3LUYA

Putative chorismate mutase from bifidobacterium adolescentis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
326
structure length
326
Chain Sequence
MSARKLFYLGPQGTFTHQAAVNAAQELARFEPQGFDLMPMDDVPQILDAAQHGDGWGIVAWENNVEGYVVPNLDALIDAKDLVGFARVGVNVEFDAYVAQGADPAEARIATAHPHGLAQCKRFIAEHRLSTQPATSNAAACRDLIPGEIAFGPAICGELYDITRIGTAIQDYQGAATDFLVLSPRAEVARLLAKPRAEANVEYESVLTLIPLVTGPGVLANLLDVFRDAGLNMTSFISRPIKGRTGTYSFIVTLDAAPWEERFRDALVEIAEHGDWAKTLAVYPRREHPNPPVTSWMLPQGGVRLDDSHLPDDWQNDETVRRELMW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable chorismate mutase
publication title X-ray crystal structure of putative chorismate mutase from Bifidobacterium adolescentis.
rcsb
source organism Bifidobacterium adolescentis
molecule tags Isomerase
total genus 93
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3luyA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3luyA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3luyA02
1SC6A 5DVJA 3MQ9A 1Z7NE 1B3FA 3IL1B 4M4GA 3OO9A 2DQVA 3EPEA 3P96A 5FHMA 3IB1A 3LBSA 3FVNA 1R9QA 3E9XA 3IB2A 3HHFA 3PMWA 1RKMA 2GHBA 5T41A 4NF6B 1Z7ME 1ZBMA 1SVXB 3A09A 3FD3A 5I58B 1S7YA 3TUZC 3O28A 4OFLA 4YKPA 3AXFA 1YTVA 3U1OA 3EHTA 2V84A 4ELQA 2DT9A 5AE4A 5ITPA 1PB8A 4XIGQ 4GLIA 2QS3A 4QFKA 3B7DA 3FVKA 4QSDA 1UTHA 5HBCA 1YAEA 2RC7A 2PT1A 1R9LA 3TTMA 3OFHA 3UORA 3L6HA 4ESWA 3PGFA 1A8EA 2VD2A 2ONRA 2FYIA 1NH8A 4RNSA 1Y3NA 4JWOA 3B6WA 3OFFA 3PD9A 1MXWA 2UVHA 4JWYA 1MQHA 1XTZA 4DCYA 1EZPA 4EF2A 5TU0A 4TOZA 4H8IA 5HPQA 3S9MC 1URGA 4FEBA 1PB7A 1IXHA 1LAHE 3MVXA 1DOTA 3IBWA 2DWAA 4IY5A 2F6GA 4I62A 2F7AA 4G8HA 4GWOA 3T9VA 4F39A 3GBBA 3K4UA 4OFJA 5L8DA 4NF4A 1SQYA 4PFUA 1XOCA 4BDNA 4U1ZA 4DLDA 3Q25A 2NWJA 2ABHA 3TUJC 4GMKA 1O64A 3SESA 1B0LA 5B7DA 4FIMA 1YPNA 3QAXA 1HSJA 3C36A 3FXQA 4PQJA 3HN0A 5I2KA 1LCFA 3PUVE 2DE2A 4ZZAA 1P1QA 4YKJA 4GL8A 2RQKA 2OWSA 4U2RA 4X1DA 4U22A 1OVTA 4TLMB 1LFGA 3TELA 4R2FA 4QF9A 3U93A 3MJNA 3CIJA 1S50A 4F1YA 2DXRA 3UIFA 2XXTA 4DDDA 5H8HB 1URDA 4KFQA 3C34A 5FHOA 4FECA 4HCYA 2B65A 3DM0A 2I49A 3VFJA 4EQ9A 1QVSA 4LQ2A 3N6UA 3KN8A 3MVZA 1MDQA 4RJZA 2QRYA 1SW4A 2X7QA 4R9GA 2PYYA 4KR5A 4IO5A 4OXVA 3C9HA 3FXUA 5AA2D 1RYXA 3K1MA 1M5EA 4F31B 5IAIA 3CR9A 3IJXB 2BJJX 1IEJA 1MQJA 4DIGA 2OBGA 4QFNA 5ICTA 4H67A 3TQWA 2FA7A 3KSXA 3ENWA 1SW2A 3OEKA 2E0SA 2I3VA 5DYHA 4U23A 2O1LA 1JETA 3TCFA 4NF5A 5LOMA 2ZYNA 3V83A 5AA2B 2A5TA 4ZZEA 1P1NA 3OO6A 1UQWA 4ZEBA 4NF8B 1QKAA 3O6IA 1RWUA 2QMXA 2I4CA 1GGGA 2F6PA 3MP6A 1II5A 4RXLA 1Y3QA 3MZBA 1GVCA 2PBWA 3K6XA 4KCCA 1B1XA 1B4ZA 3GZGA 4U4SA 1NNTA 4YKIA 2VP1A 4LA9A 3SEUA 2XXYA 2DWHA 3SEYA 1B5IA 3H3GA 1N3WA 4LZ8A 2LQJA 1UTBA 1VFEA 2PVUA 3K00A 5DEXA 2I58A 5EHSA 1B6HA 3OEMA 4IB2A 3PUWE 1NL5A 1MH4A 4KPTA 3PUXE 4FE8A 4GF8A 4PFYA 4Z7EA 3CEDA 3IOWA 3IOVA 1NNPA 1MXUA 1FTLA 2JOQA 1SD3A 5TPAA 1M0SA 2XX7A 3ECRA 5CM6A 1FQEA 2ZHOA 1D9YA 2XXQA 1A7LA 2H25A 4M1VA 2XX9A 2I9SA 3TPAA 3HHEA 4G68A 3PU5A 2XXVA 3FGSA 3OSRA 1SW5A 2H9ZA 1XVYA 2F7BA 4U21A 4FEDA 1LKZA 4JB7A 4OENA 3O6GA 4GFRA 1MXYA 4G8MA 4EF1A 2R71A 1QUKA 3QUJA 3MAMA 3G3HA 1FTKA 2M8CA 3KZGA 3JV9A 3JYRA 5I56A 2Z22A 3OMBA 3OXNA 3VXBA 3K6WA 4PFTA 3T66A 3PPNA 1I6BA 5CMKA 2THIA 2REGA 2F36A 1LK5A 2PX1A 1VSOA 4NTLA 2O7IA 1ZPVA 2P9GA 4GD5A 1LBBA 4ZEDA 3S1TA 4F1VA 3C4MA 1UJ6A 1JVYA 1IUDA 3BFUA 3RN8A 2DVZA 2H98A 2V3TA 2LVWA 5CC2A 1XT8A 1B3HA 2I0BA 2XXPA 3TEPA 4I9DA 1LBCA 1WODA 5IT4A 2AYSA 1LAGE 4NEDA 3L7OA 2J0XA 5TP9A 2Q2AA 2HXWA 3SKPA 1T0KA 3OFGA 5I2NB 3FUZA 3PPOA 4OTEA 4KQPA 1U8SA 4YB5A 3MP1A 2I0CA 3T96B 2O68A 4E0XA 3IO4A 3AAWB 3LC8A 1BTJA 1JW1A 3N0VA 3SDFA 2P2AA 1ZU0A 4LQ5A 4Q8RA 1MG1A 4DZ1A 1LB9A 3LOUA 3KWMA 1ZMGA 2Z8FA 4RPOA 2ZMBA 3K01A 3EF7A 1AL3A 5I59B 5JTYB 3UK4A 4N6PA 4WEPA 3TUIC 3VVDA 5DTBA 2I4BA 3I5OA 3D4GA 1FCKA 1B40A 2F78A 3SEXA 4DE8A 3TAJA 2O51A 1JW5A 4RK2A 4GO5X 1OQGA 3B6QA 4P11A 2UYEA 3TODA 1XHYA 4G8NA 1AOVA 3O1LA 5I57A 3IAZA 2F97A 4H5GA 2PMSA 2ANJA 1MY1A 4ZE8A 1B9JA 4QHQA 1LFIA 4IO7A 2V3UA 3MP8A 5CRYA 2FGCA 5ITOA 5CMBA 4HCWA 4Q0CA 3KOSA 1Y3PA 3PUZE 1SI1A 2UVGA 3CFXA 4Z0IA 1LGBC 1BIYA 3S9LC 3MW0A 1B32A 4G68C 2P9EA 3PUYE 1FQBA 4QFLA 4N07A 1MXVA 3CVGA 3IX1A 4OEVA 4QSEA 2LAOA 5H8FB 1HSEA 1TFAA 3DP8A 3CG3A 2F1FA 2D21A 3KGCA 3I3VA 3DDNA 2V25A 4OFOA 3KG2A 2UYFA 3DELB 3ENVA 1JW4A 3T9XB 5HM4B 2REJA 4KCDA 1OVBA 5IKBA 4LZ7A 4R73A 1IXGA 1MQIA 2DTJA 1HSLA 2QS2A 5AA3A 2HCAA 2GH9A 5H8NB 4F3BA 5KCJA 1NNFA 3TFLA 4RY1A 3CI8A 2DXYA 2CZLA 3FZVA 4AB5A 5CMCA 4QFPA 4AB6A 1NFTA 1JEUA 1SI0A 4GL0A 3MZ1A 2ZYMA 1B0HA 1JNFA 3A3CA 4NWCA 4EUOA 1QW0A 1UJ5A 2DSFA 3MAHA 4ND9A 1DTGA 2W7YA 2V3QA 1DSNA 3N94A 3MBPA 4OVJA 2VOZA 2HAUA 3OD7A 3U8QA 2RE1A 3HCQA 1FQFA 3KJTA 3FXRA 1P1WA 1USYH 4EXLA 1MPBA 3K6UA 2DYXA 4YB6A 3DC2A 2Q88A 4H0WA 1EH3A 3QXMA 1MDP1 4H6DA 3UN6A 3MZ9A 1QUIA 1ZKBA 1B5JA 1B46A 3U72A 4POXA 2XX8A 1P1OA 1B3GA 5KDTB 4POWA 4UA8A 1B3EA 4F18A 2ESNA 4Q30B 1VFDA 2PC6A 1B7HA 2OLBA 4DXBA 4MBPA 3SETA 3KBRA 4KI0E 3RUMA 5ICQA 2HEUA 1TXFA 1VE4A 1TT1A 1ZIUA 2P0SA 3TMGA 2RC8A 1JEVA 5AA4B 2VHAA 1D4NA 3RT8A 4YB7A 2RC9A 5F1QA 3M8UA 3CFZA 5JJBA 4DXCA 1POTA 1B5HA 4NF6A 1A8FA 3CSBA 5K2YA 1MXZA 1SBPA 5M2VA 4HS7A 5I58A 