4R73A

Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (endogenous glucose-6-phosphate and mannose-6-phosphate bound)
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
321
structure length
321
Chain Sequence
GSKGRLVIYCSATNVMCENAAKTFEQKYDVKTSFIRNGSGSTFAKIEAEKNNPQADVWYGGTLDPQSQAGELGLLEAYRSPNIDQIMPKFQDPAKVKGNLSSAVYIGILGFAVNTERLKKLGIEKIPQCWNDLTDPKLKGEIQIADPQSSGTAYTAIATFAQLWGEDKAFDYFKHLHPNISQYTKSGITPARNAARGETTVGIGFLHDYALEKEQGAPLEMVVPCEGTGYELGGVSILKGARNLDNAKLFVDFALSKEGQETAWKKGQALQTLTNTTAEQSPLAFDLTKLKLIDYDFEKYGASDERKRLINKWVDEIKLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC-type Fe3+ transport system, periplasmic component
publication title Active Transport of Phosphorylated Carbohydrates Promotes Intestinal Colonization and Transmission of a Bacterial Pathogen.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
total genus 115
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r73A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r73A01
1JVYA 4LZ8A 4H1XA 3GZGA 5ICTA 4R9FA 2XD2A 1NNPA 3S2VA 4ZZAA 1XC1A 4RK2A 4N6PA 4RYAA 3PUWE 4F3BA 1GV8A 4IO4A 4LZ5A 1QULA 3D4GA 2Q2AA 2F7AA 2VHAA 4U2RA 4HTGA 4QFNA 1MXXA 4MBPA 1I6AA 1WODA 2DXRA 3K1MA 3TQLA 1R1NA 1DTZA 1UIVA 4HW8A 5AA4B 4GXAA 1GVCA 3AXFA 1POTA 1SW5A 2O51A 3IX1A 1JW1A 4U23A 2QMWA 4OMBA 1DTGA 3RPWA 1VFDA 3KBRA 4EF1A 1EZOA 4KYEA 1UIUA 3FVKA 2REJA 4GVOA 4NWCA 3SEUA 3Q26A 1CE2A 2Z23A 3OEMA 3PPRA 3RUMA 3H6VA 1AH5A 1IXGA 1P1OA 1BTJA 3TTLA 4P0IA 4GWOA 2F35A 3V89B 3U1OA 1EZ9A 4TQUQ 3G3KA 1OLCA 5ITOA 4EXKA 3K01A 5CC2A 2RCBA 2HXWA 4DCXA 4JWOA 1FTOA 2FA7A 5K2XA 4UA8A 3ZSFA 3C36A 4MFIA 5I2KB 3MZ9A 1JEUA 3O6HA 4ZEFA 1Y3QA 1AIVA 5KDTB 3FJ7A 4ZS9A 1USYE 4BDNA 4OVJA 2BJJX 1MY1A 1US4A 1B7ZA 4F29A 4THIA 4WXJA 2X7PA 2THIA 2YJPA 3TCFA 2I48A 3FIRA 3C9HA 4LUBA 3Q29A 4QHQA 1MPBA 5HBCA 1ATGA 3MP8A 4RPNA 2V93A 1LGBC 4OXVA 4RNSA 4C1UA 4F22A 1B40A 2CZLA 1FQAA 3MZBA 1EU8A 1IEJA 4X1DA 3FVNA 1SDXA 1YPNA 3TDJA 3S9MC 3SEYA 1D4NA 4R6YA 3SEWA 2RCAA 3S9NC 5DVJA 1A8FA 1J1NA 4H8IA 1MY0A 3MPLA 4OTEA 3QAXA 2V3QA 1NL5A 4JSOA 5CMBA 3FD3A 1PB7A 5JTYB 3VVDA 5KCJB 4NTLA 1MXZA 1MXVA 3V5AA 4YB7A 2OWTA 5CMMA 4YMBA 5LOMA 3OOAA 5AA2D 3FXUA 1BIYA 3THIA 1DOTA 1JVXA 4IO5A 3R6UA 4QFLA 4F3GA 3E4RA 3PUVE 4X1BA 1MQHA 2P2AA 1QJMA 4ECFA 1KWHA 3WAFA 3L6GA 3MPKA 2YPNA 2I4CA 2R71A 1BKAA 1LAXA 3UIFA 3F11A 5AA4A 5DEXB 4PE5B 2HFBA 4Z0IA 3W9VA 1MY3A 1A54A 5FHNA 4I62A 1BLFA 1NH7A 4Z7EA 1B58A 2ZNTA 4KCCA 1XT8A 4TLLB 4KPTA 2DWJA 2ZNUA 1A99A 2H4IA 4P11A 1HSLA 3TCHA 4WEDA 4JXIA 1MY4A 5F7VA 1Y4CA 4GIZA 1N04A 4NF6B 1IITA 3QYTA 1B7UA 3DM0A 3OO9A 4EQBA 2M8CA 4BDMA 3JV9A 1LFGA 2O6AA 5L9SA 1LFHA 3MWBA 5I2KA 5TP9B 1QUKA 5H8HB 2Q9TA 4TOZA 4JBZA 5KDTA 4EXLA 3O66A 2Y7RA 3LSWA 2Z22A 4LATA 4BDRA 2R9JA 2XXYA 5FHMA 3IB0A 4QFKA 2O7IA 4GFRA 5I58B 3SESA 5BUUA 2X7QA 2F78A 2HZKA 2VD2A 2DVCA 3EHUA 2RC9A 2DYXA 1ZMGA 4C0RA 2F5XA 3TMGA 1FQEA 3N26A 5A5XB 4LA9A 1FQFA 2P1SA 2NUVA 3DP4A 3U8QA 5L9MA 3DLNA 4IO2A 2E1SA 5KCJA 4ESXA 2DQVA 1UTHB 3EHSA 3TZAA 3O28A 3IOWA 2OWSA 5DVFA 3H6TA 2NXOA 2NVUB 5KZTA 1BP5A 3OD7A 3H7MA 1F9BA 1JW5A 3HO7A 3C32A 4OFOA 1RYXA 1AMFA 3LC8A 3I6VA 5H8FB 3FZVA 1SYIA 1MQIA 1Y4TA 5H8QB 3EN3A 1QKBA 2DP8A 4G8NA 3EPEA 2B3FA 1QUIA 5DEXA 1H43A 3M3LA 3CFXA 3FJGA 5FHOA 3I3VA 4R75A 4U4SA 2UVJA 1M5BA 5DYHA 2OLBA 2RKMA 4F2OA 5ISUA 2Q89A 4G8HA 3CG1A 4G8MA 3IOVA 2Z8DA 4KYDA 4EUOA 4O3AA 4BLAA 4RA1A 3SKPA 1NH8A 4IO3A 1SBPA 2H98A 2XXRA 3HHFA 1PC3A 1MPDA 5JEIA 5ICQA 2F6GA 4ND9A 3OENA 4ZEDA 1T0KA 4ELQA 4ZEBA 3MW0A 4XKPA 4PP0A 3UA8A 4NF6A 4FECA 3QIMA 1M5CA 3RT6B 3FV1A 3IAZA 3VFJA 4NWDA 4U1ZA 5TP9A 1OQGA 1PBQA 2XX9A 1B5HA 2I3VA 5H8HA 4F31B 4R74A 2XXUA 3C33A 2Q8JA 2PT2A 4R9GA 4RJZA 1LAFE 4FEBA 3HCQA 2UYFA 4JWYA 4OESA 4NF8B 2HCAA 3ONMA 3FUZA 4RY1A 3B6QA 3TELA 4MH5A 5I58A 1N3XA 4R6HA 4YU0A 2Q88A 3P7IA 3GXAA 2A5TA 5L9OA 2ZYOA 3TTMA 1LFIA 5A5XA 4HS7A 4F3SA 1PEBA 3I5OA 1B46A 3EHTA 1B05A 2A5SA 1TFDA 3PPOA 1LCTA 2AL5A 1OMPA 4GRKA 4G68B 4IGRA 4F1YA 4R2BA 3BBRA 2I0BA 4KCDA 3LUYA 3H3GA 1LBCA 4YKPA 1B3EA 1TFAA 3FJMA 2I58A 4EDPA 1UTHA 2KLFA 3KGCA 3IO6A 1B5IA 4FATA 3TUSA 1B4HA 4RPOA 3CI8A 5H8NB 1LAHE 1Y3NA 3HPIA 4GL0A 2D5WA 4M1VA 4GOTA 1GR2A 3RT8A 2ONKE 4POXA 5IKBA 5H8FA 5J1DA 2NOOA 1EH3A 2P0SA 4GD5A 3G3GA 4X9TA 3MAMA 5H8QA 1FTLA 4MLQA 4XTCQ 3FVGA 3RN8A 3U94A 5EHSA 4DZ1A 3T9XB 1B3HA 2F8DA 1SI1A 3TYHA 3IK6B 2FNCA 3B6WA 2UXAA 1SQYA 5DTBA 1IXIA 3OSQA 2ONRA 3IORA 3PPNA 2GH9A 4FAJA 3MP1A 3O6GA 4XKRA 4WKMA 1SW2A 5CBRA 3TAJA 4IGTA 4E0WA 4E0XA 1DPPA 3G3IA 4OQOA 2XXIA 1O64A 4Q0CA 4POWA 4G2ZA 3TTKA 5BWJA 3T9UA 5IAIA 2FYIA 1YAEA 3N94A 2HAVA 3E3KA 3HV1A 3MP6A 2QSXA 3GBBA 4IY5A 3FASA 3JYRA 3CFLA 1FQCA 1Y3PA 2REGA 1B2HA 3G3JA 3VV5A 2F97A 4ZECA 3IOUA 4JB7A 1I6BA 4GQOA 1ZU0A 3IR1A 3VDFA 4NF8A 3MVZA 4O3CA 1URSA 2Q2CA 4H8JA 5B70A 4GL8A 3MVXA 3MVWA 1N7WA 4ZE9A 2ALUA 4F39A 3OSRA 4JWXA 5L8DA 2H25A 1DMBA 1RKMA 4LQ5A 1LB8A 2W7YA 3Q27A 1ZJLA 2WKYA 1NNFA 5FTHA 3VLVA 3K6UA 2H99A 1SW1A 3OEKA 1II5A 4KFQA 4L17A 4KI0E 1B7HA 4OFLA 1FW0A 5AA3A 2VD3A 4FJPA 4LZ7A 4BDQA 3K2DA 4G68A 3G3FA 4RK9A 1JNFA 1QUJA 4OFJA 3A3UA 2F36A 1JETA 3QXMA 1B3FA 4DXBA 1P1WA 3N6UA 4DE8A 4R73A 1XS5A 1IIWA 2UVGA 3CG3A 1MDQA 3RLFE 4H0WA 2F34A 1N3WA 5H8NA 4DCYA 4R2FA 3JZJA 4DDDA 2QS1A 3FGSA 4PFTA 3C34A 1M5EA 1DSNA 2PMSA 1POY1 5CBSA 3Q28A 3TTNA 3U92A 1NNTA 2V3UA 1FTJA 2RINA 4OETA 4NF5B 2V84A 5CM6A 1QW0A 2V3TA 5AA1A 1B3GA 2I49A 2QS3A 1ANFA 1MH4A 4KR5A 3K6XA 4QSCA 3E9XA 3T66A 5CMCA 2ESNA 4PFUA 4YZZA 1LCFA 5M2VA 4IO7A 1P1QA 1Y9UA 4AB6A 4HCYA 2ZMBA 1PDAA 5F1QA 4PETA 2XXXA 3FXRA 3MQ9A 2I3WA 3KOTA 1SVXB 4IO6A 3U72A 3K4UA 5JTYA 2DWHA 4RXLA 3RTWB 4ZEIA 3DELB 2IEEA 5JK4A 4ISUA 4AB5A 3VLWA 2XXTA 3GLBA 2O84X 2QL3A 3PMVA 2RC8A 4K3FA 3IL1B 1UQWA 1OVBA 5I57B 2OZZA 3SERA 2PYYA 1H44A 3SEVA 1P99A 3K00A 2DWAA 5I2NB 4FIMA 3PUXE 3SEXA 1MY2A 3BFTA 1OLAA 1FTKA 1FQDA 4X48A 3VXBA 3TODA 4MLVA 2B3BA 3GBAA 1UTBB 4YAHX 1FQBA 3PD9A 4LQ2A 1A55A 3KOSA 4G4PA 3TKDA 2ZYNA 4OWDA 2ZYKA 1MRPA 3QK6A 2IA4A 1VFEA 4YICA 4G68C 2VGQA 3V83A 4G77A 1N7XA 3H4ZA 1PB8A 3T9HB 5I59B 2X26A 2QMXA 1N0TA 3B6TA 1B6HA 2Y7IA 3H6UA 1Q1KA 2Z8EA 5I84A 1YCJA 3OO6A 4KQPA 3S9LC 2ANJA 1ZBMA 1EZPA 4I8CA 2O1LA 3MBPA 1MM7A 1TWYA 3PV0E 2F7CA 1FTMA 2ONSA 4H6DA 3O9PA 3ODBA 3OXNA 2UVIA 3A09A 3K02A 2H9BA 2I4BA 2QRYA 3R26A 1FCKA 1MH3A 1HSEA 3QSLA 3FATA 4NF5A 2XD3A 5EHMA 3VVFA 2QS2A 4F1UA 2O7UA 5K2YA 1XVXA 2XX7A 1PBPA 4F2QA 3K6VA 5H8SA 3ILTB 3PGFA 3CFZA 1SYHA 4I9DA 2I0CA 3RQTA 1H76A 1XVYA 1JW4A 2XX8A 4Q30B 2VP1A 3LR1A 2PVUA 4XIGQ 1NNKA 4PFYA 4BDLA 2GHBA 4XXUA 2DE4A 3OO7A 3QUFA 3E13X 2DSFA 3ZS6A 1IUDA 3FXQA 4O3BA 3W15C 1ZLQA 5EYFA 3MZ1A 1WVJA 1JEVA 2OK2A 4PQJA 1LSTA 2HEUA 1L5TA 3USDA 3HN0A 4OHNA 3W9WA 4ESWA 2Y7KA 2HQ0A 4IB2A 3M3FA 2RF1A 4DXCA 1IZ1A 4KD5A 1D3KA 1SI0A 4ZZEA 2QS4A 2XXPA 4ELOA 3PMXA 3KG2A 3TCGA 2AIXA 1IXHA 4ZEKA 4PFWA 5CI5A 3U93A 3PUYE 5TPAB 1TT1A 3G7WA 2HZLA 2RC7A 5I57A 4XKQA 4H5GA 3RY3A 4U22A 4LONB 4ZDMA 3KSXA 3IB2A 2DOJA 2OBGA 2O69A 2QJEA 3ZKKA 2ZNSA 4EQ7A 2GRVA 2Z8FA 5I2NA 1SW4A 3O29A 1A7LA 1D9YA 4H5FA 4F18A 4QF9A 2D21A 2G93A 4GF8A 4HCWA 2DVZA 3T22A 1MXUA 4WEPA 3CSBA 1UTBA 3FV2A 3T9VA 4DLDA 3DP6A 2R6GE 1LBBA 1MDP1 3SDFA 4NE4A 1H45A 3KSJA 2DS9A 5CMKA 4NEDA 1H3DA 2AYSA 3IJXB 1DPEA 3ILUB 3O2AA 1Z7NE 4R6KA 1HSJA 3H06B 2OCUA 3VXCA 2PBWA 1N76A 5I59A 4OERA 4TLMB 1XOCA 3M3KA 3KN7A 4FEDA 1AL3A 3IJOB 4N13A 1S7YA 4YKJA 5AA2B 1Y1MA 2Y7PA 1B4ZA 4YB6A 3MVYA 3Q25A 1B0HA 1ZKBA 1O63A 1I69A 5CRYA 2XXVA 3T93B 2XHDA 2GHAA 1SD3A 1MQJA 3UGWA 1R9QA 1Y1ZA 1M5DA 4LVQA 3TFLA 1TXFA 2XXQA 2ZYMA 3PPPA 3HSTA 4QSEA 4YMAA 3KEIA 5I56B 4BDOA 3HHGA 4F19A 3WAEA 4U21A 1VR5A 3LSFB 4OEUA 4XKNA 2XXWA 1D9VA 1B9JA 3CIJA 4H65A 4ONYA 3PUZE 1URDA 4NF4B 1P1NA 1VSOA 3O97A 3H6WA 3K0VA 3TQWA 1MPCA 2DE3A 2B65A 2PT1A 4GLIA 4IY6A 4AQ4A 1AOVA 1LLSA 2DXYA 3OO8A 3EQ1A 2Y84A 1M5FA 3S4UA 4Q8RA 3CVGA 1MXYA 4ZE8A 1A40A 1IQ7A 1B32A 1MQGA 3VVEA 2F7BA 1LB9A 4EQ9A 3K1PA 1QVSA 1S9TA 1US5A 1NMUA 3RTFB 3R7XA 2VOZA 5ITPA 3CRBA 5FTIA 5TPAA 4C1TA 3UK4A 1Y20A 3CSGA 3DP8A 2V25A 4U4XA 3T96B 3IB1A 2YLNA 3V8XB 3KN3A 1GGGA 4I1DA 3UN6A 3IOTA 3S9EA 3BKIB 3K1NA 4R72A 2ZXTA 3MUQA 5ELVA 3M8UA 2NWJA 2OJTA 1Z7ME 4Q5TA 4H67A 2PX1A 3QUJA 3FVOA 4OYVA 1QKAA 2XXHA 1OVTA 4OEVA 3TTRA 1A8EA 2Y7WA 4GXSB 1ELJA 4MF3A 1MG1A 1YTVA 3PU5A 3LSLA 3PPQA 1LAGE 4FORA 3UORA 3EF7A 1NKXA 2A5TB 2UVHA 1Q35A 3SETA 1GTKA 4N07A 1URGA 1B52A 1B5JA 3O6IA 5DT6A 3H03A 3PD8A 4FE8A 3IO4A 1MQDA 2H5YA 3N6TA 3C35A 1I6QA 2HAUA 3KJTA 3L6HA 5B7DA 2AL4A 1S50A 3RGYA 2ABHA 2F6PA 3LBSA 5AA2A 3A3CA 3C31A 4UACA 2E0SA 1B51A 1R6ZA 1IXCA 3BFUA 1ZTYA 4F1VA 3MJNA 1MM6A 2LAOA 1OQHA 1B1XA 2D3IA 3OMBA 4EF2A 3KZGA 2I6EA 3CR9A 5TU0A 3LSXA 4P0GA 2DE2A 2CMOA 3ZKLA 3D4CA 1ZIUA 2QPQA 4QRZA 3ECRA 3KJ7A 1P1UA 3MC2A 4QSDA 4QFOA 4ELRA 3UP9A 2G29A 5I56A 1N84A 5HPQA 1PB9A 4DIGA 1OIBA 3C4MA 5HM4B 1B3LA 4NMYA 1CB6A 1MXWA 5DVIA 3B7DA 4YKKA 4OZ9A 3VLUA 4ELPA 2O68A 1XHYA 4DXUA 4U1OA 1USYH 3VE1B 4NF4A 3TEPA 1NFTA 3OELA 4LP2B 3TPAA 1O7TA 1RYOA 3N5LA 1B0LA 3G3HA 1JQFA 1B1HA 4JDFA 4F3PA 1MS7A 4OENA 4M4GA 1WDNA 2GFEA 4QFPA 3PMWA 2O1MA 4JSDA 3KFMA 2DWIA 4YB5A 4KYSA 2UYEA 3RNNA 4YKIA 3K6WA 1VE4A 4KHZE 1R9LA 5AE4A 3KN8A
