3LUYA

Putative chorismate mutase from bifidobacterium adolescentis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
326
structure length
326
Chain Sequence
MSARKLFYLGPQGTFTHQAAVNAAQELARFEPQGFDLMPMDDVPQILDAAQHGDGWGIVAWENNVEGYVVPNLDALIDAKDLVGFARVGVNVEFDAYVAQGADPAEARIATAHPHGLAQCKRFIAEHRLSTQPATSNAAACRDLIPGEIAFGPAICGELYDITRIGTAIQDYQGAATDFLVLSPRAEVARLLAKPRAEANVEYESVLTLIPLVTGPGVLANLLDVFRDAGLNMTSFISRPIKGRTGTYSFIVTLDAAPWEERFRDALVEIAEHGDWAKTLAVYPRREHPNPPVTSWMLPQGGVRLDDSHLPDDWQNDETVRRELMW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Probable chorismate mutase
publication title X-ray crystal structure of putative chorismate mutase from Bifidobacterium adolescentis.
rcsb
source organism Bifidobacterium adolescentis
total genus 93
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3luyA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3luyA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3luyA02
1LSTA 1B7HA 2PT1A 1ELJA 4DCXA 3M3KA 4Q5TA 3DP4A 3VVFA 2Y7KA 4NF5B 4YB7A 1H43A 5TP9B 2PYYA 4NTLA 2I4BA 1EZPA 1Y9UA 5I2NA 2VP1A 1D3KA 3ECRA 4IO2A 4GMKA 3S9NC 1MQIA 1D9YA 1IXGA 2HCAA 4R2FA 1NNKA 3FUZA 4ND9A 4WEDA 1Y4TA 4IY5A 4OETA 4P0IA 3B7DA 1Y3QA 4DZ1A 1A7LA 1IXHA 1OLCA 4ZS9A 5I2KA 3K2DA 4BDMA 2DP8A 3D4GA 1Z7NE 2QS2A 1LKZA 4M8LA 4I1DA 4NF6A 4RY1A 4JSDA 3KSXA 4ESXA 4PETA 1MY3A 1S9TA 2QSWA 2RC8A 2XHDA 4G2ZA 3E3KA 2I3VA 2I4CA 3FJ7A 1SW2A 3K1MA 3AB4B 4WKMA 4R2BA 1B46A 2PMSA 1SYIA 2W7YA 1Y20A 4N07A 3LSLA 3LC8A 1M0SA 3HO7A 4R72A 4DXCA 4TLLB 5DYHA 3C31A 2THIA 3OBIA 4ZZAA 2OWSA 1Y7PA 3GXAA 1HSEA 2Z8FA 3JYRA 3HV1A 4FECA 1BIYA 3C9HA 4XXUA 3S4UA 3GLBA 3PMVA 4U1ZA 5F1QA 4ISUA 3V83A 5L9SA 2V3QA 4IO4A 4DCYA 3RUMA 5AA2B 3H6TA 3DDNA 4NF5A 4AB5A 1LAFE 5TP9A 3TTNA 3HHGA 2NYIA 3CI8A 4N13A 3MW0A 2I9SA 4F19A 4MBPA 2P2AA 2R9JA 1MPBA 3ZKKA 1AMFA 3C34A 4R73A 3HN0A 3OSQA 3TTRA 3AAWB 3EN3A 1M5FA 2DE2A 3T9XB 4YMAA 2I58A 4ELPA 3IXQA 3D4CA 4H8IA 4P0GA 4FJPA 2DVCA 2I3WA 5TU0A 1NNTA 2D3IA 1JW5A 2F7BA 4FIMA 1LCTA 4QFOA 1N7WA 3TFLA 4NF4B 2QPQA 4PQJA 3CFZA 4XKQA 4YKIA 3DP8A 3T9UA 1II5A 4ONYA 1NMUA 3PUWE 1YCJA 2F35A 4QFKA 2REJA 3U93A 5K2YA 3K00A 3OELA 2RC9A 1B3LA 1ZU0A 3H6VA 3OEKA 4R6HA 2Q2CA 2QMWA 3R6UA 2F8DA 3IL1B 3NRBA 4F39A 3MQ9A 1B7ZA 2Q9TA 3MAHA 3QAXA 2G29A 2O6AA 4Q30B 1YTVA 4F2OA 4IO5A 5KCJA 1MQGA 3K6UA 4PFWA 1RKMA 1WVJA 4EXLA 5JTYB 1LK5A 2UYFA 4JWOA 4FATA 4N6PA 4C0RA 2H5YA 1NH8A 3FV1A 3KJ7A 4HTGA 1UJ6A 5BUUA 1UJ4A 2XXXA 3OFEA 1AIVA 4JDFA 1PC3A 4Q8RA 4WXJA 5A5XB 2O1MA 5HM4B 1LGBC 3PPNA 4ZEFA 5AA2A 4MF3A 2DTJA 1SI0A 1MXYA 3PD9A 2PX1A 2ABHA 5EHMA 3RNNA 5F7VA 3A3CA 2FNCA 4XTCQ 1B52A 3OD7A 2FGCA 5H8QA 4F1UA 4WEPA 4QFLA 1EZ9A 3KFMA 4OYVA 1B3GA 1US5A 3SDFA 3PPPA 5L9MA 3L7OA 3MP6A 1ZPVA 3KN3A 2Q8JA 4F3PA 3FVKA 1MM6A 1B32A 3KSJA 4OHNA 2ZYMA 4U22A 2GH9A 4NF4A 1FW0A 2ZXTA 2RC7A 2NWJA 1QJMA 1AL3A 4QHQA 4RYAA 4EQ7A 2X26A 4F22A 3VLWA 2I48A 1NNPA 4UACA 4BDQA 4OEUA 3MUQA 4GRKA 3HSTA 1JETA 1D4NA 1MXWA 3MPLA 1ZLQA 1FTOA 2B3BA 1FCKA 3MJNA 2AL4A 2XXTA 2E0SA 3K5PA 4YAHX 3CFLA 3O6GA 1MH3A 1JNFA 5H8NB 2OWTA 4PFYA 2KO1A 3G3KA 3K0VA 2D5WA 3W15C 1ATGA 5JTYA 3I5OA 3OEMA 2XX8A 5J1DA 3FV2A 1L5TA 3PPQA 3UK4A 1A40A 3P7IA 2X7PA 4RK2A 4F18A 3K6VA 1SW4A 3MP1A 3RQTA 2DE3A 1MXVA 5A5XA 3BKIB 5AA4B 3LR1A 3LSWA 2HZLA 5IT4A 4KYSA 4C1UA 2DT9A 2XXPA 2XX7A 1H76A 1YGYA 4FE8A 5CMBA 1GR2A 3ZSFA 1TWYA 2V25A 1FQFA 2O51A 2XD3A 3V8XB 2VD2A 3U92A 3DELB 2CDQA 2J0WA 3IAZA 4OENA 1QULA 1MPDA 1MH4A 5HPQA 5AA1A 2ANJA 5DEXB 1IQ7A 1QUKA 5CRYA 1MDQA 4QSDA 5CMCA 3MVYA 3TUZC 5DVJA 1DTGA 1O64A 1F9BA 2Z8DA 4OMBA 3ENVA 1LK7A 1US4A 2ZYNA 4MLQA 2F1FA 2DOJA 3Q29A 2P9EA 4F3GA 2LVWA 2I6EA 4LVQA 3O1LA 1B5JA 1OIBA 5H8HB 3RT6B 2XD2A 3DHXA 5CMMA 5IS2A 1P1OA 2UVJA 1JW4A 1YPNA 3FVNA 1QUJA 3Q28A 1B3HA 4P11A 4GL8A 2XX9A 5H8NA 1N3XA 1VSOA 4YZZA 3EHUA 3H6WA 2PT2A 4JXIA 1LCFA 4GLIA 4PWUA 3O2AA 1WODA 2XXHA 2Y7IA 4E0XA 5I56B 1I6QA 5AE4A 4XKRA 5ITOA 2P0SA 5AA4A 3QIMA 3MWBA 3WAEA 4G4PA 4H8JA 3TTLA 3EHTA 4GWOA 4H65A 3VE1B 3C33A 3RPWA 3VXCA 5ELVA 4U21A 2QS1A 2UVHA 2QRYA 1B0HA 4ELQA 1AH5A 3I3VA 3MBPA 3N26A 5CM6A 4F1YA 3FIRA 1P1NA 1B3EA 1B9JA 3KEIA 2DXYA 3DLNA 3GBAA 1NFTA 3SEXA 3RT8A 3C4MA 3L6GA 3E9XA 1MY1A 1LBCA 3IOWA 1PBPA 3Q26A 1B7UA 2AL5A 4JSOA 3VVDA 3I6VA 5AA2D 1SVXB 1VFEA 1P1UA 3KOTA 3TQWA 4GIZA 1NKXA 5IT0A 2F97A 1R6ZA 4ECFA 2ZHOA 5DTBA 1IXCA 1B5IA 4MH5A 2RE1A 1Y4CA 2R71A 2OZZA 1XS5A 2PBWA 1JVXA 4I62A 4H6DA 1ZBMA 3OSRA 1UQWA 2VGQA 3ONMA 3OO7A 4RA1A 3GBBA 3KOSA 2M8CA 3IOUA 4G68B 1CB6A 4O3CA 3IOTA 4BDLA 1XC1A 4NE4A 3B6QA 3SERA 1U8SA 4F31B 1H45A 1SW1A 2GHAA 3TKDA 1P1WA 1UIVA 4R6KA 4AB6A 1T0KA 2WKYA 4PP0A 1A8EA 3TQLA 1N04A 3O66A 2Y84A 5AA3A 4X48A 4QRZA 4GXAA 5I56A 4KD5A 4LZ7A 3TYHA 5IKBA 3K6WA 2PC6A 3IB2A 3E4RA 4G77A 2DWIA 1PDAA 4NEDA 2REGA 3FGSA 3KN7A 3G3FA 4U4SA 3RY3A 2YLNA 1DSNA 1BTJA 5IAIA 2QSXA 1SDXA 1FTJA 1FTMA 1DPPA 4F3BA 1PSDA 4BDOA 3N5LA 3TEPA 3FJMA 1XHYA 3FASA 3MZ9A 4QSEA 2F8MA 4F1VA 4M1VA 3JZJA 2V84A 4ZZEA 3IB0A 1Q1KA 4LUBA 1BKAA 1CE2A 3K1PA 4X84A 4KCCA 4OEVA 4X9TA 2YJPA 4YB6A 4YICA 3FD3A 1XOCA 5TPAB 3EF7A 3R26A 4RXLA 2VHAA 3MVZA 4OFOA 3PPRA 4POWA 1I6AA 2H4IA 2RQKA 2OCUA 4ELOA 