3MTJA 5F7VA 3IK6B 1ANFA 1MQDA 3RGYA 1PBPA 3TDJA 3MPLA 1MM7A 4R2BA 5FHNA 1ELJA 2ONSA 3RQTA 2H9BA 3LSXA 4R6KA 2O6AA 4R72A 3TTLA 2Q9TA 3S9EA 4X1BA 1OQHA 3C35A 2DWJA 3GXAA 5H8QB 4HW8A 1B7ZA 1QKBA 2ZNUA 1SW1A 4KHZE 1TFDA 2D5WA 3K6VA 1USYE 3PMVA 2DE4A 1GR2A 2ALUA 5B70A 1MM6A 2Z8EA 4AQ4A 3OO7A 5JEIA 3OBIA 2ZXTA 2X26A 3GLBA 2UVIA 3KSJA 1I6AA 5CMMA 1DMBA 4R74A 2HAVA 3K2DA 1IQ7A 3B6TA 3MWBA 4JXIA 3BFTA 4PE5B 3O2AA 3ODBA 1P99A 4KYEA 4TQUQ 3AB2B 4FATA 1Y7PA 2QRRA 3ZSFA 2NYIA 4XKQA 3ZS6A 4IO1A 1MY0A 4GIZA 4ELRA 4GVOA 2RCAA 3KFMA 4LP2B 3OFEA 3ZKKA 1I6QA 2RF1A 3IO6A 1B05A 4ZS9A 3LUYA 4IO4A 3Q26A 4ISUA 1BKAA 1H43A 4P0IA 5L9MA 1H44A 4C1TA 4ZEFA 3RPWA 2QJEA 1URSA 3QSLA 4C0RA 5A5XA 4PP0A 2XXWA 3IB0A 1D3KA 2F7CA 4RYAA 2AIXA 1UTHB 3KN7A 4G4PA 4O3CA 2O7UA 5ELVA 4ESXA 4PETA 1Y4CA 1R6ZA 2RINA 3GBAA 4THIA 2XHDA 3JZJA 2Z8DA 4F29A 5H8HA 3VLWA 2DS9A 3MC2A 3O6HA 1F9BA 3TKDA 3NRBA 2H99A 3TCGA 4YKKA 3I6VA 4UACA 4RK9A 4GOTA 2J0WA 1N84A 4GQOA 1PSDA 4F2QA 1WDNA 1LAXA 2YJPA 1B51A 3LSWA 4R75A 4YU0A 4YICA 2G93A 1AMFA 2XXIA 1O8BA 3G3IA 2F34A 1DPPA 3Q29A 1NKXA 1N04A 1P1UA 1Y4TA 2UXAA 1FW0A 2H5YA 4NF4B 3MVYA 1AIVA 4KYDA 2XXUA 2DP8A 4X84A 3EN3A 1N76A 1ZLQA 1B58A 4OETA 1B52A 5AA2A 3FVGA 4BLAA 3OELA 2YLNA 5DVIA 5I2KB 4G2ZA 3MVWA 4XKRA 1H76A 3RTWB 4ZDMA 1CB6A 3W9VA 4NF8A 3U7JA 2I6EA 3H4ZA 5DT6A 4I8CA 3H03A 2VGQA 2F8DA 2Y7WA 1LSTA 4JWXA 2NOOA 3N6TA 1N7WA 1XVXA 3IJOB 4GXSB 1M5FA 4KYSA 4MF3A 2R9JA 1RYOA 2RCBA 2DE3A 5J1DA 2GHAA 2G29A 5EYFA 3IOUA 3H6TA 2NUVA 2RQMA 2O69A 1QJMA 4MLQA 3HSTA 4HTGA 4LONB 4IO2A 3MPKA 3SEVA 3CRBA 3W9WA 2E1SA 2QPQA 3S9NC 2B3BA 4XTCQ 2CMOA 1UIVA 2Q89A 2QSWA 3PPRA 4DXUA 1US4A 1MY3A 5K2XA 3VVEA 1XS5A 5L9SA 3ZKLA 4IO6A 1O7TA 3PV0E 3G3KA 5AA1A 1LLSA 2B3FA 1QUJA 3N26A 4JDFA 1IXIA 1NNKA 1XC1A 3S4UA 1MY2A 4OMBA 4NF5B 1I69A 4LZ5A 3SEWA 1M5CA 3DLNA 4LVQA 2A5TB 3O97A 1MQGA 1DPEA 2P9CA 4F2OA 1PDAA 3TTKA 1LAFE 1J1NA 2ZNSA 4BDQA 2QSXA 4GRKA 4ZEIA 1JQFA 2A5SA 3VV5A 3RT6B 4Q5TA 1BLFA 4OHNA 1FTOA 2HZLA 3QIMA 3QYTA 1GV8A 3T9HB 4ZECA 5FTIA 4OERA 1FQCA 4WXJA 1UJ4A 1LCTA 3N5LA 3ENQA 2OJTA 2NXOA 2Q2CA 1M5DA 3P7IA 1N3XA 5EHMA 3RTFB 3C32A 5IS2A 3O66A 1TWYA 2KO1A 4H1XA 4YAHX 4G77A 1UTBB 3E3KA 4ELPA 4YMBA 5DEXB 1PBQA 3L6GA 5BWJA 5KZTA 3E4RA 3O29A 4M8LA 4O3BA 1B7UA 3IOTA 4R6HA 3USDA 4MH5A 4OQOA 3EHUA 2V93A 3T22A 4L17A 1B2HA 3DP4A 2NVUB 5I84A 1CE2A 3Q28A 5FTHA 2O84X 3K02A 3VLVA 1VR5A 5TPAB 4LATA 1POY1 3UGWA 3TZAA 4WEDA 2HQ0A 4EQ7A 3UA8A 1YCJA 3FV2A 3T93B 4ECFA 2QL3A 3TQLA 3G3GA 3DHXA 5A5XB 4F22A 4G68B 1IITA 5BUUA 2XD2A 2I3WA 3EHSA 1Y1MA 2PT2A 5I2NA 1B3LA 1US5A 3HHGA 2MDAA 4YMAA 1FTJA 4OZ9A 4EQBA 1ATGA 3PPQA 2F35A 3D4CA 4DCXA 1N7XA 1BP5A 3KN3A 3CG1A 4OEUA 2AL5A 4IO3A 4BDRA 3IR1A 2GRVA 3FV1A 2QMWA 4QFOA 1GTKA 2YPNA 4H5FA 4TLLB 3U92A 4YZZA 1JVXA 2XD3A 1OIBA 3Q27A 1LK7A 4BDLA 3VVFA 3C33A 3H6WA 4F3PA 1OMPA 1H45A 1Q1KA 5I56B 2OZZA 5CBRA 2ZNTA 3E13X 1QULA 3LR1A 1R1NA 5I59A 1YGYA 5JTYA 2P1SA 3RLFE 2Y7KA 4P0GA 5DVFA 4QRZA 4OESA 4F19A 4O3AA 1KS2A 3M3LA 1H3DA 4NE4A 4XXUA 2OK2A 4IGTA 4WKMA 4E0WA 2IA4A 3R7XA 3THIA 4U4XA 3TYHA 4C1UA 3TTNA 3VXCA 3HV1A 3BBRA 1Y9UA 1A99A 1Q35A 2Y84A 3O9PA 2F8MA 3FJMA 2FNCA 3OSQA 1LFHA 1B4HA 1MRPA 3TCHA 5TP9B 3R26A 3ILUB 3MUQA 3H06B 3WAFA 3HO7A 3OENA 4GXAA 2I48A 3OO8A 4EXKA 2X7PA 3M3KA 1PEBA 2XXXA 3FATA 1OLAA 3KOTA 3EQ1A 5H8SA 5H8FA 3TUSA 3HPIA 3VE1B 4RPNA 1ZTYA 3W15C 1IXCA 1PB9A 2HZKA 1Y20A 2F5XA 3A3UA 1S9TA 3F11A 4IGRA 1A55A 5CBSA 4MFIA 3LSFB 2DOJA 4JSDA 3H7MA 4BDMA 3W7BA 3QK6A 1DTZA 1IZ1A 3ONMA 3ILTB 2UVJA 4IY6A 4BDOA 1MY4A 4RA1A 1MXXA 3TTRA 2IEEA 1UIUA 4KD5A 4N13A 5H8NA 4NMYA 4X48A 1B1HA 1MPCA 1SYIA 3V5AA 2ZYKA 1IIWA 1MPDA 2R6GE 3RY3A 3RNNA 4XKPA 3VDFA 5ISUA 4FORA 4F3GA 5I57B 4F1UA 2KLFA 4ZEKA 3OOAA 4R6YA 4JBZA 2WKYA 3C31A 1MS7A 5IT0A 1WVJA 3K1PA 4MLVA 4NWDA 2H4IA 4ELOA 3PMXA 4EDPA 1EZ9A 3PD8A 3R6UA 1D9VA 3IXQA 4PWUA 1MH3A 4OWDA 1AH5A 1M5BA 2Y7IA 3IORA 1ZJLA 2D3IA 3K1NA 4FJPA 3H6VA 4PFWA 3K5PA 2DVCA 3KJ7A 3FJ7A 4QSCA 5KDTA 3T9UA 1A40A 4OYVA 3FASA 2RKMA 2Y7RA 4LUBA 3M3FA 4ZE9A 3LSLA 2PA3A 1N0TA 1FQDA 3CFLA 2HFBA 3S2VA 1L5TA 3G3FA 4I1DA 4X9TA 5CI5A 4H8JA 2DWIA 4FAJA 5AA4A 3WAEA 1LB8A 1NH7A 1KWHA 1A54A 3SERA 2XXHA 4F3SA 3UW1A 3PPPA 1FTMA 2AL4A 4U1OA 1PC3A 3V8XB 2XXRA 2O1MA 2GFEA 3FVOA 5FIIA 3H6UA 5KCJB 3DHWC 4GO7X 3G7WA 2CDQA 1EZOA 2ZYOA 3UP9A 3FJGA 1Y1ZA 4JSOA 2QS4A 1OLCA 3DP6A 1SDXA 1SYHA 3CSGA 2OCUA 5H8QA 3V89B 4H65A 5JK4A 1NMUA 3FIRA 3BKIB 2Q8JA 1YBAA 4ONYA 4NMLA 3U94A 2ONKE 3KEIA 1EU8A 3K0VA 1FQAA 3QUFA 3VLUA 3AB4B 1O63A 2VD3A 4R9FA 4K3FA 2JHEA 2OWTA 2QS1A 2Z23A 2Y7PA 4XKNA 3G3JA 5L9OA
chains in the Genus database with same CATH superfamily
