4YZZA

Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
336
structure length
336
Chain Sequence
NPTVRWRMSTSWPKSLDTIYGSADELCKRVGQLTDGKFEIRAFPGGELVPSAQNMDAVSNGTVECNHVLSTMYIGKNTALTFDTGLSFGLNARQHNAWIHYGGGLQQLRELYKKYNIVNHVCGNVGVQMGGWYRKEIKSTADLNGLNMRIGGIGGMVLSKLGVVPQQIPPGDIYPALEKGTIDAAEWIGPYDDEKLGFNKVAPYYYSPGWFEGSASITSMVNDKAWEALPPAYQAAFEAACGEQSMRMLANYDARNPLALRKLIAGGAKVSFFPKEVMDAVYKASQQLWTELSEKNPDFKAIYPGWKKFQEDEAGWFRVAENALDNYTFAAVARAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
publication title Crystal structure of a TRAP transporter solute binding protein (IPR025997) from Bordetella bronchiseptica RB50 (BB0280, TARGET EFI-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site
rcsb
source organism Bordetella bronchiseptica
total genus 133
structure length 336
sequence length 336
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4yzzA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4yzzA01
3N26A 3H6UA 1JW1A 3K2DA 3U94A 1MM6A 5IGAA 1B58A 3IJOB 3M3FA 1ANFA 1I69A 4PQJA 1PEBA 1UIVA 1P99A 1Z7ME 1ZLQA 3SEXA 4R9FA 4DCXA 3K1MA 1S7YA 1NMUA 2NWJA 4R6KA 1SW4A 3DP8A 4P1LA 3IAZA 1HSJA 2XD2A 4ECFA 4HTGA 3FATA 4OFLA 1BP5A 1IXIA 2VP1A 1QUIA 2DS9A 1B7UA 1VSOA 1EZPA 5I2NA 3KN7A 1LAXA 4GRKA 3TCFA 5CBSA 4RK9A 1GR2A 4WXJA 4X48A 2NVUB 4P3LA 5KZTA 3T9VA 1MPDA 4BDLA 2Q2AA 1P1WA 3KSJA 1J1NA 2UVIA 3D4CA 3THIA 4F2OA 3A3UA 3LC8A 2NXOA 4XKRA 2DWHA 4NWCA 2XX9A 3FD3A 1B7HA 3O28A 2H99A 2GHAA 3OEKA 4OEUA 3UK4A 5ICTA 4PP0A 4N6KA 5TPAA 5CI5A 2D5WA 4P0GA 3QAXA 3CSGA 3PD9A 3CFLA 2Y7IA 3FVOA 3VVDA 4U2RA 4FEDA 3S9EA 3S9MC 1PB7A 3PPOA 4RA1A 2ZMBA 2HFBA 4XIGQ 1DMBA 4F18A 1LFHA 3PPPA 1ZU0A 3KSXA 4NN3A 4ZEIA 3CI8A 5F1QA 4THIA 3RN8A 4R75A 1M5EA 3G3GA 3IB0A 1POTA 1TFAA 1N3WA 4P47A 3MW0A 1XOCA 4ELRA 3SEWA 3G7WA 3S2VA 4R9GA 3Q27A 4P9KA 2QPQA 1UTHB 4MF3A 3FJMA 5AA3A 4PGNA 4YKPA 1VR5A 1NFTA 3E4RA 2OWTA 4X1DA 4IO7A 4DE8A 1SYIA 1LBBA 3VLUA 1MY1A 1R9LA 3I6VA 4PAIA 1A99A 3OD7A 4EUOA 1US4A 4MLVA 4U23A 3IX1A 5CBRA 2I58A 1T0KA 4NF6A 3M3KA 4OVJA 3HSTA 3TTKA 4X8RA 4P8BA 3T93B 5JTYA 1OLAA 1B3FA 3QXMA 1IXGA 4MNIA 1B0HA 2H25A 5I56A 5HM4B 1POY1 1NL5A 5CM6A 2AL4A 4PC9A 2XHDA 3G3IA 1N76A 4F3PA 4YB7A 3MPLA 3TMGA 3OEMA 3OO6A 1ZJLA 1TT1A 3OO7A 3EHTA 4F3GA 2P1SA 4KYEA 4N13A 4AQ4A 2I4CA 3K6XA 3IOUA 4G8NA 1B3EA 2VHAA 4G68A 3Q25A 1EZ9A 4OZ9A 3TTLA 3N94A 3CFZA 3OOAA 5AA4A 4IO3A 4GQOA 3TCGA 3U72A 1JEUA 4EQ9A 4OESA 4OEVA 1UTBB 1MXUA 4ZS9A 1Z7NE 1PDAA 5H8HB 1SI0A 1N84A 4OVRA 1Y1ZA 1MXWA 4RK2A 4BLAA 2UYEA 3OO9A 3PUVE 4XKNA 1ZKBA 4FORA 3TODA 2XXRA 4OENA 5KDTA 2H9BA 2RC8A 4QSEA 4LUBA 3MZBA 4FECA 3OSQA 4EXLA 1B3GA 4R73A 2I6EA 4Q8RA 2GHBA 4Z0IA 2DWAA 3UIFA 1MRPA 4OYVA 2V4CA 2DWIA 1Y20A 4H5FA 4ZZEA 4ZECA 5L9SA 4OVPA 2PYYA 4DI4B 2BJJX 5FTIA 2AL5A 1IXCA 5KCJB 2FNCA 1MY0A 1JW5A 4ESWA 4PDHA 3GXAA 3RNNA 4N4UA 1USYE 4JB7A 4MHFA 4X04A 3MVWA 3G3HA 3TQLA 1FTLA 3PUXE 3CVGA 3VXCA 3IL1B 1JVYA 1IUDA 2F7AA 1P1QA 3HCQA 4PETA 4GL0A 1B4ZA 2DVCA 2XXYA 3C31A 4KCDA 5LOMA 4GL8A 2YJPA 2QS4A 2XD3A 1EZOA 3MBPA 1BLFA 4X1BA 3RT8A 1LB9A 3H03A 3B50A 2ZNSA 3CSBA 2UXAA 4GFRA 2HCAA 4C1TA 4RYAA 3N5LA 4BDQA 2F6PA 3RQTA 1AH5A 4FEBA 4N91A 1P1OA 1ZIUA 3UN6A 3U8QA 4OFOA 3CFXA 3CIJA 3KN3A 4NHBA 2GRVA 5TU0A 1B51A 4ISUA 2P2AA 1B1HA 1QW0A 1GV8A 3DP6A 1IITA 4N8YA 4GXSB 2XWKA 4LZ8A 2OBGA 3H06B 4ZEBA 4R6YA 4NQ8A 3MAMA 5I58B 1UTHA 3IOTA 4KYDA 4OETA 4NTLA 3IB1A 4I1DA 4LP2B 3T96B 4ESXA 3BFUA 1LAGE 1XHYA 3T22A 2Y84A 3ODBA 1YPNA 4ZEFA 1A8FA 1LSTA 1FTOA 3TTRA 3KN8A 5LTCA 1DPEA 3RGYA 4QFNA 4YKKA 4GXAA 3FXUA 3JV9A 3TELA 3V83A 5JEIA 2HAVA 4H8JA 1IXHA 4F19A 1VE4A 3LBSA 4MCOA 3MZ1A 5H8QB 5CMKA 5JK4A 1Y3PA 2RCAA 1CB6A 4ZE8A 4KD5A 4OVTA 4R2BA 1H43A 5ISUA 3VE1B 4NAPA 3RT6B 2UYFA 3O29A 1SDXA 5AA1A 5B7DA 2XWOA 4TLMB 1MXVA 5CRYA 5HBCA 3B6QA 4XF5A 2X26A 1ZTYA 1MDQA 4H1XA 3E3KA 1IQ7A 1MY4A 1FTMA 5BWJA 1YAEA 1XC1A 1B46A 1JNFA 2ZYKA 5L8DA 2F34A 2UVGA 4JSDA 3PPNA 2Q8JA 2PBWA 4AB5A 2IEEA 5A5XB 1AOVA 1UTBA 5H8HA 2CZLA 4H0WA 2I3WA 3QSLA 3VVEA 5EHSA 4R74A 1N0TA 1B32A 3MQ9A 1Y9UA 1OMPA 3PMWA 2H4IA 1M5BA 4EQBA 2I4BA 3D4GA 2E1SA 3DM0A 2F7BA 3T66A 1D4NA 2R71A 1FQAA 1PB8A 3OXNA 3K0VA 1H45A 1WDNA 5KCJA 3LSFB 1SI1A 3U93A 3FVKA 5I7IA 1N3XA 5EHMA 5H8FB 2A5TB 3RY3A 3W9VA 4F2QA 3G3KA 1H44A 1NKXA 1Y4TA 1B5JA 3UP9A 2O51A 3DP4A 1FW0A 2R9JA 4U1OA 2PX1A 4O3AA 4ELOA 1B4HA 1PBQA 3GZGA 4Q5TA 3FVGA 1QULA 2RC7A 4ZE9A 3KJTA 3CG3A 1JEVA 3EN3A 4OFJA 2WX9A 5L9OA 4RNSA 4F31B 1LGBC 4MEVA 2XXWA 3OO8A 2XX7A 3PV0E 1B3LA 1MQDA 2F6GA 4I8CA 4PFUA 1XS5A 3TFLA 3PPRA 2XXPA 2QMWA 4DCYA 4OVQA 1D3KA 4I62A 4NF5B 3O6IA 3LSWA 1QUJA 2V3TA 5H8NB 1USYH 1JVXA 4ELQA 3A3CA 4MAGA 2XXQA 2Q9TA 3N6TA 2R6GE 3ECRA 1B3HA 2XXIA 3GBBA 1OQHA 2REJA 5TP9B 4KFQA 1Y4CA 5FHNA 2OJTA 3V89B 4GF8A 4P0IA 2CMOA 4TOZA 3B6WA 3GBAA 4LQ5A 2VD2A 4RY1A 4KR5A 4POWA 5AA2B 1A40A 3MVZA 5I58A 2CEYA 1MY2A 1RYOA 3K4UA 5DYHA 2E0SA 3OSRA 1OLCA 2F78A 2ZZVA 1MXXA 3HV1A 4EQ7A 3K6WA 3QUJA 1XVXA 3K00A 2I48A 4X9TA 4AB6A 2I3VA 1JQFA 1OVTA 1LFGA 5FTHA 1DTGA 5I57B 3QYTA 3V8XB 3ZKLA 2DXRA 3FZVA 3Q29A 3H6WA 2V93A 2QS2A 2F8DA 4PAKA 2Z23A 4JSOA 3MVXA 3R7XA 3FVNA 3HHGA 3JYRA 4BDRA 3B6TA 4R6HA 5H8QA 4DXUA 2VPNA 1MQJA 1VFEA 5K2XA 2G93A 4MMPA 3OELA 4HCYA 2DE2A 4QHQA 3SERA 1IIWA 1MH3A 3ZSFA 1Q35A 4OA4A 3Q28A 3PU5A 4Z7EA 4TQUQ 2FYIA 3ONMA 4HCWA 5ICQA 3PUWE 3K1NA 3VVFA 1LFIA 3IOWA 1DSNA 4F3BA 3UGWA 5ELVA 2XWVA 1QKBA 5H8SA 3W9WA 1SW2A 1SVXB 3LSXA 4YU0A 3K01A 2WYKA 1NNKA 4PF6A 2XXXA 3KBRA 2IA4A 2ZZWA 3SKPA 3RUMA 2DE4A 4FATA 1B5IA 2RC9A 1L5TA 4YMAA 5A5XA 4ZEKA 2F35A 4PFWA 4EXKA 1BTJA 4PFTA 2DP8A 2QL3A 3VXBA 4QFOA 2QS1A 3S9LC 3V5AA 1MS7A 1N7XA 5IZZA 5TPAB 4JWXA 2HZKA 4PCDA 2THIA 1Y1MA 4Q30B 4UACA 3R26A 2XWIA 1A55A 1M5FA 4U1ZA 4UABA 3EHSA 1MXZA 3FUZA 4PBQA 4NWDA 4JWOA 3I5OA 2PVUA 3Q26A 1RYXA 1XVYA 4XKPA 2AYSA 3WAEA 1MDP1 3MC2A 4PFRA 3TAJA 3U1OA 2LAOA 4RXLA 4N6DA 1LCFA 4PBHA 1B7ZA 1OVBA 5H8FA 2QJEA 2A5TA 4M1VA 3MP8A 2RKMA 3G3FA 3TDJA 4EF2A 3PD8A 1LAFE 5CMBA 3CRBA 4F39A 2Y7PA 3A09A 3FASA 3U65A 1HSEA 3BKIB 2G29A 1NH7A 3H4ZA 1AMFA 5DEXB 1YCJA 4G8MA 3SEUA 3K6UA 3O6HA 4XTCQ 4O3BA 4PAFA 2CEXA 3CR9A 2D3IA 3IR1A 3DELB 4QFPA 2H98A 4DXCA 1GVCA 1SW1A 2HAUA 3TTMA 3LSLA 3VFJA 4R2FA 3OMBA 1UIUA 4G2ZA 3WAFA 2FA7A 2XXVA 3VLVA 4N07A 5JTYB 4IY6A 4XFEA 4NF5A 4MNPA 4IGRA 4OMBA 5H8NA 4RPNA 4DI3D 1XT8A 4C1UA 5I5PA 2NUVA 3KG2A 3FXBA 4H6DA 1TWYA 1B1XA 2O6AA 2OLBA 3K6VA 1GTKA 2B3BA 5TP9A 3PMXA 4YZZA 3GLBA 3MZ9A 3O9PA 1D9YA 2XA5A 1FQEA 3KOSA 4NF4B 1HSLA 3H7MA 3LR1A 2O68A 3C33A 1Y3QA 4JWYA 5AA2A 5AA4B 3IOVA 1A54A 2ZZXA 3P7IA 2PT1A 2ESNA 4LZ7A 2XXUA 3T9XB 2OZZA 3QIMA 4PE5B 5CMMA 2Q2CA 1MY3A 1Y3NA 4F3SA 2O84X 3PUYE 3RTWB 4DLDA 1R6ZA 4BDOA 4G68C 5L9MA 5M2VA 1S50A 2ALUA 1TXFA 2O69A 1O7TA 1PC3A 2VGQA 4HS7A 3MP6A 3HO7A 1NH8A 1OIBA 2GFEA 3C32A 2HXWA 2ZYOA 4XKQA 2GH9A 4QFKA 4TLLB 4P1EA 4NEDA 4MFIA 5FHOA 1TFDA 2Z8FA 2O1LA 1NNTA 1PBPA 4PGPA 3CG1A 3UA8A 1D9VA 4IO6A 2H5YA 1B52A 1SQYA 3ILUB 1II5A 3SEVA 2DXYA 3IJXB 5CC2A 1FQFA 1MPCA 4E0XA 4YICA 4IO4A 2ZYMA 3MJNA 5ITPA 4LATA 4QSCA 1FQBA 1LBCA 4YB5A 4N15A 5F7VA 3PGFA 3TQWA 1AIVA 4ONYA 4P56A 4H67A 2QRYA 4EF1A 4F1VA 2PT2A 5B70A 4YMBA 2REGA 4MBPA 2I49A 4QSDA 4RJZA 2B65A 1SD3A 4L17A 3HHFA 1PB9A 1YTVA 4O94A 3MVYA 1SW5A 4F29A 1ZMGA 2XXHA 2VPOA 4FE8A 2PMSA 1BKAA 1ZBMA 3O2AA 3ILTB 3SEYA 3PMVA 4U4XA 4BDNA 4OERA 2DWJA 4DXBA 3TKDA 2W7YA 3IK6B 4NGUA 3FXRA 1MQIA 1H3DA 1NNPA 1O63A 2KLFA 3G3JA 3FXQA 3UORA 3N6UA 2O7IA 4H65A 2QMXA 5DVJA 1EU8A 4LA9A 1JETA 5I59B 4I9DA 4C0RA 4LONB 1QVSA 3T9HB 3M8UA 4FAJA 4PFIA 4NF8B 3IO6A 2DVZA 4MLQA 4XXUA 2WKYA 1LCTA 3E9XA 3RPWA 1AL3A 4QF9A 4ZEDA 2DE3A 1MQGA 3LUYA 3BFTA 3TEPA 1B5HA 5DEXA 3EPEA 4PE3A 4YB6A 4DDDA 3C9HA 2PFYA 4XEQA 5I2KB 3T9UA 4K3FA 1B40A 1O64A 2F36A 1I6QA 4BDMA 1B2HA 2XXKA 1B05A 2ZNUA 1UQWA 1A8EA 3KFMA 3O97A 4GIZA 4LQ2A 4O7MA 1MXYA 1ELJA 3MPKA 1ATGA 1F9BA 2HPGA 2B3FA 4JXIA 3IB2A 4OTEA 4F1UA 3TUSA 5AA2D 4G4PA 1US5A 1MQHA 2HZLA 3F11A 4MX6A 3FV1A 3K02A 3K1PA 2Z8DA 3S9NC 2Q89A 4QFLA 3TZAA 4POXA 4HW8A 4OHNA 1KWHA 1P1UA 4U4SA 2UVJA 2RCBA 2V25A 4O3CA 1QKAA 2HEUA 5I84A 4LZ5A 3SESA 2V84A 4NF4A 4IO2A 3EQ1A 3GYYA 3L6HA 2OK2A 2DQVA 1S9TA 4NF0A 1GGGA 2QSXA 2DSFA 3PPQA 4GD5A 3SETA 5IKBA 2V3UA 2A5SA 3W15C 1LB8A 4LN5A 3AXFA 3C4MA 2P0SA 3KEIA 1MM7A 2AIXA 2ZYNA 5I2NB 4ZDMA 4OANA 4IGTA 1LLSA 1H76A 1N7WA 1BIYA 2Q88A 3MUQA 3RTFB 2QS3A 4KQPA 2OWSA 2VOZA 2X7PA 4Q0CA 3FIRA 1JW4A 1Q1KA 4PF8A 4RPOA 4YAHX 3KGCA 1WVJA 5CMCA 3O6GA 4QRZA 3ZKKA 1MG1A 2ZNTA 3MP1A 1B9JA 4ND9A 4JBZA 2XX8A 4KCCA 2O1MA 3C36A 1LAHE 1URSA 1FQCA 1FCKA 1IZ1A 2F7CA 4FJPA 1MPBA 2ZXTA 4MNCA 2Y7WA 4IB2A 2I0CA 3FJ7A 1IEJA 4GOTA 3PUZE 2UVHA 3VV5A 4F1YA 1N04A 2ONSA 2O7UA 2HQ0A 3M3LA 2Z22A 2VD3A 4M4GA 4F22A 4UA8A 4ELPA 3FJGA 1R1NA 4H8IA 1R9QA 1P1NA 4U22A 4GVOA 2I0BA 3JZJA 3OENA 4KHZE 2F97A 4N17A 3IO4A 4U21A 2ABHA 4WEPA 5J1DA 3TYHA 3ZS6A 4PFYA 2F5XA 2V3QA 1DOTA 3VDFA 3HN0A 3B7DA 3S4UA 5AE4A 3O66A 4OXVA 3E13X 2ANJA 3U92A 3KJ7A 4MH5A 2PFZA 4FIMA 4ZZAA 1CE2A 2NOOA 2WYPA 4LVQA 4DZ1A 4NG7A 5IM2A 3MWBA 4WKMA 1M5DA 1URGA 3HPIA 3EF7A 1EH3A 5BUUA 4KI0E 3C34A 5DVFA 4EDPA 4P11A 3IORA 4YKIA 5HPQA 4N8GA 1WODA 4NF6B 5I59A 4OVSA 4NX1A 3FV2A 3VLWA 1SYHA 3KOTA 5K2YA 3QK6A 4PFBA 4NF8A 1B6HA 1RKMA 4E0WA 3SDFA 5I56B 1DTZA 3H6TA 2OCUA 3FGSA 3I3VA 5DVIA 3TCHA 1VFDA 4NE4A 1I6BA 4MIJA 2M8CA 1NNFA 2Y7KA 2D21A 2Y7RA 2XXTA 5FHMA 3KZGA 2DOJA 1FQDA 5I2KA 3C35A 1FTJA 2DYXA 1FTKA 4GWOA 4G68B 4DIGA 2YPNA 3DLNA 4R72A 2ONKE 5IAIA 4YKJA 1OQGA 4G77A 3H6VA 4KPTA 3TPAA 1I6AA 2X7QA 4OQOA 3EHUA 1MH4A 4N6PA 5DT6A 4PDDA 5ITOA 4H5GA 4NMYA 3H3GA 2Z8EA 2YLNA 4KYSA 1URDA 2ONRA 1B0LA 3RLFE 5EYFA 2RF1A 3BBRA 3L6GA 4OWDA 1SBPA 4IO5A 1M5CA 3USDA 5DTBA 1DPPA 4IY5A 1A7LA 1QJMA 3TTNA 4G8HA 3QUFA 4JDFA 4O8MA 5KDTB 5I57A 2RINA 4GLIA 1QUKA 4WEDA 3R6UA
