3LUYA

Putative chorismate mutase from bifidobacterium adolescentis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
326
structure length
326
Chain Sequence
MSARKLFYLGPQGTFTHQAAVNAAQELARFEPQGFDLMPMDDVPQILDAAQHGDGWGIVAWENNVEGYVVPNLDALIDAKDLVGFARVGVNVEFDAYVAQGADPAEARIATAHPHGLAQCKRFIAEHRLSTQPATSNAAACRDLIPGEIAFGPAICGELYDITRIGTAIQDYQGAATDFLVLSPRAEVARLLAKPRAEANVEYESVLTLIPLVTGPGVLANLLDVFRDAGLNMTSFISRPIKGRTGTYSFIVTLDAAPWEERFRDALVEIAEHGDWAKTLAVYPRREHPNPPVTSWMLPQGGVRLDDSHLPDDWQNDETVRRELMW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of putative chorismate mutase from Bifidobacterium adolescentis.
rcsb
source organism Bifidobacterium adolescentis
molecule tags Isomerase
molecule keywords Probable chorismate mutase
total genus 93
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3luyA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3luyA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3luyA02
3OEMA 3S4UA 4KYDA 2F5XA 4G8MA 2YLNA 5CRYA 1SYIA 4KCCA 3BKIB 4G2ZA 3VV5A 3KEIA 4H8IA 1D9VA 3MP1A 2XXQA 2UYFA 4EQ7A 4ZS9A 4AQ4A 4RA1A 4RNSA 5L9MA 4Q8RA 2ANJA 5KZTA 3DM0A 2RKMA 4U22A 3P96A 3TUSA 4BLAA 2XX9A 2H4IA 3T93B 1FTOA 4ELOA 1B7UA 2P9GA 3FJ7A 5H8FB 1NNPA 4NMLA 3N26A 4F31B 4KHZE 2RQMA 3IBWA 3CFZA 4LQ5A 1SD3A 3DELB 5CC2A 1FQDA 2QRYA 5AA2B 4GLIA 4YICA 2NVUB 4PE5B 1LAFE 5EYFA 4LUBA 1P1WA 1FTKA 4RPOA 2F7AA 4IGTA 2BJJX 1US5A 3N6TA 1FQFA 3K6XA 4LZ8A 4ZE8A 1QW0A 1JETA 4MH5A 1BKAA 2PMSA 3H7MA 1UTBA 4PFWA 3K1PA 3Q29A 3MPLA 1MY4A 4GO7X 4R6YA 1N84A 1QUKA 2DWHA 1D3KA 1NNTA 2O84X 2LVWA 3A3UA 3PPNA 2XXTA 4GVOA 2QS3A 3KSJA 4X1DA 5H8SA 3TDJA 3SDFA 2I48A 3RLFE 3PU5A 4TOZA 3OEKA 1SW4A 2XXXA 2M8CA 3MVZA 3VLVA 1Y4CA 3AAWB 3C9HA 1B3FA 3OFGA 3O6HA 4LZ7A 2QL3A 3MVYA 2RC9A 2MDAA 3MVWA 1MQHA 2FA7A 3IK6B 4NMYA 1AL3A 4H6DA 1ZKBA 1URSA 4F39A 5H8FA 1VSOA 1Y1ZA 2XXIA 3HHEA 1B5HA 2V3TA 2B3BA 4OZ9A 5TU0A 3SETA 3T9XB 3OO7A 3TTLA 4EF2A 3K0VA 5FTHA 1S7YA 3FASA 1MS7A 2G93A 2ZYOA 4FECA 3RGYA 2XXUA 5H8QA 2A5TA 3MVXA 3LUYA 1ELJA 3HPIA 4IO4A 5KCJA 1S9TA 4GO5X 1QKAA 2OZZA 3CIJA 1ZBMA 4OFOA 3K5PA 4NF6B 2QSWA 1OVBA 1MY0A 2PA3A 2I6EA 5HM4B 5TPAB 1A54A 3QSLA 3KGCA 4N6PA 3E3KA 2GHAA 3I5OA 4YB7A 4DE8A 2F6PA 2Q8JA 1LB9A 3TAJA 4UA8A 1UJ4A 1Y4TA 3G3JA 1A8FA 2H25A 3ZS6A 4EUOA 3GLBA 3O2AA 3NRBA 3H6UA 5I59A 3K2DA 3FVGA 4KCDA 1SC6A 3KN7A 4OFLA 1LFGA 3LSFB 4FE8A 2V3UA 4ESWA 1NNFA 5M2VA 2I3VA 1MXXA 5I56A 3C36A 1ZIUA 3CI8A 1KS2A 3U1OA 2P9CA 5TP9B 3MTJA 4BDLA 4C1TA 1B05A 3IOTA 2V84A 3VXCA 1IQ7A 1OVTA 3U92A 1UTHB 3B6QA 1L5TA 3FVNA 3KWMA 3R7XA 2FGCA 1Q1KA 4UACA 1D4NA 4DXCA 1H44A 4BDMA 3ZKLA 3R26A 3O6GA 2Y7IA 1B0HA 3UK4A 3Q25A 4H1XA 2HZLA 3WAEA 4R9GA 1PEBA 2DWJA 3RN8A 1II5A 1XS5A 1P1NA 4ELQA 3N6UA 2Y7PA 3TTMA 3G3FA 1IUDA 2OWSA 1DSNA 1M5DA 3FIRA 2VGQA 3IB2A 1ZU0A 2ABHA 1SVXB 3BFUA 1POY1 3EQ1A 3L6GA 1B2HA 4ZZAA 1I69A 2NYIA 4WKMA 1SW1A 2O7IA 5JTYA 2P1SA 3H6VA 2GHBA 1H43A 3DC2A 2QJEA 2ZYKA 4LATA 1FTMA 3W9VA 4QFKA 5AA4A 3QAXA 4DXBA 2KO1A 1PC3A 3Q27A 4Q0CA 5H8NB 1XTZA 3FJGA 5DTBA 3HN0A 3OBIA 2CZLA 5L8DA 4NEDA 3SEWA 2ZYNA 3JV9A 4NF8B 4ZDMA 4U2RA 3TTKA 2A5TB 1XC1A 3I3VA 3IOWA 3H03A 3PUWE 3AB2B 3SEXA 3OXNA 3LSXA 2X7QA 3UA8A 3IO4A 1BLFA 3G3IA 2PVUA 5J1DA 2HZKA 1FQEA 3TUZC 1KWHA 4IO6A 2H98A 2DXYA 2X7PA 1IITA 3B6WA 3HHFA 1A8EA 1MDP1 3K6VA 4F3GA 1Q35A 4YKJA 1LGBC 2REGA 1I6QA 3TMGA 3QK6A 4QHQA 2V3QA 2RINA 2YJPA 4RXLA 1YTVA 1UIUA 5DEXB 2Y7KA 3RQTA 3FJMA 3T22A 2R9JA 2DVCA 1AH5A 3PD8A 3O29A 4GOTA 4O3CA 1LBCA 2NUVA 3K02A 4I1DA 5LOMA 1JVXA 3SERA 1B6HA 4OENA 4DXUA 5FHOA 2ZHOA 1F9BA 2I9SA 1R9QA 1IXHA 3TQWA 4FORA 3VVEA 2OJTA 4X84A 4X9TA 3FVKA 3MZ1A 4ZE9A 1R1NA 4TQUQ 2W7YA 3HHGA 3GBAA 3DHXA 2H9ZA 4ONYA 2XXVA 4ZEDA 4GQOA 3PPQA 5TP9A 2PT2A 4HCYA 1BIYA 5KDTA 1LBBA 1XHYA 4Q5TA 3IL1B 1B51A 1A55A 1YCJA 1OQGA 5I2KA 1P1QA 4OQOA 3PMWA 4M4GA 1PB7A 2D5WA 5H8NA 4PWUA 1RYXA 4H5FA 4FEBA 4R6KA 1XT8A 3MQ9A 4NF4B 5I2NA 1OLCA 1QUJA 2H9BA 1VFDA 2DT9A 2QSXA 1TWYA 4MBPA 3TUJC 4ELRA 1PBPA 4F1YA 4XIGQ 2XXWA 2I3WA 4OERA 1DPEA 2PYYA 2F8DA 2B65A 2ONRA 4K3FA 2ALUA 2F78A 2NWJA 4M1VA 4LA9A 5BWJA 2ZYMA 2I0CA 4F3SA 3CSBA 2GFEA 1JEVA 3DDNA 1N7XA 4F19A 3GXAA 1A40A 2XXHA 3T96B 4RJZA 2I4CA 4XTCQ 4QSCA 1US4A 1MQGA 4OESA 4EDPA 1LFHA 3OOAA 3IB1A 4X1BA 3V89B 5H8HA 2D3IA 3L7OA 2ZXTA 2F7BA 4KQPA 4U21A 2B3FA 2ESNA 1GTKA 4YMBA 2DXRA 2XD3A 5IAIA 3S9LC 3OSRA 4OHNA 3UGWA 4FIMA 3LOUA 2VOZA 4NF5B 2O1LA 3LSLA 4E0XA 4KD5A 4YMAA 1FCKA 4RY1A 2RCBA 2H99A 3CRBA 4KFQA 3KN8A 3RPWA 2DOJA 4GFRA 5ITOA 5ISUA 3TCGA 3AB4B 3G3KA 2XD2A 3KBRA 1OLAA 1EU8A 3O97A 4PFYA 3FATA 4ZEFA 1M5BA 4BDQA 5DVJA 3EHTA 4WEPA 1RWUA 1N7WA 3OMBA 4QFNA 2DE2A 1TFDA 3TELA 3DHWC 1ZMGA 3K1NA 1B1XA 1Y7PA 1PB9A 3CR9A 3T9HB 3M3KA 5AA2A 1N0TA 5EHMA 3PPRA 3N5LA 3PUXE 5CMMA 1MXWA 4PETA 3K01A 3SKPA 3TYHA 1O63A 2DQVA 4EQBA 4N07A 5I58A 1J1NA 4H67A 3PPPA 1OMPA 2NOOA 4G68C 3MP8A 2QRRA 3OO8A 4MLQA 3EN3A 4IGRA 1JNFA 4E0WA 5KCJB 3RUMA 1IZ1A 5DYHA 3U7JA 3TODA 1NFTA 4I8CA 2NXOA 4NF4A 3IJXB 3HO7A 1SI0A 3LR1A 1BTJA 3TKDA 1PB8A 4QSDA 4GD5A 4OYVA 1O64A 2F97A 3TTRA 4ZZEA 3FV2A 4WEDA 3OSQA 4QFOA 2J0XA 1MG1A 3O66A 3QUJA 3OO6A 2J0WA 3RTFB 1WDNA 4OTEA 2Q88A 3E13X 2QMXA 