1D9VA

Haemophilus influenzae ferric-binding protein apo form
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
309
structure length
309
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PROTEIN (iron-utilization periplasmic protein)
publication title Crystallographic and biochemical analyses of the metal-free Haemophilus influenzae Fe3+-binding protein.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 115
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 1999-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1d9vA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1d9vA01
1R6ZA 2HZLA 2FYIA 2I49A 3T9XB 3F11A 2Q89A 2F34A 2ONRA 2HEUA 3EN3A 2RCBA 3FJ7A 3FIRA 1P1QA 2REJA 3FXQA 3MP6A 1HSLA 2OWSA 3CFZA 2NUVA 3FZVA 4NMYA 1YTVA 2XXRA 3IOWA 3IORA 1BP5A 2GRVA 2HXWA 1B1XA 4EQ7A 1ZIUA 4NEDA 4FE8A 5KCJA 2XXXA 4ZDMA 4AB5A 2RC8A 2DE3A 2DQVA 1VFDA 2I0CA 4NTLA 4R9FA 3H3GA 1IXCA 1MPDA 3MVZA 3OXNA 3A09A 1VR5A 3G3IA 4I1DA 5CBSA 3EF7A 4H5FA 2ZNSA 3VE1B 3S9MC 3TUSA 3PD8A 3ECRA 3QUFA 3QXMA 1PB7A 3TTNA 4QF9A 1MRPA 3V5AA 3M3FA 3FVGA 4FORA 4DXBA 4WEDA 3MQ9A 4NF8B 3SDFA 5CBRA 4LONB 4M4GA 1BKAA 4I9DA 1URGA 3W9VA 5ITOA 3H7MA 1SI1A 4THIA 5I2KA 4DCYA 2Z8EA 1MY2A 1MXWA 4Q8RA 4KYSA 2OWTA 4GL0A 4IO6A 5H8HA 3WAFA 4OXVA 1O64A 3QIMA 4FEDA 1FTOA 4PE5B 1NNFA 2CZLA 4QFOA 3I6VA 4WXJA 3VXCA 1UQWA 1QUJA 1B05A 3RT8A 1R9QA 1XHYA 1LFIA 1QUIA 4F3GA 3U93A 5CMBA 4ISUA 1PDAA 4U22A 3MP1A 4IO5A 3UORA 3IX1A 2DS9A 1HSJA 4RYAA 3K6WA 1DTGA 2RKMA 4LVQA 2PMSA 1EH3A 3LC8A 3KSJA 3W15C 1PB9A 3CSBA 1FQDA 4POWA 3PUVE 3D4CA 1NKXA 2NXOA 1PBPA 2AL4A 3MVXA 4E0XA 4PETA 4G8MA 4X48A 2Q88A 3AXFA 1IITA 2OLBA 4MLVA 1SW4A 2V3TA 2RCAA 3T66A 4GFRA 2GH9A 5CC2A 1J1NA 1WODA 3EHSA 4HCYA 4P0IA 1MS7A 4PQJA 1FTKA 4NF6A 3KJ7A 3B7DA 3CG3A 4DDDA 3RPWA 2UVHA 1Q35A 3OELA 3TFLA 4K3FA 2XX9A 2DE4A 3VXBA 1LFGA 3FD3A 2I58A 3H6VA 1LLSA 3OEKA 1OLCA 3O66A 1FQAA 1NNTA 3ILTB 4BDMA 5JK4A 4BDNA 2OJTA 5B7DA 3IOVA 5KDTB 3SESA 2HAVA 4OYVA 2GHBA 4YB5A 5DTBA 3IOTA 4PFTA 4RK9A 2XXYA 3Q29A 4FJPA 4RNSA 4EQBA 2UVGA 3Q25A 3CIJA 3T9UA 1Y3QA 2V25A 4BDQA 4IO7A 2QJEA 4Q5TA 4O3BA 1QKAA 4ELRA 1NFTA 4U4SA 5FHMA 5TP9B 2XXIA 1MQDA 2ANJA 1MXYA 1M5DA 1Y4CA 3R26A 1H44A 2DVCA 1QVSA 3D4GA 2V3UA 1UTHA 5TPAA 5BUUA 1SBPA 3C4MA 4KHZE 3E9XA 5I59A 5BWJA 1MQIA 3KBRA 4F18A 2PT2A 1OQGA 2UYFA 1NNPA 4GOTA 2FA7A 5H8QB 5FHOA 3VFJA 2VGQA 1LB8A 2E0SA 5ELVA 1LAGE 5M2VA 3PPOA 1URSA 3TEPA 2F8DA 4GVOA 3GLBA 2ALUA 4EUOA 4AQ4A 2YLNA 3FXUA 3LSLA 1A8FA 3RGYA 1SW5A 3MZ9A 1B7UA 1D4NA 3VLWA 3MPLA 5DVFA 2Y84A 1BIYA 1A54A 4NWCA 2F97A 4DXCA 4ZECA 4FAJA 4GWOA 4QFNA 1Y3PA 4IGRA 4RJZA 3ONMA 4OMBA 2QRYA 4DZ1A 3CFXA 5LOMA 1B4ZA 1FW0A 1N0TA 3T93B 2B3FA 4JWXA 2ONKE 4KYEA 2DXRA 3JYRA 4LZ8A 3C9HA 4ZZAA 3IK6B 3PUXE 1VSOA 4LA9A 4H67A 4NE4A 1POTA 3IL1B 3CRBA 3GBAA 2QS4A 1M5FA 2RINA 1AOVA 2R71A 4G4PA 1S9TA 1SD3A 3PPRA 3M3KA 3RQTA 4KCCA 1SI0A 4U21A 1VE4A 3VLVA 1B52A 4JB7A 3GBBA 2O1MA 1NH8A 2ZYKA 3HN0A 3ZSFA 1FQFA 2H5YA 2A5TA 3OMBA 1TXFA 5FTIA 3K6UA 1MH3A 2XHDA 4OEUA 3USDA 1N84A 4YICA 5ISUA 4BDLA 3MUQA 4MF3A 1HSEA 3I5OA 4GQOA 3VVFA 3ODBA 2OBGA 4I8CA 1SW1A 4O3CA 4IO2A 4RPNA 4OFOA 1OLAA 1ZTYA 5B70A 1R9LA 4F1VA 2ZYMA 4QRZA 3OSQA 3ZKKA 4NWDA 4GIZA 4F3BA 1MY0A 1P1OA 1I69A 4R74A 1RYXA 1Y20A 1AIVA 3KFMA 5AA2D 3Q27A 1A99A 2QS3A 1B5HA 3O6IA 1WDNA 3KN3A 4UA8A 3VVEA 1LBBA 3K0VA 1Q1KA 1JVXA 2QS1A 2G29A 2ZNTA 4ECFA 1SW2A 5A5XB 3PUZE 4ELOA 1B51A 1S7YA 4QSEA 2OCUA 3PGFA 1B46A 4XKQA 4YKPA 3T9HB 3G3HA 4OHNA 2Y7KA 2XXHA 3RTFB 3O6GA 1T0KA 2O68A 4ELPA 4JDFA 3DP8A 1MY1A 4WEPA 3K4UA 1ANFA 3U72A 3L6GA 4GD5A 4UACA 4ZS9A 3DELB 1JNFA 5TU0A 4R2BA 3S2VA 1H43A 3SKPA 1IXGA 5HM4B 3HV1A 2QS2A 1Y3NA 1MG1A 3GXAA 1QUKA 2XD2A 1B0HA 5HPQA 3UK4A 2PX1A 2XXUA 3R6UA 4OVJA 1ZJLA 4QFLA 2HFBA 4HS7A 4DXUA 5DEXA 2PT1A 5KCJB 3H6TA 3TZAA 2DYXA 4EXKA 4NF5A 3JZJA 1AL3A 3C32A 2I3WA 3TCGA 4OFJA 4XXUA 2PBWA 1Y4TA 1NMUA 3FJMA 5EHMA 3BFUA 3IB2A 4FIMA 4IY6A 3OSRA 2F6GA 3RN8A 3G3FA 1Z7ME 3SETA 4HCWA 2P0SA 3BKIB 1POY1 1B3EA 1ZBMA 1MXZA 5I58A 3IO6A 1GVCA 4EQ9A 5JEIA 4ZE8A 3W9WA 1N04A 5I2NA 4ZEIA 2OK2A 1JW1A 4YB6A 1I6QA 4ZEDA 3A3CA 4NF4A 3U1OA 2HCAA 3KG2A 4TLLB 3H06B 2OZZA 5I2KB 5I2NB 2H99A 3K6VA 2DXYA 4YMAA 2DSFA 4JXIA 4AB6A 3MBPA 5H8HB 3MW0A 3RLFE 3C36A 3CFLA 1AMFA 5F1QA 1CE2A 1O7TA 3O6HA 2REGA 2F5XA 2DE2A 3CG1A 1FQEA 4H6DA 4JBZA 4EF1A 1MQJA 1ZU0A 1B32A 4U4XA 2NVUB 1JEUA 4LUBA 4M1VA 3KJTA 3LSXA 2XX8A 2F6PA 2F7BA 1B6HA 2DWJA 3TCFA 3CSGA 4QHQA 1UTBA 3UN6A 1FCKA 3KN7A 4XIGQ 2ABHA 4N07A 3TQLA 3KOTA 3TODA 3IJXB 3S9EA 3L6HA 3T9VA 5L9MA 4Q0CA 3EHTA 1UTBB 4GF8A 2XD3A 3OO7A 4OESA 5I56A 1B40A 4NF6B 3IAZA 4H65A 4OFLA 4PFYA 3QK6A 1YAEA 3TMGA 1MDP1 3TTLA 4R73A 1RYOA 3FJGA 4G68A 1PBQA 1RKMA 4LZ7A 4FEBA 3HSTA 1IEJA 4H8IA 1B3GA 3BFTA 3KEIA 1B3HA 3B6WA 4U23A 5AA4A 2Y7PA 1EZPA 3N6TA 5H8FA 1F9BA 3LR1A 2QMWA 3PD9A 4R2FA 3IB0A 3MPKA 1TT1A 2F36A 5I57A 2VHAA 3UA8A 4JWOA 2UYEA 1CB6A 4X1BA 2O6AA 3PU5A 4E0WA 2H9BA 3S9NC 1IXIA 1SVXB 4LP2B 3VLUA 5CMKA 5I57B 1MXXA 2O69A 1XT8A 4F2OA 1JW4A 4BLAA 4R72A 2QMXA 2NWJA 1UTHB 5TPAB 2UVJA 2IA4A 1NNKA 1Z7NE 4O3AA 3M8UA 4XTCQ 2UVIA 5I59B 3EQ1A 1US4A 1URDA 2O7IA 4Z0IA 4MBPA 4LQ2A 1MPCA 3PMWA 4IB2A 1Y9UA 3O29A 2Q2CA 1B3LA 3HPIA 3FUZA 1JW5A 2DP8A 4MFIA 4WKMA 5IKBA 3IOUA 2RC7A 2VD3A 2XXTA 1EZ9A 4YB7A 3OO6A 3SEUA 1TWYA 4G8HA 1SDXA 3C31A 4C0RA 4X9TA 1JVYA 1XVYA 3PPQA 4ZEKA 4YZZA 1O63A 3GZGA 4Z7EA 2QPQA 1B1HA 3OEMA 4F31B 1N3WA 1GR2A 4F29A 2ZXTA 3SERA 2A5SA 4P11A 1XS5A 1R1NA 1WVJA 3I3VA 4JSDA 1IIWA 4F1UA 3N94A 4BDRA 3TDJA 5DVIA 2PYYA 4YKJA 2CMOA 2QL3A 2H98A 1NH7A 2DOJA 2ZYNA 2ZYOA 4XKRA 1MM7A 4H1XA 3V83A 3EHUA 4R6KA 4EXLA 3HHFA 3C34A 1LAFE 1N7XA 4IO3A 3O28A 4TOZA 3K1NA 3HHGA 1MM6A 4PFWA 4IO4A 4DIGA 4IGTA 4QFPA 4U1OA 4DE8A 3KOSA 2DWAA 5EHSA 1M5EA 3MZBA 2AL5A 1FTMA 4RY1A 2A5TB 1A8EA 1YCJA 4R6HA 1NL5A 3E3KA 1DPPA 3OO9A 4OETA 4OTEA 3SEVA 5CMMA 3LSWA 4XKNA 1FQCA 4KQPA 3FV1A 1LCTA 3T22A 1JEVA 2Y7RA 3QAXA 4F3PA 3MWBA 4OENA 4GXSB 1JQFA 2Z8FA 2AYSA 4G8NA 4C1UA 3RTWB 4ONYA 4F2QA 3TCHA 4EF2A 2O7UA 5DT6A 3LUYA 1ZLQA 5K2YA 3DM0A 2THIA 5JTYA 3MJNA 1B58A 2Z8DA 1ZMGA 4N6PA 2F35A 3O9PA 1USYH 4OERA 1II5A 4KCDA 3FV2A 1N76A 2Z23A 2RF1A 4MH5A 3Q28A 3QUJA 4YKKA 1TFAA 5F7VA 2DWIA 5JTYB 3RT6B 4OWDA 4BDOA 2B3BA 4PFUA 5ICTA 4YU0A 2KLFA 2Q9TA 3MZ1A 3T96B 5DYHA 5HBCA 1PC3A 2HAUA 1SYHA 2F78A 3MVYA 1FQBA 4FECA 2H4IA 1QW0A 4FATA 4RPOA 3K1PA 4GLIA 4H5GA 2Q8JA 1M5CA 3S4UA 3G7WA 1MPBA 1LB9A 1MXUA 1A55A 3PPNA 3A3UA 2P1SA 2GHAA 3K01A 5J1DA 3G3GA 2H25A 4NF8A 3DLNA 5DEXB 4ESXA 1EZOA 3CVGA 2Z22A 3KGCA 4NF5B 1A40A 4DLDA 4EDPA 3FGSA 2BJJX 2DVZA 1B4HA 1H3DA 5AA1A 4KPTA 4KI0E 1OMPA 3V89B 3K00A 3B6TA 1IQ7A 3DP4A 3MVWA 1L5TA 2O51A 4G77A 1B0LA 2XXWA 1P1WA 3UGWA 5I58B 4C1TA 5ICQA 1GV8A 2FNCA 2M8CA 5H8SA 1P1NA 1B7HA 4G68C 1KWHA 5ITPA 2W7YA 2ESNA 3LSFB 2Y7WA 4NF4B 3PUYE 3KZGA 5AA3A 2D21A 1S50A 4TQUQ 3QSLA 3PUWE 4TLMB 4ZEFA 4F19A 2UXAA 2VD2A 3MC2A 4H0WA 3TPAA 3TKDA 4OZ9A 4ZEBA 3FVOA 1LGBC 3P7IA 4YMBA 1XVXA 4G2ZA 5CI5A 4R9GA 2F7AA 1OVBA 2XXPA 4GXAA 4R6YA 4QSDA 2I4CA 1ZKBA 3UIFA 1MY4A 5K2XA 3TAJA 1SQYA 3DP6A 1MQGA 4JWYA 3U8QA 1LBCA 3TTMA 3HCQA 3TTRA 2HQ0A 2XXQA 5EYFA 3BBRA 2ZMBA 1DTZA 4KYDA 3VV5A 2E1SA 3H4ZA 5KDTA 3PMXA 1N7WA 4I62A 1I6AA 3ZS6A 3MAMA 3RNNA 3THIA 2XX7A 5L8DA 4XKPA 1B5JA 2I4BA 5I56B 4X1DA 4HTGA 5CM6A 5FTHA 3C33A 3V8XB 3QYTA 4N13A 5TP9A 3HO7A 3SEXA 4HW8A 2XXVA 2RC9A 1I6BA 4G68B 1OQHA 2AIXA 3OOAA 3VDFA 4ND9A 2GFEA 2O1LA 2IEEA 1DOTA 5AA4B 2R9JA 2YJPA 3IB1A 3Q26A 3E13X 2Q2AA 4RK2A 1BTJA 2QSXA 5H8FB 1UIVA 5CRYA 5FHNA 4POXA 3FVKA 1Y1MA 3K6XA 4QSCA 5KZTA 3M3LA 3PMVA 1B5IA 1AH5A 4F1YA 3O97A 5AA2A 5H8QA 3TQWA 1FTJA 2V93A 1P99A 3WAEA 1YPNA 4JSOA 3SEWA 3H6UA 3FASA 4LZ5A 1MDQA 1QULA 1PEBA 4MLQA 4H8JA 1MY3A 5AA2B 1QJMA 1OIBA 4RA1A 1D9YA 3IR1A 4F3SA 1LFHA 1B9JA 1UIUA 1P1UA 3OD7A 4KFQA 1BLFA 3N6UA 5L9OA 1FTLA 1QKBA 1USYE 4DCXA 4LQ5A 1US5A 4LATA 2LAOA 3UP9A 2VP1A 3N5LA 4KD5A 3ZKLA 2ZNUA 1D9VA 3U94A 2P2AA 4QFKA 3TTKA 1B7ZA 4F39A 1IUDA 3PV0E 1M5BA 1LSTA 2F7CA 1ELJA 1LAHE 3RY3A 3VVDA 1DPEA 1XC1A 1IXHA 3CR9A 1MH4A 1LAXA 3S9LC 4KR5A 2I48A 4ZZEA 1GGGA 3N26A 3TYHA 1EU8A 4ZE9A 2D3IA 1IZ1A 3U92A 1DMBA 2X26A 1H76A 3LBSA 1B2HA 5L9SA 4R75A 3MP8A 2NOOA 1GTKA 3TELA 4U1ZA 1VFEA 3ILUB 2I6EA 1MXVA 2DWHA 2HZKA 4F22A 4U2RA 3KSXA 4GRKA 3K2DA 2I0BA 1D3KA 3R7XA 2YPNA 4OEVA 4Q30B 5CMCA 3OENA 2B65A 3JV9A 2VOZA 1OVTA 4YAHX 3K1MA 3K02A 3EPEA 1B3FA 1MQHA 2ONSA 1JETA 3H03A 3OO8A 3FATA 1DSNA 4IY5A 5IAIA 4L17A 2PVUA 2V3QA 3FXRA 1H45A 2R6GE 2V84A 4PP0A 3IJOB 3O2AA 1SYIA 4OQOA 1ATGA 3CI8A 4GL8A 3IO4A 3E4RA 1A7LA 3SEYA 2X7QA 3FVNA 5AE4A 3G3JA 2G93A 2I3VA 5H8NA 5A5XA 1LCFA 3H6WA 3RUMA 4P0GA 4ESWA 4YKIA 2O84X 1PB8A 2WKYA 1N3XA 1TFDA 3G3KA 2Y7IA 5I84A 1XOCA 5H8NB 3C35A 2X7PA 5DVJA 1Y1ZA 3PPPA 2D5WA 3B6QA 3KN8A 4RXLA 4ELQA
