2VOZA

Apo futa2 from synechocystis pcc6803
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
313
structure length
313
Chain Sequence
RTINLYSSRHYNTDDALYDAFGEVNLIEASAEELIERIQSEGANSPGDILFTVDAGMLWRAEQAGLFQPVRSGKLNERIPENLRHPDGLWYGFTQRARVLYYSRDRVNPADLSTYEALADPQWRGKILVRPSSNVYNLSLTASRIAIHGEPETRRWLQGLVGNFARQPEGNDTAQIRAIAAGIGDVAIANSYYYIRLQKSTDPADQEVVEKVSLFFPNTGSGERGTHVNVSGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNEYPVIPGVPIDPVLAAHGQLKGDPLNVSNLGRYQPDSARLMNEVGWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PERIPLASMIC IRON-BINDING PROTEIN
publication title Futa2 is a Ferric Binding Protein from Synechocystis Pcc 6803.
pubmed doi rcsb
total genus 123
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vozA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vozA02
1M5EA 1QJMA 3K2DA 2DQVA 4FAJA 3KJTA 1P1QA 1Y20A 4GVOA 2H4IA 4RXLA 3Q25A 4R2BA 3M3KA 4FATA 3N94A 2Z8FA 1JETA 1OQGA 2XXHA 3G3JA 3FJMA 4RPNA 4PE5B 4AB6A 3W9WA 3V83A 3GLBA 1IITA 3S9LC 5ICQA 1LB8A 1MY1A 1FQEA 1LAGE 4TOZA 3TYHA 4ZEIA 2HZKA 1QUKA 4LATA 3JV9A 1PEBA 1OLCA 4KYDA 1B0HA 2DE4A 1PB8A 2XD2A 4PFTA 3FATA 4POWA 4LUBA 1TT1A 3PD9A 3U94A 3HPIA 5I2KB 3PUXE 5L8DA 3VLUA 3TTLA 2F35A 3VFJA 1MQIA 3BFTA 1R9QA 1BP5A 5K2XA 3MP6A 3U1OA 3IB2A 4KD5A 2F8DA 3OSQA 1DOTA 4H8IA 2REJA 1VE4A 3IB0A 3R7XA 1D3KA 3TMGA 5IAIA 3VXCA 1B5JA 2RC8A 2F97A 4QF9A 2YPNA 1XVXA 3TTNA 1FTJA 1F9BA 3PMWA 3M3LA 5K2YA 3TTKA 4FECA 1D4NA 5I56A 2H99A 2OWSA 2HAVA 4GL0A 1H43A 1IXCA 1B7UA 5M2VA 3TELA 1US5A 5CMBA 1SW4A 2UVGA 2DP8A 1MXZA 2XXUA 1FTKA 4NWCA 1ZKBA 3FJGA 4KCCA 5I59A 1JEVA 3OELA 3VVFA 4IO2A 3C36A 3MQ9A 5CMKA 3CIJA 3D4GA 1B2HA 4O3CA 3THIA 3N6TA 2QS4A 2HZLA 2DWAA 1PC3A 4OZ9A 4UA8A 4F39A 1Q1KA 1MDQA 5TP9A 3OMBA 4YICA 3DP4A 3N5LA 2DWJA 4R9FA 4R73A 4R9GA 1MY2A 4RA1A 3DP8A 3O28A 3KJ7A 3B6QA 3QXMA 1B05A 1LAHE 4H1XA 2HCAA 2I3WA 