3ILTB 1N76A 2Y7RA 3KJ7A 2UVIA 4O3AA 1IXGA 4U4XA 1MY1A 2X26A 3C32A 3K4UA 3P7IA 2AIXA 1TT1A 2XHDA 1JQFA 1MQJA 4HTGA 4THIA 1LLSA 3D4GA 4EQ9A 1EZ9A 2Y7WA 1AIVA 1MXZA 2Q2AA 1DMBA 3IAZA 1GR2A 5L9OA 4EF1A 3N0VA 3ENQA 2QS1A 4GRKA 3EPEA 2RCAA 4GXAA 5H8HB 1LB8A 3TPAA 2HCAA 3SESA 5CBSA 2ZNSA 2Y84A 1PBQA 4P0GA 3S9EA 2F8MA 4IO3A 3CEDA 2V25A 3MW0A 1QJMA 4Z0IA 2OWTA 3USDA 1MY3A 1TFAA 2Z8DA 3TCFA 1QUIA 3C4MA 4RK2A 3U93A 2RC8A 4OWDA 4RPNA 4LP2B 4IO2A 4BDRA 2DSFA 1B3GA 2F35A 2VHAA 3GZGA 4H5GA 3FV1A 2UVHA 3VLUA 3AXFA 4AB5A 1AOVA 2XXPA 3IXQA 1LAXA 2HFBA 3MAHA 5I59B 2Z23A 5I56B 2O1MA 3O6IA 4G68B 4OMBA 3PV0E 4MF3A 2HAVA 5K2YA 1MH3A 3BBRA 2A5SA 2VD2A 4P11A 3TZAA 3ENWA 4ZEIA 1UTHA 1DTGA 4OETA 1Y3NA 3OFEA 1H3DA 1MXUA 4R2BA 2PBWA 2DP8A 1FQAA 1MQDA 3IR1A 1GV8A 3IX1A 3K6WA 4KYEA 2YPNA 1SDXA 3IJOB 3VVDA 4POWA 5K2XA 5FHMA 1WODA 2LQJA 2QS4A 1Z7NE 5JTYB 3GBBA 4XKRA 2FYIA 3OD7A 3DP8A 2Q89A 3FGSA 1LSTA 2DE4A 2P2AA 1D9YA 4JSOA 3IB0A 1M0SA 3B6TA 4YB6A 3VXBA 2DYXA 4OXVA 1LAHE 4GMKA 4IB2A 1SI1A 2REJA 4YB5A 4I62A 2CDQA 2THIA 3VVFA 3MP6A 1DOTA 3PGFA 3RTWB 4TLLB 1DPPA 1IXCA 4LZ5A 3HV1A 4YZZA 2F34A 3KSXA 4EXKA 3TEPA 2CMOA 5I57A 4GL8A 3C34A 4U1OA 2GH9A 1ANFA 5JJBA 4P0IA 3ECRA 4KPTA 1MXYA 1MPDA 3KZGA 4IY5A 3JYRA 1LCFA 1B0LA 2XX8A 2H5YA 3RT6B 2WKYA 4GF8A 1XVXA 2PT1A 1MH4A 4F22A 1IEJA 1MPBA 1YAEA 4R9FA 3V5AA 2I49A 5FHNA 2V93A 4U23A 1FW0A 3W7BA 4U4SA 2P9EA 2IEEA 1A7LA 4QRZA 3A3CA 2DVZA 3B7DA 4F3PA 3O1LA 5B70A 3WAFA 5DEXA 3VFJA 2Q2CA 3M3FA 4F1VA 4NF8A 3IORA 3T9UA 3QYTA 5AA3A 2RF1A 3PD9A 2OCUA 3MWBA 1QVSA 3C35A 3RT8A 4JWXA 1ATGA 3S9NC 1B9JA 4HCWA 1EZPA 2DS9A 3M8UA 2F6GA 4YKKA 3KG2A 2I4BA 5DVFA 3TQLA 3VDFA 1JVYA 1XVYA 1PSDA 2AYSA 2JOQA 4F2OA 4IY6A 1LK7A 1Y3QA 2QPQA 3THIA 1Y9UA 3DP4A 1B3HA 1USYH 4GIZA 5L9SA 5KDTB 2VD3A 3MC2A 4H0WA 4JB7A 1OQHA 5A5XA 4XKQA 1VR5A 4QF9A 2UVGA 3UIFA 1NH8A 4ISUA 4BDOA 1N3XA 3KFMA 3S9MC 3FVOA 3PUZE 1Y1MA 3MAMA 3LBSA 2G29A 5CBRA 5CMCA 2ZMBA 4LVQA 3U72A 3HSTA 2PC6A 1M5FA 1R6ZA 2O6AA 4XKPA 3RY3A 1HSEA 3BFTA 1NL5A 3VLWA 5T41A 5HPQA 4NE4A 4G8HA 2OLBA 3U94A 4DLDA 1UTBB 1IXIA 3MBPA 3E9XA 1IIWA 2RQKA 4G77A 3OFFA 3UP9A 4FJPA 5I2KB 4M8LA 4HW8A 1URDA 1POTA 5CMKA 1I6AA 4NWCA 1SW2A 3W9WA 4H65A 4JDFA 3IO6A 4YKIA 4LONB 4JSDA 4IO7A 2I58A 3PMVA 3F11A 4NWDA 3HCQA 4G68A 3T66A 3A09A 2HEUA 1MPCA 4I9DA 5TPAA 3H3GA 5IKBA 1YPNA 4RYAA 4N13A 2VP1A 4JWOA 4DDDA 3DP6A 2JHEA 2F1FA 3H4ZA 5A5XB 4R72A 2XXRA 4F3BA 2AL5A 1YBAA 5ITPA 1HSJA 4G8NA 5H8QB 1U8SA 4GWOA 1NMUA 4R75A 3V8XB 1B7HA 4POXA 2RC7A 3H06B 2HQ0A 1O7TA 3CVGA 3MUQA 4G4PA 4JWYA 4ND9A 2D21A 3VE1B 2DWAA 4DZ1A 1B58A 1FQBA 4XKNA 4ZECA 4NF5A 4NF6A 1Y3PA 4DIGA 2Z22A 3TUIC 1M5EA 2ONKE 1SBPA 4DCYA 4MFIA 1B7ZA 1B3LA 1AMFA 4IO1A 5DVIA 1QKBA 2QMWA 5AA1A 1CE2A 1EZOA 3H6WA 4AB6A 3ZKKA 5CMBA 4XXUA 4PQJA 3H6TA 2O68A 3EHUA 1FTJA 5AE4A 5ICTA 3KOSA 3LC8A 4ESXA 3L6HA 1SQYA 3FUZA 3EHSA 1RKMA 1P1OA 4PFUA 1SW5A 4DCXA 4F29A 1URGA 3KJTA 2O51A 4FATA 2E1SA 4PP0A 4ZEBA 4R6HA 4Q30B 1B5JA 1N04A 2XXYA 1B32A 3QIMA 3R6UA 1A99A 3O28A 3U8QA 1MY2A 4U1ZA 2DWIA 4BDNA 1MM7A 2FNCA 1LCTA 4KR5A 5I58B 3M3LA 5EHSA 3MPKA 3QXMA 2HAUA 1Z7ME 1B3EA 4QFPA 3OENA 1B4HA 4LQ2A 5IS2A 1DTZA 5JK4A 4C0RA 1B4ZA 3FZVA 5AA4B 2UVJA 3DLNA 3K6UA 3OELA 3D4CA 1OIBA 3PUVE 2ZNUA 5BUUA 2R71A 1R9LA 3LSWA 4HS7A 4QSEA 2I0BA 3C31A 2O69A 2GRVA 1NNKA 4GL0A 2LAOA 4F18A 3G3HA 1LKZA 3RNNA 3G7WA 3I6VA 1H76A 4YAHX 1GVCA 1MRPA 1JW4A 5AA2D 4X48A 3K1MA 3S1TA 5I84A 4JBZA 3FXQA 3PUYE 1NH7A 2OBGA 5CI5A 5IT0A 3PMXA 2KLFA 3FXRA 1JW5A 3CFXA 2R6GE 4RK9A 2P0SA 1ZJLA 5B7DA 3O9PA 3UN6A 3K00A 1EH3A 4YU0A 1B40A 3OO9A 2UXAA 3G3GA 4Z7EA 2O7UA 4EXLA 4R73A 1JW1A 1S50A 1VE4A 1YGYA 4FAJA 1B5IA 1TXFA 2OK2A 3IOUA 2ZNTA 5IT4A 5ICQA 3W15C 1M5CA 2HXWA 4KI0E 3ZSFA 3MJNA 3QUFA 4ECFA 1T0KA 4C1UA 4WXJA 5DT6A 2QS2A 1I6BA 1UIVA 1B46A 2F36A 4F1UA 4ELPA 3TTNA 1QULA 3Q26A 3CFLA 1WVJA 4MLVA 1JEUA 3S2VA 4TLMB 3UW1A 2ONSA 2DTJA 1ZPVA 2XX7A 3ODBA 2IA4A 1B52A 2PX1A 2Q9TA 4R2FA 1B1HA 1RYOA 4QFLA 3KN3A 4H8JA 1LK5A 4O3BA 5FTIA 3V83A 3FD3A 1P1UA 3CSGA 1FQCA 4NTLA 3CG1A 5CM6A 4OFJA 4FEDA 4ZEKA 3MZBA 1XOCA 5FIIA 1P99A 1ZLQA 3JZJA 5I2NB 3MZ9A 4IO5A 1CB6A 1LFIA 3N94A 3Q28A 1BP5A 3PPOA 4GXSB 4R74A 1UJ6A 2F7CA 1N3WA 5ELVA 4OVJA 5F1QA 3EF7A 2RE1A 3UORA 4JXIA 2Z8FA 5F7VA 3KOTA 1Y20A 5HBCA 2E0SA 3FXUA 1SYHA 3IOVA 1ZTYA 3ILUB 4F2QA 1HSLA 1MQIA 3ENVA 5I57B 3CG3A 4YKPA 1MM6A 3E4RA 2AL4A 3ONMA 1USYE 3SEUA 1LAGE 2Z8EA 3T9VA 1VFEA 1PDAA 3SEVA 3SEYA 2DE3A 1MXVA 1FTLA 2UYEA 4OEUA 4L17A 3TFLA 1O8BA 1MDQA 1UJ5A 3OFHA 1GGGA 1UQWA 4KYSA 1NKXA 4OEVA 3TCHA 5JEIA 1H45A 3C33A 4PFTA
chains in the Genus database with same CATH superfamily