1A54A 1MQJA 4U4XA 2XXWA 4GVOA 2DYXA 4GQOA 2ONKE 1BP5A 3QUJA 5I57B 3N6TA 4U2RA 2DQVA 4KHZE 1B05A 3A3UA 2UYEA 1DPEA 3B6WA 1VR5A 2CMOA 3OXNA 3TPAA 4BDRA 1MS7A 2P9CA 2I0BA 3N0VA 1JVYA 3B6TA 4IGRA 3S9EA 2OLBA 4G68A 1B1XA 4YU0A 3LUYA 2RF1A 1A8FA 1I69A 5CI5A 5FIIA 3IR1A 3ENQA 2RKMA 4OFJA 5FHOA 1N76A 3PD8A 3SEWA 3OO9A 1VE4A 3PU5A 3LOUA 3K6XA 3UW1A 1ZJLA 2HAUA 1SD3A 4YKKA 3O97A 3PMWA 4RPOA 3IB1A 3K02A 1RWUA 2LQJA 2F34A 4ZEDA 4JWYA 4G8NA 3TUIC 2HFBA 2ONSA 3THIA 1IXIA 3H6UA 4GXSB 2NVUB 5B70A 3MP8A 3MC2A 3OENA 3G3HA 4R74A 4GD5A 1O7TA 3RGYA 1B1HA 2ZYKA 5KZTA 1P1QA 3VFJA 1LFHA 5LOMA 1VFDA 1UJ5A 1URDA 4Q0CA 1B5HA 4XKPA 2HEUA 3LBSA 1SC6A 1OMPA 1H3DA 3T22A 2O7UA 5TPAA 1DOTA 4UA8A 4PFUA 2OK2A 5CC2A 3MZ1A 2JOQA 3VXBA 4IB2A 1YAEA 1LAGE 3IO6A 1LFIA 4EQBA 4RK9A 3FATA 3USDA 4M4GA 3G3GA 1M5CA 1SI1A 5I57A 3K01A 1GVCA 1KWHA 4OWDA 3HHEA 2IEEA 5CMKA 4R6YA 3O29A 2YPNA 3CEDA 1UTBB 3TUSA 4U1OA 5FHNA 3VVEA 3O6HA 4ZDMA 3SETA 3Q25A 3Q27A 1NH7A 4KFQA 2I0CA 2NOOA 4GL0A 4H5GA 2XXQA 1LB8A 4LATA 4LZ5A 1B2HA 5JJBA 5JEIA 1PB9A 1N84A 3QUFA 1MPCA 5L8DA 3UIFA 5DVFA 5I58B 4G8MA 3T93B 1KS2A 3MTJA 3DM0A 4DXUA 2DWJA 2XXYA 3MVWA 1YBAA 3DP6A 1TXFA 4QSCA 2MDAA 2ZMBA 3M3LA 3U1OA 4PE5B 2ALUA 3WAFA 5I2KB 2NXOA 2Q89A 5T41A 1FTKA 4KCDA 4YB5A 1OQHA 4QFNA 4OTEA 3VLVA 1IIWA 2PA3A 2QL3A 4EDPA 4H1XA 1LLSA 1QKBA 1QUIA 4FEBA 4THIA 2A5SA 4TQUQ 3H06B 1EZOA 3HHFA 3M3FA 2F7CA 2Z22A 2DS9A 1MDP1 1B6HA 4EXKA 5DT6A 4FEDA 2XXIA 4IO1A 4ZEKA 1MXUA 4GF8A 4EQ9A 4RJZA 3EHSA 2HZKA 5ICTA 3CSBA 3U7JA 1B4HA 2D21A 4O3BA 3TUJC 3T66A 2O69A 2QS3A 2UXAA 3M8UA 1GV8A 3SKPA 1O8BA 1SW5A 2ZNSA 5H8SA 2Z8EA 1LAHE 2H9BA 1FQEA 1R1NA 3S2VA 5EHSA 2F5XA 5ISUA 3QK6A 4DXBA 1UTBA 3F11A 3HPIA 3ENWA 1R9LA 5DVIA 1A55A 3S1TA 3KBRA 4F2QA 3C32A 2JHEA 2J0XA 2H25A 4XIGQ 2Z23A 3TELA 4OQOA 2RCBA 4FORA 4I9DA 3TTKA 3KZGA 5I58A 2DSFA 2BJJX 4ESWA 3K4UA 2RQMA 4Z7EA 1URGA 2DE4A 5H8FB 3IX1A 1UIUA 3PV0E 4GO5X 2ZYOA 3PUXE 3UORA 3FZVA 4RNSA 2CZLA 2ZNTA 3OFGA 1BLFA 3FVOA 4ZECA 3O6IA 1OVBA 4ELRA 1AOVA 3ILUB 1POY1 2HQ0A 3H03A 4ZE8A 5DEXA 2I49A 3IJOB 2Y7RA 2AIXA 4EUOA 1M5DA 5KDTB 2F6GA 3H4ZA 3LSFB 1PEBA 3GZGA 1OLAA 3W9WA 1XVYA 3TDJA 2E1SA 5K2XA 1FQBA 2X7QA 3N6UA 1N0TA 1ZTYA 2H98A 1P99A 4F3SA 3CG1A 5FTIA 3OFFA 4K3FA 3TAJA 2H99A 1IUDA 3L6HA 1N3WA 4DIGA 4LA9A 4EF2A 4GO7X 4JB7A 1N7XA 2F36A 1PBQA 4ZEBA 4MFIA 3ZKLA 1OVTA 1JEVA 1SYHA 4GOTA 2A5TB 4QF9A 3U94A 5H8HA 3RLFE 5B7DA 2DWHA 3H3GA 1FQAA 2OJTA 2KLFA 4H0WA 4Z0IA 1FQCA 1MRPA 5EYFA 5KCJB 5BWJA 3JV9A 2AYSA 4KYEA 2QMXA 2Q2AA 4H67A 1Z7ME 2V93A 1LAXA 3VDFA 3TODA 3TTMA 4H5FA 4AQ4A 1LFGA 4HCWA 4KI0E 4LP2B 1USYH 1POTA 3KGCA 4HW8A 3KN8A 3ILTB 2Y7PA 1EU8A 3SEUA 2H9ZA 3DC2A 1PB8A 5I59B 5FHMA 1NL5A 3PUVE 1EH3A 1GGGA 2V3TA 1JEUA 1ZMGA 1MXXA 4OFLA 3T9HB 5H8QB 1FQDA 4DE8A 3IOVA 3UN6A 3IO4A 2RINA 3S9MC 5H8FA 3OO8A 4KYDA 1GTKA 5FTHA 4R75A 1R9QA 1NNFA 1ZKBA 3ODBA 3QXMA 3FJGA 2GHBA 1UTHB 3BBRA 1O63A 3O28A 5KDTA 1I6BA 2HAVA 1SQYA 3IJXB 4NF8B 2B65A 4DLDA 3U72A 4KPTA 1MQDA 3MPKA 2P9GA 2GFEA 1Y3PA 1JW1A 3CG3A 2P1SA 3PUZE 2UVGA 3AB2B 4NMLA 1B0LA 4X1DA 1B58A 3C36A 2QS4A 4YKJA 2OBGA 3VLUA 3R7XA 3UA8A 3LSXA 3QYTA 4XKNA 1XT8A 3SEVA 3TCFA 2QRRA 1LBBA 3A09A 4IY6A 4G68C 3T96B 3FXQA 4G8HA 5CBRA 5ICQA 3CVGA 4LQ5A 3EQ1A 2A5TA 1S50A 1WDNA 2IA4A 5HBCA 1B3FA 3BFTA 3SESA 1DMBA 3U8QA 4U23A 4ZE9A 4FAJA 1IZ1A 3W7BA 4GFRA 1B4ZA 3TMGA 4OXVA 4JBZA 3ZS6A 5JK4A 3HCQA 4X1BA 2VD3A 3C35A 4IO6A 3IK6B 3O9PA 2F6PA 1D9VA 1J1NA 1MM7A 2ONRA 5I59A 4PFTA 2O1LA 2O84X 1FTLA 4HS7A 2FA7A 3KG2A 3N94A 1H44A 4NWCA 4DDDA 2F7AA 2DWAA 4C1TA 3CIJA 3H7MA 3VV5A 1QW0A 1ANFA 4F29A 3CSGA 4NMYA 3CR9A 4OERA 3T9VA 4KR5A 1IEJA 1UTHA 3FVGA 3RTWB 1QKAA 2XXVA 3MZBA 4LQ2A 4RPNA 5CBSA 4NF8A 4IGTA 5M2VA 3AXFA 3KWMA 1SBPA 4L17A 4EF1A 4IO7A 1RYOA 5I84A 1A99A 3RTFB 4NWDA 2B3FA 2V3UA 3CRBA 4YKPA 2O68A 3K1NA 4OZ9A 1TFAA 2DXRA 1QVSA 3OFHA 2ZNUA 3G7WA 4E0WA 1MXZA 4LONB 4OVJA 1MY4A 3V89B 3OO6A 3IORA 3S9LC 2GRVA 2XXRA 1PB7A 1B40A 2F78A 3PUYE 1Y3NA 4TLMB 3CFXA 4O3AA 3V5AA 3IBWA 5I2NB 2VOZA 3FXRA 3EPEA 1Y1ZA 2QJEA 1IITA 1MQHA 3KJTA 3DHWC 3QSLA 4OESA 2Y7WA 4QFPA 1Y1MA 4I8CA 4ZEIA 3TZAA 1HSLA 1XVXA 1MY2A 1ZIUA 4TOZA 3PPOA 3E13X 4MLVA 5L9OA 2RCAA 4POXA 3RN8A 2G93A 2O7IA 3W9VA 3MAMA 3UP9A 4NF6B 5ITPA 4LZ8A 2NUVA 3OMBA 2FYIA 1S7YA 3G3JA 1M5BA 1JQFA 3TCGA 3SEYA 2ESNA 1MG1A 1M5EA 1XTZA 1USYE 1B51A 1RYXA 2DVZA 4IO3A 2XXUA 1Q35A 2R6GE 2PVUA 4R9GA 3PMXA 4KQPA 3PGFA 4BLAA 1LB9A 1TFDA 4R9FA 1MY0A 4JWXA 1HSJA 3MVXA 3TCHA 3OOAA 1DTZA 1OQGA 4HCYA 4YMBA 3P96A 1URSA 3FXUA 3G3IA 3BFUA 1TT1A 2HXWA 4BDNA 2UVIA 2LAOA 3UGWA 2Q88A
chains in the Genus database with same CATH superfamily