chains in the Genus database with same CATH superfamily
4XEQA 1JVYA 4LZ8A 4H1XA 3GZGA 5ICTA 4R9FA 2XD2A 1NNPA 2XWKA 3S2VA 4ZZAA 1XC1A 4RK2A 4N6PA 4RYAA 3PUWE 4F3BA 2FIEA 1GV8A 4IO4A 4LZ5A 1QULA 3D4GA 2Q2AA 2F7AA 2VHAA 4U2RA 4HTGA 4QFNA 1MXXA 4MBPA 1I6AA 1WODA 2DXRA 3K1MA 3TQLA 1R1NA 1DTZA 2WBBA 1UIVA 4HW8A 5AA4B 4GXAA 1GVCA 3AXFA 1POTA 1SW5A 2O51A 3IX1A 1JW1A 4U23A 4MIJA 2QMWA 4OMBA 1DTGA 3RPWA 1VFDA 3KBRA 4EF1A 1EZOA 4KYEA 3FXBA 1UIUA 3FVKA 1NV2A 2REJA 4GVOA 4NWCA 3SEUA 3Q26A 1CE2A 2Z23A 3OEMA 3PPRA 3RUMA 3H6VA 1AH5A 1IXGA 1P1OA 1BTJA 3TTLA 4P0IA 2DDKA 4GWOA 2F35A 5T3JA 3V89B 3U1OA 1EZ9A 3D1RA 4TQUQ 3G3KA 1OLCA 5ITOA 1G0HA 4EXKA 3K01A 5CC2A 2RCBA 2HXWA 4P8BA 3KC1A 2F3DA 4DCXA 4JWOA 1FTOA 3RPLA 2FA7A 5K2XA 5IGAA 4UA8A 3ZSFA 3C36A 4MFIA 5I2KB 4JVCA 1IMCA 4NAPA 3MZ9A 1VDWA 1JEUA 3O6HA 4ZEFA 1Y3QA 1AIVA 5KDTB 3FJ7A 4ZS9A 1USYE 4BDNA 4OVJA 1RDXA 2QVUA 2BJJX 1MY1A 1US4A 1B7ZA 5ESYA 4F29A 4THIA 4WXJA 2X7PA 2THIA 2YJPA 3TCFA 4PDDA 2I48A 3FIRA 3C9HA 4LUBA 3Q29A 5I5PA 3KBZA 4QHQA 1MPBA 5HBCA 1ATGA 1IMFA 3MP8A 4LN5A 3B50A 4RPNA 2V93A 1LGBC 3BIHA 4OXVA 4RNSA 4C1UA 4F22A 1B40A 2CZLA 1FQAA 3EKIA 3MZBA 1EU8A 1IEJA 4X1DA 3FVNA 1SDXA 1YPNA 3TDJA 3S9MC 3SEYA 1D4NA 4R6YA 3SEWA 2RCAA 2PFZA 1NUWA 3S9NC 5DVJA 1A8FA 5FBPA 1J1NA 4H8IA 1MY0A 3MPLA 4OTEA 3QAXA 2V3QA 4PE3A 1NL5A 4JSOA 5CMBA 3FD3A 1PB7A 5JTYB 3VVDA 5KCJB 5EQ8A 4NTLA 1MXZA 1MXVA 3V5AA 2KR0A 4YB7A 2QVRA 2OWTA 5CMMA 4YMBA 4I3EA 5LOMA 3OOAA 5AA2D 3FXUA 1BIYA 3THIA 1DOTA 1JVXA 1NV4A 4GBVA 4IO5A 3R6UA 4QFLA 4F3GA 3E4RA 3PUVE 4X1BA 1MQHA 2P2AA 4HE2A 1QJMA 1RDYA 4ECFA 1KWHA 3WAFA 3L6GA 3MPKA 4O7MA 2YPNA 4PAKA 2V4CA 2I4CA 2R71A 5ET5A 1K9YA 1BKAA 1LAXA 3UIFA 3F11A 1KA1A 1FBEA 5AA4A 5DEXB 4PE5B 4P1EA 2HFBA 5IZ3B 4Z0IA 3ROJA 3W9VA 1MY3A 4P1LA 3U65A 1A54A 5FHNA 4I62A 4P56A 3RYDA 1BLFA 1LEVA 1NH7A 4Z7EA 1B58A 2ZNTA 4FBPA 4KCCA 1XT8A 4TLLB 4PFRA 4KPTA 2DWJA 2ZNUA 1A99A 2H4IA 4PCDA 4P11A 1HSLA 3TCHA 4WEDA 4JXIA 4DI4B 1MY4A 5F7VA 5ET6A 1Y4CA 1FPJA 4GIZA 1N04A 4NF6B 1IITA 3QYTA 1B7UA 1LBVA 3DM0A 3OO9A 4EQBA 2M8CA 4BDMA 3JV9A 1LFGA 2O6AA 5L9SA 1LFHA 3MWBA 5I2KA 5TP9B 1QUKA 2WX9A 4QBAA 5H8HB 4N4UA 2Q9TA 4TOZA 4JBZA 1FPBA 5KDTA 4EXLA 3O66A 2Y7RA 3LSWA 2Z22A 1FPEA 4LATA 4BDRA 2R9JA 1NV3A 2XXYA 4I3YA 5FHMA 2HPGA 3IB0A 4QFKA 2O7IA 4GFRA 5I58B 3SESA 5BUUA 2B4MA 2X7QA 2F78A 2HZKA 2VD2A 2DVCA 1JP4A 3EHUA 2KQZA 2RC9A 2DYXA 4GWYA 1ZMGA 4C0RA 4XF5A 2F5XA 4OVRA 3TMGA 4PTKA 1FQEA 2PFYA 3N26A 5A5XB 1FBPA 4LA9A 4MNIA 1FQFA 1NV7A 2P1SA 2Q74A 2NUVA 3DP4A 4MHFA 3U8QA 3PTYA 5L9MA 3DLNA 2CZKA 2WYKA 1KA0A 4IO2A 1NUZA 2CEYA 2E1SA 5KCJA 5EYGA 4ESXA 2DQVA 1DK4A 1UTHB 3EHSA 4X8RA 3TZAA 3O28A 3IOWA 4MJOA 2OWSA 5DVFA 3H6TA 4OVQA 2NXOA 2QFLA 4P3LA 2NVUB 5KZTA 1BP5A 3OD7A 1NI9A 2FBPA 3H7MA 4NG7A 1F9BA 1JW5A 3HO7A 3C32A 4OFOA 1RYXA 1AMFA 3LC8A 3I6VA 5H8FB 3FZVA 1SYIA 1MQIA 1Y4TA 5H8QB 3EN3A 2CZIA 1QKBA 2DP8A 2VPOA 4G8NA 3EPEA 2B3FA 1QUIA 5DEXA 1H43A 3M3LA 3CFXA 3FJGA 5FHOA 3I3VA 3T1BA 4NF0A 4R75A 4U4SA 5IZ3A 2UVJA 1M5BA 5DYHA 2OLBA 2RKMA 4F2OA 5ISUA 2Q89A 4G8HA 3CG1A 4G8MA 3IOVA 2Z8DA 4KYDA 4EUOA 4O3AA 4BLAA 4RA1A 3SKPA 1FRPA 1NH8A 4IO3A 1SBPA 2H98A 2L5VA 2XXRA 3HHFA 5DW8A 1PC3A 1MPDA 5JEIA 5EYHA 5ICQA 2F6GA 4GX4A 4ND9A 3OENA 3A29A 4ZEDA 1T0KA 4ELQA 4ZEBA 3MW0A 4XKPA 4PP0A 3UA8A 4NF6A 4FECA 1IMEA 3QIMA 4GWUA 1M5CA 3RT6B 3FV1A 3IAZA 3VFJA 4NWDA 4U1ZA 3LUZA 5TP9A 1OQGA 1KZ8A 1PBQA 2XX9A 1B5HA 2I3VA 5H8HA 4F31B 1Q9DA 4R74A 2XXUA 3C33A 2Q8JA 1AWBA 3IFCA 2PT2A 4R9GA 4MEVA 4RJZA 2Y5KA 1LAFE 4FEBA 3HCQA 2UYFA 4JWYA 4OESA 4NF8B 2HCAA 3ONMA 4N6KA 3FUZA 4RY1A 3B6QA 3TELA 4MH5A 5I58A 1N3XA 4R6HA 4YU0A 2Q88A 3P7IA 3GXAA 2A5TA 5L9OA 2VPNA 2ZYOA 3TTMA 1LFIA 5A5XA 4HS7A 4F3SA 1PEBA 3I5OA 4MNCA 1B46A 3EHTA 1B05A 2A5SA 1TFDA 3PPOA 1LCTA 2AL5A 1OMPA 4GRKA 4NN3A 2HHMA 4G68B 4IGRA 4F1YA 4R2BA 3BBRA 2I0BA 4KCDA 3IFAA 3LUYA 3H3GA 2FIXA 1LBCA 4YKPA 1B3EA 1TFAA 3FJMA 2I58A 4H45A 4EDPA 1UTHA 2KLFA 3KGCA 1LBYA 1LBZA 3IO6A 1B5IA 4FATA 3TUSA 1B4HA 4RPOA 3CI8A 5IM2A 1NUYA 5H8NB 1FBHA 1LAHE 1Y3NA 3HPIA 4GL0A 2D5WA 4M1VA 4GOTA 1GR2A 3RT8A 2ONKE 4POXA 5IKBA 5H8FA 5J1DA 2NOOA 1EH3A 2P0SA 4GD5A 3G3GA 4X9TA 3MAMA 4NGUA 5H8QA 1FTLA 4MLQA 4XTCQ 3FVGA 4MX6A 3RN8A 3U94A 5EHSA 4DZ1A 3T9XB 1B3HA 2F8DA 1SI1A 3TYHA 3IK6B 1K9ZA 2FNCA 2GQ1A 3B6WA 2UXAA 1SQYA 4XFEA 5DTBA 1IXIA 3OSQA 2ONRA 3IORA 3PPNA 2GH9A 4N6DA 4FAJA 3MP1A 3O6GA 4XKRA 3LV0A 4WKMA 5EQAA 5IZZA 1SW2A 5CBRA 3ISPA 3TAJA 4IGTA 4E0WA 4E0XA 1DPPA 3G3IA 4OQOA 2XXIA 1O64A 4Q0CA 4POWA 4PC9A 2JJKA 4G2ZA 3TTKA 5BWJA 3T9UA 5IAIA 2FYIA 1YAEA 4OVTA 1DBZA 3N94A 2HAVA 3E3KA 1EYJA 3HV1A 3MP6A 2QSXA 3GBBA 4IY5A 3FASA 3JYRA 3CFLA 1FQCA 1Y3PA 2REGA 1B2HA 3G3JA 3VV5A 2F97A 4MAGA 3MSTA 4ZECA 4HE1A 4PF8A 3IOUA 4JB7A 4PFIA 1INPA 1CNQA 1I6BA 4GQOA 1ZU0A 3IR1A 3VDFA 4KXPA 3MVZA 1YZ0A 4NF8A 4O3CA 1URSA 2Q2CA 4H8JA 4AS4A 5B70A 4GL8A 3MVXA 3MVWA 1N7WA 4ZE9A 2ALUA 4F39A 3OSRA 4JWXA 5L8DA 2H25A 1DMBA 1RKMA 4LQ5A 1QGXA 1LB8A 2W7YA 3Q27A 1ZJLA 2WKYA 1NNFA 5FTHA 3QMFA 4NQ8A 3VLVA 1YYZA 3K6UA 4O94A 2H99A 1SW1A 3OEKA 1II5A 4KFQA 2XWOA 4L17A 4KI0E 2XWIA 1B7HA 4OFLA 1FW0A 5AA3A 2VD3A 4OANA 4FJPA 4LZ7A 5LTCA 4BDQA 3K2DA 4G68A 3G3FA 4RK9A 2QVVA 1JNFA 1QUJA 4OFJA 3A3UA 2F36A 1JETA 3QXMA 1B3FA 2ZZWA 4DXBA 1P1WA 3N6UA 4DE8A 4R73A 1EYKA 1XS5A 4PF6A 1IIWA 2UVGA 3CG3A 1MDQA 3RLFE 5ET7A 1BK4A 1NV1A 4H0WA 2F34A 1N3WA 5H8NA 4DCYA 4R2FA 3JZJA 4DDDA 1FPDA 2QS1A 3FGSA 4PFTA 3C34A 1M5EA 4P47A 1DSNA 2PMSA 1POY1 5CBSA 3Q28A 3TTNA 5EQ9A 3U92A 1NNTA 2V3UA 1FTJA 2RINA 4OETA 4NF5B 2V84A 5CM6A 1QW0A 2V3TA 5AA1A 1B3GA 2I49A 2QS3A 1ANFA 1MH4A 2B4LA 1LBWA 4JVDA 4KR5A 2P3VA 3K6XA 4QSCA 1FJ9A 3E9XA 2ZZXA 3T66A 5CMCA 4PFUA 2ESNA 4YZZA 1LCFA 5M2VA 4IO7A 1P1QA 4OVSA 1Y9UA 4AB6A 4HCYA 2ZMBA 1PDAA 5F1QA 4PETA 2XXXA 1FPLA 4N91A 2WBDA 3FXRA 3MQ9A 2I3WA 3KOTA 1SVXB 4IO6A 3U72A 3K4UA 5JTYA 2DWHA 4RXLA 3RTWB 1LBXA 4UABA 4H46A 4ZEIA 3DELB 2IEEA 5JK4A 4ISUA 4AB5A 2WYPA 3VLWA 2XXTA 3GLBA 2O84X 2QL3A 3PMVA 4NHBA 2RC8A 4K3FA 3IL1B 1UQWA 4N8GA 1OVBA 5I57B 1FBFA 2OZZA 3SERA 2PYYA 1H44A 3SEVA 1P99A 3K00A 2DWAA 5I2NB 4FIMA 2WEFA 3PUXE 3SEXA 1MY2A 2BJIA 3BFTA 1OLAA 1FTKA 1FQDA 4X48A 3VXBA 4PFBA 3TODA 4MLVA 2VT5A 2B3BA 3GBAA 1UTBB 4YAHX 4OA4A 1FQBA 3PD9A 4LQ2A 1A55A 3KOSA 4G4PA 3TKDA 2ZYNA 4OWDA 2ZYKA 1MRPA 3QK6A 2IA4A 1VFEA 4YICA 4G68C 2VGQA 3V83A 4G77A 1N7XA 3H4ZA 1PB8A 3T9HB 5I59B 2X26A 2QMXA 4OVPA 1N0TA 3B8BA 3B6TA 4PAFA 1B6HA 4N8YA 2Y7IA 3H6UA 4PGPA 1Q1KA 2Z8EA 5I84A 1YCJA 3OO6A 4KQPA 3S9LC 2ANJA 1ZBMA 1EZPA 4I8CA 2O1LA 3MBPA 1MM7A 1TWYA 5EQ7A 3PV0E 2F7CA 1FTMA 2ONSA 4H6DA 3O9PA 3ODBA 3OXNA 5I7IA 2UVIA 3A09A 3K02A 2H9BA 2I4BA 2QRYA 2Y5LA 1FCKA 3R26A 4GWXA 1MH3A 1HSEA 3QSLA 3FATA 4NF5A 2XD3A 5EHMA 3VVFA 2QS2A 4F1UA 2O7UA 5K2YA 1XVXA 1FPGA 1SPIA 2XX7A 1PBPA 4F2QA 3K6VA 5H8SA 3ILTB 3PGFA 3CFZA 2FHYA 1SYHA 4I9DA 2I0CA 3RQTA 1EYIA 1H76A 1XVYA 1JW4A 2XX8A 4Q30B 2VP1A 3LR1A 2PVUA 1DCUA 4XIGQ 1NNKA 4PFYA 4BDLA 2GHBA 4XXUA 2DE4A 3OO7A 3QUFA 1XI6A 3E13X 2DSFA 3ZS6A 1IUDA 3FXQA 4O3BA 3W15C 1ZLQA 5EYFA 3MZ1A 1WVJA 1JEVA 2OK2A 4PQJA 1LSTA 2HEUA 1L5TA 3USDA 3HN0A 4OHNA 3W9WA 4ESWA 2Y7KA 2HQ0A 4IB2A 1FBDA 3M3FA 2RF1A 4DXCA 1IZ1A 2PCRA 4KD5A 1D3KA 1SI0A 4P9KA 4ZZEA 2QS4A 2XXPA 4ELOA 3PMXA 3KG2A 3TCGA 2AIXA 1IXHA 4ZEKA 4PFWA 5CI5A 3U93A 3PUYE 5TPAB 4GBWA 1TT1A 4PGNA 3G7WA 2HZLA 2RC7A 5I57A 4XKQA 4H5GA 3RY3A 4U22A 3BIGA 4LONB 4ZDMA 3KSXA 3IB2A 2DOJA 2OBGA 2R8TA 2O69A 2QJEA 3ZKKA 5I3SA 2ZNSA 2FVZA 4EQ7A 2GRVA 2Z8FA 5I2NA 1NUXA 1SW4A 3O29A 1A7LA 1D9YA 4H5FA 4F18A 4QF9A 2D21A 2G93A 2OX3A 4HXVA 4GF8A 4HCWA 2DVZA 3T22A 4PAIA 1MXUA 4WEPA 3CSBA 1UTBA 3FV2A 3T9VA 4DLDA 3DP6A 