1D9VA

Haemophilus influenzae ferric-binding protein apo form
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
309
structure length
309
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and biochemical analyses of the metal-free Haemophilus influenzae Fe3+-binding protein.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
molecule keywords PROTEIN (iron-utilization periplasmic protein)
total genus 115
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 1999-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1d9vA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1d9vA01
2F78A 1B4ZA 4I1DA 1USYH 2F6GA 5BUUA 4FEDA 1JETA 3EHSA 3PPRA 4IO5A 4ZEIA 1B32A 1B7ZA 4R2BA 1A54A 2F34A 3TAJA 1B3GA 2I4BA 3QXMA 1PBPA 4X1BA 2ONSA 1IXHA 1GTKA 5CI5A 3KJ7A 2FNCA 2QS3A 2H9BA 2RCAA 4QFOA 2P1SA 4PQJA 1FTJA 1VR5A 4M4GA 4E0XA 4H0WA 2Q89A 2XXTA 4YB6A 1HSLA 5H8FA 4YMBA 3D4CA 3HO7A 3MAMA 1SQYA 1P1OA 1H43A 1P1NA 4F3SA 4OESA 1NNTA 3KEIA 3KOTA 5AA2A 4Q0CA 2DSFA 2VGQA 2UXAA 4OEVA 4TLLB 2H99A 3RQTA 4F18A 4TQUQ 3MP1A 3SETA 2RCBA 1D3KA 3OD7A 1FTLA 3FVGA 3K01A 3MZ1A 4KI0E 4QSCA 1CB6A 3Q27A 4JWXA 4DXCA 1MPBA 1MXYA 1UTBA 2HAVA 3LC8A 5H8HB 2REJA 5H8QB 1I6QA 3FJ7A 4GD5A 3MJNA 2ABHA 4U1OA 3IL1B 3SEWA 1OQHA 3I6VA 3FXUA 1QULA 4BDRA 3FVKA 1B46A 3UK4A 4OYVA 3I3VA 1NNFA 2HFBA 3O97A 1P1WA 4OWDA 2W7YA 4AQ4A 2O84X 5L9MA 3SEYA 4H5FA 2AL4A 4OXVA 5ICQA 1MS7A 2ALUA 2D21A 2Y7WA 1UIVA 3IR1A 3QAXA 4O3AA 3T9VA 1B5HA 1PB9A 4FIMA 1B6HA 2Q2CA 3K6XA 1P1UA 1DMBA 3BBRA 3TODA 5KDTA 1Z7ME 2X7QA 3KJTA 1II5A 2V3UA 4POXA 1GR2A 5AA2D 4BDOA 2VHAA 4QFKA 1O63A 2Z8FA 4G8HA 2OWTA 1ZJLA 2F6PA 4R2FA 3IB2A 3O29A 1B58A 4R73A 4XKRA 1RKMA 3TQLA 1JW1A 3UORA 3VV5A 3ZS6A 3O6IA 3TTNA 5L9OA 4O3BA 3FATA 1Q1KA 5H8NA 1Z7NE 3C33A 4I9DA 4YKJA 1A99A 2O69A 4NE4A 3QIMA 4R75A 4DXBA 3RNNA 3PUYE 1WDNA 3AXFA 3DP4A 3SDFA 4N07A 4X48A 4G77A 5F1QA 5FTIA 1XOCA 3PPPA 3U92A 4F39A 4RJZA 1M5CA 4ZE9A 1QUJA 4BLAA 4KYEA 5I84A 1B4HA 3MZ9A 2QRYA 1B7HA 2XHDA 2A5TB 3LBSA 3PU5A 4NF4A 4PFUA 4F2QA 3OMBA 1NNPA 3H4ZA 1POTA 1IEJA 3FV1A 3IORA 4R6YA 3FD3A 3FGSA 3KSJA 5TPAB 1SW4A 2Q8JA 3G3HA 2V25A 4YICA 1A7LA 2NXOA 2XXXA 4GFRA 3C35A 3VE1B 2F7CA 4DCXA 4ELPA 1FQFA 2VD2A 1HSJA 3MC2A 4M1VA 1J1NA 3OO9A 4H65A 1N84A 4P0GA 2F8DA 1WVJA 1KWHA 3PMVA 1MM7A 3PUXE 2H25A 1UIUA 1LCTA 2Z22A 5TPAA 2PT2A 2ZNSA 4I8CA 3WAEA 1Y3QA 2O1LA 2I4CA 3L6GA 2LAOA 5M2VA 2F97A 2I6EA 1B2HA 1LAGE 4GL8A 3KN3A 4NMYA 3WAFA 2KLFA 1M5FA 1T0KA 1DPPA 4EDPA 4Z7EA 4PP0A 3B6QA 3P7IA 1B3HA 2E0SA 1ATGA 1LB9A 2ZXTA 3FJMA 3OO7A 2DP8A 5DEXB 4XKNA 3V8XB 5B7DA 1MXZA 1BIYA 2GHBA 2QMWA 2QS2A 4OTEA 3ONMA 1N3XA 1B05A 1OVBA 2GRVA 3K1MA 3OOAA 3SERA 5FTHA 4U21A 3MBPA 1SW2A 3PUWE 4QFLA 3Q28A 4LATA 3S9NC 2NOOA 4MF3A 2Q88A 3TTRA 1PB7A 3B6TA 1TT1A 2AL5A 5CMCA 2CMOA 3FV2A 5EHSA 1IXCA 1FTMA 3LSWA 4YKKA 4HCYA 1MH3A 2F36A 1I6BA 1LSTA 4IO2A 1Y3NA 1Y3PA 2Y7PA 4IB2A 4OVJA 4QFNA 4N6PA 3G3IA 3PGFA 4G8MA 1IXGA 1CE2A 1TFDA 4RA1A 3T93B 1SW1A 1LAFE 4DZ1A 5B70A 4R9GA 1JVXA 3IB0A 1R1NA 2QJEA 3TQWA 5AA4B 5ICTA 4GOTA 4OFJA 3T96B 5ITPA 4NTLA 3U1OA 3C4MA 2QMXA 3E9XA 3RTWB 3LSFB 4EF2A 1AOVA 4GF8A 3TCFA 1SYHA 3ILUB 4P0IA 5H8FB 2M8CA 3K6UA 3PUZE 3ILTB 1A8EA 2CZLA 4U4XA 3EHUA 4ND9A 4FE8A 4PFYA 5FHNA 1LCFA 2PYYA 1YCJA 3FUZA 3O66A 3PPOA 1FQEA 1O7TA 2Z8EA 3F11A 3T9HB 4EQ7A 3C32A 3TYHA 2V3TA 4C1TA 5FHOA 4LQ5A 3U93A 3TMGA 2H5YA 4PETA 3K02A 3PMWA 4WEPA 4X9TA 5EHMA 3U72A 5CM6A 2ESNA 4DLDA 1S50A 1SI1A 1IZ1A 1FTKA 3TPAA 3V89B 1L5TA 3EN3A 3FXRA 3IOVA 3OXNA 4RPNA 4QSEA 3IO6A 2XXHA 1SI0A 1URDA 3FZVA 5JEIA 2Y7KA 3IB1A 1D9YA 1MQJA 2ONKE 5CRYA 5KCJB 4IGRA 3K4UA 1ANFA 2XX8A 3OEMA 4MBPA 2ZYMA 1LFHA 3A09A 4QF9A 4ELOA 5K2YA 5CMBA 3H06B 3TUSA 3B7DA 4KD5A 1XT8A 4PFTA 5I59A 3E3KA 1DOTA 2R6GE 2DVCA 3VVDA 2RKMA 3KG2A 2D5WA 2UVHA 1MDP1 3T9UA 1Y4TA 2QSXA 3Q25A 3RUMA 4BDNA 3SESA 1OLCA 2DQVA 1B51A 1P99A 1URGA 3CFXA 3MQ9A 3PUVE 4FORA 4QRZA 4ZZAA 2UYEA 5TP9A 1NH8A 1B9JA 1NNKA 4NEDA 5ELVA 3CFLA 4F1YA 3IK6B 2DWJA 2AYSA 2I3VA 3IOWA 2OCUA 2DS9A 2X7PA 3K1PA 4YAHX 2DE3A 4GRKA 1N7WA 3ZSFA 3C34A 5I57A 1B5JA 5I58A 5I2KA 1B7UA 1ZIUA 2D3IA 2Z8DA 3G3KA 3OO8A 3VDFA 3HN0A 1QKAA 3MPKA 3RTFB 4ECFA 1DSNA 4RK2A 4UACA 5HPQA 4BDMA 3A3CA 2V84A 4WKMA 3UN6A 1N76A 4G68A 4LP2B 1SW5A 5AE4A 3IJXB 3OO6A 2DVZA 1IQ7A 4L17A 3FIRA 3RPWA 2HQ0A 1QKBA 4Z0IA 1TWYA 1UTHB 2ANJA 1DPEA 2HEUA 4R72A 3FVNA 4N13A 1QUIA 3QYTA 3R7XA 3U94A 4ESXA 2XD2A 1I69A 4HCWA 1US5A 1EU8A 1MQGA 4LZ8A 1PDAA 4XKQA 4NF5B 3BKIB 2IEEA 1A55A 4IO4A 4PE5B 1LBBA 3GBAA 2DOJA 4LA9A 1UQWA 1US4A 1NKXA 2ZMBA 3K6WA 4H6DA 1P1QA 1AH5A 3RY3A 4Q8RA 4DXUA 3S9MC 4YKIA 5AA1A 2DWAA 3N26A 3UA8A 3H03A 1LB8A 1MG1A 3CVGA 2QL3A 3O6GA 4FJPA 4OENA 3QUJA 4R6KA 1B0LA 4LONB 1MPCA 4ONYA 4RY1A 2ZYOA 2OJTA 2UVGA 3V83A 1MXWA 2HCAA 1LFGA 1MY1A 2XX9A 4YB7A 4F2OA 3TFLA 1XVYA 4H67A 4MLVA 3S9LC 2HXWA 2WKYA 4GLIA 1MY4A 1N7XA 1VFDA 3K1NA 2OZZA 2PX1A 1BTJA 4ZECA 5I57B 5EYFA 1JW4A 2QPQA 1B3FA 4EXKA 2OLBA 3TZAA 2XXQA 1OVTA 3O9PA 3H6WA 1MY0A 2R9JA 1PC3A 1S7YA 4OHNA 4XTCQ 4YKPA 1IITA 5TU0A 5AA2B 4F1UA 3KOSA 1AIVA 1M5DA 2HZKA 3CG1A 1DTZA 2RC7A 3DLNA 1B3EA 3GBBA 3OSQA 4MLQA 2THIA 3DELB 3RT6B 1RYOA 1H3DA 4AB5A 1QUKA 3IJOB 1O64A 4IO3A 5DVFA 1UTBB 3MVXA 2FA7A 5H8HA 2QS4A 2Y84A 3D4GA 2XD3A 3PD8A 4THIA 1XC1A 4DCYA 5HM4B 5KZTA 3LSXA 1LFIA 1R9LA 3E13X 3G3GA 4QSDA 5LOMA 3KN8A 3K2DA 2VOZA 3MP6A 4GVOA 3T66A 1SYIA 1ZU0A 3DP6A 3LR1A 1MQIA 3SKPA 5I56A 4JSOA 4ZZEA 1DTGA 1JQFA 4ESWA 2V3QA 3HPIA 1GVCA 4G2ZA 1NH7A 2E1SA 3W15C 1LBCA 4QHQA 4F29A 2XXIA 2OBGA 3K00A 1B40A 2GH9A 3FVOA 3IX1A 3K6VA 1MRPA 3CFZA 3KBRA 3DM0A 3KGCA 3MPLA 4KHZE 4LVQA 3QSLA 3SEUA 2F35A 4FEBA 5I2KB 4F3PA 1JEVA 2R71A 1LAXA 3M3KA 4ELQA 5KDTB 3CRBA 2RC8A 3QK6A 4GXSB 4ZEFA 2G93A 3FJGA 4C0RA 4F22A 1PBQA 2ZNTA 3TCGA 4KCCA 5IAIA 2B3FA 2VP1A 4ZE8A 1Y1ZA 2O7IA 1MPDA 1Q35A 3GXAA 3THIA 3G3JA 1N3WA 2O1MA 3EQ1A 1PEBA 3VFJA 4KYDA 2YLNA 4EXLA 2XXWA 4OERA 3G3FA 3UIFA 2HZLA 4OZ9A 2XXRA 3JV9A 2DXRA 4GWOA 1LLSA 3CG3A 3MZBA 4GIZA 2B65A 1WODA 2V93A 4JWOA 3TEPA 4R6HA 5BWJA 1QJMA 1MXUA 4NWCA 3FXQA 3H7MA 3CI8A 4P11A 4TLMB 3R26A 3MWBA 1FQAA 1VFEA 1VE4A 1ZBMA 5CC2A 2F7AA 2F5XA 3OENA 4JSDA 1B1XA 4OQOA 5I2NA 1B3LA 4HW8A 1GGGA 1NFTA 1XS5A 3IO4A 1MM6A 3B6WA 4F19A 3IOTA 1A8FA 2AIXA 3TELA 1MQHA 3JYRA 3JZJA 3GLBA 2I3WA 4ZDMA 4F3BA 4YMAA 2IA4A 2O68A 3VLVA 3HHGA 3KFMA 4Q5TA 3TKDA 3VLWA 3H6VA 2RF1A 3S9EA 3VVFA 5AA4A 1AMFA 3OSRA 1ZLQA 2NVUB 3CIJA 3PPQA 4U2RA 4RNSA 1MY3A 2I48A 4RXLA 5A5XB 1GV8A 2XXUA 1RYXA 3PMXA 1TXFA 3LSLA 4OFLA 3U8QA 3MVZA 5K2XA 3CSBA 4ZEBA 4XIGQ 3IOUA 4OMBA 1MH4A 3H6TA 1FCKA 1UTHA 1MQDA 3HSTA 1JNFA 3MUQA 1EZ9A 5HBCA 5DVIA 4OEUA 1IIWA 1FTOA 5CMKA 4GXAA 4IO7A 1SDXA 1MXXA 2Y7IA 4MFIA 5DEXA 1OMPA 1N04A 1MDQA 5JK4A 2XXPA 4OFOA 4BDQA 1H76A 1ZKBA 4HTGA 2ZYNA 1IXIA 1OLAA 3TTMA 1A40A 2Q9TA 1B52A 2A5TA 2I49A 2XX7A 4U22A 1M5EA 2PVUA 2UYFA 4OETA 3TDJA 1NL5A 4NF6A 3M3LA 4WEDA 4GQOA 3N94A 4IGTA 4YU0A 1R6ZA 2H4IA 3H3GA 4EF1A 3N6TA 4F3GA 2H98A 4KR5A 2ZYKA 3M8UA 4JXIA 3HHFA 5DVJA 2I0BA 3MVYA 3S4UA 4ELRA 1JVYA 1EZPA 5CMMA 1M5BA 3N5LA 3O28A 2Y7RA 4LZ5A 5J1DA 1YPNA 3E4RA 3C9HA 4I62A 4WXJA 2F7BA 5CBSA 2P0SA 3H6UA 4KCDA 1BP5A 3BFTA 1YTVA 4ZEKA 3EHTA 3TCHA 1S9TA 1SVXB 1Y9UA 3QUFA 4H1XA 2UVJA 4IO6A 1USYE 1MXVA 3T9XB 2OWSA 2YJPA 4HS7A 1Y4CA 2NWJA 2GFEA 4ZEDA 5FHMA 4NF8B 3TTKA 3G7WA 5L9SA 1D4NA 1ZMGA 1Y1MA 3O6HA 3CR9A 3OELA 1JEUA 3OEKA 5A5XA 2DWHA 2DXYA 3I5OA 3ZKLA 2Z23A 3M3FA 3W9WA 3MVWA 4H8JA 4JB7A 4DDDA 4G68B 1OQGA 5H8SA 2OK2A 3IAZA 2DE2A 3CSGA 4DIGA 4KYSA 2DE4A 2VD3A 1XHYA 3A3UA 1LAHE 1NMUA 2RINA 3KN7A 3PPNA 3Q26A 4GL0A 4MH5A 1SD3A 4NF8A 2YPNA 3SEXA 3RN8A 1JW5A 3UGWA 4FATA 5AA3A 4XXUA 1FQBA 2ONRA 3T22A 5I56B 4LZ7A 5DYHA 4NWDA 5JTYA 4X1DA 3K0VA 3KZGA 3ODBA 5I2NB 2PMSA 3S2VA 4NF6B 1PB8A 2HAUA 5I59B 1QW0A 4JDFA 1N0TA 2G29A 1H44A 1FQDA 4LUBA 4ZS9A 5L8DA 4F31B 1Y20A 5ISUA 2FYIA 3LUYA 1IUDA 1SBPA 4POWA 4LQ2A 3UP9A 1AL3A 5H8QA 4IY5A 3PD9A 4JWYA 5ITOA 4F1VA 1B0HA 1BLFA 3Q29A 4O3CA 5I58B 1EH3A 1ELJA 1YAEA 2DYXA 3BFUA 4KQPA 4QFPA 3V5AA 3W9VA 4AB6A 3DP8A 3HCQA 1OIBA 1B5IA 3RGYA 1F9BA 1HSEA 4E0WA 4FECA 3VVEA 2QS1A 4EQ9A 4RPOA 3KSXA 1BKAA 3SEVA 2UVIA 2PT1A 4H8IA 3RLFE 1R9QA 2DWIA 2NUVA 4K3FA 3HV1A 1ZTYA 4RYAA 5DTBA 4FAJA 3VXCA 2O7UA 5F7VA 2ZNUA 4G68C 3TTLA 4EUOA 3L6HA 2Q2AA 2XXYA 1VSOA 2O6AA 4G8NA 3GZGA 2REGA 2A5SA 3C31A 3EF7A 4R9FA 4BDLA 2P2AA 2RC9A 3C36A 3N6UA 1QVSA 4XKPA 1I6AA 4U1ZA 3MW0A 4JBZA 5H8NB 4U23A 5KCJA 1FQCA 4UA8A 2O51A 1EZOA 4C1UA 4EQBA 4U4SA 4TOZA 3PV0E 1LGBC 2B3BA 3FASA 4Q30B 4YB5A 3EPEA 4RK9A 3ZKKA 1H45A 2I58A 2X26A 3R6UA 3ECRA 4H5GA 4IY6A 4PFWA 2PBWA 3VLUA 2BJJX 4KPTA 2XXVA 4KFQA 4R74A 4NF5A 1MY2A 1URSA 3VXBA 5IKBA 1TFAA 3MP8A 2I0CA 1B1HA 5CBRA 3O2AA 1D9VA 3USDA 3RT8A 4NF4B 1FW0A 5TP9B 4YZZA 5JTYB 1POY1 4ISUA 5DT6A 2GHAA 4DE8A 1XVXA 4G4PA