4HHJA 1F6TA 2XWOA 4OYZA 3EDQB 3EICA 3SIPB 3HVWA 3R3TA 4Q5TA 4O44B 2LFVA 1H43A 1S72S 3CCJS 2X1GA 5KFQA 1U0HB 4MX6A 4CLZA 2C3MA 5I2NA 1WEZA 1D3KA 3ECRA 1HHQA 1VRTB 2LQ8A 2LP4A 2DNHA 1D9YA 1IXGA 2HCAA 3UDVA 5D6GA 1U45A 2CPIA 3ULHA 4WEDA 2MEWA 2OD4A 4P0IA 2BKPA 4CWBA 4LF4F 2W9AA 3T5LA 4LF8J 4AD6A 2PDAA 2AKWB 1OLCA 4ZS9A 4BDMA 4NA2A 2XLIA 2IC3B 4NLSA 5IV3A 4ZJOA 3D1QA 2ZH2A 4NF6A 3CPWR 3LA0A 1YZ6A 2CAJA 3KSXA 4ESXA 2DHHA 1MY3A 2FJDB 2QGFB 2KT2A 2QL5B 5AT1B 2XEXA 1SW2A 4RBTA 3IS9B 4I6YA 4R2BA 2ZD1A 1SJFA 3F73A 2D1CA 2B9XA 4MAGA 1O6XA 2Z58B 3LC8A 3TA1A 3HO7A 5HLFB 1U0SA 1U1QA 5MAOA 4DXCA 3EVMA 2THIA 1SV5A 1QLNA 3SSRA 2HFSA 4NLUA 1CG2A 1VQPS 3WZ0A 4Q8EA 2Z8FA 3HV1A 2VKRA 4HTIA 4DQQA 3ILOA 5A8KB 4M94A 5DDPC 1T05A 2W8LA 4U1ZA 1HBNB 3LWMA 4KIAA 4JV1A 2AQ4A 3PRVA 4RUHA 4Q2MA 4FYXB 1S10A 4KO0A 4C98A 4NF5A 3I4PA 3CIMA 2ATCB 1TUWA 3HHGA 1HBOA 5IT9Y 2R7OA 2B6AB 3RZAA 4FVMA 4N13A 3MW0A 2B3TB 1C0TB 2R9JA 3FSIA 1MPBA 5ET5A 4K0KJ 2HS3A 3KJVB 2HHWA 1O51A 4ZJLA 3CMQA 1S9GB 3OSQA 4KHPF 4TLRA 2HHVA 1NSQA 2LDYA 4Y0FA 3T9XB 4YMAA 4DR6F 2YH1A 1PC4A 2XM3A 4K50A 1BQMA 3ITHB 4N6DA 1RTDA 3TA0A 5TU0A 2KHCA 4XO0A 2C2NA 3NY0A 3JQKA 4QFOA 3NCQA 4LRFA 3VAGA 2QPQA 3W61A 2JFDA 3FUYA 3DNCA 3T9UA 3MPWA 1II5A 3BGRA 3CCLS 3O3LA 2WSEC 3NCRA 1NMUA 5KT2A 2KVQE 2XY5A 2Q1LA 1DTQA 3ZTPA 1AROP 3CDWA 5J2NA 2B8PA 3MEGA 5I5PA 3OELA 1VQ4S 3R5AA 2B0GA 1CBKA 3TQ1A 1TFWA 3L95X 5K20B 2DR7A 3UD5A 1BWVA 3NRBA 4GKJF 4F39A 2OUGA 1B7ZA 3FRYA 4MIBA 5AE2A 3TP2A 2Q9TA 3MAHA 3QAXA 4LSZB 4Q30B 1YTVA 1Y5IB 4EFAC 4Y2AA 3B4MA 3LPEA 2XMWA 4IO5A 4GX6A 1LK5A 4FATA 5LDZA 4N6PA 2H5YA 2DY9A 2J7UA 2XS5A 3KJ7A 4HTGA 5IV4A 1PC3A 4LRBA 1SC1B 2F5GA 2J6SA 3PPNA 3PZPA 5AA2A 2G13A 2DTJA 2GA7A 1FBCA 1MXYA 4ZIVA 3NOGA 1YSJA 4OYWA 2DNGA 4J7CA 4S0MA 5EYGA 2N4DA 4ECWA 5F7VA 4NLPA 3MCSA 3OD7A 1MMNA 4F1UA 3IRXB 3VV2B 3EXCX 4QFLA 3KFMA 4X4NA 3DOLB 3ELHA 2HAFA 3SDFA 4YUDA 1FE0A 3X1LB 4P74A 5FDLB 1BQXA 2CJ9A 3FVKA 1Q4RA 2KYZA 1HWKA 2YNFA 5HVHA 1FPEA 3BGOP 1MM6A 3RUBL 1FW0A 4ID5A 4FF4A 4ENOA 2ZBIA 2DNNA 4F22A 3VLWA 2I48A 2DR8A 2CJBA 4ZPTR 4UACA 4HI2A 4BDQA 5F9LA 4CZCA 3NGRA 5LMNJ 4F0MA 4L6V3 2CZIA 3L3CA 4B3SJ 2K2PA 3MCOA 3DRSB 2VONA 2VQFJ 3UCGA 3P45B 2B3BA 5LT5A 3MJNA 1KOOA 1WF1A 2XXTA 1N6QA 1U6FA 4F0KA 4ES1A 4O8MA 2AGPA 3CFLA 1KQGB 2CFXA 3U27A 1FFGB 4GRSA 5BYRA 2BW2A 4IRDA 1ZBTA 4PFYA 4OHYA 1U49A 3K0VA 1AA1B 3P4UB 1RT4A 4WK1A 5JTYA 3OVSA 3OEMA 5J2MA 4ZVSB 3TZXA 2XX8A 3FV2A 1TKDA 3EPGA 3JAMU 3UK4A 4F18A 5K8PA 3K6VA 3VGVA 1FNXH 1SW4A 3B4DA 2V4QA 4L3KA 3RQTA 4NCAA 2O1PA 5A5XA 3BKIB 5AA4B 3LR1A 1C0UB 1WG1A 1XEZA 3LSWA 1TKXA 2F40A 2HZLA 2KN4A 4KYSA 3MPUB 2CQIA 4PFIA 3LP0A 1YGYA 4MAKA 3TEHB 4Y2CA 3ZSFA 1TWYA 2V25A 2O51A 4CLPA 1WC3A 4JI8J 3DELB 1R6VA 1RCXB 1MPDA 1IKVB 3M8PB 1MH4A 2EFQA 5HPQA 4MFBB 4OYMA 3GIIA 3Q86A 3TZYA 5KAKA 1TQLA 3KDNA 5CRYA 4ETZA 3FCVA 4ERDA 1GXUA 5CMCA 2W2PP 1FTRA 3DRRA 4CDIA 2VQEJ 1T94A 1DTGA 3FBBA 4OI3A 3E2EA 3EWGA 1NNDA 2BE2B 2GCFA 1Y3JA 1US4A 4OHVA 3GYNA 1H7XA 5DQIA 3G82A 1PBUA 2IVYA 3CCWA 3NOHA 2F1FA 2DOJA 3Q29A 4OZJA 3IN5A 1J5EF 5HN0A 4F3GA 2ZKUA 3MD1A 1TAUA 5D4OA 3VR1A 4IH7A 3RGIA 1B5JA 4YMEA 2W9BA 2ILYA 4P11A 2MKJA 3I0RB 4MHFA 2R7SA 5H8NA 1N3XA 3MPYA 2MJUA 3FC9A 3AD8C 4X4QA 1C1CB 4YS2A 2WVBA 4QIVA 2BABA 2AJQA 2DGXA 1N5YB 2YX7A 2NCKL 4DMZA 1X0FA 1FD8A 4OJGA 2MKIA 2HHUA 2XXHA 2Y7IA 4E0XA 5I56B 3G6XA 5AE4A 3SZ2A 2JC1A 2WYKA 3GYXB 1X7VA 4LF2A 5DS7A 4BWJA 4GWOA 3QFHA 4QW8A 4NLXA 4H65A 3NNHA 2LEAA 4P75A 2A18A 4P2FA 5B0CA 4DFJA 2RDDA 3EUNA 3PR5B 2QRYA 5HROB 4MCOA 2XG8A 4N17A 1IMAA 4A8XA 1B0HA 2E5LJ 2V9WA 2LEPA 8RUCA 1CULB 4FNIA 4WU3A 1X0PA 3I3VA 3MBPA 5KG3A 4JI0J 5JVGQ 2FVSA 3J7AN 5CM6A 2UUAJ 4PR6A 1JLAA 4P56A 2VFRA 3DLKB 5HVGA 3VAIA 3KEIA 1S9EA 4C8NA 1OYEA 1B0PA 5CZXA 4URSA 2ZM6F 1V3ZA 3L7PA 3C4MA 2OEJA 4AUKA 1MY1A 1K1QA 3IOWA 1U1RA 4JSOA 1QVGR 2FJAB 2JX2A 2DHGA 5T7LB 2ZZMA 1RT5B 3I0SB 2WONB 2F97A 2RJZA 2L9NA 2P8IA 4CO2A 1RTJB 1IXCA 2L48A 1B5IA 2IAJB 1T3OA 2VC0A 2OZZA 3I6PA 1DLOB 2RDIA 1ZBMA 3ONMA 1HPZA 2B4LA 2C2RA 3OO7A 3TNVA 2DEIA 2UXCJ 2UV8A 2MQPA 2ZOGA 2ZJRQ 2CRLA 1RACB 2QZ8A 3PXGa 3FMBA 2NS1B 2AX1A 3IOTA 4BDLA 3B6QA 1U8SA 4F31B 4K4WA 2CEXA 2GHAA 3G8SA 1EP4B 3OPKA 3GG0A 4IKAA 1A8EA 2HFNA 1YLXA 4X4VA 3O66A 3ISZA 4P1EA 1U8WA 4JI2F 3W2VA 3KFWX 5AA3A 1JJCB 3NS5A 1WD6A 4LZ7A 3K6WA 3IB2A 2H1YA 1PILA 3E4RA 3NGUA 2OX3A 3AT1B 4OI4A 4G77A 1IBMF 1REVA 1UW4A 3FQKA 2ZH4A 5CH7B 3KN7A 4NE9C 3G3FA 3M8SA 4U4SA 2B4UA 2ZH3A 1BTJA 4GWZA 5IAIA 4P71A 2WW4A 1TL4A 4NYZA 4IOCQ 3OR2B 3CMES 1UCNA 1FTMA 3J80U 2HRTA 4FP9A 3N5LA 3FJMA 3K7RA 3FASA 1RBOB 1APSA 4QSEA 2AYBA 3FFIA 1EB0A 2CQ4A 1TL3A 5LL6d 3OTDA 1FPDA 2MKKA 1U1LA 1RDZA 5C24B 1Q1KA 1HLWA 1UWBA 4X84A 1OS5A 3BEGB 1XOCA 3QYYA 4Q0BA 3R26A 2W1BA 1H6KX 2EC0A 3M8WA 5CQGA 1HL6A 3MVZA 4POWA 1ZM3A 1I6AA 2H4IA 2RQKA 3FSXA 4DX6A 1NB2A 5G0RB 1TAQA 2APOA 3S7RA 4U67Q 2XXWA 4GVOA 2CNLB 1ZAWA 5E3AA 1W25A 5LSOA 4DR5J 2IM2A 3J81j 3BBFA 5L1JA 5E7OB 4U2RA 4DPTA 4F26A 2OD6A 2PT0A 3OD2A 2ZZTA 2AD9A 1DPEA 2V69A 3B6WA 4GVBA 1UFLA 2H51B 2VPWB 1RAGB 2Z56B 1MS7A 1WG4A 4Q8FA 4O4GB 2PGCA 1JVYA 1GFWB 4DPOA 4ZLLA 1R6YA 1O0PA 4ZVUB 1B1XA 4YU0A 3LUYA 2QYCA 2H4WB 4OYOA 2HS4A 5DG7A 4R0EA 5F8GA 4C0OC 3V6KA 1P27B 2RKMA 2HVHA 1VQNS 3V5RA 1OMSA 4C8ZA 2CNOB 3Q8PB 1IMEA 2HAUA 1CPZA 2XY7A 4NHBA 3O97A 2B8QA 5H1SV 3GFHA 1FRIA 3IB1A 3K02A 3TYTA 4LRCA 1S6QA 4PDDA 1Q0NA 2HPUA 4ZEDA 5CYQB 4G8NA 1NU4A 4CT9A 5C25B 2BVZA 2ONSA 1FRPA 5E3CA 1NAQA 2Z2YB 3H6UA 1S1VB 3AOAA 1HNXJ 4HT7A 3F44A 5F8MA 3OENA 1NLKL 5ET6A 4K0KF 1D9FA 1N48A 2ZBRA 2HFZA 2GC8A 4RW7B 2HBRB 2J0SD 1LWEA 1KKHA 2GFFA 3OJSA 3BQ1A 2CJYB 1P1QA 3VFJA 3DLEB 4N47A 3PYDA 1UJ5A 1NI9A 4Q0CA 