1LW2B 1NXIA 5D4PA 4DR7J 4HHJA 4GC7A 2WVCA 3NCRA 1M5PC 1M1KT 3HT0A 2B56A 4A8FA 1ZA2B 3SV4A 4DV1J 3IL1B 1RA6A 1FDNA 3OTDA 4IR9A 2UUTA 3WIVA 1SKRA 2YKNB 3IB1A 5KFIA 1QSLA 3GFYA 4IRCA 3MECA 1DQ9A 2ATLA 3GONA 5T41A 2VKRA 2BKPA 1ZBMA 1SVXB 1F3VA 2CZVC 3O28A 2CRLA 3RAMA 4O3SA 3G8QA 4WIQA 1EQ0A 1BWVA 3SCIE 3EHTA 1GXLA 2C2MB 2AW0A 3BSNA 3DGPB 5IT9Y 4U7UK 4ID5A 1UTHA 2ABYA 3V6DA 1SH3A 3I5BA 2MGZB 2WZ1A 2FB0A 1RTJA 2YWHA 2Q74A 3D7SB 4LN5A 3CCUS 4RNSA 2W01A 5D77A 1ZAXA 1KLMA 3M05A 4M5LA 2RDIA 1RCXB 1KVJA 3MEDA 4MYUA 1XTZA 3NCQA 4DCYA 1EZPA 2YWGA 5TU0A 1IR0A 3DN9A 5FLXU 4H8IA 3HI9A 1K0VA 4QR0A 1S1TA 4OYXA 1PB7A 1WKJA 3KUEA 2Y1JA 3BJYA 2CPXA 3SV3A 2GA7A 1NPPA 4KE5A 3SCLE 1IXHA 3KUHA 3KYLA 4IY5A 4IRDA 2X1BA 2F6GA 3DOKA 3JTOA 2F7AA 1H2VZ 3K89A 2H5IB 3UWTA 3FFIA 3T9VA 1K9ZA 4F39A 3RPLB 3K4UA 3QGHA 5L8DA 3BSAA 2W4PA 5KFRA 1SQYA 1FWLA 3T5KA 4ZLJA 2UP1A 1IM6A 4IOBA 1S9GA 3TANA 1SJRA 2P5VA 2ABHA 3TUJC 1KRPA 3DM2A 4B3TF 3CD0A 3EKIA 5ETKA 3MPDA 1IBMF 1SIZA 2F63A 1Q16B 1D9QA 2GJFA 2DB1A 2DE2A 3V6HA 3V4IA 2EG2A 4YKJA 3C19A 3V4MA 2XWOA 3UN2A 2OPQB 5CYQA 2N3LA 4C8KA 3BZQA 3AJ2A 1LFGA 1Z4UA 1WJ9A 3TELA 5C24A 3U93A 2VFVA 3WC2A 3CIJA 3SXLA 4TNOA 1DJ0A 3CDEA 5ET6A 2ZD1B 4M5KA 5EWFA 2CA9A 2HGLA 4HCYA 2DHAA 3CC7S 3C8YA 3ITHA 3VFJA 4EQ9A 3PW5A 2QFIA 3MCMA 4LFCJ 1T02A 2O5DA 3MVZA 3M1VA 1B70B 3D1QA 3MM6A 1KQKA 4RJZA 1M5OC 1SW4A 2X7QA 4X8RA 4NYPA 1L3TA 5IFMA 1TKDA 3DYAA 3FXUA 5AA2D 5F3ZA 2QLBB 3H25A 3GIIA 2ZITA 1IEJA 3EXYA 5IC6B 1HPZA 5LMUF 2DY9A 2V8DA 1QVGR 3UD3P 3TQWA 2HFSA 1SW2A 1BE4A 4JV1A 4LFAF 1S1WB 4LSNB 1G2EA 3T5LA 5C2CA 5HSPA 4U23A 1B64A 1JETA 4DUYJ 1ZZNA 4W92B 3NXZA 1RJJA 2ZYNA 5AA2B 2CPZA 4DR4F 2A5TA 4JVIA 3OO6A 2H5JB 2KZZA 3HD1A 2PT0A 2W2MP 2DO0A 1R8CA 1ZETA 3UFCX 2HHHJ 1WF0A 3O6IA 4DV2F 4DPOA 1NMEB 1RWUA 2OGUA 1EKSA 1HL6A 2NXJA 1F9HA 2V8GA 4ZP9A 2F6PA 1DQAA 4GWZA 3G6VA 1HQUB 3UR0A 4RXLA 2DR7A 3WC0A 1GVCA 3W2VA 1B4ZA 2FC8A 3GZGA 4ZLNA 4NN3A 1U6ZA 1NNTA 3CCMS 2XMJA 4ECUA 2XXYA 3QRPA 2CADA 2BKNA 3SEYA 4I2PA 2JC1A 5E3PA 4LZ8A 2WVEA 2LQJA 2PI5A 2AJFE 1HHQA 4CNZA 2ROPA 2YPZA 5EHSA 2F4VF 1B6HA 1N32J 2YNFB 1P27B 4H46A 4IB2A 1BQNB 2F8EX 3BGFA 4FE8A 2R7XA 2HSEB 1RT2B 3CEDA 2XMKA 5EQ9A 3IOWA 3IOVA 3PG9A 4OHYA 2ADCA 3MGJA 4ZN1A 3R97A 1CVJA 1NB2A 5TPAA 1GMUA 5LL6d 5BYQA 1HI1A 4ED6A 1F5AA 2HWTA 2CPDA 4ZITA 4HTJA 2OEKA 2HHVA 5CM6A 4R5PB 2ZHOA 2X1AA 2ZH9A 4RWXA 2XX9A 2XG8A 3C6TB 1Q8IA 3MAAA 4JBCA 4O3OA 3J7AN 4L73A 2SXLA 3SMZA 1REVB 4NRTA 2HVZA 3J7A1 2XXVA 2DYAA 4WTYA 2WVBA 2B9XA 1SW5A 1KNZA 2GIFA 4TLQA 3R5CA 3MMBA 2YY3A 1C0UB 5C2GA 3BGLA 2CQ2A 2V68A 3KMQA 2BM1A 4LSLA 2ACYA 3W1YC 4YR3A 1OO0B 3O6GA 3NGDA 3NBPA 4B3OB 4GFRA 2B4MA 1QUKA 1JK9B 2JEIA 5ETOA 3KBZA 5D8HB 3G3HA 2KG1A 4JI0J 2OUGA 3KZGA 4MTPA 3JV9A 4UQTA 4CCHA 1FHTA 3VXBA 3K6WA 4PFTA 2X51A 4IG3B 5AJ3F 5CMKA 2W9CB 4RL1A 3GMGA 1KEKA 2F36A 2DBBA 3GILA 3TQEA 1TU0B 1ZPVA 4GD5A 2VBWA 3BPSP 4PTKA 4ZCLA 3GFHA 2PDAA 2BQ3A 1HNIA 4WK3A 4WE1A 4F1VA 2Z4PA 1UJ6A 1IUDA 1TUGB 2Z2YB 2GV1A 1RI7A 3NGTA 2H98A 2BJIA 2HFOA 2XSJB 2XO7A 1H73A 1I3OB 2OPSA 1RCOB 1UAWA 1LBCA 2AZ1A 4DOZA 4DV5J 4CLKA 1EYJA 4CLWA 5IT4A 4WCEQ 3OQ2A 2PN6A 3ZZOA 2CJYB 4NEDA 3HFUA 3L7OA 3PR5B 5TP9A 3IS9B 4Q5VA 2V8VA 1LFWA 4K4ZA 4UABA 1N36F 2BRKA 1D0EA 5HP1A 3PPOA 2HZAA 4EFAC 2KVIA 4KQPA 2DR6A 5J2NB 3NGSA 3FDSA 4KC5A 3T96B 3J80Y 3BO3A 4DUZF 1BTJA 1UEKA 3AQOA 3N0VA 2JNJA 4C8MA 3DMJB 3EJMA 4X2BA 2P2AA 1H38A 4GWWA 3KLFA 1NK9A 4WU2A 4Q8RA 1FTRA 3NAIA 3QSYB 1LB9A 2BV3A 4JP8A 3KJVB 3MPVA 5DQHA 2ATCB 3GCWP 1SQEA 3G6XA 1VQ7S 2ZMBA 1MWZA 1KQFB 2YQ3A 3K01A 2FVQA 5JTYB 2VDHA 3PYGA 4OZNA 1M5KC 2CG8A 1KONA 4FNHA 3R5DA 2YVSA 3SEXA 2XWYA 3PACA 3IM9A 1BY9A 4HHUA 3VVTA 3TAJA 2IM0A 3RRGA 1X0FA 4OANA 1OY6A 2CNOB 2HG4A 2HFVA 4KGVB 2DNLA 2UYEA 1RHQB 1XHYA 4L76A 4PWDA 1NV6A 4O44B 3O1LA 5I57A 3IAZA 3VGSA 4K0KF 4DF8A 3E8OA 1SC4B 4ZE8A 1B9JA 2DHHA 4QHQA 1LOUA 4X66F 4J7CA 3JTPA 1Q95G 4Q8FA 5ITOA 5CMBA 4NOHA 4HCWA 2MKSA 4AD6A 1R0AA 1IR2A 3PUZE 1J5EJ 1RT5B 3M6WA 3M8YA 2MJNA 3H42A 1BIYA 3THTA 3VCDA 1ZM3A 2FZKB 1IKWA 3U1LA 4G1IA 1B3TA 4N07A 4QFLA 3NS7B 3N5BA 4NLPA 5K14A 3ELHA 2UUAF 2PI4A 2HNZA 9RUBA 3TZZA 3MR2A 1RWMB 3A4TA 5F41A 3U1NA 3CC4S 4DR1F 4LQ9A 1TFAA 2KYZA 2DIUA 3TZWA 2YX1A 2ROGA 2V25A 3DI6A 4U95A 3KG2A 4N8OA 1SJ3P 1F60B 2CQBA 1FNOA 5HM4B 1URNA 3QT7A 1SJFA 2B8QA 4LZ7A 2CQ3A 3JSMA 4IH7A 3CPWR 3IFEA 1U1RA 1ZH5A 2DTJA 1F9EB 4DV0F 2HCAA 4KBIA 2ROEA 5H8NB 2E1CA 4CTAA 4E98A 5KCJA 4F67A 3CI8A 3H98A 2J9CA 1KHVA 2NQPA 2R3VA 5CMCA 1YVFA 2MZ1A 4O4GA 4QFPA 1IMCA 1NFTA 1FFSB 2DHSA 2HBYB 3A3OB 2GX8A 3MZ1A 2ZYMA 3A3CA 1Q0NA 3Q23A 2KT2A 2RHQB 2JWNA 1ZM9A 4DJBA 4ELTA 5M2RA 3MAHA 3QGIA 2W7YA 2V3QA 8AT1B 5IZ3A 3OD7A 4GWXA 2DH9A 3HCQA 3FXRA 1X5OA 3IGNA 1USYH 1MPBA 4NI2B 2JEFA 2MTLA 4N47A 4C8YA 2Q88A 4H0WA 4ZPAA 1ZKBA 2UVRA 1D8YA 1X5SA 1B46A 2K3IA 4POXA 3S6EA 3GTYX 2UUBF 2XX8A 4OIXA 2O67A 4MK7A 1B3GA 4HT7A 5LSRA 4UA8A 1B3EA 4HT5A 4GKKF 5B7WA 2KZMA 1ZAVA 1FPLA 1CULA 1XMBA 1D3WA 3IRXB 4MBPA 4ZJQA 5KFYA 5DG9A 4GBWA 5G4DA 5ICQA 1TXFA 2OPPB 5IWAJ 2CJQA 2XBPA 1ZIUA 2P0SA 1AA1B 1JEVA 2VHAA 3GU0A 4N76A 4WKYA 4P72A 2PCRA 4O7IA 3VGUA 4CLYA 3QMFA 4NRUA 1LWFA 5KFDA 1YZ7A 5LXRA 3T1YF 1A8FA 1WC4A 4M5HA 4I3EA 4QXDA 1MW7A 4DXLA 3I4PA 4DSIA 4RW6A 5F7VA 4ZA1A 2L41A 5DO2A 2R7RA 3RGYA 1PC4A 2VPWB 2IVYA 5RUBA 4M5JA 1MM7A 2GJIA 3VTIA 4NXMF 1S6QB 3HSGA 3M6XA 2H9BA 2VICA 5HVGA 2OPRB 1HWKA 5GADU 1RQ0A 3PO5A 1HFEL 5D4NA 1U6BA 2AJ1A 1QKBA 2W2QP 2KH9A 5GAHU 1H2TZ 2CEYA 4FN5A 2BVZA 3HHKA 3K6VA 2D5WA 5G0RB 3FCVA 1GR2A 4Z7CA 2ALUA 5B70A 4KHPF 2DNNA 4LR7A 4N81A 2C3PA 4IKAA 4MMOA 1QY7A 3BO4A 2MY8A 1JXLA 2VFUA 2X26A 5KG3A 2XWKA 2LP4A 1I6AA 4Y2AA 