chains in the Genus database with same CATH superfamily
2F6GA 3EHSA 4IO5A 1B7ZA 4R2BA 1A54A 2F34A 2H9BA 4E0XA 2Q89A 1HSLA 1LBYA 1EYJA 4OA4A 2VGQA 2UXAA 3MP1A 2RCBA 1IMBA 3K01A 2HAVA 3FJ7A 1RDZA 3IL1B 1LBZA 4BDRA 4NAPA 4N6KA 2PFYA 3I3VA 2W7YA 4AQ4A 4P9KA 1UIVA 3QAXA 1K9YA 4FIMA 2Q2CA 3LUZA 3TODA 1II5A 2V3UA 1GR2A 3CHGA 2HPGA 2VHAA 3NOHA 2Z8FA 2OWTA 1ZJLA 3IB2A 1RKMA 3VV5A 1JW1A 4O3BA 5H8NA 3C33A 4YKJA 4R75A 5J16A 4F39A 4N07A 5FTIA 4G77A 4O94A 3E79A 1POTA 3FGSA 4OVRA 1SW4A 3RYDA 2KR0A 2V25A 1A7LA 2XXXA 3C35A 4PAKA 1FQFA 1HSJA 4M1VA 3OO9A 1KWHA 3WAEA 2I4CA 2LAOA 5M2VA 4GL8A 3KN3A 3WAFA 2KLFA 2PFZA 4Z7EA 4N91A 1B3HA 1G0HA 2E0SA 2JJKA 3V8XB 5DEXB 1MXZA 2WYKA 2GHBA 4QXDA 2QS2A 4OTEA 3SERA 4PF8A 1FTAA 2Q88A 3TTRA 1PB7A 1TT1A 2CMOA 3FV2A 5EHSA 4HCYA 1I6BA 2ZZVA 4IO2A 1Y3NA 4OVJA 4DZ1A 4R9GA 1JVXA 3U1OA 3E9XA 4GX4A 3TCFA 5H8FB 3K6UA 3ILTB 2XA5A 1NV4A 4FE8A 4PFYA 1YCJA 3PPOA 1KZ8A 5FHOA 3K02A 3PMWA 4X9TA 3U72A 4DLDA 3TPAA 4I3EA 1L5TA 3IOVA 3OXNA 4QSEA 3FZVA 5JEIA 1MQJA 5KCJB 2WBDA 4IGRA 1ANFA 4QF9A 3H06B 3B7DA 3E3KA 1DOTA 2DVCA 2RKMA 1MDP1 2QSXA 4MMPA 1P99A 1URGA 4F1YA 4NEDA 3CFLA 5EYHA 4YAHX 2DS9A 2X7PA 3ZSFA 3C34A 1B7UA 3HN0A 4PAIA 4ECFA 1SPIA 4UACA 3A3CA 4GWXA 4LP2B 3IJXB 3RPWA 2HQ0A 5EYGA 2HEUA 4OANA 3R7XA 2KQZA 1FBGA 1I69A 1EU8A 1MQGA 4GX3A 1FPDA 5I3SA 4PE5B 1NKXA 4Q8RA 1P1QA 4DXUA 3S9MC 3B50A 5AA1A 3N26A 3UA8A 4NQ8A 4R6KA 1B0LA 4LONB 1MPCA 4RY1A 2ZYOA 3V83A 1LFGA 2FIXA 2OZZA 5EYFA 4EXKA 2XXQA 4PCDA 1MY0A 2R9JA 5AA2B 4OHNA 2FIEA 3KOSA 1AIVA 2HZKA 3CG1A 3OSQA 3RT6B 1H3DA 4MJOA 5H8HA 3MVXA 4DCYA 1XC1A 1LFIA 3G3GA 4QSDA 3KN8A 3MP6A 1NV3A 3BIHA 4JSOA 1FBHA 1YZ0A 3HPIA 3IFCA 2E1SA 4QHQA 4F29A 3DM0A 4O7MA 4FEBA 1FPKA 1LAXA 5ET7A 2RC8A 4P1EA 3FJGA 4C0RA 2ZNTA 4KCCA 3GXAA 3G3JA 3VFJA 2XXWA 3UIFA 3G3FA 2HZLA 3JV9A 3MZBA 5LTCA 4R6HA 5BWJA 4NWCA 4P11A 1FPJA 3FXQA 1VFEA 5T3JA 2F5XA 4N81A 1B3LA 4HW8A 1MQHA 4FBPA 2I3WA 4F3BA 2F3BA 3VLVA 3HHGA 4JVCA 3TKDA 4HE2A 2I48A 4OFLA 4ZEBA 4XIGQ 1FCKA 1UTHA 3HSTA 3MUQA 1EZ9A 5DVIA 1FBFA 1FTOA 4IO7A 4MFIA 1MDQA 1N04A 2XXPA 1ZKBA 2Q74A 1OLAA 1B52A 2A5TA 1M5EA 4OETA 3M3LA 4NHBA 3H3GA 4EF1A 2ZYKA 2I0BA 4XFEA 3H6UA 3KC0A 4HE0A 4MCOA 1BP5A 4IO6A 3QUFA 3T9XB 1MXVA 4NF8B 3TTKA 1JEUA 5A5XA 2DWHA 3W9WA 3MVWA 4H8JA 4I3YA 5H8SA 2DE2A 4NF8A 3SEXA 5AA3A 5I56B 2ONRA 4NF6B 4JDFA 5L8DA 5ISUA 3LUYA 4LQ2A 1IMAA 3UP9A 1B0HA 4OVPA 3RGYA 3VVEA 5EQ7A 1ZTYA 4GWYA 4RYAA 2O7UA 4X04A 3L6HA 1VSOA 3SZPA 3N6UA 4XKPA 4U1ZA 1FQCA 1EZOA 2O51A 4C1UA 4U4SA 3PV0E 3ZKKA 4RK9A 5EQ8A 2BJJX 4NF5A 1URSA 1TFAA 3MP8A 1XI6A 1FW0A 4HXVA 4YZZA 1POY1 2F78A 4I1DA 1USYH 4MNPA 4P1LA 5BUUA 4ZEIA 1JETA 1B3GA 4X1BA 5CI5A 1GTKA 3KJ7A 2RCAA 4QFOA 2P1SA 2XXTA 4YB6A 4YMBA 3MAMA 4F3SA 5ET6A 5AA2A 3KOTA 2XWOA 2DSFA 3RQTA 4P3LA 3OD7A 3FVGA 3MZ1A 2P3VA 5H8HB 1I6QA 3MJNA 5A5LA 3SEWA 4GBVA 1G0IA 1NV1A 1B46A 4OYVA 1NNFA 2HFBA 3O97A 2O84X 5L9MA 3KBZA 5EQAA 4O3AA 2D21A 5CC2A 1B5HA 3K6XA 1P1UA 5ET5A 1DMBA 3BBRA 5KDTA 4QFKA 1O63A 2ZZXA 3O29A 3UORA 4XKRA 2FHYA 3FATA 2XWVA 1Q1KA 1Z7NE 4I9DA 1A99A 4NE4A 3AXFA 4X48A 3PPPA 4BLAA 1B4HA 2QRYA 2XHDA 4NF4A 2A5TB 1FPBA 1NNPA 1IEJA 3IORA 4R6YA 1KA0A 2Q8JA 2OX3A 4YICA 4DI3D 4ELPA 2F7CA 3MC2A 5I7IA 2H25A 2O1LA 2F97A 1EYKA 1LAGE 4XF5A 4EDPA 4PP0A 3B6QA 3P7IA 5IZ3A 2ZXTA 1LB9A 3OO7A 5B7DA 1BIYA 2QMWA 1DCUA 3ONMA 1B05A 3OOAA 5FTHA 3T1BA 3Q28A 4MF3A 1FJ9A 5I5PA 4XEQA 3LSWA 4IB2A 4N6PA 3PGFA 3IB0A 2QJEA 4GOTA 4OFJA 4NTLA 3C4MA 3LSFB 1A8EA 4U4XA 5DW8A 1FQEA 2Z8EA 3C32A 3TYHA 3U93A 4PETA 2XWKA 2DDKA 1IZ1A 3V89B 3EN3A 2WX9A 1SI0A 1URDA 5CRYA 2ONKE 4HE1A 3OEMA 4MBPA 2ZYMA 5CMBA 4KD5A 1XT8A 1FPIA 4PFTA 2QVUA 3KG2A 2UVHA 2VPNA 1Y4TA 4BDNA 1OLCA 2UYEA 1FPLA 1NNKA 3IK6B 2I3VA 2DE3A 2FBPA 1YYZA 1B5JA 1EYIA 3G3KA 2D3IA 3PTYA 4RK2A 2V84A 3UN6A 4G68A 4N8GA 1SW5A 5AE4A 3OO6A 1IQ7A 4DI4B 4L17A 3FIRA 4Z0IA 1TWYA 3QYTA 4ESXA 3U94A 1US5A 2L5VA 4NF5B 4AS4A 4GWZA 3RPLB 4LA9A 1UQWA 2ZMBA 3K6WA 2Y5LA 3H03A 1MG1A 2QL3A 2UVGA 2XX9A 4F2OA 3TFLA 1XVYA 4OVQA 2HXWA 1MY4A 1VFDA 5I57B 1JW4A 1FRPA 2OLBA 3TZAA 1OVTA 3H6WA 1S7YA 4XTCQ 3DELB 1RYOA 1JP4A 3IJOB 1UTBB 2QS4A 2Y84A 1Q9DA 1R9LA 3K2DA 4GVOA 4ZZEA 3A29A 4ESWA 4G2ZA 1NH7A 1LBCA 2XXIA 2GH9A 3KGCA 3QSLA 3M3KA 5KDTB 3QK6A 3TCGA 4ZE8A 1Y1ZA 1MPDA 1Q35A 4PBQA 1NUZA 1N3WA 2DXRA 4GWOA 1DK4A 4GIZA 1RDYA 1QJMA 3H7MA 3CI8A 3R26A 3ROJA 1XS5A 3IO4A 1MM6A 3JYRA 3JZJA 2IA4A 2O68A 2RF1A 3VVFA 1AMFA 3OSRA 2NVUB 1MY3A 4RXLA 5A5XB 1GV8A 2XXUA 4P47A 3MVZA 5K2XA 2CZIA 1FJ6A 1MQDA 1NI9A 4OEUA 5IZ3B 5CMKA 2Y7IA 5JK4A 4BDQA 1IXIA 4N17A 2I49A 1FPFA 1YXIA 4N8YA 4YU0A 2H4IA 4KR5A 1M5BA 3N5LA 1YPNA 4I62A 4ZEKA 3TCHA 1SVXB 1Y9UA 2UVJA 2OWSA 2YJPA 1NV7A 5L9SA 3O6HA 3OELA 2DXYA 3ZKLA 2Z23A 4NF0A 4DDDA 4G68B 2OK2A 4KYSA 2DE4A 2VD3A 1NMUA 3KN7A 4FATA 1SD3A 3RN8A 4JVIA 1NUWA 4NWDA 4X1DA 3ODBA 3S2VA 1N0TA 2G29A 1FQDA 4F31B 2HXRA 2FYIA 1SBPA 1AL3A 5ITOA 4O3CA 4NG7A 4KQPA 4AB6A 3DP8A 4GWSA 3HCQA 4EQ9A 1F9BA 4RPOA 3RLFE 2DWIA 2NUVA 4EUOA 4G68C 2Q2AA 2REGA 4R9FA 3EF7A 2P2AA 3C36A 4YB5A 4TOZA 3FASA 4Q30B 2I58A 3R6UA 2QVVA 3ECRA 4GBWA 4KPTA 3VXBA 5IKBA 1B1HA 5CBRA 4NF4B 5TP9B 4ISUA 5I58A 4DE8A 4JVDA 2MKZA 4FEDA 1B32A 2I4BA 2ONSA 4PQJA 1FTJA 4M4GA 5H8FA 3HO7A 1P1OA 1P1NA 1NV2A 1NNTA 4OESA 4Q0CA 4OEVA 2H99A 4F18A 4KI0E 3Q27A 4JWXA 1MPBA 1MXYA 1UTBA 2REJA 2ZZWA 4U1OA 1OQHA 3SEYA 5FBPA 4H5FA 2AL4A 4OXVA 3IR1A 2Y7WA 3T9VA 1PB9A 3EKIA 1NUYA 1Z7ME 3KJTA 4BDOA 4G8HA 4R2FA 4MX6A 3TQLA 3ZS6A 3O6IA 3TTNA 4PFIA 3TEPA 3QIMA 3RNNA 3PUYE 3T0JA 4RJZA 1M5CA 1QUJA 3LBSA 3PU5A 3OMBA 5ESYA 3FV1A 4X8RA 3FD3A 3KSJA 2NXOA 3VE1B 1J1NA 4H65A 3PMVA 1MM7A 3PUXE 4MEVA 1LCTA 4NMYA 1M5FA 2XXKA 1T0KA 1DPPA 3BIGA 1ATGA 3FJMA 2DP8A 4XKNA 1N3XA 1OVBA 3K1MA 3MBPA 1SW2A 4QFLA 3S9NC 4N4UA 5CMCA 1FTMA 4YKKA 1LSTA 1Y3PA 2Y7PA 4G8MA 4H46A 1CE2A 1SW1A 1R1NA 5ITPA 3U65A 2QMXA 3RTWB 3RPLA 1AOVA 4GF8A 1SYHA 3ILUB 4P0IA 2M8CA 2WEFA 4ND9A 5FHNA 3FUZA 3O66A 1O7TA 3T9HB 2V3TA 4C1TA 5EHMA 5CM6A 1NUXA 1SI1A 1FTKA 3FXRA 4RPNA 3IB1A 4P56A 1D9YA 3K4UA 1LFHA 3A09A 1IMEA 2R6GE 3Q25A 3RUMA 3IFAA 1FPEA 2B4MA 4FORA 3MQ9A 3CFXA 4ZZAA 5TP9A 5ELVA 2P3NA 4GX6A 2DWJA 1N7WA 5I57A 5I2KA 2Z8DA 3OO8A 3VDFA 3MPKA 1DSNA 5HPQA 4BDMA 4WKMA 1N76A 1DBZA 4OVSA 1QKBA 2ANJA 1UTHB 3FVNA 4N13A 1QUIA 4O7IA 2XD2A 4HCWA 1NV5A 4XKQA 3BKIB 1A55A 4IO4A 1LBBA 3GBAA 2DOJA 1US4A 3RY3A 1AH5A 2DWAA 1LB8A 3O6GA 4FJPA 3QUJA 2OJTA 2HCAA 1MY1A 4GLIA 1BTJA 4ZECA 3QMFA 1B3FA 5TU0A 1IITA 4F1UA 3GBBA 3DLNA 4MLQA 4AB5A 1QUKA 1O64A 4IO3A 5DVFA 4NN3A 3D4GA 2XD3A 3PD8A 4THIA 5KZTA 3LSXA 1VDWA 3E13X 5LOMA 2VOZA 1SYIA 1ZU0A 3SKPA 5I56A 1JQFA 2V3QA 1GVCA 2OBGA 3K00A 1B40A 3FVOA 2HHMA 3USDA 2F35A 1JEVA 3CRBA 2G93A 4F22A 1PBQA 5IAIA 2O7IA 3THIA 2O1MA 3EQ1A 4EXLA 4PTKA 4OZ9A 1IMDA 1D9QA 2B65A 1WODA 2V93A 4JWOA 4PBHA 1FQAA 1VE4A 1ZBMA 4JSDA 1B1XA 4P8BA 5I2NA 1GGGA 1NFTA 3B6WA 3TELA 1QGXA 4Q5TA 3VLWA 3CIJA 3PPQA 4U2RA 3E78A 5IM2A 1RYXA 3LSLA 3U8QA 4I40A 3CSBA 3HFUA 1MH4A 3H6TA 2WBBA 1JNFA 1IIWA 4GXAA 1SDXA 1MXXA 2ZYNA 1A40A 1FBEA 4U22A 2XX7A 2PVUA 2UYFA 3ISPA 1IMCA 4NF6A 4WEDA 4UABA 1R6ZA 2F3DA 1NV6A 4F3GA 2H98A 3S4UA 1EZPA 5CMMA 3O28A 2Y7RA 5J1DA 3E4RA 3C9HA 4WXJA 2F7BA 5CBSA 3EHTA 1S9TA 1USYE 1Y4CA 3FXBA 1D4NA 1Y1MA 3OEKA 3I5OA 3CSGA 3PPNA 4MH5A 4XXUA 1FQBA 3T22A 5DYHA 3KZGA 1PB8A 2HAUA 1QW0A 4ZS9A 4OVTA 1IUDA 4JWYA 1EH3A 1ELJA 1YAEA 3BFUA 4QFPA 3W9VA 1B5IA 4FECA 2QS1A 3KSXA 4KXPA 3SEVA 4K3FA 3HV1A 1K9ZA 3VXCA 2ZNUA 3TTLA 2O6AA 4G8NA 3GZGA 2A5SA 3C31A 2RC9A 4AS5A 1QVSA 1I6AA 4JBZA 5H8NB 2BJIA 1AWBA 1LGBC 1NV0A 2XXVA 4KFQA 4R74A 1MY2A 2I0CA 3O2AA 1D9VA 2CEXA 5JTYB 5DT6A 4G4PA 1B4ZA 2CZHA 3PPRA 3TAJA 1LBVA 2QVRA 3QXMA 1PBPA 1IXHA 2FNCA 2QS3A 1VR5A 4H0WA 4N6DA 3D4CA 1SQYA 1H43A 3KEIA 4TLLB 4TQUQ 4PGNA 4PFBA 3SETA 1D3KA 1FTLA 4QSCA 1CB6A 4DXCA 5H8QB 3LC8A 4GD5A 2ABHA 4PDHA 4MIJA 2B4LA 3I6VA 3FXUA 1QULA 3FVKA 3UK4A 1P1WA 4OWDA 1MS7A 2ALUA 1B6HA 4O8MA 2X7QA 4POXA 4GWUA 5AA2D 2F6PA 4R73A 1B58A 1FBCA 