1URSA 4NF6B 2XXPA 4YKJA 3H6UA 4F2QA 2M8CA 3MUQA 1FQFA 3LSWA 4P0GA 1JQFA 5FHNA 2FNCA 2F34A 1USYH 2DYXA 1MH3A 5DVIA 2ABHA 3C34A 2V3TA 3TFLA 5DVJA 1P1OA 2R71A 4XKPA 3TTRA 2HEUA 4AB5A 4EQBA 3H4ZA 3U93A 5HM4B 1UIUA 4F1YA 3FD3A 3S9NC 2P0SA 2QMWA 4Z0IA 1P99A 3PPPA 3G3GA 3G3KA 3PU5A 4DLDA 4PFUA 1PBQA 3ZKKA 1JW5A 4RK2A 5JTYA 4C0RA 4QFLA 2CZLA 5EHMA 5AA4A 3IJXB 4EUOA 3UK4A 5ELVA 3H6WA 4IO3A 2PVUA 3IOTA 3K1MA 3RQTA 3CRBA 3C4MA 3M8UA 5H8FA 1UTHA 2CMOA 3WAFA 2QS1A 4DCYA 2XXQA 4ESXA 1MXUA 2XXYA 4U4XA 2Y7WA 4DXUA 5CBRA 3VVEA 2G29A 3KN8A 3S4UA 4DDDA 2RCAA 3LSLA 3MWBA 3K1NA 3PPNA 1MM7A 4TLLB 2I49A 5EHSA 1SVXB 3DM0A 3CI8A 5JEIA 1LLSA 3S9EA 1FTOA 5H8HB 2NWJA 3Q29A 1NKXA 4U4SA 1LAXA 1YAEA 4OFJA 4HTGA 2QL3A 4WEPA 1PB9A 4OEVA 1FQBA 5FTIA 1ZIUA 2ZYOA 1LSTA 1UTBA 4TQUQ 5AE4A 1LFGA 3ONMA 1ATGA 5FHMA 3FIRA 4LZ8A 4KR5A 1HSEA 3H3GA 2LAOA 4IGTA 1IUDA 4BDMA 4FEDA 1FTMA 1I6AA 3ECRA 1HSLA 2I48A 5TPAB 4I1DA 2XHDA 4G77A 2F7BA 5B70A 3LSXA 4Q30B 4E0XA 3G3HA 4M4GA 3MBPA 4R6HA 4QSEA 1N84A 1O64A 2ESNA 1BTJA 1RYXA 4KFQA 3GBAA 3KSJA 4QRZA 3K6WA 3BKIB 5LOMA 2DXYA 4H0WA 3I5OA 1GVCA 3OENA 2I0BA 3RGYA 3IOUA 1MXXA 4U2RA 3K01A 1N7XA 5FTHA 4N6PA 4OMBA 2OK2A 4EQ9A 4GRKA 3PPOA 2QS2A 3IB1A 3FVNA 3VVDA 1NL5A 3QIMA 3LBSA 1POY1 4HCYA 5DTBA 1XOCA 4RJZA 1B4ZA 1S9TA 3LR1A 1B32A 2DOJA 3H7MA 2BJJX 3G3IA 1YCJA 2QSXA 2UYEA 1POTA 4I9DA 4H65A 1MS7A 3KG2A 1MPBA 4DIGA 2F7CA 1S7YA 3UP9A 4HS7A 1XHYA 1QUIA 3U92A 1B3GA 3RTWB 1N7WA 1R1NA 3T66A 4LA9A 2VGQA 1HSJA 1LCFA 1MXYA 3KOTA 4LQ5A 5H8NA 4JBZA 4KCDA 3MPKA 5I57B 4F18A 1IXGA 1OQHA 3N26A 1LBBA 4EF2A 2GRVA 4RK9A 2XXRA 2WKYA 4BDQA 2A5TA 1B3EA 3RTFB 4YB5A 5I56B 3FVGA 4X1BA 2H25A 5ISUA 2NXOA 1B5IA 1DTGA 2DE2A 1S50A 1EZPA 3PPRA 4KPTA 1NH8A 2XD3A 2RCBA 4JSOA 4R75A 4FORA 4XXUA 2VD2A 4XKNA 2Q2CA 5DEXA 1P1WA 1GGGA 4DCXA 2B3FA 1URGA 1SW5A 3Q26A 4ELQA 1Y3QA 3VE1B 4TLMB 5I59B 