4CLSA 4CT8A 1DMBA 4Y3CA 1FE4A 2DJWA 1BMQB 5I3UB 4DZ6A 2I38A 4I56A 3B6TA 4DQQA 4JXIA 4KGZB 5KFQA 4FXDA 3JB9k 4PE5B 1P99A 3QO9A 1RT4A 4PWWA 3AB2B 3JYTB 3CCSS 3ZSFA 5E3CA 5CAAA 5J2MB 2R42A 4AUKA 1Y00A 4I6WA 1X0PA 4GVOA 5IGAA 4K4UA 3KFMA 3ZKKA 2JJ4D 4DL2A 4ZS9A 2BJ9A 3Q26A 4P1LA 2CQ0A 3ZO7A 4ISUA 3QGPA 5KFFA 4DUTA 3E78A 3UVJB 4UZBA 2QJEA 3QSLA 4DX8H 2XS5A 2KT5A 3ET6A 2XXWA 2O3DA 2RDJA 4DLEA 3O8WA 5EQAA 5I42B 4ED2A 2YKMA 4NZ0A 2R2UA 2J6UA 2PMWA 1TKZB 1DCUA 3KN7A 5ELVA 3W9HA 4ESXA 3C6UA 5LTCA 1R0CB 1E6YB 2WYKA 2RKIB 3SIPB 4ED8A 5AE3A 3PRBA 3AOBA 4HVZA 3VLWA 2DS9A 2BJ1A 4OLOA 1GMVA 2W1BA 3LO3A 4LT6A 4P73A 1F9BA 3TKDA 3Q83A 2H99A 3PYDA 3QQCD 1I5OB 4K4TA 4YKKA 1ZAWA 3R5GA 2K1RA 3VZIA 4GOTA 2YNHA 2J0WA 2X3GA 1EIYB 2R9LA 1KN6A 2HAFA 3TRGA 1S9EB 1WDNA 2R7QA 1MMLA 4I7FB 1B51A 3LSWA 1YX2A 3TX8A 1VDHA 1O8BA 1EAYC 4DL3A 5L39A 2F34A 1U1LA 3Q29A 1AYEA 2UV8G 2DEIA 2KXNB 2M88A 4NF4B 1X60A 1HD1A 2P8IA 2OX3A 2XXUA 5L9XA 2DKOB 1H6KX 3OTEA 2DP8A 3K5LA 1HD0A 4X84A 5GAGU 1N76A 2ZJRQ 1ZLQA 4I2QB 4OETA 2J7WA 3M8RA 4XIUA 3SSRA 3FVGA 2NLWA 1RP5A 3IO1A 4FBPA 2F3DA 3HVAA 4EEYA 5I2KB 2AGPA 2UVUA 2QVUA 4G2ZA 1DQ8A 4IQMA 2KR0A 1H76A 3RTWB 5D0GA 1CB6A 3BGRB 1EYKA 3ZTOA 3EXCX 4CIOA 3OVAA 3P5TL 1QSSA 3PJWA 2IA6A 5HATA 3KHLA 4MIJA 2Q43A 4FP9A 4BHQA 3DLBA 4LREA 4I8CA 1LWXA 4YY3F 4JWXA 2ALYB 3N6TA 2CDRB 1XVXA 1JJ2R 4NCGB 5HBMA 4DLGA 3QIDA 2DGXA 1FK9A 2RCBA 4C2MA 2VFTA 2FTRA 4DR5F 1JQGA 3GCXP 4KSEB 4J9UE 4JV5J 2CZ9A 3H6TA 4RW7B 4PBQA 2RRAA 3VF0B 2HQDA 3FJ2A 3BDPA 4DV7F 2BABA 3W9WA 1RE1B 3RAQA 3WHIA 1FBCA 2Y5LA 2QSWA 3GSIA 2RSQA 4DXUA 4ECTA 1PGZA 3G6ES 4DV6F 1X4AA 4IO6A 4LFBJ 3QBCA 4Q7AA 1FDAA 4RX6A 1QUJA 5DG8A 3N26A 3Q0AA 2V4JA 4ZVEA 3ULHA 3S4UA 1MY2A 3H7HB 2F40A 4OMBA 4USVA 4NF5B 1B7YB 3US5A 1XJWB 1S6PA 1TL4A 4PZVA 1M5CA 2EXUA 4LVQA 2XMAA 1VLOA 1DPEA 2KRBA 2GMHA 1JLBA 1KQGB 2V94A 3CSKA 3DLEA 1LAFE 4JVDA 2ZNSA 1OYEA 2BKOA 1F2GA 3R8YA 4Q5TA 1BLFA 1FTOA 3NCPA 1E6VB 1FNMA 2W4CA 4ZCKA 1ZBTA 3PW2A 4DWIA 1T9TA 3MPUB 4G3IA 1RZMA 4PF8A 4UOHA 2DNQA 4QYRA 3SZ2A 1NUZA 1UJ4A 2FVSA 1LCTA 4AQYF 5L8RC 3ENQA 4CDIA 2OJTA 4ED1A 4KXPA 3QYYA 2HNDA 4PG5A 1YJ9S 5KG4A 1TWYA 5ADZA 2CQCA 4H1XA 4YAHX 4A4JA 1VR6A 3V6KA 4ELPA 4ECVA 2XTJP 2IC3B 4LF4F 5H1SV 1OJ4A 2V4QA 4K4XA 3E4RA 4R6HA 3EYZA 3USDA 1Q9DA 5JUMA 3KC0A 3H0PA 2V93A 4OJ3A 4YEAA 1B2HA 1YJNS 2FLLA 1G0HA 2IYGA 5KFKA 2POKA 1APSA 3IC1A 3HVTB 5FTHA 3K02A 4BCAA 3SDEA 3VLVA 4DX5A 2KG0A 4LRFA 1QE1B 4PPDA 2DR5A 4FYDA 3UGWA 3UA8A 1YCJA 1PKUA 2QA4G 1N54B 4PPZA 3QATA 3PNIA 4G68B 3G82A 3PHEA 2I3WA 3ZXWA 4LF8F 2JRSA 1QAXA 1Y1MA 5I2NA 1LFPA 1NUYA 1US5A 3GJTB 3LP0B 1XN9A 2E5LJ 4YMAA 1FTJA 4EQBA 2F35A 2FC9A 4DCXA 4CLFA 4NZ7A 1N7XA 1CJUB 1S1XA 3EGNA 4F0KA 2ZDPA 4IO3A 2E1RA 2LXUA 3KK3A 2GRVA 5A5LA 3FV1A 4LIWA 2QMWA 3AA9A 4C9DA 4TLLB 2B5JB 3FUYA 3C2PA 2LQBA 4YHHF 2XD3A 2VQFJ 1RT6A 1OIBA 1MWQA 1RDXA 1N5YB 3OXFA 1K44A 1OS5A 2HVHA 4NLDA 3Q2TC 4F3PA 1PJ5A 1T05B 2ZNTA 1LEOA 3QZ7A 3GIMA 2P1SA 3RLFE 4P0GA 1F2HA 2DO4A 1RLCL 3MEEA 4OESA 1U6FA 4F19A 4O3AA 4ZS6A 1VBZA 2AQ4A 1PC5A 1VQPS 1LQ9A 2GHVC 4EYHB 3M3LA 3M8QB 4QPTA 3H5YA 3MD3A 1LWEB 4XXUA 4E0WA 3B4DA 2GVZB 1Q4RA 1TK5A 3LAKA 3R7XA 3THIA 3MM7A 2ZFHA 3QJLA 4F0MA 2WOMB 1K1SA 4KKOA 2L48A 1N52B 2XZWA 2E5HA 1Z2LA 1TL1B 2XSFA 2UZAA 2XS7A 1CBKA 1Q53A 2BBEA 2MQQA 3M2RB 1IR1A 2E5JA 3FJMA 1OYDA 1LFHA 1RHMB 3R26A 2ERRA 2OWZA 1FBFA 4P2MA 3VAFA 1NDCA 2HBZB 4F4YA 3HZEA 4QIGA 2FZCB 2YH0A 3SYZA 4ZPCA 4ZKAA 2XXXA 2MKCA 1N33J 1IWGA 1OLAA 3KOTA 2VJVA 5H8SA 1RBOB 1WF2A 3TARA 4UZCA 4M63A 3VE1B 4ANDA 1S59A 3TX0A 2R7VA 3W15C 3NOGA 1PB9A 1DRZA 2F5XA 2JVRA 2MYFA 3A3UA 4IGRA 2MB0B 3KLHA 2VOPA 2DOJA 2I5JA 3D6MB 3W7BA 3QK6A 1S0MA 1HNXF 1DTZA 2ZZXA 1B7FA 5JVHQ 5KFOA 4IY6A 2ZE2B 4OA4A 3FSYA 4HHHA 4KD5A 3GG0A 4WP3A 4NMYA 3M8WA 1MPCA 1FEHA 5K20B 1VMBA 4B3MJ 1IIWA 1MPDA 2B9EA 2DNKA 3UO0A 4M95A 5GVQA 4FORA 1FRIA 3C15B 5LDZA 3I5CA 1ZTWA 3G8TA 4ZEKA 3CJKB 2A3JA 4F4AA 3DNCA 4EUVA 5IT0A 4Q8EA 4OL8A 3K1PA 2H4IA 5CYMB 5IT9U 1FFGB 1EZ9A 4URGA 3EDQB 4F4XA 2PFFB 3I31A 4PWUA 5U47A 5LMNF 1M5BA 5HQLA 1RT3A 2ZH8A 1S1VB 1ZYQA 2D3IA 3H6VA 2YX7A 1NSKL 2HHTA 4NLWA 4JI8F 6FDRA 3CB4A 4EO8A 5KDTA 1GNKA 2WVDA 1A40A 1U47A 1EP4A 2XNRA 3M3FA 1SJQA 5F3TA 5E3RA 5AXNA 1HQEA 1TAQA 3S2VA 3BBCA 3KLIA 4I1DA 4EI2A 4B9TA 5CA5A 3FXBA 3W5YA 4WIIA 4A47A 5CYJA 1V3SA 4F4KA 1SL1A 3TA0A 2UXCF 1SPIA 2F3JA 2LEBA 4GKJJ 3WX8A 3IR5B 3MM8A 2J9DE 2Z0GA 1J27A 3CD6S 3FMWA 3ZC4A 3PDNA 1SIWB 4KTQA 1XMOJ 3HD2A 2VASA 3VAKA 2QZ8A 1Y1ZA 2QS4A 4WXOA 2G2OA 1NLKL 1LNQA 1U26A 3A3NB 2U2FA 4DG1A 4OX9J 1RKIA 5ETNA 2H4WB 1W26A 3CSGA 1JLCB 4ANEA 5J2PB 3V89B 5JK4A 1FJGF 1EETB 1FCAA 3PRVA 5AE1A 2H1YA 4X62F 1S6UA 3U65A 3BYPA 3TAMB 2MZQA 1YBAA 1ZA1B 4PQAA 4DSJA 4FKYA 2AYBA 2ONKE 3KEIA 2B7CB 3DXSX 1EU8A 1NUWA 3BM7A 1FQAA 3QUFA 1R89A 2QLJB 3W9JA 4DR7F 2HVEA 3JSYA 2JHEA 5F24A 4U9RA 4DV1F 5IM2A 3GB0A 2FJDB 2Y7PA 2DNPA 3G3JA 1C4CA 1DTQA 4CM2A 4CWBA 2ZBIA 1S0VA 4AXIA 4Y2KA 1SV5B 3P4UB 1MN9A 1WF1A 5DVJA 3MQ9A 1U8WA 3AFGA 2LQ9A 4ER8A 2YWEA 2OMLA 2B4UA 1GX5A 5EGYA 2C2KB 2DNHA 1T8EA 4MJOA 3CE8A 3N6LA 1R3NA 4PQUB 4NCBA 5A8RA 2GHBA 4WFXA 1Z7ME 1CPZA 4FYVB 3FD3A 3HJVA 5I58B 