5L9OA 2O69A 4DXBA 3SDFA 1WDNA 3DP4A 3U92A 5F1QA 1XOCA 2FVZA 4ZE9A 4KYEA 5I84A 3MZ9A 1B7HA 5IZZA 1FBDA 4PFUA 4F2QA 3H4ZA 4PFRA 5TPAB 3G3HA 4GFRA 4DCXA 2VD2A 2VPOA 4P0GA 1N84A 2F8DA 1WVJA 4MNCA 1UIUA 2Z22A 5TPAA 2PT2A 2ZNSA 4I8CA 1Y3QA 3L6GA 5LDZA 2I6EA 1B2HA 2CZKA 1FBPA 4QBAA 5IGAA 1IMFA 2GRVA 4U21A 2OWZA 3PUWE 4LATA 2NOOA 3B6TA 2AL5A 1IXCA 1MH3A 2F36A 4QFNA 3G3IA 4RA1A 1IXGA 1TFDA 3T93B 5B70A 1LAFE 2V4CA 2QFLA 3TQWA 4PE3A 5AA4B 5ICTA 3T96B 4G61A 4EF2A 4PF6A 3PUZE 2CEYA 2CZLA 3EHUA 1LEVA 1LCFA 2PYYA 2GQ1A 3F11A 4EQ7A 4LQ5A 3TMGA 2H5YA 1FPGA 4WEPA 2ESNA 1S50A 1LBXA 4PAFA 3IO6A 2XXHA 5ET8A 2Y7KA 2XX8A 2Q8MA 4ELOA 3TUSA 5K2YA 5I59A 3VVDA 5ICQA 2D5WA 3T9UA 4IR8A 2DQVA 1B51A 3PUVE 4QRZA 1NH8A 1B9JA 2AYSA 3IOWA 2OCUA 3K1PA 4GRKA 1ZIUA 1QKAA 3RTFB 5EQ9A 2DVZA 1BK4A 4NGUA 1DPEA 4R72A 1FSAA 4GWWA 4LZ8A 1PDAA 3MSTA 2IEEA 4N15A 4H6DA 1INPA 4YKIA 3CVGA 4OENA 4ONYA 1MXWA 4YB7A 2Y5KA 1KA1A 4H67A 4MLVA 3S9LC 2WKYA 1N7XA 3K1NA 1RDXA 2PX1A 2QPQA 5IZ1A 3O9PA 1PC3A 4YKPA 1M5DA 1DTZA 2RC7A 1B3EA 2THIA 3MYUA 2FA7A 5HM4B 4H45A 3T66A 3DP6A 3LR1A 1MQIA 1DTGA 3W15C 3IX1A 3K6VA 4HTGA 3MPLA 1MRPA 3CFZA 3KBRA 4KHZE 4LVQA 3SEUA 4F3PA 5I2KB 2R71A 4ELQA 2XWIA 4GXSB 4ZEFA 2B3FA 2VP1A 3D1RA 1PEBA 4KYDA 2YLNA 4OERA 2XXRA 1CNQA 1LLSA 3CG3A 4PGPA 1MXUA 4TLMB 3MWBA 2F7AA 4OQOA 3OENA 1LBWA 4F19A 3IOTA 1A8FA 2AIXA 2PCRA 3GLBA 4ZDMA 4YMAA 3KFMA 3S9EA 3H6VA 5AA4A 1ZLQA 4RNSA 3PMXA 1TXFA 3IOUA 4OMBA 2WYPA 5HBCA 5DEXA 1OMPA 4OFOA 1H76A 3TTMA 2Q9TA 3TDJA 1NL5A 4GQOA 3N94A 4IGTA 3N6TA 3M8UA 4JXIA 3HHFA 5DVJA 3MVYA 4ELRA 1JVYA 4LZ5A 4MNIA 2P0SA 4KCDA 3BFTA 1YTVA 4H1XA 2R8TA 4HS7A 2NWJA 4ZEDA 2GFEA 5FHMA 3G7WA 2VT5A 3B8BA 1ZMGA 3CR9A 5F24A 3M3FA 4JB7A 3KC1A 1OQGA 3IAZA 4DIGA 3GYYA 1XHYA 3A3UA 1LAHE 2RINA 3Q26A 4GL0A 3SESA 2YPNA 1JW5A 3UGWA 4LZ7A 5JTYA 3K0VA 4PDDA 5I2NB 2PMSA 4LN5A 5I59B 4LUBA 1H44A 1Y20A 4POWA 5H8QA 3FBPA 4IY5A 3PD9A 4F1VA 1BLFA 3Q29A 5I58B 2DYXA 3V5AA 1OIBA 4MAGA 4NX1A 1HSEA 4E0WA 1BKAA 2UVIA 2PT1A 4H8IA 1R9QA 5DTBA 4FAJA 3LV0A 5F7VA 2XXYA 4BDLA 3MW0A 4U23A 5KCJA 4UA8A 4EQBA 2B3BA 3EPEA 1H45A 2X26A 4IY6A 4H5GA 4PFWA 4PC9A 2PBWA 3VLUA 3RT8A 4MHFA 2GHAA 1XVXA
chains in the Genus database with same CATH topology
2F78A 1B4ZA 4I1DA 1USYH 2F6GA 5BUUA 4FEDA 1JETA 3EHSA 3PPRA 4IO5A 4ZEIA 1B32A 1B7ZA 4R2BA 1A54A 2F34A 3TAJA 1B3GA 2I4BA 3QXMA 1PBPA 4X1BA 2ONSA 1IXHA 1GTKA 5CI5A 3KJ7A 2FNCA 2QS3A 2H9BA 2RCAA 4QFOA 2P1SA 4PQJA 1FTJA 1VR5A 4M4GA 4E0XA 4H0WA 2Q89A 2XXTA 4YB6A 1HSLA 5H8FA 4YMBA 3D4CA 3HO7A 3MAMA 1SQYA 1P1OA 1H43A 1P1NA 4F3SA 4OESA 1NNTA 3KEIA 3KOTA 5AA2A 4Q0CA 2DSFA 2VGQA 2UXAA 4OEVA 4TLLB 2H99A 3RQTA 4F18A 4TQUQ 3MP1A 3SETA 2RCBA 1D3KA 3OD7A 1FTLA 3FVGA 3K01A 3MZ1A 4KI0E 4QSCA 1CB6A 3Q27A 4JWXA 4DXCA 1MPBA 1MXYA 1UTBA 2HAVA 3LC8A 5H8HB 2REJA 5H8QB 1I6QA 3FJ7A 4GD5A 3MJNA 2ABHA 4U1OA 3IL1B 3SEWA 1OQHA 3I6VA 3FXUA 1QULA 4BDRA 3FVKA 1B46A 3UK4A 4OYVA 3I3VA 1NNFA 2HFBA 3O97A 1P1WA 4OWDA 2W7YA 4AQ4A 2O84X 5L9MA 3SEYA 4H5FA 2AL4A 4OXVA 5ICQA 1MS7A 2ALUA 2D21A 2Y7WA 1UIVA 3IR1A 3QAXA 4O3AA 3T9VA 1B5HA 1PB9A 4FIMA 1B6HA 2Q2CA 3K6XA 1P1UA 1DMBA 3BBRA 3TODA 5KDTA 1Z7ME 2X7QA 3KJTA 1II5A 2V3UA 4POXA 1GR2A 5AA2D 4BDOA 2VHAA 4QFKA 1O63A 2Z8FA 4G8HA 2OWTA 1ZJLA 2F6PA 4R2FA 3IB2A 3O29A 1B58A 4R73A 4XKRA 1RKMA 3TQLA 1JW1A 3UORA 3VV5A 3ZS6A 3O6IA 3TTNA 5L9OA 4O3BA 3FATA 1Q1KA 5H8NA 1Z7NE 3C33A 4I9DA 4YKJA 1A99A 2O69A 4NE4A 3QIMA 4R75A 4DXBA 3RNNA 3PUYE 1WDNA 3AXFA 3DP4A 3SDFA 4N07A 4X48A 4G77A 5F1QA 5FTIA 1XOCA 3PPPA 3U92A 4F39A 4RJZA 1M5CA 4ZE9A 1QUJA 4BLAA 4KYEA 5I84A 1B4HA 3MZ9A 2QRYA 1B7HA 2XHDA 2A5TB 3LBSA 3PU5A 4NF4A 4PFUA 4F2QA 3OMBA 1NNPA 3H4ZA 1POTA 1IEJA 3FV1A 3IORA 4R6YA 3FD3A 3FGSA 3KSJA 5TPAB 1SW4A 2Q8JA 3G3HA 2V25A 4YICA 1A7LA 2NXOA 2XXXA 4GFRA 3C35A 3VE1B 2F7CA 4DCXA 4ELPA 1FQFA 2VD2A 1HSJA 3MC2A 4M1VA 1J1NA 3OO9A 4H65A 1N84A 4P0GA 2F8DA 1WVJA 1KWHA 3PMVA 1MM7A 3PUXE 2H25A 1UIUA 1LCTA 2Z22A 5TPAA 2PT2A 2ZNSA 4I8CA 3WAEA 1Y3QA 2O1LA 2I4CA 3L6GA 2LAOA 5M2VA 2F97A 2I6EA 1B2HA 1LAGE 4GL8A 3KN3A 4NMYA 3WAFA 2KLFA 1M5FA 1T0KA 1DPPA 4EDPA 4Z7EA 4PP0A 3B6QA 3P7IA 1B3HA 2E0SA 1ATGA 1LB9A 2ZXTA 3FJMA 3OO7A 2DP8A 5DEXB 4XKNA 3V8XB 5B7DA 1MXZA 1BIYA 2GHBA 2QMWA 2QS2A 4OTEA 3ONMA 1N3XA 1B05A 1OVBA 2GRVA 3K1MA 3OOAA 3SERA 5FTHA 4U21A 3MBPA 1SW2A 3PUWE 4QFLA 3Q28A 4LATA 3S9NC 2NOOA 4MF3A 2Q88A 3TTRA 1PB7A 3B6TA 1TT1A 2AL5A 5CMCA 2CMOA 3FV2A 5EHSA 1IXCA 1FTMA 3LSWA 4YKKA 4HCYA 1MH3A 2F36A 1I6BA 1LSTA 4IO2A 1Y3NA 1Y3PA 2Y7PA 4IB2A 4OVJA 4QFNA 4N6PA 3G3IA 3PGFA 4G8MA 1IXGA 1CE2A 1TFDA 4RA1A 3T93B 1SW1A 1LAFE 4DZ1A 5B70A 4R9GA 1JVXA 3IB0A 1R1NA 2QJEA 3TQWA 5AA4B 5ICTA 4GOTA 4OFJA 3T96B 5ITPA 4NTLA 3U1OA 3C4MA 2QMXA 3E9XA 3RTWB 3LSFB 4EF2A 1AOVA 4GF8A 3TCFA 1SYHA 3ILUB 4P0IA 5H8FB 2M8CA 3K6UA 3PUZE 3ILTB 1A8EA 2CZLA 4U4XA 3EHUA 4ND9A 4FE8A 4PFYA 5FHNA 1LCFA 2PYYA 1YCJA 3FUZA 3O66A 3PPOA 1FQEA 1O7TA 2Z8EA 3F11A 3T9HB 4EQ7A 3C32A 3TYHA 2V3TA 4C1TA 5FHOA 4LQ5A 3U93A 3TMGA 2H5YA 4PETA 3K02A 3PMWA 4WEPA 4X9TA 5EHMA 3U72A 5CM6A 2ESNA 4DLDA 1S50A 1SI1A 1IZ1A 1FTKA 3TPAA 3V89B 1L5TA 3EN3A 3FXRA 3IOVA 3OXNA 4RPNA 4QSEA 3IO6A 2XXHA 1SI0A 1URDA 3FZVA 5JEIA 2Y7KA 3IB1A 1D9YA 1MQJA 2ONKE 5CRYA 5KCJB 4IGRA 3K4UA 1ANFA 2XX8A 3OEMA 4MBPA 2ZYMA 1LFHA 3A09A 4QF9A 4ELOA 5K2YA 5CMBA 3H06B 3TUSA 3B7DA 4KD5A 1XT8A 4PFTA 5I59A 3E3KA 1DOTA 2R6GE 2DVCA 3VVDA 2RKMA 3KG2A 2D5WA 2UVHA 1MDP1 3T9UA 1Y4TA 2QSXA 3Q25A 3RUMA 4BDNA 3SESA 1OLCA 2DQVA 1B51A 1P99A 1URGA 3CFXA 3MQ9A 3PUVE 4FORA 4QRZA 4ZZAA 2UYEA 5TP9A 1NH8A 1B9JA 1NNKA 4NEDA 5ELVA 3CFLA 4F1YA 3IK6B 2DWJA 2AYSA 2I3VA 3IOWA 2OCUA 2DS9A 2X7PA 3K1PA 4YAHX 2DE3A 4GRKA 1N7WA 3ZSFA 3C34A 5I57A 1B5JA 5I58A 5I2KA 1B7UA 1ZIUA 2D3IA 2Z8DA 3G3KA 3OO8A 3VDFA 3HN0A 1QKAA 3MPKA 3RTFB 4ECFA 1DSNA 4RK2A 4UACA 5HPQA 4BDMA 3A3CA 2V84A 4WKMA 3UN6A 1N76A 4G68A 4LP2B 1SW5A 5AE4A 3IJXB 3OO6A 2DVZA 1IQ7A 4L17A 3FIRA 3RPWA 2HQ0A 1QKBA 4Z0IA 1TWYA 1UTHB 2ANJA 1DPEA 2HEUA 4R72A 3FVNA 4N13A 1QUIA 3QYTA 3R7XA 3U94A 4ESXA 2XD2A 1I69A 4HCWA 1US5A 1EU8A 1MQGA 4LZ8A 1PDAA 4XKQA 4NF5B 3BKIB 2IEEA 1A55A 4IO4A 4PE5B 1LBBA 3GBAA 2DOJA 4LA9A 1UQWA 1US4A 1NKXA 2ZMBA 3K6WA 4H6DA 1P1QA 1AH5A 3RY3A 4Q8RA 4DXUA 3S9MC 4YKIA 5AA1A 2DWAA 3N26A 3UA8A 3H03A 1LB8A 1MG1A 3CVGA 2QL3A 3O6GA 4FJPA 4OENA 3QUJA 4R6KA 1B0LA 4LONB 1MPCA 4ONYA 4RY1A 2ZYOA 2OJTA 2UVGA 3V83A 1MXWA 2HCAA 1LFGA 1MY1A 2XX9A 4YB7A 4F2OA 3TFLA 1XVYA 4H67A 4MLVA 3S9LC 2HXWA 2WKYA 4GLIA 1MY4A 1N7XA 1VFDA 3K1NA 2OZZA 2PX1A 1BTJA 4ZECA 5I57B 5EYFA 1JW4A 2QPQA 1B3FA 4EXKA 2OLBA 3TZAA 2XXQA 1OVTA 3O9PA 3H6WA 1MY0A 2R9JA 1PC3A 1S7YA 4OHNA 4XTCQ 4YKPA 1IITA 5TU0A 5AA2B 4F1UA 3KOSA 1AIVA 1M5DA 2HZKA 3CG1A 1DTZA 2RC7A 3DLNA 1B3EA 3GBBA 3OSQA 4MLQA 2THIA 3DELB 3RT6B 1RYOA 1H3DA 4AB5A 1QUKA 3IJOB 1O64A 4IO3A 5DVFA 1UTBB 3MVXA 2FA7A 5H8HA 2QS4A 2Y84A 3D4GA 2XD3A 3PD8A 4THIA 1XC1A 4DCYA 5HM4B 5KZTA 3LSXA 1LFIA 1R9LA 3E13X 3G3GA 4QSDA 5LOMA 3KN8A 3K2DA 2VOZA 3MP6A 4GVOA 3T66A 1SYIA 1ZU0A 3DP6A 3LR1A 1MQIA 3SKPA 5I56A 4JSOA 4ZZEA 1DTGA 1JQFA 4ESWA 2V3QA 3HPIA 1GVCA 4G2ZA 1NH7A 2E1SA 3W15C 1LBCA 4QHQA 4F29A 2XXIA 2OBGA 3K00A 1B40A 2GH9A 3FVOA 3IX1A 3K6VA 1MRPA 3CFZA 3KBRA 3DM0A 3KGCA 3MPLA 4KHZE 4LVQA 3QSLA 3SEUA 2F35A 4FEBA 5I2KB 4F3PA 1JEVA 2R71A 1LAXA 3M3KA 4ELQA 5KDTB 3CRBA 2RC8A 3QK6A 4GXSB 4ZEFA 2G93A 3FJGA 4C0RA 4F22A 1PBQA 2ZNTA 3TCGA 4KCCA 5IAIA 2B3FA 2VP1A 4ZE8A 1Y1ZA 2O7IA 1MPDA 1Q35A 3GXAA 3THIA 3G3JA 1N3WA 2O1MA 3EQ1A 1PEBA 3VFJA 4KYDA 2YLNA 4EXLA 2XXWA 4OERA 3G3FA 3UIFA 2HZLA 4OZ9A 2XXRA 3JV9A 2DXRA 4GWOA 1LLSA 3CG3A 3MZBA 4GIZA 2B65A 1WODA 2V93A 4JWOA 3TEPA 4R6HA 5BWJA 1QJMA 1MXUA 4NWCA 3FXQA 3H7MA 3CI8A 4P11A 4TLMB 3R26A 3MWBA 1FQAA 1VFEA 1VE4A 1ZBMA 5CC2A 2F7AA 2F5XA 3OENA 4JSDA 1B1XA 4OQOA 5I2NA 1B3LA 4HW8A 1GGGA 1NFTA 1XS5A 3IO4A 1MM6A 3B6WA 4F19A 3IOTA 1A8FA 2AIXA 3TELA 1MQHA 3JYRA 3JZJA 3GLBA 2I3WA 4ZDMA 4F3BA 4YMAA 2IA4A 2O68A 3VLVA 3HHGA 3KFMA 4Q5TA 3TKDA 3VLWA 3H6VA 2RF1A 3S9EA 3VVFA 5AA4A 1AMFA 3OSRA 1ZLQA 2NVUB 3CIJA 3PPQA 4U2RA 4RNSA 1MY3A 2I48A 4RXLA 5A5XB 1GV8A 2XXUA 1RYXA 3PMXA 1TXFA 3LSLA 4OFLA 3U8QA 3MVZA 5K2XA 3CSBA 4ZEBA 4XIGQ 3IOUA 4OMBA 1MH4A 3H6TA 1FCKA 1UTHA 1MQDA 3HSTA 1JNFA 3MUQA 1EZ9A 5HBCA 5DVIA 4OEUA 1IIWA 1FTOA 5CMKA 4GXAA 4IO7A 1SDXA 1MXXA 2Y7IA 4MFIA 5DEXA 1OMPA 1N04A 1MDQA 5JK4A 2XXPA 4OFOA 4BDQA 1H76A 1ZKBA 4HTGA 