2O7UA 1MQGA 2AL5A 3O9PA 5IKBA 4EF1A 3RY3A 3T93B 1II5A 1FQAA 4ZEFA 4OXVA 1LFHA 2Q89A 1BKAA 3SKPA 4NTLA 5AA2A 4OYVA 5TP9B 4YMBA 3CFZA 1DTZA 3EHTA 3KSXA 4ZEKA 1WODA 5CC2A 1DPEA 4ELRA 3TDJA 3IORA 1A55A 3PUVE 3BBRA 4K3FA 1H44A 4YU0A 3TUSA 5I84A 4RPOA 3CSBA 2F78A 4KI0E 3R26A 1DSNA 1CB6A 2RC9A 3UORA 4X9TA 4GOTA 1I69A 4OWDA 4PFWA 1MG1A 1LCTA 3SEYA 2O1LA 1WVJA 4YKIA 3CVGA 3EPEA 4MF3A 3CG3A 4MH5A 1B3HA 5BWJA 1B51A 3HO7A 3T9VA 1MQDA 4ZS9A 5B7DA 4HW8A 1Y4CA 4RYAA 3KBRA 4JWXA 5ICTA 2Y7RA 4G8NA 4XTCQ 3VDFA 4R72A 2FYIA 3C33A 1GR2A 2ONSA 1VSOA 3PMXA 5JTYB 3TCHA 4OESA 5AA4B 5JK4A 5FHOA 1MXVA 1MY0A 4JSDA 4PFYA 3JYRA 1B5HA 3QK6A 4YMAA 4ONYA 3DLNA 4IY6A 3KEIA 3A3UA 1YTVA 1LGBC 4LONB 4DE8A 5H8FB 2Z23A 2Y7PA 1UTHB 2P1SA 1MY3A 3TCGA 4ECFA 3V8XB 4RNSA 3UN6A 4OETA 3N6UA 3B6TA 5KCJB 2Q2AA 1SBPA 5J1DA 2G93A 3MVZA 3DELB 3FXQA 4F22A 4IY5A 4OERA 1WDNA 1NNPA 3O6IA 3L6GA 3IX1A 2UVHA 3KOSA 1J1NA 1ZBMA 5H8QA 3SDFA 5ITOA 2DVCA 1LFIA 3FV2A 3K6XA 4YKKA 2XXIA 4NF8A 2XX8A 1O7TA 4KYEA 1B7ZA 1H3DA 4DXBA 2I0CA 1Y3NA 3TAJA 1UTBB 2I4CA 4Z7EA 1UQWA 2O68A 4F29A 4NMYA 5BUUA 2THIA 1SYIA 2E0SA 1B1HA 3MC2A 3FXUA 3QYTA 4NEDA 2ZYNA 1ZLQA 3E9XA 1JVXA 4U1OA 2DE3A 3H06B 2VHAA 1I6BA 4H5FA 1H76A 4ESWA 1Y4TA 3MPLA 1NH7A 2DVZA 2X7PA 4BLAA 3O97A 3PUYE 2W7YA 4EDPA 3WAEA 1A54A 3TTMA 4IGRA 3C9HA 2V25A 2REGA 4JXIA 3FVKA 4OEUA 1MY4A 2VP1A 2UXAA 4QFKA 4R6YA 1GTKA 1JVYA 1SD3A 2R9JA 3HN0A 4H8JA 2GH9A 2XX9A 4YKPA 3C32A 3RT8A 4RY1A 4OTEA 4XKQA 4GIZA 3TQWA 2Q9TA 1L5TA 1B4HA 5HPQA 4WEDA 3IK6B 4WXJA 1XT8A 1P1UA 1ZU0A 4QSCA 4F31B 5I2NA 2X26A 3MZ1A 2VOZA 3OO7A 2IEEA 1ELJA 2OJTA 3CSGA 3TPAA 5H8NB 3G7WA 2PT2A 4G8HA 3T22A 3I3VA 3QSLA 4QHQA 1US4A 2QRYA 5A5XA 4R6KA 1TFDA 3EN3A 5ITPA 3IR1A 3K6UA 1A8EA 4HCWA 2A5TB 4F19A 3MZ9A 2I58A 1PB7A 2HAUA 3SEVA 3E13X 1MXWA 3U72A 4NWDA 4QSDA 2F6PA 2XXTA 2KLFA 2V3UA 4GD5A 4EXLA 1MQJA 4ZZEA 3USDA 