1B5HA 3DI6A 2ZDPA 1BE4A 2VKZG 2HEUA 2YKMA 1SC6A 1GT8A 1HQEA 1OMPA 1H3DA 2EI5A 1DOTA 4UA8A 4PFUA 2HGLA 4JB8B 4PFBA 4DLGA 3VXBA 3D7SB 4IB2A 1LAGE 2GHVC 3USDA 4M4GA 3JTOA 3G3GA 1T9UA 4JYAF 1M5CA 1X5SA 3CJ4A 4OWDA 1TKTB 4N15A 3QRPA 5DM6Q 1FTAA 2IEEA 2GMLA 3CCUS 2R2SA 2XSJB 3G87A 3O29A 2N3OA 5KFZA 1T11A 2W7PA 5FHNA 5MLCV 1HFEL 3O6HA 5J16A 1R8PA 4LF7F 1MW7A 2X51A 3C6TA 1GQEA 4I6AA 2I0CA 2NOOA 4H5GA 1QTNB 1EIYB 1Q5YA 4ZCKA 3OXFA 5KFOA 4K4XA 5LOQA 3M8YA 4YOEA 2FZCB 4FKYA 5DZ6A 4OVQA 1YITS 5I58B 4RU9A 4G8MA 3T93B 3FMWA 1FO1A 2YPZA 5THWA 1NUEA 1MU2A 1S99A 2XXYA 1HNZJ 3I4HX 2BOAA 1UVMA 3KHGA 2IJRA 3QGPA 2ZMBA 3U1OA 3WAFA 2R7WA 3MMAA 4MJKA 2A6MA 2MZ1A 5IM0A 3VAHA 4YB5A 4OTEA 3UVJB 5KFLA 3WX4A 3IAS9 4H1XA 1LLSA 1RE1B 1YVFA 2A5SA 3H06B 4F04B 2EBGA 2JVRA 3CCES 2ZEJA 4TQSA 3CF5Q 2F7CA 4ZLPA 1U48A 2DS9A 3TWZA 4I2PA 5EQAA 1FJEB 1EHWA 4PPDA 3BM7A 2YKNB 2HRYA 1X4EA 4LR9A 4ZP9A 3OJUA 5HP1A 3QLHA 4RJZA 4KXPA 2VFSA 2CPFA 3U7JA 4B3MJ 2IRUA 3HVTB 4B08A 3PRBA 2GAGC 4O3BA 4NASA 2XTJP 3MCMA 3TUJC 1TUGB 1VQ8S 5LMNF 2QS3A 3F56A 2CPDA 4B3SF 3H0PA 1IMBA 3SKPA 2Z30B 4A46A 1U26A 5H8SA 2Z8EA 1LAHE 3HFKA 3UD4P 1LBVA 3S2VA 2VQFF 4ANEA 2VG7A 2F5XA 2V50A 4FPIA 1GH8A 5K9FA 2VICA 3FK4A 3F11A 5IQ6A 3HPIA 3JTNA 1FPIA 4TU8A 2RD5C 2EG2A 4KO0B 4P52A 4E0DA 3MCNA 2K3KA 2BZ2A 2RRNA 1S0NA 2MQMA 1Y11A 3U02A 2J0XA 4DR1J 5IWAJ 2CQGA 4CH1A 1NK9A 2Z23A 4UUXA 1C4CA 3TTKA 1VOMA 2DSFA 4F4XA 3K4UA 4CT8A 2DHXA 4O23A 3HHLB 4GO5X 1IKYA 1S1WA 3PO5A 1WORA 1XNRJ 2CZLA 1F5CA 4X2BA 1HIYA 3UDCA 2Q6CA 4ELRA 1POY1 2HQ0A 3GIRA 3IJOB 1IKXA 5E3QA 4EUOA 3AJ1A 4ES3A 5KDTB 2V34A 4RW9A 2DO0A 1DY3A 1OLAA 1VQOS 4JI8F 2Q6BA 2X7QA 2H54B 4PQUB 1NJIT 1H74A 5FTIA 2L41A 3NL0A 3TAJA 5GMDA 2M2BA 3GR1A 2B7CB 1KVIA 2VQEF 4AT1B 4P47A 1JEVA 3HZEA 3I31A 4OZ2A 4J9PA 5H8HA 4IR8A 1F1BB 2B5JB 3ZNJ1 4RUBA 2KDOA 1DRZA 1MRPA 2MZSA 1DARA 3C14B 2V93A 2GGPB 1NDKA 3PFOA 2QG9B 4RNOA 5C42B 2CXEA 3RU0A 5CCMA 1RHKB 1FT8A 5D0GA 5FJ4A 1C1BA 4FVCA 1IN0A 4K5SA 1EU8A 3PJXA 1AFJA 2YKOA 1NL5A 3PUVE 1IKWB 1RLDA 2V2VA 4JOUA 1M1KT 1WI8A 4E98A 1GGGA 1RQ0A 4DFKA 1IWGA 1PO6A 3D2WA 5L46A 4MIAA 1MXXA 1JLCB 5J2PA 4Y2MA 3UN6A 4TLQA 1RZMA 1RAOA 1RI7A 2GO9A 4WXOA 4Z2XA 1XR6A 4LIWA 5A6WA 4ETXA 2DNPA 3OO8A 1NSAA 4KYDA 1RWKB 5HBMB 2P2CB 2JNJA 3HFUA 1R9QA 1AFIA 3LP1A 5KTQA 3ODBA 3QXMA 2ZOFA 2DGUA 4TY9A 4FKXA 1SQYA 3PKYA 4OQJA 1N56A 4NF8B 2B65A 4KPTA 2HQDA 3MPKA 2RRAA 2E5LF 3HSDA 2P9GA 4F36A 1RAAB 3Q8YA 1Y3PA 1JW1A 3CG3A 3PUZE 4PXBA 4JI0F 1N88A 2EG1A 1YJWS 2UUAF 1RTIB 4YKJA 2BJDA 5ETPA 3SDEB 3MD3A 3US5A 4P8BA 5A2QY 4K7QA 4DL6A 1N33J 2H65B 4TU7A 2KJVA 1X31C 2YWKA 1BQNA 4G68C 3FXQA 4JUZA 2EC2A 3VQTA 4FXDA 3CVGA 3EQ1A 2A5TA 1VIOA 1FRXA 1RHQB 2RKIB 3JQMA 1IMFA 3SESA 2O66A 4ZE9A 4DR7F 2FLLA 4DFMA 4DOZA 1J5OB 1W2IA 4NZ6A 4GFRA 4KPYA 5D0RA 2IM3A 3ZS6A 3PIOQ 4DL3A 1PYSB 2CQBA 4IRCA 3QSIA 4RR5A 1KTQA 2B4VA 1QE1B 3IWNC 1CJVB 1FNOA 1X4FA 2N82B 2CZKA 1YIJS 2UXCF 2ZWOA 2OJ3A 5D8HB 2ASJA 2F6PA 1D9VA 1VQ7S 4NCGB 2O84X 1YBUA 2UZAA 3LP0B 4R8UB 4PC9A 2N3LA 1PAEX 5GADI 3D1RA 4HS7A 1FWLA 1PJ6A 4NWCA 2DWAA 1JB0C 3AHPA 4C1TA 3CIJA 3H7MA 4LF6J 3AJDA 2YQ3A 1Y10A 3KK3A 3CSGA 4M5DB 3CR9A 4OERA 4KR5A 2DO4A 1UTHA 2CIMA 3RTWB 1QKAA 1HW8A 2XXVA 3MZBA 1YYZA 2EFNA 2ZH9A 4PBQA 1GMWD 4RPNA 5CBSA 2QA4G 4OA4A 4LSLA 1SBPA 3MTKA 5I84A 2KL8A 1ULRA 1XQIA 3M1VA 3B82A 4DBQA 2GIQA 4YKPA 2X1BA 1GXLA 1DQ8A 2RMLA 1NEEA 3DMJB 5J1NA 2WBDA 1SC4B 4RW4B 1WC4A 3TJ9A 1G6BA 1LBXA 4I68A 4E0WA 1B7FA 1TMJA 4I1TA 1Z1ZA 1FCAA 4UT4A 4RLEA 3V89B 4OYBA 4YY3F 3H2LA 3M2VA 2GRVA 4NLVA 3ZTSA 3LALA 3OL9A 4EBDA 1T9YA 2R7TA 2F78A 4DR5F 4NXMJ 5H9EK 4PYDA 3PUYE 2DVIA 3MAAB 3GTYX 3V6JA 2DPIA 4DSIA 1ZZFA 2XZWA 2VOZA 3RAXA 2W01A 1WEXA 5F0WA 2HK2A 4I69A 3H8YA 3DHWC 3BDPA 1Y1MA 2FZGB 4ECXA 3QT7A 4QQBA 4X4PA 3DOKB 1HSLA 2HRUA 1E6VA 3VQSA 3GIKA 1U47A 1ZIUA 3PPOA 5ETKA 4WFNQ 5L9OA 2RCAA 2VDHA 2CQHA 5A76A 1KQFB 5I3SA 2RF2A 4MKVA 3BSAA 4LZ8A 1BK4A 1WI6A 4EO8A 4NLGA 1SIWB 4KHRA 4W98A 2NUVA 2V4RA 4PWDA 3RPLB 3KHHA 3OVAA 4KRWA 3G3JA 1M5BA 1JQFA 1URRA 1YRUA 4CM0A 1VQMS 4QBUA 2L9WA 1CLFA 2F4FA 3OHBA 1B99A 1NO8A 1HNXF 5T3JA 2BACA 3T5JA 4DUYJ 3K58A 4GX3A 1RYXA 2GQ2A 4XPEA 1RT3A 1QJHA 1HI1A 3R97A 1JIHA 1Q35A 3MI7X 3PMXA 1MWZA 1VLYA 2LKZA 3TR5A 4TNOA 4KQPA 4DUTA 3OL6A 4JWXA 1SQFA 1IBKJ 2QIFA 1D9QA 1LWCA 4KC5A 4QIWD 5D3GB 1DTZA 1ZA1B 4HCYA 3T1YJ 3SFUA 2VBXA 2E44A 4H54A 2ZC4A 3FXUA 1DCUA 2V0NA 3BFUA 4HHHA 2EEYA 4PG8A 4WYWA 4R5PB 3UGWA 2Q88A 4NI2A 3LTOA 4LJMA 1FI4A 2MSTA 3V6DA 3WC2A 2OELA 5ET8A 3DRYA 1ELJA 2LEBA 4DCXA 4I3YA 1NUXA 3BGUA 2J6TA 3DP4A 4M5MA 5TP9B 3AFGA 2ZWPA 2PYYA 2ERRA 4BWMA 3E3XA 5IC4B 3PO4A 4LF1A 4PAAA 3T9NA 3DLLQ 2FVRA 4K4ZA 2Z8QA 1KTVA 5EHHA 3ET6B 1REGX 4ND9A 3W8PA 1O5JA 1R0BG 4G1IA 4J37A 4IY5A 4OETA 2GVDA 3B50A 1RAFB 1A7LA 2XSFA 2B4PA 1XMBA 2MY7A 2DP8A 2IHR1 1Z7NE 2QS2A 1LKZA 1ELOA 3DYAA 4DV7J 4RWWA 5KFFA 4N8GA 4Z7YA 4M5KA 5K8OA 1HNZF 1D3WA 1JKHA 2QSWA 2XHDA 2LU2A 2VOOA 3E3KA 2I3VA 4O7MA 5KFDA 5AE3A 2BKNA 3K1MA 4C11B 2BM1A 1B46A 1TMMA 2PMSA 2N7CA 2W7YA 1Y20A 2COLA 3D5MA 2OMOA 3LSLA 4DSEA 4XTTA 3QGGA 1ZOTA 1M0SA 3RBDA 3M2UA 2VDIA 4TLLB 1UVJA 3N4WA 4EMDA 1RT2A 3VCDA 2CVIA 