chains in the Genus database with same CATH superfamily
3N26A 3H6UA 1JW1A 3K2DA 3U94A 1MM6A 5IGAA 1B58A 3IJOB 1INPA 3M3FA 1ANFA 1JP4A 1I69A 4PQJA 1PEBA 1UIVA 1P99A 3IFCA 1Z7ME 1ZLQA 3SEXA 4R9FA 4DCXA 3K1MA 1S7YA 1NMUA 2NWJA 4R6KA 1SW4A 3DP8A 4P1LA 3IAZA 1HSJA 1LEVA 2XD2A 4ECFA 4HTGA 3FATA 4OFLA 1BP5A 1IXIA 2VP1A 1QUIA 1KZ8A 2DS9A 1B7UA 1VSOA 3SZPA 1EZPA 5I2NA 1AWBA 3KN7A 1LAXA 4GRKA 3TCFA 5CBSA 1IMEA 4RK9A 1GR2A 4WXJA 4X48A 2NVUB 4P3LA 5KZTA 3T9VA 1MPDA 4BDLA 2Q2AA 1P1WA 3KSJA 1J1NA 2UVIA 3D4CA 3BIGA 3THIA 4F2OA 3A3UA 3LC8A 2NXOA 4XKRA 2DWHA 4NWCA 1FPJA 2XX9A 3FD3A 1B7HA 3O28A 2H99A 2GHAA 5IZ3B 3OEKA 4OEUA 1KA1A 3UK4A 5ICTA 4N6KA 4PP0A 5TPAA 5CI5A 2D5WA 4P0GA 3QAXA 3CSGA 3PD9A 3CFLA 2Y7IA 3FVOA 3VVDA 4U2RA 4FEDA 3S9EA 3S9MC 1PB7A 3PPOA 1LBWA 4RA1A 2ZMBA 2HFBA 4XIGQ 1DMBA 4F18A 1LFHA 3PPPA 1ZU0A 3KSXA 4NN3A 4ZEIA 3CI8A 5F1QA 4THIA 3RN8A 4R75A 1M5EA 3G3GA 1EYIA 3IB0A 1POTA 1TFAA 1N3WA 4P47A 3MW0A 1XOCA 4ELRA 3SEWA 3G7WA 3S2VA 4R9GA 3Q27A 4P9KA 2QPQA 1UTHB 4JVCA 4MF3A 3FJMA 5AA3A 2QVRA 2MKZA 4PGNA 4YKPA 1VR5A 1FBCA 1NFTA 3E4RA 1YXIA 2OWTA 5ET7A 4X1DA 4IO7A 4DE8A 1SYIA 1LBBA 3VLUA 1MY1A 1R9LA 3I6VA 4PAIA 1A99A 3OD7A 4EUOA 1Q9DA 2F3BA 1US4A 4MLVA 4U23A 3IX1A 5CBRA 2I58A 1T0KA 2WEFA 2QVVA 4NF6A 3M3KA 4OVJA 3HSTA 3TTKA 4X8RA 4P8BA 3T93B 5DW8A 5JTYA 1OLAA 1IMDA 1B3FA 3QXMA 1IXGA 4MNIA 1B0HA 2H25A 5I56A 5HM4B 1POY1 1NL5A 5CM6A 2AL4A 4PC9A 2XHDA 4JVIA 3G3IA 1N76A 4F3PA 4YB7A 3MPLA 3TMGA 3OEMA 3OO6A 1ZJLA 1TT1A 3OO7A 1LBZA 3EHTA 4F3GA 2P1SA 5ET5A 4KYEA 2CZHA 4N13A 4AQ4A 2I4CA 3K6XA 3IOUA 4G8NA 1B3EA 2VHAA 4G68A 3Q25A 1EZ9A 4OZ9A 3TTLA 3N94A 3CFZA 3OOAA 5AA4A 4I40A 4IO3A 4GQOA 3TCGA 3U72A 1JEUA 4EQ9A 1G0IA 4OESA 4OEVA 1UTBB 1MXUA 2GQ1A 4ZS9A 1Z7NE 1PDAA 5H8HB 1SI0A 1N84A 4OVRA 1Y1ZA 1MXWA 4RK2A 4BLAA 1K9YA 2R8TA 2UYEA 3OO9A 3PUVE 4XKNA 4IR8A 1ZKBA 4FORA 3TODA 2XXRA 4OENA 1KA0A 1FBDA 5KDTA 2H9BA 4HE2A 2RC8A 4QSEA 4LUBA 3MZBA 4FECA 3OSQA 4EXLA 1B3GA 4R73A 2I6EA 3E78A 4Q8RA 2GHBA 4Z0IA 2DWAA 3UIFA 4FBPA 1MRPA 2KQZA 4OYVA 2V4CA 2DWIA 1Y20A 4H5FA 4ZZEA 4ZECA 5L9SA 4OVPA 2PYYA 4DI4B 2BJJX 5FTIA 3RYDA 2AL5A 5EQAA 1IXCA 5KCJB 2FNCA 1NV0A 1MY0A 1JW5A 4ESWA 4PDHA 3GXAA 3RNNA 4N4UA 1USYE 1NV2A 4JB7A 4QBAA 4MHFA 4X04A 3MVWA 3G3HA 2L5VA 3TQLA 1FTLA 3PUXE 3CVGA 3VXCA 3IL1B 2P3NA 1JVYA 4MJOA 1IUDA 2F7AA 1P1QA 3HCQA 4PETA 4GL0A 1B4ZA 2DVCA 2XXYA 3C31A 4KCDA 5LOMA 4GL8A 2YJPA 2QS4A 2XD3A 1EZOA 3MBPA 1BLFA 4X1BA 3RT8A 1LB9A 3H03A 3B50A 2ZNSA 1EYJA 3CHGA 3CSBA 2UXAA 5IZ3A 4GFRA 2HCAA 3LV0A 4C1TA 2QFLA 4RYAA 3N5LA 4BDQA 2HXRA 3D1RA 2F6PA 3RQTA 1FBGA 1AH5A 2Y5KA 4FEBA 4N91A 1P1OA 1ZIUA 3UN6A 3U8QA 4OFOA 3CFXA 3CIJA 3KN3A 4NHBA 2GRVA 1LBYA 5TU0A 1B51A 4ISUA 2P2AA 1B1HA 1QW0A 1GV8A 3DP6A 1IITA 4N8YA 4GXSB 2XWKA 4LZ8A 1LBXA 1NV5A 2OBGA 3H06B 4ZEBA 4R6YA 4NQ8A 3MAMA 5I58B 1UTHA 3IOTA 1DCUA 4KYDA 4OETA 4NTLA 3IB1A 4I1DA 4LP2B 5ESYA 3IFAA 3T96B 4ESXA 3BFUA 1LAGE 1XHYA 3T22A 2Y84A 3ODBA 2Q74A 1YPNA 1NUZA 4ZEFA 1FSAA 1A8FA 1LSTA 1FTOA 3TTRA 3KN8A 5LTCA 1DPEA 3RGYA 4QFNA 4YKKA 4GXAA 3FXUA 3JV9A 3TELA 3V83A 5JEIA 2HAVA 4H8JA 1IXHA 4F19A 2CZIA 4HXVA 1VE4A 3LBSA 4MCOA 3MZ1A 5H8QB 5CMKA 5JK4A 1Y3PA 2RCAA 1CB6A 4ZE8A 4KD5A 4OVTA 4R2BA 1H43A 5ISUA 3VE1B 4NAPA 3RT6B 2UYFA 3O29A 1XI6A 1SDXA 5AA1A 2XWOA 5B7DA 4TLMB 1MXVA 5CRYA 5HBCA 3B6QA 4XF5A 2X26A 1ZTYA 1MDQA 4H1XA 3E3KA 1IQ7A 1MY4A 1FTMA 5BWJA 3KC0A 1YAEA 1XC1A 4I3EA 3B8BA 1B46A 1JNFA 2Q8MA 2ZYKA 5L8DA 2F34A 2QVUA 2UVGA 4JSDA 3PPNA 2Q8JA 2PBWA 4GWSA 4AB5A 2IEEA 5A5XB 1AOVA 1UTBA 4GWUA 5H8HA 2CZLA 4H0WA 2I3WA 3QSLA 3VVEA 5EHSA 4R74A 1N0TA 1B32A 3MQ9A 1Y9UA 1OMPA 3PMWA 4GBWA 2H4IA 1M5BA 4EQBA 2I4BA 3D4GA 2E1SA 2OX3A 3DM0A 2F7BA 1FPIA 5J16A 3T66A 1D4NA 1BK4A 2FHYA 1NV7A 1FQAA 1PB8A 2R71A 3OXNA 3K0VA 1H45A 5T3JA 1WDNA 5KCJA 3LSFB 1SI1A 3U93A 3FVKA 5I7IA 1N3XA 5EHMA 5H8FB 2A5TB 3RY3A 3W9VA 4F2QA 3G3KA 4GWWA 1H44A 1NKXA 1Y4TA 3QMFA 1B5JA 3UP9A 2O51A 3DP4A 1FW0A 2R9JA 4U1OA 2PX1A 4O3AA 4ELOA 4H45A 1B4HA 1PBQA 3GZGA 4Q5TA 3FVGA 1QULA 2RC7A 4ZE9A 3KJTA 3CG3A 1JEVA 3EN3A 2WX9A 4OFJA 5L9OA 4RNSA 4F31B 1LGBC 4MEVA 1NUYA 2XXWA 3OO8A 1NV6A 2XX7A 3PV0E 1B3LA 1MQDA 2F6GA 4I8CA 4PFUA 1XS5A 3TFLA 1QGXA 1FBEA 3PPRA 2XXPA 2QMWA 4DCYA 4OVQA 3RPLA 1D3KA 4I62A 4NF5B 3O6IA 3LSWA 1QUJA 2V3TA 5H8NB 1USYH 1YYZA 1JVXA 5LDZA 4ELQA 3A3CA 4MAGA 2XXQA 4GX3A 2Q9TA 3N6TA 2R6GE 3ECRA 1B3HA 2XXIA 3GBBA 1OQHA 2REJA 5TP9B 4KFQA 1Y4CA 4QXDA 5FHNA 2OJTA 5ET6A 3V89B 4GF8A 4P0IA 2CMOA 4TOZA 3ROJA 3B6WA 3GBAA 4LQ5A 2VD2A 4RY1A 4KR5A 2F3DA 4POWA 2DDKA 5AA2B 1A40A 3MVZA 5I58A 2CEYA 1MY2A 1RYOA 3K4UA 5DYHA 2E0SA 3OSRA 1OLCA 2F78A 4O7IA 2ZZVA 4GWXA 1MXXA 3HV1A 4EQ7A 3K6WA 3QUJA 1XVXA 3K00A 4AS5A 2I48A 4HE0A 4GBVA 4X9TA 3EKIA 1FTAA 4AB6A 2I3VA 1JQFA 1OVTA 1LFGA 5FTHA 1DTGA 5I57B 3QYTA 3V8XB 3ZKLA 2DXRA 3FZVA 3Q29A 3H6WA 2V93A 2QS2A 2F8DA 4PAKA 1EYKA 2Z23A 1NV4A 5EQ8A 4PTKA 4JSOA 3MVXA 3R7XA 3FVNA 3HHGA 3JYRA 4BDRA 4KXPA 3B6TA 2BJIA 4R6HA 5H8QA 2VPNA 4DXUA 1MQJA 1VFEA 1FPBA 5K2XA 2G93A 4MMPA 3OELA 4HCYA 2DE2A 4QHQA 3SERA 1IIWA 1MH3A 3ZSFA 2PCRA 1Q35A 4OA4A 3Q28A 3PU5A 4Z7EA 4GX6A 4TQUQ 2FYIA 3ONMA 4HCWA 5ICQA 3PUWE 3K1NA 3VVFA 1LFIA 3IOWA 1DSNA 4F3BA 3UGWA 1FPLA 5ELVA 2XWVA 1QKBA 5H8SA 3W9WA 1SW2A 1SVXB 3LSXA 4YU0A 3K01A 2WYKA 1NNKA 4PF6A 2XXXA 1LBVA 2IA4A 2ZZWA 3KBRA 3SKPA 3RUMA 2DE4A 4FATA 1B5IA 2RC9A 1L5TA 4YMAA 5A5XA 4ZEKA 2F35A 4PFWA 4EXKA 1BTJA 2FIXA 4PFTA 2DP8A 2QL3A 3VXBA 4QFOA 2QS1A 3S9LC 3V5AA 3KC1A 1MS7A 3KBZA 1N7XA 4H46A 5IZZA 5TPAB 4JWXA 2HZKA 4PCDA 2THIA 3FBPA 1Y1MA 4Q30B 4UACA 3R26A 2XWIA 1A55A 1YZ0A 1M5FA 3BIHA 4U1ZA 1NV3A 4UABA 3EHSA 1FBPA 1MXZA 3FUZA 4PBQA 4NWDA 4JWOA 3I5OA 2PVUA 3Q26A 1RYXA 1XVYA 4XKPA 2AYSA 3WAEA 1MDP1 3MC2A 4PFRA 3TAJA 3U1OA 2LAOA 4N6DA 4RXLA 1LCFA 4PBHA 1B7ZA 1OVBA 5H8FA 2QJEA 2A5TA 4M1VA 3MP8A 2RKMA 3G3FA 3TDJA 4EF2A 3PD8A 1LAFE 5CMBA 3CRBA 4F39A 2Y7PA 3A09A 3FASA 3U65A 1HSEA 3BKIB 2G29A 1NH7A 3H4ZA 1AMFA 5DEXB 1YCJA 4G8MA 3SEUA 3K6UA 3O6HA 4XTCQ 3HFUA 4O3BA 4PAFA 2CEXA 4GX4A 3CR9A 2D3IA 3IR1A 3DELB 3A29A 4QFPA 2H98A 2FBPA 4DXCA 1GVCA 1SW1A 2HAUA 1CNQA 3TTMA 3LSLA 3VFJA 4R2FA 3OMBA 1UIUA 4G2ZA 2OWZA 3WAFA 2FA7A 2XXVA 3VLVA 4N07A 4XFEA 4IY6A 5JTYB 1IMBA 4NF5A 2KR0A 4MNPA 4IGRA 4OMBA 5H8NA 1NV1A 4RPNA 4DI3D 1XT8A 4C1UA 5I5PA 2NUVA 3KG2A 3FXBA 4H6DA 1TWYA 5EQ7A 1B1XA 2O6AA 2OLBA 3ISPA 3K6VA 1GTKA 2B3BA 5TP9A 3PMXA 4YZZA 3GLBA 3MZ9A 3O9PA 1D9YA 2XA5A 1FQEA 3KOSA 4NF4B 1HSLA 3H7MA 3LR1A 2O68A 3C33A 1Y3QA 4JWYA 2VT5A 5AA2A 5AA4B 3IOVA 1A54A 2ZZXA 3P7IA 2PT1A 2ESNA 4LZ7A 2XXUA 3T9XB 1FBFA 2OZZA 3QIMA 4PE5B 5CMMA 2Q2CA 1MY3A 1Y3NA 4F3SA 2O84X 1FJ6A 3PUYE 3RTWB 4DLDA 4HE1A 1R6ZA 4BDOA 1VDWA 1DK4A 4G68C 5L9MA 5M2VA 1S50A 2ALUA 1TXFA 2O69A 1FPGA 1O7TA 1PC3A 2VGQA 4HS7A 3MP6A 3HO7A 1NI9A 1NH8A 1OIBA 2GFEA 3C32A 2HXWA 2ZYOA 4XKQA 2GH9A 4GWYA 4QFKA 4AS4A 4TLLB 4P1EA 4NEDA 4MFIA 5FHOA 1TFDA 2Z8FA 2O1LA 1NNTA 4I3YA 1PBPA 1FBHA 4PGPA 3CG1A 3MYUA 3UA8A 1D9VA 4IO6A 2H5YA 1B52A 1SQYA 3ILUB 1II5A 3SEVA 2DXYA 3IJXB 5CC2A 1FQFA 2Y5LA 1MPCA 4E0XA 4YICA 1DBZA 4IO4A 2ZYMA 3MJNA 5ITPA 4LATA 4QSCA 1FQBA 1LBCA 4YB5A 3LUZA 4N15A 5F7VA 3PGFA 1RDYA 3TQWA 1AIVA 4ONYA 4P56A 4H67A 2JJKA 2QRYA 1IMCA 4EF1A 4F1VA 2PT2A 5B70A 4YMBA 2REGA 4MBPA 2I49A 4QSDA 4RJZA 2B65A 1SD3A 4L17A 3HHFA 1PB9A 1YTVA 4O94A 3MVYA 1SW5A 4F29A 1ZMGA 2XXHA 2VPOA 1FPEA 4FE8A 2PMSA 1BKAA 1ZBMA 2CZKA 3O2AA 3ILTB 3SEYA 3PMVA 2HHMA 4U4XA 4BDNA 4OERA 2DWJA 4DXBA 2W7YA 3IK6B 4NGUA 3TKDA 3FXRA 1MQIA 1D9QA 1H3DA 1NNPA 1O63A 2KLFA 3G3JA 3FXQA 3UORA 3N6UA 2O7IA 4H65A 2QMXA 5DVJA 1EU8A 4LA9A 1JETA 5I59B 4I9DA 3MSTA 4C0RA 4LONB 5EQ9A 1QVSA 3T9HB 3M8UA 4PFIA 4FAJA 4NF8B 3IO6A 2B4LA 2DVZA 4MLQA 4XXUA 2WKYA 1LCTA 5EYHA 3E9XA 3RPWA 1AL3A 4QF9A 4ZEDA 2DE3A 1MQGA 3LUYA 3E79A 3BFTA 3TEPA 1B5HA 5DEXA 3EPEA 4PE3A 4YB6A 4DDDA 3C9HA 2PFYA 4XEQA 1RDZA 5I2KB 3T9UA 4K3FA 5F24A 4G61A 1B40A 1O64A 2F36A 1I6QA 4BDMA 1B2HA 2XXKA 1B05A 2ZNUA 1UQWA 1A8EA 3KFMA 3O97A 4GIZA 4LQ2A 4GWZA 4O7MA 1MXYA 1ELJA 3MPKA 1ATGA 1RDXA 1F9BA 2HPGA 2B3FA 4JXIA 3IB2A 4OTEA 4F1UA 3TUSA 3T1BA 5AA2D 4G4PA 1US5A 1MQHA 2HZLA 3F11A 4MX6A 3FV1A 3K02A 3K1PA 2Z8DA 3S9NC 2Q89A 4QFLA 3TZAA 4POXA 4HW8A 4OHNA 1KWHA 1P1UA 4U4SA 2UVJA 2RCBA 2V25A 4O3CA 1QKAA 2HEUA 5I84A 4LZ5A 5EYGA 3SESA 2V84A 4NF4A 4IO2A 3EQ1A 3GYYA 3L6HA 2OK2A 2DQVA 1S9TA 2FIEA 4NF0A 1GGGA 2QSXA 3PTYA 2DSFA 3PPQA 4GD5A 3SETA 2B4MA 1SPIA 5IKBA 1NUWA 2V3UA 1IMAA 2A5SA 3W15C 2WBDA 1LB8A 4LN5A 3AXFA 3C4MA 2P0SA 3KEIA 1MM7A 2AIXA 2ZYNA 5I2NB 4OANA 4ZDMA 4IGTA 1LLSA 1H76A 1N7WA 1BIYA 2Q88A 3MUQA 3RTFB 2QS3A 4KQPA 2OWSA 2VOZA 2X7PA 4Q0CA 3FIRA 1JW4A 1Q1KA 4PF8A 4RPOA 4YAHX 3KGCA 1WVJA 