1D9VA 3MVXA 4KHZE 1AIVA 1AH5A 1YPNA 3KN3A 1USYE 1BIYA 2F5XA 3MJNA 4XIGQ 1IXHA 3A09A 1B58A 4ZE9A 4LZ5A 4Q0CA 4JWOA 3V89B 2I3VA 5AA2B 3QUJA 1OIBA 4G68A 1H45A 1NNFA 2AYSA 5H8SA 3IAZA 1VFDA 2OBGA 4JDFA 2QMXA 1AL3A 3R6UA 3S9MC 1BLFA 2Z8DA 1M5FA 2FA7A 1PDAA 1SYHA 4BDOA 1KWHA 4QFNA 3TCFA 2E1SA 2XXWA 5F1QA 2O6AA 1MDP1 2HQ0A 2X7QA 1URDA 2R6GE 3ILUB 1P1NA 2V3QA 5EYFA 2H5YA 1Q35A 4G8MA 3ZS6A 4MFIA 1N3WA 1VR5A 3OSRA 1SW2A 1MM6A 1TFAA 1OLAA 1QULA 4C1UA 1DMBA 1IIWA 1CE2A 2YLNA 3ODBA 1A8FA 4U22A 5DVFA 4OQOA 1MPDA 4O3BA 2ALUA 4Q8RA 4Q5TA 4NF4A 4F3BA 4FE8A 3L6HA 2XXXA 3T9UA 1LAFE 4R2FA 5F7VA 4GF8A 1R6ZA 1RYOA 5AA3A 4LZ7A 3MVWA 1JNFA 2AL4A 1O63A 3GBBA 2DXRA 2QPQA 3U8QA 1Y3PA 3T96B 4GWOA 3SEUA 3V5AA 4BDLA 3MAMA 5CBSA 4ISUA 2F36A 1A40A 1QVSA 4NF5A 2NVUB 1IZ1A 3HHGA 2V84A 4DXCA 4H6DA 2RF1A 1M5CA 3O6HA 1A7LA 2F7AA 5H8QB 3K4UA 5CRYA 3PGFA 2ONKE 1LBCA 1N04A 4PQJA 4F1VA 4XKRA 4F3PA 1QKBA 4PP0A 4NF8B 3UIFA 3IOVA 1XS5A 2AIXA 2DWHA 2B65A 4G2ZA 3LC8A 5KDTA 3EF7A 3E4RA 2XXVA 2D21A 1Z7ME 4FJPA 3FUZA 1LB9A 1TWYA 4G68C 1MPCA 4YB7A 3A3CA 2NOOA 1EU8A 4KQPA 2HFBA 4ZE8A 2A5SA 3H6TA 4OVJA 1B0LA 4GL8A 5L9MA 2RINA 2ZYKA 1MRPA 2OWTA 4O3AA 4X48A 2ZNUA 2PBWA 3CFXA 4LP2B 3K02A 1Y9UA 5I57A 4UACA 2UYFA 3HSTA 4L17A 4GFRA 4ELPA 1ZTYA 3RPWA 3OOAA 3IOWA 2I6EA 4PETA 1VFEA 4IO5A 5CI5A 2PT1A 3C31A 3PPQA 1B52A 4NE4A 1NNKA 4IO7A 1B9JA 1XVYA 3OO8A 1RKMA 1B1XA 3FGSA 5L9SA 4AQ4A 3C35A 5AA2D 5I58A 3MVYA 4E0WA 3MP1A 4BDRA 1JEUA 3BFUA 1FQCA 3RT6B 3K0VA 3EQ1A 1SI1A 3MP8A 2Y84A 2P2AA 2RKMA 1OMPA 2ZMBA 4MLVA 3ILTB 2O1MA 3MZBA 2H9BA 5TU0A 5I2NB 1QUJA 1SW1A 3F11A 3W15C 2OCUA 3ZSFA 1ANFA 4GXAA 2ZNTA 3KZGA 5AA1A 3UGWA 2O69A 3DP6A 3OEKA 4P11A 4YB6A 3CG1A 5A5XB 4OFOA 3H03A 2OLBA 4GXSB 4IO6A 3OO9A 2F6GA 1SI0A 2D5WA 3O2AA 1NNTA 5I2KA 3W9VA 3SEXA 3I6VA 3LSFB 1XC1A 3IO6A 5DT6A 4C1TA 4ZDMA 1FW0A 2I4BA 3T9XB 2ZYMA 4X1DA 