3LUYA

Putative chorismate mutase from bifidobacterium adolescentis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
326
structure length
326
Chain Sequence
MSARKLFYLGPQGTFTHQAAVNAAQELARFEPQGFDLMPMDDVPQILDAAQHGDGWGIVAWENNVEGYVVPNLDALIDAKDLVGFARVGVNVEFDAYVAQGADPAEARIATAHPHGLAQCKRFIAEHRLSTQPATSNAAACRDLIPGEIAFGPAICGELYDITRIGTAIQDYQGAATDFLVLSPRAEVARLLAKPRAEANVEYESVLTLIPLVTGPGVLANLLDVFRDAGLNMTSFISRPIKGRTGTYSFIVTLDAAPWEERFRDALVEIAEHGDWAKTLAVYPRREHPNPPVTSWMLPQGGVRLDDSHLPDDWQNDETVRRELMW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of putative chorismate mutase from Bifidobacterium adolescentis.
rcsb
source organism Bifidobacterium adolescentis
molecule tags Isomerase
molecule keywords Probable chorismate mutase
total genus 93
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3luyA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3luyA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3luyA02
1B3HA 3BFUA 1MQDA 3PPOA 3UN6A 3ENQA 2H9BA 3RT6B 3LBSA 5EHSA 1AL3A 2O7UA 4TLLB 1P1OA 4MBPA 4NMYA 1B4ZA 4HTGA 3K4UA 3L7OA 3EHSA 1P1NA 2DE3A 4LP2B 1HSJA 2OZZA 3PGFA 3TUZC 3HO7A 4YB6A 3T93B 1SYHA 5CBRA 4U22A 4GQOA 3B7DA 2R71A 3LSWA 3T96B 3VFJA 4FE8A 1MM7A 3GBBA 4KYSA 2DXRA 4R2BA 4G68C 1II5A 3CI8A 5JTYB 4IO4A 4R6YA 5I58B 4RK2A 1POTA 4KYEA 1N84A 4DXUA 4QRZA 4U1OA 1NNPA 1MS7A 4OEUA 3B6WA 4BDQA 1A7LA 1PEBA 3EPEA 5IT0A 1A8FA 3RUMA 5ELVA 4GD5A 5F1QA 2DVCA 3QK6A 1SW4A 1TXFA 2I4CA 4M1VA 1B7UA 1PB9A 2RKMA 1GGGA 3K6WA 3PPPA 4QSEA 3TDJA 3VLWA 4PFWA 3QUJA 4XIGQ 1SI0A 3KOSA 3H6UA 4RJZA 4XTCQ 5H8FA 3Q27A 4H5GA 4Q30B 5I59A 2OWSA 1FTJA 1N04A 1FTLA 2IA4A 2DWHA 4ESXA 3RLFE 4GRKA 1EH3A 5IKBA 1L5TA 3TKDA 3MP6A 3T9HB 5I59B 3RGYA 1DTGA 2P9EA 4JWOA 1USYE 1SW1A 1B1XA 1XS5A 3GXAA 3OOAA 3MUQA 2FYIA 2KO1A 4U2RA 4X84A 2KLFA 4OQOA 4X1BA 2E1SA 5KDTA 3OEKA 1B5JA 4FEDA 4XKRA 3MZ1A 5DVFA 5DYHA 4DCYA 3PU5A 3DHXA 1QULA 1MY2A 2B65A 2I49A 5FHNA 4JXIA 3UW1A 3CR9A 3U93A 4R2FA 4DXCA 1FQCA 1XVYA 3E4RA 3UK4A 4AQ4A 1YAEA 1LFHA 2Z8FA 3EQ1A 4ONYA 4IGRA 2R6GE 4AB6A 3CRBA 1ZPVA 5IT4A 2QMXA 2UVJA 1SBPA 3TAJA 2DS9A 3PMVA 2RE1A 4GXAA 3M3FA 2UVHA 4I9DA 1HSLA 1IUDA 2OJTA 4N07A 4E0XA 3VVDA 2A5SA 2NUVA 3ODBA 1I6AA 2NVUB 3G3KA 3K6VA 4M8LA 4ZEDA 1HSEA 3PUWE 4X1DA 1PSDA 3ECRA 5TU0A 1ATGA 1M0SA 3DP4A 4YKPA 4ELOA 4F2QA 2O7IA 1S9TA 4HCYA 4ECFA 4ESWA 2Q9TA 2ABHA 1JQFA 1OVBA 1UTHA 1DTZA 1H76A 3QUFA 2HCAA 3LOUA 2H9ZA 2IEEA 3KN8A 3CG3A 3IK6B 3RN8A 4KCCA 4IO3A 1YCJA 2OK2A 3K1MA 3OMBA 1Y3QA 3FZVA 3TEPA 5TP9B 1ZBMA 1PDAA 1A99A 1QW0A 4F18A 2XXUA 1ZU0A 3ENVA 4EUOA 3DP8A 4H6DA 3SDFA 4GL8A 5TP9A 5KDTB 1RWUA 1QKBA 2Z23A 1BTJA 4IO1A 3JYRA 3MAHA 4XKNA 4GFRA 2ZXTA 1U8SA 2HFBA 5DVIA 3IBWA 2VP1A 2V3QA 1OVTA 4OENA 4F3BA 1J1NA 1FQFA 3SEUA 3W9WA 3IOUA 4OTEA 4YICA 1GV8A 2DE2A 4R6KA 2QL3A 2DSFA 5CMMA 1DSNA 1M5BA 3TTRA 4NTLA 1ANFA 4TLMB 3MAMA 2A5TA 1F9BA 1B9JA 3KZGA 5JEIA 1N3WA 3U94A 3ZKLA 4GO7X 4PE5B 2P9CA 4KI0E 5AA2B 2DTJA 3GZGA 1RKMA 1JW5A 4ZEKA 3A3UA 3OO9A 3Q29A 3FJMA 4R6HA 3T9XB 1XT8A 3MVWA 3Q28A 2PA3A 4ZECA 1B7HA 3LC8A 3T9UA 1I6QA 2OCUA 1NNKA 4BDNA 2FNCA 3R7XA 5L9MA 3FV1A 1CE2A 4FIMA 1DMBA 4ND9A 1B3GA 1YPNA 3UIFA 1YTVA 4NE4A 1MQJA 4DLDA 1R9LA 3HCQA 4TOZA 3TMGA 5I2KA 3H4ZA 3HHFA 4POXA 2DWJA 3LR1A 2LVWA 4PFUA 3PMWA 3TTMA 2ZYKA 3S9NC 3FJGA 4G8HA 3FATA 1URSA 2XXWA 3R6UA 5ICQA 1FTMA 1WODA 3FIRA 3CFZA 2F5XA 2RC9A 2J0WA 4OETA 1MG1A 4IB2A 3IOVA 1NMUA 4GO5X 4GLIA 2D3IA 1SQYA 4F2OA 3O2AA 1IEJA 4F3PA 2ZNSA 1Y20A 4KFQA 3VV5A 4OERA 2Z8EA 4FEBA 2DXYA 2I0BA 4G2ZA 4N13A 1Y1ZA 3QSLA 3R26A 3CG1A 2F35A 3H6WA 2I3VA 4KCDA 2HZKA 3TTNA 5AE4A 3T66A 2ZMBA 3FXUA 1MY3A 3LSLA 3H6TA 1JNFA 4RY1A 1JW1A 5T41A 5AA3A 2QS2A 3TUIC 2ONSA 1B52A 2I6EA 5I84A 3RNNA 4R75A 1DPEA 3O1LA 4P0IA 2PT2A 2RC7A 2XXTA 2Y7PA 1UTBB 3DDNA 4DCXA 1UTHB 3OO7A 4WXJA 5FHOA 3IO6A 1B46A 4JDFA 1QJMA 5L9OA 4EF1A 2Y7RA 4YMBA 2AL4A 3SESA 2UVGA 3K00A 1FQEA 2YPNA 4U4SA 1B1HA 1R1NA 4IY6A 3HSTA 5M2VA 3EHUA 4GOTA 3N5LA 4Z7EA 4R72A 1Y1MA 2ZYMA 2PT1A 2PVUA 4IGTA 2GH9A 1SW2A 3MVZA 1LFIA 1MY4A 1B3LA 2GFEA 1FCKA 1PB8A 5ITPA 1N7WA 2DQVA 1M5DA 1MPBA 4YKKA 4E0WA 1VFDA 4F1YA 3MVXA 2THIA 4ZS9A 3K6UA 2MDAA 3S4UA 3V83A 2B3FA 1OLCA 1QUJA 3IX1A 3LSFB 3ZKKA 3K0VA 1D4NA 3SERA 5H8HA 1OQHA 5TPAB 4M4GA 2P1SA 1LBBA 5F7VA 5FTHA 3CFLA 5H8NB 2O84X 4LA9A 2QRRA 4NF5A 3KBRA 2UYEA 4N6PA 3TYHA 2P9GA 4POWA 2HXWA 4IO6A 2UXAA 1Q35A 3ZS6A 5DEXB 4DDDA 3OFFA 3VLVA 4ELQA 1NH7A 4DXBA 3C36A 4U1ZA 1LB9A 2F34A 2Y84A 2DVZA 5CRYA 4YB5A 1MXWA 3ILTB 1BLFA 3TELA 2BJJX 4GMKA 3S1TA 5I57A 3NRBA 3E3KA 1JVXA 4X9TA 2CDQA 2R9JA 4GIZA 5H8FB 4G68A 1GR2A 2YJPA 1M5EA 2OLBA 1PBQA 1S7YA 2VOZA 4QSCA 4KQPA 3TZAA 3KEIA 2XXIA 1FQAA 4LONB 2Y7WA 3KOTA 3CVGA 2XHDA 4TQUQ 4LATA 3FXRA 1URDA 4O3CA 3IO4A 1EU8A 3IB2A 1H3DA 3HHGA 4FAJA 3TUJC 4R9GA 4NF8B 4EXLA 1H43A 4KPTA 4H65A 2F7CA 2Q2AA 3CIJA 3L6HA 1Z7NE 2ZNUA 3USDA 3U8QA 4EQ7A 2JOQA 1MH3A 2HQ0A 1Q1KA 3W7BA 2E0SA 4KR5A 3UP9A 3FVKA 5KCJB 3C33A 4QFNA 2ZYOA 4KHZE 3IORA 1D9VA 3C34A 3IL1B 5FTIA 5I2NA 2RQKA 1OMPA 5DVJA 3G7WA 3VXCA 4F29A 4JB7A 1IXCA 3TCFA 1SW5A 4NF6A 2P0SA 1N76A 4Z0IA 3TODA 5B70A 5K2YA 3EHTA 3IXQA 4XXUA 1B6HA 2QRYA 2AIXA 3DHWC 1B5HA 