3OHAA 4R5PA 1R6YA 3S4UA 3KHLA 2F5XA 2GFFA 4K4VA 4G8MA 1EX8A 2C2DA 2JVOA 2AW0A 3JTPA 3ZFVA 3GYYA 1D9VA 3CMAS 3PO4A 3PACA 2OD4A 4I1TA 5KT7A 3VWSA 3MP1A 5EYHA 2FY1A 4HH0A 1UMJA 4AQ4A 5EQ7A 3TJ9A 2HGMA 4PFIA 2RKMA 1NBEB 1VQSA 3TUSA 2XX9A 2AJFE 1P6TA 1YIJS 1XR7A 3T93B 4O3NA 2P9GA 4X4SA 5B0EA 1BY9A 3KLEA 4KHZE 2MQ8A 2DR8A 4KAIA 3IBWA 4LQ5A 2FC8A 1FQDA 5AA2B 3MM8A 1SL2A 5F3ZA 4GLIA 2K1RB 2QX0A 1UP1A 1P1WA 4DV1F 1JX4A 2FJBB 2VT5A 4GX4A 1VOMA 3RGIA 2BJJX 2XG8A 4EBCA 5GAEU 2XBPA 3M6XA 4DSEA 1QW0A 1JETA 2DNYA 3FZBA 3A8EA 1FRXA 2MGZB 1U1QA 4Q8EA 3H7MA 2D69A 1EARA 3L7PA 3MPLA 3ET6B 3AH6A 4ED3A 4P72A 1IR0A 1VC0A 2H54B 5I42A 1VBZA 2DWHA 3CJSA 4I0WA 2O84X 2XXTA 4OX9F 3A29A 2UUTA 2I48A 1KNZA 3RLFE 3M6UA 4IR9A 1AUDA 3D28A 2ACYA 4GKJF 4UOGA 4Q8FA 1ZPWX 3O6HA 2Z8QA 2XMVA 5KFEA 1N88A 3EGZA 3HHLB 4ZP8A 1RAAB 3W5YA 2RC9A 3MVWA 4FYWB 1F5BA 2XZTB 2QG9B 3IK6B 3TVZA 4ZVUB 4LFCF 3NXZA 3OL7A 2DGWA 2QLXA 3HHLD 1VSOA 2JSXA 2V6AA 3KXDA 3K2YA 2ZWOA 2OWZA 1HBOB 2DCLA 3OO7A 3TTLA 4EF2A 2C2RA 2VASA 2ZYOA 5AE1A 3ZZPA 2G2YA 4EO8A 2MJNA 1SJ4P 1JMTA 2QV6A 4V1Ak 3K7RA 4KGXB 1NUWA 2IM1A 2R9LA 3NS7B 3D1OA 3D2WA 1Q8IA 1FXRA 3ZC4A 5GMEA 5JXSA 1FRIA 3M1VB 4TLQA 1UVNA 4LF2A 2OZZA 4OV1A 1VMBA 2HHXA 4NX1A 2F9JA 2ZE2B 1FCAA 1YZ6A 3DGPB 5HLFB 4NF6B 2HURA 1MY0A 3HJFA 2OX3A 5HM4B 1TU0B 1A54A 3M2UB 1B64A 3E3KA 4YB7A 1R31A 3L7UA 3FZ2A 1LB9A 2I5JA 3TEHB 1XNRF 1UJ4A 2CZ9A 2EG2A 4A8WA 5KFRA 4NYOA 2NS1B 4I6AA 5CCLA 4J9MA 4EUOA 3LGNA 1FBHA 3O2AA 4J9VA 5I59A 5E0OA 3K2DA 4TQRA 1TFWA 1RQ0A 1TELA 3E51A 3FVGA 2VH7A 4PPZA 3QNWB 2E5LF 1S1VB 1NM2A 1SC6A 3KN7A 1FJEB 2IRXA 2GMHA 3ULHA 4FE8A 3B8HA 1MU2B 5C7PA 3C36A 1ZIUA 1EB0A 3U1OA 2JJ4D 5TP9B 1GX5A 2W4PA 3MTJA 4KPCA 2XSJA 4EEYA 5GAHI 1ICEB 4YHHF 4DV0J 2K1RA 2VPYB 3IM8A 1GTEA 4OHXA 1X60A 1BQMB 1U8WA 3KWMA 4U7CA 3RB3A 3VHQA 2FGCA 4UACA 3UN3A 2IJRA 5EWEA 3ZKLA 2R4FA 4URSA 4F4ZA 2ZVIA 1BMQB 1RK8A 2HVZA 2HZLA 4R9GA 1PEBA 1RT7B 1VLOA 3RRHA 1XS5A 2KZZA 3CHGA 3P49B 1GFWB 3CC7S 2W7OA 3S6EA 2HBZB 2VGQA 3QGPA 1N6QA 4OX8A 3BQ1A 4Y2KA 4LF4F 3L6GA 1B2HA 2AU0A 3CCVS 1AB8A 2XNQA 4WKMA 4X4OA 3G82B 3IP0A 1KDNA 2P1SA 1FBCA 2BDPA 5HI7A 2DRAA 5LJ5Y 5THWA 4LATA 2NCKL 4MNPA 3W9VA 5C42B 3QAXA 2KO1A 5H8NB 1G3OA 4LFAF 5DTBA 2WONB 2DGXA 1WG4A 5B09A 1OSDA 4CO1A 3J81U 3NAHA 3L9ZA 4ECZA 3SEWA 4LVOP 3JV9A 2DYAA 5KFOA 3M8YA 2KT5A 2FLLA 3H8YA 3RAXA 3ITHB 1JJHA 2HFVA 1FPGA 4J9NA 1JLEA 3PUWE 1FRLA 4ANDA 1FQEA 4NCAA 3KJVA 4LRAA 3PG9A 3TUZC 1KWHA 3DFEA 2EW9A 2H98A 1UCNA 2V9KA 2DXYA 3FUYA 3B6WA 1FJ7A 3HHFA 4F4KA 3TI0A 2PSZA 3NNHA 4F0MA 1JLGB 1MDP1 4YKJA 1LGBC 1GQEA 2REGA 3EDRB 3UVJB 1FFGB 4D3HA 2CQ0A 4DUZF 1SJFA 3QK6A 2APOA 1U0HA 1Y5IB 4ETZA 3AT1B 5MLCV 3T1AA 2IBOA 3MEDA 1HNVB 4RW8B 3EGNA 2CQ1A 3Q24A 5DEXB 3RQTA 1KFDA 4NRUA 1T03A 2R9JA 2I6WA 4WFXA 3PD8A 2RKIA 1TL7B 3VF0B 3PJ9A 4I3EA 2C2ZB 5LOMA 1H2TZ 2HNYB 1B6HA 5ET5A 3HFVA 4DXUA 2DR6A 2ZHOA 3ELHA 2BOPA 1VQNS 2HKEA 2I9SA 2G2OA 5HVGA 3OVSA 3DOLA 4A8KA 3VZHA 3VVEA 4NX9A 1S1WB 3GV5B 4TQUQ 3GBAA 4F02A 2H9ZA 5F9NA 4NOHA 4ZEDA 4GQOA 2MQOA 3PPQA 2PT2A 2NZCA 3R5JB 4HCYA 4KH1B 1BQMA 3CMES 1BIYA 3O6QA 1KONA 3H40A 3ZTPA 2OPRA 2KT3A 2KQZA 1R89A 4PR6A 1CBKA 4Y3CA 4C9DA 5I2KA 2N7CA 1IWAA 2W2NP 1DJ0A 1PYSB 4R6KA 2GA7A 3HFZB 1WC5A 2H9BA 3I56S 1H98A 1KLMA 2HYIB 1HBMB 3RG6A 4AL6A 3AA8A 3QFWA 1U1PA 5D4OA 2JEGA 4ZVHA 1RU2A 5DW8A 1TKZA 5I3SA 1NPPA 2MPUA 4FNIA 4PYAA 4OERA 2PYYA 2F8DA 4GVBB 4K3FA 4UTGA 2F78A 1IBLJ 4U67Q 2KDOA 4LA9A 4ANEA 5JVHQ 4HTJA 4DV4F 5BWJA 2ZYMA 2I0CA 4ID8A 4HHUA 1MMDA 4ZCLA 3SEOA 2E44A 3U1LA 4CLFA 2KM8C 1UEKA 3T96B 2UV8A 1VGYA 2I4CA 4C0BA 4QSCA 3MOZA 5T7LB 3RBDA 1NZ8A 4EMDA 4WCEQ 2BQUA 4B9SA 2FGOA 4QQBA 4GWZA 2DGTA 3KHRA 2R8KA 3OOAA 4O7IA 3L7OA 2H5IB 3VAKA 4PPDA 1SPBP 4L74A 2E1MC 4JI1F 2E9RX 2OPSB 2FVRA 1R8AA 2J6UA 3TX0A 3W64A 1B7YB 4N77A 1JLGA 4OHNA 2V5HG 4FIMA 2O1LA 1TL3B 2BRKA 3R97A 2FC9A 4E0XA 1S12A 4FF3A 4GWWA 3TX8A 3UDLA 4FKYA 1FCKA 2K7JA 3UVJA 3PVXA 2RCBA 4KKOA 2C3OA 4ALZA 1VQPS 2QFIA 2LMIA 3DLEB 5ITOA 1WKKA 5ISUA 2WOMB 1VDWA 5IM2A 4DR2F 1TAQA 1RAFB 3HFUA 2J8AA 3M2VA 3FEZA 2GIFA 3M7VA 1NK7A 2HQ3A 4RUBA 1NV0A 1B7FA 2GIRA 2G1HA 3R5AA 4ZVTB 4OANA 3OTOF 1HYSB 2HRYA 1Z2LA 2QLJB 4WEPA 1R0CB 2W9CB 2GC8A 5IOLA 1T03B 3KNAA 3OMBA 1K1SA 4PFRA 1AZSA 2WW4A 4QFNA 2FD2A 4C6AA 5F8NA 3TNVA 5LSRA 4OX6A 4ZMMA 2PCRA 1IKWB 2H51B 2VDIA 3SV4A 2ASJA 1RLCL 1E6YA 1TVRB 4CO0A 4X4PA 3KJFB 3TJAA 2LQ9A 5KFPA 2D9OA 2VPWB 1XWLA 1IWGA 4BLGA 2AZ1A 4OA4A 2VC0A 1YQHA 3N5LA 5HVFA 3PUXE 2V8DA 1U1LA 3I96A 4AL5A 1FFSB 3DU5A 1C1BA 3QIDA 1ZM4A 2YWFA 5I58A 1J1NA 3OTOJ 5JUMA 2XWXA 2NOOA 2Q3PA 1CJUA 3VR1A 4ZHRB 3QGHA 4IGRA 1JNFA 2HNYA 4NLOA 4CYUA 3RYDA 1S1TA 4X65J 3U7JA 2B4PA 3FRYA 4I8CA 4IFVB 4YS2A 5KG0A 3D3BJ 3M32B 5A2QU 3IJXB 1PC5A 4G1QA 3KFWX 1BTJA 2ZH1A 4DL6A 3DOMB 2ZUAA 3K8WA 5GADI 2HW3A 4LSNB 1O64A 1N5QA 3NKYA 1LW0B 3QT6A 4ILRA 2H48B 2XTJP 2YNGB 2HPGA 3QUJA 3OO6A 1Q86T 2GX8A 4C2MA 3E01A 3SCIE 1WF1A 5H9EJ 2FHOB 2E1AA 5DZ7A 2A2DA 1SXLA 4DZ6A 4O3PA 4OTEA 2Q88A 2R7WA 2QMXA 3ILTB 4DL5A 1LWCA 4RNFA 1RT4B 4O44A 3KJ7A 4F26A 2HHHF 4O3AA 5ETQA 4MJOA 4U4XA 2CPXA 4ZVSB 1FERA 3K4UA 4A8MP 2E5LJ 3P7IA 2DNMA 1TR0A 3GYGA 2LECA 3GJRB 1MQJA 2IY5B 4THIA 4C11A 1FKOB 4IDKA 1MXZA 2DNRA 4MKAA 1RA7A 2M70A 1LWXA 2XI2A 2W2QP 2YWEA 2CQGA 3ENQA 1RTIB 4DR5F 3N28A 1I94J 3MXHP 2DHAA 1URNA 4HLBA 1PBAA 2B4MA 4DR1J 2WBRA 5F0UA 4PC9A 3SESA 4NZ6A 3HFKA 1IR1A 1VQ8S 1TKTB 1PBQA 4USJC 4XEQA 4RNOA 2G0CA 4O94A 2JJKA 2Y8YA 2V25A 1XQIA 1XNQF 2DNLA 2VV5A 1FJ6A 1HWKA 2NPFA 4X62F 1O0PA 4C8OA 4DUYF 2Z8DA 1H38A 4FBPA 1FSAA 3C4MA 3E79A 4HT7A 4DR5J 1KA1A 4HE0A 4RPNA 1Y3JA 4UY85 4LSNA 2NSCA 4IO2A 3G6ES 4ILMA 2VHAA 3ILOA 4H5GA 3FV1A 