3S2VA 4EXKA 3IL1B 1QKAA 1T0KA 2O51A 3SERA 4OENA 1FTLA 3M3FA 3ZKLA 4QFPA 4JB7A 2ZNSA 3D4CA 4DZ1A 3EHUA 2PYYA 3FVOA 3MW0A 4G4PA 3RLFE 4F3SA 3PD8A 3HCQA 2DWIA 1B40A 4G68B 1B3LA 3TODA 1NMUA 4P0IA 1D9YA 4QFOA 3PUZE 1I6QA 3KN7A 4YZZA 1B3FA 3O6GA 5HBCA 2DSFA 4LVQA 2PMSA 3OEMA 3OD7A 1EZ9A 2V93A 4U21A 1UIVA 3K1PA 5KCJA 4YAHX 4EQ7A 2PX1A 1JW1A 2GHBA 2ZXTA 3AXFA 2HXWA 2ANJA 2Y7KA 4IO4A 4GQOA 4MLQA 3TKDA 3CR9A 2Q8JA 3Q27A 2ONRA 3G3FA 5L9OA 3QUFA 2DS9A 4NF6A 3SEWA 4ZEDA 3RN8A 2YJPA 1ZJLA 1OVBA 1SQYA 3FV1A 3KFMA 1GV8A 1N76A 3VLVA 3KGCA 4MBPA 1AMFA 2Z22A 5DEXB 4NF4B 4U23A 2Y7IA 3JZJA 3VXBA 3TEPA 2O7IA 1M5DA 1DPPA 2GFEA 3TQLA 1NFTA 3CFLA 3OO6A 2GHAA 3O29A 4POXA 4ELOA 4OHNA 3VLWA 3UA8A 3PUWE 1N3XA 3FXRA 1IEJA 4F3GA 1MQHA 2XX7A 4R74A 4ZZAA 3PMVA 2O84X 4NF5B 1FCKA 1B7HA 4ZECA 3GXAA 4WKMA 1SDXA 1N0TA 4KYSA 2VD3A 2RC7A 2Q88A 3K00A 4ZEBA 1Y1MA 4N13A 3E3KA 3T9HB 3B7DA 3VV5A 3QAXA 1B6HA 3K6VA 1A99A 2D3IA 1B46A 5KDTB 3LUYA 1QW0A 1OVTA 2QJEA 2UVJA 3H6VA 3PV0E 1IXIA 3HHFA 4JWYA 2QS3A 1EZOA 3FJ7A 3HV1A 4ND9A 4OFLA 5H8HA 3SESA 1AOVA 4N07A 3IO4A 4I62A 4GLIA 3RNNA 2Z8EA 1EH3A 3FASA 3TZAA 4FIMA 4M1VA 1PBPA 3IJOB 3Q28A 4U1ZA 5CMMA 1JW4A 1Z7NE 5KZTA 3B6WA 3OXNA 5CMCA 4IB2A 1Y1ZA 3GZGA 3P7IA 4H5GA 5CM6A 3EHSA 2NUVA 2UVIA 5TPAA 3RUMA 4FEBA 4F1UA 1R9LA 1ZMGA 3O66A 4BDNA 4F2OA 2H98A 4LQ2A 3FZVA 3SETA 4THIA 1TXFA 2B3BA 1MH4A 5DYHA 2IA4A 1IQ7A 5I58B 1FQDA 4H67A 4I8CA 1M5BA 2OZZA
chains in the Genus database with same CATH superfamily
1M5EA 1QJMA 3K2DA 2DQVA 1IMEA 4FAJA 3KJTA 1P1QA 1Y20A 4GVOA 2H4IA 4RXLA 4PDHA 3Q25A 4MAGA 3M3KA 4R2BA 4FATA 3QMFA 3N94A 4PTKA 2Z8FA 1JETA 3T1BA 1OQGA 2XXHA 4P56A 3G3JA 3FJMA 4RPNA 4PE5B 4AB6A 3W9WA 3V83A 3GLBA 1IITA 4I3YA 3S9LC 3IFCA 3GYYA 5ICQA 1LB8A 1MY1A 1FQEA 1LAGE 4TOZA 3TYHA 4ZEIA 2HZKA 1QUKA 4LATA 3JV9A 1PEBA 1OLCA 4KYDA 1B0HA 2DE4A 1PB8A 2XD2A 4PFTA 