5H9EJ 3WC0A 3SCIE 3K5OA 5I42B 1IWAA 4KTQA 4KV8A 1HSEA 3Q22A 2K8GA 4FECA 5GAGU 1BIYA 3C9HA 4IG0A 2VV5A 1X9SA 4XXUA 2W4PA 3S4UA 3KHRA 5B09A 5ETVA 1L3VA 4K4UA 4U7CA 2HHXA 5F1QA 4J9SA 3OQ2A 2V3QA 4USMA 3UCZP 4K4SA 3LAKA 3DOMA 2ZH5A 4DCYA 4N8YA 3IBCB 3CCQS 2YKPA 2XO6A 5IGAA 4AB5A 3FCHA 1Q95G 4FF3A 4ZPAA 2BR0A 2E66A 4ED1A 1U0HA 2B43A 2NYIA 4USVA 2OI2A 3HXMA 4MBPA 2P2AA 3ZKKA 2DKOB 1AMFA 4IG3B 3C34A 2CPHA 5EX3A 4R73A 1LWFB 3EZUA 1KFDA 1NV5A 3JXOA 4G1PA 1VRTA 2FJVA 1YX2A 1BY9A 2GHPA 4OFZA 3AAWB 2P3VA 2MKCA 5E0OA 3T6BA 5KFHA 4ELPA 2CYYA 4DR1F 4JI5J 5IWAF 4EYIB 1NXIA 4N41A 3IM8A 2H5JB 2F7BA 1LCTA 2W24A 3KMSA 3TFLA 2IC3A 4PQJA 4YKIA 4C8OA 3DP8A 4Y65A 4D3HA 1BD6A 3DU5A 4WU2A 1FPJA 4FZVA 2V63A 3K0JA 4MIJA 3A3NB 1NPRA 2F35A 3VGUA 1L3SA 3GV5B 2REJA 3U93A 2ALZA 2VASA 2VB6A 3IS9A 1FA0A 3G2XA 3R7SB 2RC9A 3P8BB 3PEHA 2XQCA 3MZIA 4QJVA 3MUTP 3R6UA 2FVQA 2QVUA 4V19J 1QAXA 1X9MA 5LMUJ 1PC5A 4LMZA 4XDCA 4O3SA 4P72A 2G29A 1V5IB 2E5GA 2IPOB 4DX5A 2JJKA 1WC5A 5GAEI 4YDXA 1TL7B 3HDSA 2GJ2A 3T41A 2IRYA 1MQGA 1LXJA 4PFWA 4X62F 1T8EA 1WEYA 2XGPA 2UYFA 1UWAA 4JWOA 4FNHA 5A8KA 1KA0A 2POKA 4ECUA 2XYPB 3FV1A 2OPPB 1HR0J 4OYAA 5BUUA 4WTOB 2J5AA 3FBPA 1UJ4A 2XXXA 2NLWA 3OFEA 1AIVA 2NPFA 1VYAA 2KG1A 1FDNA 3UDLA 4X66J 2ZHBA 1HBNA 4QWAA 4WXJA 3TVKA 1FD2A 2GX8A 4F50A 2V9KA 2HGMA 4H4OB 4MF3A 3L9ZA 1SI0A 3PJWA 4RPFA 2LU1A 1CS4B 4IYQA 2PX1A 5EHMA 1NZAA 4PAIA 3RNNA 2FNCA 4UTGA 1S57A 1V9OA 1C0TA 4JP8A 2CEYA 3KJVA 3BQ2A 2Q74A 1NRKA 1RISA 1S9GA 2G2YA 1U1OA 2G9OA 1OQ3A 1PAUB 4HDGA 4URQU 2MHEA 1K9ZA 2PEHA 1US5A 5L9MA 4WFBQ 3LF0A 3MMAB 3ITHA 3TAMA 4UY8T 4QWCA 2YQ1A 5IM0B 2X1AA 2EPIA 3MECB 2XZDB 3HSJA 1YHQS 4OHNA 4X4UA 2ZYMA 2GH9A 2CDRB 2ROPA 4HL9A 2O3DA 2ZXTA 2KB2A 3K57A 3SEOA 2OGUA 1AL3A 4CNYA 4QHQA 3ZZOA 4RYAA 4C8MA 2UXDJ 4O0NA 1HNVB 4USJC 2G0CA 1S9FA 3FRZA 4O3NA 1AWBA 4WKYA 3JSBA 4PABA 3ZZYA 4GRKA 2Y1RI 2O67A 3HSTA 1YRTA 3MPLA 1HNWJ 4DV0J 1FTOA 2BANB 4FBUA 1R7IA 2HVEA 3DDIA 2AL4A 1FEHA 4IH6A 4LFAJ 1RADB 1DURA 2E0SA 4YAHX 2DGVA 1Q5VA 4MT1A 3O6GA 1OQ6A 2UUWA 4EO6A 2OWTA 2Y1JA 2I5JA 2KO1A 1A7GE 4K2XA 3G3KA 2D5WA 3W15C 1CJTB 1UPMB 3D1HA 2MKSA 1KLNA 3I5OA 4PEOA 2A3JA 2V4JB 3JYTB 5DZ7A 1FBFA 3PPQA 1X5OA 1OPZA 2X7PA 4LBHA 4ZPCA 4UZBA 4GWWA 3KKFA 4NAPA 5L9XA 2DE3A 1MXVA 4L72B 4USWA 4LF4J 1DJ0A 3I5BA 2WVDA 5IT4A 2UUCJ 4DG1B 2DT9A 2XXPA 2XX7A 1KEKA 4WIQA 1I5OB 1T0TV 2E1MC 4NEZA 3MM9A 1CJKB 1WDDA 1FQFA 2Y9HA 2VBZA 2VD2A 3IRXA 2CDQA 2M8DB 3EJMA 4RL1A 3IAZA 2HGNA 3KLIB 4OENA 3H5UA 3DOLA 3NNCA 5AA1A 1PIEA 4DN0A 2ANJA 2BJIA 1ROFA 1QUKA 5FDLA 1MDQA 1QAIA 3D67A 4F3QA 3TUZC 3GYGA 3ICLA 4AL5A 1O64A 1F9BA 2HQ3A 2J9CA 3DCAA 3EGZA 1HBUB 3PIPQ 1ZS6A 3RRGA 1WACA 3ENVA 2HPGA 3UR3C 2IRXA 2OSRA 2YKQA 4LF6F 1CSJA 3KC1A 2YH0A 2CWKA 2I6EA 4LVQA 1LFPA 1RU1A 5HATA 2E5IA 3O1LA 3DRSA 4ED3A 2OPRA 4DX7A 3V81B 1SH0A 3HVAA 2FGOA 1OIBA 4ZVRB 5H8HB 2XD2A 5B0EA 5IS2A 1P1OA 2KQZA 4DI4B 3Q28A 2W2QP 2JLFA 1ZETA 3H6WA 1LCFA 4N5SA 4GLIA 3PR4A 1FPGA 5EQ8A 2B7BB 4C6AA 5KFGA 3G4SS 4USTA 5HMYA 2AJ0A 2CPZA 2E9TA 4XKRA 5AA4A 1C0UA 4LR7A 3QIMA 1UPPA 2G1HA 3WAEA 4B9UA 1IM4A 2PI4A 4NXMF 3EHTA 3TTLA 2OLWA 3VE1B 2V5HG 1WWHA 3M6UA 1TL1B 3VXCA 4TXSA 3W2WB 5ELVA 2M9KA 1FK9B 4U21A 3HT3A 2UVHA 4ZVFA 4QR1A 2VU5A 3PW2A 2UVUA 1IKVA 3M8PA 1S1XA 2N7YA 3GFZA 4MFBA 3FIRA 1B3EA 1Y4ZB 2DXYA 1HYSB 3GBAA 2Q66A 2FHMA 3ZO7A 1XJWB 1XIQA 1D0EA 1TU0B 3E9XA 4GKJJ 3VVDA 3BSNA 2BE2A 3QFWA 1Q9DA 4PRFA 4PCQA 4Y28C 2NQPA 1P1UA 1NV2A 4CLSA 4HE1A 2L08A 5U47A 2UU9J 2R8IA 3AOCA 4QPTA 3D0HE 3SI8A 4J9NA 1R6ZA 1RAEB 3F41A 3T19A 1GTEA 2V2QA 4ILRA 2RE1A 2FVPA 2R71A 2KRRA 5CYMB 1BQNB 3EKIA 5GAHI 4EBCA 3KOAA 4DUYF 2RUGA 3ZZUA 1HQUB 2DNOA 1U2CA 4NYOA 5J1EA 2AW0A 5IZ3B 4LF5J 5HMZA 3LAMA 3OUYA 1K73T 4RA1A 2M8CA 4ZOSA 4G68B 5DGBA 4YB1P 1JLGB 3I0RA 2CPXA 1INPA 2PE8A 1IBKF 3SERA 1OWXA 1G1XA 1RDRA 4R6KA 3TARA 1T0KA 4PP0A 2M3DA 3QAEA 3PX0A 5A8RA 1N04A 3SV3A 4OVSA 2F8HA 2Y84A 2HHMA 1FFSB 2QLFB 1T02A 4QRZA 1S79A 4GXAA 5I56A 3TYHA 5IKBA 2AJ2A 3DM2B 2PC6A 1HWUA 3KTQA 5EQ9A 4W90B 2XMTA 1S7HA 4J9QA 2DGOA 1SVDA 2DWIA 2V68A 2MLXA 1NKCA 3FGSA 1K47A 2AJFE 4I40A 3IR6B 3NGKA 4EYHB 1SDXA 4CYUB 1FTJA 1DPPA 4P2SA 4U8VA 3PYGA 2RNEA 2FJWA 1R43A 3HLUA 1B0VA 3KLEB 3U1NA 3MZ9A 3G8TA 4I64A 5DETA 1CULA 2MSSA 2VPZB 2WVCA 3QZ8A 1LEVA 2R2UA 2V84A 2E1PA 3TZZA 3B78A 4MEVA 4LUBA 1BKAA 1DHMA 3DLKA 4KCCA 4X9TA 3ZZ0A 2RB7A 1QY7A 4YICA 3FD3A 3OSNA 5TPAB 2J8SA 4RXLA 2VHAA 3FEZA 4QYRA 4DV7F 2RU3A 4MYUA 2CADA 4PPZA 1MMLA 1MQJA 1RT5A 4U4XA 2WONA 4JI6J 1R31A 2DRAA 4GQOA 3QRRA 2FIXA 2ONKE 1HARA 1RTJA 5I57B 3N6TA 1NV0A 5AJ3J 2DQVA 2IAJA 3R6GB 4JV2A 1DLOA 4A4JA 1N5VA 3OXNA 2QN6B 3N79A 1FKAF 2BMBA 3PFEA 2I0BA 2D74B 3M2VB 3VZHA 1UVIA 3G6VA 2ROEA 2VFTA 2VL1A 2OLBA 1JMTA 1UMJA 2KM8C 1A8FA 5CI5A 5FIIA 5FBPA 4WJBA 1EP4A 4DL4A 5FHOA 1N76A 2C2EA 1F3FA 3SEWA 3VGTA 5M2UA 5B08A 3LOUA 1VIXA 5KFUA 1ZJLA 1MNEA 1SL0A 1SD3A 1AB8A 2RHQB 2GV1A 3PMWA 4RPOA 1VBKA 5DG9A 1ZZNA 3EE3A 2PN6A 4XF5A 1V3SA 1Y0HA 4OANA 1FFWB 1IXIA 4PF6A 1B0TA 5B70A 4HHUA 1CNQA 1RWXB 4OLOA 5IC6B 3MC2A 2AX0A 3OR2A 4O3RA 2I6WA 2YX1A 3G3HA 5ETTA 3BQ0A 5C2GA 2BRLA 3RGYA 3OXLA 2ZYKA 1X4BA 2DJWA 3GIJA 3Q0AA 2BBEA 