2ZYNA 1IXIA 1OLAA 3TTMA 1A40A 2Q9TA 1B52A 2A5TA 2I49A 2XX7A 4U22A 1M5EA 2PVUA 2UYFA 4OETA 3TDJA 1NL5A 4NF6A 3M3LA 4WEDA 4GQOA 3N94A 4IGTA 4YU0A 1R6ZA 2H4IA 3H3GA 4EF1A 3N6TA 4F3GA 2H98A 4KR5A 2ZYKA 3M8UA 4JXIA 3HHFA 5DVJA 2I0BA 3MVYA 3S4UA 4ELRA 1JVYA 1EZPA 5CMMA 1M5BA 3N5LA 3O28A 2Y7RA 4LZ5A 5J1DA 1YPNA 3E4RA 3C9HA 4I62A 4WXJA 2F7BA 5CBSA 2P0SA 3H6UA 4KCDA 1BP5A 3BFTA 1YTVA 4ZEKA 3EHTA 3TCHA 1S9TA 1SVXB 1Y9UA 3QUFA 4H1XA 2UVJA 4IO6A 1USYE 1MXVA 3T9XB 2OWSA 2YJPA 4HS7A 1Y4CA 2NWJA 2GFEA 4ZEDA 5FHMA 4NF8B 3TTKA 3G7WA 5L9SA 1D4NA 1ZMGA 1Y1MA 3O6HA 3CR9A 3OELA 1JEUA 3OEKA 5A5XA 2DWHA 2DXYA 3I5OA 3ZKLA 2Z23A 3M3FA 3W9WA 3MVWA 4H8JA 4JB7A 4DDDA 4G68B 1OQGA 5H8SA 2OK2A 3IAZA 2DE2A 3CSGA 4DIGA 4KYSA 2DE4A 2VD3A 1XHYA 3A3UA 1LAHE 1NMUA 2RINA 3KN7A 3PPNA 3Q26A 4GL0A 4MH5A 1SD3A 4NF8A 2YPNA 3SEXA 3RN8A 1JW5A 3UGWA 4FATA 5AA3A 4XXUA 1FQBA 2ONRA 3T22A 5I56B 4LZ7A 5DYHA 4NWDA 5JTYA 4X1DA 3K0VA 3KZGA 3ODBA 5I2NB 2PMSA 3S2VA 4NF6B 1PB8A 2HAUA 5I59B 1QW0A 4JDFA 1N0TA 2G29A 1H44A 1FQDA 4LUBA 4ZS9A 5L8DA 4F31B 1Y20A 5ISUA 2FYIA 3LUYA 1IUDA 1SBPA 4POWA 4LQ2A 3UP9A 1AL3A 5H8QA 4IY5A 3PD9A 4JWYA 5ITOA 4F1VA 1B0HA 1BLFA 3Q29A 4O3CA 5I58B 1EH3A 1ELJA 1YAEA 2DYXA 3BFUA 4KQPA 4QFPA 3V5AA 3W9VA 4AB6A 3DP8A 3HCQA 1OIBA 1B5IA 3RGYA 1F9BA 1HSEA 4E0WA 4FECA 3VVEA 2QS1A 4EQ9A 4RPOA 3KSXA 1BKAA 3SEVA 2UVIA 2PT1A 4H8IA 3RLFE 1R9QA 2DWIA 2NUVA 4K3FA 3HV1A 1ZTYA 4RYAA 5DTBA 4FAJA 3VXCA 2O7UA 5F7VA 2ZNUA 4G68C 3TTLA 4EUOA 3L6HA 2Q2AA 2XXYA 1VSOA 2O6AA 4G8NA 3GZGA 2REGA 2A5SA 3C31A 3EF7A 4R9FA 4BDLA 2P2AA 2RC9A 3C36A 3N6UA 1QVSA 4XKPA 1I6AA 4U1ZA 3MW0A 4JBZA 5H8NB 4U23A 5KCJA 1FQCA 4UA8A 2O51A 1EZOA 4C1UA 4EQBA 4U4SA 4TOZA 3PV0E 1LGBC 2B3BA 3FASA 4Q30B 4YB5A 3EPEA 4RK9A 3ZKKA 1H45A 2I58A 2X26A 3R6UA 3ECRA 4H5GA 4IY6A 4PFWA 2PBWA 3VLUA 2BJJX 4KPTA 2XXVA 4KFQA 4R74A 4NF5A 1MY2A 1URSA 3VXBA 5IKBA 1TFAA 3MP8A 2I0CA 1B1HA 5CBRA 3O2AA 1D9VA 3USDA 3RT8A 4NF4B 1FW0A 5TP9B 4YZZA 5JTYB 1POY1 4ISUA 5DT6A 2GHAA 4DE8A 1XVXA 4G4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F78 A;  1B4Z A;  4I1D A;  1USY H;  2F6G A;  5BUU A;  4FED A;  1JET A;  3EHS A;  3PPR A;  4IO5 A;  4ZEI A;  1B32 A;  1B7Z A;  4R2B A;  1A54 A;  2F34 A;  3TAJ A;  1B3G A;  2I4B A;  3QXM A;  1PBP A;  4X1B A;  2ONS A;  1IXH A;  1GTK A;  5CI5 A;  3KJ7 A;  2FNC A;  2QS3 A;  2H9B A;  2RCA A;  4QFO A;  2P1S A;  4PQJ A;  1FTJ A;  1VR5 A;  4M4G A;  4E0X A;  4H0W A;  2Q89 A;  2XXT A;  4YB6 A;  1HSL A;  5H8F A;  4YMB A;  3D4C A;  3HO7 A;  3MAM A;  1SQY A;  1P1O A;  1H43 A;  1P1N A;  4F3S A;  4OES A;  1NNT A;  3KEI A;  3KOT A;  5AA2 A;  4Q0C A;  2DSF A;  2VGQ A;  2UXA A;  4OEV A;  4TLL B;  2H99 A;  3RQT A;  4F18 A;  4TQU Q;  3MP1 A;  3SET A;  2RCB A;  1D3K A;  3OD7 A;  1FTL A;  3FVG A;  3K01 A;  3MZ1 A;  4KI0 E;  4QSC A;  1CB6 A;  3Q27 A;  4JWX A;  4DXC A;  1MPB A;  1MXY A;  1UTB A;  2HAV A;  3LC8 A;  5H8H B;  2REJ A;  5H8Q B;  1I6Q A;  3FJ7 A;  4GD5 A;  3MJN A;  2ABH A;  4U1O A;  3IL1 B;  3SEW A;  1OQH A;  3I6V A;  3FXU A;  1QUL A;  4BDR A;  3FVK A;  1B46 A;  3UK4 A;  4OYV A;  3I3V A;  1NNF A;  2HFB A;  3O97 A;  1P1W A;  4OWD A;  2W7Y A;  4AQ4 A;  2O84 X;  5L9M A;  3SEY A;  4H5F A;  2AL4 A;  4OXV A;  5ICQ A;  1MS7 A;  2ALU A;  2D21 A;  2Y7W A;  1UIV A;  3IR1 A;  3QAX A;  4O3A A;  3T9V A;  1B5H A;  1PB9 A;  4FIM A;  1B6H A;  2Q2C A;  3K6X A;  1P1U A;  1DMB A;  3BBR A;  3TOD A;  5KDT A;  1Z7M E;  2X7Q A;  3KJT A;  1II5 A;  2V3U A;  4POX A;  1GR2 A;  5AA2 D;  4BDO A;  2VHA A;  4QFK A;  1O63 A;  2Z8F A;  4G8H A;  2OWT A;  1ZJL A;  2F6P A;  4R2F A;  3IB2 A;  3O29 A;  1B58 A;  4R73 A;  4XKR A;  1RKM A;  3TQL A;  1JW1 A;  3UOR A;  3VV5 A;  3ZS6 A;  3O6I A;  3TTN A;  5L9O A;  4O3B A;  3FAT A;  1Q1K A;  5H8N A;  1Z7N E;  3C33 A;  4I9D A;  4YKJ A;  1A99 A;  2O69 A;  4NE4 A;  3QIM A;  4R75 A;  4DXB A;  3RNN A;  3PUY E;  1WDN A;  3AXF A;  3DP4 A;  3SDF A;  4N07 A;  4X48 A;  4G77 A;  5F1Q A;  5FTI A;  1XOC A;  3PPP A;  3U92 A;  4F39 A;  4RJZ A;  1M5C A;  4ZE9 A;  1QUJ A;  4BLA A;  4KYE A;  5I84 A;  1B4H A;  3MZ9 A;  2QRY A;  1B7H A;  2XHD A;  2A5T B;  3LBS A;  3PU5 A;  4NF4 A;  4PFU A;  4F2Q A;  3OMB A;  1NNP A;  3H4Z A;  1POT A;  1IEJ A;  3FV1 A;  3IOR A;  4R6Y A;  3FD3 A;  3FGS A;  3KSJ A;  5TPA B;  1SW4 A;  2Q8J A;  3G3H A;  2V25 A;  4YIC A;  1A7L A;  2NXO A;  2XXX A;  4GFR A;  3C35 A;  3VE1 B;  2F7C A;  4DCX A;  4ELP A;  1FQF A;  2VD2 A;  1HSJ A;  3MC2 A;  4M1V A;  1J1N A;  3OO9 A;  4H65 A;  1N84 A;  4P0G A;  2F8D A;  1WVJ A;  1KWH A;  3PMV A;  1MM7 A;  3PUX E;  2H25 A;  1UIU A;  1LCT A;  2Z22 A;  5TPA A;  2PT2 A;  2ZNS A;  4I8C A;  3WAE A;  1Y3Q A;  2O1L A;  2I4C A;  3L6G A;  2LAO A;  5M2V A;  2F97 A;  2I6E A;  1B2H A;  1LAG E;  4GL8 A;  3KN3 A;  4NMY A;  3WAF A;  2KLF A;  1M5F A;  1T0K A;  1DPP A;  4EDP A;  4Z7E A;  4PP0 A;  3B6Q A;  3P7I A;  1B3H A;  2E0S A;  1ATG A;  1LB9 A;  2ZXT A;  3FJM A;  3OO7 A;  2DP8 A;  5DEX B;  4XKN A;  3V8X B;  5B7D A;  1MXZ A;  1BIY A;  2GHB A;  2QMW A;  2QS2 A;  4OTE A;  3ONM A;  1N3X A;  1B05 A;  1OVB A;  2GRV A;  3K1M A;  3OOA A;  3SER A;  5FTH A;  4U21 A;  3MBP A;  1SW2 A;  3PUW E;  4QFL A;  3Q28 A;  4LAT A;  3S9N C;  2NOO A;  4MF3 A;  2Q88 A;  3TTR A;  1PB7 A;  3B6T A;  1TT1 A;  2AL5 A;  5CMC A;  2CMO A;  3FV2 A;  5EHS A;  1IXC A;  1FTM A;  3LSW A;  4YKK A;  4HCY A;  1MH3 A;  2F36 A;  1I6B A;  1LST A;  4IO2 A;  1Y3N A;  1Y3P A;  2Y7P A;  4IB2 A;  4OVJ A;  4QFN A;  4N6P A;  3G3I A;  3PGF A;  4G8M A;  1IXG A;  1CE2 A;  1TFD A;  4RA1 A;  3T93 B;  1SW1 A;  1LAF E;  4DZ1 A;  5B70 A;  4R9G A;  1JVX A;  3IB0 A;  1R1N A;  2QJE A;  3TQW A;  5AA4 B;  5ICT A;  4GOT A;  4OFJ A;  3T96 B;  5ITP A;  4NTL A;  3U1O A;  3C4M A;  2QMX A;  3E9X A;  3RTW B;  3LSF B;  4EF2 A;  1AOV A;  4GF8 A;  3TCF A;  1SYH A;  3ILU B;  4P0I A;  5H8F B;  2M8C A;  3K6U A;  3PUZ E;  3ILT B;  1A8E A;  2CZL A;  4U4X A;  3EHU A;  4ND9 A;  4FE8 A;  4PFY A;  5FHN A;  1LCF A;  2PYY A;  1YCJ A;  3FUZ A;  3O66 A;  3PPO A;  1FQE A;  1O7T A;  2Z8E A;  3F11 A;  3T9H B;  4EQ7 A;  3C32 A;  3TYH A;  2V3T A;  4C1T A;  5FHO A;  4LQ5 A;  3U93 A;  3TMG A;  2H5Y A;  4PET A;  3K02 A;  3PMW A;  4WEP A;  4X9T A;  5EHM A;  3U72 A;  5CM6 A;  2ESN A;  4DLD A;  1S50 A;  1SI1 A;  1IZ1 A;  1FTK A;  3TPA A;  3V89 B;  1L5T A;  3EN3 A;  3FXR A;  3IOV A;  3OXN A;  4RPN A;  4QSE A;  3IO6 A;  2XXH A;  1SI0 A;  1URD A;  3FZV A;  5JEI A;  2Y7K A;  3IB1 A;  1D9Y A;  1MQJ A;  2ONK E;  5CRY A;  5KCJ B;  4IGR A;  3K4U A;  1ANF A;  2XX8 A;  3OEM A;  4MBP A;  2ZYM A;  1LFH A;  3A09 A;  4QF9 A;  4ELO A;  5K2Y A;  5CMB A;  3H06 B;  3TUS A;  3B7D A;  4KD5 A;  1XT8 A;  4PFT A;  5I59 A;  3E3K A;  1DOT A;  2R6G E;  2DVC A;  3VVD A;  2RKM A;  3KG2 A;  2D5W A;  2UVH A;  1MDP 1;  3T9U A;  1Y4T A;  2QSX A;  3Q25 A;  3RUM A;  4BDN A;  3SES A;  1OLC A;  2DQV A;  1B51 A;  1P99 A;  1URG A;  3CFX A;  3MQ9 A;  3PUV E;  4FOR A;  4QRZ A;  4ZZA A;  2UYE A;  5TP9 A;  1NH8 A;  1B9J A;  1NNK A;  4NED A;  5ELV A;  3CFL A;  4F1Y A;  3IK6 B;  2DWJ A;  2AYS A;  2I3V A;  3IOW A;  2OCU A;  2DS9 A;  2X7P A;  3K1P A;  4YAH X;  2DE3 A;  4GRK A;  1N7W A;  3ZSF A;  3C34 A;  5I57 A;  1B5J A;  5I58 A;  5I2K A;  1B7U A;  1ZIU A;  2D3I A;  2Z8D A;  3G3K A;  3OO8 A;  3VDF A;  3HN0 A;  1QKA A;  3MPK A;  3RTF B;  4ECF A;  1DSN A;  4RK2 A;  4UAC A;  5HPQ A;  4BDM A;  3A3C A;  2V84 A;  4WKM A;  3UN6 A;  1N76 A;  4G68 A;  4LP2 B;  1SW5 A;  5AE4 A;  3IJX B;  3OO6 A;  2DVZ A;  1IQ7 A;  4L17 A;  3FIR A;  3RPW A;  2HQ0 A;  1QKB A;  4Z0I A;  1TWY A;  1UTH B;  2ANJ A;  1DPE A;  2HEU A;  4R72 A;  3FVN A;  4N13 A;  1QUI A;  3QYT A;  3R7X A;  3U94 A;  4ESX A;  2XD2 A;  1I69 A;  4HCW A;  1US5 A;  1EU8 A;  1MQG A;  4LZ8 A;  1PDA A;  4XKQ A;  4NF5 B;  3BKI B;  2IEE A;  1A55 A;  4IO4 A;  4PE5 B;  1LBB A;  3GBA A;  2DOJ A;  4LA9 A;  1UQW A;  1US4 A;  1NKX A;  2ZMB A;  3K6W A;  4H6D A;  1P1Q A;  1AH5 A;  3RY3 A;  4Q8R A;  4DXU A;  3S9M C;  4YKI A;  5AA1 A;  2DWA A;  3N26 A;  3UA8 A;  3H03 A;  1LB8 A;  1MG1 A;  3CVG A;  2QL3 A;  3O6G A;  4FJP A;  4OEN A;  3QUJ A;  4R6K A;  1B0L A;  4LON B;  1MPC A;  4ONY A;  4RY1 A;  2ZYO A;  2OJT A;  2UVG A;  3V83 A;  1MXW A;  2HCA A;  1LFG A;  1MY1 A;  2XX9 A;  4YB7 A;  4F2O A;  3TFL A;  1XVY A;  4H67 