1FPDA 5CMCA 3O6GA 4QRZA 3ZKKA 1MG1A 2ZNTA 3MP1A 1B9JA 4ND9A 4JBZA 2XX8A 1FJ9A 4KCCA 2O1MA 3C36A 1LAHE 1URSA 1FQCA 1FCKA 1IZ1A 2F7CA 4FJPA 1FPKA 1MPBA 2ZXTA 4MNCA 2Y7WA 4IB2A 2I0CA 3FJ7A 1IEJA 5IZ1A 4GOTA 3PUZE 2UVHA 3VV5A 4F1YA 1N04A 2ONSA 1FPFA 2O7UA 2HQ0A 3M3LA 2Z22A 2VD3A 4M4GA 4F22A 4UA8A 4ELPA 3FJGA 1R1NA 4H8IA 1R9QA 1P1NA 4U22A 4GVOA 2I0BA 3JZJA 3OENA 4KHZE 2F97A 4N17A 3IO4A 4U21A 2ABHA 4WEPA 5J1DA 3TYHA 4PFYA 3ZS6A 5A5LA 2F5XA 2V3QA 1DOTA 3VDFA 3HN0A 3B7DA 3S4UA 5AE4A 3O66A 4OXVA 3E13X 3RPLB 2ANJA 3U92A 3KJ7A 4MH5A 2PFZA 4FIMA 4ZZAA 1CE2A 2NOOA 2WYPA 4LVQA 4DZ1A 4NG7A 5IM2A 3MWBA 4WKMA 1M5DA 1URGA 3HPIA 3EF7A 5FBPA 1EH3A 5BUUA 4KI0E 3C34A 5DVFA 4EDPA 4P11A 3IORA 4YKIA 5HPQA 4N8GA 1WODA 2FVZA 4NF6B 5I59A 4OVSA 4NX1A 3FV2A 3VLWA 1IMFA 1SYHA 3KOTA 5K2YA 4JVDA 5ET8A 3QK6A 4PFBA 4NF8A 1B6HA 1RKMA 4E0WA 3SDFA 5I56B 1DTZA 3H6TA 2OCUA 3FGSA 3I3VA 5DVIA 3TCHA 1VFDA 4NE4A 1I6BA 2WBBA 4MIJA 1K9ZA 2M8CA 1NNFA 2Y7KA 2D21A 2Y7RA 2XXTA 5FHMA 3KZGA 2DOJA 3NOHA 1FQDA 5I2KA 3C35A 1FTJA 2DYXA 1FTKA 4GWOA 4G68B 4DIGA 2YPNA 3DLNA 4R72A 4N81A 2ONKE 5IAIA 3T0JA 4YKJA 1OQGA 4G77A 3H6VA 4KPTA 3TPAA 1I6AA 2X7QA 4OQOA 3EHUA 1MH4A 4N6PA 5DT6A 4PDDA 2P3VA 5ITOA 4H5GA 4NMYA 3H3GA 2Z8EA 2YLNA 1G0HA 4KYSA 1URDA 2ONRA 1B0LA 3RLFE 5EYFA 2RF1A 3BBRA 3L6GA 4OWDA 1SBPA 4IO5A 1M5CA 3USDA 5DTBA 1DPPA 4IY5A 1A7LA 1QJMA 3TTNA 1FRPA 4G8HA 3QUFA 4JDFA 5I3SA 4O8MA 5KDTB 5I57A 2RINA 1NUXA 4GLIA 1QUKA 4WEDA 3R6UA
chains in the Genus database with same CATH topology
3N26A 3H6UA 1JW1A 3K2DA 3U94A 1MM6A 5IGAA 1B58A 3IJOB 1INPA 3M3FA 1ANFA 1JP4A 1I69A 4PQJA 1PEBA 1UIVA 1P99A 3IFCA 1Z7ME 1ZLQA 3SEXA 4R9FA 4DCXA 3K1MA 1S7YA 1NMUA 2NWJA 4R6KA 1SW4A 3DP8A 4P1LA 3IAZA 1HSJA 2XD2A 1LEVA 4ECFA 4HTGA 3FATA 4OFLA 1BP5A 1IXIA 2VP1A 1QUIA 1KZ8A 2DS9A 1B7UA 1VSOA 3SZPA 1EZPA 5I2NA 1AWBA 3KN7A 1LAXA 4GRKA 3TCFA 5CBSA 4RK9A 1IMEA 1GR2A 4WXJA 4X48A 2NVUB 4P3LA 5KZTA 3T9VA 1MPDA 4BDLA 2Q2AA 1P1WA 3KSJA 1J1NA 2UVIA 3D4CA 3BIGA 3THIA 4F2OA 3A3UA 3LC8A 2NXOA 4XKRA 2DWHA 4NWCA 1FPJA 2XX9A 3FD3A 1B7HA 3O28A 2H99A 2GHAA 5IZ3B 3OEKA 4OEUA 1KA1A 3UK4A 5ICTA 4PP0A 4N6KA 5TPAA 5CI5A 2D5WA 4P0GA 3QAXA 3CSGA 3PD9A 3CFLA 2Y7IA 3FVOA 3VVDA 4U2RA 4FEDA 3S9EA 3S9MC 1PB7A 3PPOA 4RA1A 1LBWA 2ZMBA 2HFBA 4XIGQ 1DMBA 4F18A 1LFHA 3PPPA 1ZU0A 3KSXA 4NN3A 4ZEIA 3CI8A 5F1QA 4THIA 3RN8A 4R75A 1M5EA 3G3GA 1EYIA 3IB0A 1POTA 1TFAA 1N3WA 4P47A 3MW0A 1XOCA 4ELRA 3SEWA 3G7WA 3S2VA 4R9GA 3Q27A 4P9KA 2QPQA 1UTHB 4JVCA 4MF3A 3FJMA 5AA3A 2QVRA 2MKZA 4PGNA 4YKPA 1VR5A 1NFTA 1FBCA 3E4RA 1YXIA 2OWTA 5ET7A 4X1DA 4IO7A 4DE8A 1SYIA 1LBBA 3VLUA 1MY1A 1R9LA 3I6VA 4PAIA 1A99A 3OD7A 4EUOA 1Q9DA 2F3BA 1US4A 4MLVA 4U23A 3IX1A 5CBRA 2I58A 1T0KA 2WEFA 2QVVA 4NF6A 3M3KA 4OVJA 3HSTA 3TTKA 4X8RA 4P8BA 3T93B 5DW8A 5JTYA 1OLAA 1IMDA 1B3FA 3QXMA 1IXGA 4MNIA 1B0HA 2H25A 5I56A 5HM4B 1POY1 1NL5A 5CM6A 2AL4A 4PC9A 2XHDA 4JVIA 3G3IA 1N76A 4F3PA 4YB7A 3MPLA 3TMGA 3OEMA 3OO6A 1ZJLA 1TT1A 3OO7A 3EHTA 1LBZA 4F3GA 2P1SA 5ET5A 4KYEA 2CZHA 4N13A 4AQ4A 2I4CA 3K6XA 3IOUA 4G8NA 1B3EA 2VHAA 4G68A 3Q25A 1EZ9A 4OZ9A 3TTLA 3N94A 3CFZA 3OOAA 5AA4A 4I40A 4IO3A 4GQOA 3TCGA 3U72A 1JEUA 4EQ9A 4OESA 1G0IA 4OEVA 1UTBB 1MXUA 2GQ1A 4ZS9A 1Z7NE 1PDAA 5H8HB 1SI0A 1N84A 4OVRA 1Y1ZA 1MXWA 4RK2A 4BLAA 1K9YA 2R8TA 2UYEA 3OO9A 3PUVE 4XKNA 4IR8A 1ZKBA 4FORA 3TODA 2XXRA 4OENA 1KA0A 5KDTA 1FBDA 2H9BA 4HE2A 2RC8A 4QSEA 4LUBA 3MZBA 4FECA 3OSQA 4EXLA 1B3GA 4R73A 2I6EA 3E78A 4Q8RA 2GHBA 4Z0IA 2DWAA 3UIFA 4FBPA 1MRPA 2KQZA 4OYVA 2V4CA 2DWIA 1Y20A 4H5FA 4ZZEA 4ZECA 5L9SA 4OVPA 2PYYA 4DI4B 2BJJX 5FTIA 3RYDA 2AL5A 5EQAA 1IXCA 5KCJB 2FNCA 1NV0A 1MY0A 1JW5A 4ESWA 4PDHA 3GXAA 3RNNA 4N4UA 1USYE 1NV2A 4JB7A 4QBAA 4MHFA 4X04A 3MVWA 3G3HA 3TQLA 2L5VA 1FTLA 3PUXE 3CVGA 3VXCA 3IL1B 2P3NA 1JVYA 4MJOA 1IUDA 2F7AA 1P1QA 3HCQA 4PETA 4GL0A 1B4ZA 2DVCA 2XXYA 3C31A 4KCDA 5LOMA 4GL8A 2YJPA 2QS4A 2XD3A 1EZOA 3MBPA 1BLFA 4X1BA 3RT8A 1LB9A 3H03A 3B50A 2ZNSA 1EYJA 3CHGA 3CSBA 2UXAA 5IZ3A 4GFRA 2HCAA 3LV0A 4C1TA 2QFLA 4RYAA 3N5LA 4BDQA 2HXRA 3D1RA 2F6PA 3RQTA 1FBGA 1AH5A 2Y5KA 4FEBA 4N91A 1P1OA 1ZIUA 3UN6A 3U8QA 4OFOA 3CFXA 3CIJA 3KN3A 4NHBA 2GRVA 1LBYA 5TU0A 1B51A 4ISUA 2P2AA 1B1HA 1QW0A 1GV8A 3DP6A 1IITA 4N8YA 4GXSB 2XWKA 4LZ8A 1LBXA 1NV5A 2OBGA 3H06B 4ZEBA 4R6YA 4NQ8A 3MAMA 5I58B 1UTHA 3IOTA 1DCUA 4KYDA 4OETA 4NTLA 3IB1A 4I1DA 4LP2B 5ESYA 3T96B 4ESXA 3IFAA 3BFUA 1LAGE 1XHYA 3T22A 2Y84A 3ODBA 2Q74A 1YPNA 1NUZA 4ZEFA 1FSAA 1A8FA 1LSTA 1FTOA 3TTRA 3KN8A 5LTCA 1DPEA 3RGYA 4QFNA 4YKKA 4GXAA 3FXUA 3JV9A 3TELA 3V83A 5JEIA 2HAVA 4H8JA 1IXHA 4F19A 2CZIA 4HXVA 1VE4A 3LBSA 4MCOA 3MZ1A 5H8QB 5CMKA 5JK4A 1Y3PA 2RCAA 1CB6A 4ZE8A 4KD5A 4OVTA 4R2BA 1H43A 5ISUA 3VE1B 4NAPA 3RT6B 2UYFA 3O29A 1XI6A 1SDXA 5AA1A 5B7DA 2XWOA 4TLMB 1MXVA 5CRYA 5HBCA 3B6QA 4XF5A 2X26A 1ZTYA 1MDQA 4H1XA 3E3KA 1IQ7A 1MY4A 1FTMA 5BWJA 3KC0A 1YAEA 1XC1A 4I3EA 3B8BA 1B46A 1JNFA 2Q8MA 2ZYKA 5L8DA 2F34A 2QVUA 2UVGA 4JSDA 3PPNA 2Q8JA 2PBWA 4GWSA 4AB5A 2IEEA 5A5XB 1AOVA 1UTBA 4GWUA 5H8HA 2CZLA 4H0WA 2I3WA 3QSLA 3VVEA 5EHSA 4R74A 1N0TA 1B32A 3MQ9A 1Y9UA 1OMPA 3PMWA 4GBWA 2H4IA 1M5BA 4EQBA 2I4BA 3D4GA 2E1SA 2OX3A 3DM0A 2F7BA 1FPIA 5J16A 3T66A 1D4NA 1BK4A 2FHYA 2R71A 1FQAA 1PB8A 3OXNA 1NV7A 3K0VA 1H45A 5T3JA 1WDNA 5KCJA 3LSFB 1SI1A 3U93A 3FVKA 5I7IA 1N3XA 5EHMA 5H8FB 2A5TB 3RY3A 3W9VA 4F2QA 3G3KA 4GWWA 1H44A 1NKXA 1Y4TA 3QMFA 1B5JA 3UP9A 2O51A 3DP4A 1FW0A 2R9JA 4U1OA 2PX1A 4O3AA 4ELOA 4H45A 1B4HA 1PBQA 3GZGA 4Q5TA 3FVGA 1QULA 2RC7A 4ZE9A 3KJTA 3CG3A 1JEVA 3EN3A 4OFJA 2WX9A 5L9OA 4RNSA 4F31B 1LGBC 4MEVA 1NUYA 2XXWA 3OO8A 1NV6A 2XX7A 3PV0E 1B3LA 1MQDA 2F6GA 4I8CA 4PFUA 1XS5A 3TFLA 1QGXA 3PPRA 1FBEA 2XXPA 2QMWA 4DCYA 4OVQA 3RPLA 1D3KA 4I62A 4NF5B 3O6IA 3LSWA 1QUJA 2V3TA 5H8NB 1USYH 1YYZA 1JVXA 5LDZA 4ELQA 3A3CA 4MAGA 2XXQA 4GX3A 2Q9TA 3N6TA 2R6GE 3ECRA 1B3HA 2XXIA 3GBBA 1OQHA 2REJA 5TP9B 4KFQA 1Y4CA 4QXDA 5FHNA 2OJTA 5ET6A 3V89B 4GF8A 4P0IA 2CMOA 4TOZA 3ROJA 3B6WA 3GBAA 4LQ5A 2VD2A 4RY1A 4KR5A 4POWA 2F3DA 5AA2B 2DDKA 1A40A 3MVZA 5I58A 2CEYA 1MY2A 1RYOA 3K4UA 5DYHA 2E0SA 3OSRA 1OLCA 2F78A 4O7IA 2ZZVA 4GWXA 1MXXA 3HV1A 4EQ7A 3K6WA 3QUJA 1XVXA 3K00A 4AS5A 2I48A 4HE0A 4X9TA 4GBVA 3EKIA 4AB6A 1FTAA 2I3VA 1JQFA 1OVTA 1LFGA 5FTHA 1DTGA 5I57B 3QYTA 3V8XB 3ZKLA 2DXRA 3FZVA 3Q29A 3H6WA 2V93A 2QS2A 2F8DA 4PAKA 1EYKA 2Z23A 1NV4A 5EQ8A 4PTKA 4JSOA 3MVXA 3R7XA 3FVNA 3HHGA 3JYRA 4BDRA 4KXPA 3B6TA 4R6HA 2BJIA 5H8QA 4DXUA 2VPNA 1MQJA 1VFEA 1FPBA 5K2XA 2G93A 4MMPA 3OELA 4HCYA 2DE2A 4QHQA 3SERA 1IIWA 1MH3A 3ZSFA 2PCRA 1Q35A 4OA4A 3Q28A 3PU5A 4Z7EA 4GX6A 4TQUQ 2FYIA 3ONMA 4HCWA 5ICQA 3PUWE 3K1NA 3VVFA 1LFIA 3IOWA 1DSNA 4F3BA 3UGWA 1FPLA 5ELVA 2XWVA 1QKBA 5H8SA 3W9WA 1SW2A 1SVXB 3LSXA 4YU0A 3K01A 2WYKA 1NNKA 4PF6A 2XXXA 3KBRA 2IA4A 1LBVA 2ZZWA 3SKPA 3RUMA 2DE4A 4FATA 1B5IA 2RC9A 1L5TA 4YMAA 5A5XA 4ZEKA 2F35A 4PFWA 4EXKA 1BTJA 2FIXA 4PFTA 2DP8A 2QL3A 3VXBA 4QFOA 2QS1A 3S9LC 3V5AA 3KC1A 1MS7A 3KBZA 1N7XA 4H46A 5IZZA 5TPAB 4JWXA 2HZKA 4PCDA 2THIA 3FBPA 1Y1MA 4Q30B 4UACA 3R26A 2XWIA 1A55A 1YZ0A 1M5FA 3BIHA 4U1ZA 1NV3A 4UABA 3EHSA 1FBPA 1MXZA 3FUZA 4PBQA 4NWDA 4JWOA 3I5OA 2PVUA 3Q26A 1RYXA 1XVYA 4XKPA 2AYSA 3WAEA 1MDP1 3MC2A 4PFRA 3TAJA 3U1OA 2LAOA 4RXLA 4N6DA 1LCFA 4PBHA 1B7ZA 1OVBA 5H8FA 2QJEA 2A5TA 4M1VA 3MP8A 2RKMA 3G3FA 3TDJA 4EF2A 3PD8A 1LAFE 5CMBA 3CRBA 4F39A 2Y7PA 3A09A 3FASA 3U65A 1HSEA 3BKIB 2G29A 1NH7A 3H4ZA 1AMFA 5DEXB 1YCJA 4G8MA 3SEUA 3K6UA 3O6HA 4XTCQ 4O3BA 3HFUA 4PAFA 2CEXA 4GX4A 3CR9A 2D3IA 3IR1A 3DELB 3A29A 4QFPA 2H98A 2FBPA 4DXCA 1GVCA 1SW1A 2HAUA 1CNQA 3TTMA 3LSLA 3VFJA 4R2FA 3OMBA 1UIUA 4G2ZA 2OWZA 3WAFA 2FA7A 2XXVA 3VLVA 4N07A 5JTYB 4IY6A 4XFEA 1IMBA 4NF5A 2KR0A 4MNPA 4IGRA 4OMBA 5H8NA 1NV1A 4RPNA 4DI3D 1XT8A 4C1UA 5I5PA 2NUVA 3KG2A 3FXBA 4H6DA 1TWYA 5EQ7A 1B1XA 2O6AA 2OLBA 3ISPA 3K6VA 1GTKA 2B3BA 5TP9A 3PMXA 4YZZA 3GLBA 3MZ9A 3O9PA 1D9YA 2XA5A 1FQEA 3KOSA 4NF4B 1HSLA 3H7MA 3LR1A 2O68A 3C33A 1Y3QA 4JWYA 2VT5A 5AA2A 5AA4B 3IOVA 1A54A 2ZZXA 3P7IA 2PT1A 2ESNA 4LZ7A 2XXUA 3T9XB 1FBFA 2OZZA 3QIMA 4PE5B 5CMMA 2Q2CA 1MY3A 1Y3NA 4F3SA 2O84X 1FJ6A 3PUYE 3RTWB 4DLDA 4HE1A 1R6ZA 4BDOA 1VDWA 4G68C 1DK4A 5L9MA 5M2VA 1S50A 2ALUA 1TXFA 2O69A 1FPGA 1O7TA 1PC3A 2VGQA 4HS7A 3MP6A 3HO7A 1NI9A 1NH8A 1OIBA 2GFEA 3C32A 2HXWA 2ZYOA 4XKQA 2GH9A 4GWYA 4QFKA 4AS4A 4TLLB 4P1EA 4NEDA 4MFIA 5FHOA 1TFDA 2Z8FA 2O1LA 1NNTA 4I3YA 1PBPA 1FBHA 4PGPA 3CG1A 3UA8A 3MYUA 1D9VA 4IO6A 2H5YA 1B52A 1SQYA 3ILUB 1II5A 3SEVA 2DXYA 3IJXB 5CC2A 1FQFA 2Y5LA 1MPCA 4E0XA 4YICA 1DBZA 4IO4A 2ZYMA 3MJNA 5ITPA 4LATA 4QSCA 1FQBA 1LBCA 4YB5A 3LUZA 4N15A 5F7VA 3PGFA 1RDYA 3TQWA 1AIVA 4ONYA 4P56A 4H67A 2JJKA 2QRYA 1IMCA 4EF1A 4F1VA 2PT2A 5B70A 4YMBA 2REGA 4MBPA 2I49A 4QSDA 4RJZA 2B65A 1SD3A 4L17A 3HHFA 1PB9A 1YTVA 4O94A 3MVYA 1SW5A 4F29A 1ZMGA 2XXHA 2VPOA 1FPEA 4FE8A 2PMSA 1BKAA 1ZBMA 2CZKA 3O2AA 3ILTB 3SEYA 3PMVA 2HHMA 4U4XA 4BDNA 4OERA 2DWJA 4DXBA 3TKDA 2W7YA 3IK6B 4NGUA 3FXRA 1MQIA 1D9QA 1H3DA 1NNPA 1O63A 2KLFA 3G3JA 3FXQA 3UORA 3N6UA 2O7IA 4H65A 2QMXA 5DVJA 1EU8A 4LA9A 1JETA 5I59B 4I9DA 4C0RA 3MSTA 4LONB 5EQ9A 1QVSA 3T9HB 3M8UA 4FAJA 4PFIA 4NF8B 3IO6A 2B4LA 2DVZA 4MLQA 4XXUA 2WKYA 1LCTA 5EYHA 3E9XA 3RPWA 1AL3A 