1IMDA 3FATA 4POWA 4LUBA 1TT1A 1IMBA 3PD9A 3U94A 3HPIA 5I2KB 3PUXE 5L8DA 3BIGA 3VLUA 3TTLA 4GWYA 2F35A 3VFJA 1MQIA 3BFTA 1R9QA 1BP5A 5K2XA 3MP6A 3U1OA 3IB2A 4N8YA 4KD5A 2F8DA 3OSQA 1DOTA 4H8IA 2REJA 1VE4A 3IB0A 3R7XA 1D3KA 3TMGA 4P8BA 5IAIA 3VXCA 1B5JA 2RC8A 2F97A 4QF9A 2YPNA 1XVXA 3TTNA 1FTJA 4O7MA 4PCDA 1F9BA 3PMWA 3M3LA 5K2YA 3TTKA 4FECA 1D4NA 5I56A 2H99A 2OWSA 5EQ9A 2HAVA 4GL0A 1H43A 1IXCA 1B7UA 4XFEA 5M2VA 3TELA 1FPIA 1US5A 5CMBA 1SW4A 2UVGA 2DP8A 2XWVA 4IR8A 1MXZA 2XXUA 4GWZA 1FTKA 4NWCA 1ZKBA 1LBYA 3FJGA 4KCCA 5I59A 1JEVA 3OELA 2MKZA 3VVFA 4IO2A 3C36A 3MQ9A 5CMKA 3CIJA 3D4GA 1B2HA 4O3CA 3THIA 1NV0A 3N6TA 2QS4A 2HZLA 2DWAA 1EYJA 1PC3A 4OZ9A 4UA8A 5EQAA 2FBPA 4F39A 1Q1KA 2QVUA 1MDQA 5ET7A 4O8MA 5TP9A 3OMBA 4YICA 3DP4A 3N5LA 2DWJA 4R9FA 4R73A 4R9GA 1MY2A 4RA1A 3DP8A 3O28A 3KJ7A 3RPLA 3B6QA 3QXMA 1B05A 1LAHE 4H1XA 2HCAA 2I3WA 1URSA 4NF6B 2XXPA 4YKJA 3H6UA 4F2QA 2M8CA 2FIXA 3MUQA 1FQFA 3LSWA 4P0GA 1JQFA 2DDKA 5FHNA 2WEFA 2FNCA 2F34A 1USYH 2DYXA 1MH3A 5DVIA 2ABHA 3KBZA 4GX3A 4JVDA 4N81A 3C34A 2V3TA 3TFLA 2CZKA 5DVJA 1P1OA 3T0JA 2R71A 3E79A 4XKPA 3TTRA 2HEUA 4AB5A 4EQBA 3H4ZA 3U93A 5HM4B 1UIUA 4F1YA 3FD3A 3S9NC 2P0SA 2QMWA 4Z0IA 1P99A 3PPPA 3G3GA 1RDYA 3G3KA 3PU5A 2B4LA 4DLDA 4PFUA 1PBQA 3ZKKA 1JW5A 4RK2A 5JTYA 4C0RA 4QFLA 2CZLA 5EHMA 4OVPA 5AA4A 3IJXB 4EUOA 3UK4A 5ELVA 3H6WA 4IO3A 2PVUA 4I3EA 3IOTA 3K1MA 3RQTA 3CRBA 3C4MA 3M8UA 5H8FA 1UTHA 2CMOA 4PFBA 2HPGA 3WAFA 2QS1A 4DCYA 2XXQA 4OA4A 4ESXA 1MXUA 2XXYA 4U4XA 2Y7WA 4DXUA 5CBRA 3VVEA 2G29A 3KN8A 3S4UA 4DDDA 2RCAA 3LSLA 3MWBA 3K1NA 3PPNA 1NV7A 1MM7A 4TLLB 2I49A 5EHSA 1SVXB 3DM0A 3CI8A 5JEIA 1LLSA 3S9EA 1FTOA 5H8HB 4N17A 1LBXA 2NWJA 4HE1A 3Q29A 1NKXA 4U4SA 1LAXA 1YAEA 4OFJA 4HTGA 2QL3A 4I40A 4WEPA 1PB9A 4OEVA 1FQBA 5FTIA 1ZIUA 2HHMA 2ZYOA 1LSTA 1UTBA 4PBHA 4TQUQ 5AE4A 1LFGA 3ONMA 1ATGA 5FHMA 3FIRA 4LZ8A 