5LOMA 4OZLA 3EYZA 4JI5F 3H20A 4DR4F 1S4EA 2YWHA 3LBSA 3T22A 2VFVA 4LQ3A 1RT3B 2OK2A 2F3JA 3CGIA 1FNMA 2R42A 1DAXA 4OHZA 3IO6A 2BQ3A 4EQBA 5G0RA 1LWCB 5L1IA 2GNKA 3H2UB 4ED7A 2K06A 2F4VF 1RCOB 1VC5A 3BYRA 3OTOJ 1KWHA 4GWXA 2HKEA 4DF8A 1I6JA 3DN9A 2U1AA 2OH2A 5CMKA 2YPNA 1W26A 2CA9A 1S59A 1UTBB 3TUSA 4CQ1A 8ATCB 4O4GA 2ZH1A 3SETA 2E7VA 2P6TA 5KG5A 5JMNA 4PE3A 4DJBA 3Q25A 2W7OA 1NH7A 3PRDA 1VK3A 4Y2KA 1LB8A 4LATA 2J9EA 1RT1B 4LZ5A 3T1HF 2HBQB 4HXVA 5JJBA 2YKAA 1P1TA 2YNHB 3PM9A 1MPCA 4X04A 1HR0F 4TKTA 4DSJA 2LQ9A 1JWWA 1EYJA 3MTJA 4X66F 2XA5A 2DWJA 2JH3A 5DGAA 2ADBA 1FWPA 3BN4A 3G9CA 4CM2A 3DP6A 1LXNA 1IJEB 2HQCA 2GVDB 5CYQA 2ZC3A 3NCPA 5C25A 2V8GA 3POTB 4C0HA 2NXOA 3AA9A 2Q89A 1FTKA 1S1VA 4KCDA 2WB4A 3PJ9A 4I2QB 3VLVA 1IR2A 2NXCA 4RW7A 4FEBA 1WNEA 4ZHRB 2DD8S 4N8NA 1U1KA 2V67A 4JBCA 1KP6A 2P5VA 1FDAA 4OLPA 3HHFA 1VQKS 1FRHA 4J9RA 1VHIA 1MDP1 4EXKA 2GMJA 1B4SA 1SH3A 1RA6A 5ESYA 4IO1A 4P10A 3ISNC 4GF8A 4QU7A 2XY6A 4PYAA 3DLBA 5IZZA 4QWEA 2HWIA 3D66A 2UXDF 3G96A 4L73A 3NGTA 5IM2A 4W4MA 2O69A 2UXAA 1NBEB 4IG0B 4UUWA 4P2XA 1FBEA 3M8UA 1GV8A 4JI3F 2VPXB 1TKTA 1Q79A 3GJSB 2K7KA 2HHTA 1FQEA 4ZCLA 4JI2J 1HNWF 5EHSA 2XSJA 3PYFA 5F8LA 4ED5A 1N54B 4MH8A 4DXBA 4RUCA 3DOMB 1Q8IA 4LFAF 2EVZA 3UN2A 2FY8A 1IBMJ 1FSAA 3S1TA 2QLJB 1UVLA 3MPVA 4F2QA 3WIVA 5IZ1A 1FERA 4KSEB 2H25A 4IFYB 4XIGQ 2V2KA 2J9DA 1FRJA 1A6LA 2XHWA 2NXEA 5KFAA 3KZGA 5I58A 4GX4A 3W9IA 1B70B 5ETNA 5CCLA 1URGA 4ITSA 2DNRA 4YHHF 1UIUA 4DL5A 4B3OA 2KTQA 4JVCA 3OFGA 4WWSA 3FVOA 1HQ2A 1NCLA 1AOVA 5CXTA 4EBEA 3CJ5A 4ZE8A 2UUCF 5L1KA 1S6PB 4E2FB 1RAHB 4B17A 2Y7RA 4KPCA 4LVNP 4YP3A 4L3NA 3SSQA 3UVJA 3C3LA 4KE5A 1PEBA 4X4TA 5K2XA 3M32B 5E2QA 1FQBA 3BIGA 1N0TA 1U4BA 2FLPA 1S1UB 1ZTYA 4DV1F 4F3SA 3CG1A 1NDPA 1N36J 3HSGA 2ZNYA 1EARA 5T14A 1N3WA 4DIGA 5I4MA 4IOBA 4OZ1A 4LA9A 1SBRA 2GAHC 2IDEA 1KQKA 4GO7X 2CUYA 1N7XA 2F36A 2C2ZB 3HFZB 4ZEBA 2YKNA 2GQQA 3CDUA 1SYHA 1F60B 1RYSA 3BZQA 3U94A 2VG5B 2DXEA 1WG5A 2G2ZA 3ZC4A 2HNDB 3K5NA 3GILA 4Z0IA 3HVTA 1WTBA 2ZUGA 2CPEA 3GV8B 1NPPA 3ZZTA 2V2ZA 3FVYA 4KYEA 2QMXA 1DBZA 3I9V9 1Z7ME 4KT0C 1QUVA 4ILMA 3TODA 3TTMA 2IBKA 1VFJA 2FHJA 2MKHA 2WOMB 4ZLJA 1K8AT 3SFGA 3CC2S 4KI0E 2RQ4A 4PXDA 1FXLA 1USYH 3M4XA 1XMOJ 4XAKA 1IMDA 1FBHA 1R8AA 2HZVA 1FRKA 5ETSA 1T95A 2V8HA 3SEUA 1ZPWX 2KH9A 4CLTA 2KG0A 2CQ2A 3DC2A 3GSIA 1RT6B 3J7ZT 5FHMA 1FPFA 2KXFA 2VFUA 4NL5A 1D8YA 2HURA 4WTYA 2V3TA 2CZ9A 1ZMGA 4OFLA 3C16A 2YY3A 3ISPA 4QXDA 4WPAA 4DE8A 2MKYA 2C3OA 3IO4A 1WF0A 2UVVA 3S9MC 2CQDA 4XEQA 3HHLA 3EGNA 2XMAA 1FPKA 3TAMB 3GG1A 2YWWA 1KR4A 1VRUB 2W4DA 4ZCIA 1JNZB 1Y5NB 2GHBA 3FJGA 3LP2B 3PNIA 2VT5A 3UR0A 3BBRA 5KDTA 2EFPA 2HVDA 2KYXA 1FBPA 4DLDA 3E8OA 3IFEA 3CXCR 1S7IA 1MQDA 4PQUA 2X7IA 1H38A 4ANCA 1YWXA 2P1SA 4WE1B 1MROA 4NZ0A 2KT3A 4JYAJ 4RBUA 3GFXA 4X1DA 2EFVA 3VLUA 2OBGA 3GV7B 3RW6A 3UA8A 3NMAA 3QYTA 2DEJA 1FPLA 4F67A 3BO3A 3SEVA 4IY6A 3T96B 4M63A 5CBRA 5F8IA 2DK2A 2AZ3A 3CULA 3BR9A 2R7VA 4LF7J 1AZSB 2NSCA 2B5JA 1LW2B 4AE5A 1B3FA 3CJTA 2I5JB 2UU9F 1WELA 2CQCA 1FJGJ 3C14A 2F63A 2GGPA 3E01B 3W7BA 1ZH5A 3W3SA 2JSXA 4Y34A 1X4HA 5C42A 2JEFA 1UW9A 3HCQA 4X1BA 1PJ7A 4ECTA 2M4MA 1OY6A 1NB7A 3HZGA 1ZA2B 1WSVA 3KNGA 4LF5F 4IO6A 4CLKA 2HBZB 3B6BA 3IK6B 1NHVA 1S49A 2EBEA 1VQLS 2ONRA 4OYXA 1MM7A 1M5PC 4QWBA 4CTAB 1PCAA 1IKWA 4EWTA 1WC0A 1OSDA 3MM9B 2PCRA 2CKWA 2E5HA 3DLHA 1JLCA 1M1HA 3LO3A 1NM2A 4H46A 4F25A 2BE7D 1PYOB 2L9DA 3CWJA 2CVEA 2Q43A 4WP8A 1EETB 5HBMA 5A2QU 1ITPA 3VV5A 1QW0A 2PSZA 1ANFA 3T9VA 1R8BA 3FVGA 4EUVA 1L3UA 3H5SA 3KK2B 1SKRA 4LQ2A 3R27A 5IXUA 4M5NA 1S6OA 4NF8A 3K8VA 1YJRA 3KWMA 3LGNA 1A9NB 3OLBA 4NX9A 4MKBA 3DLJA 3J81Y 3LPYA 2AU0A 2B3FA 3CRBA 4PTKA 2O68A 4PXCA 5D15A 4BCAA 1RTIA 3QZ7A 2OPRB 3SDEA 4J9LA 3I56S 3OFHA 3CCZA 3MGJA 1VDHA 2ZNUA 3G7WA 1FVSA 2M70A 1MXZA 3AD7C 4LONB 1MY4A 3TOQA 3IORA 2AV5A 3QIPA 4CO3A 2RKIA 1UL3A 4JI6F 1WKLA 2FBPA 2RU9A 1RSCA 4OX7A 1J5OA 4NLRA 3AH6A 3EGWB 5AJ3F 1TUVA 1RBAA 3IBWA 3B8BA 4XIUA 4FN5A 4KGXB 4H4MA 1DK4A 3EPEA 3KJFB 1Y1ZA 2QJEA 5F9NA 3M30B 1QE1A 1CJVA 2HHSA 2WVFA 3G8QA 2HNYB 2Y7WA 1GEHA 4ICLB 3JSMB 4NCGA 3RG6A 4ED2A 1E6YB 2AYMA 4PQAA 4R8UA 5KFTA 4WFAQ 1KQSR 3D54A 2QA1A 4UY85 5EQ7A 2DNZA 4MLVA 2V94A 1YK9A 3OVBA 3NBPB 3OHAA 1ZTTA 2G93A 1XK8A 3W9VA 2WEFA 2Y5LA 2XGQA 5A5LA 3UP9A 4DR3J 1YTYA 4FBPA 4CLYA 1S1XB 1QTMA 5ITPA 4LSNB 4N4UA 3OMBA 4NCBA 4I7FB 4RW8B 4M5DA 3CD6S 2UVWA 3SEYA 2ESNA 1K1SA 1Q7YT 1XN9A 2HS0A 2LECA 3QGIA 2YNGB 2GO8A 2QLXA 4ZDNA 4WP3A 3ZNUA 2RUSA 1MG1A 1B51A 3KG0A 2DVZA 4FXVA 2JLGA 3PHTA 1VQSA 2FVCA 4PG6A 1U1PA 4ZP8A 3KLFB 5I3UB 4BLAA 2YPYA 3LH2S 3QJLA 3JB9k 2CWXA 1HSJA 2OFHX 3TCHA 3OXGA 3EMTA 3OOAA 1PGZA 3W60A 3DMJA 3F0NA 1NHKL 1OY8A 3BBCA 4RW4A 3P96A 2E5JA 1HWLA 2JWNA 3H98A 1KNZA 5J1EB 4BDNA 4F4ZA 3J7A1 3OUYB 1AW0A 1VLOA 2C3UA 3VZIA 2JRSA 2OPSB 1LSTA 1FTCA 3C19A 3M3KA 4MK9A 4DQRA 2R8TA 3UPFA 1CQMA 2PIIA 2EW9A 1EQMA 3IGVA 1AT1B 3MAAA 4NTLA 2R7QA 2I4BA 4OVPA 2YNIB 1EZPA 2Y1IA 4DDFA 3OTOF 5A8RB 3LV0A 4C8LA 2VP1A 5SZTA 2HNZB 4O3PA 4IO2A 2B4OA 4GMKA 1Q86T 1JXVA 5LM7E 1EQ0A 3S9NC 4WF9Q 1D9DA 1FXDA 2FIUA 4A48A 3G86A 1NNKA 3FUZA 1XMQF 2CZ4A 1SL1A 4DZ6A 3DOKA 2ZNZA 3FCWA 