4QF9A 4ZEDA 2DE3A 1MQGA 3LUYA 3E79A 3BFTA 3TEPA 1B5HA 5DEXA 3EPEA 4PE3A 4YB6A 4DDDA 3C9HA 2PFYA 4XEQA 1RDZA 5I2KB 3T9UA 4K3FA 5F24A 4G61A 1B40A 1O64A 2F36A 1I6QA 4BDMA 1B2HA 2XXKA 1B05A 2ZNUA 1UQWA 1A8EA 3KFMA 3O97A 4GIZA 4LQ2A 4GWZA 4O7MA 1MXYA 1ELJA 3MPKA 1ATGA 1RDXA 1F9BA 2HPGA 2B3FA 4JXIA 3IB2A 4OTEA 4F1UA 3TUSA 3T1BA 5AA2D 4G4PA 1US5A 1MQHA 2HZLA 3F11A 4MX6A 3FV1A 3K02A 3K1PA 2Z8DA 3S9NC 2Q89A 4QFLA 3TZAA 4POXA 4HW8A 4OHNA 1KWHA 1P1UA 4U4SA 2UVJA 2RCBA 2V25A 4O3CA 1QKAA 2HEUA 5I84A 4LZ5A 5EYGA 3SESA 2V84A 4NF4A 4IO2A 3EQ1A 3GYYA 3L6HA 2OK2A 2DQVA 1S9TA 2FIEA 4NF0A 1GGGA 2QSXA 3PTYA 2DSFA 3PPQA 4GD5A 3SETA 2B4MA 1SPIA 5IKBA 1NUWA 2V3UA 1IMAA 2A5SA 3W15C 2WBDA 1LB8A 4LN5A 3AXFA 3C4MA 2P0SA 3KEIA 1MM7A 2AIXA 2ZYNA 5I2NB 4ZDMA 4OANA 4IGTA 1LLSA 1H76A 1N7WA 1BIYA 2Q88A 3MUQA 3RTFB 2QS3A 4KQPA 2OWSA 2VOZA 2X7PA 4Q0CA 3FIRA 1JW4A 1Q1KA 4PF8A 4RPOA 4YAHX 3KGCA 1WVJA 1FPDA 5CMCA 3O6GA 4QRZA 3ZKKA 1MG1A 2ZNTA 3MP1A 1B9JA 4ND9A 4JBZA 2XX8A 4KCCA 1FJ9A 2O1MA 3C36A 1LAHE 1URSA 1FQCA 1FCKA 1IZ1A 2F7CA 4FJPA 1FPKA 1MPBA 2ZXTA 4MNCA 2Y7WA 4IB2A 2I0CA 3FJ7A 1IEJA 5IZ1A 4GOTA 3PUZE 2UVHA 3VV5A 4F1YA 1N04A 2ONSA 1FPFA 2O7UA 2HQ0A 3M3LA 2Z22A 2VD3A 4M4GA 4F22A 4UA8A 4ELPA 3FJGA 1R1NA 4H8IA 1R9QA 1P1NA 4U22A 4GVOA 2I0BA 3JZJA 3OENA 4KHZE 2F97A 4N17A 3IO4A 4U21A 2ABHA 4WEPA 5J1DA 3TYHA 3ZS6A 4PFYA 5A5LA 2F5XA 2V3QA 1DOTA 3VDFA 3HN0A 3B7DA 3S4UA 5AE4A 3O66A 4OXVA 3E13X 3RPLB 2ANJA 3U92A 3KJ7A 4MH5A 2PFZA 4FIMA 4ZZAA 1CE2A 2NOOA 2WYPA 4LVQA 4DZ1A 4NG7A 5IM2A 3MWBA 4WKMA 1M5DA 1URGA 3HPIA 3EF7A 5FBPA 1EH3A 5BUUA 4KI0E 3C34A 5DVFA 4EDPA 4P11A 3IORA 4YKIA 5HPQA 4N8GA 1WODA 2FVZA 4NF6B 5I59A 4OVSA 4NX1A 3FV2A 3VLWA 1IMFA 1SYHA 3KOTA 5K2YA 4JVDA 5ET8A 3QK6A 4PFBA 4NF8A 1B6HA 1RKMA 4E0WA 3SDFA 5I56B 1DTZA 3H6TA 2OCUA 3FGSA 3I3VA 5DVIA 3TCHA 1VFDA 4NE4A 1I6BA 2WBBA 4MIJA 1K9ZA 2M8CA 1NNFA 2Y7KA 2D21A 2Y7RA 2XXTA 5FHMA 3KZGA 2DOJA 3NOHA 1FQDA 5I2KA 3C35A 1FTJA 2DYXA 1FTKA 4GWOA 4G68B 4DIGA 2YPNA 3DLNA 4R72A 4N81A 2ONKE 5IAIA 3T0JA 4YKJA 1OQGA 4G77A 3H6VA 4KPTA 3TPAA 1I6AA 2X7QA 4OQOA 3EHUA 1MH4A 4N6PA 5DT6A 4PDDA 2P3VA 5ITOA 4H5GA 4NMYA 3H3GA 2Z8EA 2YLNA 1G0HA 4KYSA 1URDA 2ONRA 1B0LA 3RLFE 5EYFA 2RF1A 3BBRA 3L6GA 4OWDA 1SBPA 4IO5A 1M5CA 3USDA 5DTBA 1DPPA 4IY5A 1A7LA 1QJMA 3TTNA 1FRPA 4G8HA 3QUFA 4JDFA 5I3SA 4O8MA 5KDTB 5I57A 2RINA 1NUXA 4GLIA 1QUKA 4WEDA 3R6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N26 A;  3H6U A;  1JW1 A;  3K2D A;  3U94 A;  1MM6 A;  5IGA A;  1B58 A;  3IJO B;  3M3F A;  1ANF A;  1I69 A;  4PQJ A;  1PEB A;  1UIV A;  1P99 A;  1Z7M E;  1ZLQ A;  3SEX A;  4R9F A;  4DCX A;  3K1M A;  1S7Y A;  1NMU A;  2NWJ A;  4R6K A;  1SW4 A;  3DP8 A;  4P1L A;  3IAZ A;  1HSJ A;  2XD2 A;  4ECF A;  4HTG A;  3FAT A;  4OFL A;  1BP5 A;  1IXI A;  2VP1 A;  1QUI A;  2DS9 A;  1B7U A;  1VSO A;  1EZP A;  5I2N A;  3KN7 A;  1LAX A;  4GRK A;  3TCF A;  5CBS A;  4RK9 A;  1GR2 A;  4WXJ A;  4X48 A;  2NVU B;  4P3L A;  5KZT A;  3T9V A;  1MPD A;  4BDL A;  2Q2A A;  1P1W A;  3KSJ A;  1J1N A;  2UVI A;  3D4C A;  3THI A;  4F2O A;  3A3U A;  3LC8 A;  2NXO A;  4XKR A;  2DWH A;  4NWC A;  2XX9 A;  3FD3 A;  1B7H A;  3O28 A;  2H99 A;  2GHA A;  3OEK A;  4OEU A;  3UK4 A;  5ICT A;  4PP0 A;  4N6K A;  5TPA A;  5CI5 A;  2D5W A;  4P0G A;  3QAX A;  3CSG A;  3PD9 A;  3CFL A;  2Y7I A;  3FVO A;  3VVD A;  4U2R A;  4FED A;  3S9E A;  3S9M C;  1PB7 A;  3PPO A;  4RA1 A;  2ZMB A;  2HFB A;  4XIG Q;  1DMB A;  4F18 A;  1LFH A;  3PPP A;  1ZU0 A;  3KSX A;  4NN3 A;  4ZEI A;  3CI8 A;  5F1Q A;  4THI A;  3RN8 A;  4R75 A;  1M5E A;  3G3G A;  3IB0 A;  1POT A;  1TFA A;  1N3W A;  4P47 A;  3MW0 A;  1XOC A;  4ELR A;  3SEW A;  3G7W A;  3S2V A;  4R9G A;  3Q27 A;  4P9K A;  2QPQ A;  1UTH B;  4MF3 A;  3FJM A;  5AA3 A;  4PGN A;  4YKP A;  1VR5 A;  1NFT A;  3E4R A;  2OWT A;  4X1D A;  4IO7 A;  4DE8 A;  1SYI A;  1LBB A;  3VLU A;  1MY1 A;  1R9L A;  3I6V A;  4PAI A;  1A99 A;  3OD7 A;  4EUO A;  1US4 A;  4MLV A;  4U23 A;  3IX1 A;  5CBR A;  2I58 A;  1T0K A;  4NF6 A;  3M3K A;  4OVJ A;  3HST A;  3TTK A;  4X8R A;  4P8B A;  3T93 B;  5JTY A;  1OLA A;  1B3F A;  3QXM A;  1IXG A;  4MNI A;  1B0H A;  2H25 A;  5I56 A;  5HM4 B;  1POY 1;  1NL5 A;  5CM6 A;  2AL4 A;  4PC9 A;  2XHD A;  3G3I A;  1N76 A;  4F3P A;  4YB7 A;  3MPL A;  3TMG A;  3OEM A;  3OO6 A;  1ZJL A;  1TT1 A;  3OO7 A;  3EHT A;  4F3G A;  2P1S A;  4KYE A;  4N13 A;  4AQ4 A;  2I4C A;  3K6X A;  3IOU A;  4G8N A;  1B3E A;  2VHA A;  4G68 A;  3Q25 A;  1EZ9 A;  4OZ9 A;  3TTL A;  3N94 A;  3CFZ A;  3OOA A;  5AA4 A;  4IO3 A;  4GQO A;  3TCG A;  3U72 A;  1JEU A;  4EQ9 A;  4OES A;  4OEV A;  1UTB B;  1MXU A;  4ZS9 A;  1Z7N E;  1PDA A;  5H8H B;  1SI0 A;  1N84 A;  4OVR A;  1Y1Z A;  1MXW A;  4RK2 A;  4BLA A;  2UYE A;  3OO9 A;  3PUV E;  4XKN A;  1ZKB A;  4FOR A;  3TOD A;  2XXR A;  4OEN A;  5KDT A;  2H9B A;  2RC8 A;  4QSE A;  4LUB A;  3MZB A;  4FEC A;  3OSQ A;  4EXL A;  1B3G A;  4R73 A;  2I6E A;  4Q8R A;  2GHB A;  4Z0I A;  2DWA A;  3UIF A;  1MRP A;  4OYV A;  2V4C A;  2DWI A;  1Y20 A;  4H5F A;  4ZZE A;  4ZEC A;  5L9S A;  4OVP A;  2PYY A;  4DI4 B;  2BJJ X;  5FTI A;  2AL5 A;  1IXC A;  5KCJ B;  2FNC A;  1MY0 A;  1JW5 A;  4ESW A;  4PDH A;  3GXA A;  3RNN A;  4N4U A;  1USY E;  4JB7 A;  4MHF A;  4X04 A;  3MVW A;  3G3H A;  3TQL A;  1FTL A;  3PUX E;  3CVG A;  3VXC A;  3IL1 B;  1JVY A;  1IUD A;  2F7A A;  1P1Q A;  3HCQ A;  4PET A;  4GL0 A;  1B4Z A;  2DVC A;  2XXY A;  3C31 A;  4KCD A;  5LOM A;  4GL8 A;  2YJP A;  2QS4 A;  2XD3 A;  1EZO A;  3MBP A;  1BLF A;  4X1B A;  3RT8 A;  1LB9 A;  3H03 A;  3B50 A;  2ZNS A;  3CSB A;  2UXA A;  4GFR A;  2HCA A;  4C1T A;  4RYA A;  3N5L A;  4BDQ A;  2F6P A;  3RQT A;  1AH5 A;  4FEB A;  4N91 A;  1P1O A;  1ZIU A;  3UN6 A;  3U8Q A;  4OFO A;  3CFX A;  3CIJ A;  3KN3 A;  4NHB A;  2GRV A;  5TU0 A;  1B51 A;  4ISU A;  2P2A A;  1B1H A;  1QW0 A;  1GV8 A;  3DP6 A;  1IIT A;  4N8Y A;  4GXS B;  2XWK A;  4LZ8 A;  2OBG A;  3H06 B;  4ZEB A;  4R6Y A;  4NQ8 A;  3MAM A;  5I58 B;  1UTH A;  3IOT A;  4KYD A;  4OET A;  4NTL A;  3IB1 A;  4I1D A;  4LP2 B;  3T96 B;  4ESX A;  3BFU A;  1LAG E;  1XHY A;  3T22 A;  2Y84 A;  3ODB A;  1YPN A;  4ZEF A;  1A8F A;  1LST A;  1FTO A;  3TTR A;  3KN8 A;  5LTC A;  1DPE A;  3RGY A;  4QFN A;  4YKK A;  4GXA A;  3FXU A;  3JV9 A;  3TEL A;  3V83 A;  5JEI A;  2HAV A;  4H8J A;  1IXH A;  4F19 A;  1VE4 A;  3LBS A;  4MCO A;  3MZ1 A;  5H8Q B;  5CMK A;  5JK4 A;  1Y3P A;  2RCA A;  1CB6 A;  4ZE8 A;  4KD5 A;  4OVT A;  4R2B A;  1H43 A;  5ISU A;  3VE1 B;  4NAP A;  3RT6 B;  2UYF A;  3O29 A;  1SDX A;  5AA1 A;  5B7D A;  2XWO A;  4TLM B;  1MXV A;  5CRY A;  5HBC A;  3B6Q A;  4XF5 A;  2X26 A;  1ZTY A;  1MDQ A;  4H1X A;  3E3K A;  1IQ7 A;  1MY4 A;  1FTM A;  5BWJ A;  1YAE A;  1XC1 A;  1B46 A;  1JNF A;  2ZYK A;  5L8D A;  2F34 A;  2UVG A;  4JSD A;  3PPN A;  2Q8J A;  2PBW A;  4AB5 A;  2IEE A;  5A5X B;  1AOV A;  1UTB A;  5H8H A;  2CZL A;  4H0W A;  2I3W A;  3QSL A;  3VVE A;  5EHS A;  4R74 A;  1N0T A;  1B32 A;  3MQ9 A;  1Y9U A;  1OMP A;  3PMW A;  2H4I A;  1M5B A;  4EQB A;  2I4B A;  3D4G A;  2E1S A;  3DM0 A;  2F7B A;  3T66 A;  1D4N A;  2R71 A;  1FQA A;  1PB8 A;  3OXN A;  3K0V A;  1H45 A;  1WDN A;  5KCJ A;  3LSF B;  1SI1 A;  3U93 A;  3FVK A;  5I7I A;  1N3X A;  5EHM A;  5H8F B;  2A5T B;  3RY3 A;  3W9V A;  4F2Q A;  3G3K A;  1H44 A;  1NKX A;  1Y4T A;  1B5J A;  3UP9 A;  2O51 A;  3DP4 A;  1FW0 A;  2R9J A;  4U1O A;  2PX1 A;  4O3A A;  4ELO A;  1B4H A;  1PBQ A;  3GZG A;  4Q5T A;  3FVG A;  1QUL A;  2RC7 A;  4ZE9 A;  3KJT A;  3CG3 A;  1JEV A;  3EN3 A;  4OFJ A;  2WX9 A;  5L9O A;  4RNS A;  4F31 B;  1LGB C;  4MEV A;  2XXW A;  3OO8 A;  2XX7 A;  3PV0 E;  1B3L A;  1MQD A;  2F6G A;  4I8C A;  4PFU A;  1XS5 A;  3TFL A;  3PPR A;  2XXP A;  2QMW A;  4DCY A;  4OVQ A;  1D3K A;  4I62 A;  4NF5 B;  3O6I A;  3LSW A;  1QUJ A;  2V3T A;  5H8N B;  1USY H;  1JVX A;  4ELQ A;  3A3C A;  4MAG A;  2XXQ A;  2Q9T A;  3N6T A;  2R6G E;  3ECR A;  1B3H A;  2XXI A;  3GBB A;  1OQH A;  2REJ A;  5TP9 B;  4KFQ A;  1Y4C A;  5FHN A;  2OJT A;  3V89 B;  4GF8 A;  4P0I A;  2CMO A;  4TOZ A;  3B6W A;  3GBA A;  4LQ5 A;  2VD2 A;  4RY1 A;  4KR5 A;  4POW A;  5AA2 B;  1A40 A;  3MVZ A;  5I58 A;  2CEY A;  1MY2 A;  1RYO A;  3K4U A;  5DYH A;  2E0S A;  3OSR A;  1OLC A;  2F78 A;  2ZZV A;  1MXX A;  3HV1 A;  4EQ7 A;  3K6W A;  3QUJ A;  1XVX A;  3K00 A;  2I48 A;  4X9T A;  4AB6 A;  2I3V A;  1JQF A;  1OVT A;  1LFG A;  5FTH A;  1DTG A;  5I57 B;  3QYT A;  3V8X B;  3ZKL A;  2DXR A;  3FZV A;  3Q29 A;  3H6W A;  2V93 A;  2QS2 A;  2F8D A;  4PAK A;  2Z23 A;  4JSO A;  3MVX A;  3R7X A;  3FVN A;  3HHG A;  3JYR A;  4BDR A;  3B6T A;  4R6H A;  5H8Q A;  4DXU A;  2VPN A;  1MQJ A;  1VFE A;  5K2X A;  2G93 A;  4MMP A;  3OEL A;  4HCY A;  2DE2 A;  4QHQ A;  3SER A;  1IIW A;  1MH3 A;  3ZSF A;  1Q35 A;  4OA4 A;  3Q28 A;  3PU5 A;  4Z7E A;  4TQU Q;  2FYI A;  3ONM A;  4HCW A;  5ICQ A;  3PUW E;  3K1N A;  3VVF A;  1LFI A;  3IOW A;  1DSN A;  4F3B A;  3UGW A;  5ELV A;  2XWV A;  1QKB A;  5H8S A;  3W9W A;  1SW2 A;  1SVX B;  3LSX A;  4YU0 A;  3K01 A;  2WYK A;  1NNK A;  4PF6 A;  2XXX A;  3KBR A;  2IA4 A;  2ZZW A;  3SKP