1G0IA 2R6GE 1LBBA 1YXIA 1MDP1 3SDFA 4NE4A 1H45A 3KSJA 2DS9A 5CMKA 4NEDA 1H3DA 2AYSA 3IJXB 1DPEA 3ILUB 3O2AA 1Z7NE 4R6KA 1HSJA 1FPIA 3H06B 2OCUA 3VXCA 2PBWA 1N76A 5I59A 2XWVA 4OERA 2Q8MA 4TLMB 1XOCA 4AS5A 3M3KA 3KN7A 4JVIA 4FEDA 1AL3A 4IR8A 3FBPA 3IJOB 4N13A 1S7YA 4N15A 4YKJA 5AA2B 1Y1MA 2Y7PA 1B4ZA 3CHGA 4YB6A 3MVYA 3Q25A 1B0HA 1ZKBA 1O63A 1NV5A 1I69A 5CRYA 2XXVA 4MNPA 3T93B 2XHDA 2GHAA 1SD3A 1MQJA 3UGWA 1R9QA 1Y1ZA 1M5DA 4LVQA 3TFLA 1TXFA 2XXQA 2ZYMA 5IZ1A 3PPPA 3HSTA 3HFUA 1FTAA 4QSEA 4YMAA 3KEIA 5I56B 4BDOA 3HHGA 4F19A 3WAEA 4U21A 1VR5A 1NV0A 3LSFB 4OEUA 4XKNA 2XXWA 1D9VA 1FPKA 1B9JA 3CIJA 4H65A 4ONYA 3PUZE 1URDA 4I40A 1P1NA 4NF4B 1VSOA 3O97A 3H6WA 3K0VA 3TQWA 1MPCA 2DE3A 2B65A 2PT1A 4GLIA 4O7IA 3E78A 4IY6A 4AQ4A 1AOVA 1LLSA 2DXYA 3OO8A 2CEXA 3EQ1A 2Y84A 1M5FA 5ET8A 4PBQA 3S4UA 4Q8RA 3CVGA 2P3NA 1MXYA 2OWZA 4ZE8A 4HE0A 1A40A 1IQ7A 1B32A 1MQGA 3VVEA 2F7BA 1LB9A 2CZHA 5F24A 4EQ9A 3K1PA 1QVSA 1S9TA 1US5A 4QXDA 1NMUA 3RTFB 2XXKA 4GWWA 3R7XA 2VOZA 5ITPA 3CRBA 1FPFA 1FBCA 5FTIA 5TPAA 2ZZVA 4C1TA 3UK4A 4N17A 1Y20A 3CSGA 3DP8A 2V25A 4U4XA 3MYUA 3T96B 3IB1A 2YLNA 3V8XB 3KN3A 1GGGA 4I1DA 3UN6A 3IOTA 3KC0A 1RDZA 3S9EA 3BKIB 3K1NA 4R72A 2ZXTA 3MUQA 3NOHA 5ELVA 3M8UA 2NWJA 2OJTA 1Z7ME 4Q5TA 4H67A 2PX1A 3QUJA 3FVOA 1IMBA 4OYVA 1QKAA 2XXHA 1OVTA 5A5LA 4OEVA 3TTRA 1FBGA 4NX1A 1A8EA 2Y7WA 4GXSB 1ELJA 4MF3A 1MG1A 1YTVA 3PU5A 3LSLA 3PPQA 4O8MA 2F3BA 4MCOA 1LAGE 4FORA 3UORA 3EF7A 1NKXA 2A5TB 2UVHA 1Q35A 3SETA 1GTKA 4N07A 1URGA 1B52A 1B5JA 3O6IA 5DT6A 3H03A 3PD8A 4FE8A 3IO4A 1MQDA 1FSAA 2H5YA 1IMAA 3N6TA 3C35A 1I6QA 2XA5A 3SZPA 2HAUA 3KJTA 3L6HA 5B7DA 1FJ6A 2AL4A 4GWSA 1S50A 3RGYA 2ABHA 2F6PA 3LBSA 5AA2A 3A3CA 3C31A 4UACA 2E0SA 1B51A 3RPLB 1R6ZA 1IXCA 3BFUA 3T0JA 1ZTYA 4F1VA 3MJNA 1MM6A 2LAOA 1OQHA 1B1XA 2D3IA 3OMBA 4EF2A 3KZGA 2I6EA 3CR9A 5TU0A 3LSXA 4P0GA 2DE2A 1IMDA 2CMOA 3ZKLA 3D4CA 1NV6A 1ZIUA 2QPQA 4QRZA 3ECRA 3KJ7A 4GX6A 1P1UA 2HXRA 3MC2A 4QSDA 4QFOA 4ELRA 3UP9A 1D9QA 2G29A 4DI3D 5I56A 1N84A 5HPQA 1PB9A 4G61A 3E79A 4DIGA 1OIBA 3C4MA 5HM4B 1B3LA 4NMYA 1CB6A 1MXWA 5DVIA 4MMPA 4GWZA 3B7DA 4YKKA 4OZ9A 4PDHA 3VLUA 4ELPA 2O68A 4PBHA 1XHYA 4DXUA 3GYYA 5J16A 4U1OA 1USYH 4X04A 3VE1B 4NF4A 3TEPA 1NFTA 2MKZA 3OELA 4LP2B 3TPAA 1O7TA 1RYOA 3N5LA 1B0LA 3G3HA 1JQFA 1B1HA 4JDFA 4F3PA 1MS7A 4OENA 4M4GA 1WDNA 2GFEA 5LDZA 4QFPA 3PMWA 2O1MA 4JSDA 4N81A 3KFMA 2DWIA 4YB5A 4KYSA 4GX3A 2UYEA 3RNNA 4YKIA 3K6WA 1VE4A 4KHZE 1R9LA 5AE4A 3KN8A
chains in the Genus database with same CATH topology
1JVYA 4LZ8A 4H1XA 3GZGA 5ICTA 4R9FA 2XD2A 1NNPA 3S2VA 4ZZAA 1XC1A 4RK2A 4N6PA 4RYAA 3PUWE 4F3BA 1GV8A 4IO4A 4LZ5A 1QULA 3D4GA 2Q2AA 2F7AA 2VHAA 4U2RA 4HTGA 4QFNA 1MXXA 4MBPA 1I6AA 1WODA 2DXRA 3K1MA 3TQLA 1R1NA 1DTZA 1UIVA 4HW8A 5AA4B 4GXAA 1GVCA 3AXFA 1POTA 1SW5A 2O51A 3IX1A 1JW1A 4U23A 2QMWA 4OMBA 1DTGA 3RPWA 1VFDA 3KBRA 4EF1A 1EZOA 4KYEA 1UIUA 3FVKA 2REJA 4GVOA 4NWCA 3SEUA 3Q26A 1CE2A 2Z23A 3OEMA 3PPRA 3RUMA 3H6VA 1AH5A 1IXGA 1P1OA 1BTJA 3TTLA 4P0IA 4GWOA 2F35A 3V89B 3U1OA 1EZ9A 4TQUQ 3G3KA 1OLCA 5ITOA 4EXKA 3K01A 5CC2A 2RCBA 2HXWA 4DCXA 4JWOA 1FTOA 2FA7A 5K2XA 4UA8A 3ZSFA 3C36A 4MFIA 5I2KB 3MZ9A 1JEUA 3O6HA 4ZEFA 1Y3QA 1AIVA 5KDTB 3FJ7A 4ZS9A 1USYE 4BDNA 4OVJA 2BJJX 1MY1A 1US4A 1B7ZA 4F29A 4THIA 4WXJA 2X7PA 2THIA 2YJPA 3TCFA 2I48A 3FIRA 3C9HA 4LUBA 3Q29A 4QHQA 1MPBA 5HBCA 1ATGA 3MP8A 4RPNA 2V93A 1LGBC 4OXVA 4RNSA 4C1UA 4F22A 1B40A 2CZLA 1FQAA 3MZBA 1EU8A 1IEJA 4X1DA 3FVNA 1SDXA 1YPNA 3TDJA 3S9MC 3SEYA 1D4NA 4R6YA 3SEWA 2RCAA 3S9NC 5DVJA 1A8FA 1J1NA 4H8IA 1MY0A 3MPLA 4OTEA 3QAXA 2V3QA 1NL5A 4JSOA 5CMBA 3FD3A 1PB7A 5JTYB 3VVDA 5KCJB 4NTLA 1MXZA 1MXVA 3V5AA 4YB7A 2OWTA 5CMMA 4YMBA 5LOMA 3OOAA 5AA2D 3FXUA 1BIYA 3THIA 1DOTA 1JVXA 4IO5A 3R6UA 4QFLA 4F3GA 3E4RA 3PUVE 4X1BA 1MQHA 2P2AA 1QJMA 4ECFA 1KWHA 3WAFA 3L6GA 3MPKA 2YPNA 2I4CA 2R71A 1BKAA 1LAXA 3UIFA 3F11A 5AA4A 5DEXB 4PE5B 2HFBA 4Z0IA 3W9VA 1MY3A 1A54A 5FHNA 4I62A 1BLFA 1NH7A 4Z7EA 1B58A 2ZNTA 4KCCA 1XT8A 4TLLB 4KPTA 2DWJA 2ZNUA 1A99A 2H4IA 4P11A 1HSLA 3TCHA 4WEDA 4JXIA 1MY4A 5F7VA 1Y4CA 4GIZA 1N04A 4NF6B 1IITA 3QYTA 1B7UA 3DM0A 3OO9A 4EQBA 2M8CA 4BDMA 3JV9A 1LFGA 2O6AA 5L9SA 1LFHA 3MWBA 5I2KA 5TP9B 1QUKA 5H8HB 2Q9TA 4TOZA 4JBZA 5KDTA 4EXLA 3O66A 2Y7RA 3LSWA 2Z22A 4LATA 4BDRA 2R9JA 2XXYA 5FHMA 3IB0A 4QFKA 2O7IA 4GFRA 5I58B 3SESA 5BUUA 2X7QA 2F78A 2HZKA 2VD2A 2DVCA 3EHUA 2RC9A 2DYXA 1ZMGA 4C0RA 2F5XA 3TMGA 1FQEA 3N26A 5A5XB 4LA9A 1FQFA 2P1SA 2NUVA 3DP4A 3U8QA 5L9MA 3DLNA 4IO2A 2E1SA 5KCJA 4ESXA 2DQVA 1UTHB 3EHSA 3TZAA 3O28A 3IOWA 2OWSA 5DVFA 3H6TA 2NXOA 2NVUB 5KZTA 1BP5A 3OD7A 3H7MA 1F9BA 1JW5A 3HO7A 3C32A 4OFOA 1RYXA 1AMFA 3LC8A 3I6VA 5H8FB 3FZVA 1SYIA 1MQIA 1Y4TA 5H8QB 3EN3A 1QKBA 2DP8A 4G8NA 3EPEA 2B3FA 1QUIA 5DEXA 1H43A 3M3LA 3CFXA 3FJGA 5FHOA 3I3VA 4R75A 4U4SA 2UVJA 1M5BA 5DYHA 2OLBA 2RKMA 4F2OA 5ISUA 2Q89A 4G8HA 3CG1A 4G8MA 3IOVA 2Z8DA 4KYDA 4EUOA 4O3AA 4BLAA 4RA1A 3SKPA 1NH8A 4IO3A 1SBPA 2H98A 2XXRA 3HHFA 1PC3A 1MPDA 5JEIA 5ICQA 2F6GA 4ND9A 3OENA 4ZEDA 1T0KA 4ELQA 4ZEBA 3MW0A 4XKPA 4PP0A 3UA8A 4NF6A 4FECA 3QIMA 1M5CA 3RT6B 3FV1A 3IAZA 3VFJA 4NWDA 4U1ZA 5TP9A 1OQGA 1PBQA 2XX9A 1B5HA 2I3VA 5H8HA 4F31B 4R74A 2XXUA 3C33A 2Q8JA 2PT2A 4R9GA 4RJZA 1LAFE 4FEBA 3HCQA 2UYFA 4JWYA 4OESA 4NF8B 2HCAA 3ONMA 3FUZA 4RY1A 3B6QA 3TELA 4MH5A 5I58A 1N3XA 4R6HA 4YU0A 2Q88A 3P7IA 3GXAA 2A5TA 5L9OA 2ZYOA 3TTMA 1LFIA 5A5XA 4HS7A 4F3SA 1PEBA 3I5OA 1B46A 3EHTA 1B05A 2A5SA 1TFDA 3PPOA 1LCTA 2AL5A 1OMPA 4GRKA 4G68B 4IGRA 4F1YA 4R2BA 3BBRA 2I0BA 4KCDA 3LUYA 3H3GA 1LBCA 4YKPA 1B3EA 1TFAA 3FJMA 2I58A 4EDPA 1UTHA 2KLFA 3KGCA 3IO6A 1B5IA 4FATA 3TUSA 1B4HA 4RPOA 3CI8A 5H8NB 1LAHE 1Y3NA 3HPIA 4GL0A 2D5WA 4M1VA 4GOTA 1GR2A 3RT8A 2ONKE 4POXA 5IKBA 5H8FA 5J1DA 2NOOA 1EH3A 2P0SA 4GD5A 3G3GA 4X9TA 3MAMA 5H8QA 1FTLA 4MLQA 4XTCQ 3FVGA 3RN8A 3U94A 5EHSA 4DZ1A 3T9XB 1B3HA 2F8DA 1SI1A 3TYHA 3IK6B 2FNCA 3B6WA 2UXAA 1SQYA 5DTBA 1IXIA 3OSQA 2ONRA 3IORA 3PPNA 2GH9A 4FAJA 3MP1A 3O6GA 4XKRA 4WKMA 1SW2A 5CBRA 3TAJA 4IGTA 4E0WA 4E0XA 1DPPA 3G3IA 4OQOA 2XXIA 1O64A 4Q0CA 4POWA 4G2ZA 3TTKA 5BWJA 3T9UA 5IAIA 2FYIA 1YAEA 3N94A 2HAVA 3E3KA 3HV1A 3MP6A 2QSXA 3GBBA 4IY5A 3FASA 3JYRA 3CFLA 1FQCA 1Y3PA 2REGA 1B2HA 3G3JA 3VV5A 2F97A 4ZECA 3IOUA 4JB7A 1I6BA 4GQOA 1ZU0A 3IR1A 3VDFA 4NF8A 3MVZA 4O3CA 1URSA 2Q2CA 4H8JA 5B70A 4GL8A 3MVXA 3MVWA 1N7WA 4ZE9A 2ALUA 4F39A 3OSRA 4JWXA 5L8DA 2H25A 1DMBA 1RKMA 4LQ5A 1LB8A 2W7YA 3Q27A 1ZJLA 2WKYA 1NNFA 5FTHA 3VLVA 3K6UA 2H99A 1SW1A 3OEKA 1II5A 4KFQA 4L17A 4KI0E 1B7HA 4OFLA 1FW0A 5AA3A 2VD3A 4FJPA 4LZ7A 4BDQA 3K2DA 4G68A 3G3FA 4RK9A 1JNFA 1QUJA 4OFJA 3A3UA 2F36A 1JETA 3QXMA 1B3FA 4DXBA 1P1WA 3N6UA 4DE8A 4R73A 1XS5A 1IIWA 2UVGA 3CG3A 1MDQA 3RLFE 4H0WA 2F34A 1N3WA 5H8NA 4DCYA 4R2FA 3JZJA 4DDDA 2QS1A 3FGSA 4PFTA 3C34A 1M5EA 1DSNA 2PMSA 1POY1 5CBSA 3Q28A 3TTNA 3U92A 1NNTA 2V3UA 1FTJA 2RINA 4OETA 4NF5B 2V84A 5CM6A 1QW0A 2V3TA 5AA1A 1B3GA 2I49A 2QS3A 1ANFA 1MH4A 4KR5A 3K6XA 4QSCA 3E9XA 3T66A 5CMCA 2ESNA 4PFUA 4YZZA 1LCFA 5M2VA 4IO7A 1P1QA 1Y9UA 4AB6A 4HCYA 2ZMBA 1PDAA 5F1QA 4PETA 2XXXA 3FXRA 3MQ9A 2I3WA 3KOTA 1SVXB 4IO6A 3U72A 3K4UA 5JTYA 2DWHA 4RXLA 3RTWB 4ZEIA 3DELB 2IEEA 5JK4A 4ISUA 4AB5A 3VLWA 2XXTA 3GLBA 2O84X 2QL3A 3PMVA 2RC8A 4K3FA 3IL1B 1UQWA 1OVBA 5I57B 2OZZA 3SERA 2PYYA 1H44A 3SEVA 1P99A 3K00A 2DWAA 5I2NB 4FIMA 3PUXE 3SEXA 1MY2A 3BFTA 1OLAA 1FTKA 1FQDA 4X48A 3VXBA 3TODA 4MLVA 2B3BA 3GBAA 1UTBB 4YAHX 1FQBA 3PD9A 4LQ2A 1A55A 3KOSA 4G4PA 3TKDA 2ZYNA 4OWDA 2ZYKA 1MRPA 3QK6A 2IA4A 1VFEA 4YICA 4G68C 2VGQA 3V83A 4G77A 1N7XA 3H4ZA 1PB8A 3T9HB 5I59B 2X26A 2QMXA 1N0TA 3B6TA 1B6HA 2Y7IA 3H6UA 1Q1KA 2Z8EA 5I84A 1YCJA 3OO6A 4KQPA 3S9LC 2ANJA 1ZBMA 1EZPA 4I8CA 2O1LA 3MBPA 1MM7A 1TWYA 3PV0E 2F7CA 1FTMA 2ONSA 4H6DA 3O9PA 3ODBA 3OXNA 2UVIA 3A09A 3K02A 2H9BA 2I4BA 2QRYA 3R26A 1FCKA 1MH3A 1HSEA 3QSLA 3FATA 4NF5A 2XD3A 5EHMA 3VVFA 2QS2A 4F1UA 2O7UA 5K2YA 1XVXA 2XX7A 1PBPA 4F2QA 3K6VA 5H8SA 3ILTB 3PGFA 3CFZA 1SYHA 4I9DA 2I0CA 3RQTA 1H76A 1XVYA 1JW4A 2XX8A 4Q30B 2VP1A 3LR1A 2PVUA 4XIGQ 1NNKA 4PFYA 4BDLA 2GHBA 4XXUA 2DE4A 3OO7A 3QUFA 3E13X 2DSFA 3ZS6A 1IUDA 3FXQA 4O3BA 3W15C 1ZLQA 5EYFA 3MZ1A 1WVJA 1JEVA 2OK2A 4PQJA 1LSTA 2HEUA 1L5TA 3USDA 3HN0A 4OHNA 3W9WA 4ESWA 2Y7KA 2HQ0A 4IB2A 3M3FA 2RF1A 4DXCA 1IZ1A 4KD5A 1D3KA 1SI0A 4ZZEA 2QS4A 2XXPA 4ELOA 3PMXA 3KG2A 3TCGA 2AIXA 1IXHA 4ZEKA 4PFWA 5CI5A 3U93A 3PUYE 5TPAB 1TT1A 3G7WA 