4HLBA 4USJC 1XI6A 3E01A 3R5AA 2GFFA 3D3BJ 1KDNA 4LVOP 1YTVA 3MM5A 1YITS 2DPJA 2DR9A 2MJUA 4P75A 1XMQJ 2V84A 4OVRA 2VBXA 4CP5A 2BM0A 3B7DA 3BPDA 3FVKA 1VIOA 4TQRA 1YAEA 4TQSA 2PT1A 1R9LA 1CJTA 2E9ZA 4ESWA 3PGFA 1A8EA 3CCTA 1UWAA 2F9DA 4BLGA 1T9WA 2GGPB 3WZ0A 4B17A 1NH8A 4K2JA 4FBTA 4HI1A 5A0YA 4H4OB 1D9DA 4JWOA 1FX2A 3AD9C 1B4SA 2IM3A 4O0IA 4DZDA 1MXWA 1HBOA 3V81A 2UVHA 3EM1A 4ENOA 1RK8A 3E3XA 2ZOMA 3DDKA 4TOZA 5L1LA 2FD2A 5HMZA 3W66A 5HPQA 2D9PA 4WK1A 5DS7A 4FEBA 2UV8A 1LAHE 3MVXA 1FX4A 2DWAA 3CJSA 3PX4A 5I4MA 4OZ1A 2C3YA 4A8QA 1FWPA 1A0OB 4G8HA 3FC9A 1TL3B 1UW9A 1CJVA 1L3KA 1YSJA 3FBCA 4PFUA 4BDNA 3G86A 4U1ZA 4DLDA 1TTHB 3PEJA 3Q25A 2NWJA 4Y2CA 3EGZA 4ZHRB 3IWXA 5C25B 5B7DA 4J9MA 5L1JA 1UFWA 3QAXA 2VG6A 1HSJA 1G6BA 4RUHA 2KL8A 4P2FA 5DG7A 5KFVA 4EMDA 4DPTA 1NJWA 2L9WA 4XAKA 4HEA9 1N56A 1S4EA 4B3SJ 2OWSA 2C2EA 4U22A 5A8WA 3POTB 2CZIA 1DLOA 3NP5A 4ZVOB 3RR7A 2XXKA 2NXCA 2V9WA 4NYZA 1FVSA 3G6YA 4LFCF 1S50A 2DXRA 3CT9A 3UIFA 4OI6A 4DDDA 1JLEB 2LQ5A 4C0OC 4R8UB 2CQPA 1VQYA 1HKAA 3BREA 5FHOA 5ET8A 4J9KA 1RTIB 2K2PA 2B65A 3DKDA 4LQ2A 3N6UA 2DGOA 3LP1B 2QRYA 4DL7A 5KT5A 1FT8A 4WKRA 2DGSA 4DU7A 2WBBA 2QFJA 3C9HA 2CQGA 4F31B 2QVRA 5IAIA 3KDOA 2BJJX 3DFEA 2IAJA 2AYMA 4FDFA 4DUYF 4USTA 4DIGA 2OBGA 3FQKA 1TVRB 1XR7A 5LJ3Y 3M9NB 5I3SA 4J9VA 3KSXA 3ENWA 4NLTA 4NLYA 2ILYA 2E0SA 2JEGA 5DYHA 3TCFA 2Y3YA 2HHHF 3V83A 3I82A 3OHBA 1TL7A 4CNYA 1HNVB 4ZZEA 1GXTA 5IV3A 4R0JA 2W8LA 3HKWA 3BB5A 3NMAA 1UQWA 5HMXA 3MMAB 3GSDA 4ZEBA 3MUVP 3L3CA 2NS1B 5HVFA 3M4XA 4NF8B 3HHLA 5A8KB 1JIHA 1HNWJ 2FBPA 2I4CA 2R8GA 1JMTA 5D0EA 1DZ5A 2O66A 3MP6A 3DRSB 3J80U 3MZBA 2PBWA 2RT3A 3K6XA 2BE2A 4KCCA 1FI4A 1JLAB 2P6SA 5F8IA 2QLFB 4YKIA 2DCUB 2VP1A 1N32F 2Z8QA 2DWHA 3H3GA 1N3WA 3HFVA 1IJEB 3IG1A 5DEXA 5H9EK 2AJ2A 2XC9A 4RW9A 2DNYA 5AXLA 2C2ZB 3PUWE 1NL5A 1V5VA 4QJVA 1MH4A 4M5DA 1R8BA 2MKZA 3FSXA 1I94J 1WDDA 4P2XA 1UVIA 3D6TB 1S79A 4DEZA 1MXUA 4MNIA 2B7BB 2JOQA 1FKAF 1SD3A 1NJZA 2B9YA 1OQ3A 2XX7A 3ECRA 2HGNA 1NZAA 4YOEA 4LRDA 4D3HA 4NXNJ 3FGVA 1HNZJ 3TPAA 5LSLA 3CDWA 1WG5A 3HHEA 1H0HB 3T5JA 3HX9A 2VQEJ 3FGSA 4N8YA 3BV8A 1S48A 1VC5A 2OHDA 4MAKA 1QSYA 3KHGA 4HACB 1L3SA 3J7YU 2H9ZA 4OHZA 2F7BA 4QYZK 4E0DA 4BC9A 3EUNA 1EZZB 1RHKB 1RTHB 1LKZA 1V6HA 4JI0F 3GFXA 3HLUA 2O01C 1MXYA 3KK1A 1IKYB 2R71A 4Z2XA 2WAQD 1NCLA 2IVFB 1HR0J 3OD2A 3EPGA 4MKYA 3MAMA 1FTKA 3GYNA 4IDKA 3D0GE 2M8CA 3JYRA 3MMCA 1B99A 2OO4A 1G1XA 5I56A 4FF2A 3DLJA 5H9FK 4QIFA 1N0VC 1ZM4A 3GWCA 4DHVA 2B43A 3T66A 4B9NA 2GVDA 1NM2A 1TKTB 2REGA 2VV5A 5KFWA 4TN2A 4TY8A 1SC1B 3L09A 2ASLA 4ZEDA 5HVHA 3KLGB 4MKAA 3MCSA 3BKUA 2W9BA 4A8WA 2D3ZA 3OL9A 1JVYA 4DV5F 4G1QB 1P9QC 3FCWA 3OVBA 2EBEA 4DPWA 4ZVHA 4PG7A 1WD6A 2N7YA 3LF0A 2BDPA 1XT8A 1B3HA 4WPAA 3OSPA 1KTVA 2XXPA 1TL5A 2FHMA 2C1EB 4RNFA 3CCLS 2AYSA 1IKVA 3PTYA 4LIRA 4X4NA 1HYSB 4I4BA 1WOPA 3OFGA 2AGOA 3EVOA 4YB1P 1X4GA 4YB5A 2KN4A 4E0XA 2E5GA 5FDLB 1NI9A 1U1QA 1L5UA 1IBKJ 3QNWB 1JW1A 4NYOA 3SDFA 5I3UA 1JJ4A 1ZU0A 1HBMA 3JTNA 3LOUA 4MHFA 2EC0A 4W98A 1JLFA 2VG5A 1Y3KA 4PYAA 1DBZA 1YRTA 2QA1A 2NSBA 3QAUA 2B0GA 4KO0A 3EF7A 1CG2A 4PDDA 5I59B 1FJCA 2RILA 2BUNA 3FQLA 4DS4A 2HNYB 3MPWA 5DTBA 2VFSA 4DE8A 1I51B 4FF3A 4O23A 1UPMB 3T1AA 4RK2A 4AL7A 2F65A 1OQGA 2HHPA 1L3UA 3H90A 3UVJA 1AOVA 3N4WA 5F8JA 4UW2A 5DDQC 1U2CA 4B9UA 2HPUA 1TKXB 1J5EF 1KOOA 1AXQA 4UUXA 1NK8A 3ZNUA 1PAUB 4DX6A 2VF3A 2L3MA 3UNYA 3THPA 5CRYA 1FKPA 4DMZA 1U1OA 3NNAA 1JP4A 4B3RJ 2UVGA 3PFEA 3CFXA 4OVSA 1LGBC 4PG6A 1C1CA 3S9LC 2HQFA 1NPRA 1VQKS 2RF2A 1B32A 4G68C 2XMTA 2FJEB 1RISA 3PUYE 5F8MA 1HBUA 4P8BA 1MXVA 1VRUA 1O51A 3CVGA 4QBUA 3IX1A 4ZVTB 4OEVA 4QSEA 2ZUAA 2HFNA 2HGMA 3AD8C 2MEWA 1R27B 2F1FA 2M8HA 1VQ6S 3I3VA 4OFOA 4XEQA 4RW8B 2UYFA 3LANA 3T9XB 3PM9A 1OVBA 1HQ2A 5IKBA 2CPHA 4CYUA 5D3GA 2EI5A 4F3MA 5FD1A 1MQIA 1SKSA 3D1RA 3MPYA 4GVLA 4P47A 1U4BA 4IR8A 2HK2A 1CS4B 2CPJA 4YR2A 1N6QA 3SQGB 2J8AA 2NUHA 2DXYA 2QT7A 2MQPA 2CZLA 1YJVA 3KK2B 4A8YA 3GLJA 1UW4A 2RRNA 1SI0A 4CI0B 2XULA 1ACMB 2GHWA 4AYBD 1B0HA 2CG4A 3RGIA 1GQEA 4P7TA 4O94A 4EUOA 3RB3A 1IN0A 2DSFA 4JI5J 4UY8T 1DTGA 3GZ7A 3BBFA 4O3RA 5DZ7A 3K2YA 2HAUA 3U8QA 2MLYA 2RE1A 1FQFA 1P1WA 3KLEA 4EK2A 2Z2ZA 4TXSA 1WELA 4ETXA 4YB6A 3DC2A 1RA7A 2JJKA 2VFRA 4M5MA 1MDP1 4H6DA 3MZ9A 4DV4J 4K5SA 1Y4ZB 1WC6A 3GR1A 2MQ8A 4JI7J 4WTOB 2LEAA 1P1OA 1MMDA 2ZZVA 3S7RA 1RWXB 3UN3A 1WHYA 2BANB 4F18A 1OPZA 5IWAF 4Q30B 1VFDA 2YTCA 3I9V9 2PC6A 1U1MA 4QU6A 5ET5A 4BS2A 2OLBA 2LDIA 1PO6A 1C0TB 4PCDA 1GX6A 4LMZA 1CSJA 3KBRA 4KI0E 3OR1B 1NK6A 1JLQA 3W61A 1VQOS 1FXRA 3TMGA 4NL5A 1WACA 1MU2B 5AA4B 4WP8A 3MXHP 4WZQA 3DLHA 2RC9A 5F1QA 3I4HX 1B5HA 1FPBA 1YRXA 4NF6A 4ZVPB 3CSBA 1MXZA 4HS7A 2PE8A 1RU2A 5IM0A 5GADI 1FO1A 3R2CJ 1HWIA 2A10A 4KH0B 4OI3A 1MQDA 4I64A 3UR3C 2FHYA 4OQJA 3MPLA 4R2BA 2PFDA 3D6HB 3GPAA 2VG7B 2ONSA 1S1UB 2A2CA 4C8OA 4LF6J 3OJUA 2RQCA 2O6AA 1Q82T 4R72A 1IMFA 4OZ2A 3S9EA 4QIWD 4KV8A 3D2WA 1FPEA 2W7AA 3OV7A 1FXLA 1YZ6A 1C1BA 3C35A 3D67A 2BJEA 3GXAA 1UMJA 3R1LA 3TI0A 3MF5A 1F1BB 4YS2A 3BR9A 2CNNB 1XR5A 2MZTA 4JI6J 4PG4A 4KHZE 2B4PA 1USYE 3PMVA 2FIUA 2ZVSA 5K8NA 2WONB 1IMBA 4K50A 4OI2A 1KFDA 3E2EA 2Z8EA 4GC6A 4OX7A 3NOHA 2ZH5A 