A;  3RUM A;  2DE4 A;  4FAT A;  1B5I A;  2RC9 A;  1L5T A;  4YMA A;  5A5X A;  4ZEK A;  2F35 A;  4PFW A;  4EXK A;  1BTJ A;  4PFT A;  2DP8 A;  2QL3 A;  3VXB A;  4QFO A;  2QS1 A;  3S9L C;  3V5A A;  1MS7 A;  1N7X A;  5IZZ A;  5TPA B;  4JWX A;  2HZK A;  4PCD A;  2THI A;  1Y1M A;  4Q30 B;  4UAC A;  3R26 A;  2XWI A;  1A55 A;  1M5F A;  4U1Z A;  4UAB A;  3EHS A;  1MXZ A;  3FUZ A;  4PBQ A;  4NWD A;  4JWO A;  3I5O A;  2PVU A;  3Q26 A;  1RYX A;  1XVY A;  4XKP A;  2AYS A;  3WAE A;  1MDP 1;  3MC2 A;  4PFR A;  3TAJ A;  3U1O A;  2LAO A;  4RXL A;  4N6D A;  1LCF A;  4PBH A;  1B7Z A;  1OVB A;  5H8F A;  2QJE A;  2A5T A;  4M1V A;  3MP8 A;  2RKM A;  3G3F A;  3TDJ A;  4EF2 A;  3PD8 A;  1LAF E;  5CMB A;  3CRB A;  4F39 A;  2Y7P A;  3A09 A;  3FAS A;  3U65 A;  1HSE A;  3BKI B;  2G29 A;  1NH7 A;  3H4Z A;  1AMF A;  5DEX B;  1YCJ A;  4G8M A;  3SEU A;  3K6U A;  3O6H A;  4XTC Q;  4O3B A;  4PAF A;  2CEX A;  3CR9 A;  2D3I A;  3IR1 A;  3DEL B;  4QFP A;  2H98 A;  4DXC A;  1GVC A;  1SW1 A;  2HAU A;  3TTM A;  3LSL A;  3VFJ A;  4R2F A;  3OMB A;  1UIU A;  4G2Z A;  3WAF A;  2FA7 A;  2XXV A;  3VLV A;  4N07 A;  5JTY B;  4IY6 A;  4XFE A;  4NF5 A;  4MNP A;  4IGR A;  4OMB A;  5H8N A;  4RPN A;  4DI3 D;  1XT8 A;  4C1U A;  5I5P A;  2NUV A;  3KG2 A;  3FXB A;  4H6D A;  1TWY A;  1B1X A;  2O6A A;  2OLB A;  3K6V A;  1GTK A;  2B3B A;  5TP9 A;  3PMX A;  4YZZ A;  3GLB A;  3MZ9 A;  3O9P A;  1D9Y A;  2XA5 A;  1FQE A;  3KOS A;  4NF4 B;  1HSL A;  3H7M A;  3LR1 A;  2O68 A;  3C33 A;  1Y3Q A;  4JWY A;  5AA2 A;  5AA4 B;  3IOV A;  1A54 A;  2ZZX A;  3P7I A;  2PT1 A;  2ESN A;  4LZ7 A;  2XXU A;  3T9X B;  2OZZ A;  3QIM A;  4PE5 B;  5CMM A;  2Q2C A;  1MY3 A;  1Y3N A;  4F3S A;  2O84 X;  3PUY E;  3RTW B;  4DLD A;  1R6Z A;  4BDO A;  4G68 C;  5L9M A;  5M2V A;  1S50 A;  2ALU A;  1TXF A;  2O69 A;  1O7T A;  1PC3 A;  2VGQ A;  4HS7 A;  3MP6 A;  3HO7 A;  1NH8 A;  1OIB A;  2GFE A;  3C32 A;  2HXW A;  2ZYO A;  4XKQ A;  2GH9 A;  4QFK A;  4TLL B;  4P1E A;  4NED A;  4MFI A;  5FHO A;  1TFD A;  2Z8F A;  2O1L A;  1NNT A;  1PBP A;  4PGP A;  3CG1 A;  3UA8 A;  1D9V A;  4IO6 A;  2H5Y A;  1B52 A;  1SQY A;  3ILU B;  1II5 A;  3SEV A;  2DXY A;  3IJX B;  5CC2 A;  1FQF A;  1MPC A;  4E0X A;  4YIC A;  4IO4 A;  2ZYM A;  3MJN A;  5ITP A;  4LAT A;  4QSC A;  1FQB A;  1LBC A;  4YB5 A;  4N15 A;  5F7V A;  3PGF A;  3TQW A;  1AIV A;  4ONY A;  4P56 A;  4H67 A;  2QRY A;  4EF1 A;  4F1V A;  2PT2 A;  5B70 A;  4YMB A;  2REG A;  4MBP A;  2I49 A;  4QSD A;  4RJZ A;  2B65 A;  1SD3 A;  4L17 A;  3HHF A;  1PB9 A;  1YTV A;  4O94 A;  3MVY A;  1SW5 A;  4F29 A;  1ZMG A;  2XXH A;  2VPO A;  4FE8 A;  2PMS A;  1BKA A;  1ZBM A;  3O2A A;  3ILT B;  3SEY A;  3PMV A;  4U4X A;  4BDN A;  4OER A;  2DWJ A;  4DXB A;  3TKD A;  2W7Y A;  3IK6 B;  4NGU A;  3FXR A;  1MQI A;  1H3D A;  1NNP A;  1O63 A;  2KLF A;  3G3J A;  3FXQ A;  3UOR A;  3N6U A;  2O7I A;  4H65 A;  2QMX A;  5DVJ A;  1EU8 A;  4LA9 A;  1JET A;  5I59 B;  4I9D A;  4C0R A;  4LON B;  1QVS A;  3T9H B;  3M8U A;  4FAJ A;  4PFI A;  4NF8 B;  3IO6 A;  2DVZ A;  4MLQ A;  4XXU A;  2WKY A;  1LCT A;  3E9X A;  3RPW A;  1AL3 A;  4QF9 A;  4ZED A;  2DE3 A;  1MQG A;  3LUY A;  3BFT A;  3TEP A;  1B5H A;  5DEX A;  3EPE A;  4PE3 A;  4YB6 A;  4DDD A;  3C9H A;  2PFY A;  4XEQ A;  5I2K B;  3T9U A;  4K3F A;  1B40 A;  1O64 A;  2F36 A;  1I6Q A;  4BDM A;  1B2H A;  2XXK A;  1B05 A;  2ZNU A;  1UQW A;  1A8E A;  3KFM A;  3O97 A;  4GIZ A;  4LQ2 A;  4O7M A;  1MXY A;  1ELJ A;  3MPK A;  1ATG A;  1F9B A;  2HPG A;  2B3F A;  4JXI A;  3IB2 A;  4OTE A;  4F1U A;  3TUS A;  5AA2 D;  4G4P A;  1US5 A;  1MQH A;  2HZL A;  3F11 A;  4MX6 A;  3FV1 A;  3K02 A;  3K1P A;  2Z8D A;  3S9N C;  2Q89 A;  4QFL A;  3TZA A;  4POX A;  4HW8 A;  4OHN A;  1KWH A;  1P1U A;  4U4S A;  2UVJ A;  2RCB A;  2V25 A;  4O3C A;  1QKA A;  2HEU A;  5I84 A;  4LZ5 A;  3SES A;  2V84 A;  4NF4 A;  4IO2 A;  3EQ1 A;  3GYY A;  3L6H A;  2OK2 A;  2DQV A;  1S9T A;  4NF0 A;  1GGG A;  2QSX A;  2DSF A;  3PPQ A;  4GD5 A;  3SET A;  5IKB A;  2V3U A;  2A5S A;  3W15 C;  1LB8 A;  4LN5 A;  3AXF A;  3C4M A;  2P0S A;  3KEI A;  1MM7 A;  2AIX A;  2ZYN A;  5I2N B;  4ZDM A;  4OAN A;  4IGT A;  1LLS A;  1H76 A;  1N7W A;  1BIY A;  2Q88 A;  3MUQ A;  3RTF B;  2QS3 A;  4KQP A;  2OWS A;  2VOZ A;  2X7P A;  4Q0C A;  3FIR A;  1JW4 A;  1Q1K A;  4PF8 A;  4RPO A;  4YAH X;  3KGC A;  1WVJ A;  5CMC A;  3O6G A;  4QRZ A;  3ZKK A;  1MG1 A;  2ZNT A;  3MP1 A;  1B9J A;  4ND9 A;  4JBZ A;  2XX8 A;  4KCC A;  2O1M A;  3C36 A;  1LAH E;  1URS A;  1FQC A;  1FCK A;  1IZ1 A;  2F7C A;  4FJP A;  1MPB A;  2ZXT A;  4MNC A;  2Y7W A;  4IB2 A;  2I0C A;  3FJ7 A;  1IEJ A;  4GOT A;  3PUZ E;  2UVH A;  3VV5 A;  4F1Y A;  1N04 A;  2ONS A;  2O7U A;  2HQ0 A;  3M3L A;  2Z22 A;  2VD3 A;  4M4G A;  4F22 A;  4UA8 A;  4ELP A;  3FJG A;  1R1N A;  4H8I A;  1R9Q A;  1P1N A;  4U22 A;  4GVO A;  2I0B A;  3JZJ A;  3OEN A;  4KHZ E;  2F97 A;  4N17 A;  3IO4 A;  4U21 A;  2ABH A;  4WEP A;  5J1D A;  3TYH A;  3ZS6 A;  4PFY A;  2F5X A;  2V3Q A;  1DOT A;  3VDF A;  3HN0 A;  3B7D A;  3S4U A;  5AE4 A;  3O66 A;  4OXV A;  3E13 X;  2ANJ A;  3U92 A;  3KJ7 A;  4MH5 A;  2PFZ A;  4FIM A;  4ZZA A;  1CE2 A;  2NOO A;  2WYP A;  4LVQ A;  4DZ1 A;  4NG7 A;  5IM2 A;  3MWB A;  4WKM A;  1M5D A;  1URG A;  3HPI A;  3EF7 A;  1EH3 A;  5BUU A;  4KI0 E;  3C34 A;  5DVF A;  4EDP A;  4P11 A;  3IOR A;  4YKI A;  5HPQ A;  4N8G A;  1WOD A;  4NF6 B;  5I59 A;  4OVS A;  4NX1 A;  3FV2 A;  3VLW A;  1SYH A;  3KOT A;  5K2Y A;  3QK6 A;  4PFB A;  4NF8 A;  1B6H A;  1RKM A;  4E0W A;  3SDF A;  5I56 B;  1DTZ A;  3H6T A;  2OCU A;  3FGS A;  3I3V A;  5DVI A;  3TCH A;  1VFD A;  4NE4 A;  1I6B A;  4MIJ A;  2M8C A;  1NNF A;  2Y7K A;  2D21 A;  2Y7R A;  2XXT A;  5FHM A;  3KZG A;  2DOJ A;  1FQD A;  5I2K A;  3C35 A;  1FTJ A;  2DYX A;  1FTK A;  4GWO A;  4G68 B;  4DIG A;  2YPN A;  3DLN A;  4R72 A;  2ONK E;  5IAI A;  4YKJ A;  1OQG A;  4G77 A;  3H6V A;  4KPT A;  3TPA A;  1I6A A;  2X7Q A;  4OQO A;  3EHU A;  1MH4 A;  4N6P A;  5DT6 A;  4PDD A;  5ITO A;  4H5G A;  4NMY A;  3H3G A;  2Z8E A;  2YLN A;  4KYS A;  1URD A;  2ONR A;  1B0L A;  3RLF E;  5EYF A;  2RF1 A;  3BBR A;  3L6G A;  4OWD A;  1SBP A;  4IO5 A;  1M5C A;  3USD A;  5DTB A;  1DPP A;  4IY5 A;  1A7L A;  1QJM A;  3TTN A;  4G8H A;  3QUF A;  4JDF A;  4O8M A;  5KDT B;  5I57 A;  2RIN A;  4GLI A;  1QUK A;  4WED A;  3R6U A; 
#chains in the Genus database with same CATH topology
 3N26 A;  3H6U A;  1JW1 A;  3K2D A;  3U94 A;  1MM6 A;  5IGA A;  1B58 A;  3IJO B;  1INP A;  3M3F A;  1ANF A;  1JP4 A;  1I69 A;  4PQJ A;  1PEB A;  1UIV A;  1P99 A;  3IFC A;  1Z7M E;  1ZLQ A;  3SEX A;  4R9F A;  4DCX A;  3K1M A;  1S7Y A;  1NMU A;  2NWJ A;  4R6K A;  1SW4 A;  3DP8 A;  4P1L A;  3IAZ A;  1HSJ A;  1LEV A;  2XD2 A;  4ECF A;  4HTG A;  3FAT A;  4OFL A;  1BP5 A;  1IXI A;  2VP1 A;  1QUI A;  1KZ8 A;  2DS9 A;  1B7U A;  1VSO A;  3SZP A;  1EZP A;  5I2N A;  1AWB A;  3KN7 A;  1LAX A;  4GRK A;  3TCF A;  5CBS A;  1IME A;  4RK9 A;  1GR2 A;  4WXJ A;  4X48 A;  2NVU B;  4P3L A;  5KZT A;  3T9V A;  1MPD A;  4BDL A;  2Q2A A;  1P1W A;  3KSJ A;  1J1N A;  2UVI A;  3D4C A;  3BIG A;  3THI A;  4F2O A;  3A3U A;  3LC8 A;  2NXO A;  4XKR A;  2DWH A;  4NWC A;  1FPJ A;  2XX9 A;  3FD3 A;  1B7H A;  3O28 A;  2H99 A;  2GHA A;  5IZ3 B;  3OEK A;  4OEU A;  1KA1 A;  3UK4 A;  5ICT A;  4N6K A;  4PP0 A;  5TPA A;  5CI5 A;  2D5W A;  4P0G A;  3QAX A;  3CSG A;  3PD9 A;  3CFL A;  2Y7I A;  3FVO A;  3VVD A;  4U2R A;  4FED A;  3S9E A;  3S9M C;  1PB7 A;  3PPO A;  1LBW A;  4RA1 A;  2ZMB A;  2HFB A;  4XIG Q;  1DMB A;  4F18 A;  1LFH A;  3PPP A;  1ZU0 A;  3KSX A;  4NN3 A;  4ZEI A;  3CI8 A;  5F1Q A;  4THI A;  3RN8 A;  4R75 A;  1M5E A;  3G3G A;  1EYI A;  3IB0 A;  1POT A;  1TFA A;  1N3W A;  4P47 A;  3MW0 A;  1XOC A;  4ELR A;  3SEW A;  3G7W A;  3S2V A;  4R9G A;  3Q27 A;  4P9K A;  2QPQ A;  1UTH B;  4JVC A;  4MF3 A;  3FJM A;  5AA3 A;  2QVR A;  2MKZ A;  4PGN A;  4YKP A;  1VR5 A;  1FBC A;  1NFT A;  3E4R A;  1YXI A;  2OWT A;  5ET7 A;  4X1D A;  4IO7 A;  4DE8 A;  1SYI A;  1LBB A;  3VLU A;  1MY1 A;  1R9L A;  3I6V A;  4PAI A;  1A99 A;  3OD7 A;  4EUO A;  1Q9D A;  2F3B A;  1US4 A;  4MLV A;  4U23 A;  3IX1 A;  5CBR A;  2I58 A;  1T0K A;  2WEF A;  2QVV A;  4NF6 A;  3M3K A;  4OVJ A;  3HST A;  3TTK A;  4X8R A;  4P8B A;  3T93 B;  5DW8 A;  5JTY A;  1OLA A;  1IMD A;  1B3F A;  3QXM A;  1IXG A;  4MNI A;  1B0H A;  2H25 A;  5I56 A;  5HM4 B;  1POY 1;  1NL5 A;  5CM6 A;  2AL4 A;  4PC9 A;  2XHD A;  4JVI A;  3G3I A;  1N76 A;  4F3P A;  4YB7 A;  3MPL A;  3TMG A;  3OEM A;  3OO6 A;  1ZJL A;  1TT1 A;  3OO7 A;  1LBZ A;  3EHT A;  4F3G A;  2P1S A;  5ET5 A;  4KYE A;  2CZH A;  4N13 A;  4AQ4 A;  2I4C A;  3K6X A;  3IOU A;  4G8N A;  1B3E A;  2VHA A;  4G68 A;  3Q25 A;  1EZ9 A;  4OZ9 A;  3TTL A;  3N94 A;  3CFZ A;  3OOA A;  5AA4 A;  4I40 A;  4IO3 A;  4GQO A;  3TCG A;  3U72 A;  1JEU A;  4EQ9 A;  1G0I A;  4OES A;  4OEV A;  1UTB B;  1MXU A;  2GQ1 A;  4ZS9 A;  1Z7N E;  1PDA A;  5H8H B;  1SI0 A;  1N84 A;  4OVR A;  1Y1Z A;  1MXW A;  4RK2 A;  4BLA A;  1K9Y A;  2R8T A;  2UYE A;  3OO9 A;  3PUV E;  4XKN A;  4IR8 A;  1ZKB A;  4FOR