2HZLA 2RC7A 5I57A 4XKQA 4H5GA 3RY3A 4U22A 4LONB 4ZDMA 3KSXA 3IB2A 2DOJA 2OBGA 2O69A 2QJEA 3ZKKA 2ZNSA 4EQ7A 2GRVA 2Z8FA 5I2NA 1SW4A 3O29A 1A7LA 1D9YA 4H5FA 4F18A 4QF9A 2D21A 2G93A 4GF8A 4HCWA 2DVZA 3T22A 1MXUA 4WEPA 3CSBA 1UTBA 3FV2A 3T9VA 4DLDA 3DP6A 2R6GE 1LBBA 1MDP1 3SDFA 4NE4A 1H45A 3KSJA 2DS9A 5CMKA 4NEDA 1H3DA 2AYSA 3IJXB 1DPEA 3ILUB 3O2AA 1Z7NE 4R6KA 1HSJA 3H06B 2OCUA 3VXCA 2PBWA 1N76A 5I59A 4OERA 4TLMB 1XOCA 3M3KA 3KN7A 4FEDA 1AL3A 3IJOB 4N13A 1S7YA 4YKJA 5AA2B 1Y1MA 2Y7PA 1B4ZA 4YB6A 3MVYA 3Q25A 1B0HA 1ZKBA 1O63A 1I69A 5CRYA 2XXVA 3T93B 2XHDA 2GHAA 1SD3A 1MQJA 3UGWA 1R9QA 1Y1ZA 1M5DA 4LVQA 3TFLA 1TXFA 2XXQA 2ZYMA 3PPPA 3HSTA 4QSEA 4YMAA 3KEIA 5I56B 4BDOA 3HHGA 4F19A 3WAEA 4U21A 1VR5A 3LSFB 4OEUA 4XKNA 2XXWA 1D9VA 1B9JA 3CIJA 4H65A 4ONYA 3PUZE 1URDA 4NF4B 1P1NA 1VSOA 3O97A 3H6WA 3K0VA 3TQWA 1MPCA 2DE3A 2B65A 2PT1A 4GLIA 4IY6A 4AQ4A 1AOVA 1LLSA 2DXYA 3OO8A 3EQ1A 2Y84A 1M5FA 3S4UA 4Q8RA 3CVGA 1MXYA 4ZE8A 1A40A 1IQ7A 1B32A 1MQGA 3VVEA 2F7BA 1LB9A 4EQ9A 3K1PA 1QVSA 1S9TA 1US5A 1NMUA 3RTFB 3R7XA 2VOZA 5ITPA 3CRBA 5FTIA 5TPAA 4C1TA 3UK4A 1Y20A 3CSGA 3DP8A 2V25A 4U4XA 3T96B 3IB1A 2YLNA 3V8XB 3KN3A 1GGGA 4I1DA 3UN6A 3IOTA 3S9EA 3BKIB 3K1NA 4R72A 2ZXTA 3MUQA 5ELVA 3M8UA 2NWJA 2OJTA 1Z7ME 4Q5TA 4H67A 2PX1A 3QUJA 3FVOA 4OYVA 1QKAA 2XXHA 1OVTA 4OEVA 3TTRA 1A8EA 2Y7WA 4GXSB 1ELJA 4MF3A 1MG1A 1YTVA 3PU5A 3LSLA 3PPQA 1LAGE 4FORA 3UORA 3EF7A 1NKXA 2A5TB 2UVHA 1Q35A 3SETA 1GTKA 4N07A 1URGA 1B52A 1B5JA 3O6IA 5DT6A 3H03A 3PD8A 4FE8A 3IO4A 1MQDA 2H5YA 3N6TA 3C35A 1I6QA 2HAUA 3KJTA 3L6HA 5B7DA 2AL4A 1S50A 3RGYA 2ABHA 2F6PA 3LBSA 5AA2A 3A3CA 3C31A 4UACA 2E0SA 1B51A 1R6ZA 1IXCA 3BFUA 1ZTYA 4F1VA 3MJNA 1MM6A 2LAOA 1OQHA 1B1XA 2D3IA 3OMBA 4EF2A 3KZGA 2I6EA 3CR9A 5TU0A 3LSXA 4P0GA 2DE2A 2CMOA 3ZKLA 3D4CA 1ZIUA 2QPQA 4QRZA 3ECRA 3KJ7A 1P1UA 3MC2A 4QSDA 4QFOA 4ELRA 3UP9A 2G29A 5I56A 1N84A 5HPQA 1PB9A 4DIGA 1OIBA 3C4MA 5HM4B 1B3LA 4NMYA 1CB6A 1MXWA 5DVIA 3B7DA 4YKKA 4OZ9A 3VLUA 4ELPA 2O68A 1XHYA 4DXUA 4U1OA 1USYH 3VE1B 4NF4A 3TEPA 1NFTA 3OELA 4LP2B 3TPAA 1O7TA 1RYOA 3N5LA 1B0LA 3G3HA 1JQFA 1B1HA 4JDFA 4F3PA 1MS7A 4OENA 4M4GA 1WDNA 2GFEA 4QFPA 3PMWA 2O1MA 4JSDA 3KFMA 2DWIA 4YB5A 4KYSA 2UYEA 3RNNA 4YKIA 3K6WA 1VE4A 4KHZE 1R9LA 5AE4A 3KN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVY A;  4LZ8 A;  4H1X A;  3GZG A;  5ICT A;  4R9F A;  2XD2 A;  1NNP A;  3S2V A;  4ZZA A;  1XC1 A;  4RK2 A;  4N6P A;  4RYA A;  3PUW E;  4F3B A;  1GV8 A;  4IO4 A;  4LZ5 A;  1QUL A;  3D4G A;  2Q2A A;  2F7A A;  2VHA A;  4U2R A;  4HTG A;  4QFN A;  1MXX A;  4MBP A;  1I6A A;  1WOD A;  2DXR A;  3K1M A;  3TQL A;  1R1N A;  1DTZ A;  1UIV A;  4HW8 A;  5AA4 B;  4GXA A;  1GVC A;  3AXF A;  1POT A;  1SW5 A;  2O51 A;  3IX1 A;  1JW1 A;  4U23 A;  2QMW A;  4OMB A;  1DTG A;  3RPW A;  1VFD A;  3KBR A;  4EF1 A;  1EZO A;  4KYE A;  1UIU A;  3FVK A;  2REJ A;  4GVO A;  4NWC A;  3SEU A;  3Q26 A;  1CE2 A;  2Z23 A;  3OEM A;  3PPR A;  3RUM A;  3H6V A;  1AH5 A;  1IXG A;  1P1O A;  1BTJ A;  3TTL A;  4P0I A;  4GWO A;  2F35 A;  3V89 B;  3U1O A;  1EZ9 A;  4TQU Q;  3G3K A;  1OLC A;  5ITO A;  4EXK A;  3K01 A;  5CC2 A;  2RCB A;  2HXW A;  4DCX A;  4JWO A;  1FTO A;  2FA7 A;  5K2X A;  4UA8 A;  3ZSF A;  3C36 A;  4MFI A;  5I2K B;  3MZ9 A;  1JEU A;  3O6H A;  4ZEF A;  1Y3Q A;  1AIV A;  5KDT B;  3FJ7 A;  4ZS9 A;  1USY E;  4BDN A;  4OVJ A;  2BJJ X;  1MY1 A;  1US4 A;  1B7Z A;  4F29 A;  4THI A;  4WXJ A;  2X7P A;  2THI A;  2YJP A;  3TCF A;  2I48 A;  3FIR A;  3C9H A;  4LUB A;  3Q29 A;  4QHQ A;  1MPB A;  5HBC A;  1ATG A;  3MP8 A;  4RPN A;  2V93 A;  1LGB C;  4OXV A;  4RNS A;  4C1U A;  4F22 A;  1B40 A;  2CZL A;  1FQA A;  3MZB A;  1EU8 A;  1IEJ A;  4X1D A;  3FVN A;  1SDX A;  1YPN A;  3TDJ A;  3S9M C;  3SEY A;  1D4N A;  4R6Y A;  3SEW A;  2RCA A;  3S9N C;  5DVJ A;  1A8F A;  1J1N A;  4H8I A;  1MY0 A;  3MPL A;  4OTE A;  3QAX A;  2V3Q A;  1NL5 A;  4JSO A;  5CMB A;  3FD3 A;  1PB7 A;  5JTY B;  3VVD A;  5KCJ B;  4NTL A;  1MXZ A;  1MXV A;  3V5A A;  4YB7 A;  2OWT A;  5CMM A;  4YMB A;  5LOM A;  3OOA A;  5AA2 D;  3FXU A;  1BIY A;  3THI A;  1DOT A;  1JVX A;  4IO5 A;  3R6U A;  4QFL A;  4F3G A;  3E4R A;  3PUV E;  4X1B A;  1MQH A;  2P2A A;  1QJM A;  4ECF A;  1KWH A;  3WAF A;  3L6G A;  3MPK A;  2YPN A;  2I4C A;  2R71 A;  1BKA A;  1LAX A;  3UIF A;  3F11 A;  5AA4 A;  5DEX B;  4PE5 B;  2HFB A;  4Z0I A;  3W9V A;  1MY3 A;  1A54 A;  5FHN A;  4I62 A;  1BLF A;  1NH7 A;  4Z7E A;  1B58 A;  2ZNT A;  4KCC A;  1XT8 A;  4TLL B;  4KPT A;  2DWJ A;  2ZNU A;  1A99 A;  2H4I A;  4P11 A;  1HSL A;  3TCH A;  4WED A;  4JXI A;  1MY4 A;  5F7V A;  1Y4C A;  4GIZ A;  1N04 A;  4NF6 B;  1IIT A;  3QYT A;  1B7U A;  3DM0 A;  3OO9 A;  4EQB A;  2M8C A;  4BDM A;  3JV9 A;  1LFG A;  2O6A A;  5L9S A;  1LFH A;  3MWB A;  5I2K A;  5TP9 B;  1QUK A;  5H8H B;  2Q9T A;  4TOZ A;  4JBZ A;  5KDT A;  4EXL A;  3O66 A;  2Y7R A;  3LSW A;  2Z22 A;  4LAT A;  4BDR A;  2R9J A;  2XXY A;  5FHM A;  3IB0 A;  4QFK A;  2O7I A;  4GFR A;  5I58 B;  3SES A;  5BUU A;  2X7Q A;  2F78 A;  2HZK A;  2VD2 A;  2DVC A;  3EHU A;  2RC9 A;  2DYX A;  1ZMG A;  4C0R A;  2F5X A;  3TMG A;  1FQE A;  3N26 A;  5A5X B;  4LA9 A;  1FQF A;  2P1S A;  2NUV A;  3DP4 A;  3U8Q A;  5L9M A;  3DLN A;  4IO2 A;  2E1S A;  5KCJ A;  4ESX A;  2DQV A;  1UTH B;  3EHS A;  3TZA A;  3O28 A;  3IOW A;  2OWS A;  5DVF A;  3H6T A;  2NXO A;  2NVU B;  5KZT A;  1BP5 A;  3OD7 A;  3H7M A;  1F9B A;  1JW5 A;  3HO7 A;  3C32 A;  4OFO A;  1RYX A;  1AMF A;  3LC8 A;  3I6V A;  5H8F B;  3FZV A;  1SYI A;  1MQI A;  1Y4T A;  5H8Q B;  3EN3 A;  1QKB A;  2DP8 A;  4G8N A;  3EPE A;  2B3F A;  1QUI A;  5DEX A;  1H43 A;  3M3L A;  3CFX A;  3FJG A;  5FHO A;  3I3V A;  4R75 A;  4U4S A;  2UVJ A;  1M5B A;  5DYH A;  2OLB A;  2RKM A;  4F2O A;  5ISU A;  2Q89 A;  4G8H A;  3CG1 A;  4G8M A;  3IOV A;  2Z8D A;  4KYD A;  4EUO A;  4O3A A;  4BLA A;  4RA1 A;  3SKP A;  1NH8 A;  4IO3 A;  1SBP A;  2H98 A;  2XXR A;  3HHF A;  1PC3 A;  1MPD A;  5JEI A;  5ICQ A;  2F6G A;  4ND9 A;  3OEN A;  4ZED A;  1T0K A;  4ELQ A;  4ZEB A;  3MW0 A;  4XKP A;  4PP0 A;  3UA8 A;  4NF6 A;  4FEC A;  3QIM A;  1M5C A;  3RT6 B;  3FV1 A;  3IAZ A;  3VFJ A;  4NWD A;  4U1Z A;  5TP9 A;  1OQG A;  1PBQ A;  2XX9 A;  1B5H A;  2I3V A;  5H8H A;  4F31 B;  4R74 A;  2XXU A;  3C33 A;  2Q8J A;  2PT2 A;  4R9G A;  4RJZ A;  1LAF E;  4FEB A;  3HCQ A;  2UYF A;  4JWY A;  4OES A;  4NF8 B;  2HCA A;  3ONM A;  3FUZ A;  4RY1 A;  3B6Q A;  3TEL A;  4MH5 A;  5I58 A;  1N3X A;  4R6H A;  4YU0 A;  2Q88 A;  3P7I A;  3GXA A;  2A5T A;  5L9O A;  2ZYO A;  3TTM A;  1LFI A;  5A5X A;  4HS7 A;  4F3S A;  1PEB A;  3I5O A;  1B46 A;  3EHT A;  1B05 A;  2A5S A;  1TFD A;  3PPO A;  1LCT A;  2AL5 A;  1OMP A;  4GRK A;  4G68 B;  4IGR A;  4F1Y A;  4R2B A;  3BBR A;  2I0B A;  4KCD A;  3LUY A;  3H3G A;  1LBC A;  4YKP A;  1B3E A;  1TFA A;  3FJM A;  2I58 A;  4EDP A;  1UTH A;  2KLF A;  3KGC A;  3IO6 A;  1B5I A;  4FAT A;  3TUS A;  1B4H A;  4RPO A;  3CI8 A;  5H8N B;  1LAH E;  1Y3N A;  3HPI A;  4GL0 A;  2D5W A;  4M1V A;  4GOT A;  1GR2 A;  3RT8 A;  2ONK E;  4POX A;  5IKB A;  5H8F A;  5J1D A;  2NOO A;  1EH3 A;  2P0S A;  4GD5 A;  3G3G A;  4X9T A;  3MAM A;  5H8Q A;  1FTL A;  4MLQ A;  4XTC Q;  3FVG A;  3RN8 A;  3U94 A;  5EHS A;  4DZ1 A;  3T9X B;  1B3H A;  2F8D A;  1SI1 A;  3TYH A;  3IK6 B;  2FNC A;  3B6W A;  2UXA A;  1SQY A;  5DTB A;  1IXI A;  3OSQ A;  2ONR A;  3IOR A;  3PPN A;  2GH9 A;  4FAJ A;  3MP1 A;  3O6G A;  4XKR A;  4WKM A;  1SW2 A;  5CBR A;  3TAJ A;  4IGT A;  4E0W A;  4E0X A;  1DPP A;  3G3I A;  4OQO A;  2XXI A;  1O64 A;  4Q0C A;  4POW A;  4G2Z A;  3TTK A;  5BWJ A;  3T9U A;  5IAI A;  2FYI A;  1YAE A;  3N94 A;  2HAV A;  3E3K A;  3HV1 A;  3MP6 A;  2QSX A;  3GBB A;  4IY5 A;  3FAS A;  3JYR A;  3CFL A;  1FQC A;  1Y3P A;  2REG A;  1B2H A;  3G3J A;  3VV5 A;  2F97 A;  4ZEC A;  3IOU A;  4JB7 A;  1I6B A;  4GQO A;  1ZU0 A;  3IR1 A;  3VDF A;  4NF8 A;  3MVZ A;  4O3C A;  1URS A;  2Q2C A;  4H8J A;  5B70 A;  4GL8 A;  3MVX A;  3MVW A;  1N7W A;  4ZE9 A;  2ALU A;  4F39 A;  3OSR A;  4JWX A;  5L8D A;  2H25 A;  1DMB A;  1RKM A;  4LQ5 A;  1LB8 A;  2W7Y A;  3Q27 A;  1ZJL A;  2WKY A;  1NNF A;  5FTH A;  3VLV A;  3K6U A;  2H99 A;  1SW1 A;  3OEK A;  1II5 A;  4KFQ A;  4L17 A;  4KI0 E;  1B7H A;  4OFL A;  1FW0 A;  5AA3 A;  2VD3 A;  4FJP A;  4LZ7 A;  4BDQ A;  3K2D A;  4G68 A;  3G3F A;  