4M1KA 4AB5A 4O0IA 2BJDA 2BJ8A 2KI2A 3W9HA 4K2JA 4Q43A 2CRLA 1RJJA 1NV1A 3MAHA 4QIFA 3LUZA 2GJIA 2QLWA 3DLEA 4B3SF 2Z23A 5I56B 2O1MA 3H90A 3JSMB 4OMBA 2HPUA 4P2FA 4PG4A 2HFUA 3ISZA 3QT7A 4TXSA 4OI0A 3ZO7A 2VD2A 4JI5F 4P11A 3MM7A 3ENWA 2RF2A 3OTDA 4RL1A 2HIQA 1Y3NA 1M1HA 3OFEA 3CULA 4GKJJ 3M30A 1MXUA 1BXNA 4DX6A 2PBWA 1GV8A 4QPXA 2Y1RI 5IZZA 2CNLB 3HKZD 4C7QA 3MAQA 2UVRA 3FBPA 1SDXA 3C16A 5F8MA 4FNHA 3IJOB 5CQGA 4POWA 2LQJA 4DLGA 4ED4A 4B9UA 4PGNA 2HAFA 3KHHA 1MG7A 3FGSA 3JXOA 4CYUB 2DE4A 2ZH9A 2O01C 4KFBA 4DCOB 1RHRB 1GEHA 4ANCA 1D9YA 1M5VC 3IB0A 1T05A 2MHNA 3B6TA 3GZ7A 3THVA 4MAGA 3RRKA 3TA1A 2HK2A 2REJA 1PJ5A 2OEKA 1JNRB 4I62A 1DOTA 2QFLA 3BSNA 2YWKA 3BH7B 3EZUA 1M1KT 2W7PA 1N5YA 2F34A 3KSXA 1WHXA 2ROPA 4GL8A 5KFFA 3JSRA 2HLTA 3JTNA 1JXLA 5JJBA 3RJMB 1X4HA 5J2QA 1FNMA 4E2FB 1MPDA 1SUQB 1VQLS 2H3EB 1LCFA 1B0LA 2ZD1B 4MEVA 4PZVA 3G6YA 1SQGA 2YX7A 4GF8A 2PT1A 2JLEA 4HXVA 4YFUA 3GJQB 3P3DA 4DI4B 1V6HA 5KOXA 4K0KJ 1XR6A 1QUVA 1YAEA 2I49A 5FHNA 2LU2A 3W7BA 3T3FA 5C42A 4OJ3A 3M30B 5RUBA 5C2CA 4TY8A 2KR0A 1QLNA 3POTA 4LF4J 4USVA 1NKBA 2BE9B 1R0AB 4DL4A 4OVPA 3F44A 3HSGA 3PO5A 1O51A 2Q2CA 2XO6A 1TL7A 4F1VA 3TP2A 4DSFA 3IORA 2DY1A 3T9UA 1HPZB 3PD9A 3ITHA 4GX3A 2WB1D 1WF0A 2VJUA 1CULA 3LP0B 4ZLJA 2M0GB 3G9CA 4CLYA 2P6SA 3GSIA 1B9JA 2DGVA 2DS9A 1FJCA 1RTIA 2I0XA 1RAOA 2VA2A 4ZVGA 4UZCA 2HEKA 2BR0A 5M2UA 1KZ8A 4RBTA 3MUTP 4ATNA 1NK9A 4KT0C 1WG5A 3VGSA 4DR4F 1PSDA 2AYSA 4DSJA 4WFNQ 3DP4A 3FJ2A 4GIZA 2VD3A 5HQMA 4P1EA 3MM7B 2X51A 4QF9A 1R7IA 1NH8A 2GS8A 3HHNB 2BJ7A 4ISUA 3CIZA 3G4SS 4O8MA 1FEHA 2J5AA 1FI4A 1CPZA 3BEGB 5IXUA 3KFMA 4I4BA 4U7UK 1WELA 3UN5A 2QL5B 4QW9A 3FVOA 2J9CA 2DKOB 2RB7A 1KWMA 1HHQA 3BBCA 3D0HE 5CBRA 4FZVA 5E41A 2ZMBA 4J9UE 5E33A 4LFBJ 1R6ZA 2MGZA 1T95A 4F2SA 3I82A 4DV3F 2E5IA 3BFTA 4JI0F 1UFKA 5T41A 5HPQA 1FTRA 1UTBB 3I0RA 4YMEA 4DUYJ 3UP9A 2MZ1A 5I2KB 4LR7A 4IFYA 2ZFHA 4LRFA 2MZTA 4IRCA 1I6AA 4NWCA 1N52B 3W9WA 5EX3A 3KG4A 1BC6A 1UA1A 1QVFR 2XGQA 1LNQA 4MYTA 3BO3A 4JSDA 2RUSA 2XZWA 2I58A 4IO7A 3KLHB 4DV3J 2CQPA 3PRVA 3G6VA 3HCQA 4PG6A 4G68A 1ZH5A 1UW4A 2QTWA 4WE1B 1BD6A 2XSFA 2B5JA 3A09A 2WVFA 2VQFJ 2HEUA 3BBFA 3MUVP 4DV7J 4DX5A 3H3GA 2B9WA 2FJDB 3KOAA 2CKWA 5LTCA 4QU6A 2QLFB 2KXNB 2B4UA 3DLBA 4A46A 2XLJA 5LSOA 2XXRA 1YBAA 5HBMA 4FXWA 3MCSA 3PEJA 5H8QB 6AT1B 1U8SA 4ZLPA 2R7SA 2BKOA 3H06B 2HQ0A 4QBUA 2HWIA 1UEUA 3CVGA 2AJ1A 3BGUA 4EYHB 1CJKA 4RPFA 2DWAA 4DV6F 2XB2D 4LN5A 2ZOGA 1R8HA 4P52A 4K4WA 4TU7A 4WFBQ 2JC0A 2Z22A 3BYPA 1TAUA 2ONKE 2QMUB 2LXUA 2WBDA 1S10A 4QXDA 3DMJA 1PIEA 4DPXA 4PUOA 3SYZA 2XWKA 4IO1A 3BJYA 1MMLA 3L95X 5FLXU 3C14B 5DQGA 1T0TV 2HLUA 3SDEB 1KN6A 4DSIA 3JAMU 1JLQA 4I2QA 3HPOA 1AROP 3EX7B 1X4GA 4AB6A 1ULRA 2LEPA 3AFGA 5HANA 2DNKA 2B4LA 1NDLA 4RZRA 3HVAA 2LDIA 3H6TA 2L9NA 2O68A 2DNGA 1XMBA 5AE4A 3E3XA 4ESXA 3QQCD 1JB0C 2NYHA 1P1OA 1RXOB 2KM8B 4DCXA 3CJ8A 1URGA 2MJUA 5H9FK 2C3PA 2HWHA 2DHSA 4IRKA 2O51A 4FATA 2MKZA 1S0MA 4PP0A 2CQHA 1GK8A 2HMIB 1D0EA 1N04A 4NLDA 3R5BA 1JLCA 1N34J 2D1CA 3MURP 1B32A 1ZZFA 1AZSB 1A99A 5HBMB 2DWIA 5B0CA 4KR5A 1N5SA 1J27A 2E7WA 4ECYA 2VICA 5HROB 3CJ2A 4QFPA 2VG5A 3OENA 4LBHA 1SH3A 2DPJA 2G13A 3B4DA 4C0RA 1WWHA 4ZVOB 3FZVA 2QT7A 3G8QA 2UVJA 3IG1B 4E98A 3H2VE 1WSRA 3K6UA 2BUNA 2FB0A 4DV6J 2O3DA 3W2WB 3PUVE 2CJBA 2CJKA 5KFLA 4B3MJ 2GV1A 4YUDA 5LMNJ 2CPDA 2XY5A 3J7YI 3MR7A 4DF8A 5HMYA 4I56A 3RNNA 3G7WA 2GZOA 3I6VA 5L9XA 4RW7A 3BN4A 2YNGA 1JW4A 2DB1A 4KO0A 5I3UA 3OPKA 3K1MA 3FXQA 7FDRA 3GIJA 5IT0A 3PM9A 1RTHA 2KLFA 1X4CA 1U2RA 3FXRA 3QBCA 3N01A 1WC0A 1JNZB 2UXCF 2NXEA 3KG1A 4AS4A 3TZYA 2VPXB 1PGZA 4JI3F 5B7DA 5GAGU 1NJZA 2AYMA 4YU0A 2AP6A 3H0PA 3TA2A 3OO9A 2UXAA 3ILJA 5IQ6A 4P2SA 3WIUA 2DEJA 4Z7EA 5K5MA 1FPKA 4EXLA 2GMJA 4WU2A 1G0HA 2LQBA 2RMLA 2MB0B 1DFDA 3V5RA 3CJ5A 1JW1A 4R73A 1S50A 5LSLA 1VE4A 1YGYA 2DK2A 3NY0A 4FAJA 5KOWA 2QYGA 1RDYA 2OK2A 2YNHA 1CVJA 2M2BA 3WX8A 3W15C 1O5JA 5L46A 4KI0E 4MIWA 5CHCB 3MJNA 2FHKA 2EBEA 3GR0A 3QUFA 4RX6A 3TYTA 4ECFA 4YDDB 1T9TA 1YJ9S 4WXJA 1I6BA 2F36A 4F1UA 4MLVA 3BR9A 5DDOC 2UP1A 2FTRA 5DETA 1QGXA 2R8TA 5D0GA 4YN3B 1FTAA 4EWTA 1VQ5S 3RB6A 3CC2S 1HNWJ 2FHJD 2GNKA 4Q5VA 4B9NA 1B52A 2AKWB 2C2MB 4MKYA 1B1HA 1WG1A 1RYOA 1OYEA 3KN3A 2B7BB 3SFUA 4I67A 2L9WA 1VYAA 2AYGA 5FTIA 3S01A 3GIMA 2PD1A 4PG8A 1YI2S 2YQ3A 3CCMS 4ZEKA 4C98A 1RP5A 5KFYA 3ZZZA 2KFYA 4NZ7A 5DQHA 1FJGJ 1VQ7S 3GYXB 3JZJA 2W4DA 3PIOQ 3N94A 1RADB 2H5JB 3QATA 4NHBA 3HD2A 2K8GA 2W24A 2R7VA 1X5TA 3LAKA 4GXSB 1MW7A 2K06A 4N17A 2DNNA 4MIJA 1M90T 2KJWA 2Z2YB 1HNVA 2Q8MA 4HDGA 3UORA 1KVIA 3V4IB 5F7VA 5HBCA 1FPDA 3FXUA 1RAJA 1FHTA 3KLGB 4CRJA 2HNZA 2YWHA 2V63A 4IH7A 4CH7A 4P74A 5HAOA 3MF5A 1MQIA 3CW2C 5EQ9A 1LAGE 4XO0A 3DRSB 4PKDB 1FK9A 5I3PA 2V94A 3SEVA 2C2EA 1RSCA 2XY6A 2ZH7A 1R0AA 1OWXA 4BWJA 4L17A 3HSZA 1NUYA 3KNGA 4OV6A 1UJ5A 2C2KB 3MR3A 3GE9A 4KYSA 4OEVA 4PFTA 3DXSX 4JB8B 3GYNA 4YR3A 3IGVA 1VQOS 3I32A 1Y5NB 3TZWA 1WORA 4ECQA 2UUCF 1XIQA 1FVQA 1BK4A 1OS5A 1SYIA 3T1YJ 3WC0A 2ZEJA 4DF4A 2XXQA 1OY6A 4HACA 1FEEA 3SQGB 1E6YB 4DG1B 3I0SB 4ZS9A 4OI6A 4RA1A 2VHGA 4J7CA 1TMJA 4MYUA 4N8GA 2ZE2A 3PJWA 1GXUA 3M8QA 2ZZVA 1F0XA 1ZA1B 4N5SA 4QZVB 4DR6J 4WIIA 