3VVFA 3N26A 4LZ8A 3K5PA 1NKXA 4G68B 3V5AA 3HHEA 3SEVA 3UGWA 1ZMGA 2RINA 2DWIA 1TFDA 2X7QA 3N6TA 1LGBC 3MWBA 5I56A 2Y7KA 1RYXA 1LK7A 1CB6A 2H4IA 1MXVA 1XOCA 2PX1A 3D4CA 4NF8A 3IAZA 4YU0A 1P1QA 2JHEA 4YKJA 4F3SA 4BDRA 2AL5A 4WKMA 4BDOA 4EF2A 3O9PA 1N0TA 3MTJA 3BKIB 2V93A 3KN3A 3KN7A 3VE1B 3H03A 1USYH 2XD2A 1JEVA 1FTOA 3MQ9A 2RCAA 2P2AA 1TWYA 3MZBA 1SD3A 4DE8A 3OEMA 2CZLA 3OENA 2Q2CA 2OBGA 2REJA 2NOOA 5A5XB 1MY1A 4QHQA 2DT9A 1MXZA 4LUBA 4RA1A 3QXMA 2F97A 4GF8A 4ELPA 3N6UA 2O51A 2QSWA 2AYSA 3VXBA 2ALUA 2F6PA 3FUZA 3VDFA 4ZEIA 1ZKBA 1ZJLA 1SYIA 3AXFA 4OYVA 3SETA 3PUXE 5FHMA 4NF5B 4X48A 1B7ZA 1P1UA 1LLSA 3TFLA 2RC8A 2QJEA 4QFOA 3EF7A 1GVCA 3OBIA 3TTKA 3TTLA 5CC2A 4PFYA 2F7BA 4MF3A 4IO5A 2ZNTA 5CM6A 3CSBA 4QFKA 4Q8RA 5J1DA 2I9SA 4G8MA 1QVSA 1BKAA 5L9SA 2DP8A 1ELJA 4O3BA 4OHNA 1DPPA 2PMSA 3IJOB 3MW0A 3KJ7A 1NNFA 3C4MA 4OWDA 4JSDA 4AB5A 1BIYA 1LKZA 2B3BA 5DEXA 5K2XA 4PQJA 5FIIA 4BDMA 3IOTA 3S9EA 2PC6A 3DLNA 4WEPA 2WKYA 4EXKA 1A8EA 2XXQA 4YKIA 4H1XA 1B05A 3MBPA 3VVEA 4OESA 3TQLA 1IXHA 1UJ6A 4I62A 1LAHE 5HBCA 2QS3A 2XD3A 3PUYE 3RTWB 2F36A 2HEUA 3O6HA 1N7XA 4RPNA 5ISUA 1T0KA 3HV1A 1TFAA 1MXXA 1D9YA 1AMFA 4FORA 1SDXA 3A09A 3MC2A 3THIA 2V84A 3HPIA 3O29A 4FJPA 4RPOA 3SEWA 1DOTA 3G3FA 4LQ5A 3IB1A 3VLUA 4YZZA 4RK9A 4G77A 3G3HA 1JEUA 2O6AA 4RYAA 3JZJA 1B0LA 3DP6A 4ZZAA 3IR1A 3SEYA 3G3GA 4NF4A 4F1VA 2D5WA 4LVQA 2F7AA 2F1FA 1I6BA 1IITA 3SEXA 3O66A 4U21A 3O6IA 4Q5TA 1R6ZA 4BDLA 1B40A 3TCGA 1EZOA 2I48A 4PP0A 4H67A 3WAFA 2X26A 3PUZE 1O64A 3FVGA 4DZ1A 3MJNA 1VFEA 3PUVE 5AA1A 2XX9A 2J0XA 4BLAA 3MZ9A 1MPCA 4OZ9A 2A5TB 4ZZEA 1B58A 4RNSA 3V8XB 5B7DA 2UVIA 1A55A 2M8CA 1LSTA 1PB7A 1R9QA 3U1OA 1NFTA 3ONMA 4KD5A 1IIWA 3H06B 1LK5A 3U72A 3L6GA 3LSXA 2ZHOA 2UYFA 3PPRA 4ZEBA 3PV0E 3OFHA 4ZE8A 3K01A 5ITOA 4EDPA 5AA4B 1A54A 3N94A 3TQWA 1US5A 3U7JA 1M5CA 4IO2A 1VE4A 4U4XA 4ZEFA 4KYDA 3FJ7A 4OVJA 5I56B 3RQTA 2H5YA 3TCHA 1I69A 3AB2B 1B2HA 3OD7A 3P96A 5AA4A 2V25A 3F11A 2HZLA 5IAIA 1MQIA 1LB8A 3U92A 2GHBA 3A3CA 2VHAA 3FVOA 4GVOA 4DIGA 3B6TA 4ELRA 4QFPA 3P7IA 5EYFA 5LOMA 2GHAA 2DYXA 1UIUA 4I8CA 1S50A 2I4BA 3PMXA 4NWCA 1XTZA 3OSRA 1IQ7A 3W9VA 3S9MC 5H8SA 2F6GA 2O68A 4OEVA 4YMAA 2F78A 3S2VA 1UJ5A 4EQ9A 4F19A 3FVNA 2Z8DA 4JSOA 1MPDA 3KJTA 3SKPA 4O3AA 3T9VA 4F31B 1B0HA 2W7YA 4YB7A 4PFTA 3RT8A 1XC1A 3AAWB 3BFTA 1EZPA 4XKQA 1MXUA 1Y9UA 3QIMA 4I1DA 4ZDMA 4L17A 3PPNA 3TPAA 1FQBA 1B51A 3GBAA 3T22A 1MRPA 2QPQA 2RF1A 4NMLA 4GL0A 4HCWA 4MFIA 5AA2D 3DM0A 1Z7ME 5H8QB 3ILUB 3JV9A 3C32A 3I3VA 4JWYA 1EZ9A 3OFGA 1ZLQA 1UTBA 1UIVA 4QF9A 1MM6A 2XXHA 4P11A 2Q89A 4MLQA 3OO6A 3TUSA 3ZSFA 3H6VA 5H8QA 3IB0A 2ZYNA 3I5OA 2ESNA 1KS2A 1YGYA 3RTFB 1UQWA 2V3TA 2Y7IA 4MH5A 1NL5A 3C35A 5TPAA 1OIBA 1LAFE 1XHYA 4EQBA 4Q0CA 5HM4B 4G4PA 1MDQA 3O28A 3Q26A 5ICTA 4LQ2A 5I2KB 3KFMA 1B3EA 3EN3A 3FXQA 3K6XA 4R9FA 2V3UA 4OFJA 2H98A 3B6QA 1UJ4A 3K02A 2RQMA 2XX8A 5JTYA 4FATA 3M8UA 1JW4A 2XXXA 5CMCA 5CBSA 4OFLA 3LUYA 2GRVA 4OXVA 1SI1A 1MQGA 2QS1A 1LBCA 3OXNA 1FTKA 2PBWA 3C31A 5I2NB 2CMOA 5H8NA 1AOVA 1P1WA 1FW0A 5A5XA 2O1LA 2REGA 1LAGE 2HAVA 4MLVA 1B32A 1Y3PA 2F8MA 3G3JA 4OFOA 2G93A 1IXGA 1O7TA 2ONKE 1MQHA 3M3KA 4G8NA 3FGSA 5CMBA 3N0VA 1FQDA 3OSQA 1QKAA 1Y4TA 1US4A 4F22A 3QYTA 2LQJA 2QSXA 1AIVA 3MPKA 3AB4B 3OO8A 1IZ1A 4UACA 4F1UA 1LCFA 3WAEA 3C9HA 1O63A 2XXPA 3D4GA 1BP5A 1OQGA 2XXYA 2DE4A 3MPLA 1VR5A 1A40A 1NH8A 2OWTA 1ZIUA 1H44A 1ZTYA 5BWJA 1NNTA 4PETA 5KZTA 5L8DA 5KCJA 1SC6A 4K3FA 3FASA 1Y3NA 2X7PA 1GTKA 1LFGA 4NF4B 2DWAA 1D3KA 3G3IA 4GWOA 3KWMA 5CMKA 4F39A 1M5FA 3Q25A 1MXYA 4P0GA 4UA8A 3W15C 4IO7A 4WEDA 2Q8JA 4THIA 2YLNA 1P99A 2PYYA 5EHMA 4YAHX 3HN0A 4U23A 3KSJA 4LZ7A 2I3WA 1PC3A 3GLBA 4R73A 2XXVA 4FECA 3FV2A 4JBZA 1JVYA 1AH5A 3K2DA 3KGCA 4C0RA 3KSXA 4H8JA 4H5FA 2VD2A 2XXRA 5BUUA 2H25A 2QS4A 3IOWA 2QMWA 3I6VA 5DTBA 3PPQA 1WDNA 3KG2A 5IS2A 3RPWA 4NEDA 2D21A 2O1MA 1VSOA 3IJXB 3DELB 2NYIA 4ZE9A 5CI5A 1JETA 2ANJA 3OELA 5JJBA 5I57B 3M3LA 4GXSB 1RYOA 1XVXA 5AA2A 3O97A 3QAXA 4QSDA 4F3GA 1QUIA 1PBPA 2VD3A 3H3GA 1WVJA 3FD3A 3CEDA 4NF6B 2F8DA 5HPQA 2FA7A 1YBAA 3H7MA 4LZ5A 3DC2A 2DOJA 3S9LC 3UORA 1OLAA 3MP1A 4H8IA 3E13X 3V89B 2I58A 1QUKA 4RXLA 2NXOA 3MVYA 4H0WA 5H8HB 3BBRA 4C1TA 4NWDA 1POY1 1LAXA 3RY3A 1B3FA 1IXIA 1H45A 3UA8A 1Y7PA 4OMBA 2HAUA 1URGA 1LCTA 3MP8A 3PD8A 1MY0A 1O8BA 4HW8A 2NWJA 5I58A 2Q88A 4JWXA 2FGCA 2VGQA 2ONRA 1KWHA 2O69A 4C1UA 1B4HA 4ISUA 3PD9A 5DT6A 2LAOA 2RCBA 1SVXB 1TT1A 3ENWA 4IY5A 1N3XA 1Y4CA 2H99A 1MH4A 2I0CA 1B5IA 3CSGA 2G29A 2XX7A 4PWUA 3OFEA 3K1PA 4R74A 3CFXA 1MDP1 4XKPA 3E9XA 4QFLA 5JK4A 3K1NA 2Z22A 3O6GA 4HS7A
chains in the Genus database with same CATH superfamily
