  1QUI A;  1AH5 A;  3VV5 A;  4NF6 A;  4AS5 A;  2Q74 A;  4EXK A;  1IXI A;  2P1S A;  2ONS A;  3OXN A;  3ZKK A;  3CI8 A;  3U94 A;  5T3J A;  5I5P A;  4H5F A;  1SD3 A;  4FEB A;  3LSX A;  4U4S A;  4PDH A;  1PBP A;  1LAG E;  1PB9 A;  5H8H A;  2ZYO A;  3MVY A;  1EYK A;  1PBQ A;  1TT1 A;  4IO5 A;  4OYV A;  1POY 1;  5A5X B;  1INP A;  1DBZ A;  2H9B A;  3O29 A;  4NTL A;  1LST A;  5I2K B;  4BDM A;  5DEX A;  4R9F A;  1N3X A;  4H1X A;  1MQD A;  3KOS A;  2GH9 A;  3FBP A;  3N6U A;  4OVS A;  5ET8 A;  3SDF A;  3ONM A;  3M3F A;  4RPO A;  2Q9T A;  3LC8 A;  1H43 A;  4KCD A;  1ZTY A;  4EQB A;  5F24 A;  3FV1 A;  2DE3 A;  4RYA A;  1OLC A;  2HXR A;  4FOR A;  3CG1 A;  2THI A;  3MC2 A;  5I57 B;  1IMB A;  5FHO A;  3TFL A;  4G2Z A;  4MEV A;  4PP0 A;  4NX1 A;  2KQZ A;  4P56 A;  1MY0 A;  4F1V A;  1R6Z A;  4ZEF A;  2F8D A;  3V89 B;  1PC3 A;  1LEV A;  1R9Q A;  3IOU A;  3H7M A;  3KN7 A;  4QFP A;  1B4Z A;  4R9G A;  3MBP A;  2DXR A;  3Q25 A;  3FZV A;  3JZJ A;  4NAP A;  2H99 A;  2HZK A;  4QSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...