chains in the Genus database with same CATH superfamily
1R6ZA 2HZLA 2FYIA 5I3SA 2I49A 3T9XB 3F11A 2Q89A 2F34A 2ONRA 2HHMA 2HEUA 3EN3A 2RCBA 3FJ7A 3FIRA 1P1QA 2REJA 3FXQA 3MP6A 1HSLA 2OWSA 3CFZA 2NUVA 3FZVA 4NMYA 1YTVA 2XXRA 3IOWA 3IORA 1BP5A 2GRVA 4PFIA 5ET7A 2HXWA 1B1XA 4N15A 4EQ7A 1ZIUA 4NEDA 4FE8A 5KCJA 4I3YA 2XXXA 4ZDMA 4AB5A 2RC8A 2DE3A 2DQVA 1VFDA 2I0CA 4NTLA 4R9FA 3H3GA 1IXCA 1MPDA 3MVZA 3OXNA 3A09A 1VR5A 3G3IA 4I1DA 5CBSA 3EF7A 4H5FA 2ZNSA 3VE1B 3S9MC 3TUSA 3PD8A 1QGXA 3ECRA 3QUFA 3QXMA 1PB7A 3TTNA 4QF9A 1MRPA 3V5AA 3M3FA 3FVGA 4FORA 4DXBA 4WEDA 3MQ9A 4NF8B 3SDFA 5CBRA 4LONB 4M4GA 1BKAA 4I9DA 4H45A 1URGA 3NOHA 3W9VA 5ITOA 3H7MA 1SI1A 4THIA 5I2KA 4DCYA 2Z8EA 1MY2A 5EQ8A 1MXWA 4Q8RA 4GWWA 4KYSA 2OWTA 4GL0A 4IO6A 5H8HA 3WAFA 4OXVA 1O64A 3QIMA 4P3LA 4FEDA 5A5LA 2Y5KA 1FTOA 4PE5B 1NNFA 2CZLA 4QFOA 3I6VA 4WXJA 3VXCA 1UQWA 1LBVA 1QUJA 1B05A 3RT8A 1R9QA 1XHYA 1LFIA 1QUIA 4F3GA 2MKZA 3T0JA 3U93A 5CMBA 4N6KA 4ISUA 1PDAA 2PFZA 4U22A 3MP1A 4IO5A 3RYDA 3UORA 4OVPA 3IX1A 2DS9A 1HSJA 4RYAA 3K6WA 1DTGA 2RKMA 4LVQA 2PMSA 1EH3A 3LC8A 3KSJA 3W15C 1PB9A 3CSBA 1FQDA 4POWA 3PUVE 3D4CA 1NKXA 2NXOA 1PBPA 2AL4A 3MVXA 4E0XA 4PETA 4G8MA 4X48A 4P8BA 1NV1A 1D9QA 1NV7A 2Q88A 3AXFA 1IITA 2OLBA 4MLVA 1SW4A 2V3TA 2RCAA 3T66A 4GFRA 2GH9A 5CC2A 1J1NA 1WODA 3EHSA 4PGNA 4NHBA 4HCYA 4P0IA 1MS7A 3EKIA 4PQJA 4MMPA 2VT5A 1FTKA 4NF6A 3KJ7A 4HXVA 3B7DA 3CG3A 4DDDA 3RPWA 2UVHA 1Q35A 3OELA 3TFLA 4K3FA 2XX9A 2DE4A 3VXBA 1LFGA 3FD3A 2I58A 3H6VA 1LLSA 3OEKA 1OLCA 3O66A 1FQAA 1NNTA 3ILTB 4BDMA 5JK4A 4BDNA 2OJTA 5B7DA 3D1RA 3IOVA 1IMAA 5KDTB 3SESA 3B8BA 2HAVA 3BIHA 4OYVA 2GHBA 4YB5A 5DTBA 3IOTA 4PFTA 4RK9A 1NV6A 5EQAA 2XWVA 2XXYA 3ISPA 4MX6A 3Q29A 4FJPA 4RNSA 4EQBA 2UVGA 3Q25A 3CIJA 3T9UA 1Y3QA 2V25A 4BDQA 4IO7A 2QJEA 4Q5TA 4O3BA 1QKAA 2WYPA 4IR8A 4ELRA 1FPBA 2WEFA 4N17A 1NFTA 4U4SA 5FHMA 5TP9B 2XXIA 1MQDA 2ANJA 1MXYA 1M5DA 1Y4CA 3R26A 1H44A 2DVCA 1QVSA 3D4GA 2V3UA 1UTHA 5TPAA 5BUUA 4P47A 1SBPA 2ZZXA 1IMCA 3C4MA 4MIJA 4KHZE 3E9XA 1IMDA 5I59A 5BWJA 1MQIA 3KBRA 4F18A 2PT2A 1OQGA 2JJKA 4PTKA 2UYFA 1NNPA 4GOTA 2FA7A 5H8QB 5FHOA 3VFJA 2VGQA 1LB8A 1FJ9A 2E0SA 5ELVA 1LAGE 5M2VA 2BJIA 1NI9A 3PPOA 1URSA 3TEPA 2F8DA 4GVOA 4NG7A 3GLBA 2ALUA 4EUOA 4AQ4A 2YLNA 1JP4A 2QFLA 3FXUA 3LSLA 1A8FA 3RGYA 1SW5A 3MZ9A 1B7UA 1D4NA 3VLWA 3MPLA 4NN3A 5DVFA 2Y84A 1FRPA 1BIYA 1A54A 4NWCA 1NUXA 2F97A 4DXCA 2WBDA 4ZECA 4FAJA 4GWOA 4QFNA 1DK4A 1Y3PA 4IGRA 4GBWA 4RJZA 1RDYA 3ONMA 4HE1A 4OMBA 2QRYA 3QMFA 4MAGA 4OVTA 4DZ1A 3CFXA 5LOMA 1B4ZA 1FW0A 1N0TA 3T93B 2B3FA 4JWXA 2ONKE 4KYEA 2DXRA 3JYRA 4LZ8A 5IZ3A 3C9HA 4ZZAA 3IK6B 3PUXE 2FBPA 5ET5A 1VSOA 4LA9A 4OVSA 4H67A 4NE4A 1POTA 3IL1B 3CRBA 3GBAA 2QS4A 1M5FA 2RINA 1AOVA 2R71A 4G4PA 4GWZA 1S9TA 4JVIA 1SD3A 4XFEA 2VPOA 3PPRA 3M3KA 3RQTA 4KCCA 1SI0A 4U21A 4N91A 1VE4A 3VLVA 1B52A 4JB7A 1FPFA 3GBBA 2O1MA 1NH8A 2ZYKA 3HN0A 4O7MA 3ZSFA 1FQFA 2H5YA 2A5TA 5LDZA 3OMBA 1TXFA 5FTIA 3K6UA 1MH3A 2XHDA 4OEUA 3USDA 1N84A 4YICA 5ISUA 1FBEA 4BDLA 1FJ6A 3MUQA 4MF3A 1HSEA 3I5OA 4GQOA 5IZZA 3VVFA 3ODBA 2OBGA 4I8CA 3KC1A 1SW1A 4O3CA 4UABA 3RPLA 4IO2A 4RPNA 4OFOA 1OLAA 3FXBA 1ZTYA 5B70A 1R9LA 4F1VA 2ZYMA 4QRZA 3OSQA 3ZKKA 4NWDA 4GIZA 4F3BA 1MY0A 1P1OA 2ZZWA 1I69A 4R74A 1RYXA 1Y20A 1AIVA 4HE0A 3KFMA 5AA2D 3Q27A 1A99A 2FIEA 2QS3A 1B5HA 3O6IA 1WDNA 3KN3A 4UA8A 3VVEA 1LBBA 3K0VA 1Q1KA 1JVXA 2QS1A 2G29A 2ZNTA 4ECFA 1SW2A 5A5XB 3PUZE 4ELOA 1B51A 1S7YA 1RDXA 4QSEA 2OCUA 2L5VA 3PGFA 1B46A 4XKQA 4YKPA 3T9HB 3G3HA 4OHNA 2Y7KA 2XXHA 3RTFB 3O6GA 1T0KA 2O68A 4ELPA 4JDFA 3DP8A 4GWSA 1MY1A 3U65A 4WEPA 4JVDA 3K4UA 1ANFA 4N8YA 5ESYA 3U72A 3L6GA 3PTYA 4GD5A 4UACA 4ZS9A 3DELB 1JNFA 4GWYA 5TU0A 4R2BA 2XWIA 3S2VA 1H43A 3SKPA 1IXGA 5HM4B 3HV1A 2QS2A 1Y3NA 1MG1A 3GXAA 1QUKA 2XD2A 1B0HA 2XWKA 5HPQA 3UK4A 2PX1A 1G0HA 2XXUA 3T1BA 3R6UA 4OVJA 2F3DA 1ZJLA 4QFLA 2HFBA 1CNQA 4HS7A 1AWBA 4DXUA 5DEXA 2PT1A 5KCJB 3H6TA 3TZAA 2DYXA 4EXKA 4NF5A 3JZJA 1AL3A 3C32A 5ET8A 2R8TA 2I3WA 3TCGA 4OFJA 4XXUA 2PBWA 1Y4TA 1NMUA 3FJMA 5EHMA 4N81A 3BFUA 3IB2A 4FIMA 4IY6A 3OSRA 2F6GA 3RN8A 2XA5A 3G3FA 1Z7ME 3SETA 4HCWA 2P0SA 3BKIB 4NX1A 1POY1 1B3EA 1ZBMA 1MXZA 5I58A 3IO6A 1GVCA 4GWUA 4EQ9A 1FSAA 4ZE8A 5JEIA 3W9WA 1N04A 5I2NA 4MNIA 2QVRA 4ZEIA 2OK2A 1JW1A 4YB6A 4MCOA 1I6QA 1EYIA 4ZEDA 3A3CA 4NF4A 3U1OA 4DI4B 2HCAA 3KG2A 3LV0A 4GX3A 4TLLB 1EYJA 3H06B 2OZZA 5I2KB 5I2NB 2H99A 3K6VA 2DXYA 4YMAA 2DSFA 4JXIA 4AB6A 3MBPA 5H8HB 3MW0A 3RLFE 5EYGA 2Q8MA 3C36A 3CFLA 5EYHA 2OX3A 1AMFA 5F1QA 1CE2A 1O7TA 3O6HA 2REGA 2F5XA 2DE2A 3CG1A 1LBXA 1FQEA 4H6DA 4JBZA 4EF1A 1MQJA 1ZU0A 1K9ZA 2B4MA 2XXKA 1B32A 4U4XA 2NVUB 1JEUA 4LUBA 4M1VA 3KJTA 3LSXA 3CHGA 2XX8A 3A29A 1K9YA 2F6PA 2F7BA 1YXIA 1B6HA 2DWJA 3TCFA 3CSGA 4QHQA 1UTBA 5EQ7A 3UN6A 1FCKA 2CZKA 3KN7A 4XIGQ 2ABHA 3IFAA 4N07A 3TQLA 2KQZA 3KOTA 3TODA 3IJXB 3S9EA 3L6HA 3T9VA 5L9MA 4Q0CA 3EHTA 1UTBB 4GF8A 2XD3A 3OO7A 4OESA 5I56A 1B40A 4NF6B 3IAZA 4H65A 1FPDA 4OFLA 4PFYA 3QK6A 1YAEA 3TMGA 1MDP1 3TTLA 4R73A 1RYOA 3FJGA 4G68A 1PBQA 1RKMA 4LZ7A 4FEBA 3HSTA 1IEJA 4G61A 4H8IA 1B3GA 3BFTA 3KEIA 1B3HA 3B6WA 4U23A 5AA4A 2Y7PA 1EZPA 3N6TA 5H8FA 1F9BA 3LR1A 2Q74A 2QMWA 5IZ1A 3PD9A 4NQ8A 4R2FA 3IB0A 3MPKA 1TT1A 2F36A 5I57A 2VHAA 3UA8A 4JWOA 2UYEA 1CB6A 4X1BA 2O6AA 3PU5A 4E0WA 1YZ0A 2H9BA 3S9NC 3MYUA 1IXIA 2PFYA 1SVXB 4LP2B 3VLUA 5CMKA 1FTAA 3E78A 5I57B 1MXXA 2O69A 1XT8A 4F2OA 1JW4A 4BLAA 4R72A 4QXDA 2QMXA 2NWJA 1UTHB 5TPAB 2UVJA 2IA4A 3E79A 1NNKA 1Z7NE 4O3AA 3M8UA 4XTCQ 2UVIA 5I59B 3EQ1A 1US4A 1URDA 2O7IA 4Z0IA 1XI6A 4MBPA 4LQ2A 1MPCA 3PMWA 4GX4A 4IB2A 1Y9UA 3O29A 3IFCA 2Q2CA 1B3LA 4FBPA 3HPIA 3FUZA 1JW5A 2DP8A 4MFIA 4WKMA 5IKBA 3IOUA 2RC7A 1FBGA 2VD3A 2XXTA 1NV2A 4MNCA 1EZ9A 4YB7A 3OO6A 3SEUA 1TWYA 4G8HA 1SDXA 3C31A 4C0RA 4X9TA 1JVYA 1XVYA 3PPQA 4ZEKA 4YZZA 1O63A 3GZGA 4KXPA 4Z7EA 2QPQA 1B1HA 3OEMA 4F31B 4PC9A 2B4LA 1N3WA 1FBDA 1GR2A 3KC0A 4PFBA 4F29A 2ZXTA 3SERA 2A5SA 4P11A 1XS5A 1R1NA 2FVZA 1WVJA 3I3VA 4JSDA 1IIWA 4F1UA 3N94A 4BDRA 3TDJA 5DVIA 2PYYA 4P1LA 4YKJA 2CMOA 5IZ3B 2QL3A 2H98A 1NH7A 2DOJA 2ZYNA 2HPGA 1VDWA 2ZYOA 4XKRA 1MM7A 4H1XA 3V83A 3EHUA 4R6KA 4EXLA 3HHFA 3C34A 1LAFE 1N7XA 4IO3A 3O28A 4TOZA 3K1NA 3HHGA 1MM6A 4PFWA 4X04A 4IO4A 4DIGA 4IGTA 4QFPA 4U1OA 4DE8A 1RDZA 2DWAA 3KOSA 5EHSA 1M5EA 3MZBA 2AL5A 1FTMA 4RY1A 4XF5A 2A5TB 2QVUA 1A8EA 1YCJA 4PAIA 4R6HA 1FPLA 1NL5A 3E3KA 1DPPA 3OO9A 4OETA 4OTEA 3SEVA 5CMMA 3LSWA 4XKNA 1EYKA 1FQCA 4KQPA 3FV1A 1LCTA 3T22A 1JEVA 3RPLB 2KR0A 2Y7RA 1FPEA 3QAXA 4F3PA 3MWBA 1LEVA 4OENA 4GXSB 5I7IA 1JQFA 2WBBA 2Z8FA 2AYSA 4G8NA 4C1UA 3RTWB 1DCUA 4ONYA 4P1EA 4F2QA 3TCHA 4EF2A 1KA0A 2O7UA 5DT6A 1NUYA 3LUYA 1ZLQA 5K2YA 3DM0A 2THIA 5JTYA 3MJNA 1B58A 2Z8DA 1ZMGA 4N6PA 2F35A 5DW8A 2ZZVA 3O9PA 1USYH 4OERA 1SPIA 2P3VA 1II5A 4PAFA 4KCDA 3FV2A 3HFUA 1N76A 2Z23A 2RF1A 4MH5A 3Q28A 3QUJA 4YKKA 1TFAA 5F7VA 2DWIA 5JTYB 3RT6B 4OWDA 4BDOA 2B3BA 4PFUA 5ICTA 4YU0A 2KLFA 2Q9TA 4N6DA 2HXRA 3MZ1A 3T96B 5DYHA 5HBCA 1PC3A 2CEYA 2HAUA 1SYHA 2F78A 2V4CA 3MVYA 1FQBA 4FECA 2H4IA 1QW0A 4X8RA 1LBZA 1YYZA 4FATA 4RPOA 3K1PA 4GLIA 4H5GA 2Q8JA 1M5CA 3S4UA 3G7WA 1MPBA 1LB9A 1MXUA 4PF8A 1A55A 3PPNA 1FBCA 3A3UA 2P1SA 3FBPA 2GHAA 3K01A 4MJOA 5J1DA 3G3GA 2H25A 4NF8A 3DLNA 5DEXB 1NV4A 4ESXA 5LTCA 1EZOA 3CVGA 2Z22A 3KGCA 4NF5B 1A40A 4DLDA 4EDPA 3FGSA 2BJJX 5EQ9A 2DVZA 4AS4A 1B4HA 1H3DA 5AA1A 4KPTA 4KI0E 2CZHA 4P56A 1LBWA 1OMPA 3V89B 3K00A 3B6TA 4NGUA 1IQ7A 3DP4A 3MVWA 1L5TA 2O51A 4G77A 1B0LA 2XXWA 1P1WA 3UGWA 1KA1A 5I58B 4C1TA 5ICQA 1GV8A 5I5PA 1IMFA 2FNCA 2M8CA 5H8SA 3MSTA 1G0IA 1P1NA 1B7HA 4G68C 1KWHA 4OANA 2QVVA 5ITPA 2W7YA 2ESNA 3LSFB 2Y7WA 4NF4B 3PUYE 1IMBA 3KZGA 2GQ1A 5AA3A 2D21A 1S50A 4TQUQ 5FBPA 3QSLA 2DDKA 3PUWE 4TLMB 4ZEFA 4F19A 4MNPA 4PGPA 2UXAA 1NV3A 2VD2A 3MC2A 4H0WA 5IGAA 3TPAA 3TKDA 1NV5A 4OZ9A 4ZEBA 3FVOA 1LGBC 1INPA 3P7IA 4YMBA 1XVXA 4G2ZA 5CI5A 4R9GA 2F7AA 1OVBA 1LBYA 2XXPA 4GXAA 3B50A 4R6YA 4QSDA 2I4CA 1ZKBA 3UIFA 1MY4A 1NV0A 