3W2WA 2FC8A 2VQFJ 1B3HA 3BFUA 1MQDA 1P27B 3RT6B 2DK2A 4PXBA 3EGNA 4CNZA 3KC0A 4LQ3A 1AL3A 2FY1A 4W90B 5SZTA 2GIFA 4MFBA 2D3OR 1B4ZA 1HWKA 3ZZPA 2BJ1A 4KKOA 4DV4J 3HKZD 2R42A 4AQYF 1CSJA 4LP2B 1HSJA 2WRMA 4U7UK 4O3OA 4HEA9 2OIHA 3PTYA 1NPKA 3B78A 3UDLA 3CCTA 4O0NA 4B3SF 2GA7A 1LEOA 1JP4A 4GQOA 1RU1A 2R71A 2C3PA 1NV3A 1ZS6A 1YK9A 1Z2ZA 4FE8A 4U7CA 5FDLA 1SC4B 2ATLA 4R2BA 2XCAA 2HFNA 2LDIA 1HL6A 3KG0A 2VKZG 2R7QA 4LSNB 3CMQA 3PJWA 3CI8A 2Q3PA 3PACA 1X4DA 4C6AA 2H5EA 1VQNS 4DDFA 5I58B 2Q43A 1K1SA 3C14A 2BACA 3HMJG 3GU0A 4OX9J 2B4PA 3W5ZA 3PW4A 3M6XA 2YWWA 1UVJA 4G3IA 4O44B 4B9NA 3EPEA 4B9MA 3B8BA 3CCZA 1A8FA 1S1VB 2V8VA 3R6LB 7AT1B 3PEHA 5ELVA 4DV6J 4J9NA 1SW4A 2I4CA 1TXFA 3P3DA 4M1VA 1FPIA 1C1BB 2HMIB 4FF2A 3UE2A 4USKA 2UVUA 3AH6A 3AJDA 3VLWA 3QUJA 4XIGQ 3CC4S 3L4BC 1PAEX 4Q30B 1FTJA 2BV3A 1N04A 3MURP 3OR1B 4DJBA 2GMJA 2ZOFA 2GHPA 2B43A 2P8IA 1CC8A 4DUYF 2ZZTA 3EXCX 4K4SA 3CCVS 4GRKA 4RL1A 2JH3A 5IKBA 5GAHI 4MCOA 5GMKa 5LXYA 2PN6A 3W5XA 3T9HB 3GIJA 3RBZA 2HHQA 4XIUA 1R3NA 1H73A 1X4BA 5HATA 1WACA 1DTGA 2P9EA 1S6OA 2AEMA 1TVRA 1HPZA 2IDLA 2MZQA 2B7BB 1TP7A 4E0DA 4U2RA 2DH9A 2E66A 2FZKB 1B5JA 5DYHA 4JI8J 4HXVA 4Z2XA 3PR4A 4IUFA 1SKSA 2E5JA 2I49A 4JXIA 4RKUC 3M1VA 4H54A 3U93A 2E7VA 1HHTP 2HNDA 4QBAA 3NOCA 3E4RA 1YAEA 1ZETA 1BQXA 2DNOA 1I5OB 4LF7J 1HBUA 1HNZJ 1SBPA 3TAJA 2DS9A 2GVZB 3BS9A 2F4VJ 5IZHA 1HSLA 4ITSA 2BABA 3NNAA 1YJVA 4DV4F 3PR5B 3SDEA 2QLFB 3H5XA 2A5SA 2NUVA 1T95A 2KJWA 4PG4A 1JJ4A 3VWSA 1VQOS 1SKWA 2E5IA 4N4UA 3PHTA 1FJCA 2FC9A 1JX4A 4X4OA 1URRA 1ATGA 3OR2A 3DP4A 4YKPA 1EP4B 2O7IA 5FD1A 1KA0A 3PW2A 1YJNS 4NGUA 3MDFA 1RT6B 2IBOA 2VFSA 3G6VA 1N4LA 2FJVA 3QUFA 2DY9A 1Y10A 2RRNA 3CG3A 3IK6B 4DX7A 4IO3A 3QIPA 1R6VA 4YOEA 2JZ5A 2YPZA 4ETXA 4QYRA 5TP9B 2Y1LB 5C2GA 4CIOA 1PDAA 3VGUA 2ZE2A 2IJRA 1QW0A 2DISA 2XXUA 3M8PA 2QLBB 4PAAA 1ZU0A 1HW9A 2B9WA 1W25A 4EUOA 3DP8A 4H6DA 1KBRA 2HAIA 1LEVA 2OI2A 2GC8A 4Q0BA 1RWUA 4UOCA 5EN1A 3ZTRA 3MAHA 4XKNA 3HD2A 2CEXA 4YFUA 2MLYA 4KBIA 1KSPA 1U8SA 2HFBA 3R3TA 1IN0A 1UVLA 4DX5A 4F3BA 2VQFF 3A8EA 5D77A 1QUVA 4MK9A 2QL3A 2WVFA 2BE2A 4OHVA 2XSJA 4AD6A 4NTLA 4TLMB 2XNRA 2KFYA 1B9JA 3KZGA 2H54B 3U94A 3G82B 4ZPCA 3ZKLA 2QLXA 3Q89A 5GVQA 1XQIA 2DTJA 4PFRA 3RBEA 4EBCA 3CJRA 2Z2YB 2MZTA 1F2GA 1U8WA 1AFIA 3OO9A 3FJMA 4PFIA 4R6HA 4WFXA 4I3EA 5F8GA 3B4DA 1DTQA 4ILRA 1B7HA 3MR6A 3BSAA 1R8BA 3LC8A 4JP8A 3GIRA 2OCUA 2ZJRQ 4ES3A 1PJ7A 4PAKA 2V4QA 3BYPA 1FXRA 1CE2A 5AXKA 1HQUB 4ND9A 1WOSA 2PCRA 3UIFA 2EW9A 2ZZVA 4NE4A 4DR3J 1T94A 3TNVA 3E79A 1L3SA 2BANA 1FA0A 3HHLD 3L7UA 1F5AA 1R9LA 3LP2B 2VG6A 2FHOB 4DV2F 4B3MF 2GQ2A 4KT0C 3TJ9A 2I8EA 3H4ZA 4J9UE 4DL7A 2BBEA 4RW4B 4PFUA 3LAKA 1ITPA 2PFDA 5DRKA 3W9IA 2JEIA 3MCMA 4IR1A 2FUG9 4URQU 4LIWA 4G8HA 2HFSA 1URSA 2WCXA 5HROB 1M5OC 1FX4A 4P9SA 5HMZA 4MK7A 3KLFB 1FTMA 4TQRA 1C0UB 1HA1A 4G6VB 1KZ8A 4P52A 1MG1A 1WJ9A 5D4OA 3E01A 3W8GA 2GVZA 4USIA 2XMKA 1I94F 2QA4S 3BREA 3FEZA 1XI6A 2FHJA 3TRGA 5K20B 4GLIA 2JEJA 4F2OA 3SCJE 2FTRA 1FF2A 1SQGA 4EFAC 4KFQA 2NREA 1REGX 4OI6A 4PWWA 1KQGB 2ZITA 4NLVA 1TZ0A 2MEWA 4F04B 3OT9A 3AD7C 3QFHA 2CEYA 3ISNC 2DXYA 4GX6A 1IBKF 5KFAA 5BXIA 4G2ZA 2BQRA 2GO9A 4KPCA 1VQPS 2OPRB 3R26A 2LCWA 3T5LA 2HZKA 3CO9A 3R5GA 1FTCA 4USMA 3R97A 2DRBA 3QT5A 3DLGB 2C3MA 1Y3JA 5AA3A 5ET6A 2BEFA 5KFEA 1FVSA 1CQMA 1S7HA 4OYMA 5IC6B 1G1XA 1MU2A 4MK8A 1RACB 3MZIA 4O4GA 4EO8A 3T19A 1T03B 3LA0A 1KD1T 2HK3A 1FRLA 1R8AA 2PT2A 5DG7A 2NSBA 2Y7PA 2DR9A 2DEIA 3DDNA 1NKEA 4MKAA 3M6UA 4DCXA 1UTHB 3OO7A 4X64F 3Q8SB 5DDPC 2DITA 3LPYA 1BD6A 1YRTA 1EETA 1JLAB 4KHPF 2D9PA 2UVGA 3K00A 2YPNA 2CNLB 4U4SA 3Q8VA 2UUCF 1R1NA 3BB5A 1N0VC 4DQIA 1NV6A 2Y3YA 5M2VA 1RQ0A 4N47A 1S48A 2HHTA 4GOTA 3N5LA 4Z7EA 4R72A 4BC9A 4ILMA 2PVUA 1K9ZA 4IGTA 2P6TA 3BH6B 2GH9A 3UWTA 2HVIA 1MY4A 4YQWA 1B3LA 2CAJA 4DU7A 2OSQA 2YKMB 1FCKA 4FF3A 2YWKA 1PB8A 1H6KX 3FRYA 2FIUA 1N7WA 3H2LA 8AT1B 3DNCA 3OR2B 4ELVA 4B3RJ 4ENOA 1TUGB 1UZHA 4YKKA 5BYQA 4USTA 4F1YA 3MVXA 3W2WB 1NUXA 2EG2A 2MDAA 4KXPA 4OV6A 2ZBQA 2DNRA 3IX1A 1BY9A 1L3KA 3K0VA 1D4NA 4MIAA 3ZZUA 4LFCJ 2AP6A 2P1SA 3TEGA 1K8AT 1SH2A 2ROPA 2ZNYA 3MF5A 1LOUA 4LFBJ 4CWBA 2FIXA 5GAGU 1RUSA 4CO3A 4POWA 5HVHA 3ZTPA 1WSVA 4IO6A 1PJ5A 3IS9A 1M1HA 3CDBA 4B9VA 3L09A 3F0NA 2UXAA 1RDXA 3ZS6A 3HSDA 2BXJA 3OFFA 2FVZA 3RBDA 4LF5F 4ELQA 4DXBA 2PI5A 3C36A 4QR0A 3BBBA 4YB5A 1TUVA 1UEVA 3LANA 4NI2A 3VZIA 1R89A 2JFDA 1KTVA 3E3KA 2BMBA 3ZZOA 4X9TA 5H8FB 5H1SV 2LFVA 3F44A 3QJPA 5AE2A 2J7UA 1RKJA 1QY7A 2C2NA 4KQPA 4ID5A 3IWLA 2XXIA 2KRRA 2Y7WA 3R5BA 3I9ZA 3KOTA 4DV6F 1IMCA 2DRAA 4TY8A 2ALYB 3T6BA 3FXRA 2E29A 3HFVA 4PGNA 3UD3P 4O3CA 4O7IA 2I38A 2HRYA 1H3DA 3HHGA 4A8XA 1XR5A 3NNHA 3H7HB 3M2VA 5JVHQ 4J9LA 5ESYA 3LP1A 3I4PA 3BGRA 3IWNC 3EWGA 3L6HA 1CJTB 4FN5A 4DL3A 4EQ7A 4L74A 2CYYA 1N5YA 2V4JB 2JOQA 1HYSA 2XWYA 1O51A 5HVGA 2HVHA 4KTQA 3FVKA 2QTWA 4GVLA 2H3EB 1X31C 5KCJB 1X5OA 4HL9A 4AXJA 2ZYOA 4OZ1A 1S72S 1D9VA 3C34A 3TR5A 2XYGB 1U2FA 3DI6B 3IL1B 5FTIA 5I2NA 3TX8A 4N8GA 3FMWA 4OHXA 2HFVA 2VPZB 5ET8A 1VQMS 4JI7J 1RWOB 3E51A 1WHVA 3WX8A 3D6MB 1VOMA 3VXCA 3NP5A 3EYZA 4JB7A 3W66A 1VGYA 4Z0IA 2E5LF 1IKWB 3OW2R 3DLKA 1FFWB 5B70A 1OYDA 1NKCA 4NLSA 2RD5C 1UVKA 4LFAF 3EHTA 3BH7B 4F4YA 2QRYA 2MQQA 3BV8A 4C9DA 4R25A 2P3VA 4JI2F 3PJ9A 2G1DA 2FQQB 5D78A 3MUMP 4WKRA 2R7RA 1ZMGA 4M5KA 2R8GA 2X7QA 3BKTA 3RW7A 3HFKA 2Q6BA 1LGBC 3A8KA 1ZM4A 2Y7KA 1RYXA 3HPOA 2EWHA 3IRXB 1MXVA 1UA1A 5A8WB 2LQBA 1M5SA 2MTLA 4YKJA 5CD4A 2AL5A 4WKMA 4BDOA 3NOGA 2IA6A 1G0IA 1HBNA 2PI4A 4K50A 4ECWA 3KN3A 3KN7A 3QO9A 1WF2A 2P6SA 1GQEA 3LGHA 5C2CA 4DLEA 1HQEB 4NHBA 2XD2A 4OFZA 4I64A 4ER8A 2DNQA 3D67A 2HS0A 3OEMA 2QJ3A 4UQGA 2REJA 4QHQA 4FDFA 1FKOB 