3KC0A 4KR5A 1HSEA 3H3GA 2LAOA 4IGTA 1IUDA 4BDMA 4P3LA 4FEDA 1FTMA 4GBVA 1I6AA 3ECRA 1HSLA 2I48A 5TPAB 4I1DA 2XHDA 4G77A 2F7BA 5B70A 3LSXA 4Q30B 1IMCA 4E0XA 3G3HA 4X04A 3PTYA 4M4GA 3MBPA 4P1LA 1FBPA 4R6HA 4QSEA 1N84A 3FXBA 1O64A 2ESNA 1BTJA 1RYXA 4KFQA 3GBAA 3KSJA 4QRZA 1G0HA 3K6WA 3BKIB 1EYKA 5LOMA 2DXYA 4H0WA 3I5OA 1GVCA 1FTAA 3OENA 3ROJA 3EKIA 2L5VA 2I0BA 3RGYA 3IOUA 1MXXA 4U2RA 3K01A 1N7XA 5FTHA 4N6PA 4OMBA 2OK2A 4EQ9A 5I3SA 4GRKA 3PPOA 2QS2A 3IB1A 3FVNA 3VVDA 1NL5A 3QIMA 4MJOA 3LBSA 1POY1 4HCYA 5DTBA 1XOCA 1FPDA 4RJZA 1B4ZA 1S9TA 3LR1A 1B32A 2DOJA 3H7MA 2FHYA 2BJJX 3G3IA 1YCJA 2QSXA 2Y5KA 2WYPA 2UYEA 1POTA 1EYIA 4I9DA 2QVVA 4H65A 1MS7A 4PF6A 4PDDA 3KG2A 1MPBA 4DIGA 2F7CA 1S7YA 3UP9A 4HS7A 1XHYA 1QUIA 3U92A 1B3GA 3RTWB 1N7WA 2V4CA 1R1NA 2VPNA 3T66A 4LA9A 2VGQA 1HSJA 1LCFA 1MXYA 3KOTA 4LQ5A 5H8NA 4JBZA 4KCDA 3MPKA 5I57B 4F18A 1IXGA 1OQHA 3N26A 1LBBA 4EF2A 2GRVA 4RK9A 2XXRA 5IGAA 5LTCA 2WKYA 4BDQA 5ET8A 2A5TA 1B3EA 3RTFB 4YB5A 5I56B 3FVGA 4GWUA 4X1BA 5FBPA 2H25A 5ISUA 2NXOA 1B5IA 1DTGA 4NX1A 2DE2A 1S50A 1EZPA 3PPRA 4KPTA 1NH8A 2XD3A 2RCBA 4JSOA 4R75A 4N8GA 4FORA 4XXUA 2VD2A 4XKNA 2Q2CA 5DEXA 1P1WA 1GGGA 4DCXA 2B3FA 1URGA 1SW5A 3Q26A 4ELQA 1Y3QA 2CEXA 3VE1B 2PCRA 4TLMB 5I59B 2O7UA 4NHBA 1MQGA 3HFUA 2AL5A 3O9PA 5IKBA 4EF1A 2CEYA 3RY3A 3T93B 1II5A 2XXKA 1FQAA 4ZEFA 4OXVA 1LFHA 5EQ8A 2Q89A 1BKAA 4PGPA 3SKPA 4NTLA 5AA2A 4OYVA 1KA0A 5TP9B 4YMBA 3CFZA 1DTZA 3EHTA 3KSXA 4ZEKA 2P3NA 1WODA 5CC2A 1DPEA 4ELRA 3TDJA 3IORA 4OVSA 4NGUA 1A55A 3RPLB 3MSTA 3PUVE 4JVCA 3BBRA 4K3FA 1H44A 4YU0A 3TUSA 5I84A 4RPOA 3CSBA 1NV5A 2F78A 4KI0E 5IZ1A 3R26A 1DSNA 1CB6A 2RC9A 3UORA 4X9TA 4GOTA 5I5PA 1I69A 4OWDA 4PFWA 1MG1A 4DI3D 1LCTA 3SEYA 2O1LA 1NV4A 1WVJA 4YKIA 1NUYA 3CVGA 3EPEA 1VDWA 4MF3A 3CG3A 4MH5A 1B3HA 2CZHA 5BWJA 1B51A 1FPBA 3HO7A 1NV6A 3T9VA 1MQDA 4ZS9A 5B7DA 4HW8A 