5K2XA 4XEQA 1SQYA 3TAJA 3DP6A 1MQGA 4JWYA 3U8QA 1LBCA 3TTMA 3HCQA 3TTRA 5F24A 2HQ0A 2XXQA 5EYFA 3BBRA 2ZMBA 1DTZA 4KYDA 3VV5A 2P3NA 4AS5A 2E1SA 4JVCA 3H4ZA 5KDTA 3PMXA 1DBZA 1N7WA 2CZIA 4I62A 1I6AA 4H46A 3ZS6A 3MAMA 4PBHA 4I40A 3ROJA 3RNNA 3THIA 2XX7A 5L8DA 4XKPA 1B5JA 1KZ8A 2I4BA 5I56B 4X1DA 4HTGA 5CM6A 5FTHA 3C33A 3V8XB 3QYTA 4N13A 4PE3A 5TP9A 3HO7A 3SEXA 4HW8A 2XXVA 2RC9A 2WX9A 1I6BA 4G68B 4DI3D 1FBHA 4PBQA 1OQHA 2AIXA 3OOAA 3VDFA 4ND9A 2GFEA 2XWOA 2O1LA 2IEEA 4OVQA 3GYYA 1DOTA 5AA4B 2R9JA 2YJPA 3IB1A 3Q26A 3E13X 2Q2AA 4RK2A 1BTJA 2QSXA 5H8FB 1UIVA 4PDDA 2FIXA 5CRYA 1IMEA 4POXA 5FHNA 3FVKA 4O8MA 1Y1MA 3K6XA 4QSCA 5KZTA 3M3LA 3PMVA 1B5IA 1AH5A 4F1YA 3O97A 5AA2A 5H8QA 3TQWA 1FTJA 2V93A 1P99A 2FHYA 3WAEA 1YPNA 4JSOA 3SEWA 3H6UA 1BK4A 4N4UA 2F3BA 3FASA 4LZ5A 1MDQA 1QULA 1PEBA 4MLQA 4H8JA 1MY3A 5AA2B 4OVRA 1QJMA 1OIBA 4RA1A 1D9YA 3IR1A 4F3SA 5IM2A 1Q9DA 4PAKA 2Y5LA 1LFHA 1B9JA 1UIUA 1P1UA 3OD7A 4KFQA 1BLFA 3N6UA 4LN5A 5L9OA 1FTLA 1QKBA 1USYE 4DCXA 4LQ5A 4PFRA 1US5A 4LATA 4P9KA 2LAOA 3UP9A 2VP1A 3N5LA 4KD5A 3ZKLA 2ZNUA 1D9VA 3U94A 2P2AA 4QFKA 3TTKA 1B7ZA 4F39A 1IUDA 3PV0E 1M5BA 1LSTA 2F7CA 2CEXA 1ELJA 1FBPA 1LAHE 4PCDA 2OWZA 3RY3A 3VVDA 1DPEA 1XC1A 4HE2A 1IXHA 4O7IA 3CR9A 1MH4A 4NAPA 1LAXA 3S9LC 4KR5A 2I48A 4ZZEA 3BIGA 1GGGA 4QBAA 3N26A 3KBZA 3TYHA 1EU8A 4ZE9A 4NF0A 2D3IA 1IZ1A 4PF6A 4I3EA 3U92A 1DMBA 2X26A 1H76A 3LBSA 2PCRA 1B2HA 5L9SA 4R75A 3MP8A 2NOOA 1GTKA 3TELA 4U1ZA 1VFEA 3ILUB 2I6EA 1MXVA 2DWHA 2HZKA 4F22A 4U2RA 3KSXA 2VPNA 4GRKA 1FPKA 3K2DA 2I0BA 1D3KA 3R7XA 2YPNA 4OEVA 4Q30B 5CMCA 1FPIA 3OENA 2B65A 3JV9A 2VOZA 1OVTA 4YAHX 3K1MA 3K02A 3EPEA 1B3FA 4O94A 1MQHA 2ONSA 1JETA 3H03A 3OO8A 3FATA 1DSNA 4IY5A 5IAIA 4L17A 2PVUA 2V3QA 3FXRA 1FPGA 1H45A 2R6GE 2V84A 1NUZA 4PP0A 3IJOB 3O2AA 1SYIA 4OQOA 1ATGA 3CI8A 3SZPA 4MHFA 4GL8A 3IO4A 3E4RA 1A7LA 3SEYA 2X7QA 4MEVA 3FVNA 4N8GA 5AE4A 5J16A 3G3JA 2G93A 4OA4A 2I3VA 5H8NA 5A5XA 1LCFA 3H6WA 1NUWA 3RUMA 4P0GA 1FPJA 4ESWA 4GWXA 4YKIA 2O84X 4GBVA 1PB8A 2WKYA 1N3XA 5T3JA 1TFDA 3G3KA 5ET6A 2Y7IA 3LUZA 2WYKA 5I84A 1XOCA 5H8NB 3C35A 4PDHA 4GX6A 1FBFA 2X7PA 5DVJA 1Y1ZA 3PPPA 2D5WA 3B6QA 3KN8A 4RXLA 4ELQA
chains in the Genus database with same CATH topology
1R6ZA 2HZLA 2FYIA 2I49A 3T9XB 3F11A 2Q89A 2F34A 2ONRA 2HEUA 3EN3A 2RCBA 3FJ7A 3FIRA 1P1QA 2REJA 3FXQA 3MP6A 1HSLA 2OWSA 3CFZA 2NUVA 3FZVA 4NMYA 1YTVA 2XXRA 3IOWA 3IORA 1BP5A 2GRVA 2HXWA 1B1XA 4EQ7A 1ZIUA 4NEDA 4FE8A 5KCJA 2XXXA 4ZDMA 4AB5A 2RC8A 2DE3A 2DQVA 1VFDA 2I0CA 4NTLA 4R9FA 3H3GA 1IXCA 1MPDA 3MVZA 3OXNA 3A09A 1VR5A 3G3IA 4I1DA 5CBSA 3EF7A 4H5FA 2ZNSA 3VE1B 3S9MC 3TUSA 3PD8A 3ECRA 3QUFA 3QXMA 1PB7A 3TTNA 4QF9A 1MRPA 3V5AA 3M3FA 3FVGA 4FORA 4DXBA 4WEDA 3MQ9A 4NF8B 3SDFA 5CBRA 4LONB 4M4GA 1BKAA 4I9DA 1URGA 3W9VA 5ITOA 3H7MA 1SI1A 4THIA 5I2KA 4DCYA 2Z8EA 1MY2A 1MXWA 4Q8RA 4KYSA 2OWTA 4GL0A 4IO6A 5H8HA 3WAFA 4OXVA 1O64A 3QIMA 4FEDA 1FTOA 4PE5B 1NNFA 2CZLA 4QFOA 3I6VA 4WXJA 3VXCA 1UQWA 1QUJA 1B05A 3RT8A 1R9QA 1XHYA 1LFIA 1QUIA 4F3GA 3U93A 5CMBA 4ISUA 1PDAA 4U22A 3MP1A 4IO5A 3UORA 3IX1A 2DS9A 1HSJA 4RYAA 3K6WA 1DTGA 2RKMA 4LVQA 2PMSA 1EH3A 3LC8A 3KSJA 3W15C 1PB9A 3CSBA 1FQDA 4POWA 3PUVE 3D4CA 1NKXA 2NXOA 1PBPA 2AL4A 3MVXA 4E0XA 4PETA 4G8MA 4X48A 2Q88A 3AXFA 1IITA 2OLBA 4MLVA 1SW4A 2V3TA 2RCAA 3T66A 4GFRA 2GH9A 5CC2A 1J1NA 1WODA 3EHSA 4HCYA 4P0IA 1MS7A 4PQJA 1FTKA 4NF6A 3KJ7A 3B7DA 3CG3A 4DDDA 3RPWA 2UVHA 1Q35A 3OELA 3TFLA 4K3FA 2XX9A 2DE4A 3VXBA 1LFGA 3FD3A 2I58A 3H6VA 1LLSA 3OEKA 1OLCA 3O66A 1FQAA 1NNTA 3ILTB 4BDMA 5JK4A 4BDNA 2OJTA 5B7DA 3IOVA 5KDTB 3SESA 2HAVA 4OYVA 2GHBA 4YB5A 5DTBA 3IOTA 4PFTA 4RK9A 2XXYA 3Q29A 4FJPA 4RNSA 4EQBA 2UVGA 3Q25A 3CIJA 3T9UA 1Y3QA 2V25A 4BDQA 4IO7A 2QJEA 4Q5TA 4O3BA 1QKAA 4ELRA 1NFTA 4U4SA 5FHMA 5TP9B 2XXIA 1MQDA 2ANJA 1MXYA 1M5DA 1Y4CA 3R26A 1H44A 2DVCA 1QVSA 3D4GA 2V3UA 1UTHA 5TPAA 5BUUA 1SBPA 3C4MA 4KHZE 3E9XA 5I59A 5BWJA 1MQIA 3KBRA 4F18A 2PT2A 1OQGA 2UYFA 1NNPA 4GOTA 2FA7A 5H8QB 5FHOA 3VFJA 2VGQA 1LB8A 2E0SA 5ELVA 1LAGE 5M2VA 3PPOA 1URSA 3TEPA 2F8DA 4GVOA 3GLBA 2ALUA 4EUOA 4AQ4A 2YLNA 3FXUA 3LSLA 1A8FA 3RGYA 1SW5A 3MZ9A 1B7UA 1D4NA 3VLWA 3MPLA 5DVFA 2Y84A 1BIYA 1A54A 4NWCA 2F97A 4DXCA 4ZECA 4FAJA 4GWOA 4QFNA 1Y3PA 4IGRA 4RJZA 3ONMA 4OMBA 2QRYA 4DZ1A 3CFXA 5LOMA 1B4ZA 1FW0A 1N0TA 3T93B 2B3FA 4JWXA 2ONKE 4KYEA 2DXRA 3JYRA 4LZ8A 3C9HA 4ZZAA 3IK6B 3PUXE 1VSOA 4LA9A 4H67A 4NE4A 1POTA 3IL1B 3CRBA 3GBAA 2QS4A 1M5FA 2RINA 1AOVA 2R71A 4G4PA 1S9TA 1SD3A 3PPRA 3M3KA 3RQTA 4KCCA 1SI0A 4U21A 1VE4A 3VLVA 1B52A 4JB7A 3GBBA 2O1MA 1NH8A 2ZYKA 3HN0A 3ZSFA 1FQFA 2H5YA 2A5TA 3OMBA 1TXFA 5FTIA 3K6UA 1MH3A 2XHDA 4OEUA 3USDA 1N84A 4YICA 5ISUA 4BDLA 3MUQA 4MF3A 1HSEA 3I5OA 4GQOA 3VVFA 3ODBA 2OBGA 4I8CA 1SW1A 4O3CA 4IO2A 4RPNA 4OFOA 1OLAA 1ZTYA 5B70A 1R9LA 4F1VA 2ZYMA 4QRZA 3OSQA 3ZKKA 4NWDA 4GIZA 4F3BA 1MY0A 1P1OA 1I69A 4R74A 1RYXA 1Y20A 1AIVA 3KFMA 5AA2D 3Q27A 1A99A 2QS3A 1B5HA 3O6IA 1WDNA 3KN3A 4UA8A 3VVEA 1LBBA 3K0VA 1Q1KA 1JVXA 2QS1A 2G29A 2ZNTA 4ECFA 1SW2A 5A5XB 3PUZE 4ELOA 1B51A 1S7YA 4QSEA 2OCUA 3PGFA 1B46A 4XKQA 4YKPA 3T9HB 3G3HA 4OHNA 2Y7KA 2XXHA 3RTFB 3O6GA 1T0KA 2O68A 4ELPA 4JDFA 3DP8A 1MY1A 4WEPA 3K4UA 1ANFA 3U72A 3L6GA 4GD5A 4UACA 4ZS9A 3DELB 1JNFA 5TU0A 4R2BA 3S2VA 1H43A 3SKPA 1IXGA 5HM4B 3HV1A 2QS2A 1Y3NA 1MG1A 3GXAA 1QUKA 2XD2A 1B0HA 5HPQA 3UK4A 2PX1A 2XXUA 3R6UA 4OVJA 1ZJLA 4QFLA 2HFBA 4HS7A 4DXUA 5DEXA 2PT1A 5KCJB 3H6TA 3TZAA 2DYXA 4EXKA 4NF5A 3JZJA 1AL3A 3C32A 2I3WA 3TCGA 4OFJA 4XXUA 2PBWA 1Y4TA 1NMUA 3FJMA 5EHMA 3BFUA 3IB2A 4FIMA 4IY6A 3OSRA 2F6GA 3RN8A 3G3FA 1Z7ME 3SETA 4HCWA 2P0SA 3BKIB 1POY1 1B3EA 1ZBMA 1MXZA 5I58A 3IO6A 1GVCA 4EQ9A 5JEIA 4ZE8A 3W9WA 1N04A 5I2NA 4ZEIA 2OK2A 1JW1A 4YB6A 1I6QA 4ZEDA 3A3CA 4NF4A 3U1OA 2HCAA 3KG2A 4TLLB 3H06B 2OZZA 5I2KB 5I2NB 2H99A 3K6VA 2DXYA 4YMAA 2DSFA 4JXIA 4AB6A 3MBPA 5H8HB 3MW0A 3RLFE 3C36A 3CFLA 1AMFA 5F1QA 1CE2A 1O7TA 3O6HA 2REGA 2F5XA 2DE2A 3CG1A 1FQEA 4H6DA 4JBZA 4EF1A 1MQJA 1ZU0A 1B32A 4U4XA 2NVUB 1JEUA 4LUBA 4M1VA 3KJTA 3LSXA 2XX8A 2F6PA 2F7BA 1B6HA 2DWJA 3TCFA 3CSGA 4QHQA 1UTBA 3UN6A 1FCKA 3KN7A 4XIGQ 2ABHA 4N07A 3TQLA 3KOTA 3TODA 3IJXB 3S9EA 3L6HA 3T9VA 5L9MA 4Q0CA 3EHTA 1UTBB 4GF8A 2XD3A 3OO7A 4OESA 5I56A 1B40A 4NF6B 3IAZA 4H65A 4OFLA 4PFYA 3QK6A 1YAEA 3TMGA 1MDP1 3TTLA 4R73A 1RYOA 3FJGA 4G68A 1PBQA 1RKMA 4LZ7A 4FEBA 3HSTA 1IEJA 4H8IA 1B3GA 3BFTA 3KEIA 1B3HA 3B6WA 4U23A 5AA4A 2Y7PA 1EZPA 3N6TA 5H8FA 1F9BA 3LR1A 2QMWA 3PD9A 4R2FA 3IB0A 3MPKA 1TT1A 2F36A 5I57A 2VHAA 3UA8A 4JWOA 2UYEA 1CB6A 4X1BA 2O6AA 3PU5A 4E0WA 2H9BA 3S9NC 1IXIA 1SVXB 4LP2B 3VLUA 5CMKA 5I57B 1MXXA 2O69A 1XT8A 4F2OA 1JW4A 4BLAA 4R72A 2QMXA 2NWJA 1UTHB 5TPAB 2UVJA 2IA4A 1NNKA 1Z7NE 4O3AA 3M8UA 4XTCQ 2UVIA 5I59B 3EQ1A 1US4A 1URDA 2O7IA 4Z0IA 4MBPA 4LQ2A 1MPCA 3PMWA 4IB2A 1Y9UA 3O29A 2Q2CA 1B3LA 3HPIA 3FUZA 1JW5A 2DP8A 4MFIA 4WKMA 5IKBA 3IOUA 2RC7A 2VD3A 2XXTA 1EZ9A 4YB7A 3OO6A 3SEUA 1TWYA 4G8HA 1SDXA 3C31A 4C0RA 4X9TA 1JVYA 1XVYA 3PPQA 4ZEKA 4YZZA 1O63A 3GZGA 4Z7EA 2QPQA 1B1HA 3OEMA 4F31B 1N3WA 1GR2A 4F29A 2ZXTA 3SERA 2A5SA 4P11A 1XS5A 1R1NA 1WVJA 3I3VA 4JSDA 1IIWA 4F1UA 3N94A 4BDRA 3TDJA 5DVIA 2PYYA 4YKJA 2CMOA 2QL3A 2H98A 1NH7A 2DOJA 2ZYNA 2ZYOA 4XKRA 1MM7A 4H1XA 3V83A 3EHUA 4R6KA 4EXLA 3HHFA 3C34A 1LAFE 1N7XA 4IO3A 3O28A 4TOZA 3K1NA 3HHGA 1MM6A 4PFWA 4IO4A 4DIGA 4IGTA 4QFPA 4U1OA 4DE8A 3KOSA 2DWAA 5EHSA 1M5EA 3MZBA 2AL5A 1FTMA 4RY1A 2A5TB 1A8EA 1YCJA 4R6HA 1NL5A 3E3KA 1DPPA 3OO9A 4OETA 4OTEA 3SEVA 5CMMA 3LSWA 4XKNA 1FQCA 4KQPA 3FV1A 1LCTA 3T22A 1JEVA 2Y7RA 3QAXA 4F3PA 3MWBA 4OENA 4GXSB 1JQFA 2Z8FA 2AYSA 4G8NA 4C1UA 3RTWB 4ONYA 4F2QA 3TCHA 4EF2A 2O7UA 5DT6A 3LUYA 1ZLQA 5K2YA 3DM0A 2THIA 5JTYA 3MJNA 1B58A 2Z8DA 1ZMGA 4N6PA 2F35A 3O9PA 1USYH 4OERA 1II5A 4KCDA 3FV2A 1N76A 2Z23A 2RF1A 4MH5A 3Q28A 3QUJA 4YKKA 1TFAA 5F7VA 2DWIA 5JTYB 3RT6B 4OWDA 4BDOA 2B3BA 4PFUA 5ICTA 4YU0A 2KLFA 2Q9TA 3MZ1A 3T96B 5DYHA 5HBCA 1PC3A 2HAUA 1SYHA 2F78A 3MVYA 1FQBA 4FECA 2H4IA 1QW0A 4FATA 4RPOA 3K1PA 4GLIA 4H5GA 2Q8JA 1M5CA 3S4UA 3G7WA 1MPBA 1LB9A 1MXUA 1A55A 3PPNA 3A3UA 2P1SA 2GHAA 3K01A 5J1DA 3G3GA 2H25A 4NF8A 3DLNA 5DEXB 4ESXA 1EZOA 3CVGA 2Z22A 3KGCA 4NF5B 1A40A 4DLDA 4EDPA 3FGSA 2BJJX 2DVZA 1B4HA 1H3DA 5AA1A 4KPTA 4KI0E 1OMPA 3V89B 3K00A 3B6TA 1IQ7A 3DP4A 3MVWA 1L5TA 2O51A 4G77A 1B0LA 2XXWA 1P1WA 3UGWA 5I58B 4C1TA 5ICQA 1GV8A 2FNCA 2M8CA 