4RK9 A;  1JNF A;  1QUJ A;  4OFJ A;  3A3U A;  2F36 A;  1JET A;  3QXM A;  1B3F A;  4DXB A;  1P1W A;  3N6U A;  4DE8 A;  4R73 A;  1XS5 A;  1IIW A;  2UVG A;  3CG3 A;  1MDQ A;  3RLF E;  4H0W A;  2F34 A;  1N3W A;  5H8N A;  4DCY A;  4R2F A;  3JZJ A;  4DDD A;  2QS1 A;  3FGS A;  4PFT A;  3C34 A;  1M5E A;  1DSN A;  2PMS A;  1POY 1;  5CBS A;  3Q28 A;  3TTN A;  3U92 A;  1NNT A;  2V3U A;  1FTJ A;  2RIN A;  4OET A;  4NF5 B;  2V84 A;  5CM6 A;  1QW0 A;  2V3T A;  5AA1 A;  1B3G A;  2I49 A;  2QS3 A;  1ANF A;  1MH4 A;  4KR5 A;  3K6X A;  4QSC A;  3E9X A;  3T66 A;  5CMC A;  2ESN A;  4PFU A;  4YZZ A;  1LCF A;  5M2V A;  4IO7 A;  1P1Q A;  1Y9U A;  4AB6 A;  4HCY A;  2ZMB A;  1PDA A;  5F1Q A;  4PET A;  2XXX A;  3FXR A;  3MQ9 A;  2I3W A;  3KOT A;  1SVX B;  4IO6 A;  3U72 A;  3K4U A;  5JTY A;  2DWH A;  4RXL A;  3RTW B;  4ZEI A;  3DEL B;  2IEE A;  5JK4 A;  4ISU A;  4AB5 A;  3VLW A;  2XXT A;  3GLB A;  2O84 X;  2QL3 A;  3PMV A;  2RC8 A;  4K3F A;  3IL1 B;  1UQW A;  1OVB A;  5I57 B;  2OZZ A;  3SER A;  2PYY A;  1H44 A;  3SEV A;  1P99 A;  3K00 A;  2DWA A;  5I2N B;  4FIM A;  3PUX E;  3SEX A;  1MY2 A;  3BFT A;  1OLA A;  1FTK A;  1FQD A;  4X48 A;  3VXB A;  3TOD A;  4MLV A;  2B3B A;  3GBA A;  1UTB B;  4YAH X;  1FQB A;  3PD9 A;  4LQ2 A;  1A55 A;  3KOS A;  4G4P A;  3TKD A;  2ZYN A;  4OWD A;  2ZYK A;  1MRP A;  3QK6 A;  2IA4 A;  1VFE A;  4YIC A;  4G68 C;  2VGQ A;  3V83 A;  4G77 A;  1N7X A;  3H4Z A;  1PB8 A;  3T9H B;  5I59 B;  2X26 A;  2QMX A;  1N0T A;  3B6T A;  1B6H A;  2Y7I A;  3H6U A;  1Q1K A;  2Z8E A;  5I84 A;  1YCJ A;  3OO6 A;  4KQP A;  3S9L C;  2ANJ A;  1ZBM A;  1EZP A;  4I8C A;  2O1L A;  3MBP A;  1MM7 A;  1TWY A;  3PV0 E;  2F7C A;  1FTM A;  2ONS A;  4H6D A;  3O9P A;  3ODB A;  3OXN A;  2UVI A;  3A09 A;  3K02 A;  2H9B A;  2I4B A;  2QRY A;  3R26 A;  1FCK A;  1MH3 A;  1HSE A;  3QSL A;  3FAT A;  4NF5 A;  2XD3 A;  5EHM A;  3VVF A;  2QS2 A;  4F1U A;  2O7U A;  5K2Y A;  1XVX A;  2XX7 A;  1PBP A;  4F2Q A;  3K6V A;  5H8S A;  3ILT B;  3PGF A;  3CFZ A;  1SYH A;  4I9D A;  2I0C A;  3RQT A;  1H76 A;  1XVY A;  1JW4 A;  2XX8 A;  4Q30 B;  2VP1 A;  3LR1 A;  2PVU A;  4XIG Q;  1NNK A;  4PFY A;  4BDL A;  2GHB A;  4XXU A;  2DE4 A;  3OO7 A;  3QUF A;  3E13 X;  2DSF A;  3ZS6 A;  1IUD A;  3FXQ A;  4O3B A;  3W15 C;  1ZLQ A;  5EYF A;  3MZ1 A;  1WVJ A;  1JEV A;  2OK2 A;  4PQJ A;  1LST A;  2HEU A;  1L5T A;  3USD A;  3HN0 A;  4OHN A;  3W9W A;  4ESW A;  2Y7K A;  2HQ0 A;  4IB2 A;  3M3F A;  2RF1 A;  4DXC A;  1IZ1 A;  4KD5 A;  1D3K A;  1SI0 A;  4ZZE A;  2QS4 A;  2XXP A;  4ELO A;  3PMX A;  3KG2 A;  3TCG A;  2AIX A;  1IXH A;  4ZEK A;  4PFW A;  5CI5 A;  3U93 A;  3PUY E;  5TPA B;  1TT1 A;  3G7W A;  2HZL A;  2RC7 A;  5I57 A;  4XKQ A;  4H5G A;  3RY3 A;  4U22 A;  4LON B;  4ZDM A;  3KSX A;  3IB2 A;  2DOJ A;  2OBG A;  2O69 A;  2QJE A;  3ZKK A;  2ZNS A;  4EQ7 A;  2GRV A;  2Z8F A;  5I2N A;  1SW4 A;  3O29 A;  1A7L A;  1D9Y A;  4H5F A;  4F18 A;  4QF9 A;  2D21 A;  2G93 A;  4GF8 A;  4HCW A;  2DVZ A;  3T22 A;  1MXU A;  4WEP A;  3CSB A;  1UTB A;  3FV2 A;  3T9V A;  4DLD A;  3DP6 A;  2R6G E;  1LBB A;  1MDP 1;  3SDF A;  4NE4 A;  1H45 A;  3KSJ A;  2DS9 A;  5CMK A;  4NED A;  1H3D A;  2AYS A;  3IJX B;  1DPE A;  3ILU B;  3O2A A;  1Z7N E;  4R6K A;  1HSJ A;  3H06 B;  2OCU A;  3VXC A;  2PBW A;  1N76 A;  5I59 A;  4OER A;  4TLM B;  1XOC A;  3M3K A;  3KN7 A;  4FED A;  1AL3 A;  3IJO B;  4N13 A;  1S7Y A;  4YKJ A;  5AA2 B;  1Y1M A;  2Y7P A;  1B4Z A;  4YB6 A;  3MVY A;  3Q25 A;  1B0H A;  1ZKB A;  1O63 A;  1I69 A;  5CRY A;  2XXV A;  3T93 B;  2XHD A;  2GHA A;  1SD3 A;  1MQJ A;  3UGW A;  1R9Q A;  1Y1Z A;  1M5D A;  4LVQ A;  3TFL A;  1TXF A;  2XXQ A;  2ZYM A;  3PPP A;  3HST A;  4QSE A;  4YMA A;  3KEI A;  5I56 B;  4BDO A;  3HHG A;  4F19 A;  3WAE A;  4U21 A;  1VR5 A;  3LSF B;  4OEU A;  4XKN A;  2XXW A;  1D9V A;  1B9J A;  3CIJ A;  4H65 A;  4ONY A;  3PUZ E;  1URD A;  4NF4 B;  1P1N A;  1VSO A;  3O97 A;  3H6W A;  3K0V A;  3TQW A;  1MPC A;  2DE3 A;  2B65 A;  2PT1 A;  4GLI A;  4IY6 A;  4AQ4 A;  1AOV A;  1LLS A;  2DXY A;  3OO8 A;  3EQ1 A;  2Y84 A;  1M5F A;  3S4U A;  4Q8R A;  3CVG A;  1MXY A;  4ZE8 A;  1A40 A;  1IQ7 A;  1B32 A;  1MQG A;  3VVE A;  2F7B A;  1LB9 A;  4EQ9 A;  3K1P A;  1QVS A;  1S9T A;  1US5 A;  1NMU A;  3RTF B;  3R7X A;  2VOZ A;  5ITP A;  3CRB A;  5FTI A;  5TPA A;  4C1T A;  3UK4 A;  1Y20 A;  3CSG A;  3DP8 A;  2V25 A;  4U4X A;  3T96 B;  3IB1 A;  2YLN A;  3V8X B;  3KN3 A;  1GGG A;  4I1D A;  3UN6 A;  3IOT A;  3S9E A;  3BKI B;  3K1N A;  4R72 A;  2ZXT A;  3MUQ A;  5ELV A;  3M8U A;  2NWJ A;  2OJT A;  1Z7M E;  4Q5T A;  4H67 A;  2PX1 A;  3QUJ A;  3FVO A;  4OYV A;  1QKA A;  2XXH A;  1OVT A;  4OEV A;  3TTR A;  1A8E A;  2Y7W A;  4GXS B;  1ELJ A;  4MF3 A;  1MG1 A;  1YTV A;  3PU5 A;  3LSL A;  3PPQ A;  1LAG E;  4FOR A;  3UOR A;  3EF7 A;  1NKX A;  2A5T B;  2UVH A;  1Q35 A;  3SET A;  1GTK A;  4N07 A;  1URG A;  1B52 A;  1B5J A;  3O6I A;  5DT6 A;  3H03 A;  3PD8 A;  4FE8 A;  3IO4 A;  1MQD A;  2H5Y A;  3N6T A;  3C35 A;  1I6Q A;  2HAU A;  3KJT A;  3L6H A;  5B7D A;  2AL4 A;  1S50 A;  3RGY A;  2ABH A;  2F6P A;  3LBS A;  5AA2 A;  3A3C A;  3C31 A;  4UAC A;  2E0S A;  1B51 A;  1R6Z A;  1IXC A;  3BFU A;  1ZTY A;  4F1V A;  3MJN A;  1MM6 A;  2LAO A;  1OQH A;  1B1X A;  2D3I A;  3OMB A;  4EF2 A;  3KZG A;  2I6E A;  3CR9 A;  5TU0 A;  3LSX A;  4P0G A;  2DE2 A;  2CMO A;  3ZKL A;  3D4C A;  1ZIU A;  2QPQ A;  4QRZ A;  3ECR A;  3KJ7 A;  1P1U A;  3MC2 A;  4QSD A;  4QFO A;  4ELR A;  3UP9 A;  2G29 A;  5I56 A;  1N84 A;  5HPQ A;  1PB9 A;  4DIG A;  1OIB A;  3C4M A;  5HM4 B;  1B3L A;  4NMY A;  1CB6 A;  1MXW A;  5DVI A;  3B7D A;  4YKK A;  4OZ9 A;  3VLU A;  4ELP A;  2O68 A;  1XHY A;  4DXU A;  4U1O A;  1USY H;  3VE1 B;  4NF4 A;  3TEP A;  1NFT A;  3OEL A;  4LP2 B;  3TPA A;  1O7T A;  1RYO A;  3N5L A;  1B0L A;  3G3H A;  1JQF A;  1B1H A;  4JDF A;  4F3P A;  1MS7 A;  4OEN A;  4M4G A;  1WDN A;  2GFE A;  4QFP A;  3PMW A;  2O1M A;  4JSD A;  3KFM A;  2DWI A;  4YB5 A;  4KYS A;  2UYE A;  3RNN A;  4YKI A;  3K6W A;  1VE4 A;  4KHZ E;  1R9L A;  5AE4 A;  3KN8 A; 
#chains in the Genus database with same CATH topology
 4XEQ A;  1JVY A;  4LZ8 A;  4H1X A;  3GZG A;  5ICT A;  4R9F A;  2XD2 A;  1NNP A;  2XWK A;  3S2V A;  4ZZA A;  1XC1 A;  4RK2 A;  4N6P A;  4RYA A;  3PUW E;  4F3B A;  2FIE A;  1GV8 A;  4IO4 A;  4LZ5 A;  1QUL A;  3D4G A;  2Q2A A;  2F7A A;  2VHA A;  4U2R A;  4HTG A;  4QFN A;  1MXX A;  4MBP A;  1I6A A;  1WOD A;  2DXR A;  3K1M A;  3TQL A;  1R1N A;  1DTZ A;  2WBB A;  1UIV A;  4HW8 A;  5AA4 B;  4GXA A;  1GVC A;  3AXF A;  1POT A;  1SW5 A;  2O51 A;  3IX1 A;  1JW1 A;  4U23 A;  4MIJ A;  2QMW A;  4OMB A;  1DTG A;  3RPW A;  1VFD A;  3KBR A;  4EF1 A;  1EZO A;  4KYE A;  3FXB A;  1UIU A;  3FVK A;  1NV2 A;  2REJ A;  4GVO A;  4NWC A;  3SEU A;  3Q26 A;  1CE2 A;  2Z23 A;  3OEM A;  3PPR A;  3RUM A;  3H6V A;  1AH5 A;  1IXG A;  1P1O A;  1BTJ A;  3TTL A;  4P0I A;  2DDK A;  4GWO A;  2F35 A;  5T3J A;  3V89 B;  3U1O A;  1EZ9 A;  3D1R A;  4TQU Q;  3G3K A;  1OLC A;  5ITO A;  1G0H A;  4EXK A;  3K01 A;  5CC2 A;  2RCB A;  2HXW A;  4P8B A;  3KC1 A;  2F3D A;  4DCX A;  4JWO A;  1FTO A;  3RPL A;  2FA7 A;  5K2X A;  5IGA A;  4UA8 A;  3ZSF A;  3C36 A;  4MFI A;  5I2K B;  4JVC A;  1IMC A;  4NAP A;  3MZ9 A;  1VDW A;  1JEU A;  3O6H A;  4ZEF A;  1Y3Q A;  1AIV A;  5KDT B;  3FJ7 A;  4ZS9 A;  1USY E;  4BDN A;  4OVJ A;  1RDX A;  2QVU A;  2BJJ X;  1MY1 A;  1US4 A;  1B7Z A;  5ESY A;  4F29 A;  4THI A;  4WXJ A;  2X7P A;  2THI A;  2YJP A;  3TCF A;  4PDD A;  2I48 A;  3FIR A;  3C9H A;  4LUB A;  3Q29 A;  5I5P A;  3KBZ A;  4QHQ A;  1MPB A;  5HBC A;  1ATG A;  1IMF A;  3MP8 A;  4LN5 A;  3B50 A;  4RPN A;  2V93 A;  1LGB C;  3BIH A;  4OXV A;  4RNS A;  4C1U A;  4F22 A;  1B40 A;  2CZL A;  1FQA A;  3EKI A;  3MZB A;  1EU8 A;  1IEJ A;  4X1D A;  3FVN A;  1SDX A;  1YPN A;  3TDJ A;  3S9M C;  3SEY A;  1D4N A;  4R6Y A;  3SEW A;  2RCA A;  2PFZ A;  1NUW A;  3S9N C;  5DVJ A;  1A8F A;  5FBP A;  1J1N A;  4H8I A;  1MY0 A;  3MPL A;  4OTE A;  3QAX A;  2V3Q A;  4PE3 A;  1NL5 A;  4JSO A;  5CMB A;  3FD3 A;  1PB7 A;  5JTY B;  3VVD A;  5KCJ B;  5EQ8 A;  4NTL A;  1MXZ A;  1MXV A;  3V5A A;  2KR0 A;  4YB7 A;  2QVR A;  2OWT A;  5CMM A;  4YMB A;  4I3E A;  5LOM A;  3OOA A;  5AA2 D;  3FXU A;  1BIY A;  3THI A;  1DOT A;  1JVX A;  1NV4 A;  4GBV A;  