3BPSP 4DPTA 3HO1A 1BLUA 1Q81T 1B7UA 4WIQA 1NNPA 4NMLA 5KFJA 4F31B 4LF8J 1C2PA 1M5SA 1WHWA 1IXKA 2F40A 2H4YB 4IG0A 3ZZOA 1FRHA 2MEWA 2RQMA 4Y6IA 3CFZA 3A12A 1HBUB 3R5GA 4Y2IA 5CC2A 1LBVA 2PGCA 3Q2TC 4X04A 4K59A 2NVUB 3ICLA 1LAFE 1B0PA 4F0KA 4G61A 4MKBA 4JI1J 2F7AA 2HK3A 4X4VA 4BHQA 2FY8A 3LP0A 3VGTA 2IPOB 4O4RA 4DI3D 4ZE8A 2ZBIA 5EQAA 2AGOA 3DDKA 1TMMA 1SH2A 4ECTA 2PMSA 1UTBA 2VPNA 3M8WA 3K1PA 3FSXA 3Q29A 4PAAA 4GO7X 4M95A 5B0AA 2ATCB 2OTLS 3IAM9 1PCAA 1HQEB 1VBXA 4F36A 2EFVA 1D3KA 4LF5F 2LVWA 3F41A 3FMBA 3RW7A 1IBLF 1VJWA 4J9LA 3KSJA 5KTQA 2F4FA 4N41A 3W61A 1T9WA 4B02A 3TQEA 3PU5A 4ZIWA 2EC2A 1FBGA 2VPOA 3Q83A 1DZ5A 2B6AA 2CJ9A 2HHPA 3IM9A 3VLVA 3AAWB 2KYZA 2YH0A 3KLIB 2PIIA 1U24A 3NOCA 1D3WA 3OFGA 3Q8RB 1M5OC 1DHMA 1YG0A 1YRTA 1G4CA 2CEYA 2DD8S 1K8AT 1NV3A 3FVYA 1MQHA 2FA7A 2Q79A 3DRRB 4P3LA 5D78A 3MECB 3IR7B 4H6DA 1VRUB 3MYUA 2MKKA 2XYPB 2V4JB 1Y1ZA 2XXIA 4FN5A 3HHEA 1HNXF 3OV7A 3LP1A 2B3BA 1NHKL 3J7A1 4EK2A 4KV8B 3K0VA 5E3QA 2G93A 4M5DA 3H25A 2VBZA 2DHGA 5LOQA 1B70B 3DN9A 1ZZNA 2KXFA 3RBXA 4IOBA 2VG7B 5LMUJ 3RBEA 2E1PA 4IO4A 2WEFA 2G2ZA 3PYEA 3WX4A 4GO5X 3FMWA 1FD8A 2BE7D 5K14A 3CIJA 1V3RA 4WP8A 4KYZA 5KG3A 5K20B 2ASYA 3PZPA 1U48A 1YJVA 3T19A 2QSWA 5SUHA 3UE2A 1OVBA 1JWWA 2PA3A 3D1HA 3MMAA 1UWAA 3MEDB 3O3LA 4RW8A 4CO4A 3QSLA 2RRAA 1KR4A 3I5OA 4JI8J 2F6PA 3TAJA 1DAXA 2Z58B 3DDIA 1TP7A 4UA8A 2RKIB 3AOAA 1A8FA 2H25A 4X4NA 2RNEA 4RWXA 1HNZF 3H6UA 3QIPB 3NGUA 2YTCA 4CO2A 1SQEA 2V8VA 2Z2LA 1SVDA 2ZH3A 3W62A 2PT0A 4OFLA 4Q2LA 3CMQA 2UU9J 2GJFA 2XLKA 1NNFA 2BQ3A 5M2VA 2RILA 4B3OB 1KS2A 3K0JA 3VQSA 4A8XA 4DG1A 4PUOB 2OELA 2C2OB 2DY9A 1OVTA 3ET6A 4RU9A 3FVNA 3W9IA 1SKSA 2HNDB 3OL6A 3R7XA 1S76D 4HHHA 1D4NA 4M5HA 3JYTB 4YDXA 4QR0A 4M5NA 3V2UC 2XHCA 1SJRA 3Q8VA 2Y7IA 4P7TA 4DR1F 5D0EA 4PWDB 3MM9B 2V2VA 2DWJA 4BS2A 3RN8A 2W9BA 4ELQA 2OEJA 2NR0A 1FKAF 2Y7PA 4CM0A 2IC3B 3MMJA 1NK4A 2CQ2A 2ZUGA 1HQUB 3IR5B 1S7HA 2OPRB 2ASLA 2DBBA 3HKWA 1P8GA 2MXYA 3EZOA 3IRWP 3GPAA 1M5DA 3FIRA 2OSQA 1YX2A 4EGLA 1IKYB 2Z57B 1SVXB 1QM9A 3UDVA 3BFUA 3EQ1A 4ZPBA 1X0PA 3B78A 2NYIA 2R7QA 2XCAA 4DR2J 1SW1A 2QN6B 2O67A 4ZN1A 5GADU 5JTYA 4CLKA 1XK8A 5IZ3A 1V9OA 1NJWA 4J9PA 2PN6A 1NZAA 4OI1A 1H43A 2RRNA 2CADA 4QIEA 3MR2A 5AA4A 2QZ8A 2LYVA 3M4XA 2AV5A 3OBIA 2CZLA 1ZM3A 2IRYA 4LR9A 5D4LA 1P27B 3MM5B 3AXMA 2OO4A 5LJ3Y 2VBWA 1RT3B 3LP1B 3I3VA 3NCRA 3UWTA 4OVRA 5LDZA 4H4MA 2RH3A 2EI5A 3LSXA 2YQ0A 1BHNA 3IO4A 4YHHJ 1S4EA 2HNDA 4IRDA 2XGPA 1RT1A 2HZKA 3W2WA 4RUHA 1FRPA 3I4PA 4DCPB 3I5AA 1XBWA 1VRUA 1YJNS 3DRPA 4QYRA 2XMUA 2RQCA 3K6VA 1T8EA 2AJQA 3FNNA 3UFCX 2ZH5A 2HFZA 1TV6B 4QHQA 3PJXA 3NG8A 4XF5A 3MCNA 1EP4B 1XR5A 2EFOA 1IM6A 3A3NB 2YJPA 3HVTA 2IFXA 4RXLA 2A18A 1KOHA 4AFFA 3NWGA 1WEYA 3SXLA 2Y7KA 2IVMA 3NGKA 5JMNA 1DBDA 3N4WA 2WBMA 2E9ZA 5KFNA 3O29A 2IDEA 4O3CA 4B3OA 2E66A 1C0UB 4I1DA 2XWYA 2QGFB 3SERA 3DKDA 4KXPA 5FHOA 5DDRC 3TVKA 1R9QA 1UWBA 2V4RA 4OHYA 2CYYA 4NQ8A 4Q0BA 3FVKA 2FQQB 3MZ1A 4ZE9A 1IKXB 2X1BA 1R1NA 1F3FA 1Y3KA 3JB9k 5TP9A 1FBPA 2WVBA 2CG4A 2YX4A 2P3VA 5A76A 1CSJA 2NSBA 3I5CA 3VGVA 3SZ2A 2FJVA 2CWKA 2D5WA 1CJUB 1RYRA 1T94A 1XT8A 4WP3A 4JI8F 5I2NA 9RUBA 1JIHA 1GNKA 4RR5A 3BIGA 1DTTA 2VOOA 1S1UB 2QSXA 3N5BA 1N5TA 2C42A 5EUHA 3G96A 2AJ0A 4ELRA 1XN9A 1PBPA 5HN0A 2UXDF 5D6GA 2WVDA 1K1QA 4IFVA 4B3SJ 2N7YA 5FBPA 2DIVA 3L4BC 1OO0B 5C2GA 9ATCB 1Q8LA 2K3KA 2NWJA 2LCWA 2OPPB 3IGNA 1XI6A 2Z0GA 4I6YA 1Q7YT 1DLOA 4F3SA 3R3TA 2N82B 2PMZD 2DCUB 3DDNA 3KJNB 1N7XA 3GXAA 1A40A 4O3SA 4P9SA 4RJZA 2VFTA 4X62J 2VU5A 3BQ2A 4XTCQ 2DXEA 1US4A 2N3OA 4ED0A 3KYLA 1DBZA 1TUGB 2ZC4A 2ROEA 1RHMB 2CPEA 3IB1A 4DX7A 4IYQA 1OMSA 2MY7A 3MEGA 1NJIT 3GB0A 3EGWB 2F7BA 2EFNA 2P8IA 1AFJA 2B3FA 1HMVB 4YMBA 3NGDA 5IAIA 8RUCA 1X4FA 3UGWA 3LOUA 4HKQA 1CJTB 4NF5B 3LSLA 3MPDA 2EXUA 1HBUA 4LRCA 1OPZA 2ALZA 4V19X 1B3TA 4F04B 2XNRA 4OZLA 2H99A 4GWUA 2BXJA 1ZAXA 3TAMB 3KN8A 1YK9A 2MLZA 3RR7A 1NV7A 3TUPA 2HVHA 2MZSA 3TCGA 3BGFA 4UABA 3DRXA 3HSDA 2XD2A 2ZH4A 5FD1A 3MR5A 3M2RA 4LSLB 1NJXA 2OFHX 3FATA 1C0UA 4ICLB 3DI6B 2MKHA 4PYDA 3DLJA 2L48A 2G0IA 1JJ4A 4BDQA 1QVGR 2AGQA 1RWUA 2ADCA 3VAMA 2LXIA 3O8WA 4JYAJ 1L5UA 1HLWA 3DHWC 4UT4A 5AE3A 5CXTA 2MKIA 4JV1A 3IO1A 1KA0A 3BDEA 3CCLS 1Y7PA 1RAIB 1PB9A 3CR9A 3T9HB 3M3KA 2IYGA 2PMWA 4C4WA 1RWKB 5EHMA 5J2MB 4OVQA 4YY3J 3VAFA 4WZMA 3TOQA 2FJEB 2DQVA 4NLSA 3SCLE 2RJZA 1BWVA 4G68C 4M5KA 3PW4A 1IJFB 5IZ1A 1APSA 4ZP9A 3QAUA 4E0WA 4ES2A 4OYXA 1LWFB 2M4MA 3RZAA 2HHTA 3AJ2A 3TODA 3CJKA 2VJVA 1NFTA 5L8RC 5CZXA 1OQ3A 3HO7A 1SC4B 3LR1A 4CTAA 3TKDA 1NDPA 2HWTA 2KRBA 1Y00A 1LBWA 5EWFA 4OYVA 2V0NA 4GBWA 3PX0A 2VG5B 3TTRA 5A8KB 1TKDA 5EWGA 3TQ1A 2JEJA 2J0WA 3IS9B 3M1VA 3B50A 3RTFB 1VS3A 1NB2A 2ALYB 1VCTA 4HTIA 2W9CA 3E13X 2RUGA 4DCJB 2Y7RA 3KK1A 2UVIA 1OQ6A 4C0HA 2UU9F 3OLBA 4AQYF 1MY1A 3R1LA 3C32A 2XCPA 3O44A 4BBYA 2W2MP 3CDWA 3NCQA 5K9FA 4HHJA 1TT1A 2XHDA 3J81j 1EZ9A 3KDOA 3SV3A 2WSFC 3TANA 2Q2AA 2VFUA 4MIAA 1JKHB 2HVIA 3IAZA 3F0NA 1YRUA 3M8PA 3BSCA 2RCAA 2CPFA 1M5HA 5E2QA 2DHHA 1ZAWA 5H8HB 2HCAA 3FFIB 3NNCA 3QSIA 5HROA 1KQGB 2Y84A 3UDCA 3Q8QB 4P0GA 4QCLA 3OJSA 5L39A 3POTB 2VIHA 3H5XA 1NRKA 1OY8A 2QA2A 3CEDA 4PABA 1QJMA 3K57A 