5H8SA 1P1NA 1B7HA 4G68C 1KWHA 5ITPA 2W7YA 2ESNA 3LSFB 2Y7WA 4NF4B 3PUYE 3KZGA 5AA3A 2D21A 1S50A 4TQUQ 3QSLA 3PUWE 4TLMB 4ZEFA 4F19A 2UXAA 2VD2A 3MC2A 4H0WA 3TPAA 3TKDA 4OZ9A 4ZEBA 3FVOA 1LGBC 3P7IA 4YMBA 1XVXA 4G2ZA 5CI5A 4R9GA 2F7AA 1OVBA 2XXPA 4GXAA 4R6YA 4QSDA 2I4CA 1ZKBA 3UIFA 1MY4A 5K2XA 3TAJA 1SQYA 3DP6A 1MQGA 4JWYA 3U8QA 1LBCA 3TTMA 3HCQA 3TTRA 2HQ0A 2XXQA 5EYFA 3BBRA 2ZMBA 1DTZA 4KYDA 3VV5A 2E1SA 3H4ZA 5KDTA 3PMXA 1N7WA 4I62A 1I6AA 3ZS6A 3MAMA 3RNNA 3THIA 2XX7A 5L8DA 4XKPA 1B5JA 2I4BA 5I56B 4X1DA 4HTGA 5CM6A 5FTHA 3C33A 3V8XB 3QYTA 4N13A 5TP9A 3HO7A 3SEXA 4HW8A 2XXVA 2RC9A 1I6BA 4G68B 1OQHA 2AIXA 3OOAA 3VDFA 4ND9A 2GFEA 2O1LA 2IEEA 1DOTA 5AA4B 2R9JA 2YJPA 3IB1A 3Q26A 3E13X 2Q2AA 4RK2A 1BTJA 2QSXA 5H8FB 1UIVA 5CRYA 5FHNA 4POXA 3FVKA 1Y1MA 3K6XA 4QSCA 5KZTA 3M3LA 3PMVA 1B5IA 1AH5A 4F1YA 3O97A 5AA2A 5H8QA 3TQWA 1FTJA 2V93A 1P99A 3WAEA 1YPNA 4JSOA 3SEWA 3H6UA 3FASA 4LZ5A 1MDQA 1QULA 1PEBA 4MLQA 4H8JA 1MY3A 5AA2B 1QJMA 1OIBA 4RA1A 1D9YA 3IR1A 4F3SA 1LFHA 1B9JA 1UIUA 1P1UA 3OD7A 4KFQA 1BLFA 3N6UA 5L9OA 1FTLA 1QKBA 1USYE 4DCXA 4LQ5A 1US5A 4LATA 2LAOA 3UP9A 2VP1A 3N5LA 4KD5A 3ZKLA 2ZNUA 1D9VA 3U94A 2P2AA 4QFKA 3TTKA 1B7ZA 4F39A 1IUDA 3PV0E 1M5BA 1LSTA 2F7CA 1ELJA 1LAHE 3RY3A 3VVDA 1DPEA 1XC1A 1IXHA 3CR9A 1MH4A 1LAXA 3S9LC 4KR5A 2I48A 4ZZEA 1GGGA 3N26A 3TYHA 1EU8A 4ZE9A 2D3IA 1IZ1A 3U92A 1DMBA 2X26A 1H76A 3LBSA 1B2HA 5L9SA 4R75A 3MP8A 2NOOA 1GTKA 3TELA 4U1ZA 1VFEA 3ILUB 2I6EA 1MXVA 2DWHA 2HZKA 4F22A 4U2RA 3KSXA 4GRKA 3K2DA 2I0BA 1D3KA 3R7XA 2YPNA 4OEVA 4Q30B 5CMCA 3OENA 2B65A 3JV9A 2VOZA 1OVTA 4YAHX 3K1MA 3K02A 3EPEA 1B3FA 1MQHA 2ONSA 1JETA 3H03A 3OO8A 3FATA 1DSNA 4IY5A 5IAIA 4L17A 2PVUA 2V3QA 3FXRA 1H45A 2R6GE 2V84A 4PP0A 3IJOB 3O2AA 1SYIA 4OQOA 1ATGA 3CI8A 4GL8A 3IO4A 3E4RA 1A7LA 3SEYA 2X7QA 3FVNA 5AE4A 3G3JA 2G93A 2I3VA 5H8NA 5A5XA 1LCFA 3H6WA 3RUMA 4P0GA 4ESWA 4YKIA 2O84X 1PB8A 2WKYA 1N3XA 1TFDA 3G3KA 2Y7IA 5I84A 1XOCA 5H8NB 3C35A 2X7PA 5DVJA 1Y1ZA 3PPPA 2D5WA 3B6QA 3KN8A 4RXLA 4ELQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6Z A;  2HZL A;  2FYI A;  2I49 A;  3T9X B;  3F11 A;  2Q89 A;  2F34 A;  2ONR A;  2HEU A;  3EN3 A;  2RCB A;  3FJ7 A;  3FIR A;  1P1Q A;  2REJ A;  3FXQ A;  3MP6 A;  1HSL A;  2OWS A;  3CFZ A;  2NUV A;  3FZV A;  4NMY A;  1YTV A;  2XXR A;  3IOW A;  3IOR A;  1BP5 A;  2GRV A;  2HXW A;  1B1X A;  4EQ7 A;  1ZIU A;  4NED A;  4FE8 A;  5KCJ A;  2XXX A;  4ZDM A;  4AB5 A;  2RC8 A;  2DE3 A;  2DQV A;  1VFD A;  2I0C A;  4NTL A;  4R9F A;  3H3G A;  1IXC A;  1MPD A;  3MVZ A;  3OXN A;  3A09 A;  1VR5 A;  3G3I A;  4I1D A;  5CBS A;  3EF7 A;  4H5F A;  2ZNS A;  3VE1 B;  3S9M C;  3TUS A;  3PD8 A;  3ECR A;  3QUF A;  3QXM A;  1PB7 A;  3TTN A;  4QF9 A;  1MRP A;  3V5A A;  3M3F A;  3FVG A;  4FOR A;  4DXB A;  4WED A;  3MQ9 A;  4NF8 B;  3SDF A;  5CBR A;  4LON B;  4M4G A;  1BKA A;  4I9D A;  1URG A;  3W9V A;  5ITO A;  3H7M A;  1SI1 A;  4THI A;  5I2K A;  4DCY A;  2Z8E A;  1MY2 A;  1MXW A;  4Q8R A;  4KYS A;  2OWT A;  4GL0 A;  4IO6 A;  5H8H A;  3WAF A;  4OXV A;  1O64 A;  3QIM A;  4FED A;  1FTO A;  4PE5 B;  1NNF A;  2CZL A;  4QFO A;  3I6V A;  4WXJ A;  3VXC A;  1UQW A;  1QUJ A;  1B05 A;  3RT8 A;  1R9Q A;  1XHY A;  1LFI A;  1QUI A;  4F3G A;  3U93 A;  5CMB A;  4ISU A;  1PDA A;  4U22 A;  3MP1 A;  4IO5 A;  3UOR A;  3IX1 A;  2DS9 A;  1HSJ A;  4RYA A;  3K6W A;  1DTG A;  2RKM A;  4LVQ A;  2PMS A;  1EH3 A;  3LC8 A;  3KSJ A;  3W15 C;  1PB9 A;  3CSB A;  1FQD A;  4POW A;  3PUV E;  3D4C A;  1NKX A;  2NXO A;  1PBP A;  2AL4 A;  3MVX A;  4E0X A;  4PET A;  4G8M A;  4X48 A;  2Q88 A;  3AXF A;  1IIT A;  2OLB A;  4MLV A;  1SW4 A;  2V3T A;  2RCA A;  3T66 A;  4GFR A;  2GH9 A;  5CC2 A;  1J1N A;  1WOD A;  3EHS A;  4HCY A;  4P0I A;  1MS7 A;  4PQJ A;  1FTK A;  4NF6 A;  3KJ7 A;  3B7D A;  3CG3 A;  4DDD A;  3RPW A;  2UVH A;  1Q35 A;  3OEL A;  3TFL A;  4K3F A;  2XX9 A;  2DE4 A;  3VXB A;  1LFG A;  3FD3 A;  2I58 A;  3H6V A;  1LLS A;  3OEK A;  1OLC A;  3O66 A;  1FQA A;  1NNT A;  3ILT B;  4BDM A;  5JK4 A;  4BDN A;  2OJT A;  5B7D A;  3IOV A;  5KDT B;  3SES A;  2HAV A;  4OYV A;  2GHB A;  4YB5 A;  5DTB A;  3IOT A;  4PFT A;  4RK9 A;  2XXY A;  3Q29 A;  4FJP A;  4RNS A;  4EQB A;  2UVG A;  3Q25 A;  3CIJ A;  3T9U A;  1Y3Q A;  2V25 A;  4BDQ A;  4IO7 A;  2QJE A;  4Q5T A;  4O3B A;  1QKA A;  4ELR A;  1NFT A;  4U4S A;  5FHM A;  5TP9 B;  2XXI A;  1MQD A;  2ANJ A;  1MXY A;  1M5D A;  1Y4C A;  3R26 A;  1H44 A;  2DVC A;  1QVS A;  3D4G A;  2V3U A;  1UTH A;  5TPA A;  5BUU A;  1SBP A;  3C4M A;  4KHZ E;  3E9X A;  5I59 A;  5BWJ A;  1MQI A;  3KBR A;  4F18 A;  2PT2 A;  1OQG A;  2UYF A;  1NNP A;  4GOT A;  2FA7 A;  5H8Q B;  5FHO A;  3VFJ A;  2VGQ A;  1LB8 A;  2E0S A;  5ELV A;  1LAG E;  5M2V A;  3PPO A;  1URS A;  3TEP A;  2F8D A;  4GVO A;  3GLB A;  2ALU A;  4EUO A;  4AQ4 A;  2YLN A;  3FXU A;  3LSL A;  1A8F A;  3RGY A;  1SW5 A;  3MZ9 A;  1B7U A;  1D4N A;  3VLW A;  3MPL A;  5DVF A;  2Y84 A;  1BIY A;  1A54 A;  4NWC A;  2F97 A;  4DXC A;  4ZEC A;  4FAJ A;  4GWO A;  4QFN A;  1Y3P A;  4IGR A;  4RJZ A;  3ONM A;  4OMB A;  2QRY A;  4DZ1 A;  3CFX A;  5LOM A;  1B4Z A;  1FW0 A;  1N0T A;  3T93 B;  2B3F A;  4JWX A;  2ONK E;  4KYE A;  2DXR A;  3JYR A;  4LZ8 A;  3C9H A;  4ZZA A;  3IK6 B;  3PUX E;  1VSO A;  4LA9 A;  4H67 A;  4NE4 A;  1POT A;  3IL1 B;  3CRB A;  3GBA A;  2QS4 A;  1M5F A;  2RIN A;  1AOV A;  2R71 A;  4G4P A;  1S9T A;  1SD3 A;  3PPR A;  3M3K A;  3RQT A;  4KCC A;  1SI0 A;  4U21 A;  1VE4 A;  3VLV A;  1B52 A;  4JB7 A;  3GBB A;  2O1M A;  1NH8 A;  2ZYK A;  3HN0 A;  3ZSF A;  1FQF A;  2H5Y A;  2A5T A;  3OMB A;  1TXF A;  5FTI A;  3K6U A;  1MH3 A;  2XHD A;  4OEU A;  3USD A;  1N84 A;  4YIC A;  5ISU A;  4BDL A;  3MUQ A;  4MF3 A;  1HSE A;  3I5O A;  4GQO A;  3VVF A;  3ODB A;  2OBG A;  4I8C A;  1SW1 A;  4O3C A;  4IO2 A;  4RPN A;  4OFO A;  1OLA A;  1ZTY A;  5B70 A;  1R9L A;  4F1V A;  2ZYM A;  4QRZ A;  3OSQ A;  3ZKK A;  4NWD A;  4GIZ A;  4F3B A;  1MY0 A;  1P1O A;  1I69 A;  4R74 A;  1RYX A;  1Y20 A;  1AIV A;  3KFM A;  5AA2 D;  3Q27 A;  1A99 A;  2QS3 A;  1B5H A;  3O6I A;  1WDN A;  3KN3 A;  4UA8 A;  3VVE A;  1LBB A;  3K0V A;  1Q1K A;  1JVX A;  2QS1 A;  2G29 A;  2ZNT A;  4ECF A;  1SW2 A;  5A5X B;  3PUZ E;  4ELO A;  1B51 A;  1S7Y A;  4QSE A;  2OCU A;  3PGF A;  1B46 A;  4XKQ A;  4YKP A;  3T9H B;  3G3H A;  4OHN A;  2Y7K A;  2XXH A;  3RTF B;  3O6G A;  1T0K A;  2O68 A;  4ELP A;  4JDF A;  3DP8 A;  1MY1 A;  4WEP A;  3K4U A;  1ANF A;  3U72 A;  3L6G A;  4GD5 A;  4UAC A;  4ZS9 A;  3DEL B;  1JNF A;  5TU0 A;  4R2B A;  3S2V A;  1H43 A;  3SKP A;  1IXG A;  5HM4 B;  3HV1 A;  2QS2 A;  1Y3N A;  1MG1 A;  3GXA A;  1QUK A;  2XD2 A;  1B0H A;  5HPQ A;  3UK4 A;  2PX1 A;  2XXU A;  3R6U A;  4OVJ A;  1ZJL A;  4QFL A;  2HFB A;  4HS7 A;  4DXU A;  5DEX A;  2PT1 A;  5KCJ B;  3H6T A;  3TZA A;  2DYX A;  4EXK A;  4NF5 A;  3JZJ A;  1AL3 A;  3C32 A;  2I3W A;  3TCG A;  4OFJ A;  4XXU A;  2PBW A;  1Y4T A;  1NMU A;  3FJM A;  5EHM A;  3BFU A;  3IB2 A;  4FIM A;  4IY6 A;  3OSR A;  2F6G A;  3RN8 A;  3G3F A;  1Z7M E;  3SET A;  4HCW A;  2P0S A;  3BKI B;  1POY 1;  1B3E A;  1ZBM A;  1MXZ A;  5I58 A;  3IO6 A;  1GVC A;  4EQ9 A;  5JEI A;  4ZE8 A;  3W9W A;  1N04 A;  5I2N A;  4ZEI A;  2OK2 A;  1JW1 A;  4YB6 A;  1I6Q A;  4ZED A;  3A3C A;  4NF4 A;  3U1O A;  2HCA A;  3KG2 A;  4TLL B;  3H06 B;  2OZZ A;  5I2K B;  5I2N B;  2H99 A;  3K6V A;  2DXY A;  4YMA A;  2DSF A;  4JXI A;  4AB6 A;  3MBP A;  5H8H B;  3MW0 A;  3RLF E;  3C36 A;  3CFL A;  1AMF A;  5F1Q A;  1CE2 A;  1O7T A;  3O6H A;  2REG A;  2F5X A;  2DE2 A;  3CG1 A;  1FQE A;  4H6D A;  4JBZ A;  4EF1 A;  1MQJ A;  1ZU0 A;  1B32 A;  4U4X A;  2NVU B;  1JEU A;  4LUB A;  4M1V A;  3KJT A;  3LSX A;  2XX8 A;  2F6P A;  2F7B A;  1B6H A;  2DWJ A;  3TCF A;  3CSG A;  4QHQ A;  1UTB A;  3UN6 A;  1FCK A;  3KN7 A;  4XIG Q;  2ABH A;  4N07 A;  3TQL A;  3KOT A;  3TOD A;  3IJX B;  3S9E A;  3L6H A;  3T9V A;  5L9M A;  4Q0C A;  3EHT A;  1UTB B;  4GF8 A;  2XD3 A;  3OO7 A;  4OES A;  5I56 A;  1B40 A;  4NF6 B;  3IAZ A;  4H65 A;  4OFL A;  4PFY A;  3QK6 A;  1YAE A;  3TMG A;  1MDP 1;  3TTL A;  4R73 A;  1RYO A;  3FJG A;  4G68 A;  1PBQ A;  1RKM A;  4LZ7 A;  4FEB A;  3HST A;  1IEJ A;  4H8I A;  1B3G A;  3BFT A;  3KEI A;  1B3H A;  3B6W A;  4U23 A;  5AA4 A;  2Y7P A;  1EZP A;  3N6T A;  5H8F