A;  4MLV A;  3S9L C;  2HXW A;  2WKY A;  4GLI A;  1MY4 A;  1N7X A;  1VFD A;  3K1N A;  2OZZ A;  2PX1 A;  1BTJ A;  4ZEC A;  5I57 B;  5EYF A;  1JW4 A;  2QPQ A;  1B3F A;  4EXK A;  2OLB A;  3TZA A;  2XXQ A;  1OVT A;  3O9P A;  3H6W A;  1MY0 A;  2R9J A;  1PC3 A;  1S7Y A;  4OHN A;  4XTC Q;  4YKP A;  1IIT A;  5TU0 A;  5AA2 B;  4F1U A;  3KOS A;  1AIV A;  1M5D A;  2HZK A;  3CG1 A;  1DTZ A;  2RC7 A;  3DLN A;  1B3E A;  3GBB A;  3OSQ A;  4MLQ A;  2THI A;  3DEL B;  3RT6 B;  1RYO A;  1H3D A;  4AB5 A;  1QUK A;  3IJO B;  1O64 A;  4IO3 A;  5DVF A;  1UTB B;  3MVX A;  2FA7 A;  5H8H A;  2QS4 A;  2Y84 A;  3D4G A;  2XD3 A;  3PD8 A;  4THI A;  1XC1 A;  4DCY A;  5HM4 B;  5KZT A;  3LSX A;  1LFI A;  1R9L A;  3E13 X;  3G3G A;  4QSD A;  5LOM A;  3KN8 A;  3K2D A;  2VOZ A;  3MP6 A;  4GVO A;  3T66 A;  1SYI A;  1ZU0 A;  3DP6 A;  3LR1 A;  1MQI A;  3SKP A;  5I56 A;  4JSO A;  4ZZE A;  1DTG A;  1JQF A;  4ESW A;  2V3Q A;  3HPI A;  1GVC A;  4G2Z A;  1NH7 A;  2E1S A;  3W15 C;  1LBC A;  4QHQ A;  4F29 A;  2XXI A;  2OBG A;  3K00 A;  1B40 A;  2GH9 A;  3FVO A;  3IX1 A;  3K6V A;  1MRP A;  3CFZ A;  3KBR A;  3DM0 A;  3KGC A;  3MPL A;  4KHZ E;  4LVQ A;  3QSL A;  3SEU A;  2F35 A;  4FEB A;  5I2K B;  4F3P A;  1JEV A;  2R71 A;  1LAX A;  3M3K A;  4ELQ A;  5KDT B;  3CRB A;  2RC8 A;  3QK6 A;  4GXS B;  4ZEF A;  2G93 A;  3FJG A;  4C0R A;  4F22 A;  1PBQ A;  2ZNT A;  3TCG A;  4KCC A;  5IAI A;  2B3F A;  2VP1 A;  4ZE8 A;  1Y1Z A;  2O7I A;  1MPD A;  1Q35 A;  3GXA A;  3THI A;  3G3J A;  1N3W A;  2O1M A;  3EQ1 A;  1PEB A;  3VFJ A;  4KYD A;  2YLN A;  4EXL A;  2XXW A;  4OER A;  3G3F A;  3UIF A;  2HZL A;  4OZ9 A;  2XXR A;  3JV9 A;  2DXR A;  4GWO A;  1LLS A;  3CG3 A;  3MZB A;  4GIZ A;  2B65 A;  1WOD A;  2V93 A;  4JWO A;  3TEP A;  4R6H A;  5BWJ A;  1QJM A;  1MXU A;  4NWC A;  3FXQ A;  3H7M A;  3CI8 A;  4P11 A;  4TLM B;  3R26 A;  3MWB A;  1FQA A;  1VFE A;  1VE4 A;  1ZBM A;  5CC2 A;  2F7A A;  2F5X A;  3OEN A;  4JSD A;  1B1X A;  4OQO A;  5I2N A;  1B3L A;  4HW8 A;  1GGG A;  1NFT A;  1XS5 A;  3IO4 A;  1MM6 A;  3B6W A;  4F19 A;  3IOT A;  1A8F A;  2AIX A;  3TEL A;  1MQH A;  3JYR A;  3JZJ A;  3GLB A;  2I3W A;  4ZDM A;  4F3B A;  4YMA A;  2IA4 A;  2O68 A;  3VLV A;  3HHG A;  3KFM A;  4Q5T A;  3TKD A;  3VLW A;  3H6V A;  2RF1 A;  3S9E A;  3VVF A;  5AA4 A;  1AMF A;  3OSR A;  1ZLQ A;  2NVU B;  3CIJ A;  3PPQ A;  4U2R A;  4RNS A;  1MY3 A;  2I48 A;  4RXL A;  5A5X B;  1GV8 A;  2XXU A;  1RYX A;  3PMX A;  1TXF A;  3LSL A;  4OFL A;  3U8Q A;  3MVZ A;  5K2X A;  3CSB A;  4ZEB A;  4XIG Q;  3IOU A;  4OMB A;  1MH4 A;  3H6T A;  1FCK A;  1UTH A;  1MQD A;  3HST A;  1JNF A;  3MUQ A;  1EZ9 A;  5HBC A;  5DVI A;  4OEU A;  1IIW A;  1FTO A;  5CMK A;  4GXA A;  4IO7 A;  1SDX A;  1MXX A;  2Y7I A;  4MFI A;  5DEX A;  1OMP A;  1N04 A;  1MDQ A;  5JK4 A;  2XXP A;  4OFO A;  4BDQ A;  1H76 A;  1ZKB A;  4HTG A;  2ZYN A;  1IXI A;  1OLA A;  3TTM A;  1A40 A;  2Q9T A;  1B52 A;  2A5T A;  2I49 A;  2XX7 A;  4U22 A;  1M5E A;  2PVU A;  2UYF A;  4OET A;  3TDJ A;  1NL5 A;  4NF6 A;  3M3L A;  4WED A;  4GQO A;  3N94 A;  4IGT A;  4YU0 A;  1R6Z A;  2H4I A;  3H3G A;  4EF1 A;  3N6T A;  4F3G A;  2H98 A;  4KR5 A;  2ZYK A;  3M8U A;  4JXI A;  3HHF A;  5DVJ A;  2I0B A;  3MVY A;  3S4U A;  4ELR A;  1JVY A;  1EZP A;  5CMM A;  1M5B A;  3N5L A;  3O28 A;  2Y7R A;  4LZ5 A;  5J1D A;  1YPN A;  3E4R A;  3C9H A;  4I62 A;  4WXJ A;  2F7B A;  5CBS A;  2P0S A;  3H6U A;  4KCD A;  1BP5 A;  3BFT A;  1YTV A;  4ZEK A;  3EHT A;  3TCH A;  1S9T A;  1SVX B;  1Y9U A;  3QUF A;  4H1X A;  2UVJ A;  4IO6 A;  1USY E;  1MXV A;  3T9X B;  2OWS A;  2YJP A;  4HS7 A;  1Y4C A;  2NWJ A;  2GFE A;  4ZED A;  5FHM A;  4NF8 B;  3TTK A;  3G7W A;  5L9S A;  1D4N A;  1ZMG A;  1Y1M A;  3O6H A;  3CR9 A;  3OEL A;  1JEU A;  3OEK A;  5A5X A;  2DWH A;  2DXY A;  3I5O A;  3ZKL A;  2Z23 A;  3M3F A;  3W9W A;  3MVW A;  4H8J A;  4JB7 A;  4DDD A;  4G68 B;  1OQG A;  5H8S A;  2OK2 A;  3IAZ A;  2DE2 A;  3CSG A;  4DIG A;  4KYS A;  2DE4 A;  2VD3 A;  1XHY A;  3A3U A;  1LAH E;  1NMU A;  2RIN A;  3KN7 A;  3PPN A;  3Q26 A;  4GL0 A;  4MH5 A;  1SD3 A;  4NF8 A;  2YPN A;  3SEX A;  3RN8 A;  1JW5 A;  3UGW A;  4FAT A;  5AA3 A;  4XXU A;  1FQB A;  2ONR A;  3T22 A;  5I56 B;  4LZ7 A;  5DYH A;  4NWD A;  5JTY A;  4X1D A;  3K0V A;  3KZG A;  3ODB A;  5I2N B;  2PMS A;  3S2V A;  4NF6 B;  1PB8 A;  2HAU A;  5I59 B;  1QW0 A;  4JDF A;  1N0T A;  2G29 A;  1H44 A;  1FQD A;  4LUB A;  4ZS9 A;  5L8D A;  4F31 B;  1Y20 A;  5ISU A;  2FYI A;  3LUY A;  1IUD A;  1SBP A;  4POW A;  4LQ2 A;  3UP9 A;  1AL3 A;  5H8Q A;  4IY5 A;  3PD9 A;  4JWY A;  5ITO A;  4F1V A;  1B0H A;  1BLF A;  3Q29 A;  4O3C A;  5I58 B;  1EH3 A;  1ELJ A;  1YAE A;  2DYX A;  3BFU A;  4KQP A;  4QFP A;  3V5A A;  3W9V A;  4AB6 A;  3DP8 A;  3HCQ A;  1OIB A;  1B5I A;  3RGY A;  1F9B A;  1HSE A;  4E0W A;  4FEC A;  3VVE A;  2QS1 A;  4EQ9 A;  4RPO A;  3KSX A;  1BKA A;  3SEV A;  2UVI A;  2PT1 A;  4H8I A;  3RLF E;  1R9Q A;  2DWI A;  2NUV A;  4K3F A;  3HV1 A;  1ZTY A;  4RYA A;  5DTB A;  4FAJ A;  3VXC A;  2O7U A;  5F7V A;  2ZNU A;  4G68 C;  3TTL A;  4EUO A;  3L6H A;  2Q2A A;  2XXY A;  1VSO A;  2O6A A;  4G8N A;  3GZG A;  2REG A;  2A5S A;  3C31 A;  3EF7 A;  4R9F A;  4BDL A;  2P2A A;  2RC9 A;  3C36 A;  3N6U A;  1QVS A;  4XKP A;  1I6A A;  4U1Z A;  3MW0 A;  4JBZ A;  5H8N B;  4U23 A;  5KCJ A;  1FQC A;  4UA8 A;  2O51 A;  1EZO A;  4C1U A;  4EQB A;  4U4S A;  4TOZ A;  3PV0 E;  1LGB C;  2B3B A;  3FAS A;  4Q30 B;  4YB5 A;  3EPE A;  4RK9 A;  3ZKK A;  1H45 A;  2I58 A;  2X26 A;  3R6U A;  3ECR A;  4H5G A;  4IY6 A;  4PFW A;  2PBW A;  3VLU A;  2BJJ X;  4KPT A;  2XXV A;  4KFQ A;  4R74 A;  4NF5 A;  1MY2 A;  1URS A;  3VXB A;  5IKB A;  1TFA A;  3MP8 A;  2I0C A;  1B1H A;  5CBR A;  3O2A A;  1D9V A;  3USD A;  3RT8 A;  4NF4 B;  1FW0 A;  5TP9 B;  4YZZ A;  5JTY B;  1POY 1;  4ISU A;  5DT6 A;  2GHA A;  4DE8 A;  1XVX A;  4G4P A; 
#chains in the Genus database with same CATH topology
 2F6G A;  3EHS A;  4IO5 A;  1B7Z A;  4R2B A;  1A54 A;  2F34 A;  2H9B A;  4E0X A;  2Q89 A;  1HSL A;  1LBY A;  1EYJ A;  4OA4 A;  2VGQ A;  2UXA A;  3MP1 A;  2RCB A;  1IMB A;  3K01 A;  2HAV A;  3FJ7 A;  1RDZ A;  3IL1 B;  1LBZ A;  4BDR A;  4NAP A;  4N6K A;  2PFY A;  3I3V A;  2W7Y A;  4AQ4 A;  4P9K A;  1UIV A;  3QAX A;  1K9Y A;  4FIM A;  2Q2C A;  3LUZ A;  3TOD A;  1II5 A;  2V3U A;  1GR2 A;  3CHG A;  2HPG A;  2VHA A;  3NOH A;  2Z8F A;  2OWT A;  1ZJL A;  3IB2 A;  1RKM A;  3VV5 A;  1JW1 A;  4O3B A;  5H8N A;  3C33 A;  4YKJ A;  4R75 A;  5J16 A;  4F39 A;  4N07 A;  5FTI A;  4G77 A;  4O94 A;  3E79 A;  1POT A;  3FGS A;  4OVR A;  1SW4 A;  3RYD A;  2KR0 A;  2V25 A;  1A7L A;  2XXX A;  3C35 A;  4PAK A;  1FQF A;  1HSJ A;  4M1V A;  3OO9 A;  1KWH A;  3WAE A;  2I4C A;  2LAO A;  5M2V A;  4GL8 A;  3KN3 A;  3WAF A;  2KLF A;  2PFZ A;  4Z7E A;  4N91 A;  1B3H A;  1G0H A;  2E0S A;  2JJK A;  3V8X B;  5DEX B;  1MXZ A;  2WYK A;  2GHB A;  4QXD A;  2QS2 A;  4OTE A;  3SER A;  4PF8 A;  1FTA A;  2Q88 A;  3TTR A;  1PB7 A;  1TT1 A;  2CMO A;  3FV2 A;  5EHS A;  4HCY A;  1I6B A;  2ZZV A;  4IO2 A;  1Y3N A;  4OVJ A;  4DZ1 A;  4R9G A;  1JVX A;  3U1O A;  3E9X A;  4GX4 A;  3TCF A;  5H8F B;  3K6U A;  3ILT B;  2XA5 A;  1NV4 A;  4FE8 A;  4PFY A;  1YCJ A;  3PPO A;  1KZ8 A;  5FHO A;  3K02 A;  3PMW A;  4X9T A;  3U72 A;  4DLD A;  3TPA A;  4I3E A;  1L5T A;  3IOV A;  3OXN A;  4QSE A;  3FZV A;  5JEI A;  1MQJ A;  5KCJ B;  2WBD A;  4IGR A;  1ANF A;  4QF9 A;  3H06 B;  3B7D A;  3E3K A;  1DOT A;  2DVC A;  2RKM A;  1MDP 1;  2QSX A;  4MMP A;  1P99 A;  1URG A;  4F1Y A;  4NED A;  3CFL A;  5EYH A;  4YAH X;  2DS9 A;  2X7P A;  3ZSF A;  3C34 A;  1B7U A;  3HN0 A;  4PAI A;  4ECF A;  1SPI A;  4UAC A;  3A3C A;  4GWX A;  4LP2 B;  3IJX B;  3RPW A;  2HQ0 A;  5EYG A;  2HEU A;  4OAN A;  3R7X A;  2KQZ A;  1FBG A;  1I69 A;  1EU8 A;  1MQG A;  4GX3 A;  1FPD A;  5I3S A;  4PE5 B;  1NKX A;  4Q8R A;  1P1Q A;  4DXU A;  3S9M C;  3B50 A;  5AA1 A;  3N26 A;  3UA8 A;  4NQ8 A;  4R6K A;  1B0L A;  4LON B;  1MPC A;  4RY1 A;  2ZYO A;  3V83 A;  1LFG A;  2FIX A;  2OZZ A;  5EYF A;  4EXK A;  2XXQ A;  4PCD A;  1MY0 A;  2R9J A;  5AA2 B;  4OHN A;  2FIE A;  3KOS A;  1AIV A;  2HZK A;  3CG1 A;  3OSQ A;  3RT6 B;  1H3D A;  4MJO A;  5H8H A;  3MVX A;  4DCY A;  1XC1 A;  1LFI A;  3G3G A;  4QSD A;  3KN8 