5LMUF 4RA1A 1VRQC 3FZBA 3F56A 4QYZK 1MWQA 4M1KA 1FJEB 4GF8A 3R2CJ 3N6UA 3IG1A 2QSWA 5GAEI 4Q8FA 2VHGA 3VXBA 4PC9A 3KJVB 3LH2S 4RX6A 2ZDOA 1ZJLA 1CG2A 1UWBB 3KHRA 3AXFA 4ZIVA 4NF5B 4X48A 1XR7A 1P1UA 1FPFA 3K0JA 4JV5F 4GWWA 3OV7A 2XY5A 4I69A 2KZZA 3T1BA 4CDIA 2BKPA 4JI3F 5KFJA 1JLQB 1NV2A 1RT2B 3EF7A 4AE5A 4A8KA 5DZ6A 2ZWOA 3VV2B 5CC2A 4PFYA 5KT4A 2Z58B 3CT9A 4RLEA 2W2PP 3CSBA 4N8NA 1QVSA 2AJFE 3HFZB 2DP8A 1ELJA 4O3BA 2FHYA 4HACB 5M2UA 1JLFA 2PMSA 1HWLA 1NDCA 2MLZA 2HZCA 2XM3A 3JAMU 2RUSA 2ZH1A 1U1QA 5L9NA 3CD0A 5CYMA 1NNFA 3FQKA 3HZGA 5FDLB 1HWUA 3IS9B 3DOLB 2ZH2A 4AQYJ 4OWDA 4JSDA 1YXIA 2MQMA 1H98A 5F41A 2B3BA 4LVNP 2Y0SD 4BDMA 1S0OA 1QVFR 1HNVA 1VC5A 3DLNA 1CEZA 2IVMA 3UDVA 2WKYA 4L3KA 3V5RA 4DSKA 1Q8KA 4I2PB 3SI8A 4HT7A 2W7OA 1RTIA 3CCJS 1UJ6A 1LAHE 4O7MA 1FK9B 2QS3A 2XD3A 2F36A 3O6HA 1C4AA 3BSCA 2VG7A 3SXLA 4ES1A 2IA0A 4CT9A 2LKZA 4GX4A 2BJDA 1DTTA 4L73A 4QWDA 4FXWA 3A09A 2QA2A 5F9NA 1S0NA 3HPIA 1S4FA 4NZ0A 1HR0J 2W8KA 4DSIA 3O29A 5KT2A 4G1QB 4USJC 2WSFC 5IQQA 2AGOA 2RUGA 1HBOB 3VLUA 4RNHA 3B82A 3WZ0A 4LF5J 5ETNA 3IR1A 3J7ZT 4Q43A 3IFCA 3PX6A 3QGPA 3UR3C 3G8TA 4ZS6A 3CULA 2Y1IA 2GGPA 1VK3A 1TQLA 3O66A 4DL0C 4DUZJ 3K5LA 4A8FA 1PKUA 1Q5VA 1B40A 1BQNA 5ADZA 3QGGA 2PMZD 3OLAA 1CBKA 3G6XA 1VIXA 2I48A 2MMYA 1VC0A 4MJOA 1TV6B 3KTQA 3RU0A 4PYAA 1LBZA 4N91A 2AGQA 1O64A 1VI7A 4ZA1A 3FVGA 1N5TA 3EZOA 3MJNA 1G6BA 4RWWA 1VFEA 1K47A 1RT4B 5KFNA 2XX9A 3KG4A 3R9LA 2H5JB 2BRLA 4QIEA 2P3NA 4ZZEA 2MHNA 1B58A 4EMDA 1ZAWA 1J27A 1XN9A 3HVWA 4CCHA 3WQPA 3U1OA 1BWVA 1NFTA 3ONMA 3DRSB 3QJJA 3VAGA 4O8MA 2GJ2A 1YRXA 2I5JA 3D68A 2QEXS 3DLKB 4TU7A 5K8OA 1IKWA 1SIWB 1DK4A 3BGLA 3PPRA 4QW8A 4XDDA 3KOAA 3H4BA 3OFHA 3K7RA 3PYEA 4OZLA 2W9CA 4HDGA 1RA6A 4WU2A 1R0AA 4PXDA 4KYDA 3PCOB 2XWIA 4NLDA 1G2EA 3AT1B 4DPTA 4QJVA 1B7FA 2HQDA 2H5YA 1I69A 3MTKA 1B2HA 1HHSA 2HVEA 3OD7A 3P96A 3F11A 5D0EA 2GIQA 1UPMB 2KFZA 2HZLA 3PYDA 1MQIA 4GVOA 2ZJQQ 4DIGA 5L8RC 2IM0A 2DIVA 4TN2A 2HQCA 1WG1A 4CLUA 2DYAA 4Y2AA 4LJMA 4M5IA 3PKMA 4LMZA 4N15A 3HSGA 2Z2LA 4NLRA 2GHAA 2DYXA 1GEHA 2XNQA 5E0OA 3R7BB 2ERRA 5KFGA 3TO8A 3S9MC 3V81A 1AUDA 2F6GA 5GMEA 2C3UA 5KFCA 1UJ5A 4P7VA 1RYRA 2FJDB 3RGIA 1CJKA 4RW8A 3ZTOA 2MKIA 3R5AA 1MPDA 4O3AA 2YBVA 3T9VA 1D9AA 2YX1A 4NXMF 4Q44A 2GV1A 3J7YU 2KZMA 4BWMA 1KONA 3CCES 4Q8EA 3RT8A 1XC1A 1D9QA 2BANB 2FJEB 1MXUA 5BR8J 4IO9Q 3QIMA 5IC4B 5FBPA 1BWEA 3PPNA 4DQSA 4DFPA 1FQBA 2B8QA 2BX6A 4F8RA 3M32B 2VFVA 1FJGJ 1V3SA 1MRPA 2HBRB 3CGIA 1L3TA 1A0OB 3GIKA 3I56S 4NMLA 5AA2D 2M2BA 4OJ3A 3ONQA 1Z7ME 2X1FA 2B5JA 3ENAA 4Y34A 1HHQA 4Q7AA 5KT5A 1U2CA 2WONA 1R8HA 2NXEA 4ED2A 2BE2B 1ZLQA 4YP3A 1MM6A 2Q89A 1WUUA 4GX3A 4LRFA 5H8QA 4NCGA 1ELOA 4ED4A 1YGYA 1K73T 4P7TA 1R31A 5HMYA 2V3TA 3VALA 1XHYA 2BOPA 4F0HA 4Q0CA 2G0CA 1MDQA 3O28A 3MECB 5ICTA 4LQ2A 2H51B 3EDRB 2SXLA 3GONA 1B3EA 3I96A 3EN3A 1QLNA 3K6XA 1X9SA 4R9FA 4OFJA 2QA4G 1KNZA 3KK2B 1Z2LA 3RR7A 2GCFA 2XX8A 4FATA 2KXFA 4ZCLA 2XXXA 5CBSA 2J8AA 3A3OB 4OJHA 2NSCA 1FTKA 4DPXA 5A2QU 2XHWA 3TVZA 4P3LA 3QIDA 2CJXB 3C31A 1FWPA 2XI2A 2UUAF 4JYAJ 4J9QA 1WEXA 4DQPA 3FKBA 3QAEA 1FRIA 1RT6A 4OZ0A 2OEKA 1LAGE 4LR8A 3G3JA 4X4QA 1YTYA 4OFOA 3FNNA 1C0UA 2X51A 2ONKE 1CPZA 3THTA 2RNEA 3OSQA 5B0EA 3CCMS 2U2FA 4DXLA 4K5SA 1NJYA 1XNQF 3QYTA 4X4VA 2AYGA 2CJAA 2NLWA 2HHHF 2LQJA 2QSXA 1YI2S 3AB4B 3KHGA 2IAJB 1IZ1A 4X66J 2CUYA 2CPJA 4QR1A 2QFJA 2XXPA 3KG1A 1IBLF 1OQGA 1VR5A 4WP8A 1A40A 1PC4A 4DV3F 3AA8A 5HLFA 1ZIUA 2IY5B 3QSIA 3FK4A 5CHCB 1YLXA 5CCLA 4PETA 5KZTA 4TKTA 1S7IA 3EGWB 4JI6F 1R0AB 4TU9A 5L8DA 1A6LA 1SC6A 1FFSB 1RWVB 2LEPA 2IYIA 3MUVP 5ETOA 1GTKA 4N6DA 1NSQA 4NF4B 3T3FA 3G3IA 2BRKA 3CCUS 3KWMA 5CMKA 4F39A 5I3PA 4UA8A 3W15C 1EKRA 1RTHB 1I94J 1P99A 3H98A 4ECVA 2M4MA 2ZFHA 3LV0A 5CYMB 1VQSA 1RHMB 1SUQB 3KSJA 3AQOA 2I3WA 2QSFA 1PC3A 4I6AA 4LSZB 4R73A 2WZ1A 4JBZA 1JJ2R 1VQ5S 1EKSA 3KGCA 1KFSA 3GV5B 2HZAA 3H90A 2CZVC 2WB1D 4LRDA 2Y5LA 5DTBA 3PPQA 1S57A 3THPA 4KO0B 5E3RA 3BO4A 2ZVSA 4HI2A 4K4VA 3IJXB 2NYIA 1TV6A 4ZE9A 1LXJA 5I57B 3ROJA 1FBFA 1VRTA 3TVYA 4MNIA 5KG0A 2VONA 2PFZA 4QSDA 4DPUA 1O5JA 3CIMA 3MAAB 1QUIA 1PBPA 2Z2ZA 3GSIA 2IC3A 3H3GA 2Y8WA 3FD3A 2VPOA 1GXLA 3G2XA 4JV0A 1ZTTA 1XMOJ 1REVA 1FPBA 1PILA 2B9EA 2UU9J 4LSNA 1AFJA 4OVQA 5HPQA 1YBAA 3MD3A 5B0FA 4KFBB 4B3MJ 4I2QB 3PIOQ 1H2UX 2DOJA 3S9LC 2G13A 1R27B 2X3DA 1S9GB 2H1YA 2L9DA 4Q0BB 1HNIA 3NWGA 4HE0A 2E9ZA 2UUTA 5HMWA 3EPIA 4H0WA 5H8HB 4ZJQA 2ZKUA 2CZ9A 3S8SA 4MMPA 3I0SB 3LWMA 1B3FA 1H45A 3UA8A 4OMBA 2R8JA 3QIPB 3M2UA 1YJ9S 3T5HA 3MP8A 3KJNB 3O8WA 3SIPB 1MY0A 4XF5A 4RJVA 1IBMJ 2G0IA 4WFYA 1AYEA 2Q88A 2OX3A 2OFGX 1JLGA 4C3LA 1FXDA 1Q82T 2ONRA 2XB2D 3M9OB 4F26A 3PY8A 1RHQB 1NJXA 2QC3A 4P8BA 1SVXB 2C2RA 2BW7A 1JLCB 1N3XA 5CAAA 2FHKA 3CDWA 3P5BP 1N6QA 1PG5B 1S49A 1B5IA 3VR1A 1V5IB 2G29A 2RU3A 2FGOA 4HE1A 4CM0A 1RWWB 3OVSA 3GJTB 4ZOSA 5HP1A 3OFEA 4M63A 3CJ8A 2D69A 1S6PB 4RW7A 3CJ4A 4HS7A 1T3OA 4JI4F 2IM2A 4HHUA 1GXTA 4DFKA 3V6HA 3PPOA 3PV8A 2V4CA 2WBMA 5EHSA 4OI1A 1DLOA 2O7UA 5B08A 4TLLB 1SC1B 2E1PA 4NMYA 4HTGA 3K8WA 3K4UA 3L7OA 4KJIA 4OX6A 2DGVA 5ETSA 2KL8A 3KHLA 1P1NA 3JSMA 2ZBIA 1YYZA 3KNAA 3NL0A 5GAGI 3HO7A 4A8MP 4YB6A 1GMWD 3DLHA 