4IO5 A;  3R6U A;  4QFL A;  4F3G A;  3E4R A;  3PUV E;  4X1B A;  1MQH A;  2P2A A;  4HE2 A;  1QJM A;  1RDY A;  4ECF A;  1KWH A;  3WAF A;  3L6G A;  3MPK A;  4O7M A;  2YPN A;  4PAK A;  2V4C A;  2I4C A;  2R71 A;  5ET5 A;  1K9Y A;  1BKA A;  1LAX A;  3UIF A;  3F11 A;  1KA1 A;  1FBE A;  5AA4 A;  5DEX B;  4PE5 B;  4P1E A;  2HFB A;  5IZ3 B;  4Z0I A;  3ROJ A;  3W9V A;  1MY3 A;  4P1L A;  3U65 A;  1A54 A;  5FHN A;  4I62 A;  4P56 A;  3RYD A;  1BLF A;  1LEV A;  1NH7 A;  4Z7E A;  1B58 A;  2ZNT A;  4FBP A;  4KCC A;  1XT8 A;  4TLL B;  4PFR A;  4KPT A;  2DWJ A;  2ZNU A;  1A99 A;  2H4I A;  4PCD A;  4P11 A;  1HSL A;  3TCH A;  4WED A;  4JXI A;  4DI4 B;  1MY4 A;  5F7V A;  5ET6 A;  1Y4C A;  1FPJ A;  4GIZ A;  1N04 A;  4NF6 B;  1IIT A;  3QYT A;  1B7U A;  1LBV A;  3DM0 A;  3OO9 A;  4EQB A;  2M8C A;  4BDM A;  3JV9 A;  1LFG A;  2O6A A;  5L9S A;  1LFH A;  3MWB A;  5I2K A;  5TP9 B;  1QUK A;  2WX9 A;  4QBA A;  5H8H B;  4N4U A;  2Q9T A;  4TOZ A;  4JBZ A;  1FPB A;  5KDT A;  4EXL A;  3O66 A;  2Y7R A;  3LSW A;  2Z22 A;  1FPE A;  4LAT A;  4BDR A;  2R9J A;  1NV3 A;  2XXY A;  4I3Y A;  5FHM A;  2HPG A;  3IB0 A;  4QFK A;  2O7I A;  4GFR A;  5I58 B;  3SES A;  5BUU A;  2B4M A;  2X7Q A;  2F78 A;  2HZK A;  2VD2 A;  2DVC A;  1JP4 A;  3EHU A;  2KQZ A;  2RC9 A;  2DYX A;  4GWY A;  1ZMG A;  4C0R A;  4XF5 A;  2F5X A;  4OVR A;  3TMG A;  4PTK A;  1FQE A;  2PFY A;  3N26 A;  5A5X B;  1FBP A;  4LA9 A;  4MNI A;  1FQF A;  1NV7 A;  2P1S A;  2Q74 A;  2NUV A;  3DP4 A;  4MHF A;  3U8Q A;  3PTY A;  5L9M A;  3DLN A;  2CZK A;  2WYK A;  1KA0 A;  4IO2 A;  1NUZ A;  2CEY A;  2E1S A;  5KCJ A;  5EYG A;  4ESX A;  2DQV A;  1DK4 A;  1UTH B;  3EHS A;  4X8R A;  3TZA A;  3O28 A;  3IOW A;  4MJO A;  2OWS A;  5DVF A;  3H6T A;  4OVQ A;  2NXO A;  2QFL A;  4P3L A;  2NVU B;  5KZT A;  1BP5 A;  3OD7 A;  1NI9 A;  2FBP A;  3H7M A;  4NG7 A;  1F9B A;  1JW5 A;  3HO7 A;  3C32 A;  4OFO A;  1RYX A;  1AMF A;  3LC8 A;  3I6V A;  5H8F B;  3FZV A;  1SYI A;  1MQI A;  1Y4T A;  5H8Q B;  3EN3 A;  2CZI A;  1QKB A;  2DP8 A;  2VPO A;  4G8N A;  3EPE A;  2B3F A;  1QUI A;  5DEX A;  1H43 A;  3M3L A;  3CFX A;  3FJG A;  5FHO A;  3I3V A;  3T1B A;  4NF0 A;  4R75 A;  4U4S A;  5IZ3 A;  2UVJ A;  1M5B A;  5DYH A;  2OLB A;  2RKM A;  4F2O A;  5ISU A;  2Q89 A;  4G8H A;  3CG1 A;  4G8M A;  3IOV A;  2Z8D A;  4KYD A;  4EUO A;  4O3A A;  4BLA A;  4RA1 A;  3SKP A;  1FRP A;  1NH8 A;  4IO3 A;  1SBP A;  2H98 A;  2L5V A;  2XXR A;  3HHF A;  5DW8 A;  1PC3 A;  1MPD A;  5JEI A;  5EYH A;  5ICQ A;  2F6G A;  4GX4 A;  4ND9 A;  3OEN A;  3A29 A;  4ZED A;  1T0K A;  4ELQ A;  4ZEB A;  3MW0 A;  4XKP A;  4PP0 A;  3UA8 A;  4NF6 A;  4FEC A;  1IME A;  3QIM A;  4GWU A;  1M5C A;  3RT6 B;  3FV1 A;  3IAZ A;  3VFJ A;  4NWD A;  4U1Z A;  3LUZ A;  5TP9 A;  1OQG A;  1KZ8 A;  1PBQ A;  2XX9 A;  1B5H A;  2I3V A;  5H8H A;  4F31 B;  1Q9D A;  4R74 A;  2XXU A;  3C33 A;  2Q8J A;  1AWB A;  3IFC A;  2PT2 A;  4R9G A;  4MEV A;  4RJZ A;  2Y5K A;  1LAF E;  4FEB A;  3HCQ A;  2UYF A;  4JWY A;  4OES A;  4NF8 B;  2HCA A;  3ONM A;  4N6K A;  3FUZ A;  4RY1 A;  3B6Q A;  3TEL A;  4MH5 A;  5I58 A;  1N3X A;  4R6H A;  4YU0 A;  2Q88 A;  3P7I A;  3GXA A;  2A5T A;  5L9O A;  2VPN A;  2ZYO A;  3TTM A;  1LFI A;  5A5X A;  4HS7 A;  4F3S A;  1PEB A;  3I5O A;  4MNC A;  1B46 A;  3EHT A;  1B05 A;  2A5S A;  1TFD A;  3PPO A;  1LCT A;  2AL5 A;  1OMP A;  4GRK A;  4NN3 A;  2HHM A;  4G68 B;  4IGR A;  4F1Y A;  4R2B A;  3BBR A;  2I0B A;  4KCD A;  3IFA A;  3LUY A;  3H3G A;  2FIX A;  1LBC A;  4YKP A;  1B3E A;  1TFA A;  3FJM A;  2I58 A;  4H45 A;  4EDP A;  1UTH A;  2KLF A;  3KGC A;  1LBY A;  1LBZ A;  3IO6 A;  1B5I A;  4FAT A;  3TUS A;  1B4H A;  4RPO A;  3CI8 A;  5IM2 A;  1NUY A;  5H8N B;  1FBH A;  1LAH E;  1Y3N A;  3HPI A;  4GL0 A;  2D5W A;  4M1V A;  4GOT A;  1GR2 A;  3RT8 A;  2ONK E;  4POX A;  5IKB A;  5H8F A;  5J1D A;  2NOO A;  1EH3 A;  2P0S A;  4GD5 A;  3G3G A;  4X9T A;  3MAM A;  4NGU A;  5H8Q A;  1FTL A;  4MLQ A;  4XTC Q;  3FVG A;  4MX6 A;  3RN8 A;  3U94 A;  5EHS A;  4DZ1 A;  3T9X B;  1B3H A;  2F8D A;  1SI1 A;  3TYH A;  3IK6 B;  1K9Z A;  2FNC A;  2GQ1 A;  3B6W A;  2UXA A;  1SQY A;  4XFE A;  5DTB A;  1IXI A;  3OSQ A;  2ONR A;  3IOR A;  3PPN A;  2GH9 A;  4N6D A;  4FAJ A;  3MP1 A;  3O6G A;  4XKR A;  3LV0 A;  4WKM A;  5EQA A;  5IZZ A;  1SW2 A;  5CBR A;  3ISP A;  3TAJ A;  4IGT A;  4E0W A;  4E0X A;  1DPP A;  3G3I A;  4OQO A;  2XXI A;  1O64 A;  4Q0C A;  4POW A;  4PC9 A;  2JJK A;  4G2Z A;  3TTK A;  5BWJ A;  3T9U A;  5IAI A;  2FYI A;  1YAE A;  4OVT A;  1DBZ A;  3N94 A;  2HAV A;  3E3K A;  1EYJ A;  3HV1 A;  3MP6 A;  2QSX A;  3GBB A;  4IY5 A;  3FAS A;  3JYR A;  3CFL A;  1FQC A;  1Y3P A;  2REG A;  1B2H A;  3G3J A;  3VV5 A;  2F97 A;  4MAG A;  3MST A;  4ZEC A;  4HE1 A;  4PF8 A;  3IOU A;  4JB7 A;  4PFI A;  1INP A;  1CNQ A;  1I6B A;  4GQO A;  1ZU0 A;  3IR1 A;  3VDF A;  4KXP A;  3MVZ A;  1YZ0 A;  4NF8 A;  4O3C A;  1URS A;  2Q2C A;  4H8J A;  4AS4 A;  5B70 A;  4GL8 A;  3MVX A;  3MVW A;  1N7W A;  4ZE9 A;  2ALU A;  4F39 A;  3OSR A;  4JWX A;  5L8D A;  2H25 A;  1DMB A;  1RKM A;  4LQ5 A;  1QGX A;  1LB8 A;  2W7Y A;  3Q27 A;  1ZJL A;  2WKY A;  1NNF A;  5FTH A;  3QMF A;  4NQ8 A;  3VLV A;  1YYZ A;  3K6U A;  4O94 A;  2H99 A;  1SW1 A;  3OEK A;  1II5 A;  4KFQ A;  2XWO A;  4L17 A;  4KI0 E;  2XWI A;  1B7H A;  4OFL A;  1FW0 A;  5AA3 A;  2VD3 A;  4OAN A;  4FJP A;  4LZ7 A;  5LTC A;  4BDQ A;  3K2D A;  4G68 A;  3G3F A;  4RK9 A;  2QVV A;  1JNF A;  1QUJ A;  4OFJ A;  3A3U A;  2F36 A;  1JET A;  3QXM A;  1B3F A;  2ZZW A;  4DXB A;  1P1W A;  3N6U A;  4DE8 A;  4R73 A;  1EYK A;  1XS5 A;  4PF6 A;  1IIW A;  2UVG A;  3CG3 A;  1MDQ A;  3RLF E;  5ET7 A;  1BK4 A;  1NV1 A;  4H0W A;  2F34 A;  1N3W A;  5H8N A;  4DCY A;  4R2F A;  3JZJ A;  4DDD A;  1FPD A;  2QS1 A;  3FGS A;  4PFT A;  3C34 A;  1M5E A;  4P47 A;  1DSN A;  2PMS A;  1POY 1;  5CBS A;  3Q28 A;  3TTN A;  5EQ9 A;  3U92 A;  1NNT A;  2V3U A;  1FTJ A;  2RIN A;  4OET A;  4NF5 B;  2V84 A;  5CM6 A;  1QW0 A;  2V3T A;  5AA1 A;  1B3G A;  2I49 A;  2QS3 A;  1ANF A;  1MH4 A;  2B4L A;  1LBW A;  4JVD A;  4KR5 A;  2P3V A;  3K6X A;  4QSC A;  1FJ9 A;  3E9X A;  2ZZX A;  3T66 A;  5CMC A;  4PFU A;  2ESN A;  4YZZ A;  1LCF A;  5M2V A;  4IO7 A;  1P1Q A;  4OVS A;  1Y9U A;  4AB6 A;  4HCY A;  2ZMB A;  1PDA A;  5F1Q A;  4PET A;  2XXX A;  1FPL A;  4N91 A;  2WBD A;  3FXR A;  3MQ9 A;  2I3W A;  3KOT A;  1SVX B;  4IO6 A;  3U72 A;  3K4U A;  5JTY A;  2DWH A;  4RXL A;  3RTW B;  1LBX A;  4UAB A;  4H46 A;  4ZEI A;  3DEL B;  2IEE A;  5JK4 A;  4ISU A;  4AB5 A;  2WYP A;  3VLW A;  2XXT A;  3GLB A;  2O84 X;  2QL3 A;  3PMV A;  4NHB A;  2RC8 A;  4K3F A;  3IL1 B;  1UQW A;  4N8G A;  1OVB A;  5I57 B;  1FBF A;  2OZZ A;  3SER A;  2PYY A;  1H44 A;  3SEV A;  1P99 A;  3K00 A;  2DWA A;  5I2N B;  4FIM A;  2WEF A;  3PUX E;  3SEX A;  1MY2 A;  2BJI A;  3BFT A;  1OLA A;  1FTK A;  1FQD A;  4X48 A;  3VXB A;  4PFB A;  3TOD A;  4MLV A;  2VT5 A;  2B3B A;  3GBA A;  1UTB B;  4YAH X;  4OA4 A;  1FQB A;  3PD9 A;  4LQ2 A;  1A55 A;  3KOS A;  4G4P A;  3TKD A;  2ZYN A;  4OWD A;  2ZYK A;  1MRP A;  3QK6 A;  2IA4 A;  1VFE A;  4YIC A;  4G68 C;  2VGQ A;  3V83 A;  4G77 A;  1N7X A;  3H4Z A;  1PB8 A;  3T9H B;  5I59 B;  2X26 A;  2QMX A;  4OVP A;  1N0T A;  3B8B A;  3B6T A;  4PAF A;  1B6H A;  4N8Y A;  2Y7I A;  3H6U A;  4PGP A;  1Q1K A;  2Z8E A;  5I84 A;  1YCJ A;  3OO6 A;  4KQP A;  3S9L C;  2ANJ A;  1ZBM A;  1EZP A;  4I8C A;  2O1L A;  3MBP A;  1MM7 A;  1TWY A;  5EQ7 A;  3PV0 E;  2F7C A;  1FTM A;  2ONS A;  4H6D A;  3O9P A;  3ODB A;  3OXN A;  5I7I A;  2UVI A;  3A09 A;  3K02 A;  2H9B A;  2I4B A;  2QRY A;  2Y5L A;  1FCK A;  3R26 A;  4GWX A;  1MH3 A;  1HSE A;  3QSL A;  3FAT A;  4NF5 A;  2XD3 A;  5EHM A;  3VVF A;  2QS2 A;  4F1U A;  2O7U A;  5K2Y A;  1XVX A;  1FPG A;  1SPI A;  2XX7 A;  1PBP A;  4F2Q A;  3K6V A;  5H8S A;  3ILT B;  3PGF A;  3CFZ A;  2FHY A;  1SYH A;  4I9D A;  2I0C A;  3RQT A;  1EYI A;  1H76 A;  1XVY A;  1JW4 A;  2XX8 A;  4Q30 B;  2VP1 A;  3LR1 A;  2PVU A;  1DCU A;  4XIG Q;  1NNK A;  4PFY A;  4BDL A;  2GHB A;  4XXU A;  2DE4 A;  3OO7 A;  3QUF A;  1XI6 A;  3E13 X;  2DSF A;  3ZS6 A;  1IUD A;  3FXQ A;  4O3B A;  3W15 C;  1ZLQ A;  5EYF A;  3MZ1 A;  1WVJ A;  1JEV A;  2OK2 A;  4PQJ A;  1LST A;  2HEU A;  1L5T A;  3USD A;  3HN0 A;  4OHN A;  3W9W A;  4ESW A;  2Y7K A;  2HQ0 A;  