A;  3MP6 A;  1NV3 A;  3BIH A;  4JSO A;  1FBH A;  1YZ0 A;  3HPI A;  3IFC A;  2E1S A;  4QHQ A;  4F29 A;  3DM0 A;  4O7M A;  4FEB A;  1FPK A;  1LAX A;  5ET7 A;  2RC8 A;  4P1E A;  3FJG A;  4C0R A;  2ZNT A;  4KCC A;  3GXA A;  3G3J A;  3VFJ A;  2XXW A;  3UIF A;  3G3F A;  2HZL A;  3JV9 A;  3MZB A;  5LTC A;  4R6H A;  5BWJ A;  4NWC A;  4P11 A;  1FPJ A;  3FXQ A;  1VFE A;  5T3J A;  2F5X A;  4N81 A;  1B3L A;  4HW8 A;  1MQH A;  4FBP A;  2I3W A;  4F3B A;  2F3B A;  3VLV A;  3HHG A;  4JVC A;  3TKD A;  4HE2 A;  2I48 A;  4OFL A;  4ZEB A;  4XIG Q;  1FCK A;  1UTH A;  3HST A;  3MUQ A;  1EZ9 A;  5DVI A;  1FBF A;  1FTO A;  4IO7 A;  4MFI A;  1MDQ A;  1N04 A;  2XXP A;  1ZKB A;  2Q74 A;  1OLA A;  1B52 A;  2A5T A;  1M5E A;  4OET A;  3M3L A;  4NHB A;  3H3G A;  4EF1 A;  2ZYK A;  2I0B A;  4XFE A;  3H6U A;  3KC0 A;  4HE0 A;  4MCO A;  1BP5 A;  4IO6 A;  3QUF A;  3T9X B;  1MXV A;  4NF8 B;  3TTK A;  1JEU A;  5A5X A;  2DWH A;  3W9W A;  3MVW A;  4H8J A;  4I3Y A;  5H8S A;  2DE2 A;  4NF8 A;  3SEX A;  5AA3 A;  5I56 B;  2ONR A;  4NF6 B;  4JDF A;  5L8D A;  5ISU A;  3LUY A;  4LQ2 A;  1IMA A;  3UP9 A;  1B0H A;  4OVP A;  3RGY A;  3VVE A;  5EQ7 A;  1ZTY A;  4GWY A;  4RYA A;  2O7U A;  4X04 A;  3L6H A;  1VSO A;  3SZP A;  3N6U A;  4XKP A;  4U1Z A;  1FQC A;  1EZO A;  2O51 A;  4C1U A;  4U4S A;  3PV0 E;  3ZKK A;  4RK9 A;  5EQ8 A;  2BJJ X;  4NF5 A;  1URS A;  1TFA A;  3MP8 A;  1XI6 A;  1FW0 A;  4HXV A;  4YZZ A;  1POY 1;  2F78 A;  4I1D A;  1USY H;  4MNP A;  4P1L A;  5BUU A;  4ZEI A;  1JET A;  1B3G A;  4X1B A;  5CI5 A;  1GTK A;  3KJ7 A;  2RCA A;  4QFO A;  2P1S A;  2XXT A;  4YB6 A;  4YMB A;  3MAM A;  4F3S A;  5ET6 A;  5AA2 A;  3KOT A;  2XWO A;  2DSF A;  3RQT A;  4P3L A;  3OD7 A;  3FVG A;  3MZ1 A;  2P3V A;  5H8H B;  1I6Q A;  3MJN A;  5A5L A;  3SEW A;  4GBV A;  1G0I A;  1NV1 A;  1B46 A;  4OYV A;  1NNF A;  2HFB A;  3O97 A;  2O84 X;  5L9M A;  3KBZ A;  5EQA A;  4O3A A;  2D21 A;  5CC2 A;  1B5H A;  3K6X A;  1P1U A;  5ET5 A;  1DMB A;  3BBR A;  5KDT A;  4QFK A;  1O63 A;  2ZZX A;  3O29 A;  3UOR A;  4XKR A;  2FHY A;  3FAT A;  2XWV A;  1Q1K A;  1Z7N E;  4I9D A;  1A99 A;  4NE4 A;  3AXF A;  4X48 A;  3PPP A;  4BLA A;  1B4H A;  2QRY A;  2XHD A;  4NF4 A;  2A5T B;  1FPB A;  1NNP A;  1IEJ A;  3IOR A;  4R6Y A;  1KA0 A;  2Q8J A;  2OX3 A;  4YIC A;  4DI3 D;  4ELP A;  2F7C A;  3MC2 A;  5I7I A;  2H25 A;  2O1L A;  2F97 A;  1EYK A;  1LAG E;  4XF5 A;  4EDP A;  4PP0 A;  3B6Q A;  3P7I A;  5IZ3 A;  2ZXT A;  1LB9 A;  3OO7 A;  5B7D A;  1BIY A;  2QMW A;  1DCU A;  3ONM A;  1B05 A;  3OOA A;  5FTH A;  3T1B A;  3Q28 A;  4MF3 A;  1FJ9 A;  5I5P A;  4XEQ A;  3LSW A;  4IB2 A;  4N6P A;  3PGF A;  3IB0 A;  2QJE A;  4GOT A;  4OFJ A;  4NTL A;  3C4M A;  3LSF B;  1A8E A;  4U4X A;  5DW8 A;  1FQE A;  2Z8E A;  3C32 A;  3TYH A;  3U93 A;  4PET A;  2XWK A;  2DDK A;  1IZ1 A;  3V89 B;  3EN3 A;  2WX9 A;  1SI0 A;  1URD A;  5CRY A;  2ONK E;  4HE1 A;  3OEM A;  4MBP A;  2ZYM A;  5CMB A;  4KD5 A;  1XT8 A;  1FPI A;  4PFT A;  2QVU A;  3KG2 A;  2UVH A;  2VPN A;  1Y4T A;  4BDN A;  1OLC A;  2UYE A;  1FPL A;  1NNK A;  3IK6 B;  2I3V A;  2DE3 A;  2FBP A;  1YYZ A;  1B5J A;  1EYI A;  3G3K A;  2D3I A;  3PTY A;  4RK2 A;  2V84 A;  3UN6 A;  4G68 A;  4N8G A;  1SW5 A;  5AE4 A;  3OO6 A;  1IQ7 A;  4DI4 B;  4L17 A;  3FIR A;  4Z0I A;  1TWY A;  3QYT A;  4ESX A;  3U94 A;  1US5 A;  2L5V A;  4NF5 B;  4AS4 A;  4GWZ A;  3RPL B;  4LA9 A;  1UQW A;  2ZMB A;  3K6W A;  2Y5L A;  3H03 A;  1MG1 A;  2QL3 A;  2UVG A;  2XX9 A;  4F2O A;  3TFL A;  1XVY A;  4OVQ A;  2HXW A;  1MY4 A;  1VFD A;  5I57 B;  1JW4 A;  1FRP A;  2OLB A;  3TZA A;  1OVT A;  3H6W A;  1S7Y A;  4XTC Q;  3DEL B;  1RYO A;  1JP4 A;  3IJO B;  1UTB B;  2QS4 A;  2Y84 A;  1Q9D A;  1R9L A;  3K2D A;  4GVO A;  4ZZE A;  3A29 A;  4ESW A;  4G2Z A;  1NH7 A;  1LBC A;  2XXI A;  2GH9 A;  3KGC A;  3QSL A;  3M3K A;  5KDT B;  3QK6 A;  3TCG A;  4ZE8 A;  1Y1Z A;  1MPD A;  1Q35 A;  4PBQ A;  1NUZ A;  1N3W A;  2DXR A;  4GWO A;  1DK4 A;  4GIZ A;  1RDY A;  1QJM A;  3H7M A;  3CI8 A;  3R26 A;  3ROJ A;  1XS5 A;  3IO4 A;  1MM6 A;  3JYR A;  3JZJ A;  2IA4 A;  2O68 A;  2RF1 A;  3VVF A;  1AMF A;  3OSR A;  2NVU B;  1MY3 A;  4RXL A;  5A5X B;  1GV8 A;  2XXU A;  4P47 A;  3MVZ A;  5K2X A;  2CZI A;  1FJ6 A;  1MQD A;  1NI9 A;  4OEU A;  5IZ3 B;  5CMK A;  2Y7I A;  5JK4 A;  4BDQ A;  1IXI A;  4N17 A;  2I49 A;  1FPF A;  1YXI A;  4N8Y A;  4YU0 A;  2H4I A;  4KR5 A;  1M5B A;  3N5L A;  1YPN A;  4I62 A;  4ZEK A;  3TCH A;  1SVX B;  1Y9U A;  2UVJ A;  2OWS A;  2YJP A;  1NV7 A;  5L9S A;  3O6H A;  3OEL A;  2DXY A;  3ZKL A;  2Z23 A;  4NF0 A;  4DDD A;  4G68 B;  2OK2 A;  4KYS A;  2DE4 A;  2VD3 A;  1NMU A;  3KN7 A;  4FAT A;  1SD3 A;  3RN8 A;  4JVI A;  1NUW A;  4NWD A;  4X1D A;  3ODB A;  3S2V A;  1N0T A;  2G29 A;  1FQD A;  4F31 B;  2HXR A;  2FYI A;  1SBP A;  1AL3 A;  5ITO A;  4O3C A;  4NG7 A;  4KQP A;  4AB6 A;  3DP8 A;  4GWS A;  3HCQ A;  4EQ9 A;  1F9B A;  4RPO A;  3RLF E;  2DWI A;  2NUV A;  4EUO A;  4G68 C;  2Q2A A;  2REG A;  4R9F A;  3EF7 A;  2P2A A;  3C36 A;  4YB5 A;  4TOZ A;  3FAS A;  4Q30 B;  2I58 A;  3R6U A;  2QVV A;  3ECR A;  4GBW A;  4KPT A;  3VXB A;  5IKB A;  1B1H A;  5CBR A;  4NF4 B;  5TP9 B;  4ISU A;  5I58 A;  4DE8 A;  4JVD A;  2MKZ A;  4FED A;  1B32 A;  2I4B A;  2ONS A;  4PQJ A;  1FTJ A;  4M4G A;  5H8F A;  3HO7 A;  1P1O A;  1P1N A;  1NV2 A;  1NNT A;  4OES A;  4Q0C A;  4OEV A;  2H99 A;  4F18 A;  4KI0 E;  3Q27 A;  4JWX A;  1MPB A;  1MXY A;  1UTB A;  2REJ A;  2ZZW A;  4U1O A;  1OQH A;  3SEY A;  5FBP A;  4H5F A;  2AL4 A;  4OXV A;  3IR1 A;  2Y7W A;  3T9V A;  1PB9 A;  3EKI A;  1NUY A;  1Z7M E;  3KJT A;  4BDO A;  4G8H A;  4R2F A;  4MX6 A;  3TQL A;  3ZS6 A;  3O6I A;  3TTN A;  4PFI A;  3TEP A;  3QIM A;  3RNN A;  3PUY E;  3T0J A;  4RJZ A;  1M5C A;  1QUJ A;  3LBS A;  3PU5 A;  3OMB A;  5ESY A;  3FV1 A;  4X8R A;  3FD3 A;  3KSJ A;  2NXO A;  3VE1 B;  1J1N A;  4H65 A;  3PMV A;  1MM7 A;  3PUX E;  4MEV A;  1LCT A;  4NMY A;  1M5F A;  2XXK A;  1T0K A;  1DPP A;  3BIG A;  1ATG A;  3FJM A;  2DP8 A;  4XKN A;  1N3X A;  1OVB A;  3K1M A;  3MBP A;  1SW2 A;  4QFL A;  3S9N C;  4N4U A;  5CMC A;  1FTM A;  4YKK A;  1LST A;  1Y3P A;  2Y7P A;  4G8M A;  4H46 A;  1CE2 A;  1SW1 A;  1R1N A;  5ITP A;  3U65 A;  2QMX A;  3RTW B;  3RPL A;  1AOV A;  4GF8 A;  1SYH A;  3ILU B;  4P0I A;  2M8C A;  2WEF A;  4ND9 A;  5FHN A;  3FUZ A;  3O66 A;  1O7T A;  3T9H B;  2V3T A;  4C1T A;  5EHM A;  5CM6 A;  1NUX A;  1SI1 A;  1FTK A;  3FXR A;  4RPN A;  3IB1 A;  4P56 A;  1D9Y A;  3K4U A;  1LFH A;  3A09 A;  1IME A;  2R6G E;  3Q25 A;  3RUM A;  3IFA A;  1FPE A;  2B4M A;  4FOR A;  3MQ9 A;  3CFX A;  4ZZA A;  5TP9 A;  5ELV A;  2P3N A;  4GX6 A;  2DWJ A;  1N7W A;  5I57 A;  5I2K A;  2Z8D A;  3OO8 A;  3VDF A;  3MPK A;  1DSN A;  5HPQ A;  4BDM A;  4WKM A;  1N76 A;  1DBZ A;  4OVS A;  1QKB A;  2ANJ A;  1UTH B;  3FVN A;  4N13 A;  1QUI A;  4O7I A;  2XD2 A;  4HCW A;  1NV5 A;  4XKQ A;  3BKI B;  1A55 A;  4IO4 A;  1LBB A;  3GBA A;  2DOJ A;  1US4 A;  3RY3 A;  1AH5 A;  2DWA A;  1LB8 A;  3O6G A;  4FJP A;  3QUJ A;  2OJT A;  2HCA A;  1MY1 A;  4GLI A;  1BTJ A;  4ZEC A;  3QMF A;  1B3F A;  5TU0 A;  1IIT A;  4F1U A;  3GBB A;  3DLN A;  4MLQ A;  4AB5 A;  1QUK A;  1O64 A;  4IO3 A;  5DVF A;  4NN3 A;  3D4G A;  2XD3 A;  3PD8 A;  4THI A;  5KZT A;  3LSX A;  1VDW A;  3E13 X;  5LOM A;  2VOZ A;  1SYI A;  1ZU0 A;  3SKP A;  5I56 A;  1JQF A;  2V3Q A;  1GVC A;  2OBG A;  3K00 A;  1B40 A;  3FVO A;  2HHM A;  3USD A;  2F35 A;  1JEV A;  3CRB A;  2G93 A;  4F22 A;  1PBQ A;  5IAI A;  2O7I A;  3THI A;  2O1M A;  3EQ1 A;  4EXL A;  4PTK A;  4OZ9 A;  1IMD A;  1D9Q A;  2B65 A;  1WOD A;  2V93 A;  4JWO A;  4PBH A;  1FQA A;  1VE4 A;  1ZBM A;  4JSD A;  1B1X A;  4P8B A;  5I2N A;  1GGG A;  1NFT A;  3B6W A;  3TEL A;  1QGX A;  4Q5T A;  3VLW A;  3CIJ A;  3PPQ A;  4U2R A;  3E78 A;  5IM2 A;  1RYX A;  3LSL A;  3U8Q A;  4I40 A;  3CSB A;  3HFU A;  1MH4 A;  3H6T A;  2WBB A;  1JNF A;  1IIW A;  4GXA A;  1SDX A;  1MXX A;  2ZYN A;  1A40 A;  1FBE A;  4U22 A;  2XX7 A;  2PVU A;  2UYF A;  3ISP A;  1IMC A;  4NF6 A;  4WED A;  4UAB A;  1R6Z A;  2F3D A;  1NV6 A;  4F3G A;  2H98 A;  3S4U A;  1EZP A;  5CMM A;  3O28 A;  2Y7R A;  5J1D A;  3E4R A;  3C9H A;  4WXJ A;  2F7B A;  5CBS A;  3EHT A;  1S9T A;  1USY E;  1Y4C A;  3FXB A;  1D4N