A;  3TOD A;  2XXR A;  4OEN A;  1KA0 A;  1FBD A;  5KDT A;  2H9B A;  4HE2 A;  2RC8 A;  4QSE A;  4LUB A;  3MZB A;  4FEC A;  3OSQ A;  4EXL A;  1B3G A;  4R73 A;  2I6E A;  3E78 A;  4Q8R A;  2GHB A;  4Z0I A;  2DWA A;  3UIF A;  4FBP A;  1MRP A;  2KQZ A;  4OYV A;  2V4C A;  2DWI A;  1Y20 A;  4H5F A;  4ZZE A;  4ZEC A;  5L9S A;  4OVP A;  2PYY A;  4DI4 B;  2BJJ X;  5FTI A;  3RYD A;  2AL5 A;  5EQA A;  1IXC A;  5KCJ B;  2FNC A;  1NV0 A;  1MY0 A;  1JW5 A;  4ESW A;  4PDH A;  3GXA A;  3RNN A;  4N4U A;  1USY E;  1NV2 A;  4JB7 A;  4QBA A;  4MHF A;  4X04 A;  3MVW A;  3G3H A;  2L5V A;  3TQL A;  1FTL A;  3PUX E;  3CVG A;  3VXC A;  3IL1 B;  2P3N A;  1JVY A;  4MJO A;  1IUD A;  2F7A A;  1P1Q A;  3HCQ A;  4PET A;  4GL0 A;  1B4Z A;  2DVC A;  2XXY A;  3C31 A;  4KCD A;  5LOM A;  4GL8 A;  2YJP A;  2QS4 A;  2XD3 A;  1EZO A;  3MBP A;  1BLF A;  4X1B A;  3RT8 A;  1LB9 A;  3H03 A;  3B50 A;  2ZNS A;  1EYJ A;  3CHG A;  3CSB A;  2UXA A;  5IZ3 A;  4GFR A;  2HCA A;  3LV0 A;  4C1T A;  2QFL A;  4RYA A;  3N5L A;  4BDQ A;  2HXR A;  3D1R A;  2F6P A;  3RQT A;  1FBG A;  1AH5 A;  2Y5K A;  4FEB A;  4N91 A;  1P1O A;  1ZIU A;  3UN6 A;  3U8Q A;  4OFO A;  3CFX A;  3CIJ A;  3KN3 A;  4NHB A;  2GRV A;  1LBY A;  5TU0 A;  1B51 A;  4ISU A;  2P2A A;  1B1H A;  1QW0 A;  1GV8 A;  3DP6 A;  1IIT A;  4N8Y A;  4GXS B;  2XWK A;  4LZ8 A;  1LBX A;  1NV5 A;  2OBG A;  3H06 B;  4ZEB A;  4R6Y A;  4NQ8 A;  3MAM A;  5I58 B;  1UTH A;  3IOT A;  1DCU A;  4KYD A;  4OET A;  4NTL A;  3IB1 A;  4I1D A;  4LP2 B;  5ESY A;  3IFA A;  3T96 B;  4ESX A;  3BFU A;  1LAG E;  1XHY A;  3T22 A;  2Y84 A;  3ODB A;  2Q74 A;  1YPN A;  1NUZ A;  4ZEF A;  1FSA A;  1A8F A;  1LST A;  1FTO A;  3TTR A;  3KN8 A;  5LTC A;  1DPE A;  3RGY A;  4QFN A;  4YKK A;  4GXA A;  3FXU A;  3JV9 A;  3TEL A;  3V83 A;  5JEI A;  2HAV A;  4H8J A;  1IXH A;  4F19 A;  2CZI A;  4HXV A;  1VE4 A;  3LBS A;  4MCO A;  3MZ1 A;  5H8Q B;  5CMK A;  5JK4 A;  1Y3P A;  2RCA A;  1CB6 A;  4ZE8 A;  4KD5 A;  4OVT A;  4R2B A;  1H43 A;  5ISU A;  3VE1 B;  4NAP A;  3RT6 B;  2UYF A;  3O29 A;  1XI6 A;  1SDX A;  5AA1 A;  2XWO A;  5B7D A;  4TLM B;  1MXV A;  5CRY A;  5HBC A;  3B6Q A;  4XF5 A;  2X26 A;  1ZTY A;  1MDQ A;  4H1X A;  3E3K A;  1IQ7 A;  1MY4 A;  1FTM A;  5BWJ A;  3KC0 A;  1YAE A;  1XC1 A;  4I3E A;  3B8B A;  1B46 A;  1JNF A;  2Q8M A;  2ZYK A;  5L8D A;  2F34 A;  2QVU A;  2UVG A;  4JSD A;  3PPN A;  2Q8J A;  2PBW A;  4GWS A;  4AB5 A;  2IEE A;  5A5X B;  1AOV A;  1UTB A;  4GWU A;  5H8H A;  2CZL A;  4H0W A;  2I3W A;  3QSL A;  3VVE A;  5EHS A;  4R74 A;  1N0T A;  1B32 A;  3MQ9 A;  1Y9U A;  1OMP A;  3PMW A;  4GBW A;  2H4I A;  1M5B A;  4EQB A;  2I4B A;  3D4G A;  2E1S A;  2OX3 A;  3DM0 A;  2F7B A;  1FPI A;  5J16 A;  3T66 A;  1D4N A;  1BK4 A;  2FHY A;  1NV7 A;  1FQA A;  1PB8 A;  2R71 A;  3OXN A;  3K0V A;  1H45 A;  5T3J A;  1WDN A;  5KCJ A;  3LSF B;  1SI1 A;  3U93 A;  3FVK A;  5I7I A;  1N3X A;  5EHM A;  5H8F B;  2A5T B;  3RY3 A;  3W9V A;  4F2Q A;  3G3K A;  4GWW A;  1H44 A;  1NKX A;  1Y4T A;  3QMF A;  1B5J A;  3UP9 A;  2O51 A;  3DP4 A;  1FW0 A;  2R9J A;  4U1O A;  2PX1 A;  4O3A A;  4ELO A;  4H45 A;  1B4H A;  1PBQ A;  3GZG A;  4Q5T A;  3FVG A;  1QUL A;  2RC7 A;  4ZE9 A;  3KJT A;  3CG3 A;  1JEV A;  3EN3 A;  2WX9 A;  4OFJ A;  5L9O A;  4RNS A;  4F31 B;  1LGB C;  4MEV A;  1NUY A;  2XXW A;  3OO8 A;  1NV6 A;  2XX7 A;  3PV0 E;  1B3L A;  1MQD A;  2F6G A;  4I8C A;  4PFU A;  1XS5 A;  3TFL A;  1QGX A;  1FBE A;  3PPR A;  2XXP A;  2QMW A;  4DCY A;  4OVQ A;  3RPL A;  1D3K A;  4I62 A;  4NF5 B;  3O6I A;  3LSW A;  1QUJ A;  2V3T A;  5H8N B;  1USY H;  1YYZ A;  1JVX A;  5LDZ A;  4ELQ A;  3A3C A;  4MAG A;  2XXQ A;  4GX3 A;  2Q9T A;  3N6T A;  2R6G E;  3ECR A;  1B3H A;  2XXI A;  3GBB A;  1OQH A;  2REJ A;  5TP9 B;  4KFQ A;  1Y4C A;  4QXD A;  5FHN A;  2OJT A;  5ET6 A;  3V89 B;  4GF8 A;  4P0I A;  2CMO A;  4TOZ A;  3ROJ A;  3B6W A;  3GBA A;  4LQ5 A;  2VD2 A;  4RY1 A;  4KR5 A;  2F3D A;  4POW A;  2DDK A;  5AA2 B;  1A40 A;  3MVZ A;  5I58 A;  2CEY A;  1MY2 A;  1RYO A;  3K4U A;  5DYH A;  2E0S A;  3OSR A;  1OLC A;  2F78 A;  4O7I A;  2ZZV A;  4GWX A;  1MXX A;  3HV1 A;  4EQ7 A;  3K6W A;  3QUJ A;  1XVX A;  3K00 A;  4AS5 A;  2I48 A;  4HE0 A;  4GBV A;  4X9T A;  3EKI A;  1FTA A;  4AB6 A;  2I3V A;  1JQF A;  1OVT A;  1LFG A;  5FTH A;  1DTG A;  5I57 B;  3QYT A;  3V8X B;  3ZKL A;  2DXR A;  3FZV A;  3Q29 A;  3H6W A;  2V93 A;  2QS2 A;  2F8D A;  4PAK A;  1EYK A;  2Z23 A;  1NV4 A;  5EQ8 A;  4PTK A;  4JSO A;  3MVX A;  3R7X A;  3FVN A;  3HHG A;  3JYR A;  4BDR A;  4KXP A;  3B6T A;  2BJI A;  4R6H A;  5H8Q A;  2VPN A;  4DXU A;  1MQJ A;  1VFE A;  1FPB A;  5K2X A;  2G93 A;  4MMP A;  3OEL A;  4HCY A;  2DE2 A;  4QHQ A;  3SER A;  1IIW A;  1MH3 A;  3ZSF A;  2PCR A;  1Q35 A;  4OA4 A;  3Q28 A;  3PU5 A;  4Z7E A;  4GX6 A;  4TQU Q;  2FYI A;  3ONM A;  4HCW A;  5ICQ A;  3PUW E;  3K1N A;  3VVF A;  1LFI A;  3IOW A;  1DSN A;  4F3B A;  3UGW A;  1FPL A;  5ELV A;  2XWV A;  1QKB A;  5H8S A;  3W9W A;  1SW2 A;  1SVX B;  3LSX A;  4YU0 A;  3K01 A;  2WYK A;  1NNK A;  4PF6 A;  2XXX A;  1LBV A;  2IA4 A;  2ZZW A;  3KBR A;  3SKP A;  3RUM A;  2DE4 A;  4FAT A;  1B5I A;  2RC9 A;  1L5T A;  4YMA A;  5A5X A;  4ZEK A;  2F35 A;  4PFW A;  4EXK A;  1BTJ A;  2FIX A;  4PFT A;  2DP8 A;  2QL3 A;  3VXB A;  4QFO A;  2QS1 A;  3S9L C;  3V5A A;  3KC1 A;  1MS7 A;  3KBZ A;  1N7X A;  4H46 A;  5IZZ A;  5TPA B;  4JWX A;  2HZK A;  4PCD A;  2THI A;  3FBP A;  1Y1M A;  4Q30 B;  4UAC A;  3R26 A;  2XWI A;  1A55 A;  1YZ0 A;  1M5F A;  3BIH A;  4U1Z A;  1NV3 A;  4UAB A;  3EHS A;  1FBP A;  1MXZ A;  3FUZ A;  4PBQ A;  4NWD A;  4JWO A;  3I5O A;  2PVU A;  3Q26 A;  1RYX A;  1XVY A;  4XKP A;  2AYS A;  3WAE A;  1MDP 1;  3MC2 A;  4PFR A;  3TAJ A;  3U1O A;  2LAO A;  4N6D A;  4RXL A;  1LCF A;  4PBH A;  1B7Z A;  1OVB A;  5H8F A;  2QJE A;  2A5T A;  4M1V A;  3MP8 A;  2RKM A;  3G3F A;  3TDJ A;  4EF2 A;  3PD8 A;  1LAF E;  5CMB A;  3CRB A;  4F39 A;  2Y7P A;  3A09 A;  3FAS A;  3U65 A;  1HSE A;  3BKI B;  2G29 A;  1NH7 A;  3H4Z A;  1AMF A;  5DEX B;  1YCJ A;  4G8M A;  3SEU A;  3K6U A;  3O6H A;  4XTC Q;  3HFU A;  4O3B A;  4PAF A;  2CEX A;  4GX4 A;  3CR9 A;  2D3I A;  3IR1 A;  3DEL B;  3A29 A;  4QFP A;  2H98 A;  2FBP A;  4DXC A;  1GVC A;  1SW1 A;  2HAU A;  1CNQ A;  3TTM A;  3LSL A;  3VFJ A;  4R2F A;  3OMB A;  1UIU A;  4G2Z A;  2OWZ A;  3WAF A;  2FA7 A;  2XXV A;  3VLV A;  4N07 A;  4XFE A;  4IY6 A;  5JTY B;  1IMB A;  4NF5 A;  2KR0 A;  4MNP A;  4IGR A;  4OMB A;  5H8N A;  1NV1 A;  4RPN A;  4DI3 D;  1XT8 A;  4C1U A;  5I5P A;  2NUV A;  3KG2 A;  3FXB A;  4H6D A;  1TWY A;  5EQ7 A;  1B1X A;  2O6A A;  2OLB A;  3ISP A;  3K6V A;  1GTK A;  2B3B A;  5TP9 A;  3PMX A;  4YZZ A;  3GLB A;  3MZ9 A;  3O9P A;  1D9Y A;  2XA5 A;  1FQE A;  3KOS A;  4NF4 B;  1HSL A;  3H7M A;  3LR1 A;  2O68 A;  3C33 A;  1Y3Q A;  4JWY A;  2VT5 A;  5AA2 A;  5AA4 B;  3IOV A;  1A54 A;  2ZZX A;  3P7I A;  2PT1 A;  2ESN A;  4LZ7 A;  2XXU A;  3T9X B;  1FBF A;  2OZZ A;  3QIM A;  4PE5 B;  5CMM A;  2Q2C A;  1MY3 A;  1Y3N A;  4F3S A;  2O84 X;  1FJ6 A;  3PUY E;  3RTW B;  4DLD A;  4HE1 A;  1R6Z A;  4BDO A;  1VDW A;  1DK4 A;  4G68 C;  5L9M A;  5M2V A;  1S50 A;  2ALU A;  1TXF A;  2O69 A;  1FPG A;  1O7T A;  1PC3 A;  2VGQ A;  4HS7 A;  3MP6 A;  3HO7 A;  1NI9 A;  1NH8 A;  1OIB A;  2GFE A;  3C32 A;  2HXW A;  2ZYO A;  4XKQ A;  2GH9 A;  4GWY A;  4QFK A;  4AS4 A;  4TLL B;  4P1E A;  4NED A;  4MFI A;  5FHO A;  1TFD A;  2Z8F A;  2O1L A;  1NNT A;  4I3Y A;  1PBP A;  1FBH A;  4PGP A;  3CG1 A;  3MYU A;  3UA8 A;  1D9V A;  4IO6 A;  2H5Y A;  1B52 A;  1SQY A;  3ILU B;  1II5 A;  3SEV A;  2DXY A;  3IJX B;  5CC2 A;  1FQF A;  2Y5L A;  1MPC A;  4E0X A;  4YIC A;  1DBZ A;  4IO4 A;  2ZYM A;  3MJN A;  5ITP A;  4LAT A;  4QSC A;  1FQB A;  1LBC A;  4YB5 A;  3LUZ A;  4N15 A;  5F7V A;  3PGF A;  1RDY A;  3TQW A;  1AIV A;  4ONY A;  4P56 A;  4H67 A;  2JJK A;  2QRY A;  1IMC A;  4EF1 A;  4F1V A;  2PT2 A;  5B70 A;  4YMB A;  2REG A;  4MBP A;  2I49 A;  4QSD A;  4RJZ A;  2B65 A;  1SD3 A;  4L17 A;  3HHF A;  1PB9 A;  1YTV A;  4O94 A;  3MVY A;  1SW5 A;  4F29 A;  1ZMG A;  2XXH A;  2VPO A;  1FPE A;  4FE8 A;  2PMS A;  1BKA A;  1ZBM A;  2CZK A;  3O2A A;  3ILT B;  3SEY A;  3PMV A;  2HHM A;  4U4X A;  4BDN A;  4OER A;  2DWJ A;  4DXB A;  2W7Y A;  3IK6 B;  4NGU A;  3TKD A;  3FXR A;  1MQI A;  1D9Q A;  1H3D A;  1NNP A;  1O63 A;  2KLF A;  3G3J A;  3FXQ A;  3UOR A;  3N6U A;  2O7I A;  4H65 A;  2QMX A;  5DVJ A;  1EU8 A;  4LA9 A;  1JET A;  5I59 B;  4I9D A;  3MST A;  4C0R A;  4LON B;  5EQ9 A;  1QVS A;  3T9H B;  3M8U A;  4PFI A;  4FAJ A;  4NF8 B;  3IO6 A;  2B4L A;  2DVZ A;  4MLQ A;  4XXU A;  2WKY A;  1LCT A;  5EYH A;  3E9X A;  3RPW A;  1AL3 A;  4QF9 A;  4ZED A;  2DE3 A;  1MQG A;  3LUY A;  3E79 A;  3BFT A;  3TEP A;  1B5H A;  5DEX A;  3EPE A;  4PE3 A;  4YB6 A;  4DDD A;  3C9H A;  2PFY A;  4XEQ A;  1RDZ A;  5I2K B;  3T9U A;  4K3F A;  5F24 A;  4G61 A;  1B40 A;  1O64 A;  2F36 A;  1I6Q A;  4BDM A;  1B2H A;  2XXK A;  1B05 A;  2ZNU A;  1UQW A;  1A8E A;  3KFM A;  3O97 A;  4GIZ A;  4LQ2 A;  4GWZ A;  4O7M A;  1MXY A;  1ELJ A;  3MPK A;  1ATG A;  1RDX A;  