1EKRA 1H98A 1Y3QA 3TUPA 4DZ1A 5KFCA 5AXNA 1IXHA 3M8QB 1TK5A 2R7RA 1RHMB 3BJYA 3D3CJ 4MNPA 4I1DA 1WC1A 3TVZA 3OV7A 3ZXWA 4RY1A 2J0QD 1KWMA 2XNRA 3RPLA 2RC8A 4FXWA 2BJ1A 2I4CA 2XLJA 4K8RA 4DS4A 4DL7A 1IJFB 3I32A 5KFVA 4KY3A 1UP1A 3UDEA 1SYIA 2HXRA 3K89A 4PWWA 4N07A 5ET7A 4OYPA 2FLNA 3CDAA 3IG1B 4R72A 4J9MA 4MMOA 5DYHA 3C31A 4NGUA 3AOBA 4CLWA 1NV6A 2YTCA 4PG4A 4DR7J 2GZOA 3RW7A 1I1GA 4G61A 1RDXA 2MZQA 5D3GA 1UA0A 2DPJA 4WZQA 4JV0A 3UWTA 1PBAA 2QLBB 5K14B 4B9VA 3Q2TC 4R5PA 1WHYA 1SQEA 3PMVA 2VF3A 3IP0A 3QSYB 4ISUA 3V83A 2MXYA 5JXSA 4BC9A 3ETMA 4DV5F 1UAWA 3DDNA 3WQPA 4U7UD 3P3DA 2ACYA 4PAFA 1AUDA 5TP9A 3I5CA 3JSRA 3TTNA 3EX7B 1L5UA 3W65A 3CI8A 2MQNA 3W9HA 1SXLA 2I9SA 4FS1A 3PEJA 2QL9B 3KHLA 3NS7B 3JQJA 3UI3A 1WHWA 3MOZA 4OI6A 3ET6A 1M5FA 2R4FA 2I58A 2ZZVA 5B0DA 3L09A 3IXQA 3M9MB 2QFLA 4P0GA 1Z2LA 4ELVA 1NNTA 3MUMP 4FIMA 2Q3PA 2R8JA 1SKWA 3E51A 1F5BA 1N7WA 4EEYA 4NF4B 3D3BJ 3KJNB 2UUTA 4P9SA 2GIRA 1SKSA 4XKQA 1M1GA 1BGXT 2CPYA 4ONYA 1WDTA 2BXJA 2KHDA 3N28A 2RHSB 3V4IB 4G1QB 3O8WA 2I2YA 4C11A 5K2YA 5GMEA 2WCXA 2GHWA 1RXOB 2VA3A 4R6HA 2GW8A 3SCKE 1ICEB 2QMWA 1SJ1A 4CLFA 1WTFA 3IL1B 4QPXA 4YY3J 2X3GA 2XO7A 2D3O1 1TK8A 2O6AA 2UV8G 4F2OA 5I42A 1N36F 2VOPA 5C2CA 5KCJA 4LRDA 4CO5A 3K6UA 1F9FA 4EXLA 4PZVA 1FPBA 1LBZA 1VGYA 4C0RA 4GC6A 4OZNA 1NH8A 3BPDA 1SPIA 1UJ6A 3PG9A 2J9DE 4WZMA 4J91A 1FKOA 4JDFA 2OEKA 5I3QA 4FPRA 4GKKJ 1BHNA 4B9NA 3D6MB 4YDDB 3CCVS 2O1MA 5HM4B 1LGBC 3PYEA 1NUWA 2FUG9 5ETOA 3PD9A 5DLFA 4OX8A 3A3CA 4USKA 3X3UA 4JI4F 1SH2A 4IG3A 2FGCA 5H8QA 1TV6B 1U02A 3MUVP 1LWFA 3W66A 4O94A 4WEPA 1LOUA 1XMOF 3PY8A 3NS6A 4OYVA 4WFYA 4IFVB 1B3GA 2BJEA 2LLZA 3I5AA 4QW9A 3PPPA 2CNNB 4FF2A 5J2QB 3I9ZA 1ZPVA 3M8ZA 2AYEA 1B64A 1WOOA 1Q78A 1B32A 3SBMA 1RYRA 1RWPB 1FHTA 3S6EA 4U22A 4DSLA 2J76E 3CTRA 2RC7A 4USHA 4EQ7A 3MM6A 5EWEA 1EX8A 1I3OB 2E1RA 1CC8A 2ZJQQ 2JEIA 1N5TA 1RKIA 1VQ5S 3MMCB 4OEUA 2WBMA 2ZVIA 3D1OA 1JETA 1D4NA 1ZLQA 3HX9A 1WF2A 2W2NP 1FCKA 3BKTA 4P2MA 4OJ3A 3MR2A 2ZDOA 2AF6A 3GYYA 1XI6A 2AHOB 3MR3A 1OJ4A 2H4YB 1RHUB 1UEKA 2HLUA 3N01A 4UF4A 4JV5J 3R5JB 3M2RB 1JNFA 1JLFB 1TL7A 3QT5A 1H72C 2XYHB 1FX4A 4NQ8A 5J1DA 4NZ7A 1L5TA 2OPPA 2ILZA 5A0YB 1QSYA 3QIDA 3CHGA 3MOJB 4M5GA 4OI1A 1RABB 1FX2A 4KB7A 5HAOA 2HW3A 3P49B 5BXIA 2GJIA 4H4OA 3A29A 2XB2D 1CS4A 2QLWA 4HYKA 2U2FA 1FJGF 5LSLA 1H76A 3QGHA 4WFZA 5CMBA 4EZ6A 1VRQC 1XNQJ 2BA9A 3V8XB 3M6WA 1RHJB 3U92A 3L4BC 1R0AB 5DRKA 2C42A 2FJEB 1JP4A 4B3OB 1QULA 4HH1A 4LR8A 2P3NA 3IM9A 1IQ7A 2B4MA 2DDKA 5BJRA 1SKUB 2BDPA 4OV6A 3MECA 2AGQA 1XBWA 2AEJA 3SCJE 2RAQA 3SSSA 3S01A 3HT0A 4AS4A 2Z8DA 4DSKA 2R9LA 1LK7A 1KD1T 4F7VA 1HNVA 3CJRA 2LXIA 4U95A 2R8HA 2KXHA 2Q79A 3FNNA 2ZYNA 4MLQA 5IQQA 3QT8A 2LVWA 2ASDA 5EWGA 2NUUG 4I3EA 4HACB 4UQGA 2OEMA 2BANA 2F9JA 3MM8B 1NV4A 2HZAA 2XCAA 2MZTA 2V8DA 3FVNA 1RU2A 4GL8A 1SQGA 4YZZA 3EHUA 2PT2A 1CJTA 4ZPWR 2B56A 1TZ0A 2V4JA 1FVQA 3JYTA 4WXWA 3O2AA 4ZVQB 1WODA 3HJFA 4J5OA 4F2SA 1HNIB 2J7WA 3QT6A 3A12A 3O44A 1I6QA 2FJBB 3TZWA 5F3ZA 2IJFA 5ITOA 3TA2A 4OX6A 1JX4A 4JI7J 3MWBA 2BE9B 3KDOA 3HD1A 4H8JA 3TAQA 4DG1A 4QU6A 3C16B 2ATLA 4NA3A 1J27A 3QRQA 1CJKA 3S8SA 1JQGA 4WP9A 4HDHA 4DHVA 3KLIA 3IGNA 1UFWA 4PGNA 1AH5A 1F9HA 3N26A 2ASLA 4F1YA 2M5YA 1P1NA 2VG6B 3HJVA 3KNAA 4U7UK 3A8IA 1NFTA 4GWSA 3SEXA 3FJ2A 3RT8A 3UNGC 3L6GA 4G65A 1EZZB 2ZJPQ 1UTAA 1PBPA 2BQUA 3I6VA 1HBUA 5AA2D 2NPIA 4DR3F 4F4AA 1MROB 4CLLA 5KT4A 3IFAA 1WHVA 3CJ8A 2D7SA 2CG8A 2CQ3A 4GIZA 1NKXA 5IT0A 4X62J 1EYKA 4ECFA 3RB6A 2ZHOA 2H48B 2RH3A 5KT3A 2QTWA 3V81A 1G2EA 3DRPB 3H40A 1SJ3P 5AE1A 1X8DA 2HFVA 1UQWA 3DGPA 2VGQA 1OO0B 3EPIA 3KOSA 1V3RA 4GVLA 3IOUA 4MK8A 4GWYA 4O3CA 3SV4A 3GJQB 4F4WA 1XC1A 4NE4A 4P7TA 2HQFA 1H45A 1SW1A 2O5DA 2WRMA 3CJKB 4AB6A 2WKYA 1FRLA 3HI9A 3TQLA 2DNKA 3HHLC 2FHYA 2YX4A 2NXNA 2HIQA 4X48A 1H2TZ 4KD5A 2DCLA 4AQYJ 3R1LA 4AXJA 1S5ZA 4QIEA 4Y6IA 4OJHA 4DUZF 3WHIA 1IQZA 2W9CB 2K1RB 3GZ7A 1PDAA 3IA0A 3EGVA 4Q45A 2REGA 1RJJA 1JXEA 5I7IA 3RY3A 1DSNA 1V5VA 4DR2J 2QSXA 1TL1A 1URNA 3W2WA 1MMDA 2DR9A 1FK9A 1PSDA 1RBLA 1KBRA 2FC9A 1NSKL 1S1TB 2VBWA 2KXNB 2MKZA 1XHYA 4TY8B 1NJXA 4XPCA 3W5XA 4F1VA 2ZBQA 4M1VA 4DL0C 2KZMA 5CD4H 3JZJA 5E33A 3DFEA 2WBRA 4ZZEA 3IB0A 3PW7A 1H0HB 4OEVA 2C1EB 3M8RA 1JLQB 3C66A 1HYSA 1VMBA 2MLYA 3EF7A 2XWYA 3M9NB 1X4GA 3HD2A 3IWLA 1KFSA 1OSCA 3PPRA 1RK8A 4EU0A 5K8MA 4ELOA 3CO0P 1A54A 3TO8A 2C3YA 4OX9J 4C4WA 2GVZB 1GX6A 1RWNB 3BF4A 2ZVSA 3AODA 2XI2A 5A6PA 1YJNS 1HHSA 4KHZE 5CYMA 3QO9A 3A3UA 2UYEA 2KFYA 3KK1B 3C15B 3H4DA 3QJPA 1VI7A 1U1MA 3MEDB 1HQUA 3CO9A 3QIPB 4ECQA 2Z2LA 1JJHA 4FYDA 5IZ3A 3N0VA 2WHOA 3T9ZA 1DTTB 3B6TA 3OR1B 3UD3P 2RQCA 4IGRA 3TAPA 4G68A 1DQ9A 1HHTP 1JLGA 1G3OA 1RT7B 2RF1A 4PG5A 3J7Z5 4PUOB 3IR1A 1RWMB 3KJQB 2XHCA 4BS2A 4H4MB 3DLGB 4ER8A 3ENQA 2HFUA 3PD8A 3B54A 5HANA 4K2JA 1VE4A 1HKAA 1JJ2R 1LV5A 3W62A 1LWXA 3GIMA 2Y8YA 3NAHA 1MG7A 4YKKA 4ECZA 3DM2A 3UO0A 4NG7A 5CD4A 4CO1A 5EUHA 2KZZA 2HYIB 3GR0A 3TUIC 1L3TA 2HFBA 3THIA 2A0FB 2E7WA 3AQPA 4ZN1A 3QWUA 3K17A 5BR8J 4HH0A 4GXSB 5JUMA 2W25A 5D78A 3MP8A 2ACMA 4CYUA 3UN3A 3CB4A 1VQ9S 4ZKAA 2FC8A 1FKPA 4R74A 4DV3J 1O7TA 4GD5A 3O2IA 3KLEA 1B1HA 4HVZA 5KZTA 4WBFA 4CO0A 4ZIWA 