3Q8RB 3IC1A 4LSLA 3W62A 2N4DA 2N4CA 1NUWA 5ETMA 3JSMB 3DM2A 3LSWA 2AJ1A 3VFJA 4KYSA 1D1UA 1HW8A 2E5LJ 3BF4A 4EBDA 1F9FA 3WIUA 1F6TA 1S59A 5BYSA 4MYTA 2NQPA 5E7OB 2EVZA 3HF5A 2WYPA 4QRZA 4U1OA 2B4MA 3ZZZA 5CXTA 2FZGB 2VFUA 3B6WA 4BDQA 2WEFA 3HSZA 1NHKL 5EQ9A 5IT0A 5HK4A 2VASA 2VB6A 3NWRA 2DVCA 3QK6A 1TKDA 1GNKA 3P5TL 1GGGA 3PPPA 2XMJA 3TDJA 1B99A 1F3FA 2EFNA 4QIVA 3NNCA 5J1NA 2OP5A 5EGYA 3H6UA 1ULRA 5H8FA 2NYHA 1X4CA 4H5GA 1KRPA 2ZEJA 2DWHA 3HVAA 2A3JA 4GWSA 2UXDF 1JMTA 4G1QA 3IG1B 1L5TA 1NV7A 3TKDA 5IZ1A 2MZRA 3RGYA 2DNLA 1BQNB 4JWOA 2H4WB 4ERDA 3ISPA 1SW1A 2MKHA 5HSPA 1XS5A 3DRSA 1RTJA 3ISND 1X60A 4YUDA 2MHEA 3T1YF 4ELTA 3T0JA 3PRDA 3P6YC 3MMCA 4XKRA 4DCYA 2EXUA 4IOCQ 4JI6J 4C11B 2W9BA 3DHXA 2LEBA 4Q5VA 1QULA 3HM9A 2MQNA 2OD6A 3FBFA 3U02A 1RHJB 2MQLA 3UW1A 4EEYA 3MOJB 1SKRA 5EYHA 2O5DA 4ED1A 2NUHA 4ONYA 1QJHA 4IGRA 2QVRA 2CPDA 2QMXA 1JLFB 4C48A 4A8WA 3PMVA 3D3BJ 2IC3B 3Q22A 3MXHP 2UVHA 4CO5A 1R8CA 2RAQA 3QFWA 4ANEA 2K7KA 4FF1A 1IUDA 3GCWP 3V6JA 1X8DA 4N81A 1HLWA 5T3JA 4DCPB 1RTZA 1U02A 3VVDA 3ODBA 1I6AA 3J81Y 4QXDA 3G3KA 5DQHA 1RT2A 3JB9k 2UUCJ 2F40A 4ZVRB 4K8RA 2AV5A 1IR1A 3C3LA 3PUWE 4ID5B 3PNIA 4X1DA 5H9FJ 3ECRA 1CS4B 2KKHA 2BE9B 3PW7A 1VRUB 1OVBA 1UTHA 1XNRJ 1RHUB 1DTZA 2V68A 1GMUA 2YX4A 3CXCR 2VKRA 3KN8A 4K4UA 5F0UA 3GMGA 1LXNA 2OK2A 2VIHA 3OMBA 1D09B 1Y3QA 2DGSA 3FZVA 1S4EA 1NV5A 3TEPA 1ZBMA 4RW6A 2JVRA 4B02A 3PRBA 1KQKA 1F5BA 4KH0B 4DSJA 2UVRA 1B64A 5KFPA 2UXCF 1MW7A 3MM9A 2AZ3A 3SDFA 2RB7A 1WKLA 2WSCC 1HYSB 2LQ9A 5KDTB 3PJXA 3GIMA 4WIIA 3JYRA 1TL5A 4IDKB 5C25B 3N28A 4DWIA 3M2RB 1JLBB 5DDQC 2WBDA 4C8KA 4HACA 1OVTA 3C6TB 1J1NA 1FQFA 3DRXA 4NLWA 4AYBD 4OTEA 4YICA 3M8RA 4GWUA 2WHOA 1I1GA 1VDWA 1DSNA 1FKOA 4DZ6A 4IKAA 2EPIA 3EZUA 5F9LA 3MAMA 3GG0A 2MKYA 5JEIA 1N3WA 2M70A 3DRPA 1CJUA 4GO7X 4HVZA 4PE5B 3NLCA 4J9SA 2R7TA 1H7XA 1D8ZA 1FE0A 5I3QA 5AE1A 3HI9A 1WWHA 1GFWB 3A3UA 2DH8A 3IGNA 2F8HA 3Q29A 2GHWA 1XT8A 3N5BA 6FDRA 1ZYQA 3JXOA 3MR3A 1V3RA 2W2MP 1I6QA 4HHHA 2FNCA 2NXNA 4K4XA 3R7XA 2KT2A 2XULA 3TJ8A 2ZH9A 1DMBA 1B3GA 4OLPA 2QMUB 2KU7A 1MQJA 4NF0A 3ITHB 2YNIA 1NHVA 3MMJA 5IGAA 2XWOA 2GQ1A 1RLCL 1QVGR 2E9RX 1UW9A 2YWGA 1YJTA 4WZQA 2C28A 1T0TV 3E2EA 1ICEB 2RHQB 2F3BA 3M2UB 2G2ZA 2ZYKA 4LRBA 4NYOA 2KJVA 3K5MA 4PDDA 3V4IA 3BN4A 3C2PA 3R6UA 2ROEA 2RF2A 1S6QA 4DR1F 2QL7B 4X65J 2YNGB 1WODA 5ITHA 4IG3B 2RC9A 2ZJPQ 2CNKB 2BE7D 5K8PA 2MKSA 4EZ9A 3BIGA 1KOHA 3RW6A 5C42A 2MPUA 4IB2A 3IOVA 1VS3A 4NLOA 1JLGB 4GO5X 1MWYA 4I40A 4CO4A 1H0HB 2N3LA 3AXKA 2ZZXA 5EX0A 3TZZA 4F3PA 3TA2A 1FPEA 1UPPA 3I55S 3DOMA 4ZVSB 1LWEA 2HQIA 2MY8A 4F0MA 1VQKS 5G4DA 2W7PA 3FCVA 3NGSA 3RAMA 3NS7B 3K8VA 2DY1A 4Y2IA 1Y1ZA 2GO8A 3CG1A 2F35A 3H6WA 2Q74A 4KCDA 3MPUB 3EVOA 4R8UA 4Q2LA 5KG7A 3TTNA 3HHLA 5AE4A 4HYKA 1NK0A 1Y4ZB 2EG1A 2ZMBA 2MGZA 3FXUA 4E8UA 2K06A 1JNFA 4ICLB 3NXZA 1SKUB 4LFCF 2WTFA 3KNGA 1S1XA 2HGLA 1LBXA 1SJ1A 5T41A 1LBYA 3TUIC 3TZYA 4JV2A 1B52A 2E5GA 2I6EA 1WC3A 2YX7A 3F41A 3BPDA 3WBZA 5B0BA 4ED5A 2V8GA 4R75A 1M5PC 1NRKA 1DPEA 1TK0A 5HLFB 4LVOP 4P0IA 2RC7A 2XXTA 2WBBA 3DRYA 3GFZA 2CJKA 3AXMA 4MAKA 5GAEU 4NEZA 1OPZA 1EX8A 3W60A 2VJUA 5DDRC 1RTDB 2FJXA 4LSLB 2RSQA 3KC1A 1GXUA 2OMLA 3MPYA 4JDFA 4Q45A 3UN2A 2X1GA 1N5YB 1NSAA 2VFRA 1FQEA 2OPRA 3C46A 2YVSA 2J8SA 1UVMA 1B1HA 2DD8S 3HSTA 1WD6A 2UXDJ 4C4WA 4CLTA 1Y1MA 2ZYMA 4DOZA 4PFBA 4KIAA 2QYCA 4ZPTR 4KPYA 1SUQA 1Y5NB 1NPPA 4WP9A 2BJ9A 4CNYA 4WCEQ 1NJZA 1T9VA 4NLXA 3QATA 1BXNA 2XG8A 4RO0A 4DL6A 3SZPA 5AJ3F 3GJQB 4E0WA 3N6NA 3W1YC 2V4RA 1KHVA 1VFDA 1YRUA 1Z1ZA 2CQDA 2THIA 1IKXB 1WC6A 3BGOP 2HGMA 4OX7A 2B3FA 5FLXU 2HQFA 3ZKKA 3LSFB 3GV7B 1JLCA 4O3RA 2VA3A 3KDOA 1OQHA 4I3YA 5TPAB 4M4GA 3SQOP 4DU8A 4J5OA 3FGVA 3CFLA 2JDJA 1D9DA 3CJSA 1Q53A 2AW0A 3KBRA 2UYEA 4BWJA 1FKAF 3GPAA 1FJ9A 1OSDA 1Q35A 5BYRA 4DDDA 3CD7A 2HQ3A 3G86A 2WW8A 2VV5A 4NX9A 3IA0A 1MXWA 2DJWA 2AD9A 3TELA 3NMAA 1NUEA 3S1TA 1NU4A 4DF4A 1JVXA 1P1TA 2CDQA 3TX0A 2R9JA 1PBQA 5IT9U 3IAM9 1YX2A 2XCPA 1S7YA 2VOZA 3R5JB 4S0MA 5KFLA 4PCDA 1UCNA 4A47A 4DV1J 4U7UD 1URNA 1HI8A 3K5OA 2PGCA 2XHDA 4TQUQ 1URDA 3T9ZA 5A0YA 4OV1A 1S1WB 4FBPA 3IO4A 3IB2A 4YB1P 4DR3F 1NK8A 5CZXA 1HBOA 5IQ6A 2M52A 4KV8A 1IMFA 1PYOB 2HLTA 4H65A 1OWXA 2Q2AA 3CIJA 3FCHA 5CH7B 3KK1A 3W2VB 4ZVFA 2ZNUA 3USDA 3U8QA 2DPJA 4DL4A 1DBZA 1Q1KA 4ZPDA 4ED8A 2E0SA 1NSKL 3UP9A 2LXFA 1KP6A 3HDSA 1C4CA 3BGFA 1U1NA 4OMFG 4QU6A 2HWHA 4ZVTB 5HQ8A 2ACYA 3CB4A 5ETLA 5DDOC 1MG7A 3H5SA 2AQ4A 5IFMA 3A12A 3HO1A 3GG1A 1VIOA 3Q0AA 2PMHA 3H25A 2B56A 4CM2A 3C15B 3I5BA 4GWYA 2FYXA 2DDKA 5D4PA 4QBUA 3BSNA 3VGVA 3G7WA 4JUZA 1EIYB 5D6GA 3D0HE 4F29A 5E33A 1SW5A 3TCFA 5LDZA 1RZMA 1SJRA 2AEJA 2FLLA 3TODA 4HE2A 2HHUA 2RS2A 5K2YA 4KR0B 3IXQA 2LECA 4OYPA 2AIXA 1FESA 1FT8A 3DHWC 5F0WA 3H40A 1B5HA 3N26A 4NLGA 4LZ8A 3K5PA 1IMAA 3VVFA 2FPHX 3LUZA 4J9VA 3PX0A 3R7SB 3C66A 4G68B 1FNMA 3V5AA 1BLUA 2RINA 2DWIA 5KFQA 4NE9C 4NA3A 4NMXA 2O1PA 3OL9A 2H4IA 3NCQA 3OXFA 2PX1A 3D4CA 5L39A 4O3SA 3GB0A 4DV5F 2PA8D 2JHEA 2CIMA 4BDRA 2I2YA 4WFZA 1HNZF 2WSEC 1N0TA 1IR0A 3O9PA 2CA9A 3SQGB 1UZDA 1NDPA 4IOBA 3PHEA 2LQ5A 2XZTB 3MQ9A 4L6V3 1TWYA 2A18A 1IWGA 1UL3A 3KMQA 1SD3A 4NCBA 4ECXA 2B4VA 