1F9B A;  2HPG A;  2B3F A;  4JXI A;  3IB2 A;  4OTE A;  4F1U A;  3TUS A;  3T1B A;  5AA2 D;  4G4P A;  1US5 A;  1MQH A;  2HZL A;  3F11 A;  4MX6 A;  3FV1 A;  3K02 A;  3K1P A;  2Z8D A;  3S9N C;  2Q89 A;  4QFL A;  3TZA A;  4POX A;  4HW8 A;  4OHN A;  1KWH A;  1P1U A;  4U4S A;  2UVJ A;  2RCB A;  2V25 A;  4O3C A;  1QKA A;  2HEU A;  5I84 A;  4LZ5 A;  5EYG A;  3SES A;  2V84 A;  4NF4 A;  4IO2 A;  3EQ1 A;  3GYY A;  3L6H A;  2OK2 A;  2DQV A;  1S9T A;  2FIE A;  4NF0 A;  1GGG A;  2QSX A;  3PTY A;  2DSF A;  3PPQ A;  4GD5 A;  3SET A;  2B4M A;  1SPI A;  5IKB A;  1NUW A;  2V3U A;  1IMA A;  2A5S A;  3W15 C;  2WBD A;  1LB8 A;  4LN5 A;  3AXF A;  3C4M A;  2P0S A;  3KEI A;  1MM7 A;  2AIX A;  2ZYN A;  5I2N B;  4OAN A;  4ZDM A;  4IGT A;  1LLS A;  1H76 A;  1N7W A;  1BIY A;  2Q88 A;  3MUQ A;  3RTF B;  2QS3 A;  4KQP A;  2OWS A;  2VOZ A;  2X7P A;  4Q0C A;  3FIR A;  1JW4 A;  1Q1K A;  4PF8 A;  4RPO A;  4YAH X;  3KGC A;  1WVJ A;  1FPD A;  5CMC A;  3O6G A;  4QRZ A;  3ZKK A;  1MG1 A;  2ZNT A;  3MP1 A;  1B9J A;  4ND9 A;  4JBZ A;  2XX8 A;  1FJ9 A;  4KCC A;  2O1M A;  3C36 A;  1LAH E;  1URS A;  1FQC A;  1FCK A;  1IZ1 A;  2F7C A;  4FJP A;  1FPK A;  1MPB A;  2ZXT A;  4MNC A;  2Y7W A;  4IB2 A;  2I0C A;  3FJ7 A;  1IEJ A;  5IZ1 A;  4GOT A;  3PUZ E;  2UVH A;  3VV5 A;  4F1Y A;  1N04 A;  2ONS A;  1FPF A;  2O7U A;  2HQ0 A;  3M3L A;  2Z22 A;  2VD3 A;  4M4G A;  4F22 A;  4UA8 A;  4ELP A;  3FJG A;  1R1N A;  4H8I A;  1R9Q A;  1P1N A;  4U22 A;  4GVO A;  2I0B A;  3JZJ A;  3OEN A;  4KHZ E;  2F97 A;  4N17 A;  3IO4 A;  4U21 A;  2ABH A;  4WEP A;  5J1D A;  3TYH A;  4PFY A;  3ZS6 A;  5A5L A;  2F5X A;  2V3Q A;  1DOT A;  3VDF A;  3HN0 A;  3B7D A;  3S4U A;  5AE4 A;  3O66 A;  4OXV A;  3E13 X;  3RPL B;  2ANJ A;  3U92 A;  3KJ7 A;  4MH5 A;  2PFZ A;  4FIM A;  4ZZA A;  1CE2 A;  2NOO A;  2WYP A;  4LVQ A;  4DZ1 A;  4NG7 A;  5IM2 A;  3MWB A;  4WKM A;  1M5D A;  1URG A;  3HPI A;  3EF7 A;  5FBP A;  1EH3 A;  5BUU A;  4KI0 E;  3C34 A;  5DVF A;  4EDP A;  4P11 A;  3IOR A;  4YKI A;  5HPQ A;  4N8G A;  1WOD A;  2FVZ A;  4NF6 B;  5I59 A;  4OVS A;  4NX1 A;  3FV2 A;  3VLW A;  1IMF A;  1SYH A;  3KOT A;  5K2Y A;  4JVD A;  5ET8 A;  3QK6 A;  4PFB A;  4NF8 A;  1B6H A;  1RKM A;  4E0W A;  3SDF A;  5I56 B;  1DTZ A;  3H6T A;  2OCU A;  3FGS A;  3I3V A;  5DVI A;  3TCH A;  1VFD A;  4NE4 A;  1I6B A;  2WBB A;  4MIJ A;  1K9Z A;  2M8C A;  1NNF A;  2Y7K A;  2D21 A;  2Y7R A;  2XXT A;  5FHM A;  3KZG A;  2DOJ A;  3NOH A;  1FQD A;  5I2K A;  3C35 A;  1FTJ A;  2DYX A;  1FTK A;  4GWO A;  4G68 B;  4DIG A;  2YPN A;  3DLN A;  4R72 A;  4N81 A;  2ONK E;  5IAI A;  3T0J A;  4YKJ A;  1OQG A;  4G77 A;  3H6V A;  4KPT A;  3TPA A;  1I6A A;  2X7Q A;  4OQO A;  3EHU A;  1MH4 A;  4N6P A;  5DT6 A;  4PDD A;  2P3V A;  5ITO A;  4H5G A;  4NMY A;  3H3G A;  2Z8E A;  2YLN A;  1G0H A;  4KYS A;  1URD A;  2ONR A;  1B0L A;  3RLF E;  5EYF A;  2RF1 A;  3BBR A;  3L6G A;  4OWD A;  1SBP A;  4IO5 A;  1M5C A;  3USD A;  5DTB A;  1DPP A;  4IY5 A;  1A7L A;  1QJM A;  3TTN A;  1FRP A;  4G8H A;  3QUF A;  4JDF A;  5I3S A;  4O8M A;  5KDT B;  5I57 A;  2RIN A;  1NUX A;  4GLI A;  1QUK A;  4WED A;  3R6U A; 
#chains in the Genus database with same CATH homology
 3N26 A;  3H6U A;  1JW1 A;  3K2D A;  3U94 A;  1MM6 A;  5IGA A;  1B58 A;  3IJO B;  1INP A;  3M3F A;  1ANF A;  1JP4 A;  1I69 A;  4PQJ A;  1PEB A;  1UIV A;  1P99 A;  3IFC A;  1Z7M E;  1ZLQ A;  3SEX A;  4R9F A;  4DCX A;  3K1M A;  1S7Y A;  1NMU A;  2NWJ A;  4R6K A;  1SW4 A;  3DP8 A;  4P1L A;  3IAZ A;  1HSJ A;  2XD2 A;  1LEV A;  4ECF A;  4HTG A;  3FAT A;  4OFL A;  1BP5 A;  1IXI A;  2VP1 A;  1QUI A;  1KZ8 A;  2DS9 A;  1B7U A;  1VSO A;  3SZP A;  1EZP A;  5I2N A;  1AWB A;  3KN7 A;  1LAX A;  4GRK A;  3TCF A;  5CBS A;  4RK9 A;  1IME A;  1GR2 A;  4WXJ A;  4X48 A;  2NVU B;  4P3L A;  5KZT A;  3T9V A;  1MPD A;  4BDL A;  2Q2A A;  1P1W A;  3KSJ A;  1J1N A;  2UVI A;  3D4C A;  3BIG A;  3THI A;  4F2O A;  3A3U A;  3LC8 A;  2NXO A;  4XKR A;  2DWH A;  4NWC A;  1FPJ A;  2XX9 A;  3FD3 A;  1B7H A;  3O28 A;  2H99 A;  2GHA A;  5IZ3 B;  3OEK A;  4OEU A;  1KA1 A;  3UK4 A;  5ICT A;  4PP0 A;  4N6K A;  5TPA A;  5CI5 A;  2D5W A;  4P0G A;  3QAX A;  3CSG A;  3PD9 A;  3CFL A;  2Y7I A;  3FVO A;  3VVD A;  4U2R A;  4FED A;  3S9E A;  3S9M C;  1PB7 A;  3PPO A;  4RA1 A;  1LBW A;  2ZMB A;  2HFB A;  4XIG Q;  1DMB A;  4F18 A;  1LFH A;  3PPP A;  1ZU0 A;  3KSX A;  4NN3 A;  4ZEI A;  3CI8 A;  5F1Q A;  4THI A;  3RN8 A;  4R75 A;  1M5E A;  3G3G A;  1EYI A;  3IB0 A;  1POT A;  1TFA A;  1N3W A;  4P47 A;  3MW0 A;  1XOC A;  4ELR A;  3SEW A;  3G7W A;  3S2V A;  4R9G A;  3Q27 A;  4P9K A;  2QPQ A;  1UTH B;  4JVC A;  4MF3 A;  3FJM A;  5AA3 A;  2QVR A;  2MKZ A;  4PGN A;  4YKP A;  1VR5 A;  1NFT A;  1FBC A;  3E4R A;  1YXI A;  2OWT A;  5ET7 A;  4X1D A;  4IO7 A;  4DE8 A;  1SYI A;  1LBB A;  3VLU A;  1MY1 A;  1R9L A;  3I6V A;  4PAI A;  1A99 A;  3OD7 A;  4EUO A;  1Q9D A;  2F3B A;  1US4 A;  4MLV A;  4U23 A;  3IX1 A;  5CBR A;  2I58 A;  1T0K A;  2WEF A;  2QVV A;  4NF6 A;  3M3K A;  4OVJ A;  3HST A;  3TTK A;  4X8R A;  4P8B A;  3T93 B;  5DW8 A;  5JTY A;  1OLA A;  1IMD A;  1B3F A;  3QXM A;  1IXG A;  4MNI A;  1B0H A;  2H25 A;  5I56 A;  5HM4 B;  1POY 1;  1NL5 A;  5CM6 A;  2AL4 A;  4PC9 A;  2XHD A;  4JVI A;  3G3I A;  1N76 A;  4F3P A;  4YB7 A;  3MPL A;  3TMG A;  3OEM A;  3OO6 A;  1ZJL A;  1TT1 A;  3OO7 A;  3EHT A;  1LBZ A;  4F3G A;  2P1S A;  5ET5 A;  4KYE A;  2CZH A;  4N13 A;  4AQ4 A;  2I4C A;  3K6X A;  3IOU A;  4G8N A;  1B3E A;  2VHA A;  4G68 A;  3Q25 A;  1EZ9 A;  4OZ9 A;  3TTL A;  3N94 A;  3CFZ A;  3OOA A;  5AA4 A;  4I40 A;  4IO3 A;  4GQO A;  3TCG A;  3U72 A;  1JEU A;  4EQ9 A;  4OES A;  1G0I A;  4OEV A;  1UTB B;  1MXU A;  2GQ1 A;  4ZS9 A;  1Z7N E;  1PDA A;  5H8H B;  1SI0 A;  1N84 A;  4OVR A;  1Y1Z A;  1MXW A;  4RK2 A;  4BLA A;  1K9Y A;  2R8T A;  2UYE A;  3OO9 A;  3PUV E;  4XKN A;  4IR8 A;  1ZKB A;  4FOR A;  3TOD A;  2XXR A;  4OEN A;  1KA0 A;  5KDT A;  1FBD A;  2H9B A;  4HE2 A;  2RC8 A;  4QSE A;  4LUB A;  3MZB A;  4FEC A;  3OSQ A;  4EXL A;  1B3G A;  4R73 A;  2I6E A;  3E78 A;  4Q8R A;  2GHB A;  4Z0I A;  2DWA A;  3UIF A;  4FBP A;  1MRP A;  2KQZ A;  4OYV A;  2V4C A;  2DWI A;  1Y20 A;  4H5F A;  4ZZE A;  4ZEC A;  5L9S A;  4OVP A;  2PYY A;  4DI4 B;  2BJJ X;  5FTI A;  3RYD A;  2AL5 A;  5EQA A;  1IXC A;  5KCJ B;  2FNC A;  1NV0 A;  1MY0 A;  1JW5 A;  4ESW A;  4PDH A;  3GXA A;  3RNN A;  4N4U A;  1USY E;  1NV2 A;  4JB7 A;  4QBA A;  4MHF A;  4X04 A;  3MVW A;  3G3H A;  3TQL A;  2L5V A;  1FTL A;  3PUX E;  3CVG A;  3VXC A;  3IL1 B;  2P3N A;  1JVY A;  4MJO A;  1IUD A;  2F7A A;  1P1Q A;  3HCQ A;  4PET A;  4GL0 A;  1B4Z A;  2DVC A;  2XXY A;  3C31 A;  4KCD A;  5LOM A;  4GL8 A;  2YJP A;  2QS4 A;  2XD3 A;  1EZO A;  3MBP A;  1BLF A;  4X1B A;  3RT8 A;  1LB9 A;  3H03 A;  3B50 A;  2ZNS A;  1EYJ A;  3CHG A;  3CSB A;  2UXA A;  5IZ3 A;  4GFR A;  2HCA A;  3LV0 A;  4C1T A;  2QFL A;  4RYA A;  3N5L A;  4BDQ A;  2HXR A;  3D1R A;  2F6P A;  3RQT A;  1FBG A;  1AH5 A;  2Y5K A;  4FEB A;  4N91 A;  1P1O A;  1ZIU A;  3UN6 A;  3U8Q A;  4OFO A;  3CFX A;  3CIJ A;  3KN3 A;  4NHB A;  2GRV A;  1LBY A;  5TU0 A;  1B51 A;  4ISU A;  2P2A A;  1B1H A;  1QW0 A;  1GV8 A;  3DP6 A;  1IIT A;  4N8Y A;  4GXS B;  2XWK A;  4LZ8 A;  1LBX A;  1NV5 A;  2OBG A;  3H06 B;  4ZEB A;  4R6Y A;  4NQ8 A;  3MAM A;  5I58 B;  1UTH A;  3IOT A;  1DCU A;  4KYD A;  4OET A;  4NTL A;  3IB1 A;  4I1D A;  4LP2 B;  5ESY A;  3T96 B;  4ESX A;  3IFA A;  3BFU A;  1LAG E;  1XHY A;  3T22 A;  2Y84 A;  3ODB A;  2Q74 A;  1YPN A;  1NUZ A;  4ZEF A;  1FSA A;  1A8F A;  1LST A;  1FTO A;  3TTR A;  3KN8 A;  5LTC A;  1DPE A;  3RGY A;  4QFN A;  4YKK A;  4GXA A;  3FXU A;  3JV9 A;  3TEL A;  3V83 A;  5JEI A;  2HAV A;  4H8J A;  1IXH A;  4F19 A;  2CZI A;  4HXV A;  1VE4 A;  3LBS A;  4MCO A;  3MZ1 A;  5H8Q B;  5CMK A;  5JK4 A;  1Y3P A;  2RCA A;  1CB6 A;  4ZE8 A;  4KD5 A;  4OVT A;  4R2B A;  1H43 A;  5ISU A;  3VE1 B;  4NAP A;  3RT6 B;  2UYF A;  3O29 A;  1XI6 A;  1SDX A;  5AA1 A;  5B7D A;  2XWO A;  4TLM B;  1MXV A;  5CRY A;  5HBC A;  3B6Q A;  4XF5 A;  2X26 A;  1ZTY A;  1MDQ A;  4H1X A;  3E3K A;  1IQ7 A;  1MY4 A;  1FTM A;  5BWJ A;  3KC0 A;  1YAE A;  1XC1 A;  4I3E A;  3B8B A;  1B46 A;  1JNF A;  2Q8M A;  2ZYK A;  5L8D A;  2F34 A;  2QVU A;  2UVG A;  4JSD A;  3PPN A;  2Q8J A;  2PBW A;  4GWS A;  4AB5 A;  2IEE A;  5A5X B;  1AOV A;  1UTB A;  4GWU A;  5H8H A;  2CZL A;  4H0W A;  2I3W A;  3QSL A;  3VVE A;  5EHS A;  4R74 A;  1N0T A;  1B32 A;  3MQ9 A;  1Y9U A;  1OMP A;  3PMW A;  4GBW A;  2H4I A;  1M5B A;  4EQB A;  2I4B A;  3D4G A;  2E1S A;  2OX3 A;  3DM0 A;  2F7B A;  1FPI A;  5J16 A;  3T66 A;  1D4N A;  1BK4 A;  2FHY A;  2R71 A;  1FQA A;  1PB8 A;  3OXN A;  1NV7 A;  3K0V A;  1H45 A;  5T3J A;  1WDN A;  5KCJ A;  3LSF B;  1SI1 A;  3U93 A;  3FVK A;  5I7I A;  1N3X A;  5EHM A;  5H8F B;  2A5T B;  3RY3 A;  3W9V A;  4F2Q A;  3G3K A;  4GWW A;  1H44 A;  1NKX A;  1Y4T A;  3QMF A;  1B5J A;  3UP9 A;  2O51 A;  3DP4 A;  1FW0 A;  2R9J A;  4U1O A;  2PX1 A;  4O3A A;  4ELO A;  4H45 A;  1B4H A;  1PBQ A;  3GZG A;  4Q5T A;  3FVG A;  1QUL A;  2RC7 A;  