A;  1Y1M A;  3OEK A;  3I5O A;  3CSG A;  3PPN A;  4MH5 A;  4XXU A;  1FQB A;  3T22 A;  5DYH A;  3KZG A;  1PB8 A;  2HAU A;  1QW0 A;  4ZS9 A;  4OVT A;  1IUD A;  4JWY A;  1EH3 A;  1ELJ A;  1YAE A;  3BFU A;  4QFP A;  3W9V A;  1B5I A;  4FEC A;  2QS1 A;  3KSX A;  4KXP A;  3SEV A;  4K3F A;  3HV1 A;  1K9Z A;  3VXC A;  2ZNU A;  3TTL A;  2O6A A;  4G8N A;  3GZG A;  2A5S A;  3C31 A;  2RC9 A;  4AS5 A;  1QVS A;  1I6A A;  4JBZ A;  5H8N B;  2BJI A;  1AWB A;  1LGB C;  1NV0 A;  2XXV A;  4KFQ A;  4R74 A;  1MY2 A;  2I0C A;  3O2A A;  1D9V A;  2CEX A;  5JTY B;  5DT6 A;  4G4P A;  1B4Z A;  2CZH A;  3PPR A;  3TAJ A;  1LBV A;  2QVR A;  3QXM A;  1PBP A;  1IXH A;  2FNC A;  2QS3 A;  1VR5 A;  4H0W A;  4N6D A;  3D4C A;  1SQY A;  1H43 A;  3KEI A;  4TLL B;  4TQU Q;  4PGN A;  4PFB A;  3SET A;  1D3K A;  1FTL A;  4QSC A;  1CB6 A;  4DXC A;  5H8Q B;  3LC8 A;  4GD5 A;  2ABH A;  4PDH A;  4MIJ A;  2B4L A;  3I6V A;  3FXU A;  1QUL A;  3FVK A;  3UK4 A;  1P1W A;  4OWD A;  1MS7 A;  2ALU A;  1B6H A;  4O8M A;  2X7Q A;  4POX A;  4GWU A;  5AA2 D;  2F6P A;  4R73 A;  1B58 A;  1FBC A;  5L9O A;  2O69 A;  4DXB A;  3SDF A;  1WDN A;  3DP4 A;  3U92 A;  5F1Q A;  1XOC A;  2FVZ A;  4ZE9 A;  4KYE A;  5I84 A;  3MZ9 A;  1B7H A;  5IZZ A;  1FBD A;  4PFU A;  4F2Q A;  3H4Z A;  4PFR A;  5TPA B;  3G3H A;  4GFR A;  4DCX A;  2VD2 A;  2VPO A;  4P0G A;  1N84 A;  2F8D A;  1WVJ A;  4MNC A;  1UIU A;  2Z22 A;  5TPA A;  2PT2 A;  2ZNS A;  4I8C A;  1Y3Q A;  3L6G A;  5LDZ A;  2I6E A;  1B2H A;  2CZK A;  1FBP A;  4QBA A;  5IGA A;  1IMF A;  2GRV A;  4U21 A;  2OWZ A;  3PUW E;  4LAT A;  2NOO A;  3B6T A;  2AL5 A;  1IXC A;  1MH3 A;  2F36 A;  4QFN A;  3G3I A;  4RA1 A;  1IXG A;  1TFD A;  3T93 B;  5B70 A;  1LAF E;  2V4C A;  2QFL A;  3TQW A;  4PE3 A;  5AA4 B;  5ICT A;  3T96 B;  4G61 A;  4EF2 A;  4PF6 A;  3PUZ E;  2CEY A;  2CZL A;  3EHU A;  1LEV A;  1LCF A;  2PYY A;  2GQ1 A;  3F11 A;  4EQ7 A;  4LQ5 A;  3TMG A;  2H5Y A;  1FPG A;  4WEP A;  2ESN A;  1S50 A;  1LBX A;  4PAF A;  3IO6 A;  2XXH A;  5ET8 A;  2Y7K A;  2XX8 A;  2Q8M A;  4ELO A;  3TUS A;  5K2Y A;  5I59 A;  3VVD A;  5ICQ A;  2D5W A;  3T9U A;  4IR8 A;  2DQV A;  1B51 A;  3PUV E;  4QRZ A;  1NH8 A;  1B9J A;  2AYS A;  3IOW A;  2OCU A;  3K1P A;  4GRK A;  1ZIU A;  1QKA A;  3RTF B;  5EQ9 A;  2DVZ A;  1BK4 A;  4NGU A;  1DPE A;  4R72 A;  1FSA A;  4GWW A;  4LZ8 A;  1PDA A;  3MST A;  2IEE A;  4N15 A;  4H6D A;  1INP A;  4YKI A;  3CVG A;  4OEN A;  4ONY A;  1MXW A;  4YB7 A;  2Y5K A;  1KA1 A;  4H67 A;  4MLV A;  3S9L C;  2WKY A;  1N7X A;  3K1N A;  1RDX A;  2PX1 A;  2QPQ A;  5IZ1 A;  3O9P A;  1PC3 A;  4YKP A;  1M5D A;  1DTZ A;  2RC7 A;  1B3E A;  2THI A;  3MYU A;  2FA7 A;  5HM4 B;  4H45 A;  3T66 A;  3DP6 A;  3LR1 A;  1MQI A;  1DTG A;  3W15 C;  3IX1 A;  3K6V A;  4HTG A;  3MPL A;  1MRP A;  3CFZ A;  3KBR A;  4KHZ E;  4LVQ A;  3SEU A;  4F3P A;  5I2K B;  2R71 A;  4ELQ A;  2XWI A;  4GXS B;  4ZEF A;  2B3F A;  2VP1 A;  3D1R A;  1PEB A;  4KYD A;  2YLN A;  4OER A;  2XXR A;  1CNQ A;  1LLS A;  3CG3 A;  4PGP A;  1MXU A;  4TLM B;  3MWB A;  2F7A A;  4OQO A;  3OEN A;  1LBW A;  4F19 A;  3IOT A;  1A8F A;  2AIX A;  2PCR A;  3GLB A;  4ZDM A;  4YMA A;  3KFM A;  3S9E A;  3H6V A;  5AA4 A;  1ZLQ A;  4RNS A;  3PMX A;  1TXF A;  3IOU A;  4OMB A;  2WYP A;  5HBC A;  5DEX A;  1OMP A;  4OFO A;  1H76 A;  3TTM A;  2Q9T A;  3TDJ A;  1NL5 A;  4GQO A;  3N94 A;  4IGT A;  3N6T A;  3M8U A;  4JXI A;  3HHF A;  5DVJ A;  3MVY A;  4ELR A;  1JVY A;  4LZ5 A;  4MNI A;  2P0S A;  4KCD A;  3BFT A;  1YTV A;  4H1X A;  2R8T A;  4HS7 A;  2NWJ A;  4ZED A;  2GFE A;  5FHM A;  3G7W A;  2VT5 A;  3B8B A;  1ZMG A;  3CR9 A;  5F24 A;  3M3F A;  4JB7 A;  3KC1 A;  1OQG A;  3IAZ A;  4DIG A;  3GYY A;  1XHY A;  3A3U A;  1LAH E;  2RIN A;  3Q26 A;  4GL0 A;  3SES A;  2YPN A;  1JW5 A;  3UGW A;  4LZ7 A;  5JTY A;  3K0V A;  4PDD A;  5I2N B;  2PMS A;  4LN5 A;  5I59 B;  4LUB A;  1H44 A;  1Y20 A;  4POW A;  5H8Q A;  3FBP A;  4IY5 A;  3PD9 A;  4F1V A;  1BLF A;  3Q29 A;  5I58 B;  2DYX A;  3V5A A;  1OIB A;  4MAG A;  4NX1 A;  1HSE A;  4E0W A;  1BKA A;  2UVI A;  2PT1 A;  4H8I A;  1R9Q A;  5DTB A;  4FAJ A;  3LV0 A;  5F7V A;  2XXY A;  4BDL A;  3MW0 A;  4U23 A;  5KCJ A;  4UA8 A;  4EQB A;  2B3B A;  3EPE A;  1H45 A;  2X26 A;  4IY6 A;  4H5G A;  4PFW A;  4PC9 A;  2PBW A;  3VLU A;  3RT8 A;  4MHF A;  2GHA A;  1XVX A; 
#chains in the Genus database with same CATH homology
 2F78 A;  1B4Z A;  4I1D A;  1USY H;  2F6G A;  5BUU A;  4FED A;  1JET A;  3EHS A;  3PPR A;  4IO5 A;  4ZEI A;  1B32 A;  1B7Z A;  4R2B A;  1A54 A;  2F34 A;  3TAJ A;  1B3G A;  2I4B A;  3QXM A;  1PBP A;  4X1B A;  2ONS A;  1IXH A;  1GTK A;  5CI5 A;  3KJ7 A;  2FNC A;  2QS3 A;  2H9B A;  2RCA A;  4QFO A;  2P1S A;  4PQJ A;  1FTJ A;  1VR5 A;  4M4G A;  4E0X A;  4H0W A;  2Q89 A;  2XXT A;  4YB6 A;  1HSL A;  5H8F A;  4YMB A;  3D4C A;  3HO7 A;  3MAM A;  1SQY A;  1P1O A;  1H43 A;  1P1N A;  4F3S A;  4OES A;  1NNT A;  3KEI A;  3KOT A;  5AA2 A;  4Q0C A;  2DSF A;  2VGQ A;  2UXA A;  4OEV A;  4TLL B;  2H99 A;  3RQT A;  4F18 A;  4TQU Q;  3MP1 A;  3SET A;  2RCB A;  1D3K A;  3OD7 A;  1FTL A;  3FVG A;  3K01 A;  3MZ1 A;  4KI0 E;  4QSC A;  1CB6 A;  3Q27 A;  4JWX A;  4DXC A;  1MPB A;  1MXY A;  1UTB A;  2HAV A;  3LC8 A;  5H8H B;  2REJ A;  5H8Q B;  1I6Q A;  3FJ7 A;  4GD5 A;  3MJN A;  2ABH A;  4U1O A;  3IL1 B;  3SEW A;  1OQH A;  3I6V A;  3FXU A;  1QUL A;  4BDR A;  3FVK A;  1B46 A;  3UK4 A;  4OYV A;  3I3V A;  1NNF A;  2HFB A;  3O97 A;  1P1W A;  4OWD A;  2W7Y A;  4AQ4 A;  2O84 X;  5L9M A;  3SEY A;  4H5F A;  2AL4 A;  4OXV A;  5ICQ A;  1MS7 A;  2ALU A;  2D21 A;  2Y7W A;  1UIV A;  3IR1 A;  3QAX A;  4O3A A;  3T9V A;  1B5H A;  1PB9 A;  4FIM A;  1B6H A;  2Q2C A;  3K6X A;  1P1U A;  1DMB A;  3BBR A;  3TOD A;  5KDT A;  1Z7M E;  2X7Q A;  3KJT A;  1II5 A;  2V3U A;  4POX A;  1GR2 A;  5AA2 D;  4BDO A;  2VHA A;  4QFK A;  1O63 A;  2Z8F A;  4G8H A;  2OWT A;  1ZJL A;  2F6P A;  4R2F A;  3IB2 A;  3O29 A;  1B58 A;  4R73 A;  4XKR A;  1RKM A;  3TQL A;  1JW1 A;  3UOR A;  3VV5 A;  3ZS6 A;  3O6I A;  3TTN A;  5L9O A;  4O3B A;  3FAT A;  1Q1K A;  5H8N A;  1Z7N E;  3C33 A;  4I9D A;  4YKJ A;  1A99 A;  2O69 A;  4NE4 A;  3QIM A;  4R75 A;  4DXB A;  3RNN A;  3PUY E;  1WDN A;  3AXF A;  3DP4 A;  3SDF A;  4N07 A;  4X48 A;  4G77 A;  5F1Q A;  5FTI A;  1XOC A;  3PPP A;  3U92 A;  4F39 A;  4RJZ A;  1M5C A;  4ZE9 A;  1QUJ A;  4BLA A;  4KYE A;  5I84 A;  1B4H A;  3MZ9 A;  2QRY A;  1B7H A;  2XHD A;  2A5T B;  3LBS A;  3PU5 A;  4NF4 A;  4PFU A;  4F2Q A;  3OMB A;  1NNP A;  3H4Z A;  1POT A;  1IEJ A;  3FV1 A;  3IOR A;  4R6Y A;  3FD3 A;  3FGS A;  3KSJ A;  5TPA B;  1SW4 A;  2Q8J A;  3G3H A;  2V25 A;  4YIC A;  1A7L A;  2NXO A;  2XXX A;  4GFR A;  3C35 A;  3VE1 B;  2F7C A;  4DCX A;  4ELP A;  1FQF A;  2VD2 A;  1HSJ A;  3MC2 A;  4M1V A;  1J1N A;  3OO9 A;  4H65 A;  1N84 A;  4P0G A;  2F8D A;  1WVJ A;  1KWH A;  3PMV A;  1MM7 A;  3PUX E;  2H25 A;  1UIU A;  1LCT A;  2Z22 A;  5TPA A;  2PT2 A;  2ZNS A;  4I8C A;  3WAE A;  1Y3Q A;  2O1L A;  2I4C A;  3L6G A;  2LAO A;  5M2V A;  2F97 A;  2I6E A;  1B2H A;  1LAG E;  4GL8 A;  3KN3 A;  4NMY A;  3WAF A;  2KLF A;  1M5F A;  1T0K A;  1DPP A;  4EDP A;  4Z7E A;  4PP0 A;  3B6Q A;  3P7I A;  1B3H A;  2E0S A;  1ATG A;  1LB9 A;  2ZXT A;  3FJM A;  3OO7 A;  2DP8 A;  5DEX B;  4XKN A;  3V8X B;  5B7D A;  1MXZ A;  1BIY A;  2GHB A;  2QMW A;  2QS2 A;  4OTE A;  3ONM A;  1N3X A;  1B05 A;  1OVB A;  2GRV A;  3K1M A;  3OOA A;  3SER A;  5FTH A;  4U21 A;  3MBP A;  1SW2 A;  3PUW E;  4QFL A;  3Q28 A;  4LAT A;  3S9N C;  2NOO A;  4MF3 A;  2Q88 A;  3TTR A;  1PB7 A;  3B6T A;  1TT1 A;  2AL5 A;  5CMC A;  2CMO A;  3FV2 A;  5EHS A;  1IXC A;  1FTM A;  3LSW A;  4YKK A;  4HCY A;  1MH3 A;  2F36 A;  1I6B A;  1LST A;  4IO2 A;  1Y3N A;  1Y3P A;  2Y7P A;  4IB2 A;  4OVJ A;  4QFN A;  4N6P A;  3G3I A;  3PGF A;  4G8M A;  1IXG A;  1CE2 A;  1TFD A;  4RA1 A;  3T93 B;  1SW1 A;  1LAF E;  4DZ1 A;  5B70 A;  4R9G A;  1JVX A;  3IB0 A;  1R1N A;  2QJE A;  3TQW A;  5AA4 B;  5ICT A;  4GOT A;  4OFJ A;  3T96 B;  5ITP A;  4NTL A;  3U1O A;  3C4M A;  2QMX A;  3E9X A;  3RTW B;  3LSF B;  4EF2 A;  1AOV A;  4GF8 A;  3TCF A;  1SYH A;  3ILU B;  4P0I A;  5H8F B;  2M8C A;  3K6U A;  3PUZ E;  3ILT B;  1A8E A;  2CZL A;  4U4X A;  3EHU A;  4ND9 A;  4FE8 A;  4PFY A;  5FHN A;  1LCF A;  2PYY A;  1YCJ A;  3FUZ A;  3O66 A;  3PPO A;  1FQE A;  1O7T A;  2Z8E A;  3F11 A;  3T9H B;  4EQ7 A;  3C32 A;  3TYH A;  2V3T A;  4C1T A;  5FHO A;  4LQ5 A;  3U93 A;  3TMG A;  2H5Y A;  4PET A;  3K02 A;  3PMW A;  4WEP A;  4X9T A;  5EHM A;  3U72 A;  5CM6 A;  2ESN A;  4DLD A;  1S50 A;  1SI1 A;  1IZ1 A;  1FTK A;  3TPA A;  3V89 B;  1L5T A;  3EN3 A;  3FXR A;  3IOV A;  3OXN A;  4RPN A;  4QSE A;  3IO6 A;  2XXH A;  1SI0 A;  1URD A;  3FZV A;  5JEI A;  2Y7K A;  3IB1 A;  1D9Y A;  1MQJ A;  2ONK E;  5CRY A;  5KCJ B;  4IGR A;  3K4U A;  1ANF A;  2XX8 A;  3OEM A;  4MBP A;  2ZYM A;  1LFH A;  3A09 A;  4QF9 A;  4ELO A;  5K2Y A;  5CMB A;  3H06 B;  3TUS A;  3B7D A;  4KD5 A;  1XT8 A;  4PFT A;  5I59 A;  3E3K A;  1DOT A;  2R6G E;  2DVC A;  3VVD A;  2RKM A;  3KG2 A;  2D5W A;  2UVH A;  1MDP 1;  3T9U A;  1Y4T A;  2QSX A;  3Q25 A;  3RUM A;  4BDN A;  3SES A;  1OLC A;  2DQV A;  1B51 A;  1P99 A;  1URG A;  3CFX A;  3MQ9 A;  3PUV E;  4FOR A;  4QRZ A;  4ZZA A;  2UYE A;  5TP9 A;  1NH8 A;  1B9J A;  1NNK A;  4NED A;  5ELV A;  3CFL A;  4F1Y A;  3IK6 B;  2DWJ A;  2AYS A;  2I3V A;  3IOW A;  2OCU A;  2DS9 A;  2X7P A;  3K1P A;  4YAH X;  2DE3 A;  4GRK A;  1N7W A;  3ZSF A;  3C34 A;  5I57 A;  1B5J A;  5I58 A;  5I2K A;  1B7U A;  1ZIU A;  2D3I A;  2Z8D A;  3G3K A;  3OO8 A;  3VDF A;  3HN0 A;  1QKA A;  3MPK A;  3RTF B;  4ECF A;  1DSN A;  4RK2 A;  4UAC A;  5HPQ A;  4BDM A;  3A3C A;  2V84 A;  4WKM A;  3UN6 A;  1N76 A;  4G68 A;  4LP2 B;  1SW5 A;  5AE4 A;  3IJX B;  3OO6 A;  2DVZ A;  1IQ7 A;  4L17 A;  3FIR A;  3RPW A;  2HQ0 A;  1QKB A;  4Z0I A;  1TWY A;  1UTH B;  2ANJ A;  1DPE A;  2HEU A;  4R72 A;  3FVN A;  4N13 A;  1QUI A;  3QYT A;  3R7X A;  3U94 A;  4ESX A;  2XD2 A;  1I69 A;  4HCW A;  1US5 A;  1EU8 A;  1MQG A;  4LZ8 A;  1PDA A;  4XKQ A;  4NF5 B;  3BKI B;  2IEE A;  1A55 A;  4IO4 A;  4PE5 B;  1LBB A;  3GBA A;  2DOJ A;  4LA9 A;  1UQW A;  1US4 A;  1NKX A;  2ZMB A;  3K6W A;  4H6D A;  1P1Q A;  1AH5 A;  3RY3 A;  4Q8R A;  4DXU A;  3S9M C;  4YKI A;  5AA1 A;  2DWA A;  3N26 A;  3UA8 A;  3H03 A;  1LB8 A;  1MG1 A;  3CVG A;  2QL3 A;  3O6G A;  4FJP A;  4OEN A;  3QUJ A;  4R6K A;  1B0L A;  4LON B;  1MPC A;  4ONY A;  4RY1 A;  2ZYO A;  2OJT A;  2UVG A;  3V83 A;  1MXW A;  2HCA A;  1LFG A;  1MY1 A;  2XX9 A;  4YB7 A;  4F2O A;  3TFL A;  1XVY A;  4H67 A;  4MLV A;  3S9L C;  2HXW A;  2WKY A;  4GLI A;  1MY4 A;  1N7X A;  1VFD A;  3K1N A;  2OZZ A;  2PX1 A;  1BTJ A;  4ZEC A;  5I57 B;  5EYF A;  1JW4 A;  2QPQ A;  1B3F A;  4EXK A;  2OLB A;  3TZA A;  2XXQ A;  1OVT A;  3O9P A;  3H6W A;  1MY0 A;  2R9J A;  1PC3 A;  1S7Y A;  4OHN A;  4XTC Q;  4YKP A;  1IIT A;  5TU0 A;  5AA2 B;  4F1U A;  3KOS A;  1AIV A;  1M5D A;  2HZK A;  3CG1 A;  1DTZ A;  2RC7 A;  3DLN A;  1B3E A;  3GBB A;  3OSQ A;  4MLQ A;  2THI A;  3DEL B;  3RT6 B;  1RYO A;  1H3D A;  4AB5 A;  1QUK A;  3IJO B;  1O64 A;  4IO3 A;  5DVF A;  1UTB B;  3MVX A;  2FA7 A;  5H8H A;  2QS4 A;  2Y84 A;  3D4G A;  2XD3 A;  3PD8 A;  4THI A;  1XC1 A;  4DCY A;  5HM4 B;  5KZT A;  3LSX A;  1LFI A;  1R9L A;  3E13 X;  3G3G A;  4QSD A;  5LOM A;  3KN8 A;  3K2D A;  2VOZ A;  3MP6 A;  4GVO A;  3T66 A;  1SYI A;  1ZU0 A;  3DP6 A;  3LR1 A;  1MQI A;  3SKP A;  5I56 A;  4JSO A;  4ZZE A;  1DTG A;  1JQF A;  4ESW A;  2V3Q A;  3HPI A;  1GVC A;  4G2Z A;  1NH7 A;  2E1S A;  3W15 C;  1LBC A;  4QHQ A;  4F29 A;  2XXI A;  2OBG A;  3K00 A;  1B40 A;  2GH9 A;  3FVO A;  3IX1 A;  3K6V A;  1MRP A;  3CFZ A;  3KBR A;  3DM0 A;  3KGC A;  3MPL A;  4KHZ E;  4LVQ A;  3QSL A;  3SEU A;  2F35 A;  4FEB A;  5I2K B;  4F3P A;  1JEV A;  2R71 A;  1LAX A;  3M3K A;  4ELQ A;  5KDT B;  3CRB A;  2RC8 A;  3QK6 A;  4GXS B;  4ZEF A;  2G93 A;  3FJG A;  4C0R A;  4F22 A;  1PBQ A;  2ZNT A;  3TCG A;  4KCC A;  5IAI A;  2B3F A;  2VP1 A;  4ZE8 A;  1Y1Z A;  2O7I A;  1MPD A;  1Q35 A;  3GXA A;  3THI A;  3G3J A;  1N3W A;  2O1M A;  3EQ1 A;  1PEB A;  3VFJ A;  4KYD A;  2YLN A;  4EXL A;  2XXW A;  4OER A;  3G3F A;  3UIF A;  2HZL A;  4OZ9 A;  2XXR A;  3JV9 A;  2DXR A;  4GWO A;  1LLS A;  3CG3 A;  3MZB A;  4GIZ A;  2B65 A;  1WOD A;  2V93 A;  4JWO A;  3TEP A;  4R6H A;  5BWJ A;  1QJM A;  1MXU A;  4NWC A;  3FXQ A;  3H7M A;  3CI8 A;  4P11 A;  4TLM B;  3R26 A;  3MWB A;  1FQA A;  1VFE A;  1VE4 A;  1ZBM A;  5CC2 A;  2F7A A;  2F5X A;  3OEN A;  4JSD A;  1B1X A;  4OQO A;  5I2N A;  1B3L A;  4HW8 A;  1GGG A;  1NFT A;  1XS5 A;  3IO4 A;  1MM6 A;  3B6W A;  4F19 A;  3IOT A;  1A8F A;  2AIX A;  3TEL A;  1MQH A;  3JYR A;  3JZJ A;  3GLB A;  2I3W A;  4ZDM A;  4F3B A;  4YMA A;  2IA4 A;  2O68 A;  3VLV A;  3HHG A;  3KFM A;  4Q5T A;  3TKD A;  3VLW A;  3H6V A;  2RF1 A;  3S9E A;  3VVF A;  5AA4 A;  1AMF A;  3OSR A;  1ZLQ A;  2NVU B;  3CIJ A;  3PPQ A;  4U2R A;  4RNS A;  1MY3 A;  2I48 A;  4RXL A;  5A5X B;  1GV8 A;  2XXU A;  1RYX A;  3PMX A;  1TXF A;  3LSL A;  4OFL A;  3U8Q A;  3MVZ A;  5K2X A;  3CSB A;  4ZEB A;  4XIG Q;  3IOU A;  4OMB A;  1MH4 A;  3H6T A;  1FCK A;  1UTH A;  1MQD A;  3HST A;  1JNF A;  3MUQ A;  1EZ9 A;  5HBC A;  5DVI A;  4OEU A;  1IIW A;  1FTO A;  5CMK A;  4GXA A;  4IO7 A;  1SDX A;  1MXX A;  2Y7I A;  4MFI A;  5DEX A;  1OMP A;  1N04 A;  1MDQ A;  5JK4 A;  2XXP A;  4OFO A;  4BDQ A;  1H76 A;  1ZKB A;  4HTG A;  2ZYN A;  1IXI A;  1OLA A;  3TTM A;  1A40 A;  2Q9T A;  1B52 A;  2A5T A;  2I49 A;  2XX7 A;  4U22 A;  1M5E A;  2PVU A;  2UYF A;  4OET A;  3TDJ A;  1NL5 A;  4NF6 A;  3M3L A;  4WED A;  4GQO A;  3N94 A;  4IGT A;  4YU0 A;  1R6Z A;  2H4I A;  3H3G A;  4EF1 A;  3N6T A;  4F3G A;  2H98 A;  4KR5 A;  2ZYK A;  3M8U A;  4JXI A;  3HHF A;  5DVJ A;  2I0B A;  3MVY A;  3S4U A;  4ELR A;  1JVY A;  1EZP A;  5CMM A;  1M5B A;  3N5L A;  3O28 A;  2Y7R A;  4LZ5 A;  5J1D A;  1YPN A;  3E4R A;  3C9H A;  4I62 A;  4WXJ A;  2F7B A;  5CBS A;  2P0S A;  3H6U A;  4KCD A;  1BP5 A;  3BFT A;  1YTV A;  4ZEK A;  3EHT A;  3TCH A;  1S9T A;  1SVX B;  1Y9U A;  3QUF A;  4H1X A;  2UVJ A;  4IO6 A;  1USY E;  1MXV A;  3T9X B;  2OWS A;  2YJP A;  4HS7 A;  1Y4C A;  2NWJ A;  2GFE A;  4ZED A;  5FHM A;  4NF8 B;  3TTK A;  3G7W A;  5L9S A;  1D4N A;  1ZMG A;  1Y1M A;  3O6H A;  3CR9 A;  3OEL A;  1JEU A;  3OEK A;  5A5X A;  2DWH A;  2DXY A;  3I5O A;  3ZKL A;  2Z23 A;  3M3F A;  3W9W A;  3MVW A;  4H8J A;  4JB7 A;  4DDD A;  4G68 B;  1OQG A;  5H8S A;  2OK2 A;  3IAZ A;  2DE2 A;  3CSG A;  4DIG A;  4KYS A;  2DE4 A;  2VD3 A;  1XHY A;  3A3U A;  1LAH E;  1NMU A;  2RIN A;  3KN7 A;  3PPN A;  3Q26 A;  4GL0 A;  4MH5 A;  1SD3 A;  4NF8 A;  2YPN A;  3SEX A;  3RN8 A;  1JW5 A;  3UGW A;  4FAT A;  5AA3 A;  4XXU A;  1FQB A;  2ONR A;  3T22 A;  5I56 B;  4LZ7 A;  5DYH A;  4NWD A;  5JTY A;  4X1D A;  3K0V A;  3KZG A;  3ODB A;  5I2N B;  2PMS A;  3S2V A;  4NF6 B;  1PB8 A;  2HAU A;  5I59 B;  1QW0 A;  4JDF A;  1N0T A;  2G29 A;  1H44 A;  1FQD A;  4LUB A;  4ZS9 A;  5L8D A;  4F31 B;  1Y20 A;  5ISU A;  2FYI A;  3LUY A;  1IUD A;  1SBP A;  4POW A;  4LQ2 A;  3UP9 A;  1AL3 A;  5H8Q A;  4IY5 A;  3PD9 A;  4JWY A;  5ITO A;  4F1V A;  1B0H A;  1BLF A;  3Q29 A;  4O3C A;  5I58 B;  1EH3 A;  1ELJ A;  1YAE A;  2DYX A;  3BFU A;  4KQP A;  4QFP A;  3V5A A;  3W9V A;  4AB6 A;  3DP8 A;  3HCQ A;  1OIB A;  1B5I A;  3RGY A;  1F9B A;  1HSE A;  4E0W A;  4FEC A;  3VVE A;  2QS1 A;  4EQ9 A;  4RPO A;  3KSX A;  1BKA A;  3SEV A;  2UVI A;  2PT1 A;  4H8I A;  3RLF E;  1R9Q A;  2DWI A;  2NUV A;  4K3F A;  3HV1 A;  1ZTY A;  4RYA A;  5DTB A;  4FAJ A;  3VXC A;  2O7U A;  5F7V A;  2ZNU A;  4G68 C;  3TTL A;  4EUO A;  3L6H A;  2Q2A A;  2XXY A;  1VSO A;  2O6A A;  4G8N A;  3GZG A;  2REG A;  2A5S A;  3C31 A;  3EF7 A;  4R9F A;  4BDL A;  2P2A A;  2RC9 A;  3C36 A;  3N6U A;  1QVS A;  4XKP A;  1I6A A;  4U1Z A;  3MW0 A;  4JBZ A;  5H8N B;  4U23 A;  5KCJ A;  1FQC A;  4UA8 A;  2O51 A;  1EZO A;  4C1U A;  4EQB A;  4U4S A;  4TOZ A;  3PV0 E;  1LGB C;  2B3B A;  3FAS A;  4Q30 B;  4YB5 A;  3EPE A;  4RK9 A;  3ZKK A;  1H45 A;  2I58 A;  2X26 A;  3R6U A;  3ECR A;  4H5G A;  4IY6 A;  4PFW A;  2PBW A;  3VLU A;  2BJJ X;  4KPT A;  2XXV A;  4KFQ A;  4R74 A;  4NF5 A;  1MY2 A;  1URS A;  3VXB A;  5IKB A;  1TFA A;  3MP8 A;  2I0C A;  1B1H A;  5CBR A;  3O2A A;  1D9V A;  3USD A;  3RT8 A;  4NF4 B;  1FW0 A;  5TP9 B;  4YZZ A;  5JTY B;  1POY 1;  4ISU A;  5DT6 A;  2GHA A;  4DE8 A;  1XVX A;  4G4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...