1YHQS 3OL8A 2R2UA 4CLWA 1NI9A 4ECTA 3US5A 3HHLB 3EXYA 3A3PB 4FVCA 2NOOA 2C2EA 4W98A 3G71S 1RAOA 3QNWB 1Q5YA 2HQGA 3M8PB 1KLMA 1W7WA 5RUBA 1G0HA 2MLXA 4A46A 5IOLA 1S1TA 4KV8B 1B0VA 2IFXA 2ZM6F 2O51A 3I82A 2HGNA 1SL2A 2W8LA 1N5SA 4ZEIA 1JNZB 4UABA 4BC7A 3E3XA 4OHWA 1H2TZ 1SYIA 4IG3A 4OYVA 1P8GA 2COLA 2NXJA 3SETA 1K9YA 3PUXE 2PMWA 2FD2A 1B7ZA 1LLSA 1S6QB 3T1HF 3BBFA 2HS3A 4C97A 3GCXP 5B0AA 3UVJB 3Q8QB 2JNJA 2F7BA 4IO5A 2ZNTA 1IKXA 3BR9A 3A4TA 1RDYA 1LNQA 5J1DA 4RUCA 4NCGB 3SV4A 1M1KT 1BKAA 4OHNA 5L9SA 1QSYA 1DPPA 2A0FB 4PWDA 2AJ4A 5IZ3B 1FPLA 4PXEA 3MW0A 4M5MA 2B4LA 2YKOA 5A8WA 2JSXA 2XTJP 3C4MA 3V81B 4FNIA 4AB5A 1LKZA 4C0HA 2CJ9A 2Z0GA 2QV6A 5DEXA 4PQJA 3O2IA 3VVUA 2K3KA 1M5VC 3GYGA 4WEPA 3SSQA 4EXKA 2KT5A 1Q81T 2V9WA 1IM6A 2B6AA 3NGKA 4ZPVR 5HBCA 1RTJB 1HNVB 3M6WA 4RPNA 2VG5A 3CCSS 2JEGA 3TARA 5ISUA 3R6GB 1T0KA 3CJ5A 2Q66A 2XLKA 1TFAA 5D0RA 2RVJA 1MXXA 1AMFA 4NLQA 3J7YI 4C8YA 3MC2A 3THIA 4ZVUB 2W9AA 4RW8B 1KVKA 4FJPA 1DOTA 2CQPA 4LQ5A 3KUEA 4Y65A 4YZZA 3IR5B 4RK9A 4G77A 3ISZA 4ZVQB 1JEUA 2O6AA 3TA1A 4O3PA 3DP6A 2ASYA 2UV8G 4ZZAA 5KG2A 4LF4F 4PR6A 5I42B 3RRHA 4GWXA 2GMLA 3G3GA 1JLBA 2F7AA 4B3OB 2V6AA 4A4JA 1I6BA 4QIGA 1IITA 3SEXA 4U21A 4Q5TA 1WG4A 4BDLA 3TCGA 2KXNB 1KKHA 2XGQA 2QVUA 3P8BB 2XMAA 4ZLLA 3MEKA 4DI4B 3GWCA 3JTOA 3IN5A 1Q79A 2OPQA 2HXRA 1KQSR 4C3MA 3IMQJ 2XXKA 3PUVE 2W2OP 4DV1F 1FVQA 3MM7B 3HHDA 4BLAA 3POTA 4UOHA 4NOHA 4OZ9A 2AYBA 2R7VA 2A5TB 2ZBCA 4RNSA 3V8XB 2QL5B 5B7DA 5A6WA 1FKPA 2I5JB 2M8CA 3ILOA 3EM1A 4RNFA 2HBQB 5B0GA 1XMQJ 1TR0A 2HEKA 1J5EF 2OJ3A 4R0JA 4RZRA 2HVDA 1HPZB 1S0VA 3PFOA 1C1BA 1Q8BA 2VOOA 2M9KA 4ATNA 3ZZ0A 3H06B 5I5PA 3VVTA 3RJMB 4H4OB 4B3TF 3X1LB 4DR6J 1FRHA 2DBBA 5M2RA 2ZHOA 1FJGF 3NS5A 4IFYB 4UUWA 4AUKA 3EE3A 5ITOA 2G0JA 1UA0A 4EDPA 5AA4B 4JI4J 2YNIB 1VE4A 1UAWA 2DGOA 4RUAA 3Q23A 5LMNF 3OTCA 5ETPA 3QMQA 1N36F 2AGPA 3SCKE 5K5MA 3TCHA 3TZWA 5IXUA 5AA4A 1RT1A 1LB8A 3U92A 2GHBA 2V8HA 4Y2KA 2YWHA 2VHAA 3GLJA 5H9FK 2VPYB 1GTHA 3P7IA 5EYFA 4OYOA 4QZVB 2W9BB 2ZH6A 1HQEA 4PTKA 4YN3B 1N6QB 2RMLA 2BZ2A 4K4ZA 7FD1A 4I8CA 1IKVA 3RZAA 2O01C 3NGUA 5DLGA 1IQ7A 1S77D 3W9VA 2ZH8A 5H8SA 2O68A 3J7AN 5ET5A 1UMJA 4EQ9A 3QJLA 3QGHA 4F19A 3FVNA 2BKOA 2RDDA 2Z8DA 4JSOA 2XHCA 1IVZA 2DVIA 4QOTA 3FFIB 3PXGa 3SKPA 4IFYA 2GS8A 1RAGB 3JSYA 4B3RF 2NUUG 1B0HA 4IR8A 2BM1A 2HIYA 2OMOA 2W7YA 4YB7A 3MR7A 1RWNB 3NMRA 3NAHA 1YKWA 3CNQP 1S1WA 2CG4A 3FBCA 1CLFA 1NV0A 1P9YA 4YHHJ 4YR2A 3DLGA 3GBAA 2RH3A 2OHDA 3EZ5A 3D4JA 5LSRA 2W2QP 1Q7YT 2RF1A 2L41A 4LF9F 3OUYB 4PG5A 1CJTA 4OZ5A 2CPEA 4MFIA 3DM0A 3ILUB 2KM8B 2AT1B 3ETOA 4I2QA 2GX8A 4JWYA 1XNRF 4XDCA 2HWIA 4AL6A 1UTBA 4QWCA 2LA4A 4QF9A 5J2MB 4P11A 1X5TA 1NJWA 2J6UA 3ZSFA 3IB0A 3I5OA 3EPGA 4MTPA 1UQWA 5T7LA 1PCAA 5HQLA 4CT8A 3BQ2A 1NL5A 3JYTA 1X5PA 5J2PA 2QG9B 3K59A 2CQIA 5HM4B 4DV7F 1QE1B 4OYWA 4LF8F 5I2KB 3KFMA 4DR7F 1Q7LB 2XS7A 4RU2A 3B8HA 3C19A 2H98A 1UJ4A 3D54A 4HR2A 3NBPB 4TYAA 4DQRA 4LN5A 2YNHA 1KVJA 3W61A 4ANDA 5MAOA 3M8UA 1I51B 2DHGA 4OFLA 9RUBA 3LUYA 4Y3CA 3U1MA 3DCAA 4OXVA 3CD6S 1UFWA 2R7OA 2MZSA 2KXHA 2W4DA 1ZPWX 4OJ1A 1DQ9A 1SJFA 2VQEJ 2CMOA 1FW0A 1UEUA 1QAYA 2REGA 4JV5J 5KFFA 4MLVA 4BS2A 1Y3PA 1CQNA 3CW2C 3UN5A 1WEZA 2G93A 1IXGA 4JB8B 2KVIA 1MQHA 2CPFA 4NG7A 5K9FA 4DN0A 1FEHA 4G8NA 5IM0B 3N0VA 4FYVB 4DPYA 2MKZA 1U49A 1P6TA 1FHTA 5AXNA 1US4A 2UVWA 1HBNB 1RT3A 3M9MB 3G82A 5LL6d 1AIVA 3NGDA 3D6FB 4G65A 3UO0A 4M94A 1LCFA 2DNPA 3Q8YA 2J9DE 3I5CA 4CLYA 5I3UB 1G7CB 1QUPA 3MPLA 5JXSA 2KTQA 2BW2A 4G1IA 3OTOF 5CYQA 5DW8A 5DM7Q 1WKKA 4TQSA 3MHYA 1S9EB 5E41A 1VRTB 3BGUA 4TU8A 2UXCJ 2JLEA 1J5OB 3D9BA 4CLPA 2DWAA 1IXKA 1D3KA 2H65B 4LF4J 4GWOA 4LQ9A 4RNNA 1M5FA 2PSZA 1XIQA 2GVDB 3KJQB 4P0GA 2ZWPA 1RWXB 2MB0B 4HDHA 4IOAQ 2EBGA 2VC0A 4IG0A 3ADAC 1C0TB 2HFZA 5DO2A 3D6TB 4YAHX 2GIRA 5KG6A 2ILYA 2HKEA 2AF6A 2DNKA 3E8OA 1HR0F 3S01A 4OI4A 4DR2J 2K3IA 3FV2A 1WOOA 3K2DA 3UVJA 2QL9B 1U1OA 3BN7A 3M8QB 4C0BA 1JXLA 2DEJA 2VD2A 2XXRA 2BM0A 2H25A 3IOWA 2QMWA 4HHJA 3I6VA 1ROFA 4X04A 3MPVA 1WDNA 5G0RB 1EETB 1JLAA 5HAOA 5DGBA 1V5VA 2HURA 3H2UB 3OELA 5AA2A 3M9NB 3BJYA 2AZ1A 4ZVOB 4RUBA 3EX7B 3KLHB 2VD3A 3CEDA 4LRAA 2F8DA 4A8QA 3BIHA 4H4KA 1RSCA 5K14A 4PZVA 3MEGA 4PCQA 5FJ4A 1VQYA 4WK3A 4WJBA 1DCUA 1OLAA 1BMQB 3LQVA 4X4TA 2ASLA 3W65A 1FD2A 2L5VA 2NXOA 4HH0A 3MVYA 2D9OA 2DIUA 4ZK7M 3KLEA 4C1TA 4MIJA 3R8YA 5DS7A 5D4LA 1POY1 4QCLA 3CDUA 1LAXA 2XO7A 2J9DA 5HROA 1IXIA 2W25A 1Y7PA 4R5PB 3I0RA 2HAUA 1AT1B 2QX0A 2OO4A 1S79A 2KT3A 2WVDA 2V2KA 1O8BA 1OS5A 2ZH7A 2F9DA 2BJIA 3W9HA 4J9PA 4GC6A 1KWHA 1CJKB 2O69A 4D3GA 1T11A 3GFXA 1TKXB 3GE9A 5AJ3J 3KLIA 1WHXA 3FC9A 1AXQA 4P71A 5KOWA 1ZZFA 2AU0A 2W4CA 2RCBA 4B9LA 2EFGA 1TT1A 1S1XB 2OLWA 3J80Y 2C2DA 4D3HA 1MH4A 1FRKA 3JQJA 2CZ4A 3T1AA 3NGTA 4GKKF 1IJFB 4XK8C 3FBBA 4CO1A 1EQMA 1QGXA 1K9MT 1HNIB 4DMZA 4XKPA 3CFXA 1S12A 4E98A 5ETQA 2CPZA 1X0FA 2UP1A 3JYTB 3K1NA 3O6GA 3X3UA 4LF6J 1TL1B 4EZ6A 1FSAA 1GTEA 2ZZNA 2J76E 3ENQA 2H9BA 1OY9A 3HJVA 1U4BA 1NZAA 1L3UA 2KG0A 4WIQA 3DGPB 1D3WA 2ZBPA 1RABB 4LF7F 1WNEA 1FTAA 4M5LA 4NXMJ 4MBPA 1QM9A 1DTQB 4PPDA 3RAQA 2GVDA 1FPJA 2F4FA 3EHSA 1IQZA 2IDEA 2R7UA 2DE3A 4KSEB 3M8YA 1RT3B 3LF0A 3OUYA 