1GH8A 2I6WA 5FLXY 3OO7A 1L3VA 3OBIA 4RUAA 1W7WA 2QJ3A 3LPEA 3GLBA 1EJ7L 3C16A 4R74A 2QSFA 4DCJB 1QAJA 1SB6A 5LM7E 1BUXA 3I56S 2FIXA 3GJSB 2V0NA 2NYIA 2RUSA 5H9EJ 5HMYA 2AIRB 4GIZA 4HE2A 2UXBJ 2YKQA 3MECB 2RCAA 3H2LA 1I6QA 3B50A 3OW2R 1CLFA 1IBLJ 1B05A 4KQZA 3LUYA 1WEZA 1RGVA 3W8GA 1OPIA 2XMVA 4GWYA 2KI2A 1H43A 2L5VA 2VC1A 4FZVA 1G7CB 2MKJA 4EO6A 5L9MA 3CCVS 1H44A 3RG6A 4C1TA 1F3FA 2B6AA 1URSA 2I2YA 2HIYA 3IB0A 2AEFA 2AIXA 4ID5B 1UTHB 4X4VA 4K4WA 5J1PA 4G4PA 4YUDA 4Z7YA 3V6DB 4MFBA 5KT3A 1QAIA 4A8SA 4PETA 4LF5J 1Y4CA 3C66A 4H4MA 1JLGA 1RTJB 3WBZA 5F9NA 3FMBA 4KRWA 3SFGA 5BYRA 1RTDA 3UCUP 5H8HA 1F0XA 4CLUA 3DLGA 4NE9C 1VJQA 3J7ZT 3O2IA 1KLMB 4NZ6A 3O6HA 4PGNA 4C0BA 4OMFG 2QLWA 4QYZJ 3NRBA 2VOOA 1N5YA 3M8SA 3MEDB 1FTAA 3I6VA 3W5ZA 4UACA 4RK9A 1T9VA 3EZOA 1NHVA 2FPHX 3TQ1A 1FPIA 1N84A 1PSDA 5GAGI 4F2QA 1IBCB 1S1TB 4P7VA 3MR6A 1LAXA 4CO0A 4R75A 3P6YC 1RSCA 1IUJA 2HEKA 2Z2LA 2VBYA 1GFWB 3DOKB 4ZN3A 2X1FA 5H9FJ 3FFIB 5DDPC 2VPOA 1QTMA 2ZKUA 1P1UA 4K2XA 4QIEA 3R7NB 1NKBA 3NWGA 1Q8BA 1FW0A 2H5YA 7FDRA 3UN5A 3MVYA 1VQLS 1SUQA 1S9GB 4NA2A 4OLPA 2C2NA 1WUUA 4ES3A 1PAEX 3DM2B 2BYCA 5CXTA 2B4VA 4NEZA 2WSFC 2R8TA 2FJWA 1B52A 2MZSA 2UXDJ 2C3UA 2NUUG 1XBWA 2ZH2A 3MVWA 4XKRA 4F50A 1F5CA 3V4IB 2HYIB 4AL5A 8RUCA 5CYQB 5DT6A 3QRRA 1S57A 1N4LA 4M5IA 1I6JA 1AB8A 3H03A 4JV5F 3BH6B 3LUZA 2QL5B 5C24B 2A6MA 4PFRA 5EN1A 1CC7A 4KYSA 4MIAA 5EX3A 2CJAA 1W2BR 2XMWA 2R9JA 4KGMA 1RYOA 3OSNA 3RBZA 4N6DA 5J1DA 2G29A 3D1HA 2R8KA 1RT7A 1VRTA 4OVTA 3AA8A 1P9YA 5T7LA 2RQMA 1PJ6A 1QJMA 3NLCA 3M1VB 4MLQA 3MM6B 4DSLA 5DLFA 5D0HA 3A3PB 3NGKA 2JDJA 3MPKA 3OUYA 3CRBA 3QWUA 3BSCA 2ZH6A 2E1SA 4XTCQ 2ZZNA 5D78A 4LFBF 3DYAB 2CMOA 1UIVA 2AX1A 2Q89A 2A6OA 3PPRA 4AL6A 1HPZB 5K2XA 3ZKLA 3OL8A 1O7TA 3PXGa 2HQCA 3EGWB 1LLSA 2PD1A 1WHWA 3B82A 1NNKA 3GYGA 2CKWA 1BHNA 3LTOA 3QJJA 2CQIA 3D5MA 4G1PA 1TELA 5I3QA 2CJ9A 5THWA 2A5TB 3O97A 4QR2A 2P9CA 1FRJA 4RJVA 4F2OA 2XWXA 3T3FA 4HDHA 3AODA 2HLTA 4ZEIA 2A0FB 5LXYA 1SQFA 2A5SA 3VV5A 2XMMA 3RT6B 2Q79A 3V2UC 1U0HA 3CMES 4U7UD 3RJMB 4O3PA 4RZRA 2DISA 4WXJA 4LF9J 3CW2C 3W2VB 4TLRA 5ET7A 2KM8B 1K47A 3N5LA 2NXOA 2Q2CA 4WFAQ 1M5DA 1UWBA 3KNGA 3P7IA 3PJXA 1KZ8A 4I2PB 1N3XA 4ECWA 2DNRA 4FNIA 2Y1LB 4G77A 3E3KA 1TAUA 2PO4A 1JJCB 4H4KA 1PBQA 3L6GA 5BWJA 2AF6A 2ZM6J 4O3BA 4L6V3 3H2UB 4LBPA 5HLFA 4DSFA 2YKPA 4IH5A 4MH5A 4OQOA 3EHUA 4L17A 4KPYA 2X7IA 2NPFA 4GWUA 1FPGA 4K4VA 3DP4A 1IKXA 3CDAA 1SI9A 2ZDOA 5I84A 2BX6A 4DI4B 2UU9J 2O84X 3CD7A 5C42A 1FDBA 1FRXA 1VR5A 5TPAB 4C11A 1POY1 1LXNA 2FVPA 2HQ0A 1UTAA 2GQ1A 3N79A 1RAGB 4ECFA 1XNRJ 2E5LF 1FBDA 3I0SA 1WKKA 1PJ7A 2MHEA 4C8LA 3CNQP 3MAAB 1FPDA 2HHUA 2N7CA 2B4OA 3EHSA 2HBQB 3V5RA 1O5JA 1B3LA 3HHGA 2MDAA 2FVZA 1G0IA 3MMBB 1KHWA 2VQFF 1NUXA 5B0BA 3CG1A 3NMRA 3BN7A 1O0PA 4LSLB 2AL5A 3L4BC 1FRPA 2JVOA 4C0HA 4X4UA 3NBPB 3KG1A 4HH1A 2CPFA 3UQSA 1GTKA 4H5FA 1KC8T 1QGXA 2RD5C 4WFYA 3HZGA 1X8DA 2ASYA 3M6VA 2DR8A 3H6WA 1AROP 1OMPA 4PUOA 3IBFB 3IP0A 5CBRA 4N7TA 1QULA 3BQ1A 1TUVA 4JV2A 3R5JB 2DD8S 3SSQA 5DVFA 3KJNB 5J16A 3WQPA 4QRZA 5DGBA 2P3VA 3M32A 1EB0A 4W4MA 2W9AA 4MX6A 1NNDA 1KS2A 1HBNA 1HNIB 3HK2A 1RAJA 4WE1B 1AFJA 1X7VA 3KJFB 3GV7B 3BEGB 5LSOA 2IA4A 4FF4A 4N77A 2XYGB 4R0EA 3C14A 2OPSB 2R7OA 4C1UA 3VXCA 1DFDA 1FE0A 4F8RA 1U02A 1A99A 3PFOA 1Q35A 3SCJE 3O9PA 4JI2J 5KFCA 2FNCA 3CTRA 1MRPA 4NCAA 5TP9B 3TCHA 1U48A 2AJ0A 1RBAA 1N33F 3TZXA 4WFNQ 2BQUA 2HMIA 3CCZA 4DR2J 2WBRA 2MQMA 5HP1B 3CGIA 1JWWA 4IFVA 2WVFA 2OI2A 2DGWA 1BQMA 4GXAA 3KC1A 1JNZB 1XNQJ 1AZSA 4EXKA 4KHMA 3LGNA 2X7PA 4PYDA 3FATA 2ZBCA 3EQ1A 1TUWA 5H8FA 2ASJA 2EKYA 3Q8RB 3TUSA 3DRYA 2GO8A 2BJ8A 4RPNA 3KLFB 2HZKA 5F0WA 2E9TA 5DM6Q 3LWMA 2NPIA 2CQDA 4RBTA 5CBSA 4MFIA 4UTGA 2AGQA 3NKYA 4JSDA 4ZVRB 4IO9Q 4MKVA 4BDMA 2Q6BA 4B3MF 3LGHA 3HM9A 4CLZA 3CJQA 1PIEA 2H5EA 4Q2LA 4BDOA 4P1EA 1MY4A 3TTRA 3WIUA 3OJSA 2XS2A 1PBAA 3V5AA 2OMOA 3DOLA 2R6GE 3I0RA 3T1HJ 2GS8A 3RNNA 1G4CA 5ISUA 4G61A 1KBRA 4PWDB 5I57B 3NL0A 4F1UA 1OMSA 1SBRA 2KLFA 3OOAA 2CQ4A 4JBZA 3MM9A 3CJ4A 4ILMA 4FVCA 1YLXA 2GJ2A 2W2OP 4MLVA 4NWDA 4L75A 3RR8A 2XGQA 4TU9A 3H8YA 2KHCA 3Q89A 3IORA 1K9MT 1XQIA 3UCZP 3K1NA 1HMVA 4FJPA 1S12A 2R7WA 3K5PA 1IKWB 3CDUA 5J1EA 2NCKL 5L9NA 3KJ7A 4DL5A 2A18A 1G3OA 1YJWS 4G65A 2M9KA 5ETSA 4JI4J 3FASA 2MY7A 4ITSA 2M52A 2Y7RA 2HNZB 2GCFA 4ZE9A 3B6BA 3U02A 5J2QA 1VFJA 2VL1A 4ATNA 1N34J 1WI8A 3DI6B 2BZ2A 2G2YA 2Q3PA 4GKJF 2MSTA 2PEBA 3WAEA 3KKFA 3VAIA 1KWHA 3SERA 2AZ3A 3T41A 1LV5A 3Q8YA 1FTMA 2AL4A 1PC3A 1T03A 1XMOF 5FIIA 2LMIA 2GW8A 4CTAB 3IR7B 2QYGA 3H6UA 5KCJB 3EZ5A 3DHWC 1S0NA 5CZVA 3FSIA 2QGFB 4OX9F 2V8PA 4RW4A 4O4GB 3EGVA 4A48A 4ANCA 1B0PA 1NV4A 1JXEA 4CQ1A 1OLCA 3BBBA 2DIVA 3DP6A 1V5IB 4JI3J 1WHVA 3RZAA 4MAGA 1KA1A 2VZ9A 1VQ8S 1GMWA 5H8QA 3BO2A 5IZ3B 4H65A 3ONQA 5KFJA 3IAM9 3LP2A 1OQ6A 3X3UA 2Q8JA 1WC1A 1B0VA 3DCAA 1FKOA 2AEJA 3AB4B 4K3FA 3GYXB 2OWTA 4P71A 3M9OB 4XKNA 2JX2A 3VAMA 2MSSA 1TMJA 1CULB 3KOAA 2AP6A 1VBXA 5E2QA 2ZHBA 3CJ3A 1INPA 3L95X 3CUNA 2CVEA 2CYYA 2ZH4A 1Z7NE 5HJYA 1NU4A 3M2UA 2JFDA 5IQ6A 2MKIA 1R0BG 2DQVA 1ZPWX 3EPEA 3P96A 3MEGA 2L08A 4USKA 3FVNA 3IB2A 3PMWA 1LWFB 1Q7LB 4X65J 1RKMA 3OTCA 1XMQF 4RW6B 3FRYA 