1KSPA 3VAJA 2C1EB 3USDA 2R8JA 1NSAA 2CFXA 2V9WA 1TFAA 4RK2A 3U93A 3BGOP 4OWDA 4HI1A 3MMAB 4BDRA 1SPIA 4DR7F 2M3DA 2QYCA 3VLUA 1AOVA 4NA2A 3IXQA 1LAXA 4M5JA 2OIHA 2EKYA 5A8RB 5I59B 2CDRB 3O6IA 3HHLC 4WE1A 2HAVA 5K2YA 1MH3A 3BBRA 1S0NA 3QYYA 2IBKA 4OYMA 1Q9DA 1TK5A 4LMZA 3TZAA 3RPLA 1Q0NA 4ZEIA 1QAYA 1UTHA 2XMWA 1H2VZ 1H3DA 3O5TB 3HF5A 5LXYA 3MOJB 1FQAA 3SCKE 5GAGI 2FZCB 3FCVA 5BJRA 2YPNA 1PAUB 4CLPA 3GJSB 3DOMA 1F9EB 1YJWS 3VVDA 5K2XA 1Z7NE 1VIOA 2AF6A 4ENOA 5IZ3B 4QR2A 2D3ZA 2J0SD 1LSTA 5FJ4A 3PEHA 4DQSA 1R27B 2Q66A 2IM0A 1N36F 1S0OA 1RKIA 4YB6A 5L9NA 3VXBA 1LAHE 1TUWA 1UAWA 3V6KA 1R8PA 4NYPA 1RHUB 1HWIA 3MP6A 2WSEC 3RTWB 2ILZA 2CWXA 1SI9A 4TLLB 1NK8A 4X8RA 3ADAC 1IXCA 4YZZA 4EXKA 1HQ2A 3FCHA 1JLEB 3SDEA 2Z2ZA 5J2PB 5KG7A 4U1OA 1S1TB 4YY3F 1YBUA 1ANFA 3KLFA 4NA3A 4P0IA 5HO4A 3KZGA 1G6BA 3LA0A 2H5YA 3RT6B 2J9EA 2JC1A 2IHR1 2ZBRA 3A13A 2WKYA 4LBIA 3TZZA 5LMNF 3MI7X 5D3GB 2AJ4A 1IEJA 2I2YA 4I2PA 2W1BA 5IT9Y 4ED1A 2B43A 2WCXA 2V93A 4NWBA 4U23A 4FYYB 1XJWB 4U4SA 2GQQA 4IG0B 4JI7F 1YSJA 4F67A 4QRZA 2XEXA 3A3CA 3B7DA 5B70A 4H4MB 3OR1B 5DEXA 1S4FA 2YWGA 4PDHA 3ILIA 2JNJA 2UUAJ 2IRUA 1CJKB 3BSOA 2BOAA 3C35A 3DYAB 2HHQA 3RT8A 4JWXA 1ATGA 1SL0A 1IMBA 3NWRA 1MMNA 4HL9A 2LKZA 2KTQA 4ZLLA 2WONA 4PG5A 3D6MB 1T9XA 2O66A 1X7VA 3D3CJ 3TQLA 1JVYA 3CC4S 4A8QA 4F2OA 1H72C 2PA8D 3H98A 3GIIA 3THIA 3A4TA 4JI2J 1B3HA 2HFNA 1D8ZA 5KAKA 5J2PA 4ILLA 4XPCA 4UUWA 1OQHA 4XKQA 3U1MA 2DR7A 5I3QA 3W63A 1S77D 3UIFA 2VC1A 1T05B 3OVBA 4ZA1A 4NLPA 4BDOA 4Y28C 5KG5A 3S9MC 4LBPA 3QFHA 1WJ9A 1Y1MA 1SKUB 2R7XA 5HL7Q 1I5OB 2VKRA 5CMCA 4N6DA 3H42A 3QO9B 5B0GA 2PC6A 3HSTA 3QT8A 3T6JA 2VF3A 2ACMA 4OLOA 1S9FA 3KMSA 4DR7J 2DH9A 3VLWA 2CPIA 1S1XB 3I4HX 4N81A 4NE4A 2OLBA 3U94A 4DLDA 4ZPCA 1IXIA 5KG4A 3E9XA 4F2RA 4Q44A 4DL2A 3OFFA 3ENAA 3MUMP 4ELUA 5F8IA 4HW8A 2KU7A 4KHPJ 3KLEB 5CMKA 3D6HB 1UEVA 1T9YA 2YX1A 4GC6A 1WC3A 1RZMA 2OPSA 3PYDA 4DX8H 1SKWA 3V6DB 4JDFA 3JSYA 4UOCA 4I40A 3ILLA 2V34A 2CQDA 4ZCKA 4PXEA 4FBTA 2HBRB 4JV5F 2ZZNA 2HQFA 4AYBD 5K8OA 2UUBF 1Q7LB 3T66A 2D3UA 3H59A 3AXKA 4Q2MA 2W2PP 5CYMB 3UCGA 4TVAB 3DM2B 4DQQA 4EYIB 5HQLA 4L3NA 1ACMB 3KC0A 4DUTA 4DDDA 3DP6A 1RWWB 4CCHA 1C1CB 1HWLA 2C2NA 3H4ZA 1CJVB 2LU1A 4R72A 3NBPA 1VK8A 5KFAA 1K44A 5ITPA 5ESYA 2XULA 1F6TA 4Y00A 1UFLA 3CJTA 4GWOA 4CT8A 4O0NA 3NS5A 1IVZA 1B7HA 2AEMA 2J7WA 4POXA 1LWEB 3R27A 1CQNA 1KLMB 4BCAA 3N5FA 1FPFA 2Y5KA 3P6YC 4G4PA 1Q8KA 4A8FA 2QFJA 4NLXA 2JL9A 3W2VB 1FQBA 4PQUA 2E7VA 2WX9A 2CPHA 2OMLA 4GVBA 2C3YA 4NF6A 1Y3PA 3CB4A 4O3QA 4DIGA 2DJWA 3OTEA 1NHUA 1M5EA 1YHQS 2KG0A 2BM1A 1SBPA 1MLAA 4GKKJ 4MFIA 1N32F 1EZZB 3W65A 3DRRA 4Z37A 2LFVA 2QMWA 1HMVA 4CLLA 3JSBA 3M2VB 4XAKA 1Y5LB 2H5EA 1KBRA 2R8GA 1HPZA 2MZJA 2DXFA 1BWEA 1K9MT 2B8QA 4ZN3A 4NLVA 5KFUA 2ZWPA 5C24A 1FTJA 2RDJA 2DGSA 3LC8A 1LQ9A 3L6HA 1FF2A 1SQYA 5DLFA 3EHSA 2IA6A 4KGMA 1IMEA 2VDHA 3CXCR 2Q6CA 2CPZA 3AQOA 3OTBA 4ZVRB 4URQU 4Q30B 3E2EA 4BDPA 4FP9A 1AFIA 2WB4A 5DS7A 3QIMA 4NXNF 4RW4B 1SV5B 3GP9A 4P2MA 4URGA 1MY2A 3C15B 1MM7A 3ZTRA 1OIAA 2A0FB 4X65F 4H4OA 5I58B 3M3LA 4GWYA 1QE1A 4B3TF 4GBVA 5BYRA 3QXMA 1G7CB 5KFMA 2JEFA 4J9KA 3EWGA 1VHFA 4DMZA 4N6KA 1B99A 2QEXS 5JK4A 2R2SA 2B5JB 1OYDA 4WXOA 3DLNA 1N34F 3Q8PB 1KP6A 2RU3A 1RTDA 3D4CA 3AHPA 2W4CA 1ROFA 2CJAA 2R71A 3MFIA 4IDKB 2XQCA 2O69A 2CNOB 4L3KA 4DFJA 2HHVA 4O23A 1GXTA 4I2QB 3V81A 2MSTA 4F18A 4PAKA 3CJKB 4YAHX 5BYSA 3SSQA 2Q6BA 3NP5A 4JI4J 4UUXA 5CYMA 4USKA 3KJVB 2MMYA 1B4SA 4ECUA 2MQLA 3PMXA 3PHTA 3N6NA 4IQMA 3GIKA 3CFXA 2G4BA 1NV4A 4ELTA 1TL1A 3T1HF 4F4XA 4E8UA 4HI2A 4PTKA 5AXLA 4NL5A 4P8BA 4LR8A 3UN6A 5KFQA 1EH3A 5AXMA 2CZ4A 4I6WA 2O7UA 5FDLB 2QA4G 4RLEA 5BXIA 2M9KA 4NLTA 2WZ1A 4F4YA 2DRDA 1OPIA 1U26A 5ICQA 2NUUG 3ZSFA 3GJTB 2CQCA 1T0KA 1TKTA 1WOOA 4FXVA 3RR8A 1B46A 1LEOA 3TTNA 4DS4A 1QULA 4MFBA 3CFLA 3H2UB 5A6WA 1JEUA 3S2VA 1Z4UA 2XM3A 1X5SA 3UW1A 3CJ4A 1K9ZA 3DLKA 1BQXA 3OW2R 3V6HA 2VQFF 3T5LA 2DTJA 1ZPVA 2XX7A 3G8TA 2WVEA 3EPIA 2IA4A 1CG2A 1JK9B 1VISA 5T3JA 4ZLNA 2PX1A 1S1UA 1RBOB 2Q9TA 1NEEA 2BMBA 2MSSA 2VKZG 2K7KA 1UTAA 2ZH6A 4USMA 2FHMA 3W8GA 3FD3A 1P1UA 4Q0BB 1D9FA 4KV8A 1FQCA 1U2FA 3KK3A 3DMJB 1DY3A 5DO2A 5CM6A 4OFJA 4J91A 2JFDA 1QAJA 4RW6B 5L1IA 3J81Y 2XWOA 2R3VA 4WKRA 1ZLQA 1KLNA 2L41A 4IO5A 1S5ZA 4LF6J 3ISPA 2PE8A 1T9UA 4ZJQA 2GHWA 3PPOA 4DDFA 1TV6A 2ZOMA 1S48A 1UJ6A 1ZETA 2BKNA 1XNQJ 3QRRA 4LF9J 3T1BA 4OVJA 1HA1A 2CZVC 4RW7B 3ZZYA 4JXIA 1LBZA 1Y20A 3R5DA 2E0SA 1U1KA 1KVJA 1SYHA 3IOVA 5F24A 4F2QA 1LBYA 1IMDA 3ENVA 5I57B 4YKPA 4MKVA 3PKYA 3D5MA 3SEUA 2A1BA 2J9DE 2IM2A 3JSMA 2D74B 5I7IA 2DE3A 3CD7A 2EG1A 5ETTA 4F25A 4O4GB 4N47A 2V50A 3OJUA 4DV2F 3S7RA 3OFHA 1GGGA 2HXRA 3TW0A 3VAHA 3N6LA 3HVRA 1H45A 1CULB 2ZZWA 4UOHA 4OZ5A 1FA0A 2CIMA 3OEMA 3QGIA 3VVTA 2VOPA 1WHVA 4KYDA 4RJVA 3B54A 3BKFA 1WOPA 1RTDB 1IMAA 5CRYA 3BKUA 5KFGA 2AGPA 3BKIB 4G2ZA 4I7FA 3KEIA 2GIQA 3NGSA 1FDNA 1YKWA 3R2CJ 3RW6A 3B4MA 5IT9U 4EQ7A 1RTHB 2AYBA 1PO6A 4OHVA 4PGPA 3HD1A 2HHMA 2ZBCA 4RNSA 2YKMA 5L9MA 3D68A 3CT9A 2EFPA 2ANJA 3DM0A 2KL8A 3O2IA 4BLAA 4DV1J 4K4UA 4M5MA 3WDOA 4J37A 2XWVA 1XMQF 5C25B 1WC4A 3Q89A 4LFAJ 3MMCB 5GMKa 3HVWA 5H8FB 1FRJA 4NLUA 4ZCMA 1DARA 