3PGFA 2HMIA 1IKVB 1B0TA 5HVFA 1KC8T 3U65A 2IYGA 5C5JA 2R8HA 2D7SA 1IM4A 3DMJA 4WTOB 4U22A 2XYHB 3KK3B 3EUNA 4P9KA 2NR0A 4X2BA 4Q2MA 2K1RB 4KAIA 4ECSA 2DO0A 2WVBA 3CMES 2HHHJ 4I56A 2WOMB 2DHAA 1U1PA 3G6YA 5JTYB 2QT7A 4IO4A 1YVFA 5IWAF 4LF1A 2VOPA 4FXDA 1RK8A 4RK2A 4WFBQ 1RTHA 2MSTA 3H8YA 5LXRA 3Q24A 2IRUA 2WB4A 4GBWA 2B9XA 1MS7A 3OSNA 1PEBA 4U6PA 3ZNJ1 2CPYA 1LBVA 3TAPA 3RUMA 2VFTA 3D66A 2XA5A 2OEMA 4GD5A 1S9EA 3KMSA 2GGPB 2RKMA 3K6WA 5B0DA 4QSEA 3C16A 3NY0A 5CYQB 3K17A 1SI0A 2FB0A 4C98A 4RJZA 2RU9A 1ZOTA 1KTQA 3Q27A 5I59A 2R8TA 2CQ4A 3GR0A 2OWSA 1XMOF 3OJUA 5F8HA 1VCTA 3RBXA 4ESXA 3RLFE 4DR4F 4EI2A 1R0BG 5F8MA 4LRCA 2N82B 2DR5A 1UVIA 4ELUA 2DH7A 2OPSB 2ZOGA 2HHVA 4MT1A 5I59B 2VL1A 4MIWA 1USYE 2RT3A 4QIFA 3PIPQ 1B1XA 4R5PA 3W64A 1LFPA 2D3ZA 2OAUA 2FYIA 4OLOA 3PRVA 2KLFA 4OQOA 4X1BA 5KDTA 3OEKA 1B7YB 4IQXA 3MZ1A 5DVFA 3M2RA 4N5SA 3A29A 3MEGB 1UETA 3GQCA 4DCOB 1MY2A 2B65A 4RW4A 5CA5A 5FHNA 2YNFB 3QWUA 3O3LA 5EUHA 1VISA 3CR9A 3FMBA 5DGAA 4RR5A 2ZUAA 5F24A 4WXWA 3O44A 4OVPA 3IR6B 4DXCA 2KR0A 1XVYA 3UK4A 4AQ4A 4DL5A 1RADB 4I7FA 3EQ1A 5F3TA 1FBDA 2LXIA 4J37A 2R6GE 1JB0C 4KRWA 1ZPVA 1YJWS 4ZN3A 2AIRB 2IJNA 2FHMA 2RE1A 1JXVA 4I9DA 3TQEA 4IDKA 5C25A 1FRPA 4B08A 3TVKA 2OJTA 1KFDA 3T9NA 2ZC4A 3D2WA 1Q0NA 1T05B 3K6VA 4ZEDA 3W2VA 1NHUA 1VR6A 2XYPB 3KXDA 1PSDA 3ICLA 4F2QA 5F3ZA 1S9TA 4HCYA 4ECFA 3OPKA 2Q9TA 1JQFA 2B7CB 1H76A 2EK1A 2HCAA 3KJVA 1VC6A 2IEEA 5A0YB 1IWAA 4KCCA 1YCJA 3ITHA 1M90T 3K1MA 3TWZA 2KG1A 4JI1F 1RT7B 4PAFA 1TKZB 4QWBA 1A99A 2EK6A 4WK1A 1YQHA 2O67A 4F18A 5HANA 1R43A 5EYGA 2XZWA 4DLGA 3ENVA 1RKIA 1S76D 1PC5A 3QRRA 5LSLA 3VAHA 5TP9A 1QKBA 2Z23A 1BTJA 2CVIA 3VCDA 1W2BR 2XLIA 5J1EB 4IYQA 5EQ8A 2ZXTA 2KQZA 1SBRA 5DVIA 3HULA 3IBWA 2VP1A 1BC6A 1IKYA 4OENA 3FFIA 4WU3A 2K2PA 4CZCA 4ETZA 3N5FA 3SEUA 4LF6F 1RT1B 4WKYA 2F65A 2DHSA 1D0EA 2DSFA 2CPXA 1TK8A 4M95A 1ANFA 2PE8A 2A5TA 4H4MA 1LW0A 4ZCKA 3V4IB 1JK9B 2P9CA 1KLMB 4IFVA 2HHSA 1RKMA 4U8VA 2PFYA 1JW5A 4ZEKA 2RKIB 1NNDA 5EQAA 4KKOB 1EJ7L 3SDEB 4HLBA 3KHHA 2RIJA 3T9XB 3DRPB 3Q28A 3BKFA 4MFBB 4ZECA 2Y9HA 5J2QA 4GKKJ 2MSSA 4PQUB 3SBMA 1CJVB 5KTQA 1NNKA 2CADA 4BDNA 4P47A 2FJAB 5L9MA 3FV1A 1SQEA 3JTNA 2RJZA 3DLLQ 4N6KA 2CQBA 5D0GA 4CYUA 1RHKB 2VT5A 2AJQA 2ZZWA 3ILJA 4F67A 4DI3D 4EBEA 3T41A 2KRBA 5F8JA 2QFLA 3D28A 3LTOA 2I1RA 5EQ7A 3AA9A 3B4MA 3OR1A 3P4UB 5I2KA 2GNKA 2DWJA 4DFMA 1QDUB 4M5HA 2DR7A 3PMWA 2DGTA 2UXBF 2YNFA 4F25A 2BQ3A 1FERA 5KFSA 3S9NC 3K89A 3FJGA 3FATA 2XXWA 4P74A 2JJ4D 1S1VA 2DHXA 3FIRA 1JLQA 2F5XA 1U6FA 4O44A 5KFXA 4WBFA 1QTMA 3NS6A 1TAUA 5LM7E 3LP1B 1UTAA 1H72C 1VJWA 3SMZA 3MMBA 1FPGA 1SQYA 5DG9A 3O2AA 2R2RA 3FZ2A 3QZ8A 3KUHA 2ZNSA 1Y20A 1XC9A 2AEFA 3H5YA 3J7Z5 3BQ1A 4OERA 2Z8EA 5C42B 4JI1J 2EFVA 4FEBA 1EYKA 4N56A 4DBQA 2XMVA 2VZ9A 3M8SA 4ZP7A 3MM6A 4N13A 1FPDA 2R4FA 1T9YA 2L08A 1FX2A 1P9QC 1TELA 2PD1A 1MY3A 2VPWB 5J1EA 3IR7B 2C3YA 2HVZA 1TL4A 2KDOA 3H6TA 4WE1B 4DR6F 4RY1A 4C8ZA 1JW1A 4YR0A 1L3VA 3GYNA 3LALA 3VZHA 1O0PA 1XR6A 4YDXA 3RNNA 2HFUA 3KUGA 2PO4A 4OYBA 1SC3B 2Z56B 1D8YA 4OQJA 1F1BB 5ET7A 3BO2A 3O1LA 1DTTB 4LR9A 1W26A 3NCRA 1NCLA 2VG5B 2OTJS 2UZAA 1R7IA 4ZCIA 2VG7B 1RGVA 4DV5J 5KFIA 3H59A 3S6EA 5FHOA 3GP9A 2PDAA 4C0OC 1KDNA 2XS5A 1B46A 5D15A 1QJMA 2ABYA 1NKBA 2HPUA 2YPYA 2AL4A 3SESA 2AHOB 1N34F 4HKQA 5KG3A 2KYZA 4QW9A 2A6OA 1NZ8A 2WBRA 2V5HG 4IY6A 2VF3A 1T05A 2CFXA 3EHUA 2CQCA 1IUJA 5DG8A 1SW2A 4LF2A 4PUOA 1LFIA 4RBTA 3Q2SC 2IM1A 3PTWA 2AYEA 4DG1A 1N33F 3N6MA 3HT3A 2Y5KA 4NQ8A 2C2KB 2J5AA 4MKVA 1FRMA 5AXLA 3WHIA 3I32A 3NBPA 3Q8PB 1MPBA 4UY85 2MY7A 3GFHA 4WF9Q 4H4OA 4DPWA 1EQ0A 2B9YA 1S97A 3K6UA 2CXEA 1FBHA 3HFUA 3V83A 4OI3A 4BCAA 1OYEA 2JVOA 1OLCA 3L95X 2YQ3A 3QT6A 1S0MA 3ZC4A 5H8HA 1AWBA 5U47A 4DEZA 3QMFA 2DNZA 5F7VA 1FKPB 5FTHA 1ZAVA 2CRLA 4W92B 3GJSB 2FHJD 2NXUA 1GX5A 2ZUGA 3GSDA 4NF5A 3MM5B 1WELA 2P9GA 2P5VA 2VBXA 4DUTA 1SJ3P 1GH8A 3D3CJ 1OJ4A 1YG0A 3OTEA 4USHA 4DSEA 6AT1B 2LP4A 2WAQD 1NH7A 1FWKA 4N7TA 4CH1A 4U1ZA 1LB9A 1R0CB 1NBEB 2DVZA 5CRYA 4A8SA 1AZSA 3U1LA 2HRTA 4ZIWA 4GVBB 3TJAA 3W9JA 4RWXA 4DUZF 1BLFA 4PQUA 5I57A 3NCPA 3I0RB 3N4WA 4NX1A 3FQLA 4K0KF 4G68A 2YJPA 3FSIA 3T1YJ 1U26A 2OLBA 3UQSA 5C7PA 2WVCA 3FUYA 1VBXA 3KEIA 4LONB 1FQAA 2KH9A 2R8KA 4JI5F 1HNWF 2DKOB 4FYDA 1RA7A 5K8MA 4LATA 2H48B 3TUPA 1ACMB 2R7WA 2EFQA 3BBCA 4Y00A 2IAJA 5L1LA 3CCQS 2FLPA 2F7VA 2F7CA 3PO5A 4F4AA 4UZCA 2JEFA 3E01B 1S6UA 1Z7NE 2BJ3A 2XGPA 1E6YA 1Q8IA 3I5AA 3IBCB 4DSLA 1KOOA 4IRDA 2HQ0A 3SYZA 2EFPA 2VBYA 3W7BA 1Y3KA 5E3PA 4B3TJ 3HVTA 5ETKA 3IORA 1G4CA 3TZXA 3R5DA 1F60B 3MEDA 3T5KA 1SJ4P 4QR2A 5A8KA 4DPOA 2F3DA 5KT6A 4ECQA 4B9UA 1REVB 3AOBA 3LPEA 1INPA 5HN0A 1IXCA 4N8YA 1N76A 1MU2B 2DXEA 1VMBA 1EAYC 4QPTA 1DQAA 1S9FA 2IRYA 2CZHA 1N52B 4H45A 1NK6A 2DNYA 3OXGA 2EEYA 1XBWA 1NKXA 2QN6B 2BQUA 4OI2A 5DZ7A 2M0GB 5G0RA 1S5ZA 1T9UA 3HHEA 3W5YA 1HI1A 4DR7J 2V34A 2RF2B 3FJ2A 3LO3A 1ZAXA 1IMDA 3OVBA 2XMMA 3NGRA 2J0SD 2JJKA 1LK7A 2DO4A 1XOCA 2ZC3A 3D1QA 2QZ8A 3H5UA 4YU0A 4FYYB 1P1QA 2CPIA 4ZN1A 4JYAF 3BYRA 2AKWB 3PFEA 4F3SA 5A76A 4GC7A 4DR2F 2FVPA 1T03A 2D74B 4UW2A 4P75A 3MTJA 1X9MA 1FBEA 2V93A 1TL1A 1TKTA 3VE1B 3H03A 4NASA 1JNRB 5KFKA 