1Y11A 3TUZC 4OFLA 1PYOB 1HW8A 1LXJA 2N82B 1EKRA 1FA0A 1HHSA 3BS9A 3W2WA 5A2QU 3P3DA 1JKHA 3U1OA 4XF5A 2RMLA 3QIPA 4C4WA 1HI0P 4K4YA 2GNKA 1PB8A 4WZMA 4XIGQ 2QS3A 1RWWB 2E7XA 4QSDA 2LDYA 5HBCA 3K59A 3ETMA 4P6QA 2RC7A 2DRDA 1HW9A 1VIXA 3TTMA 1Z1ZA 3OFHA 3L9ZA 2VD2A 2IVMA 2FYIA 2J6TA 2F9JA 2CPYA 2B3TB 3QGGA 1R6VA 4JB8B 5IZHA 1HI8A 4ERDA 3X1LB 4IG0A 4JWYA 4ZVFA 1GTEA 4EF2A 4GVBA 5CD4H 3MURP 2HHXA 3S9MC 1URGA 1BC6A 4NAPA 3JQKA 5KFBA 1DOTA 2OD4A 2YNGA 3IBWA 4F0HA 5CD4A 4OYWA 5EUHA 1K73T 4KY3A 1W2IA 2HRUA 2YNIA 2DPIA 3QO9B 1RT4B 3SFUA 3SCKE 2V6AA 4WWSA 3GBBA 4U7CA 4OFJA 3HVWA 2BXJA 5IXUA 3Q86A 2LYVA 4C8ZA 4MKBA 1XOCA 1S6OA 2ZH3A 1NBEB 5D0RA 4OV1A 4NMXA 5GAEI 1DK4A 3SESA 1D8ZA 2XWVA 2AYGA 2PA8D 3M2VA 1MNEA 3MI7X 3H5SA 4B3SF 3C36A 1SXLA 2CVIA 3FXQA 4MH8A 1LCFA 3PUVE 4KGKA 3NGRA 4ZZAA 2EG1A 3ET6B 3AOAA 1LWCA 1YQHA 4GL8A 2YKMB 2RQKA 1U2FA 1YDLA 4U2RA 1X4BA 4X1DA 3DLKA 2B4LA 2WRMA 3TW0A 4TLMB 1CJKA 3A8IA 4MIBA 3C6UB 4QF9A 3LA0A 1FRKA 1TV6A 2AJQA 4GRSA 2YH1A 4KFQA 5DRKA 3C34A 2JL9A 4LR9A 4FECA 2HK3A 2HQIA 5AE2A 1RUSA 1SPBP 4TY9A 2I49A 1Q5YA 4ICLA 1RT1A 1QJHA 4OVPA 3KN8A 2K1RB 2FJBB 2YNHB 4I3YA 2PYYA 2J0QD 1UETA 2ZBRA 3A8JA 4FXWA 4KR5A 4IO5A 4OXVA 2G0JA 4UUWA 1RYXA 3K1MA 3CR9A 2EFOA 3IJXB 1X9WA 4RUBA 2YKOA 3HCXA 4QFNA 4RUCA 2LQ8A 4H67A 2V5HG 2R2SA 3DOMA 3GV8B 4KFBA 2D3O1 2YXLA 4IFYA 2I3VA 2UVVA 2O1LA 3JAMY 1GAOA 5LOMA 5E3QA 2IY5B 1HNWF 1P1NA 1M5SA 5KFNA 4YDDB 3HFZB 3QT5A 4K4SA 2MKKA 1DHMA 2DH7A 2QMXA 1GGGA 1NHKL 2BA9A 4XTTA 1OY8A 2F3BA 3MUTP 4HI2A 2Y5KA 5HBMB 1FK9B 4U4SA 2P3NA 3MR5A 5DETA 4LA9A 4CO5A 1P6TA 5K8MA 3K8WA 5ETLA 4P74A 3CCQS 2VKZG 4GX4A 4QBAA 1UTBA 1VFEA 5EQ7A 2IMWP 3K00A 4I40A 2I58A 4F04B 3K58A 1I94F 4LF7J 2KT3A 3PR4A 2ZZWA 3HSJA 2D3UA 4CLTA 4X64J 3TA2A 2BJDA 3M8PA 3VV2B 2XY5A 4A8XA 4PEOA 3RTVA 3PUXE 1WOOA 4ZCIA 4Z7EA 2RS8A 1NK5A 2IYIA 1NNPA 2ZJPQ 2XB2D 4NXNF 2EVZA 3CC2S 5SZTA 1HNZF 1BQXA 3KHHA 2V4JB 5HROA 4J90A 2RHSB 2DXDA 2D1CA 1CQMA 4FYWB 2VQEF 1FQEA 3W8PA 2H25A 4M1VA 1YZ0A 1S6PB 4HL9A 2I9SA 2NXUA 3ZTRA 1WG4A 2FY1A 4NLXA 3OR2A 2ZWOA 1JLBB 3GYYA 2FYXA 3DLEB 3PU5A 5ETQA 3OSRA 3R3TA 3I6PA 3JSRA 4ZPDA 3TOQA 1FPKA 2Q1LA 1XVYA 3KJQB 1EARA 1RLDA 1HR0F 2OTLS 1NZ8A 4U21A 5E0OA 3W64A 4JB7A 4OENA 4YMEA 4LRCA 3UDVA 4G8MA 3EWGA 2HNDB 4ELUA 2PEHA 1XEZA 4Y34A 1XK8A 3G8SA 2DEJA 3MDFA 1YJRA 2QX0A 4O7MA 3OVSA 4D3GA 3OXNA 1X9SA 3CCWA 2MPUA 1I6BA 3PPNA 4NGUA 1WNEA 1J5OA 3HF5A 2THIA 2BOPA 1WC5A 4NTLA 2P9GA 1LBZA 3RYLA 3QRQA 2NR0A 1VYAA 4WJBA 4EBCA 4L3NA 4UOFA 1Q86T 3F73A 5K8OA 3M6UA 4CO4A 4FS1A 1VQ5S 3SDEB 5DZ6A 2PFYA 2LVWA 4RLEA 1NDPA 5EWEA 5CC2A 1XERA 4F36A 2OFHX 3TEPA 2MLXA 1RADB 4LQ3A 4IRKA 2VHGA 1N48A 1LAGE 1TK0A 2HXWA 3M30A 3GR0A 3OHAA 3SKPA 3CJ5A 3DRPA 4S0MA 2WB4A 3WDOA 1IBKF 5I2NB 4OTEA 3PX0A 1U8SA 2QO3A 1TQLA 3NWRA 1VI7A 3HHNB 2O68A 3N5FA 3FBBA 1S1XB 1EX8A 3LC8A 4WFBQ 4JUZA 2YX4A 5BR8J 3MR3A 1W25A 1WI6A 3KK3B 1FTCA 3SZPA 2V2VA 5HAOA 2DY1A 2LFVA 4DSKA 1DTTA 3O6QA 2CIMA 2FDNA 4LQ5A 2DGVA 1X4FA 4V19J 1T11A 2RU9A 1MG1A 1RT6B 4WXWA 1QDUB 3KWMA 1ZMGA 4PXBA 5EYHA 2KM8C 4EBEA 3RBEA 2Z8FA 3L7UA 2K7KA 4RPOA 2IA0A 2DGQA 2G2ZA 3AJ1A 3UK4A 4RU9A 2L9NA 4HH0A 1VC6A 3W3SA 3RAXA 4A46A 3MEEB 3VVDA 2R7TA 2VJUA 2I4BA 2W2PP 1B40A 4PR6A 2DNOA 1MROA 5B0DA 2O51A 1R8PA 1FXDA 4GO5X 3B6QA 4P11A 2CAJA 3BH7B 3QJPA 4NPOA 1UEVA 4RKUC 3TODA 2UUWA 3H5XA 4G8NA 5ETRA 4H5GA 2PMSA 2BE7D 3MM7B 3G2XA 5E5NA 1X4DA 1RWKB 4B3RF 5DDRC 5KFMA 1LFIA 2XWIA 3UDCA 1T94A 3UDLA 4IO7A 3KHRA 2V3UA 1NV3A 4KKOB 3PKMA 4ECYA 2FGCA 1SJ1A 3FCHA 2AHOB 4DDFA 4ECXA 4Q0CA 4F3OA 3KOSA 4MCOA 1Y3PA 1FRMA 2MXYA 4N8GA 2FJAB 2GMLA 3MW0A 4I6YA 2CJKA 3PX6A 3CVKA 2E66A 4ALZA 2EEYA 4C48A 2HRYA 1FQBA 2YPYA 3EX7B 2Y8YA 2EFVA 4NQ8A 2CXEA 1EYIA 2LAOA 2LA6A 1Q78A 2D41A 3DP8A 3QSIA 1K1QA 3TP2A 2D21A 1RWOB 3GIJA 2FHJA 3OLAA 3R6LB 3DELB 3KLHB 4N6KA 1FPFA 2V9KA 2REJA 2I5JB 2KFYA 4LSZB 4KCDA 4C7QA 4R73A 1IXGA 4QWDA 1VQ9S 3IFAA 3H2VE 4K59A 4F2RA 4NLOA 2QS2A 4KH1B 5AA3A 3A1YG 1HIYA 4DFJA 4H45A 2BQRA 1WC3A 4OZ0A 1NNFA 3TFLA 3N28A 4P2SA 3VZHA 4JI5F 3QLHA 3FZVA 4AB5A 1UVLA 2OSQA 4ETZA 4N5SA 2KU7A 1NKEA 1HA1A 4GL0A 1VBKA 4F3QA 1H2UX 4NWCA 1QW0A 1UVKA 1UJ5A 3FEXB 5M2PA 2FIEA 2GZOA 4ND9A 4J9NA 3ZZYA 4DV4F 2CUYA 1DSNA 4KPCA 2LXIA 4JI7F 3BIHA 2V2ZA 4OYPA 2W2NP 3PCOB 4Q43A 4EXLA 1RT3B 2XYPB 1YI2S 5KFEA 1VHFA 2M4MA 1EH3A 3QXMA 5M2UA 1B5JA 3U72A 2GAGC 3DRRA 2RRBA 5KDTB 4POWA 4DR3J 1JJHA 2ESNA 1EP4B 3D28A 5L38A 4QU7A 2DNGA 1B7HA 1LW2A 3A8KA 4PC9A 3SETA 1HQEB 2IM2A 3RRKA 3H4DA 5F8HA 2MZJA 3IWNC 2DXEA 3KLIB 3AXMA 3D0IE 1Y5IB 1VE4A 2MQLA 4DFPA 2DGUA 2RH3A 1DBDA 4Q2MA 4I1TA 2YKNA 1D4NA 3NEKA 3RT8A 4YB7A 1DAXA 5KG2A 2BR0A 3M8UA 2ZH1A 5JJBA 1POTA 1BD6A 4DN9A 5K2YA 1YIJS 1SBPA 4OHWA 2ZKTA 3MEKA 3MM8B 4LF6F 2ZZMA 1NK0A 1ANFA 3HO1A 4B9SA 1LBXA 1RABB 3JQMA 3TDJA 5JXSA 5KOXA 1P1LA 4I67A 1VGYA 1NPKA 2KJVA 3ZZTA 1ELJA 5FHNA 4WYLA 3BQ0A 2JLGA 3DGPA 2AX0A 5T3JA 4R6KA 4DG1B 4JI6F 1RDRA 3R5BA 2Q9TA 3TTLA 2EBGA 3KLVA 2BOAA 4PAKA 4MIWA 4X1BA 5HK4A 2MGZA 2AWZA 1ULRA 4OI4A 1KFSA 4UT4A 4UY85 4HW8A 3LH2S 2OFGX 2ZNUA 4PXDA 1SW1A 5E3AA 1TFDA 3K17A 2OAUA 1SKUB 2WB1D 2MHNA 2HAIA 4PAFA 4F26A 4WYWA 2ZWPA 3MCOA 