4ZE9 A;  3KJT A;  3CG3 A;  1JEV A;  3EN3 A;  4OFJ A;  2WX9 A;  5L9O A;  4RNS A;  4F31 B;  1LGB C;  4MEV A;  1NUY A;  2XXW A;  3OO8 A;  1NV6 A;  2XX7 A;  3PV0 E;  1B3L A;  1MQD A;  2F6G A;  4I8C A;  4PFU A;  1XS5 A;  3TFL A;  1QGX A;  3PPR A;  1FBE A;  2XXP A;  2QMW A;  4DCY A;  4OVQ A;  3RPL A;  1D3K A;  4I62 A;  4NF5 B;  3O6I A;  3LSW A;  1QUJ A;  2V3T A;  5H8N B;  1USY H;  1YYZ A;  1JVX A;  5LDZ A;  4ELQ A;  3A3C A;  4MAG A;  2XXQ A;  4GX3 A;  2Q9T A;  3N6T A;  2R6G E;  3ECR A;  1B3H A;  2XXI A;  3GBB A;  1OQH A;  2REJ A;  5TP9 B;  4KFQ A;  1Y4C A;  4QXD A;  5FHN A;  2OJT A;  5ET6 A;  3V89 B;  4GF8 A;  4P0I A;  2CMO A;  4TOZ A;  3ROJ A;  3B6W A;  3GBA A;  4LQ5 A;  2VD2 A;  4RY1 A;  4KR5 A;  4POW A;  2F3D A;  5AA2 B;  2DDK A;  1A40 A;  3MVZ A;  5I58 A;  2CEY A;  1MY2 A;  1RYO A;  3K4U A;  5DYH A;  2E0S A;  3OSR A;  1OLC A;  2F78 A;  4O7I A;  2ZZV A;  4GWX A;  1MXX A;  3HV1 A;  4EQ7 A;  3K6W A;  3QUJ A;  1XVX A;  3K00 A;  4AS5 A;  2I48 A;  4HE0 A;  4X9T A;  4GBV A;  3EKI A;  4AB6 A;  1FTA A;  2I3V A;  1JQF A;  1OVT A;  1LFG A;  5FTH A;  1DTG A;  5I57 B;  3QYT A;  3V8X B;  3ZKL A;  2DXR A;  3FZV A;  3Q29 A;  3H6W A;  2V93 A;  2QS2 A;  2F8D A;  4PAK A;  1EYK A;  2Z23 A;  1NV4 A;  5EQ8 A;  4PTK A;  4JSO A;  3MVX A;  3R7X A;  3FVN A;  3HHG A;  3JYR A;  4BDR A;  4KXP A;  3B6T A;  4R6H A;  2BJI A;  5H8Q A;  4DXU A;  2VPN A;  1MQJ A;  1VFE A;  1FPB A;  5K2X A;  2G93 A;  4MMP A;  3OEL A;  4HCY A;  2DE2 A;  4QHQ A;  3SER A;  1IIW A;  1MH3 A;  3ZSF A;  2PCR A;  1Q35 A;  4OA4 A;  3Q28 A;  3PU5 A;  4Z7E A;  4GX6 A;  4TQU Q;  2FYI A;  3ONM A;  4HCW A;  5ICQ A;  3PUW E;  3K1N A;  3VVF A;  1LFI A;  3IOW A;  1DSN A;  4F3B A;  3UGW A;  1FPL A;  5ELV A;  2XWV A;  1QKB A;  5H8S A;  3W9W A;  1SW2 A;  1SVX B;  3LSX A;  4YU0 A;  3K01 A;  2WYK A;  1NNK A;  4PF6 A;  2XXX A;  3KBR A;  2IA4 A;  1LBV A;  2ZZW A;  3SKP A;  3RUM A;  2DE4 A;  4FAT A;  1B5I A;  2RC9 A;  1L5T A;  4YMA A;  5A5X A;  4ZEK A;  2F35 A;  4PFW A;  4EXK A;  1BTJ A;  2FIX A;  4PFT A;  2DP8 A;  2QL3 A;  3VXB A;  4QFO A;  2QS1 A;  3S9L C;  3V5A A;  3KC1 A;  1MS7 A;  3KBZ A;  1N7X A;  4H46 A;  5IZZ A;  5TPA B;  4JWX A;  2HZK A;  4PCD A;  2THI A;  3FBP A;  1Y1M A;  4Q30 B;  4UAC A;  3R26 A;  2XWI A;  1A55 A;  1YZ0 A;  1M5F A;  3BIH A;  4U1Z A;  1NV3 A;  4UAB A;  3EHS A;  1FBP A;  1MXZ A;  3FUZ A;  4PBQ A;  4NWD A;  4JWO A;  3I5O A;  2PVU A;  3Q26 A;  1RYX A;  1XVY A;  4XKP A;  2AYS A;  3WAE A;  1MDP 1;  3MC2 A;  4PFR A;  3TAJ A;  3U1O A;  2LAO A;  4RXL A;  4N6D A;  1LCF A;  4PBH A;  1B7Z A;  1OVB A;  5H8F A;  2QJE A;  2A5T A;  4M1V A;  3MP8 A;  2RKM A;  3G3F A;  3TDJ A;  4EF2 A;  3PD8 A;  1LAF E;  5CMB A;  3CRB A;  4F39 A;  2Y7P A;  3A09 A;  3FAS A;  3U65 A;  1HSE A;  3BKI B;  2G29 A;  1NH7 A;  3H4Z A;  1AMF A;  5DEX B;  1YCJ A;  4G8M A;  3SEU A;  3K6U A;  3O6H A;  4XTC Q;  4O3B A;  3HFU A;  4PAF A;  2CEX A;  4GX4 A;  3CR9 A;  2D3I A;  3IR1 A;  3DEL B;  3A29 A;  4QFP A;  2H98 A;  2FBP A;  4DXC A;  1GVC A;  1SW1 A;  2HAU A;  1CNQ A;  3TTM A;  3LSL A;  3VFJ A;  4R2F A;  3OMB A;  1UIU A;  4G2Z A;  2OWZ A;  3WAF A;  2FA7 A;  2XXV A;  3VLV A;  4N07 A;  5JTY B;  4IY6 A;  4XFE A;  1IMB A;  4NF5 A;  2KR0 A;  4MNP A;  4IGR A;  4OMB A;  5H8N A;  1NV1 A;  4RPN A;  4DI3 D;  1XT8 A;  4C1U A;  5I5P A;  2NUV A;  3KG2 A;  3FXB A;  4H6D A;  1TWY A;  5EQ7 A;  1B1X A;  2O6A A;  2OLB A;  3ISP A;  3K6V A;  1GTK A;  2B3B A;  5TP9 A;  3PMX A;  4YZZ A;  3GLB A;  3MZ9 A;  3O9P A;  1D9Y A;  2XA5 A;  1FQE A;  3KOS A;  4NF4 B;  1HSL A;  3H7M A;  3LR1 A;  2O68 A;  3C33 A;  1Y3Q A;  4JWY A;  2VT5 A;  5AA2 A;  5AA4 B;  3IOV A;  1A54 A;  2ZZX A;  3P7I A;  2PT1 A;  2ESN A;  4LZ7 A;  2XXU A;  3T9X B;  1FBF A;  2OZZ A;  3QIM A;  4PE5 B;  5CMM A;  2Q2C A;  1MY3 A;  1Y3N A;  4F3S A;  2O84 X;  1FJ6 A;  3PUY E;  3RTW B;  4DLD A;  4HE1 A;  1R6Z A;  4BDO A;  1VDW A;  4G68 C;  1DK4 A;  5L9M A;  5M2V A;  1S50 A;  2ALU A;  1TXF A;  2O69 A;  1FPG A;  1O7T A;  1PC3 A;  2VGQ A;  4HS7 A;  3MP6 A;  3HO7 A;  1NI9 A;  1NH8 A;  1OIB A;  2GFE A;  3C32 A;  2HXW A;  2ZYO A;  4XKQ A;  2GH9 A;  4GWY A;  4QFK A;  4AS4 A;  4TLL B;  4P1E A;  4NED A;  4MFI A;  5FHO A;  1TFD A;  2Z8F A;  2O1L A;  1NNT A;  4I3Y A;  1PBP A;  1FBH A;  4PGP A;  3CG1 A;  3UA8 A;  3MYU A;  1D9V A;  4IO6 A;  2H5Y A;  1B52 A;  1SQY A;  3ILU B;  1II5 A;  3SEV A;  2DXY A;  3IJX B;  5CC2 A;  1FQF A;  2Y5L A;  1MPC A;  4E0X A;  4YIC A;  1DBZ A;  4IO4 A;  2ZYM A;  3MJN A;  5ITP A;  4LAT A;  4QSC A;  1FQB A;  1LBC A;  4YB5 A;  3LUZ A;  4N15 A;  5F7V A;  3PGF A;  1RDY A;  3TQW A;  1AIV A;  4ONY A;  4P56 A;  4H67 A;  2JJK A;  2QRY A;  1IMC A;  4EF1 A;  4F1V A;  2PT2 A;  5B70 A;  4YMB A;  2REG A;  4MBP A;  2I49 A;  4QSD A;  4RJZ A;  2B65 A;  1SD3 A;  4L17 A;  3HHF A;  1PB9 A;  1YTV A;  4O94 A;  3MVY A;  1SW5 A;  4F29 A;  1ZMG A;  2XXH A;  2VPO A;  1FPE A;  4FE8 A;  2PMS A;  1BKA A;  1ZBM A;  2CZK A;  3O2A A;  3ILT B;  3SEY A;  3PMV A;  2HHM A;  4U4X A;  4BDN A;  4OER A;  2DWJ A;  4DXB A;  3TKD A;  2W7Y A;  3IK6 B;  4NGU A;  3FXR A;  1MQI A;  1D9Q A;  1H3D A;  1NNP A;  1O63 A;  2KLF A;  3G3J A;  3FXQ A;  3UOR A;  3N6U A;  2O7I A;  4H65 A;  2QMX A;  5DVJ A;  1EU8 A;  4LA9 A;  1JET A;  5I59 B;  4I9D A;  4C0R A;  3MST A;  4LON B;  5EQ9 A;  1QVS A;  3T9H B;  3M8U A;  4FAJ A;  4PFI A;  4NF8 B;  3IO6 A;  2B4L A;  2DVZ A;  4MLQ A;  4XXU A;  2WKY A;  1LCT A;  5EYH A;  3E9X A;  3RPW A;  1AL3 A;  4QF9 A;  4ZED A;  2DE3 A;  1MQG A;  3LUY A;  3E79 A;  3BFT A;  3TEP A;  1B5H A;  5DEX A;  3EPE A;  4PE3 A;  4YB6 A;  4DDD A;  3C9H A;  2PFY A;  4XEQ A;  1RDZ A;  5I2K B;  3T9U A;  4K3F A;  5F24 A;  4G61 A;  1B40 A;  1O64 A;  2F36 A;  1I6Q A;  4BDM A;  1B2H A;  2XXK A;  1B05 A;  2ZNU A;  1UQW A;  1A8E A;  3KFM A;  3O97 A;  4GIZ A;  4LQ2 A;  4GWZ A;  4O7M A;  1MXY A;  1ELJ A;  3MPK A;  1ATG A;  1RDX A;  1F9B A;  2HPG A;  2B3F A;  4JXI A;  3IB2 A;  4OTE A;  4F1U A;  3TUS A;  3T1B A;  5AA2 D;  4G4P A;  1US5 A;  1MQH A;  2HZL A;  3F11 A;  4MX6 A;  3FV1 A;  3K02 A;  3K1P A;  2Z8D A;  3S9N C;  2Q89 A;  4QFL A;  3TZA A;  4POX A;  4HW8 A;  4OHN A;  1KWH A;  1P1U A;  4U4S A;  2UVJ A;  2RCB A;  2V25 A;  4O3C A;  1QKA A;  2HEU A;  5I84 A;  4LZ5 A;  5EYG A;  3SES A;  2V84 A;  4NF4 A;  4IO2 A;  3EQ1 A;  3GYY A;  3L6H A;  2OK2 A;  2DQV A;  1S9T A;  2FIE A;  4NF0 A;  1GGG A;  2QSX A;  3PTY A;  2DSF A;  3PPQ A;  4GD5 A;  3SET A;  2B4M A;  1SPI A;  5IKB A;  1NUW A;  2V3U A;  1IMA A;  2A5S A;  3W15 C;  2WBD A;  1LB8 A;  4LN5 A;  3AXF A;  3C4M A;  2P0S A;  3KEI A;  1MM7 A;  2AIX A;  2ZYN A;  5I2N B;  4ZDM A;  4OAN A;  4IGT A;  1LLS A;  1H76 A;  1N7W A;  1BIY A;  2Q88 A;  3MUQ A;  3RTF B;  2QS3 A;  4KQP A;  2OWS A;  2VOZ A;  2X7P A;  4Q0C A;  3FIR A;  1JW4 A;  1Q1K A;  4PF8 A;  4RPO A;  4YAH X;  3KGC A;  1WVJ A;  1FPD A;  5CMC A;  3O6G A;  4QRZ A;  3ZKK A;  1MG1 A;  2ZNT A;  3MP1 A;  1B9J A;  4ND9 A;  4JBZ A;  2XX8 A;  4KCC A;  1FJ9 A;  2O1M A;  3C36 A;  1LAH E;  1URS A;  1FQC A;  1FCK A;  1IZ1 A;  2F7C A;  4FJP A;  1FPK A;  1MPB A;  2ZXT A;  4MNC A;  2Y7W A;  4IB2 A;  2I0C A;  3FJ7 A;  1IEJ A;  5IZ1 A;  4GOT A;  3PUZ E;  2UVH A;  3VV5 A;  4F1Y A;  1N04 A;  2ONS A;  1FPF A;  2O7U A;  2HQ0 A;  3M3L A;  2Z22 A;  2VD3 A;  4M4G A;  4F22 A;  4UA8 A;  4ELP A;  3FJG A;  1R1N A;  4H8I A;  1R9Q A;  1P1N A;  4U22 A;  4GVO A;  2I0B A;  3JZJ A;  3OEN A;  4KHZ E;  2F97 A;  4N17 A;  3IO4 A;  4U21 A;  2ABH A;  4WEP A;  5J1D A;  3TYH A;  3ZS6 A;  4PFY A;  5A5L A;  2F5X A;  2V3Q A;  1DOT A;  3VDF A;  3HN0 A;  3B7D A;  3S4U A;  5AE4 A;  3O66 A;  4OXV A;  3E13 X;  3RPL B;  2ANJ A;  3U92 A;  3KJ7 A;  4MH5 A;  2PFZ A;  4FIM A;  4ZZA A;  1CE2 A;  2NOO A;  2WYP A;  4LVQ A;  4DZ1 A;  4NG7 A;  5IM2 A;  3MWB A;  4WKM A;  1M5D A;  1URG A;  3HPI A;  3EF7 A;  5FBP A;  1EH3 A;  5BUU A;  4KI0 E;  3C34 A;  5DVF A;  4EDP A;  4P11 A;  3IOR A;  4YKI A;  5HPQ A;  4N8G A;  1WOD A;  2FVZ A;  4NF6 B;  5I59 A;  4OVS A;  4NX1 A;  3FV2 A;  3VLW A;  1IMF A;  1SYH A;  3KOT A;  5K2Y A;  4JVD A;  5ET8 A;  3QK6 A;  4PFB A;  4NF8 A;  1B6H A;  1RKM A;  4E0W A;  3SDF A;  5I56 B;  1DTZ A;  3H6T A;  2OCU A;  3FGS A;  3I3V A;  5DVI A;  3TCH A;  1VFD A;  4NE4 A;  1I6B A;  2WBB A;  4MIJ A;  1K9Z A;  2M8C A;  1NNF A;  2Y7K A;  2D21 A;  2Y7R A;  2XXT A;  5FHM A;  3KZG A;  2DOJ A;  3NOH A;  1FQD A;  5I2K A;  3C35 A;  1FTJ A;  2DYX A;  1FTK A;  4GWO A;  4G68 B;  4DIG A;  2YPN A;  3DLN A;  4R72 A;  4N81 A;  2ONK E;  5IAI A;  3T0J A;  4YKJ A;  1OQG A;  4G77 A;  3H6V A;  4KPT A;  3TPA A;  1I6A A;  2X7Q A;  4OQO A;  3EHU A;  1MH4 A;  4N6P A;  5DT6 A;  4PDD A;  2P3V A;  5ITO A;  4H5G A;  4NMY A;  3H3G A;  2Z8E A;  2YLN A;  1G0H A;  4KYS A;  1URD A;  2ONR A;  1B0L A;  3RLF E;  5EYF A;  2RF1 A;  3BBR A;  3L6G A;  4OWD A;  1SBP A;  4IO5 A;  1M5C A;  3USD A;  5DTB A;  1DPP A;  4IY5 A;  1A7L A;  1QJM A;  3TTN A;  1FRP A;  4G8H A;  3QUF A;  4JDF A;  5I3S A;  4O8M A;  5KDT B;  5I57 A;  2RIN A;  1NUX A;  4GLI A;  1QUK A;  4WED A;  3R6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...