A;  1F9B A;  3LR1 A;  2QMW A;  3PD9 A;  4R2F A;  3IB0 A;  3MPK A;  1TT1 A;  2F36 A;  5I57 A;  2VHA A;  3UA8 A;  4JWO A;  2UYE A;  1CB6 A;  4X1B A;  2O6A A;  3PU5 A;  4E0W A;  2H9B A;  3S9N C;  1IXI A;  1SVX B;  4LP2 B;  3VLU A;  5CMK A;  5I57 B;  1MXX A;  2O69 A;  1XT8 A;  4F2O A;  1JW4 A;  4BLA A;  4R72 A;  2QMX A;  2NWJ A;  1UTH B;  5TPA B;  2UVJ A;  2IA4 A;  1NNK A;  1Z7N E;  4O3A A;  3M8U A;  4XTC Q;  2UVI A;  5I59 B;  3EQ1 A;  1US4 A;  1URD A;  2O7I A;  4Z0I A;  4MBP A;  4LQ2 A;  1MPC A;  3PMW A;  4IB2 A;  1Y9U A;  3O29 A;  2Q2C A;  1B3L A;  3HPI A;  3FUZ A;  1JW5 A;  2DP8 A;  4MFI A;  4WKM A;  5IKB A;  3IOU A;  2RC7 A;  2VD3 A;  2XXT A;  1EZ9 A;  4YB7 A;  3OO6 A;  3SEU A;  1TWY A;  4G8H A;  1SDX A;  3C31 A;  4C0R A;  4X9T A;  1JVY A;  1XVY A;  3PPQ A;  4ZEK A;  4YZZ A;  1O63 A;  3GZG A;  4Z7E A;  2QPQ A;  1B1H A;  3OEM A;  4F31 B;  1N3W A;  1GR2 A;  4F29 A;  2ZXT A;  3SER A;  2A5S A;  4P11 A;  1XS5 A;  1R1N A;  1WVJ A;  3I3V A;  4JSD A;  1IIW A;  4F1U A;  3N94 A;  4BDR A;  3TDJ A;  5DVI A;  2PYY A;  4YKJ A;  2CMO A;  2QL3 A;  2H98 A;  1NH7 A;  2DOJ A;  2ZYN A;  2ZYO A;  4XKR A;  1MM7 A;  4H1X A;  3V83 A;  3EHU A;  4R6K A;  4EXL A;  3HHF A;  3C34 A;  1LAF E;  1N7X A;  4IO3 A;  3O28 A;  4TOZ A;  3K1N A;  3HHG A;  1MM6 A;  4PFW A;  4IO4 A;  4DIG A;  4IGT A;  4QFP A;  4U1O A;  4DE8 A;  3KOS A;  2DWA A;  5EHS A;  1M5E A;  3MZB A;  2AL5 A;  1FTM A;  4RY1 A;  2A5T B;  1A8E A;  1YCJ A;  4R6H A;  1NL5 A;  3E3K A;  1DPP A;  3OO9 A;  4OET A;  4OTE A;  3SEV A;  5CMM A;  3LSW A;  4XKN A;  1FQC A;  4KQP A;  3FV1 A;  1LCT A;  3T22 A;  1JEV A;  2Y7R A;  3QAX A;  4F3P A;  3MWB A;  4OEN A;  4GXS B;  1JQF A;  2Z8F A;  2AYS A;  4G8N A;  4C1U A;  3RTW B;  4ONY A;  4F2Q A;  3TCH A;  4EF2 A;  2O7U A;  5DT6 A;  3LUY A;  1ZLQ A;  5K2Y A;  3DM0 A;  2THI A;  5JTY A;  3MJN A;  1B58 A;  2Z8D A;  1ZMG A;  4N6P A;  2F35 A;  3O9P A;  1USY H;  4OER A;  1II5 A;  4KCD A;  3FV2 A;  1N76 A;  2Z23 A;  2RF1 A;  4MH5 A;  3Q28 A;  3QUJ A;  4YKK A;  1TFA A;  5F7V A;  2DWI A;  5JTY B;  3RT6 B;  4OWD A;  4BDO A;  2B3B A;  4PFU A;  5ICT A;  4YU0 A;  2KLF A;  2Q9T A;  3MZ1 A;  3T96 B;  5DYH A;  5HBC A;  1PC3 A;  2HAU A;  1SYH A;  2F78 A;  3MVY A;  1FQB A;  4FEC A;  2H4I A;  1QW0 A;  4FAT A;  4RPO A;  3K1P A;  4GLI A;  4H5G A;  2Q8J A;  1M5C A;  3S4U A;  3G7W A;  1MPB A;  1LB9 A;  1MXU A;  1A55 A;  3PPN A;  3A3U A;  2P1S A;  2GHA A;  3K01 A;  5J1D A;  3G3G A;  2H25 A;  4NF8 A;  3DLN A;  5DEX B;  4ESX A;  1EZO A;  3CVG A;  2Z22 A;  3KGC A;  4NF5 B;  1A40 A;  4DLD A;  4EDP A;  3FGS A;  2BJJ X;  2DVZ A;  1B4H A;  1H3D A;  5AA1 A;  4KPT A;  4KI0 E;  1OMP A;  3V89 B;  3K00 A;  3B6T A;  1IQ7 A;  3DP4 A;  3MVW A;  1L5T A;  2O51 A;  4G77 A;  1B0L A;  2XXW A;  1P1W A;  3UGW A;  5I58 B;  4C1T A;  5ICQ A;  1GV8 A;  2FNC A;  2M8C A;  5H8S A;  1P1N A;  1B7H A;  4G68 C;  1KWH A;  5ITP A;  2W7Y A;  2ESN A;  3LSF B;  2Y7W A;  4NF4 B;  3PUY E;  3KZG A;  5AA3 A;  2D21 A;  1S50 A;  4TQU Q;  3QSL A;  3PUW E;  4TLM B;  4ZEF A;  4F19 A;  2UXA A;  2VD2 A;  3MC2 A;  4H0W A;  3TPA A;  3TKD A;  4OZ9 A;  4ZEB A;  3FVO A;  1LGB C;  3P7I A;  4YMB A;  1XVX A;  4G2Z A;  5CI5 A;  4R9G A;  2F7A A;  1OVB A;  2XXP A;  4GXA A;  4R6Y A;  4QSD A;  2I4C A;  1ZKB A;  3UIF A;  1MY4 A;  5K2X A;  3TAJ A;  1SQY A;  3DP6 A;  1MQG A;  4JWY A;  3U8Q A;  1LBC A;  3TTM A;  3HCQ A;  3TTR A;  2HQ0 A;  2XXQ A;  5EYF A;  3BBR A;  2ZMB A;  1DTZ A;  4KYD A;  3VV5 A;  2E1S A;  3H4Z A;  5KDT A;  3PMX A;  1N7W A;  4I62 A;  1I6A A;  3ZS6 A;  3MAM A;  3RNN A;  3THI A;  2XX7 A;  5L8D A;  4XKP A;  1B5J A;  2I4B A;  5I56 B;  4X1D A;  4HTG A;  5CM6 A;  5FTH A;  3C33 A;  3V8X B;  3QYT A;  4N13 A;  5TP9 A;  3HO7 A;  3SEX A;  4HW8 A;  2XXV A;  2RC9 A;  1I6B A;  4G68 B;  1OQH A;  2AIX A;  3OOA A;  3VDF A;  4ND9 A;  2GFE A;  2O1L A;  2IEE A;  1DOT A;  5AA4 B;  2R9J A;  2YJP A;  3IB1 A;  3Q26 A;  3E13 X;  2Q2A A;  4RK2 A;  1BTJ A;  2QSX A;  5H8F B;  1UIV A;  5CRY A;  5FHN A;  4POX A;  3FVK A;  1Y1M A;  3K6X A;  4QSC A;  5KZT A;  3M3L A;  3PMV A;  1B5I A;  1AH5 A;  4F1Y A;  3O97 A;  5AA2 A;  5H8Q A;  3TQW A;  1FTJ A;  2V93 A;  1P99 A;  3WAE A;  1YPN A;  4JSO A;  3SEW A;  3H6U A;  3FAS A;  4LZ5 A;  1MDQ A;  1QUL A;  1PEB A;  4MLQ A;  4H8J A;  1MY3 A;  5AA2 B;  1QJM A;  1OIB A;  4RA1 A;  1D9Y A;  3IR1 A;  4F3S A;  1LFH A;  1B9J A;  1UIU A;  1P1U A;  3OD7 A;  4KFQ A;  1BLF A;  3N6U A;  5L9O A;  1FTL A;  1QKB A;  1USY E;  4DCX A;  4LQ5 A;  1US5 A;  4LAT A;  2LAO A;  3UP9 A;  2VP1 A;  3N5L A;  4KD5 A;  3ZKL A;  2ZNU A;  1D9V A;  3U94 A;  2P2A A;  4QFK A;  3TTK A;  1B7Z A;  4F39 A;  1IUD A;  3PV0 E;  1M5B A;  1LST A;  2F7C A;  1ELJ A;  1LAH E;  3RY3 A;  3VVD A;  1DPE A;  1XC1 A;  1IXH A;  3CR9 A;  1MH4 A;  1LAX A;  3S9L C;  4KR5 A;  2I48 A;  4ZZE A;  1GGG A;  3N26 A;  3TYH A;  1EU8 A;  4ZE9 A;  2D3I A;  1IZ1 A;  3U92 A;  1DMB A;  2X26 A;  1H76 A;  3LBS A;  1B2H A;  5L9S A;  4R75 A;  3MP8 A;  2NOO A;  1GTK A;  3TEL A;  4U1Z A;  1VFE A;  3ILU B;  2I6E A;  1MXV A;  2DWH A;  2HZK A;  4F22 A;  4U2R A;  3KSX A;  4GRK A;  3K2D A;  2I0B A;  1D3K A;  3R7X A;  2YPN A;  4OEV A;  4Q30 B;  5CMC A;  3OEN A;  2B65 A;  3JV9 A;  2VOZ A;  1OVT A;  4YAH X;  3K1M A;  3K02 A;  3EPE A;  1B3F A;  1MQH A;  2ONS A;  1JET A;  3H03 A;  3OO8 A;  3FAT A;  1DSN A;  4IY5 A;  5IAI A;  4L17 A;  2PVU A;  2V3Q A;  3FXR A;  1H45 A;  2R6G E;  2V84 A;  4PP0 A;  3IJO B;  3O2A A;  1SYI A;  4OQO A;  1ATG A;  3CI8 A;  4GL8 A;  3IO4 A;  3E4R A;  1A7L A;  3SEY A;  2X7Q A;  3FVN A;  5AE4 A;  3G3J A;  2G93 A;  2I3V A;  5H8N A;  5A5X A;  1LCF A;  3H6W A;  3RUM A;  4P0G A;  4ESW A;  4YKI A;  2O84 X;  1PB8 A;  2WKY A;  1N3X A;  1TFD A;  3G3K A;  2Y7I A;  5I84 A;  1XOC A;  5H8N B;  3C35 A;  2X7P A;  5DVJ A;  1Y1Z A;  3PPP A;  2D5W A;  3B6Q A;  3KN8 A;  4RXL A;  4ELQ A; 
#chains in the Genus database with same CATH topology
 1R6Z A;  2HZL A;  2FYI A;  5I3S A;  2I49 A;  3T9X B;  3F11 A;  2Q89 A;  2F34 A;  2ONR A;  2HHM A;  2HEU A;  3EN3 A;  2RCB A;  3FJ7 A;  3FIR A;  1P1Q A;  2REJ A;  3FXQ A;  3MP6 A;  1HSL A;  2OWS A;  3CFZ A;  2NUV A;  3FZV A;  4NMY A;  1YTV A;  2XXR A;  3IOW A;  3IOR A;  1BP5 A;  2GRV A;  4PFI A;  5ET7 A;  2HXW A;  1B1X A;  4N15 A;  4EQ7 A;  1ZIU A;  4NED A;  4FE8 A;  5KCJ A;  4I3Y A;  2XXX A;  4ZDM A;  4AB5 A;  2RC8 A;  2DE3 A;  2DQV A;  1VFD A;  2I0C A;  4NTL A;  4R9F A;  3H3G A;  1IXC A;  1MPD A;  3MVZ A;  3OXN A;  3A09 A;  1VR5 A;  3G3I A;  4I1D A;  5CBS A;  3EF7 A;  4H5F A;  2ZNS A;  3VE1 B;  3S9M C;  3TUS A;  3PD8 A;  1QGX A;  3ECR A;  3QUF A;  3QXM A;  1PB7 A;  3TTN A;  4QF9 A;  1MRP A;  3V5A A;  3M3F A;  3FVG A;  4FOR A;  4DXB A;  4WED A;  3MQ9 A;  4NF8 B;  3SDF A;  5CBR A;  4LON B;  4M4G A;  1BKA A;  4I9D A;  4H45 A;  1URG A;  3NOH A;  3W9V A;  5ITO A;  3H7M A;  1SI1 A;  4THI A;  5I2K A;  4DCY A;  2Z8E A;  1MY2 A;  5EQ8 A;  1MXW A;  4Q8R A;  4GWW A;  4KYS A;  2OWT A;  4GL0 A;  4IO6 A;  5H8H A;  3WAF A;  4OXV A;  1O64 A;  3QIM A;  4P3L A;  4FED A;  5A5L A;  2Y5K A;  1FTO A;  4PE5 B;  1NNF A;  2CZL A;  4QFO A;  3I6V A;  4WXJ A;  3VXC A;  1UQW A;  1LBV A;  1QUJ A;  1B05 A;  3RT8 A;  1R9Q A;  1XHY A;  1LFI A;  1QUI A;  4F3G A;  2MKZ A;  3T0J A;  3U93 A;  5CMB A;  4N6K A;  4ISU A;  1PDA A;  2PFZ A;  4U22 A;  3MP1 A;  4IO5 A;  3RYD A;  3UOR A;  4OVP A;  3IX1 A;  2DS9 A;  1HSJ A;  4RYA A;  3K6W A;  1DTG A;  2RKM A;  4LVQ A;  2PMS A;  1EH3 A;  3LC8 A;  3KSJ A;  3W15 C;  1PB9 A;  3CSB A;  1FQD A;  4POW A;  3PUV E;  3D4C A;  1NKX A;  2NXO A;  1PBP A;  2AL4 A;  3MVX A;  4E0X A;  4PET A;  4G8M A;  4X48 A;  4P8B A;  1NV1 A;  1D9Q A;  1NV7 A;  2Q88 A;  3AXF A;  1IIT A;  2OLB A;  4MLV A;  1SW4 A;  2V3T A;  2RCA A;  3T66 A;  4GFR A;  2GH9 A;  5CC2 A;  1J1N A;  1WOD A;  3EHS A;  4PGN A;  4NHB A;  4HCY A;  4P0I A;  1MS7 A;  3EKI A;  4PQJ A;  4MMP A;  2VT5 A;  1FTK A;  4NF6 A;  3KJ7 A;  4HXV A;  3B7D A;  3CG3 A;  4DDD A;  3RPW A;  2UVH A;  1Q35 A;  3OEL A;  3TFL A;  4K3F A;  2XX9 A;  2DE4 A;  3VXB A;  1LFG A;  3FD3 A;  2I58 A;  3H6V A;  1LLS A;  3OEK A;  1OLC A;  3O66 A;  1FQA A;  1NNT A;  3ILT B;  4BDM A;  5JK4 A;  4BDN A;  2OJT A;  5B7D A;  3D1R A;  3IOV A;  1IMA A;  5KDT B;  3SES A;  3B8B A;  2HAV