2RJZA 4FS2A 4IQXA 1HARA 4AQ4A 1K8AT 2UVIA 3KSJA 1DTQB 1YWXA 2V50A 2HAVA 5HN0A 3K2DA 2UXBF 4V19X 3AXKA 3QT6A 3MWBA 4QZVB 1S76D 4L74A 3O2AA 4LRAA 4QWCA 5CCMA 4KYEA 1IBLF 4TQUQ 4YP3A 4HDGA 3RPLA 1Y7PA 2QRRA 4CT9A 4XKQA 1ZOTA 1MY0A 2CZ4A 4JI1J 4E8UA 4ELRA 4QQBA 3H20A 4LP2B 3OFEA 5E7OB 5A8RB 1M1GA 2XY6A 1U1NA 5L1KA 1DURA 1GTHA 4IO4A 1R8AA 1D1UA 2NXEA 3RB0A 3E01B 4P0IA 2XCAA 2EK1A 2XZTB 3E79A 4EYIB 2JLFA 3MM5B 3QPIA 4ZEFA 3ZZ0A 4C97A 3RPWA 3LWLA 4C0RA 2PFZA 2LA4A 4LF1A 4LF5F 2R8IA 2FLOA 2F7CA 1VQNS 2COLA 2OPQA 1NV7A 3FK4A 2C28A 1S5ZA 3I5AA 3RYDA 2XA5A 1IXKA 1CJTB 4O3CA 1VHIA 5GMEA 1YXIA 1AUSL 1R6ZA 2RINA 4OJ1A 3ZZZA 1Q81T 5A0YB 3HJFA 2ZD1A 3MOJB 1FJEB 4ID8A 3MC2A 1R43A 2PMHA 2KVQE 1HBOB 5HQMA 3V81B 3TCGA 3IN5A 5K5MA 4OX6A 5IQQA 2BE9B 4I0WA 2R8HA 4N17A 1MWYA 3QT8A 4DV3J 3A12A 4XFEA 4YU0A 4FPIA 3ZZUA 4YICA 2G93A 1AMFA 2XXIA 2HIQA 3G3IA 3PV8A 2W25A 1NKXA 1N04A 2QLXA 2E1AA 1Y4TA 1S4FA 2C3OA 4ECZA 1CJVB 3T6BA 4BDPA 4KYDA 3CCJS 2UXDF 4FXVA 3MCNA 3OTOJ 3R2DJ 1S1WA 4LSNA 1FFWB 1SKWA 4OJGA 4DQSA 3G71S 5AA2A 2VG6B 1TZ0A 2YLNA 2ZVIA 5DVIA 1FF2A 1YYZA 2UUCJ 4MNPA 4ZDMA 4ZVGA 5KFAA 3W9VA 4JYAJ 2YWKA 1B0TA 3U7JA 3CDBA 1WOSA 1T9YA 1BXNA 5IZZA 3GV5B 5A8WB 3VWSA 1DLOB 5KFZA 2VGQA 2F8DA 4DI6A 4PG8A 5JMNA 1HQUA 4P3LA 1IM4A 4JV0A 1N7WA 3IJOB 4M94A 1M5FA 5L1IA 3MOZA 2FY8A 4YR0A 2WX9A 2BW2A 2GHAA 5EYFA 2XZDB 3IOUA 4RO0A 4X4QA 2NUVA 2G9OA 3PO4A 4USHA 4DU8A 2O69A 3J7Z5 3K57A 3IM8A 3UD4P 2W4DA 4LONB 1KSPA 3SEVA 3AD7C 4PF6A 2YNFA 3GIKA 2CQ1A 1P8GA 1BQNA 2C2DA 4DR6J 2Y9HA 3CJ8A 3IR6B 3CMQA 1KOHA 1RXOB 3MZIA 3FBFA 4PABA 1RT2A 1US4A 1S9FA 2WBDA 2KXFA 2IAJB 5B0FA 2LKZA 3SBMA 2GQ2A 2OH2A 3HHLD 6FD1A 3ZNJ1 4JDFA 4KHRA 1IXIA 3B54A 1RWNB 1N5QA 2BW7A 3BF4A 3D4JA 4L72B 4R5PA 3SEWA 3AOCA 3C6TA 2WEFA 1WEYA 1TL7B 1WORA 3DLNA 1MG7A 2XGPA 1MQGA 4ILLA 1XC9A 1S0OA 5B0AA 3TTKA 4NX1A 1P1TA 4IUFA 4PE3A 1REVA 4XO0A 5KG0A 4BDQA 2QSXA 4GRKA 2IRXA 1C4AA 1JQFA 3TA1A 3HHLB 4LF9F 5I3PA 1QD1A 3D54A 4OHNA 1C0UA 3QIMA 2XM3A 3QYTA 1GV8A 4ZECA 5FTIA 1KKHA 3I87A 4OERA 1FQCA 4B3OA 2BE2B 2QC3A 4MK9A 2D3OR 4OYOA 3P45B 3A29A 4ED5A 2AEMA 4QIVA 2CJXB 2HHQA 3UNGC 2ZM6F 1T3OA 2P6TA 3PIOQ 1U45A 5EHMA 3RTFB 1CEZA 3C32A 3D68A 2KO1A 4ZLLA 2KQZA 3K8VA 1QVFR 3IG1B 4IG3A 5BJRA 5DEXB 2W9CA 2E1MC 4HR2A 3M9MB 4DFMA 4M8LA 4RW9B 1ITPA 1RHUB 4ZLPA 3AJDA 2UU9F 5B0GA 3T0JA 3T22A 2NZCA 4M5DB 1X9MA 2ZHAA 2OTJS 4EU0A 4KIAA 2X1GA 2E7WA 2E1PA 4YQWA 1XIQA 2GIRA 4USIA 4AT1B 2XQCA 4E2FB 1KD1T 3AH6A 1XNRF 3IMQJ 2XSJA 3Q8UA 2MLZA 1BGXT 1T0TV 4NA1A 1N0UA 3T6JA 4EQ7A 4ZK7M 4ZVSB 3TQLA 3G3GA 2HRTA 3O5TB 4IYQA 5A5XB 1YBTA 2E29A 3IS9A 3I55S 3EVWA 1ICEB 1KP6A 2RQ4A 4CLLA 3Q8QB 3HT3A 5J2NA 5C5JA 2QIFA 1ATGA 4Y2MA 3VQSA 4A8OA 4DI3D 4DCOB 3KN3A 3KG4A 3PKYA 3BKFA 4OEUA 4I69A 1REGX 5KFHA 2R2TA 4ED3A 4P9KA 4ZP8A 1R8HA 3IR1A 5DM7Q 3DMJA 3KK1B 2YPNA 2Z58B 4YZZA 3OPKA 1JVXA 3KDNA 2V8HA 4WF9Q 1LK7A 3KJVA 4NWBA 1RBLA 2ILZA 2FVCA 4IDKB 3C33A 2M3DA 2CQHA 3MHYA 4ECQA 3MMCB 1U49A 1Q1KA 2RAQA 2V67A 5I56B 1R1NA 2H51B 1YGYA 5JTYA 4OYIA 2APOA 2DGTA 2GVDB 4OJHA 2Y7KA 3DU6A 2K7JA 5EX0A 4TY8B 2D7SA 1XR6A 2RU3A 3UD5A 1RAOA 2N4CA 4HYKA 1GEHA 3CXCR 2W9BB 5ITHA 4NE4A 3D6FB 3TZYA 2OK2A 2D74B 4IGTA 5K8PA 4OZ3A 4PAAA 4O44A 4XDCA 3CIMA 4JI2F 5D4OA 1NJXA 4OHVA 3TTNA 3FBPA 4DR2F 4NEYA 2G1HA 2QEXS 4BBYA 3BBRA 1X4EA 1Y9UA 4JVCA 1A9NB 1IKVB 1XNQF 1RT5A 3OSQA 3B8HA 3H4BA 3IBCB 3W63A 2ZUGA 3MUQA 4I68A 3PHTA 2XO6A 3WAFA 2DDKA 3OLBA 2QTWA 1NV0A 4J9PA 1UA0A 3M3KA 1PEBA 2ZNZA 3CIZA 4EWTA 2R7UA 2HFUA 4KYZA 1ZTYA 1S99A 1Y20A 1HBMB 4V1Ak 1S9TA 1A55A 1NB7A 3VAJA 3LSFB 1JLFB 2VG5B 3H7MA 1SCJB 3H40A 4Z37A 4X4OA 4HE0A 4KO0B 1LW0B 3T1HF 2RDDA 5KFPA 1IZ1A 3ONMA 5HL7Q 1J2VA 2GMJA 2UVJA 4DL6A 2XLIA 4RA1A 2IEEA 1UIUA 4LRBA 4N13A 5H8NA 2I8EA 3FVYA 4X48A 3AHPA 1SYIA 2ZYKA 2I0XA 2IM1A 4OI1A 3U27A 2ALZA 4XKPA 3LALA 2MKYA 3VDFA 4Q45A 1WC0A 4F3GA 1WHXA 2G13A 2L9DA 4BWJA 3R7BB 4R6YA 1Y3JA 2WKYA 2VPXB 4MYTA 1MS7A 1VISA 2EK6A 3PMXA 4EDPA 1NKCA 3VAHA 2ZBPA 4ED0A 1FKPB 2DXFA 1MH3A 4OWDA 5GMDA 4NI2A 4JI4F 4P9SA 3PRDA 1TFWA 1C1CB 4PFWA 2QV6A 3GJQB 2RF2B 1HBUB 1BLUA 3T9UA 1N34F 1VRUB 4DF4A 2E44A 3JS9A 1TFYA 1NRKA 2CWXA 3ILLA 2F5GA 5C7PA 2HHMA 2EWHA 2PA3A 3IRXA 1N0TA 2XLJA 1FQDA 5L46A 3R27A 1L5TA 4RPFA 3G3FA 1UCNA 4KT0C 2AKWB 2OPPA 2VH7A 2MQNA 2BJ7A 2DWIA 3D3CJ 4FAJA 1N5VA 1AFIA 2EFPA 2QA2A 5KG6A 1VLYA 3IFCA 3W65A 4ZCMA 4CYUB 3GQCA 5D3GB 1ZM2A 5AT1B 2XXHA 4O0NA 1JX4A 3CJ0A 3V8XB 3THVA 2O1MA 2GFEA 3FVOA 4X04A 2CFXA 2C3MA 3PY8A 1N6QB 3FEYB 4NLVA 4GO7X 4PXEA 2CDQA 4JI3F 1WWHA 1EZOA 1OIAA 2ZYOA 2KB2A 5F8GA 1YBUA 1S6QA 3FBEA 4P52A 3FJGA 4N56A 2B51A 2U1AA 4ZP7A 1Q8KA 4LF2A 1YK9A 2ZC3A 2H3EB 4J9RA 2OPRA 1SJ4P 2OCUA 3K7RA 3CULA 3TAPA 5ESYA 3SI8A 3KLEB 4NMLA 3U94A 1X4HA 5G0RA 4NASA 3K5NA 3HSZA 3NS5A 4RU2A 3K0VA 3VLUA 3PW7A 2EW9A 3G96A 1O63A 2DRBA 1RDYA 3DXBA 4R9FA 2QS1A 2AU0A 3RW6A 1FRHA 2HS3A 3CJ2A 5L9OA 4LJMA 3HP6A 3VGTA 1QAYA 1H74A 3RBDA 4NLUA 4N8NA 1SC6A 2KFZA 2VC0A 1RAHB 4X4RA 3MR7A 4X65F 1B3FA 1JLQB 4M4GA 4PRFA 4Y28C 2VONA 3OO9A 3JYTA 3BSOA 5FHMA 5EYGA 4B9LA 5J2MA 3LBSA 1S77D 5KFSA 1R9QA 3E9XA 2HFZA 3HHFA 1VQSA 1M90T 4XPEA 4NF6B 3PW4A 4J9OA 3G87A