5DGBA 1K73T 2F63A 4B17A 1SD3A 1J5EF 3FXBA 1V3SA 3EKIA 2HGLA 3B8BA 4OZ2A 1V5VA 2XWIA 1F1BB 4CO5A 3VAGA 2HBQB 1J2VA 4KBIA 5KFBA 1Q95G 1TKXA 1IR2A 4A4JA 2M7SA 1SIZA 1YTYA 1LEVA 4FYDA 3K6XA 2AEFA 4LZ8A 4RUAA 4DN0A 3ISND 1HARA 4MH5A 1S1XA 1BKAA 5DJBA 2U1AA 4KKOB 4ERDA 2RS2A 2RDDA 1MY4A 4CNZA 2OI2A 3N79A 4ZOSA 1N84A 3LP2B 1SH0A 4MX6A 2F9DA 5DRKA 5BYQA 5G0RA 3A3UA 3PPNA 2D9PA 2A6MA 4OJGA 4YQWA 2QS3A 2B4VA 4X1DA 4DSLA 5H8SA 1GMUA 4TOZA 3UQSA 1J5OB 4H4KC 3TEGA 4CO3A 1PC4A 1SW4A 4H4KA 2XXXA 2M8CA 2GVDB 3WZ0A 4KSEB 4FF1A 3C9HA 1B3FA 1YXIA 5F8GA 4PF8A 1X4AA 1U0HB 2XMAA 2VPZB 3OXFA 3TA0A 4JVCA 1JLFB 5ETPA 4RWWA 2QL3A 1L3UA 2HSEB 2MDAA 4PQAA 3QO9A 1PAEX 4DEZA 3SZPA 3MM5A 3H20A 5H8FA 1WEXA 1WACA 2BW2A 1N32J 4GKKF 5TU0A 3SETA 1T9VA 1N8RT 3FASA 4FECA 2R2RA 2HS3A 2WVCA 3VALA 3U27A 4IH5A 2ZZMA 4WTOB 1DURA 3MVXA 3LUYA 1ELJA 3HPIA 4C11B 3HXMA 4CLUA 3IWLA 4JUZA 3A8KA 2L08A 4EU0A 1S9TA 3TAQA 2P6TA 1VLYA 4A8OA 2GO9A 5G4DA 3MCOA 4DV5J 1Q5VA 2I6EA 3ZNUA 5TPAB 4RKUC 1CNQA 4UQTA 2Q8JA 3GSDA 4NCGB 3G3JA 4U8YA 3ZS6A 5CD4A 3NRBA 2DNHA 5CZVA 1RCXB 1LW2B 1RE1B 4JV5J 1ZYQA 3AY0A 5B0BA 4C8KA 1CS4A 2D3O1 1VFJA 4GC7A 1U45A 2JFKA 2U2FA 3LSFB 3K5LA 4ESWA 5L1JA 4L75A 4EBDA 1U0SA 2I3VA 1MXXA 5I56A 3D67A 1SC3B 3CI8A 1N0UA 2P9CA 1UVJA 2J6SA 4HH1A 5GAEI 3IA0A 4C1TA 3PW5A 2V84A 2ZJPQ 3IRXB 3EICA 1NJYA 3B6QA 1EYKA 4ZCIA 2ZBQA 3AD8C 1Q1KA 2EPIA 2QIFA 4K50A 1NPKA 3M8PB 2Y8WA 4DXCA 4BDMA 3R26A 3IG1A 3UK4A 3Q25A 4H1XA 3RPLB 3WAEA 3R2DJ 2KFZA 3W5ZA 4ZJLA 3MTKA 1II5A 1FPEA 1P1NA 2MZQA 3N6UA 1H6KX 1F5CA 5D8HB 3G3FA 3KDNA 1IUDA 2ZZTA 1HI8A 4HYKA 4K8RA 3U65A 2ZKTA 3IB2A 2AX1A 5ET7A 2NXJA 1POY1 2IAJB 2A6OA 1VHIA 3KK2B 1Z2ZA 1VQ4S 1NSQA 2WHOA 4NASA 2J76E 2YH1A 1TFYA 2J6TA 1JLQB 4LSZB 4KFBB 1N5VA 2CVIA 4DFKA 3PYGA 2ZHAA 4ED7A 4P73A 3H6VA 1X8DA 3M2RB 2GHBA 1NLKL 1DK4A 3DC2A 1K47A 2PEHA 4JV2A 1FTMA 2IA0A 4QFKA 1G2EA 2H4WB 2RIJA 2W7AA 5A2QY 2UVUA 2PFDA 4DXBA 4Q0CA 3FJGA 1SUQA 3HN0A 2RVJA 2I1RA 1IBMJ 2CJYB 5L8DA 4NEDA 5HMWA 1XMQJ 2OGUA 1KQKA 1QE1B 1T3NA 2ZYNA 2HFOA 4NF8B 2E5GA 4ZDMA 4U2RA 3TTKA 3ZTOA 2EVZA 1XC1A 1IKVA 3IOWA 4CIOA 2RT3A 1FPBA 4AXJA 3H03A 4ZVPB 3SEXA 3OXNA 1G1XA 1FWPA 2X7QA 4EZ6A 3UA8A 2YNFA 3W66A 1FRKA 3G3IA 4IKAA 4C3LA 4TN2A 4IO6A 4OJHA 4NYZA 2X7PA 2F7VA 3THTA 3T9NA 2XC9A 1RLDA 5L1KA 3K58A 4ER8A 1Q35A 3RU0A 2DH8A 4M5LA 3VV2B 1I6QA 1F2HA 3JTOA 2E5HA 1Q8BA 5GMDA 2UXDJ 2W25A 1YTVA 2WBBA 1ZAVA 3MZIA 3I0RB 3FJMA 2YPYA 3T22A 3KK2A 4CH0S 5E7OB 3UO0A 4NCGA 1AH5A 2JZ5A 4TYBA 3K89A 1SBRA 4GOTA 1LBCA 4NLYA 2XS7A 3K02A 4X66F 3M9MB 2OUGA 3CSKA 4OENA 2KVQE 5FDLA 2L3MA 1IXHA 3TVYA 3IS9A 4LIRA 4FORA 4X84A 5BR8J 4XIUA 4NZ0A 2HVEA 4QIVA 1N36J 2FVQA 5J1EB 5J16A 3LANA 2IC3A 3DHXA 2XXVA 3GONA 4WFAQ 2HNZB 3TO8A 1WDTA 1TTHB 4ZP6A 1LBBA 4K4SA 1B51A 3IL1B 2L9DA 3NGRA 1A55A 4CT9A 2PI4A 4EO6A 2RRBA 1YCJA 1UZDA 1PB7A 5H8NA 4PWUA 5F8HA 1RYXA 3AJDA 4FEBA 3CTRA 4DV5F 3QJJA 4KGKA 1C1BB 4OYWA 3CCUS 1VFDA 1W7WA 2BQRA 4LF6F 1UPMB 4MBPA 1NAQA 2P5VA 4F3QA 2LP4A 3TUJC 3CPWR 1FK9B 2AHOB 5A8KA 1RT6A 2GVZA 4F1YA 1SQFA 4XIGQ 2XXWA 2UZAA 1DPEA 4Q45A 1P1TA 4DL7A 3ZZTA 2HS4A 2ONRA 4AE5A 2ALUA 5IM0A 5A0YB 3PCOB 4O3RA 2JVRA 5D4NA 3V6JA 2BACA 2IJNA 4DQRA 3BGRA 4JI6J 2YVSA 2GFEA 4USTA 1KVKA 3M9NB 3PR4A 5E3AA 2FVCA 2VQEF 2RQ4A 2LA6A 4TU9A 2F3BA 4GVLA 2HHHJ 4AUKA 4OESA 1BGXT 4CNYA 1S6QB 2ZH2A 1C4AA 2IIHA 1MROA 4X1BA 2RSQA 1TQLA 1Z1ZA 4IG3A 3V89B 2FPHX 3H4DA 5L1LA 2DNZA 3LAMA 1OJ4A 4KQPA 2I8EA 2A10A 1RT5B 1KHWA 1LWCB 1U1MA 1QAXA 3QGGA 2HHWA 2XD3A 3S9LC 3FFIA 1JKHA 2VOZA 4G6VB 3E01B 3SBMA 4OX9J 1TK0A 3LPYA 3IBFB 4YMAA 4M5GA 2IVYA 4CWBA 2DNOA 4Q7AA 4MNIA 3Q0AA 3CRBA 3CO9A 3FDSA 4GFRA 4FPRA 1K0VA 2FVZA 4FXDA 3HHDA 1OLAA 2E1RA 2SXLA 3WBZA 3QPIA 3GQCA 3O97A 4PFYA 4DR3F 2O5DA 5DQIA 4ITSA 3EPGA 3PW7A 1U7LA 4ZEFA 3J80U 1UWBB 3ETOA 4MK8A 3JQMA 5KT3A 5A8WA 2R7RA 5DVJA 1S0VA 3DXBA 4L73A 1LFWA 2IJFA 4ES1A 1WKLA 3UDEA 2DITA 2DE2A 4C8LA 3EVMA 3MFHA 2X3GA 3BQ0A 4G1PA 2E29A 3OUYA 1ZMGA 4LQ3A 2V2ZA 3EUNA 4X2BA 3K1NA 2EKNA 2QE5A 4HR2A 3PV8A 2F3DA 2UUCJ 2ROGA 5KFHA 5B0DA 2D7SA 5AA2A 1N0TA 1HBMA 3PPRA 1WI8A 3C2PA 5ETNA 2BX6A 5CMMA 1MXWA 1Q5YA 1QTMA 3K01A 4PETA 3SKPA 4KPYA 1FT8A 4USIA 5HP1A 1O63A 5G0RB 3AD9C 3E78A 3EYZA 1NPRA 2X1GA 2GHVC 4H67A 3PPPA 3SIPB 5KFCA 1OMPA 4NXNJ 5D3GA 3SQGA 2JRSA 3UD5A 4JV0A 3OO8A 1FKPB 2NQPA 4MLQA 3EN3A 2YKPA 5KCJB 4JBCA 1ELOA 1R8BA 5ETRA 4AXIA 5DYHA 2HHSA 3LGHA 1R43A 5KFSA 3I31A 3JS9A 1TUVA 4OL8A 5GAHU 2B9XA 4F4WA 1W26A 5EX0A 4F8RA 2MY8A 2FVPA 2KHCA 1HBNB 3LH2S 3X1LB 2B9EA 2VFRA 3BGRB 4LVNP 4WEDA 3BSAA 4ED8A 3OSQA 4QFOA 1NMEB 1MG1A 4P1LA 2DR9A 1KKHA 4XDDA 4DV2J 4NA1A 5IM0B 3LALA 3HHLA 1EYJA 3Q86A 3M8ZA 3QWUA 1S1WA 1FBEA 1N76A 1L3TA 3MECA 1K0TA 3DRYA 4I3YA 4J90A 2OKQA 2MHEA 2VG6A 5HVHA 2EFQA 2UXBF 3M9OB 1X9MA 2HHUA 1J5OA 3HHKA 2CNKB 2MQPA 4XDCA 3UR3C 1PJ6A 2J7KA 4DZDA 2YNIA 1LLSA 4EQ9A 5ADZA 5E5NA 1DMBA 2FVSA 3FBCA 5L9OA 4ZPDA 2QS1A 3WC2A 2CVEA 1I6JA 3EPEA 4W92B 3HLUA 4LF1A 1RT5A 2FJAB 2ZOFA 1IQZA 1S9GB 5AXNA 3SQOP 1EQ0A 2DGOA 1X9WA 3TPAA 4ETXA 3ROJA 5CBSA 4ZVQB 2HQGA 2ATLA 4IO9Q 3GV7B 3LGMA 1ZS6A 1RWVB 4KY3A 3HP6A 1TL4A 3FGVA 3I9ZA 5DGAA 3S9EA 2BYCA 1Q53A 