1LFHA 3LGMA 3BS9A 5L9NA 2AJ1A 1URDA 5ETRA 2AYGA 2Y5KA 4MYTA 2CJAA 1KLMB 2E29A 3SCLE 3J7YI 2F9DA 1TP7A 6FDRA 2O7UA 5TPAA 1IMCA 2HVIA 1GK8A 2HQIA 5M2RA 3SMZA 3A13A 1GXTA 3IC1A 3RRHA 3VAMA 1X4DA 2KVIA 3VF0B 1X9WA 3NG8A 1GTHA 1QD1A 4CI0B 5HVFA 2BJ9A 4RK9A 2EFOA 2CJKA 2LA6A 3FATA 1KSPA 5CAAA 4PG7A 5I57A 2R3VA 3DXBA 3RTVA 3KG4A 1GVCA 1H2UX 4K4YA 1KC8T 3HHEA 3MR6A 3GJTB 2EXUA 2BUNA 4K59A 5HI7A 1BMQB 3PV8A 1YJTA 3VVEA 5K5MA 3IR5B 1ZM2A 3Q27A 4WCEQ 1VR6A 1D8ZA 3UN5A 3GE9A 3MM7B 1NK5A 3EVWA 5HJYA 3H5XA 4B9LA 1B2HA 1FESA 3VVUA 1R8HA 1PB9A 2WW8A 2MHNA 4NLOA 5L8DA 5DVFA 3UIFA 2MQ8A 3HK2A 2HWHA 3MM5B 5GAGI 1M5OC 1VK8A 3C6UB 2MZJA 3KUGA 4GKKF 4DV6J 4DXUA 1GX5A 1YBAA 1TL5A 4Q7AA 4U96A 2M7SA 4LF9J 3OSPA 1N5SA 3I96A 1T03B 2ZHAA 5T41A 4QFNA 1IIWA 2DH8A 2PA3A 2PMZD 2LXFA 1QKBA 1SIZA 4THIA 1Q82T 5KT5A 2L3MA 1GAOA 1EZOA 2LMIA 3D0IE 4W92B 2MQOA 3PTYA 2DIVA 2LDIA 5DT6A 1DQAA 5F3TA 3CIZA 2G0IA 3D6HB 1MXUA 4G3IA 5F41A 3EHSA 2B9WA 3CSBA 3KLHB 1B4HA 4ZPVR 3M9OB 2NUHA 2XMUA 3K5LA 2RIJA 3T66A 4YN3B 4KR0B 1FF2A 1FJCA 2ZH8A 1O8BA 4ID8A 4C8KA 2ZNSA 1UFKA 3RAQA 2NZCA 2DCUB 2HHQA 2QA4S 1R1NA 4DPXA 2QO3A 2XMKA 5ISUA 1X60A 1UTBA 5LTCA 1R9LA 3PKMA 2IM0A 5DVIA 2XWIA 1M5VC 1A55A 2DNMA 1GMWA 4JV5F 4ZP6A 3C32A 2JHEA 3A3OB 3JTPA 4O3OA 1RT1A 1LW0A 4Y00A 4IOAQ 4GWUA 2RCBA 3SXLA 4FORA 5KG6A 2YNHA 1G4CA 1IBCB 3JSYA 2LA4A 4FBTA 2RQMA 4Z7EA 2BKOA 1NJWA 1MSWD 2DE4A 3IX1A 5H8FB 3PV0E 3MSTA 2ZYOA 2QYGA 4LFCJ 3PUXE 4AL6A 4RNSA 3UORA 2XMMA 2ASYA 2ZNTA 2KI2A 3O6IA 2BJ3A 3ILUB 1Q8LA 2QT7A 3H03A 2Y0SD 1HW9A 5DEXA 2I49A 3POTA 1SUQB 1WJ9A 3TJAA 3HM9A 2UXBJ 2AIXA 3CCTA 1M5DA 2WSCC 2V4CA 4AS5A 3H4ZA 1WSRA 4I2QA 1N34J 1XNQF 2QFIA 3TDJA 2E1SA 2BYCA 3N6UA 4ZHRA 3QNWB 3AJ2A 4ILLA 4IDKB 1P99A 1RAIB 3ZTRA 1BLUA 2ZZWA 1LBYA 1R0CB 3SQGB 2H99A 1QSLA 1IUDA 7FDRA 4EF2A 4LFBF 2I38A 2QC3A 5KOWA 4JB7A 3THPA 3Q8SB 4MFIA 3ZKLA 2DBBA 3PW4A 4N6KA 2RS2A 3MURP 1NHUA 4QYZK 4GOTA 5B7DA 1NJYA 4MJOA 2DWHA 3H3GA 2IBOA 1S0OA 3TQEA 1C4AA 1FQCA 5EYFA 4HE0A 2FPHX 5KCJB 4J9UE 1U25A 4HTJA 4ES2A 2AYSA 5HMXA 2VODA 4H67A 3VDFA 1LAXA 4A8FA 2CNKB 3BSOA 1XR5A 4H5FA 2XNQA 4AQ4A 3CMAS 1FKOB 5HQMA 4KGVB 2C2DA 1KHWA 3T1AA 2CQ0A 4HCWA 2ZH6A 4LP2B 1F3VA 2QMUB 1POTA 3KGCA 1P6TA 4ZS6A 3UNYA 4TQRA 3KN8A 1JXLA 2OPQA 1R89A 1Y00A 9ATCB 5I59B 1IBLJ 3MMBB 4DV2J 1EH3A 2AEFA 3SZPA 3FSYA 4V19X 4IFYA 1P9QC 5F0UA 1JEUA 3Q2SC 4B3TJ 2RDJA 3T9HB 5H8QB 4Z7CA 2CPJA 4L74A 3ZZPA 3UCUP 1JLEB 4DU7A 4DF4A 2IMWP 4JI1J 4NX1A 4NYPA 2XS7A 1GTKA 4NRUA 4R75A 2XLKA 3IWXA 4JI7F 1NNFA 1JNRB 4KBIA 1VQ6S 2GJFA 4DR4J 3A1YG 1S6PA 3NXZA 3PW0A 2FY1A 4HR2A 4LF8F 3O28A 1I6BA 5M2PA 3R7BB 2YWGA 3RR7A 3IJXB 4L76A 3MM6B 2MPUA 1FWKA 3M32A 2NREA 1CJUA 1S1UA 4N77A 1EJ7L 1TKZB 4RNNA 1U6BA 4X4SA 2F4VJ 4IRKA 4P3LA 3AB2B 3W1YC 4ELUA 4NMLA 1TVRB 4RNMA 1B58A 3C36A 3MR7A 4DPYA 1KRPA 1IR0A 3RBEA 2DY1A 3LSXA 4XKNA 1XT8A 3TCFA 1LBBA 3A09A 4G8HA 4LQ5A 3BV8A 2VG5A 1S50A 1WDNA 4DSFA 2N4CA 2HNDA 4ZVEA 2DR6A 3T1HJ 3U65A 4U23A 3WBZA 3VHQA 2OAUA 4FAJA 4B3RJ 1IZ1A 1HMVB 4DI3D 1B4ZA 3NGDA 4OXVA 2WOMA 4HT5A 1VBZA 2D3ZA 3C35A 1XERA 2Z0GA 3KMQA 5E41A 2MMYA 3NGSA 5ADZA 4P9KA 1AXQA 1U6ZA 4D3GA 4A8WA 2JEJA 3HKZD 1X5PA 4PFTA 1RT6A 1D1UA 4DS5A 2UUBJ 1YQHA 4PAKA 2I0XA 2IY5B 4TVAB 5HSPA 2QFJA 3BB5A 1WKKA 4TU9A 5FLXY 3KLGB 3HMJG 3HO1A 2FA7A 3KG2A 1GMVA 3IR7B 3N94A 4DDDA 3RB3A 2E9RX 1HBMB 1RB0A 3Q24A 3TX0A 1TK0A 1QM9A 4AQYF 4BLGA 5B7WA 3TX8A 4KKOB 4KFBB 3R1HA 2Z57B 3GCXP 4F29A 1VRUA 3D0GE 2PFFB 2JVOA 4GC7A 3R6LB 4ZLNA 3KLVA 3LP2A 2VBYA 4DR2F 2DHSA 3ONQA 4QYZJ 2VC1A 2DXFA 1RTHB 3CDBA 1Q81T 4IGTA 3AXFA 1NK4A 4L17A 4EF1A 4IO7A 3V4MA 1WUUA 1RYOA 3H59A 3BH6B 4WE1A 2E1AA 4NWDA 4MNIA 2W7AA 4J9VA 3ZFVA 1P1LA 4JI3J 3BO4A 1NK0A 1YZ7A 1TFAA 1QVSA 2B9EA 2XYGB 4QIGA 1VISA 4ZITA 3FZBA 3QBCA 4H4KA 2IM1A 4NPOA 3IMQJ 5L39A 4DWIA 3HF5A 5CZVA 4RJVA 3VWSA 4OVJA 3OO6A 1AZSA 3VAFA 1J2VA 1LW2A 1BXNA 3BYPA 4OX9F 2XXRA 1SC3B 1B40A 4TLMB 3CFXA 2PA8D 2ABYA 4O3AA 4ZP7A 2O01C 3E01A 2DNLA 5I2NB 4LRAA 3FXRA 2Y1LB 1HWJA 5ETMA 4YHHJ 5ETLA 3GP9A 2VA2A 4K4VA 1MN9A 6AT1B 2E9ZA 4QFPA 4AXIA 4A8SA 4I8CA 1B3TA 4ZEIA 4CTAA 1MY2A 2CZVC 3OL8A 2ZITA 1T7PA 3HPOA 5IFMA 1Q8KA 2AP6A 4N91A 2A2DA 2ZZNA 3J81U 5CYJA 2CQPA 2RT3A 4NF6B 5CA5A 1SB6A 1T9XA 2C2OB 2QVRA 4DV1J 3NAIA 2R2TA 1EETA 2HEKA 3VAJA 1S4FA 2V6AA 3OT9A 3GWCA 3W5YA 4OYIA 4O7IA 5DLGA 5KT6A 2ZD1B 5KT7A 4NN3A 1S0VA 5BR8F 2JEGA 1W2BR 3M6XA 3R5GA 3KK2A 1EAYC 1M5EA 1XTZA 3GLJA 4XDDA 2KR0A 2Z2ZA 3HULA 5KFBA 4YR3A 4IO3A 2BW7A 2D9OA 2KJWA 4DV3F 1PJ5A 3KXDA 5EWFA 5L38A 1SV5B 3HKWA 3PGFA 3OL7A 5AXLA 5GVQA 4ZMMA 1RP5A 1MY0A 2GMHA 3MVXA 2FDNA 3WIUA 5KG7A 2Y8WA 2HAIA 1EKSA 4M5IA 1YG0A 1SL2A 1URSA 4G6VB 3DGPB 1T05B 3G3IA 1TT1A 2HXWA 2LAOA 4RNHA 4YEAA 3B8HA 3AQOA 2A1BA 1RWWB 1S97A 1B7HA 2PT1A 1H7WA 4CP5A 3GMGA 3VVFA 2Y7KA 2IJNA 2ADCA 4OI0A 4NF5B 4YB7A 2LCWA 3BGLA 4TYAA 5HQ8A 1HBOB 5L8RC 1F0XA 4PKDB 1Y9UA 2DNQA 2M0GB 2DYAA 2QVVA 3QMQA 3FEYB 3M30A 3T5HA 1MQIA 3OTBA 5AXMA 2HNYA 1YJ9S 4R2FA 1XC9A 3IFCA 3TANA 2XS2A 1RHRB 2QV6A 4ICLA 1Y4TA 3JSMA 1BQMB 3B7DA 4I6WA 1RTDB 1E6YA 1S6UA 2FYXA 2VH7A 2HMIA 5C5JA 3H42A 1NDCA 4X8RA 5I2KA 4UOHA 3NBPA 3K2DA 1I94J 1Y5LB </