3HXMA 4M5DA 3OQ2A 2M7SA 4MNPA 1HBMB 3ELHA 3MZBA 1RI7A 2ZDPA 4FPRA 3TA0A 1CULA 3SQGA 1U7LA 2CZLA 3OENA 2Q2CA 2OBGA 3E78A 5A5XB 1RT5A 1NK4A 2DT9A 1MXZA 5JUMA 2VU5A 1Y00A 3DFEA 3QXMA 4NI2B 1LW2A 2QO3A 3UN3A 1CJUB 1XMBA 3KYLA 3QRQA 1X0PA 2OKQA 4HH1A 1YJRA 3FSYA 2ALUA 4RBVA 2HZVA 4B17A 1RCXB 3FUZA 1DAXA 3EVMA 4DL2A 3HHKA 5FHMA 2IHR1 3TFLA 3MPDA 5KFZA 2RC8A 1RCOB 2QJEA 1K44A 4WWSA 4JVIA 1KHWA 1HI0P 3NKYA 4JI0J 4O94A 2L9WA 1RTIB 1GVCA 3TTKA 4LIRA 2UXBJ 3TTLA 4MF3A 3MD1A 1T7PA 4QFKA 1FE4A 2V94A 2CQGA 5F8LA 2WYKA 2PEBA 1RAJA 2G2YA 1EB0A 2V0NA 1U1RA 3O6QA 1WTFA 1MN9A 2YKAA 3MEEA 4W4MA 4WFNQ 4C3KA 5L1KA 2ILZA 3KJ7A 4LBPA 3VQSA 2RDIA 1N33J 1U24A 1ZZNA 1YIJS 4N41A 3KLHA 4ICLA 1TFWA 2XI3A 4CTAA 3CDAA 3MMAA 1HNXJ 1KN6A 3PZPA 1IBCB 1EYIA 1A8EA 2XXQA 4O3NA 4H1XA 3TAQA 2B51A 3MBPA 2EC2A 4OANA 3TQLA 2HHMA 3M8QA 3IRWP 2L9NA 3M8WA 4YHHF 3PUYE 4PPZA 3PW0A 1N7XA 3AHPA 3MCSA 2XY6A 4K5RA 1KA1A 1N5QA 3HV1A 4RW6B 2N7YA 4EK2A 3Q86A 3OXLA 1SDXA 3KJFB 2V63A 4OZJA 2YKPA 4KY3A 4CQ1A 4OL8A 3SEWA 4KE5A 3G3FA 4IH6A 4FKYA 3IB1A 1Q4RA 2LMIA 3HHNB 1NPRA 4EU0A 1B0PA 3J81j 3SEYA 2VC1A 1NV1A 4RNOA 4LVQA 4DX6A 3M05A 3ILLA 2ASDA 2DXDA 2BJ7A 2YKNB 3O6IA 2FVSA 2F5GA 1Q9DA 4TLQA 1F2HA 1SB6A 3QLHA 5A8RB 2MJUA 2YNGA 3MMCB 4PP0A 4H67A 3ET6A 3FXBA 2XSJB 2X26A 3ZFVA 3PUZE 1KLNA 4PQAA 1SV5A 2ZE2B 4ZVEA 4X66F 2HAFA 1AB8A 4OA4A 1GT8A 4PBQA 5AA1A 1DARA 1WHYA 3MEDB 2J0XA 4KC5A 1MPCA 3UI3A 1N0UA 3VTIA 1O6XA 3CE8A 1A55A 4CP5A 3FCWA 1YJUA 2IVFB 4U67Q 1LSTA 1PB7A 1R9QA 4KGVB 1HWJA 1NM2A 4UF4A 3SEOA 1IIWA 3MMAB 1UEKA 1SJQA 1NV4A 1WSRA 3L6GA 3M32A 3LSXA 3W63A 1U09A 4I2PA 5KG4A 2DNGA 1QTNB 1RAIB 2ZM6J 2I6WA 3PV0E 2CZKA 2D3UA 4X65F 4ZE8A 3K01A 3Q8UA 1Q95G 1Q16B 1A54A 3N94A 3G6ES 1US5A 1JLEA 3U7JA 2L3MA 1M5CA 4WP3A 4U4XA 2RQCA 1WC5A 4ZEFA 3G4SS 1U1LA 3IM9A 2CPHA 3FJ7A 2XMUA 2POKA 2RS8A 2HNYB 4FZVA 5I56B 3RQTA 3AB2B 2ZKTA 2BUNA 3PDNA 4DZDA 2JX2A 5IAIA 4UOGA 2E9TA 4URSA 3FVOA 2ZH4A 3UNGC 2PT0A 3PKYA 3CJQA 3JQKA 1LWCA 3B6TA 3KLEB 1QE1A 4ELRA 4QFPA 2P2CB 1H7WA 4V19J 3V2UC 3FSXA 3MM9B 3U27A 3CJ2A 2ALZA 1S50A 2I4BA 4NWCA 3OSRA 1TKTB 2CJBA 2ZBRA 1AZSB 2KHDA 3LW5C 1ZTWA 2NZCA 4KHMA 3V4MA 3SCLE 1TL3B 4OEVA 4O23A 1TVRB 2F78A 3Q2TC 2J9CA 2QIFA 5C24B 2H4YB 1SIZA 3AODA 5E3CA 2UU9F 3GFYA 3RG6A 3KJTA 1Y9OA 2DCLA 3MSTA 5HJXA 1XMQF 3H4DA 4NXNJ 1OY8A 4ZHRB 1F3VA 3JSBA 3AAWB 4NYZA 2DPIA 1EZPA 4XKQA 3CF5Q 3MECA 4ZJLA 4F4WA 4I1DA 3OTBA 4L17A 3TPAA 4TY8B 2JWNA 4EYIB 3HJFA 3KFWX 2HS4A 3T22A 3WDOA 4CRJA 2QPQA 4DF8A 2OPPA 2KM8C 1U47A 2K8GA 1UKUA 5H8QB 4PGPA 3C32A 3I3VA 4UZBA 1JQGA 2Z8QA 3WX4A 4ZPBA 2VPNA 4OZ2A 3KKFA 5I3UA 2JLGA 3DU6A 4DUYJ 2HHPA 1UIVA 1ZM9A 4CYUB 2XXHA 4U95A 2VJVA 1U6BA 2EFOA 3TUSA 2ESNA 1K1QA 4F02A 3RTFB 1Q78A 1BK4A 5HBMB 5H9EJ 2Y7IA 1MNEA 4PEOA 3C35A 5LJ3Y 1OIBA 2HBZB 3T1HJ 2G2OA 4X4SA 4EQBA 2J7KA 4QWAA 4UQTA 3Q26A 1AROP 4J9OA 2M5YA 2UV8A 3HT0A 3QT7A 2V3UA 3DYAB 1PYTA 2RQMA 4U9RA 5ETTA 3WC0A 1QAJA 1JW4A 1NDLA 1NSPA 1E6VB 2WONB 1SI1A 2QS1A 1LBCA 1NLKL 1UFLA 2A10A 1WEYA 1EP4A 1K0VA 1Y5IB 3MCNA 4G1PA 2VDHA 1TAQA 3CWJA 5I2NB 1RWMB 3PW5A 2OTLS 1SV5B 5H8NA 1AOVA 4MEVA 2QLJB 1VHIA 4KYZA 2O1LA 2AX0A 3RB6A 2HAVA 2ROGA 2BKNA 2F8MA 2R7XA 2A6MA 4RW9A 2VA2A 3M3KA 1FTRA 3FGSA 1IMBA 5CMBA 5I7IA 3VQTA 3CC7S 3OLBA 2YKQA 1QKAA 4F22A 4B3OA 3N01A 1TKZA 4NWBA 3CJ3A 1FDDA 4ZPWR 4JVCA 4UACA 2UUBF 3WAEA 2YH1A 2F3JA 4NZ6A 1O63A 3RAXA 1BP5A 2XXYA 3HCXA 2J0QD 5CABA 5E3QA 4ZLPA 2OWTA 1FBPA 2CJYB 5IV4A 1H44A 4DR5F 1ZTYA 2X1BA 5BWJA 2CQ2A 1NNTA 5IWAJ 3F73A 2Y8YA 1ZM3A 2VDIA 5KCJA 3SFGA 3WC2A 4K3FA 4DV0F 1QSLA 5GADU 2HRUA 1A9NB 1LFGA 3T6JA 1NJIT 4X4RA 3THVA 3IM8A 5J2NB 4C8OA 4OIXA 4ZLJA 5J16A 2NPFA 2LEAA 2G1HA 4GWZA 2W24A 2DHHA 2DR6A 3C14B 3MFHA 1ZA2B 1S99A 2Q8JA 3CJTA 4THIA 2YLNA 4P72A 5EHMA 4JOUA 3HN0A 3IFEA 1U1KA 1JKHB 3R27A 3IWXA 3QAUA 3EMTA 2QE5A 3GLBA 2YQ1A 1U45A 4IR9A 1TK5A 2XXVA 4FECA 4KH1B 1CJVA 2C1EB 2HW3A 1JVYA 4H8JA 1N34J 3VGSA 2A2DA 1X4EA 2O66A 5IZ3A 4H5FA 1JLEB 2E5HA 3KDNA 5BUUA 2QS4A 2E1AA 5KAKA 1Q8LA 2APOA 2QVVA 3RPWA 3OL7A 4NEDA 2D21A 2O1MA 1VLOA 5EWFA 1VSOA 4RUHA 4ZPAA 4MHFA 2YWFA 1LWCB 2CJQA 5CI5A 1SQFA 1JETA 2ANJA 2RKIA 2V2ZA 1A7GE 4U8YA 1RBAA 5JJBA 3DN9A 3M3LA 4GXSB 2CDRB 1EHWA 1RYOA 2ZOMA 4OVTA 1MN7A 2M88A 1WVJA 4HTJA 3MI7X 1ZA1B 2W7AA 3I31A 1RT7A 2M8DB 4P73A 2FA7A 4YY3J 4BDPA 4IQMA 4BBYA 4TVAB 2Y1RI 4LZ5A 3DC2A 5BJRA 3UORA 2RHSB 1FK9A 3MP1A 4H8IA 1FCAA 3GR1A 3V89B 3ZNUA 1XJWB 2I58A 4ED0A 5A6PA 3WIVA 4FXVA 3I9V9 3IO1A 3J81U 3MOZA 5LT5A 1BQMB 4P2FA 3MM6B 4YDDB 3RY3A 4MAGA 1OQ3A 3OTDA 2PEHA 4TY9A 4L76A 4NYPA 3PD8A 4OVSA 4FKXA 4ED6A 4HW8A 2NWJA 4JWXA 4X62F 3DYAA 3MMBB 2VGQA 1B4HA 3LAMA 3EJMA 3HZEA 3PD9A 4TXSA 2LAOA 1RU2A 2YH0A 2EC0A 3RYDA 3QLHB 5A8RA 3ENWA 1Y4CA 4C8LA 5THWA 2H99A 1H38A 1SL0A 3D0IE 3NG8A 2B8PA 5GMDA 1IQTA 4F2RA 2R2TA 2XX7A 3LP0B 4WYWA 2GAHC 4QQBA 4R0EA 4B9SA 1WORA 3N9UC 3K1PA 4R74A 2JC0A 3E9XA 5CQGA 1APSA 4QFLA 5JK4A 4OYZA 4USWA 2KB2A 1TL7A 3HHLC 3FVYA 4U96A 1FBGA 2IMWP 4QU7A 1HARA 4PG8A 2E7XA 2Q79A 3UN6A 4AS4A 1U0SA 2ZD1B 4XO0A 2HYIB 2RILA 3LBSA 4B9TA 3GTYX 4I7FB 4V19X 1X4FA 1P1OA 4DV2J 1RAEB 4Y2CA 2MKJA 5HI7A 1QAXA 4NRUA 3MYUA 3PVXA 2Q8MA