3TARA 1UVLA 1NKCA 1PILA 1ZOTA 3HSJA 2OWTA 1AA1B 4TY8B 4RNNA 2BV3A 1MY3A 2Z56B 3R9LA 3TCFA 1QJHA 5D15A 4FVMA 5H9FJ 4F3OA 1HBNA 1Q78A 3MM9A 1VRQC 3SMZA 2PFYA 4TNOA 1RHKB 2R8IA 2RD5C 2PFFB 2XXPA 1NKEA 5J1NA 2E7XA 3R6LB 2MKJA 1F2GA 2FDNA 4G68B 2B51A 3PV0E 1X5OA 2NXNA 5F8JA 4FF4A 2G9OA 2D3OR 4FPIA 4NG7A 1S9EA 2YKNA 2F3JA 2QSFA 5KFXA 4WBFA 4LFCJ 4LRDA 1A9NB 1DTGA 2B8PA 4GX6A 2BRLA 2FUG9 1FKPA 1JLBB 3UI3A 1SCJB 1JJCB 2CUYA 3L09A 4CDIA 1XC9A 4NRTA 4FS2A 1WODA 2IYIA 4UOFA 5JTYB 3OD7A 1H0HB 2VFVA 4PWWA 4KRWA 2KKHA 2MLXA 1M0SA 1X4DA 2CXEA 1CC8A 3C8YA 2AMCB 2DYXA 4OXVA 2OHDA 5A5LA 3GFYA 4GMKA 1HNXJ 1FBFA 1YJUA 2KT2A 1YRXA 3KK1B 3VVFA 2XMTA 2Q74A 3PGFA 3KLGA 1DPPA 5J2NB 2FHJA 4LZ5A 3AJ1A 1FO1A 2F8HA 1EETB 3C34A 4IUFA 5DDPC 2BJEA 5DZ6A 2GMLA 4NLRA 4B3RJ 2QO3A 2J8SA 1EKRA 2DPIA 2BBEA 3BM7A 2QJ3A 2VA3A 1RWNB 2EC0A 1X31C 4HE2A 1GXLA 3PY8A 4A48A 1MH4A 1VC5A 1HW9A 3V5AA 2AWZA 1HWUA 1FW0A 2WW8A 2P9EA 2IEEA 3KBZA 8AT1B 2AIRB 4P75A 2DVZA 2VBXA 4F3PA 3O1LA 2P2CB 4B9MA 3WAFA 5ETKA 2FLPA 1D9QA 4X4UA 2N4DA 2YNFB 4J9SA 2LDYA 4NF8A 1KQSR 2HIYA 3P4UB 5AA3A 3BZQA 4IOAQ 3L3CA 2RF1A 2OCUA 2C3MA 3KUHA 4JVDA 1RI7A 4TLRA 3UPFA 2LQ8A 3DRPB 2XYHB 2ZDPA 4OMFG 4NN3A 3D1QA 4HVZA 1EZPA 1R0BG 2F6GA 5IZHA 3T9ZA 3CVKA 3H5SA 3KG2A 2I4BA 5DVFA 4X4RA 1S9GA 3OT9A 4Y0FA 1LK7A 1Y3QA 2QPQA 2M8DB 3PFOA 1Y9UA 1USYH 5L9SA 1NNDA 3MCMA 2WTFA 3GMGA 5LT5A 3MC2A 3N6MA 2HVDA 4JB7A 2RAQA 3J7YU 5A5XA 1HHSA 1VR5A 2VQEJ 3MHYA 4WYWA 3UNGC 2MKSA 3W60A 4JI5J 5L38A 1DTQB 3E8OA 3PUZE 1V3ZA 2OTJS 3LBSA 2F4VF 2YKNB 2G29A 1FDAA 2RS8A 1KHVA 3DCAA 1U02A 4ZPWR 3T1YF 4LVQA 3UR0A 5J1EA 2FLNA 4WPAA 4E0DA 3GCXP 5K8MA 2YKMB 2O6AA 4XKPA 4M63A 1EAYC 1HSEA 4ES3A 1JQGA 3PX4A 3IFEA 1NL5A 1EP4A 1IUJA 3CCWA 4G8HA 4GWSA 1S99A 3LWLA 2DVIA 2RQKA 1RYSA 4G77A 2Z2MA 1VK3A 3MGJA 4FJPA 5CA5A 1RU1A 3T5JA 5I42B 4A47A 4M8LA 1I51B 2BZ2A 2IMOA 2M52A 1POTA 1VQ6S 4KTQA 1S79A 5ETLA 1WEZA 5E3PA 1NV5A 3IO6A 3HZEA 2BJ3A 3BO2A 3H2LA 3GFZA 4LONB 3PMVA 1AYEA 5DM6Q 3F11A 1NDCA 5B0FA 1OSCA 1MSWD 1ZM2A 4QIGA 4LFBF 1RT6B 2GVZB 2VBYA 3IBCB 4RO0A 1DLOB 1FXLA 4M5DB 3J80Y 1YJ7A 1WSVA 3RRGA 4PXCA 1QUPA 5TPAA 3P5TL 5IKBA 5IGAA 4N13A 5EYGA 1S59A 4WK3A 3EJMA 2JHEA 2F1FA 4DBQA 4KIAA 3CE8A 1PBUA 4DU7A 3PNIA 3DGPA 5HLFA 3TAPA 1H2UX 4F3BA 3KUEA 2CNNB 4G8NA 1H74A 2WRMA 4KO0B 3HULA 1NMUA 4NE9C 4R0EA 3PX6A 3V8XB 3V4MA 1O7TA 5IC6B 1B0TA 3FQLA 1RBAA 1YYZA 3MUQA 1GMWD 4ND9A 4ZHRA 2D21A 3VE1B 4DZ1A 4OI2A 1FX2A 2CZIA 4UY8T 1B58A 1YDLA 4OI4A 5HSPA 4XKNA 2ZITA 1CJTA 4NF5A 2PMHA 3EVOA 1U47A 3F73A 4Z7YA 2ZHBA 1N6QB 4EUVA 1S1VA 1B3LA 5HQ8A 2Z30B 2ADBA 1Y11A 4ID5A 6FD1A 4BC9A 4XK8C 5AA1A 1CE2A 3R7SB 3ZZRA 4LQ9A 2MZRA 1QTNB 3SSRA 1AUSL 2YKOA 2NLWA 3H6WA 3DGVA 3EZ5A 3ZKKA 4XXUA 3RAQA 4PQJA 1K9YA 1PJ7A 2ABYA 4JI2F 1Y10A 3A1YG 2HZAA 5ICTA 3KOSA 2MQMA 4QPTA 1FD2A 1IKWA 2X1AA 3M6WA 3DLHA 3FUZA 1RKMA 3NL0A 1R6VA 1A0OB 3KKFA 4DPOA 4PFUA 1SW5A 2Z4PA 2KG1A 2O1PA 3WHIA 4MAKA 1D9AA 3PW2A 1NK6A 4R6HA 1I1GA 4MMOA 8ATCB 3TR5A 1RCOB 1B5JA 5K14B 1WTBA 4B3RF 4QIWD 5AJ3J 2XXYA 1RUSA 3Q2SC 3VVUA 3PRDA 3R6UA 4CTAB 1QY7A 4V19J 3A8IA 4OLPA 2QL9B 2HS0A 3U8QA 4U1ZA 5B7WA 4BDNA 2WOMA 3GILA 2Y0SD 2FNCA 1LCTA 3RBZA 2PI5A 3V6DA 5EHSA 3CJRA 4HACB 4DS5A 2DXDA 4NMXA 3DRSA 2RDIA 1OY9A 1NI9A 4DR3J 1NCLA 2B4OA 3FCWA 1HYSA 4X4TA 4USWA 3HT3A 1CS4B 5IS2A 1DTZA 2FZGB 4WF9Q 1B4ZA 3KLVA 3CCQS 3GFXA 1H7WA 2FBPA 3OELA 4QWAA 2JWNA 2YY3A 1YWXA 2NUHA 1N56A 2ZNUA 4QWEA 1TVRA 3QZ8A 1E6VA 3HT0A 1SJ3P 3GWCA 3OL9A 2I0BA 3IRXA 4GL0A 5KFTA 6FDRA 3G3HA 4PG7A 4LIWA 1H76A 2MYFA 4ZIVA 1MRPA 4J5OA 2BANA 1U1NA 3DOKA 3S1TA 5I84A 4JBZA 2BJ1A 3H5YA 4OVSA 4JOUA 3H5UA 3PUYE 3M8SA 3GLJA 2OBGA 5CI5A 1XEZA 2OMOA 5LL6d 3DM2A 4DL3A 1ZJLA 2XYGB 5ETMA 3K00A 4ZPTR 1W2BR 1RT1B 1B40A 4QU7A 4W4MA 4LF9F 2IVFB 1C1CA 2GHPA 4FKXA 5EGYA 3FK4A 3VTIA 3VCDA 3DNCA 4CQ1A 3DLGB 4QWDA 1B5IA 5AE2A 4R0JA 4LF7J 1PYTA 1X4BA 1S9EB 1FPIA 1KFSA 1GT8A 1N54B 1FRMA 5F8LA 1Y9OA 3C6UA 5DT6A 5C5JA 2QS2A 1NUXA 1JLCB 5C25A 1ZTWA 1JLBA 1WVJA 1SL1A 2DH7A 4O44B 3IAS9 1KC8T 3I55S 1HI0P 4TLMB 5CAAA 4LRBA 1P9QC 3LWMA 3EM1A 4YR0A 5IWAJ 2GCFA 2C28A 1E6VB 2V8HA 3C14A 3Q23A 2PEBA 4PRFA 1HIYA 3V81B 4R2FA 4QFLA 2WK4A 4C3KA 1ITPA 4O3BA 2KB2A 1UVKA 3V83A 5D4PA 3CSGA 4HT5A 2ZJRQ 2M8HA 4PF6A 3D1RA 2OSRA 4CLZA 3DOLB 4FEDA 2HRTA 2KJVA 3MZBA 1XOCA 4NI2B 2EK1A 4F0HA 3OTCA 1S6PB 2CEXA 3PR5B 3MEGB 1IBKF 1P99A 4IH6A 3MZ9A 1LFIA 4CLSA 3Q28A 1MNEA 1BP5A 1EJ7L 2C22A 4WWSA 3BDPA 4R74A 4TY9A 2OFGX 3R6GB 2GW8A 3C16B 2CAJA 2D41A 3LP2A 3T1HJ 3PXGa 2COLA 3PDNA 4FBUA 3WQPA 1HNIA 1JJ2R 5K8PA 4ED5A 2CQ4A 4KE5A 3ILUB 2JX2A 4H4OB 1HSLA 1RWPB 5CYJA 1HR0F 1O6XA 3CG3A 1MM6A 3E4RA 2AL4A 1EKSA 1USYE 4MHFA 5IC4B 4P7VA 1SV5A 2V2QA 4RBVA 3LPEA 3T9VA 1VFEA 4OYIA 1HQEA 4PAFA 4OEUA 2M5YA 4N91A 1S49A 1N5YB 1F5AA 4QWBA 2XS5A 4DI6A 3DLKB 1MDQA 2J9DA 3ZZUA 3OLAA 3JQJA 2Y3YA 4M94A 1NKXA 2B0GA 1IMFA 2HMIA 1FESA 3ZNJ1 3BYRA 1S6QA 3MD1A 1U4BA 4C0OC 1JLAA 3KLFB 2YLNA 4UW2A 4NXMF 4KCCA 1WTFA 3VV5A 2UXCJ 2XI3A 4H8IA 1H73A 1MU2A 4B3TJ 1J5EJ 2F4VJ 4DL0C 2R7UA 3D0IE 4DPYA 2UYFA 1WC6A 3NOGA 3CCES 1RDXA 4IOCQ 4G3IA 4I2PB 2UUAF 3QJPA 2Y5LA 4Q8RA 1FJ9A 3CDAA 3AOCA 5KZTA 3EGVA