A;  3BIH A;  4OYV A;  2GHB A;  4YB5 A;  5DTB A;  3IOT A;  4PFT A;  4RK9 A;  1NV6 A;  5EQA A;  2XWV A;  2XXY A;  3ISP A;  4MX6 A;  3Q29 A;  4FJP A;  4RNS A;  4EQB A;  2UVG A;  3Q25 A;  3CIJ A;  3T9U A;  1Y3Q A;  2V25 A;  4BDQ A;  4IO7 A;  2QJE A;  4Q5T A;  4O3B A;  1QKA A;  2WYP A;  4IR8 A;  4ELR A;  1FPB A;  2WEF A;  4N17 A;  1NFT A;  4U4S A;  5FHM A;  5TP9 B;  2XXI A;  1MQD A;  2ANJ A;  1MXY A;  1M5D A;  1Y4C A;  3R26 A;  1H44 A;  2DVC A;  1QVS A;  3D4G A;  2V3U A;  1UTH A;  5TPA A;  5BUU A;  4P47 A;  1SBP A;  2ZZX A;  1IMC A;  3C4M A;  4MIJ A;  4KHZ E;  3E9X A;  1IMD A;  5I59 A;  5BWJ A;  1MQI A;  3KBR A;  4F18 A;  2PT2 A;  1OQG A;  2JJK A;  4PTK A;  2UYF A;  1NNP A;  4GOT A;  2FA7 A;  5H8Q B;  5FHO A;  3VFJ A;  2VGQ A;  1LB8 A;  1FJ9 A;  2E0S A;  5ELV A;  1LAG E;  5M2V A;  2BJI A;  1NI9 A;  3PPO A;  1URS A;  3TEP A;  2F8D A;  4GVO A;  4NG7 A;  3GLB A;  2ALU A;  4EUO A;  4AQ4 A;  2YLN A;  1JP4 A;  2QFL A;  3FXU A;  3LSL A;  1A8F A;  3RGY A;  1SW5 A;  3MZ9 A;  1B7U A;  1D4N A;  3VLW A;  3MPL A;  4NN3 A;  5DVF A;  2Y84 A;  1FRP A;  1BIY A;  1A54 A;  4NWC A;  1NUX A;  2F97 A;  4DXC A;  2WBD A;  4ZEC A;  4FAJ A;  4GWO A;  4QFN A;  1DK4 A;  1Y3P A;  4IGR A;  4GBW A;  4RJZ A;  1RDY A;  3ONM A;  4HE1 A;  4OMB A;  2QRY A;  3QMF A;  4MAG A;  4OVT A;  4DZ1 A;  3CFX A;  5LOM A;  1B4Z A;  1FW0 A;  1N0T A;  3T93 B;  2B3F A;  4JWX A;  2ONK E;  4KYE A;  2DXR A;  3JYR A;  4LZ8 A;  5IZ3 A;  3C9H A;  4ZZA A;  3IK6 B;  3PUX E;  2FBP A;  5ET5 A;  1VSO A;  4LA9 A;  4OVS A;  4H67 A;  4NE4 A;  1POT A;  3IL1 B;  3CRB A;  3GBA A;  2QS4 A;  1M5F A;  2RIN A;  1AOV A;  2R71 A;  4G4P A;  4GWZ A;  1S9T A;  4JVI A;  1SD3 A;  4XFE A;  2VPO A;  3PPR A;  3M3K A;  3RQT A;  4KCC A;  1SI0 A;  4U21 A;  4N91 A;  1VE4 A;  3VLV A;  1B52 A;  4JB7 A;  1FPF A;  3GBB A;  2O1M A;  1NH8 A;  2ZYK A;  3HN0 A;  4O7M A;  3ZSF A;  1FQF A;  2H5Y A;  2A5T A;  5LDZ A;  3OMB A;  1TXF A;  5FTI A;  3K6U A;  1MH3 A;  2XHD A;  4OEU A;  3USD A;  1N84 A;  4YIC A;  5ISU A;  1FBE A;  4BDL A;  1FJ6 A;  3MUQ A;  4MF3 A;  1HSE A;  3I5O A;  4GQO A;  5IZZ A;  3VVF A;  3ODB A;  2OBG A;  4I8C A;  3KC1 A;  1SW1 A;  4O3C A;  4UAB A;  3RPL A;  4IO2 A;  4RPN A;  4OFO A;  1OLA A;  3FXB A;  1ZTY A;  5B70 A;  1R9L A;  4F1V A;  2ZYM A;  4QRZ A;  3OSQ A;  3ZKK A;  4NWD A;  4GIZ A;  4F3B A;  1MY0 A;  1P1O A;  2ZZW A;  1I69 A;  4R74 A;  1RYX A;  1Y20 A;  1AIV A;  4HE0 A;  3KFM A;  5AA2 D;  3Q27 A;  1A99 A;  2FIE A;  2QS3 A;  1B5H A;  3O6I A;  1WDN A;  3KN3 A;  4UA8 A;  3VVE A;  1LBB A;  3K0V A;  1Q1K A;  1JVX A;  2QS1 A;  2G29 A;  2ZNT A;  4ECF A;  1SW2 A;  5A5X B;  3PUZ E;  4ELO A;  1B51 A;  1S7Y A;  1RDX A;  4QSE A;  2OCU A;  2L5V A;  3PGF A;  1B46 A;  4XKQ A;  4YKP A;  3T9H B;  3G3H A;  4OHN A;  2Y7K A;  2XXH A;  3RTF B;  3O6G A;  1T0K A;  2O68 A;  4ELP A;  4JDF A;  3DP8 A;  4GWS A;  1MY1 A;  3U65 A;  4WEP A;  4JVD A;  3K4U A;  1ANF A;  4N8Y A;  5ESY A;  3U72 A;  3L6G A;  3PTY A;  4GD5 A;  4UAC A;  4ZS9 A;  3DEL B;  1JNF A;  4GWY A;  5TU0 A;  4R2B A;  2XWI A;  3S2V A;  1H43 A;  3SKP A;  1IXG A;  5HM4 B;  3HV1 A;  2QS2 A;  1Y3N A;  1MG1 A;  3GXA A;  1QUK A;  2XD2 A;  1B0H A;  2XWK A;  5HPQ A;  3UK4 A;  2PX1 A;  1G0H A;  2XXU A;  3T1B A;  3R6U A;  4OVJ A;  2F3D A;  1ZJL A;  4QFL A;  2HFB A;  1CNQ A;  4HS7 A;  1AWB A;  4DXU A;  5DEX A;  2PT1 A;  5KCJ B;  3H6T A;  3TZA A;  2DYX A;  4EXK A;  4NF5 A;  3JZJ A;  1AL3 A;  3C32 A;  5ET8 A;  2R8T A;  2I3W A;  3TCG A;  4OFJ A;  4XXU A;  2PBW A;  1Y4T A;  1NMU A;  3FJM A;  5EHM A;  4N81 A;  3BFU A;  3IB2 A;  4FIM A;  4IY6 A;  3OSR A;  2F6G A;  3RN8 A;  2XA5 A;  3G3F A;  1Z7M E;  3SET A;  4HCW A;  2P0S A;  3BKI B;  4NX1 A;  1POY 1;  1B3E A;  1ZBM A;  1MXZ A;  5I58 A;  3IO6 A;  1GVC A;  4GWU A;  4EQ9 A;  1FSA A;  4ZE8 A;  5JEI A;  3W9W A;  1N04 A;  5I2N A;  4MNI A;  2QVR A;  4ZEI A;  2OK2 A;  1JW1 A;  4YB6 A;  4MCO A;  1I6Q A;  1EYI A;  4ZED A;  3A3C A;  4NF4 A;  3U1O A;  4DI4 B;  2HCA A;  3KG2 A;  3LV0 A;  4GX3 A;  4TLL B;  1EYJ A;  3H06 B;  2OZZ A;  5I2K B;  5I2N B;  2H99 A;  3K6V A;  2DXY A;  4YMA A;  2DSF A;  4JXI A;  4AB6 A;  3MBP A;  5H8H B;  3MW0 A;  3RLF E;  5EYG A;  2Q8M A;  3C36 A;  3CFL A;  5EYH A;  2OX3 A;  1AMF A;  5F1Q A;  1CE2 A;  1O7T A;  3O6H A;  2REG A;  2F5X A;  2DE2 A;  3CG1 A;  1LBX A;  1FQE A;  4H6D A;  4JBZ A;  4EF1 A;  1MQJ A;  1ZU0 A;  1K9Z A;  2B4M A;  2XXK A;  1B32 A;  4U4X A;  2NVU B;  1JEU A;  4LUB A;  4M1V A;  3KJT A;  3LSX A;  3CHG A;  2XX8 A;  3A29 A;  1K9Y A;  2F6P A;  2F7B A;  1YXI A;  1B6H A;  2DWJ A;  3TCF A;  3CSG A;  4QHQ A;  1UTB A;  5EQ7 A;  3UN6 A;  1FCK A;  2CZK A;  3KN7 A;  4XIG Q;  2ABH A;  3IFA A;  4N07 A;  3TQL A;  2KQZ A;  3KOT A;  3TOD A;  3IJX B;  3S9E A;  3L6H A;  3T9V A;  5L9M A;  4Q0C A;  3EHT A;  1UTB B;  4GF8 A;  2XD3 A;  3OO7 A;  4OES A;  5I56 A;  1B40 A;  4NF6 B;  3IAZ A;  4H65 A;  1FPD A;  4OFL A;  4PFY A;  3QK6 A;  1YAE A;  3TMG A;  1MDP 1;  3TTL A;  4R73 A;  1RYO A;  3FJG A;  4G68 A;  1PBQ A;  1RKM A;  4LZ7 A;  4FEB A;  3HST A;  1IEJ A;  4G61 A;  4H8I A;  1B3G A;  3BFT A;  3KEI A;  1B3H A;  3B6W A;  4U23 A;  5AA4 A;  2Y7P A;  1EZP A;  3N6T A;  5H8F A;  1F9B A;  3LR1 A;  2Q74 A;  2QMW A;  5IZ1 A;  3PD9 A;  4NQ8 A;  4R2F A;  3IB0 A;  3MPK A;  1TT1 A;  2F36 A;  5I57 A;  2VHA A;  3UA8 A;  4JWO A;  2UYE A;  1CB6 A;  4X1B A;  2O6A A;  3PU5 A;  4E0W A;  1YZ0 A;  2H9B A;  3S9N C;  3MYU A;  1IXI A;  2PFY A;  1SVX B;  4LP2 B;  3VLU A;  5CMK A;  1FTA A;  3E78 A;  5I57 B;  1MXX A;  2O69 A;  1XT8 A;  4F2O A;  1JW4 A;  4BLA A;  4R72 A;  4QXD A;  2QMX A;  2NWJ A;  1UTH B;  5TPA B;  2UVJ A;  2IA4 A;  3E79 A;  1NNK A;  1Z7N E;  4O3A A;  3M8U A;  4XTC Q;  2UVI A;  5I59 B;  3EQ1 A;  1US4 A;  1URD A;  2O7I A;  4Z0I A;  1XI6 A;  4MBP A;  4LQ2 A;  1MPC A;  3PMW A;  4GX4 A;  4IB2 A;  1Y9U A;  3O29 A;  3IFC A;  2Q2C A;  1B3L A;  4FBP A;  3HPI A;  3FUZ A;  1JW5 A;  2DP8 A;  4MFI A;  4WKM A;  5IKB A;  3IOU A;  2RC7 A;  1FBG A;  2VD3 A;  2XXT A;  1NV2 A;  4MNC A;  1EZ9 A;  4YB7 A;  3OO6 A;  3SEU A;  1TWY A;  4G8H A;  1SDX A;  3C31 A;  4C0R A;  4X9T A;  1JVY A;  1XVY A;  3PPQ A;  4ZEK A;  4YZZ A;  1O63 A;  3GZG A;  4KXP A;  4Z7E A;  2QPQ A;  1B1H A;  3OEM A;  4F31 B;  4PC9 A;  2B4L A;  1N3W A;  1FBD A;  1GR2 A;  3KC0 A;  4PFB A;  4F29 A;  2ZXT A;  3SER A;  2A5S A;  4P11 A;  1XS5 A;  1R1N A;  2FVZ A;  1WVJ A;  3I3V A;  4JSD A;  1IIW A;  4F1U A;  3N94 A;  4BDR A;  3TDJ A;  5DVI A;  2PYY A;  4P1L A;  4YKJ A;  2CMO A;  5IZ3 B;  2QL3 A;  2H98 A;  1NH7 A;  2DOJ A;  2ZYN A;  2HPG A;  1VDW A;  2ZYO A;  4XKR A;  1MM7 A;  4H1X A;  3V83 A;  3EHU A;  4R6K A;  4EXL A;  3HHF A;  3C34 A;  1LAF E;  1N7X A;  4IO3 A;  3O28 A;  4TOZ A;  3K1N A;  3HHG A;  1MM6 A;  4PFW A;  4X04 A;  4IO4 A;  4DIG A;  4IGT A;  4QFP A;  4U1O A;  4DE8 A;  1RDZ A;  2DWA A;  3KOS A;  5EHS A;  1M5E A;  3MZB A;  2AL5 A;  1FTM A;  4RY1 A;  4XF5 A;  2A5T B;  2QVU A;  1A8E A;  1YCJ A;  4PAI A;  4R6H A;  1FPL A;  1NL5 A;  3E3K A;  1DPP A;  3OO9 A;  4OET A;  4OTE A;  3SEV A;  5CMM A;  3LSW A;  4XKN A;  1EYK A;  1FQC A;  4KQP A;  3FV1 A;  1LCT A;  3T22 A;  1JEV A;  3RPL B;  2KR0 A;  2Y7R A;  1FPE A;  3QAX A;  4F3P A;  3MWB A;  1LEV A;  4OEN A;  4GXS B;  5I7I A;  1JQF A;  2WBB A;  2Z8F A;  2AYS A;  4G8N A;  4C1U A;  3RTW B;  1DCU A;  4ONY A;  4P1E A;  4F2Q A;  3TCH A;  4EF2 A;  1KA0 A;  2O7U A;  5DT6 A;  1NUY A;  3LUY A;  1ZLQ A;  5K2Y A;  3DM0 A;  2THI A;  5JTY A;  3MJN A;  1B58 A;  2Z8D A;  1ZMG A;  4N6P A;  2F35 A;  5DW8 A;  2ZZV A;  3O9P A;  1USY H;  4OER A;  1SPI A;  2P3V A;  1II5 A;  4PAF A;  4KCD A;  3FV2 A;  3HFU A;  1N76 A;  2Z23 A;  2RF1 A;  4MH5 A;  3Q28 A;  3QUJ A;  4YKK A;  1TFA A;  5F7V A;  2DWI A;  5JTY B;  3RT6 B;  4OWD A;  4BDO A;  2B3B A;  4PFU A;  5ICT A;  4YU0 A;  2KLF A;  2Q9T A;  4N6D A;  2HXR A;  3MZ1 A;  3T96 B;  5DYH A;  5HBC A;  1PC3 A;  2CEY A;  2HAU A;  1SYH A;  2F78 A;  2V4C A;  3MVY A;  1FQB A;  4FEC A;  2H4I A;  1QW0 A;  4X8R A;  1LBZ A;  1YYZ A;  4FAT A;  4RPO A;  3K1P A;  4GLI A;  4H5G A;  2Q8J A;  1M5C A;  3S4U A;  3G7W A;  1MPB A;  1LB9 A;  1MXU A;  4PF8 A;  1A55 A;  3PPN A;  1FBC A;  3A3U A;  2P1S A;  3FBP A;  2GHA A;  3K01 A;  4MJO A;  5J1D A;  3G3G A;  2H25 A;  4NF8 