4IB2 A;  1FBD A;  3M3F A;  2RF1 A;  4DXC A;  1IZ1 A;  2PCR A;  4KD5 A;  1D3K A;  1SI0 A;  4P9K A;  4ZZE A;  2QS4 A;  2XXP A;  4ELO A;  3PMX A;  3KG2 A;  3TCG A;  2AIX A;  1IXH A;  4ZEK A;  4PFW A;  5CI5 A;  3U93 A;  3PUY E;  5TPA B;  4GBW A;  1TT1 A;  4PGN A;  3G7W A;  2HZL A;  2RC7 A;  5I57 A;  4XKQ A;  4H5G A;  3RY3 A;  4U22 A;  3BIG A;  4LON B;  4ZDM A;  3KSX A;  3IB2 A;  2DOJ A;  2OBG A;  2R8T A;  2O69 A;  2QJE A;  3ZKK A;  5I3S A;  2ZNS A;  2FVZ A;  4EQ7 A;  2GRV A;  2Z8F A;  5I2N A;  1NUX A;  1SW4 A;  3O29 A;  1A7L A;  1D9Y A;  4H5F A;  4F18 A;  4QF9 A;  2D21 A;  2G93 A;  2OX3 A;  4HXV A;  4GF8 A;  4HCW A;  2DVZ A;  3T22 A;  4PAI A;  1MXU A;  4WEP A;  3CSB A;  1UTB A;  3FV2 A;  3T9V A;  4DLD A;  3DP6 A;  1G0I A;  2R6G E;  1LBB A;  1YXI A;  1MDP 1;  3SDF A;  4NE4 A;  1H45 A;  3KSJ A;  2DS9 A;  5CMK A;  4NED A;  1H3D A;  2AYS A;  3IJX B;  1DPE A;  3ILU B;  3O2A A;  1Z7N E;  4R6K A;  1HSJ A;  1FPI A;  3H06 B;  2OCU A;  3VXC A;  2PBW A;  1N76 A;  5I59 A;  2XWV A;  4OER A;  2Q8M A;  4TLM B;  1XOC A;  4AS5 A;  3M3K A;  3KN7 A;  4JVI A;  4FED A;  1AL3 A;  4IR8 A;  3FBP A;  3IJO B;  4N13 A;  1S7Y A;  4N15 A;  4YKJ A;  5AA2 B;  1Y1M A;  2Y7P A;  1B4Z A;  3CHG A;  4YB6 A;  3MVY A;  3Q25 A;  1B0H A;  1ZKB A;  1O63 A;  1NV5 A;  1I69 A;  5CRY A;  2XXV A;  4MNP A;  3T93 B;  2XHD A;  2GHA A;  1SD3 A;  1MQJ A;  3UGW A;  1R9Q A;  1Y1Z A;  1M5D A;  4LVQ A;  3TFL A;  1TXF A;  2XXQ A;  2ZYM A;  5IZ1 A;  3PPP A;  3HST A;  3HFU A;  1FTA A;  4QSE A;  4YMA A;  3KEI A;  5I56 B;  4BDO A;  3HHG A;  4F19 A;  3WAE A;  4U21 A;  1VR5 A;  1NV0 A;  3LSF B;  4OEU A;  4XKN A;  2XXW A;  1D9V A;  1FPK A;  1B9J A;  3CIJ A;  4H65 A;  4ONY A;  3PUZ E;  1URD A;  4I40 A;  1P1N A;  4NF4 B;  1VSO A;  3O97 A;  3H6W A;  3K0V A;  3TQW A;  1MPC A;  2DE3 A;  2B65 A;  2PT1 A;  4GLI A;  4O7I A;  3E78 A;  4IY6 A;  4AQ4 A;  1AOV A;  1LLS A;  2DXY A;  3OO8 A;  2CEX A;  3EQ1 A;  2Y84 A;  1M5F A;  5ET8 A;  4PBQ A;  3S4U A;  4Q8R A;  3CVG A;  2P3N A;  1MXY A;  2OWZ A;  4ZE8 A;  4HE0 A;  1A40 A;  1IQ7 A;  1B32 A;  1MQG A;  3VVE A;  2F7B A;  1LB9 A;  2CZH A;  5F24 A;  4EQ9 A;  3K1P A;  1QVS A;  1S9T A;  1US5 A;  4QXD A;  1NMU A;  3RTF B;  2XXK A;  4GWW A;  3R7X A;  2VOZ A;  5ITP A;  3CRB A;  1FPF A;  1FBC A;  5FTI A;  5TPA A;  2ZZV A;  4C1T A;  3UK4 A;  4N17 A;  1Y20 A;  3CSG A;  3DP8 A;  2V25 A;  4U4X A;  3MYU A;  3T96 B;  3IB1 A;  2YLN A;  3V8X B;  3KN3 A;  1GGG A;  4I1D A;  3UN6 A;  3IOT A;  3KC0 A;  1RDZ A;  3S9E A;  3BKI B;  3K1N A;  4R72 A;  2ZXT A;  3MUQ A;  3NOH A;  5ELV A;  3M8U A;  2NWJ A;  2OJT A;  1Z7M E;  4Q5T A;  4H67 A;  2PX1 A;  3QUJ A;  3FVO A;  1IMB A;  4OYV A;  1QKA A;  2XXH A;  1OVT A;  5A5L A;  4OEV A;  3TTR A;  1FBG A;  4NX1 A;  1A8E A;  2Y7W A;  4GXS B;  1ELJ A;  4MF3 A;  1MG1 A;  1YTV A;  3PU5 A;  3LSL A;  3PPQ A;  4O8M A;  2F3B A;  4MCO A;  1LAG E;  4FOR A;  3UOR A;  3EF7 A;  1NKX A;  2A5T B;  2UVH A;  1Q35 A;  3SET A;  1GTK A;  4N07 A;  1URG A;  1B52 A;  1B5J A;  3O6I A;  5DT6 A;  3H03 A;  3PD8 A;  4FE8 A;  3IO4 A;  1MQD A;  1FSA A;  2H5Y A;  1IMA A;  3N6T A;  3C35 A;  1I6Q A;  2XA5 A;  3SZP A;  2HAU A;  3KJT A;  3L6H A;  5B7D A;  1FJ6 A;  2AL4 A;  4GWS A;  1S50 A;  3RGY A;  2ABH A;  2F6P A;  3LBS A;  5AA2 A;  3A3C A;  3C31 A;  4UAC A;  2E0S A;  1B51 A;  3RPL B;  1R6Z A;  1IXC A;  3BFU A;  3T0J A;  1ZTY A;  4F1V A;  3MJN A;  1MM6 A;  2LAO A;  1OQH A;  1B1X A;  2D3I A;  3OMB A;  4EF2 A;  3KZG A;  2I6E A;  3CR9 A;  5TU0 A;  3LSX A;  4P0G A;  2DE2 A;  1IMD A;  2CMO A;  3ZKL A;  3D4C A;  1NV6 A;  1ZIU A;  2QPQ A;  4QRZ A;  3ECR A;  3KJ7 A;  4GX6 A;  1P1U A;  2HXR A;  3MC2 A;  4QSD A;  4QFO A;  4ELR A;  3UP9 A;  1D9Q A;  2G29 A;  4DI3 D;  5I56 A;  1N84 A;  5HPQ A;  1PB9 A;  4G61 A;  3E79 A;  4DIG A;  1OIB A;  3C4M A;  5HM4 B;  1B3L A;  4NMY A;  1CB6 A;  1MXW A;  5DVI A;  4MMP A;  4GWZ A;  3B7D A;  4YKK A;  4OZ9 A;  4PDH A;  3VLU A;  4ELP A;  2O68 A;  4PBH A;  1XHY A;  4DXU A;  3GYY A;  5J16 A;  4U1O A;  1USY H;  4X04 A;  3VE1 B;  4NF4 A;  3TEP A;  1NFT A;  2MKZ A;  3OEL A;  4LP2 B;  3TPA A;  1O7T A;  1RYO A;  3N5L A;  1B0L A;  3G3H A;  1JQF A;  1B1H A;  4JDF A;  4F3P A;  1MS7 A;  4OEN A;  4M4G A;  1WDN A;  2GFE A;  5LDZ A;  4QFP A;  3PMW A;  2O1M A;  4JSD A;  4N81 A;  3KFM A;  2DWI A;  4YB5 A;  4KYS A;  4GX3 A;  2UYE A;  3RNN A;  4YKI A;  3K6W A;  1VE4 A;  4KHZ E;  1R9L A;  5AE4 A;  3KN8 A; 
#chains in the Genus database with same CATH homology
 1JVY A;  4LZ8 A;  4H1X A;  3GZG A;  5ICT A;  4R9F A;  2XD2 A;  1NNP A;  3S2V A;  4ZZA A;  1XC1 A;  4RK2 A;  4N6P A;  4RYA A;  3PUW E;  4F3B A;  1GV8 A;  4IO4 A;  4LZ5 A;  1QUL A;  3D4G A;  2Q2A A;  2F7A A;  2VHA A;  4U2R A;  4HTG A;  4QFN A;  1MXX A;  4MBP A;  1I6A A;  1WOD A;  2DXR A;  3K1M A;  3TQL A;  1R1N A;  1DTZ A;  1UIV A;  4HW8 A;  5AA4 B;  4GXA A;  1GVC A;  3AXF A;  1POT A;  1SW5 A;  2O51 A;  3IX1 A;  1JW1 A;  4U23 A;  2QMW A;  4OMB A;  1DTG A;  3RPW A;  1VFD A;  3KBR A;  4EF1 A;  1EZO A;  4KYE A;  1UIU A;  3FVK A;  2REJ A;  4GVO A;  4NWC A;  3SEU A;  3Q26 A;  1CE2 A;  2Z23 A;  3OEM A;  3PPR A;  3RUM A;  3H6V A;  1AH5 A;  1IXG A;  1P1O A;  1BTJ A;  3TTL A;  4P0I A;  4GWO A;  2F35 A;  3V89 B;  3U1O A;  1EZ9 A;  4TQU Q;  3G3K A;  1OLC A;  5ITO A;  4EXK A;  3K01 A;  5CC2 A;  2RCB A;  2HXW A;  4DCX A;  4JWO A;  1FTO A;  2FA7 A;  5K2X A;  4UA8 A;  3ZSF A;  3C36 A;  4MFI A;  5I2K B;  3MZ9 A;  1JEU A;  3O6H A;  4ZEF A;  1Y3Q A;  1AIV A;  5KDT B;  3FJ7 A;  4ZS9 A;  1USY E;  4BDN A;  4OVJ A;  2BJJ X;  1MY1 A;  1US4 A;  1B7Z A;  4F29 A;  4THI A;  4WXJ A;  2X7P A;  2THI A;  2YJP A;  3TCF A;  2I48 A;  3FIR A;  3C9H A;  4LUB A;  3Q29 A;  4QHQ A;  1MPB A;  5HBC A;  1ATG A;  3MP8 A;  4RPN A;  2V93 A;  1LGB C;  4OXV A;  4RNS A;  4C1U A;  4F22 A;  1B40 A;  2CZL A;  1FQA A;  3MZB A;  1EU8 A;  1IEJ A;  4X1D A;  3FVN A;  1SDX A;  1YPN A;  3TDJ A;  3S9M C;  3SEY A;  1D4N A;  4R6Y A;  3SEW A;  2RCA A;  3S9N C;  5DVJ A;  1A8F A;  1J1N A;  4H8I A;  1MY0 A;  3MPL A;  4OTE A;  3QAX A;  2V3Q A;  1NL5 A;  4JSO A;  5CMB A;  3FD3 A;  1PB7 A;  5JTY B;  3VVD A;  5KCJ B;  4NTL A;  1MXZ A;  1MXV A;  3V5A A;  4YB7 A;  2OWT A;  5CMM A;  4YMB A;  5LOM A;  3OOA A;  5AA2 D;  3FXU A;  1BIY A;  3THI A;  1DOT A;  1JVX A;  4IO5 A;  3R6U A;  4QFL A;  4F3G A;  3E4R A;  3PUV E;  4X1B A;  1MQH A;  2P2A A;  1QJM A;  4ECF A;  1KWH A;  3WAF A;  3L6G A;  3MPK A;  2YPN A;  2I4C A;  2R71 A;  1BKA A;  1LAX A;  3UIF A;  3F11 A;  5AA4 A;  5DEX B;  4PE5 B;  2HFB A;  4Z0I A;  3W9V A;  1MY3 A;  1A54 A;  5FHN A;  4I62 A;  1BLF A;  1NH7 A;  4Z7E A;  1B58 A;  2ZNT A;  4KCC A;  1XT8 A;  4TLL B;  4KPT A;  2DWJ A;  2ZNU A;  1A99 A;  2H4I A;  4P11 A;  1HSL A;  3TCH A;  4WED A;  4JXI A;  1MY4 A;  5F7V A;  1Y4C A;  4GIZ A;  1N04 A;  4NF6 B;  1IIT A;  3QYT A;  1B7U A;  3DM0 A;  3OO9 A;  4EQB A;  2M8C A;  4BDM A;  3JV9 A;  1LFG A;  2O6A A;  5L9S A;  1LFH A;  3MWB A;  5I2K A;  5TP9 B;  1QUK A;  5H8H B;  2Q9T A;  4TOZ A;  4JBZ A;  5KDT A;  4EXL A;  3O66 A;  2Y7R A;  3LSW A;  2Z22 A;  4LAT A;  4BDR A;  2R9J A;  2XXY A;  5FHM A;  3IB0 A;  4QFK A;  2O7I A;  4GFR A;  5I58 B;  3SES A;  5BUU A;  2X7Q A;  2F78 A;  2HZK A;  2VD2 A;  2DVC A;  3EHU A;  2RC9 A;  2DYX A;  1ZMG A;  4C0R A;  2F5X A;  3TMG A;  1FQE A;  3N26 A;  5A5X B;  4LA9 A;  1FQF A;  2P1S A;  2NUV A;  3DP4 A;  3U8Q A;  5L9M A;  3DLN A;  4IO2 A;  2E1S A;  5KCJ A;  4ESX A;  2DQV A;  1UTH B;  3EHS A;  3TZA A;  3O28 A;  3IOW A;  2OWS A;  5DVF A;  3H6T A;  2NXO A;  2NVU B;  5KZT A;  1BP5 A;  3OD7 A;  3H7M A;  1F9B A;  1JW5 A;  3HO7 A;  3C32 A;  4OFO A;  1RYX A;  1AMF A;  3LC8 A;  3I6V A;  5H8F B;  3FZV A;  1SYI A;  1MQI A;  1Y4T A;  5H8Q B;  3EN3 A;  1QKB A;  2DP8 A;  4G8N A;  3EPE A;  2B3F A;  1QUI A;  5DEX A;  1H43 A;  3M3L A;  3CFX A;  3FJG A;  5FHO A;  3I3V A;  4R75 A;  4U4S A;  2UVJ A;  1M5B A;  5DYH A;  2OLB A;  2RKM A;  4F2O A;  5ISU A;  2Q89 A;  4G8H A;  3CG1 A;  4G8M A;  3IOV A;  2Z8D A;  4KYD A;  4EUO A;  4O3A A;  4BLA A;  4RA1 A;  3SKP A;  1NH8 A;  4IO3 A;  1SBP A;  2H98 A;  2XXR A;  3HHF A;  1PC3 A;  1MPD A;  5JEI A;  5ICQ A;  2F6G A;  4ND9 A;  3OEN A;  4ZED A;  1T0K A;  4ELQ A;  4ZEB A;  3MW0 A;  4XKP A;  4PP0 A;  3UA8 A;  4NF6 A;  4FEC A;  3QIM A;  1M5C A;  3RT6 B;  3FV1 A;  3IAZ A;  3VFJ A;  4NWD A;  4U1Z A;  5TP9 A;  1OQG A;  1PBQ A;  2XX9 A;  1B5H A;  2I3V A;  5H8H A;  4F31 B;  4R74 A;  2XXU A;  3C33 A;  2Q8J A;  2PT2 A;  4R9G A;  4RJZ A;  1LAF E;  4FEB A;  3HCQ A;  2UYF A;  4JWY A;  4OES A;  4NF8 B;  2HCA A;  3ONM A;  3FUZ A;  4RY1 A;  3B6Q A;  3TEL A;  4MH5 A;  5I58 A;  1N3X A;  4R6H A;  4YU0 A;  2Q88 A;  3P7I A;  3GXA A;  2A5T A;  5L9O A;  2ZYO A;  3TTM A;  1LFI A;  5A5X A;  4HS7 A;  4F3S A;  1PEB A;  3I5O A;  1B46 A;  3EHT A;  1B05 A;  2A5S A;  1TFD A;  3PPO A;  1LCT A;  2AL5 A;  1OMP A;  4GRK A;  4G68 B;  4IGR A;  4F1Y A;  4R2B A;  3BBR A;  2I0B A;  4KCD A;  3LUY A;  3H3G A;  1LBC A;  4YKP A;  1B3E A;  1TFA A;  3FJM A;  2I58 A;  4EDP A;  1UTH A;  2KLF A;  3KGC A;  3IO6 A;  1B5I A;  4FAT A;  3TUS A;  1B4H A;  4RPO A;  3CI8 A;  5H8N B;  1LAH E;  1Y3N A;  3HPI A;  4GL0 A;  2D5W A;  4M1V A;  4GOT A;  1GR2 A;  3RT8 A;  2ONK E;  4POX A;  5IKB A;  5H8F A;  5J1D A;  2NOO A;  1EH3 A;  2P0S A;  4GD5 A;  3G3G A;  4X9T A;  3MAM A;  5H8Q A;  1FTL A;  4MLQ A;  4XTC Q;  3FVG A;  3RN8 A;  3U94 A;  5EHS A;  4DZ1 A;  3T9X B;  1B3H A;  2F8D A;  1SI1 A;  3TYH A;  3IK6 B;  2FNC A;  3B6W A;  2UXA A;  1SQY A;  5DTB A;  1IXI A;  3OSQ A;  2ONR A;  3IOR A;  3PPN A;  2GH9 A;  4FAJ A;  3MP1 A;  3O6G A;  4XKR A;  4WKM A;  1SW2 A;  5CBR A;  3TAJ A;  4IGT A;  4E0W A;  4E0X A;  1DPP A;  3G3I A;  4OQO A;  2XXI A;  1O64 A;  4Q0C A;  4POW A;  4G2Z A;  3TTK A;  5BWJ A;  3T9U A;  5IAI A;  2FYI A;  1YAE A;  3N94 A;  2HAV A;  3E3K A;  3HV1 A;  3MP6 A;  2QSX A;  3GBB A;  4IY5 A;  3FAS A;  3JYR A;  3CFL A;  1FQC A;  1Y3P A;  2REG A;  1B2H A;  3G3J A;  3VV5 A;  2F97 A;  4ZEC A;  3IOU A;  4JB7 A;  1I6B A;  4GQO A;  1ZU0 A;  3IR1 A;  3VDF A;  4NF8 A;  3MVZ A;  4O3C A;  1URS A;  2Q2C A;  4H8J A;  5B70 A;  4GL8 A;  3MVX A;  3MVW A;  1N7W A;  4ZE9 A;  2ALU A;  4F39 A;  3OSR A;  4JWX A;  5L8D A;  2H25 A;  1DMB A;  1RKM A;  4LQ5 A;  1LB8 A;  2W7Y A;  3Q27 A;  1ZJL A;  2WKY A;  1NNF A;  5FTH A;  3VLV A;  3K6U A;  2H99 A;  1SW1 A;  3OEK A;  1II5 A;  4KFQ A;  4L17 A;  4KI0 E;  1B7H A;  4OFL A;  1FW0 A;  5AA3 A;  2VD3 A;  4FJP A;  4LZ7 A;  4BDQ A;  3K2D A;  4G68 A;  3G3F A;  4RK9 A;  1JNF A;  1QUJ A;  4OFJ A;  3A3U A;  2F36 A;  1JET A;  3QXM A;  1B3F A;  4DXB A;  1P1W A;  3N6U A;  4DE8 A;  4R73 A;  1XS5 A;  1IIW A;  2UVG A;  3CG3 A;  1MDQ A;  3RLF E;  4H0W A;  2F34 A;  1N3W A;  5H8N A;  4DCY A;  4R2F A;  3JZJ A;  4DDD A;  2QS1 A;  3FGS A;  4PFT A;  3C34 A;  1M5E A;  1DSN A;  2PMS A;  1POY 1;  5CBS A;  3Q28 A;  3TTN A;  3U92 A;  1NNT A;  2V3U A;  1FTJ A;  2RIN A;  4OET A;  4NF5 B;  2V84 A;  5CM6 A;  1QW0 A;  2V3T A;  5AA1 A;  1B3G A;  2I49 A;  2QS3 A;  1ANF A;  1MH4 A;  4KR5 A;  3K6X A;  4QSC A;  3E9X A;  3T66 A;  5CMC A;  2ESN A;  4PFU A;  4YZZ A;  1LCF A;  5M2V A;  4IO7 A;  1P1Q A;  1Y9U A;  4AB6 A;  4HCY A;  2ZMB A;  1PDA A;  5F1Q A;  4PET A;  2XXX A;  3FXR A;  3MQ9 A;  2I3W A;  3KOT A;  1SVX B;  4IO6 A;  3U72 A;  3K4U A;  5JTY A;  2DWH A;  4RXL A;  3RTW B;  4ZEI A;  3DEL B;  2IEE A;  5JK4 A;  4ISU A;  4AB5 A;  3VLW A;  2XXT A;  3GLB A;  2O84 X;  2QL3 A;  3PMV A;  2RC8 A;  4K3F A;  3IL1 B;  1UQW A;  1OVB A;  5I57 B;  2OZZ A;  3SER A;  2PYY A;  1H44 A;  3SEV A;  1P99 A;  3K00 A;  2DWA A;  5I2N B;  4FIM A;  3PUX E;  3SEX A;  1MY2 A;  3BFT A;  1OLA A;  1FTK A;  1FQD A;  4X48 A;  3VXB A;  3TOD A;  4MLV A;  2B3B A;  3GBA A;  1UTB B;  4YAH X;  1FQB A;  3PD9 A;  4LQ2 A;  1A55 A;  3KOS A;  4G4P A;  3TKD A;  2ZYN A;  4OWD A;  2ZYK A;  1MRP A;  3QK6 A;  2IA4 A;  1VFE A;  4YIC A;  4G68 C;  2VGQ A;  3V83 A;  4G77 A;  1N7X A;  3H4Z A;  1PB8 A;  3T9H B;  5I59 B;  2X26 A;  2QMX A;  1N0T A;  3B6T A;  1B6H A;  2Y7I A;  3H6U A;  1Q1K A;  2Z8E A;  5I84 A;  1YCJ A;  3OO6 A;  4KQP A;  3S9L C;  2ANJ A;  1ZBM A;  1EZP A;  4I8C A;  2O1L A;  3MBP A;  1MM7 A;  1TWY A;  3PV0 E;  2F7C A;  1FTM A;  2ONS A;  4H6D A;  3O9P A;  3ODB A;  3OXN A;  2UVI A;  3A09 A;  3K02 A;  2H9B A;  2I4B A;  2QRY A;  3R26 A;  1FCK A;  1MH3 A;  1HSE A;  3QSL A;  3FAT A;  4NF5 A;  2XD3 A;  5EHM A;  3VVF A;  2QS2 A;  4F1U A;  2O7U A;  5K2Y A;  1XVX A;  2XX7 A;  1PBP A;  4F2Q A;  3K6V A;  5H8S A;  3ILT B;  3PGF A;  3CFZ A;  1SYH A;  4I9D A;  2I0C A;  3RQT A;  1H76 A;  1XVY A;  1JW4 A;  2XX8 A;  4Q30 B;  2VP1 A;  3LR1 A;  2PVU A;  4XIG Q;  1NNK A;  4PFY A;  4BDL A;  2GHB A;  4XXU A;  2DE4 A;  3OO7 A;  3QUF A;  3E13 X;  2DSF A;  3ZS6 A;  1IUD A;  3FXQ A;  4O3B A;  3W15 C;  1ZLQ A;  5EYF A;  3MZ1 A;  1WVJ A;  1JEV A;  2OK2 A;  4PQJ A;  1LST A;  2HEU A;  1L5T A;  3USD A;  3HN0 A;  4OHN A;  3W9W A;  4ESW A;  2Y7K A;  2HQ0 A;  4IB2 A;  3M3F A;  2RF1 A;  4DXC A;  1IZ1 A;  4KD5 A;  1D3K A;  1SI0 A;  4ZZE A;  2QS4 A;  2XXP A;  4ELO A;  3PMX A;  3KG2 A;  3TCG A;  2AIX A;  1IXH A;  4ZEK A;  4PFW A;  5CI5 A;  3U93 A;  3PUY E;  5TPA B;  1TT1 A;  3G7W A;  2HZL A;  2RC7 A;  5I57 A;  4XKQ A;  4H5G A;  3RY3 A;  4U22 A;  4LON B;  4ZDM A;  3KSX A;  3IB2 A;  2DOJ A;  2OBG A;  2O69 A;  2QJE A;  3ZKK A;  2ZNS A;  4EQ7 A;  2GRV A;  2Z8F A;  5I2N A;  1SW4 A;  3O29 A;  1A7L A;  1D9Y A;  4H5F A;  4F18 A;  4QF9 A;  2D21 A;  2G93 A;  4GF8 A;  4HCW A;  2DVZ A;  3T22 A;  1MXU A;  4WEP A;  3CSB A;  1UTB A;  3FV2 A;  3T9V A;  4DLD A;  3DP6 A;  2R6G E;  1LBB A;  1MDP 1;  3SDF A;  4NE4 A;  1H45 A;  3KSJ A;  2DS9 A;  5CMK A;  4NED A;  1H3D A;  2AYS A;  3IJX B;  1DPE A;  3ILU B;  3O2A A;  1Z7N E;  4R6K A;  1HSJ A;  3H06 B;  2OCU A;  3VXC A;  2PBW A;  1N76 A;  5I59 A;  4OER A;  4TLM B;  1XOC A;  3M3K A;  3KN7 A;  4FED A;  1AL3 A;  3IJO B;  4N13 A;  1S7Y A;  4YKJ A;  5AA2 B;  1Y1M A;  2Y7P A;  1B4Z A;  4YB6 A;  3MVY A;  3Q25 A;  1B0H A;  1ZKB A;  1O63 A;  1I69 A;  5CRY A;  2XXV A;  3T93 B;  2XHD A;  2GHA A;  1SD3 A;  1MQJ A;  3UGW A;  1R9Q A;  1Y1Z A;  1M5D A;  4LVQ A;  3TFL A;  1TXF A;  2XXQ A;  2ZYM A;  3PPP A;  3HST A;  4QSE A;  4YMA A;  3KEI A;  5I56 B;  4BDO A;  3HHG A;  4F19 A;  3WAE A;  4U21 A;  1VR5 A;  3LSF B;  4OEU A;  4XKN A;  2XXW A;  1D9V A;  1B9J A;  3CIJ A;  4H65 A;  4ONY A;  3PUZ E;  1URD A;  4NF4 B;  1P1N A;  1VSO A;  3O97 A;  3H6W A;  3K0V A;  3TQW A;  1MPC A;  2DE3 A;  2B65 A;  2PT1 A;  4GLI A;  4IY6 A;  4AQ4 A;  1AOV A;  1LLS A;  2DXY A;  3OO8 A;  3EQ1 A;  2Y84 A;  1M5F A;  3S4U A;  4Q8R A;  3CVG A;  1MXY A;  4ZE8 A;  1A40 A;  1IQ7 A;  1B32 A;  1MQG A;  3VVE A;  2F7B A;  1LB9 A;  4EQ9 A;  3K1P A;  1QVS A;  1S9T A;  1US5 A;  1NMU A;  3RTF B;  3R7X A;  2VOZ A;  5ITP A;  3CRB A;  5FTI A;  5TPA A;  4C1T A;  3UK4 A;  1Y20 A;  3CSG A;  3DP8 A;  2V25 A;  4U4X A;  3T96 B;  3IB1 A;  2YLN A;  3V8X B;  3KN3 A;  1GGG A;  4I1D A;  3UN6 A;  3IOT A;  3S9E A;  3BKI B;  3K1N A;  4R72 A;  2ZXT A;  3MUQ A;  5ELV A;  3M8U A;  2NWJ A;  2OJT A;  1Z7M E;  4Q5T A;  4H67 A;  2PX1 A;  3QUJ A;  3FVO A;  4OYV A;  1QKA A;  2XXH A;  1OVT A;  4OEV A;  3TTR A;  1A8E A;  2Y7W A;  4GXS B;  1ELJ A;  4MF3 A;  1MG1 A;  1YTV A;  3PU5 A;  3LSL A;  3PPQ A;  1LAG E;  4FOR A;  3UOR A;  3EF7 A;  1NKX A;  2A5T B;  2UVH A;  1Q35 A;  3SET A;  1GTK A;  4N07 A;  1URG A;  1B52 A;  1B5J A;  3O6I A;  5DT6 A;  3H03 A;  3PD8 A;  4FE8 A;  3IO4 A;  1MQD A;  2H5Y A;  3N6T A;  3C35 A;  1I6Q A;  2HAU A;  3KJT A;  3L6H A;  5B7D A;  2AL4 A;  1S50 A;  3RGY A;  2ABH A;  2F6P A;  3LBS A;  5AA2 A;  3A3C A;  3C31 A;  4UAC A;  2E0S A;  1B51 A;  1R6Z A;  1IXC A;  3BFU A;  1ZTY A;  4F1V A;  3MJN A;  1MM6 A;  2LAO A;  1OQH A;  1B1X A;  2D3I A;  3OMB A;  4EF2 A;  3KZG A;  2I6E A;  3CR9 A;  5TU0 A;  3LSX A;  4P0G A;  2DE2 A;  2CMO A;  3ZKL A;  3D4C A;  1ZIU A;  2QPQ A;  4QRZ A;  3ECR A;  3KJ7 A;  1P1U A;  3MC2 A;  4QSD A;  4QFO A;  4ELR A;  3UP9 A;  2G29 A;  5I56 A;  1N84 A;  5HPQ A;  1PB9 A;  4DIG A;  1OIB A;  3C4M A;  5HM4 B;  1B3L A;  4NMY A;  1CB6 A;  1MXW A;  5DVI A;  3B7D A;  4YKK A;  4OZ9 A;  3VLU A;  4ELP A;  2O68 A;  1XHY A;  4DXU A;  4U1O A;  1USY H;  3VE1 B;  4NF4 A;  3TEP A;  1NFT A;  3OEL A;  4LP2 B;  3TPA A;  1O7T A;  1RYO A;  3N5L A;  1B0L A;  3G3H A;  1JQF A;  1B1H A;  4JDF A;  4F3P A;  1MS7 A;  4OEN A;  4M4G A;  1WDN A;  2GFE A;  4QFP A;  3PMW A;  2O1M A;  4JSD A;  3KFM A;  2DWI A;  4YB5 A;  4KYS A;  2UYE A;  3RNN A;  4YKI A;  3K6W A;  1VE4 A;  4KHZ E;  1R9L A;  5AE4 A;  3KN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...