A;  3DLN A;  5DEX B;  1NV4 A;  4ESX A;  5LTC A;  1EZO A;  3CVG A;  2Z22 A;  3KGC A;  4NF5 B;  1A40 A;  4DLD A;  4EDP A;  3FGS A;  2BJJ X;  5EQ9 A;  2DVZ A;  4AS4 A;  1B4H A;  1H3D A;  5AA1 A;  4KPT A;  4KI0 E;  2CZH A;  4P56 A;  1LBW A;  1OMP A;  3V89 B;  3K00 A;  3B6T A;  4NGU A;  1IQ7 A;  3DP4 A;  3MVW A;  1L5T A;  2O51 A;  4G77 A;  1B0L A;  2XXW A;  1P1W A;  3UGW A;  1KA1 A;  5I58 B;  4C1T A;  5ICQ A;  1GV8 A;  5I5P A;  1IMF A;  2FNC A;  2M8C A;  5H8S A;  3MST A;  1G0I A;  1P1N A;  1B7H A;  4G68 C;  1KWH A;  4OAN A;  2QVV A;  5ITP A;  2W7Y A;  2ESN A;  3LSF B;  2Y7W A;  4NF4 B;  3PUY E;  1IMB A;  3KZG A;  2GQ1 A;  5AA3 A;  2D21 A;  1S50 A;  4TQU Q;  5FBP A;  3QSL A;  2DDK A;  3PUW E;  4TLM B;  4ZEF A;  4F19 A;  4MNP A;  4PGP A;  2UXA A;  1NV3 A;  2VD2 A;  3MC2 A;  4H0W A;  5IGA A;  3TPA A;  3TKD A;  1NV5 A;  4OZ9 A;  4ZEB A;  3FVO A;  1LGB C;  1INP A;  3P7I A;  4YMB A;  1XVX A;  4G2Z A;  5CI5 A;  4R9G A;  2F7A A;  1OVB A;  1LBY A;  2XXP A;  4GXA A;  3B50 A;  4R6Y A;  4QSD A;  2I4C A;  1ZKB A;  3UIF A;  1MY4 A;  1NV0 A;  5K2X A;  4XEQ A;  1SQY A;  3TAJ A;  3DP6 A;  1MQG A;  4JWY A;  3U8Q A;  1LBC A;  3TTM A;  3HCQ A;  3TTR A;  5F24 A;  2HQ0 A;  2XXQ A;  5EYF A;  3BBR A;  2ZMB A;  1DTZ A;  4KYD A;  3VV5 A;  2P3N A;  4AS5 A;  2E1S A;  4JVC A;  3H4Z A;  5KDT A;  3PMX A;  1DBZ A;  1N7W A;  2CZI A;  4I62 A;  1I6A A;  4H46 A;  3ZS6 A;  3MAM A;  4PBH A;  4I40 A;  3ROJ A;  3RNN A;  3THI A;  2XX7 A;  5L8D A;  4XKP A;  1B5J A;  1KZ8 A;  2I4B A;  5I56 B;  4X1D A;  4HTG A;  5CM6 A;  5FTH A;  3C33 A;  3V8X B;  3QYT A;  4N13 A;  4PE3 A;  5TP9 A;  3HO7 A;  3SEX A;  4HW8 A;  2XXV A;  2RC9 A;  2WX9 A;  1I6B A;  4G68 B;  4DI3 D;  1FBH A;  4PBQ A;  1OQH A;  2AIX A;  3OOA A;  3VDF A;  4ND9 A;  2GFE A;  2XWO A;  2O1L A;  2IEE A;  4OVQ A;  3GYY A;  1DOT A;  5AA4 B;  2R9J A;  2YJP A;  3IB1 A;  3Q26 A;  3E13 X;  2Q2A A;  4RK2 A;  1BTJ A;  2QSX A;  5H8F B;  1UIV A;  4PDD A;  2FIX A;  5CRY A;  1IME A;  4POX A;  5FHN A;  3FVK A;  4O8M A;  1Y1M A;  3K6X A;  4QSC A;  5KZT A;  3M3L A;  3PMV A;  1B5I A;  1AH5 A;  4F1Y A;  3O97 A;  5AA2 A;  5H8Q A;  3TQW A;  1FTJ A;  2V93 A;  1P99 A;  2FHY A;  3WAE A;  1YPN A;  4JSO A;  3SEW A;  3H6U A;  1BK4 A;  4N4U A;  2F3B A;  3FAS A;  4LZ5 A;  1MDQ A;  1QUL A;  1PEB A;  4MLQ A;  4H8J A;  1MY3 A;  5AA2 B;  4OVR A;  1QJM A;  1OIB A;  4RA1 A;  1D9Y A;  3IR1 A;  4F3S A;  5IM2 A;  1Q9D A;  4PAK A;  2Y5L A;  1LFH A;  1B9J A;  1UIU A;  1P1U A;  3OD7 A;  4KFQ A;  1BLF A;  3N6U A;  4LN5 A;  5L9O A;  1FTL A;  1QKB A;  1USY E;  4DCX A;  4LQ5 A;  4PFR A;  1US5 A;  4LAT A;  4P9K A;  2LAO A;  3UP9 A;  2VP1 A;  3N5L A;  4KD5 A;  3ZKL A;  2ZNU A;  1D9V A;  3U94 A;  2P2A A;  4QFK A;  3TTK A;  1B7Z A;  4F39 A;  1IUD A;  3PV0 E;  1M5B A;  1LST A;  2F7C A;  2CEX A;  1ELJ A;  1FBP A;  1LAH E;  4PCD A;  2OWZ A;  3RY3 A;  3VVD A;  1DPE A;  1XC1 A;  4HE2 A;  1IXH A;  4O7I A;  3CR9 A;  1MH4 A;  4NAP A;  1LAX A;  3S9L C;  4KR5 A;  2I48 A;  4ZZE A;  3BIG A;  1GGG A;  4QBA A;  3N26 A;  3KBZ A;  3TYH A;  1EU8 A;  4ZE9 A;  4NF0 A;  2D3I A;  1IZ1 A;  4PF6 A;  4I3E A;  3U92 A;  1DMB A;  2X26 A;  1H76 A;  3LBS A;  2PCR A;  1B2H A;  5L9S A;  4R75 A;  3MP8 A;  2NOO A;  1GTK A;  3TEL A;  4U1Z A;  1VFE A;  3ILU B;  2I6E A;  1MXV A;  2DWH A;  2HZK A;  4F22 A;  4U2R A;  3KSX A;  2VPN A;  4GRK A;  1FPK A;  3K2D A;  2I0B A;  1D3K A;  3R7X A;  2YPN A;  4OEV A;  4Q30 B;  5CMC A;  1FPI A;  3OEN A;  2B65 A;  3JV9 A;  2VOZ A;  1OVT A;  4YAH X;  3K1M A;  3K02 A;  3EPE A;  1B3F A;  4O94 A;  1MQH A;  2ONS A;  1JET A;  3H03 A;  3OO8 A;  3FAT A;  1DSN A;  4IY5 A;  5IAI A;  4L17 A;  2PVU A;  2V3Q A;  3FXR A;  1FPG A;  1H45 A;  2R6G E;  2V84 A;  1NUZ A;  4PP0 A;  3IJO B;  3O2A A;  1SYI A;  4OQO A;  1ATG A;  3CI8 A;  3SZP A;  4MHF A;  4GL8 A;  3IO4 A;  3E4R A;  1A7L A;  3SEY A;  2X7Q A;  4MEV A;  3FVN A;  4N8G A;  5AE4 A;  5J16 A;  3G3J A;  2G93 A;  4OA4 A;  2I3V A;  5H8N A;  5A5X A;  1LCF A;  3H6W A;  1NUW A;  3RUM A;  4P0G A;  1FPJ A;  4ESW A;  4GWX A;  4YKI A;  2O84 X;  4GBV A;  1PB8 A;  2WKY A;  1N3X A;  5T3J A;  1TFD A;  3G3K A;  5ET6 A;  2Y7I A;  3LUZ A;  2WYK A;  5I84 A;  1XOC A;  5H8N B;  3C35 A;  4PDH A;  4GX6 A;  1FBF A;  2X7P A;  5DVJ A;  1Y1Z A;  3PPP A;  2D5W A;  3B6Q A;  3KN8 A;  4RXL A;  4ELQ A; 
#chains in the Genus database with same CATH homology
 1R6Z A;  2HZL A;  2FYI A;  2I49 A;  3T9X B;  3F11 A;  2Q89 A;  2F34 A;  2ONR A;  2HEU A;  3EN3 A;  2RCB A;  3FJ7 A;  3FIR A;  1P1Q A;  2REJ A;  3FXQ A;  3MP6 A;  1HSL A;  2OWS A;  3CFZ A;  2NUV A;  3FZV A;  4NMY A;  1YTV A;  2XXR A;  3IOW A;  3IOR A;  1BP5 A;  2GRV A;  2HXW A;  1B1X A;  4EQ7 A;  1ZIU A;  4NED A;  4FE8 A;  5KCJ A;  2XXX A;  4ZDM A;  4AB5 A;  2RC8 A;  2DE3 A;  2DQV A;  1VFD A;  2I0C A;  4NTL A;  4R9F A;  3H3G A;  1IXC A;  1MPD A;  3MVZ A;  3OXN A;  3A09 A;  1VR5 A;  3G3I A;  4I1D A;  5CBS A;  3EF7 A;  4H5F A;  2ZNS A;  3VE1 B;  3S9M C;  3TUS A;  3PD8 A;  3ECR A;  3QUF A;  3QXM A;  1PB7 A;  3TTN A;  4QF9 A;  1MRP A;  3V5A A;  3M3F A;  3FVG A;  4FOR A;  4DXB A;  4WED A;  3MQ9 A;  4NF8 B;  3SDF A;  5CBR A;  4LON B;  4M4G A;  1BKA A;  4I9D A;  1URG A;  3W9V A;  5ITO A;  3H7M A;  1SI1 A;  4THI A;  5I2K A;  4DCY A;  2Z8E A;  1MY2 A;  1MXW A;  4Q8R A;  4KYS A;  2OWT A;  4GL0 A;  4IO6 A;  5H8H A;  3WAF A;  4OXV A;  1O64 A;  3QIM A;  4FED A;  1FTO A;  4PE5 B;  1NNF A;  2CZL A;  4QFO A;  3I6V A;  4WXJ A;  3VXC A;  1UQW A;  1QUJ A;  1B05 A;  3RT8 A;  1R9Q A;  1XHY A;  1LFI A;  1QUI A;  4F3G A;  3U93 A;  5CMB A;  4ISU A;  1PDA A;  4U22 A;  3MP1 A;  4IO5 A;  3UOR A;  3IX1 A;  2DS9 A;  1HSJ A;  4RYA A;  3K6W A;  1DTG A;  2RKM A;  4LVQ A;  2PMS A;  1EH3 A;  3LC8 A;  3KSJ A;  3W15 C;  1PB9 A;  3CSB A;  1FQD A;  4POW A;  3PUV E;  3D4C A;  1NKX A;  2NXO A;  1PBP A;  2AL4 A;  3MVX A;  4E0X A;  4PET A;  4G8M A;  4X48 A;  2Q88 A;  3AXF A;  1IIT A;  2OLB A;  4MLV A;  1SW4 A;  2V3T A;  2RCA A;  3T66 A;  4GFR A;  2GH9 A;  5CC2 A;  1J1N A;  1WOD A;  3EHS A;  4HCY A;  4P0I A;  1MS7 A;  4PQJ A;  1FTK A;  4NF6 A;  3KJ7 A;  3B7D A;  3CG3 A;  4DDD A;  3RPW A;  2UVH A;  1Q35 A;  3OEL A;  3TFL A;  4K3F A;  2XX9 A;  2DE4 A;  3VXB A;  1LFG A;  3FD3 A;  2I58 A;  3H6V A;  1LLS A;  3OEK A;  1OLC A;  3O66 A;  1FQA A;  1NNT A;  3ILT B;  4BDM A;  5JK4 A;  4BDN A;  2OJT A;  5B7D A;  3IOV A;  5KDT B;  3SES A;  2HAV A;  4OYV A;  2GHB A;  4YB5 A;  5DTB A;  3IOT A;  4PFT A;  4RK9 A;  2XXY A;  3Q29 A;  4FJP A;  4RNS A;  4EQB A;  2UVG A;  3Q25 A;  3CIJ A;  3T9U A;  1Y3Q A;  2V25 A;  4BDQ A;  4IO7 A;  2QJE A;  4Q5T A;  4O3B A;  1QKA A;  4ELR A;  1NFT A;  4U4S A;  5FHM A;  5TP9 B;  2XXI A;  1MQD A;  2ANJ A;  1MXY A;  1M5D A;  1Y4C A;  3R26 A;  1H44 A;  2DVC A;  1QVS A;  3D4G A;  2V3U A;  1UTH A;  5TPA A;  5BUU A;  1SBP A;  3C4M A;  4KHZ E;  3E9X A;  5I59 A;  5BWJ A;  1MQI A;  3KBR A;  4F18 A;  2PT2 A;  1OQG A;  2UYF A;  1NNP A;  4GOT A;  2FA7 A;  5H8Q B;  5FHO A;  3VFJ A;  2VGQ A;  1LB8 A;  2E0S A;  5ELV A;  1LAG E;  5M2V A;  3PPO A;  1URS A;  3TEP A;  2F8D A;  4GVO A;  3GLB A;  2ALU A;  4EUO A;  4AQ4 A;  2YLN A;  3FXU A;  3LSL A;  1A8F A;  3RGY A;  1SW5 A;  3MZ9 A;  1B7U A;  1D4N A;  3VLW A;  3MPL A;  5DVF A;  2Y84 A;  1BIY A;  1A54 A;  4NWC A;  2F97 A;  4DXC A;  4ZEC A;  4FAJ A;  4GWO A;  4QFN A;  1Y3P A;  4IGR A;  4RJZ A;  3ONM A;  4OMB A;  2QRY A;  4DZ1 A;  3CFX A;  5LOM A;  1B4Z A;  1FW0 A;  1N0T A;  3T93 B;  2B3F A;  4JWX A;  2ONK E;  4KYE A;  2DXR A;  3JYR A;  4LZ8 A;  3C9H A;  4ZZA A;  3IK6 B;  3PUX E;  1VSO A;  4LA9 A;  4H67 A;  4NE4 A;  1POT A;  3IL1 B;  3CRB A;  3GBA A;  2QS4 A;  1M5F A;  2RIN A;  1AOV A;  2R71 A;  4G4P A;  1S9T A;  1SD3 A;  3PPR A;  3M3K A;  3RQT A;  4KCC A;  1SI0 A;  4U21 A;  1VE4 A;  3VLV A;  1B52 A;  4JB7 A;  3GBB A;  2O1M A;  1NH8 A;  2ZYK A;  3HN0 A;  3ZSF A;  1FQF A;  2H5Y A;  2A5T A;  3OMB A;  1TXF A;  5FTI A;  3K6U A;  1MH3 A;  2XHD A;  4OEU A;  3USD A;  1N84 A;  4YIC A;  5ISU A;  4BDL A;  3MUQ A;  4MF3 A;  1HSE A;  3I5O A;  4GQO A;  3VVF A;  3ODB A;  2OBG A;  4I8C A;  1SW1 A;  4O3C A;  4IO2 A;  4RPN A;  4OFO A;  1OLA A;  1ZTY A;  5B70 A;  1R9L A;  4F1V A;  2ZYM A;  4QRZ A;  3OSQ A;  3ZKK A;  4NWD A;  4GIZ A;  4F3B A;  1MY0 A;  1P1O A;  1I69 A;  4R74 A;  1RYX A;  1Y20 A;  1AIV A;  3KFM A;  5AA2 D;  3Q27 A;  1A99 A;  2QS3 A;  1B5H A;  3O6I A;  1WDN A;  3KN3 A;  4UA8 A;  3VVE A;  1LBB A;  3K0V A;  1Q1K A;  1JVX A;  2QS1 A;  2G29 A;  2ZNT A;  4ECF A;  1SW2 A;  5A5X B;  3PUZ E;  4ELO A;  1B51 A;  1S7Y A;  4QSE A;  2OCU A;  3PGF A;  1B46 A;  4XKQ A;  4YKP A;  3T9H B;  3G3H A;  4OHN A;  2Y7K A;  2XXH A;  3RTF B;  3O6G A;  1T0K A;  2O68 A;  4ELP A;  4JDF A;  3DP8 A;  1MY1 A;  4WEP A;  3K4U A;  1ANF A;  3U72 A;  3L6G A;  4GD5 A;  4UAC A;  4ZS9 A;  3DEL B;  1JNF A;  5TU0 A;  4R2B A;  3S2V A;  1H43 A;  3SKP A;  1IXG A;  5HM4 B;  3HV1 A;  2QS2 A;  1Y3N A;  1MG1 A;  3GXA A;  1QUK A;  2XD2 A;  1B0H A;  5HPQ A;  3UK4 A;  2PX1 A;  2XXU A;  3R6U A;  4OVJ A;  1ZJL A;  4QFL A;  2HFB A;  4HS7 A;  4DXU A;  5DEX A;  2PT1 A;  5KCJ B;  3H6T A;  3TZA A;  2DYX A;  4EXK A;  4NF5 A;  3JZJ A;  1AL3 A;  3C32 A;  2I3W A;  3TCG A;  4OFJ A;  4XXU A;  2PBW A;  1Y4T A;  1NMU A;  3FJM A;  5EHM A;  3BFU A;  3IB2 A;  4FIM A;  4IY6 A;  3OSR A;  2F6G A;  3RN8 A;  3G3F A;  1Z7M E;  3SET A;  4HCW A;  2P0S A;  3BKI B;  1POY 1;  1B3E A;  1ZBM A;  1MXZ A;  5I58 A;  3IO6 A;  1GVC A;  4EQ9 A;  5JEI A;  4ZE8 A;  3W9W A;  1N04 A;  5I2N A;  4ZEI A;  2OK2 A;  1JW1 A;  4YB6 A;  1I6Q A;  4ZED A;  3A3C A;  4NF4 A;  3U1O A;  2HCA A;  3KG2 A;  4TLL B;  3H06 B;  2OZZ A;  5I2K B;  5I2N B;  2H99 A;  3K6V A;  2DXY A;  4YMA A;  2DSF A;  4JXI A;  4AB6 A;  3MBP A;  5H8H B;  3MW0 A;  3RLF E;  3C36 A;  3CFL A;  1AMF A;  5F1Q A;  1CE2 A;  1O7T A;  3O6H A;  2REG A;  2F5X A;  2DE2 A;  3CG1 A;  1FQE A;  4H6D A;  4JBZ A;  4EF1 A;  1MQJ A;  1ZU0 A;  1B32 A;  4U4X A;  2NVU B;  1JEU A;  4LUB A;  4M1V A;  3KJT A;  3LSX A;  2XX8 A;  2F6P A;  2F7B A;  1B6H A;  2DWJ A;  3TCF A;  3CSG A;  4QHQ A;  1UTB A;  3UN6 A;  1FCK A;  3KN7 A;  4XIG Q;  2ABH A;  4N07 A;  3TQL A;  3KOT A;  3TOD A;  3IJX B;  3S9E A;  3L6H A;  3T9V A;  5L9M A;  4Q0C A;  3EHT A;  1UTB B;  4GF8 A;  2XD3 A;  3OO7 A;  4OES A;  5I56 A;  1B40 A;  4NF6 B;  3IAZ A;  4H65 A;  4OFL A;  4PFY A;  3QK6 A;  1YAE A;  3TMG A;  1MDP 1;  3TTL A;  4R73 A;  1RYO A;  3FJG A;  4G68 A;  1PBQ A;  1RKM A;  4LZ7 A;  4FEB A;  3HST A;  1IEJ A;  4H8I A;  1B3G A;  3BFT A;  3KEI A;  1B3H A;  3B6W A;  4U23 A;  5AA4 A;  2Y7P A;  1EZP A;  3N6T A;  5H8F A;  1F9B A;  3LR1 A;  2QMW A;  3PD9 A;  4R2F A;  3IB0 A;  3MPK A;  1TT1 A;  2F36 A;  5I57 A;  2VHA A;  3UA8 A;  4JWO A;  2UYE A;  1CB6 A;  4X1B A;  2O6A A;  3PU5 A;  4E0W A;  2H9B A;  3S9N C;  1IXI A;  1SVX B;  4LP2 B;  3VLU A;  5CMK A;  5I57 B;  1MXX A;  2O69 A;  1XT8 A;  4F2O A;  1JW4 A;  4BLA A;  4R72 A;  2QMX A;  2NWJ A;  1UTH B;  5TPA B;  2UVJ A;  2IA4 A;  1NNK A;  1Z7N E;  4O3A A;  3M8U A;  4XTC Q;  2UVI A;  5I59 B;  3EQ1 A;  1US4 A;  1URD A;  2O7I A;  4Z0I A;  4MBP A;  4LQ2 A;  1MPC A;  3PMW A;  4IB2 A;  1Y9U A;  3O29 A;  2Q2C A;  1B3L A;  3HPI A;  3FUZ A;  1JW5 A;  2DP8 A;  4MFI A;  4WKM A;  5IKB A;  3IOU A;  2RC7 A;  2VD3 A;  2XXT A;  1EZ9 A;  4YB7 A;  3OO6 A;  3SEU A;  1TWY A;  4G8H A;  1SDX A;  3C31 A;  4C0R A;  4X9T A;  1JVY A;  1XVY A;  3PPQ A;  4ZEK A;  4YZZ A;  1O63 A;  3GZG A;  4Z7E A;  2QPQ A;  1B1H A;  3OEM A;  4F31 B;  1N3W A;  1GR2 A;  4F29 A;  2ZXT A;  3SER A;  2A5S A;  4P11 A;  1XS5 A;  1R1N A;  1WVJ A;  3I3V A;  4JSD A;  1IIW A;  4F1U A;  3N94 A;  4BDR A;  3TDJ A;  5DVI A;  2PYY A;  4YKJ A;  2CMO A;  2QL3 A;  2H98 A;  1NH7 A;  2DOJ A;  2ZYN A;  2ZYO A;  4XKR A;  1MM7 A;  4H1X A;  3V83 A;  3EHU A;  4R6K A;  4EXL A;  3HHF A;  3C34 A;  1LAF E;  1N7X A;  4IO3 A;  3O28 A;  4TOZ A;  3K1N A;  3HHG A;  1MM6 A;  4PFW A;  4IO4 A;  4DIG A;  4IGT A;  4QFP A;  4U1O A;  4DE8 A;  3KOS A;  2DWA A;  5EHS A;  1M5E A;  3MZB A;  2AL5 A;  1FTM A;  4RY1 A;  2A5T B;  1A8E A;  1YCJ A;  4R6H A;  1NL5 A;  3E3K A;  1DPP A;  3OO9 A;  4OET A;  4OTE A;  3SEV A;  5CMM A;  3LSW A;  4XKN A;  1FQC A;  4KQP A;  3FV1 A;  1LCT A;  3T22 A;  1JEV A;  2Y7R A;  3QAX A;  4F3P A;  3MWB A;  4OEN A;  4GXS B;  1JQF A;  2Z8F A;  2AYS A;  4G8N A;  4C1U A;  3RTW B;  4ONY A;  4F2Q A;  3TCH A;  4EF2 A;  2O7U A;  5DT6 A;  3LUY A;  1ZLQ A;  5K2Y A;  3DM0 A;  2THI A;  5JTY A;  3MJN A;  1B58 A;  2Z8D A;  1ZMG A;  4N6P A;  2F35 A;  3O9P A;  1USY H;  4OER A;  1II5 A;  4KCD A;  3FV2 A;  1N76 A;  2Z23 A;  2RF1 A;  4MH5 A;  3Q28 A;  3QUJ A;  4YKK A;  1TFA A;  5F7V A;  2DWI A;  5JTY B;  3RT6 B;  4OWD A;  4BDO A;  2B3B A;  4PFU A;  5ICT A;  4YU0 A;  2KLF A;  2Q9T A;  3MZ1 A;  3T96 B;  5DYH A;  5HBC A;  1PC3 A;  2HAU A;  1SYH A;  2F78 A;  3MVY A;  1FQB A;  4FEC A;  2H4I A;  1QW0 A;  4FAT A;  4RPO A;  3K1P A;  4GLI A;  4H5G A;  2Q8J A;  1M5C A;  3S4U A;  3G7W A;  1MPB A;  1LB9 A;  1MXU A;  1A55 A;  3PPN A;  3A3U A;  2P1S A;  2GHA A;  3K01 A;  5J1D A;  3G3G A;  2H25 A;  4NF8 A;  3DLN A;  5DEX B;  4ESX A;  1EZO A;  3CVG A;  2Z22 A;  3KGC A;  4NF5 B;  1A40 A;  4DLD A;  4EDP A;  3FGS A;  2BJJ X;  2DVZ A;  1B4H A;  1H3D A;  5AA1 A;  4KPT A;  4KI0 E;  1OMP A;  3V89 B;  3K00 A;  3B6T A;  1IQ7 A;  3DP4 A;  3MVW A;  1L5T A;  2O51 A;  4G77 A;  1B0L A;  2XXW A;  1P1W A;  3UGW A;  5I58 B;  4C1T A;  5ICQ A;  1GV8 A;  2FNC A;  2M8C A;  5H8S A;  1P1N A;  1B7H A;  4G68 C;  1KWH A;  5ITP A;  2W7Y A;  2ESN A;  3LSF B;  2Y7W A;  4NF4 B;  3PUY E;  3KZG A;  5AA3 A;  2D21 A;  1S50 A;  4TQU Q;  3QSL A;  3PUW E;  4TLM B;  4ZEF A;  4F19 A;  2UXA A;  2VD2 A;  3MC2 A;  4H0W A;  3TPA A;  3TKD A;  4OZ9 A;  4ZEB A;  3FVO A;  1LGB C;  3P7I A;  4YMB A;  1XVX A;  4G2Z A;  5CI5 A;  4R9G A;  2F7A A;  1OVB A;  2XXP A;  4GXA A;  4R6Y A;  4QSD A;  2I4C A;  1ZKB A;  3UIF A;  1MY4 A;  5K2X A;  3TAJ A;  1SQY A;  3DP6 A;  1MQG A;  4JWY A;  3U8Q A;  1LBC A;  3TTM A;  3HCQ A;  3TTR A;  2HQ0 A;  2XXQ A;  5EYF A;  3BBR A;  2ZMB A;  1DTZ A;  4KYD A;  3VV5 A;  2E1S A;  3H4Z A;  5KDT A;  3PMX A;  1N7W A;  4I62 A;  1I6A A;  3ZS6 A;  3MAM A;  3RNN A;  3THI A;  2XX7 A;  5L8D A;  4XKP A;  1B5J A;  2I4B A;  5I56 B;  4X1D A;  4HTG A;  5CM6 A;  5FTH A;  3C33 A;  3V8X B;  3QYT A;  4N13 A;  5TP9 A;  3HO7 A;  3SEX A;  4HW8 A;  2XXV A;  2RC9 A;  1I6B A;  4G68 B;  1OQH A;  2AIX A;  3OOA A;  3VDF A;  4ND9 A;  2GFE A;  2O1L A;  2IEE A;  1DOT A;  5AA4 B;  2R9J A;  2YJP A;  3IB1 A;  3Q26 A;  3E13 X;  2Q2A A;  4RK2 A;  1BTJ A;  2QSX A;  5H8F B;  1UIV A;  5CRY A;  5FHN A;  4POX A;  3FVK A;  1Y1M A;  3K6X A;  4QSC A;  5KZT A;  3M3L A;  3PMV A;  1B5I A;  1AH5 A;  4F1Y A;  3O97 A;  5AA2 A;  5H8Q A;  3TQW A;  1FTJ A;  2V93 A;  1P99 A;  3WAE A;  1YPN A;  4JSO A;  3SEW A;  3H6U A;  3FAS A;  4LZ5 A;  1MDQ A;  1QUL A;  1PEB A;  4MLQ A;  4H8J A;  1MY3 A;  5AA2 B;  1QJM A;  1OIB A;  4RA1 A;  1D9Y A;  3IR1 A;  4F3S A;  1LFH A;  1B9J A;  1UIU A;  1P1U A;  3OD7 A;  4KFQ A;  1BLF A;  3N6U A;  5L9O A;  1FTL A;  1QKB A;  1USY E;  4DCX A;  4LQ5 A;  1US5 A;  4LAT A;  2LAO A;  3UP9 A;  2VP1 A;  3N5L A;  4KD5 A;  3ZKL A;  2ZNU A;  1D9V A;  3U94 A;  2P2A A;  4QFK A;  3TTK A;  1B7Z A;  4F39 A;  1IUD A;  3PV0 E;  1M5B A;  1LST A;  2F7C A;  1ELJ A;  1LAH E;  3RY3 A;  3VVD A;  1DPE A;  1XC1 A;  1IXH A;  3CR9 A;  1MH4 A;  1LAX A;  3S9L C;  4KR5 A;  2I48 A;  4ZZE A;  1GGG A;  3N26 A;  3TYH A;  1EU8 A;  4ZE9 A;  2D3I A;  1IZ1 A;  3U92 A;  1DMB A;  2X26 A;  1H76 A;  3LBS A;  1B2H A;  5L9S A;  4R75 A;  3MP8 A;  2NOO A;  1GTK A;  3TEL A;  4U1Z A;  1VFE A;  3ILU B;  2I6E A;  1MXV A;  2DWH A;  2HZK A;  4F22 A;  4U2R A;  3KSX A;  4GRK A;  3K2D A;  2I0B A;  1D3K A;  3R7X A;  2YPN A;  4OEV A;  4Q30 B;  5CMC A;  3OEN A;  2B65 A;  3JV9 A;  2VOZ A;  1OVT A;  4YAH X;  3K1M A;  3K02 A;  3EPE A;  1B3F A;  1MQH A;  2ONS A;  1JET A;  3H03 A;  3OO8 A;  3FAT A;  1DSN A;  4IY5 A;  5IAI A;  4L17 A;  2PVU A;  2V3Q A;  3FXR A;  1H45 A;  2R6G E;  2V84 A;  4PP0 A;  3IJO B;  3O2A A;  1SYI A;  4OQO A;  1ATG A;  3CI8 A;  4GL8 A;  3IO4 A;  3E4R A;  1A7L A;  3SEY A;  2X7Q A;  3FVN A;  5AE4 A;  3G3J A;  2G93 A;  2I3V A;  5H8N A;  5A5X A;  1LCF A;  3H6W A;  3RUM A;  4P0G A;  4ESW A;  4YKI A;  2O84 X;  1PB8 A;  2WKY A;  1N3X A;  1TFD A;  3G3K A;  2Y7I A;  5I84 A;  1XOC A;  5H8N B;  3C35 A;  2X7P A;  5DVJ A;  1Y1Z A;  3PPP A;  2D5W A;  3B6Q A;  3KN8 A;  4RXL A;  4ELQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...