4X8RA 1Y4CA 4RYAA 3KBRA 2XA5A 4JWXA 5ICTA 2Y7RA 4G8NA 4XTCQ 3VDFA 4R72A 2FYIA 3C33A 1GR2A 2ONSA 1VSOA 3PMXA 5JTYB 3TCHA 4OESA 5AA4B 5JK4A 5FHOA 1MXVA 1MY0A 4JSDA 4PFYA 3JYRA 1B5HA 3QK6A 4YMAA 4ONYA 3DLNA 4IY6A 3KEIA 3A3UA 1YTVA 1LGBC 4LONB 4DE8A 5H8FB 2Z23A 2Y7PA 1UTHB 2VT5A 2P1SA 1MY3A 3TCGA 4ECFA 3V8XB 4RNSA 3RYDA 3UN6A 4OETA 3N6UA 3B6TA 5KCJB 2P3VA 2Q2AA 1SBPA 5J1DA 2G93A 3MVZA 3DELB 5DW8A 3FXQA 4F22A 4GWXA 4IY5A 4OERA 1CNQA 1WDNA 3CHGA 1NNPA 3O6IA 3L6GA 3IX1A 2UVHA 3KOSA 1J1NA 1ZBMA 5H8QA 3SDFA 5ITOA 2DVCA 1LFIA 3FV2A 3K6XA 4YKKA 1AWBA 2XXIA 4OVTA 4MMPA 4NF8A 1NUXA 2XX8A 1O7TA 4KYEA 1B7ZA 2FVZA 1H3DA 4DXBA 2I0CA 1Y3NA 3TAJA 5ESYA 2VPOA 1UTBB 2I4CA 4Z7EA 1UQWA 2O68A 2OX3A 4F29A 4NMYA 5BUUA 2THIA 1SYIA 2E0SA 1B1HA 3MC2A 3FXUA 3QYTA 1NV1A 4NEDA 2ZYNA 1ZLQA 3E9XA 4GWSA 1JVXA 4U1OA 2DE3A 4MHFA 4MNIA 3H06B 2VHAA 1I6BA 1D9QA 4H5FA 1H76A 4ESWA 4OANA 1Y4TA 3MPLA 1NH7A 2DVZA 2X7PA 4BLAA 3O97A 3PUYE 2W7YA 1JP4A 4EDPA 3WAEA 1A54A 1NUWA 3TTMA 2WX9A 4IGRA 3NOHA 3C9HA 3D1RA 2V25A 1KA1A 2REGA 4JXIA 3FVKA 4OEUA 4LN5A 1MY4A 2VP1A 2UXAA 4QFKA 2ZZXA 4N91A 4R6YA 1GTKA 5ET5A 1JVYA 1SD3A 2R9JA 3BIHA 3HN0A 4H8JA 2GH9A 2XX9A 4YKPA 3C32A 4PAFA 3RT8A 3SZPA 4RY1A 4OTEA 4XKQA 4GIZA 3TQWA 2Q9TA 3E78A 1L5TA 1B4HA 5HPQA 4WEDA 3IK6B 4WXJA 2WBDA 1XT8A 1NV3A 1P1UA 1ZU0A 4QSCA 3KC1A 4F31B 5I2NA 2X26A 3IFAA 3MZ1A 2VOZA 3OO7A 4GX4A 2IEEA 1ELJA 2OJTA 3CSGA 1FJ9A 3TPAA 5H8NB 3G7WA 2PT2A 4G8HA 3T22A 3I3VA 3QSLA 2WBBA 4QHQA 1US4A 2QRYA 5A5XA 4R6KA 1TFDA 3EN3A 5ITPA 3IR1A 3K6UA 1A8EA 4HCWA 2A5TB 4F19A 3MZ9A 4NAPA 2I58A 1PB7A 2HAUA 2FIEA 3SEVA 3E13X 1MXWA 3U72A 4NWDA 4QSDA 2F6PA 2XXTA 4P9KA 2KLFA 2PFYA 3B8BA 2XWKA 2V3UA 4GD5A 4EXLA 1MQJA 4ZZEA 3USDA 1D9VA 3MVXA 4KHZE 4MEVA 1AIVA 2KQZA 1AH5A 1YPNA 3KN3A 1USYE 1BIYA 2F5XA 3MJNA 4XIGQ 1IXHA 3A09A 1B58A 4ZE9A 4LZ5A 1FBEA 4Q0CA 4JWOA 3V89B 4MX6A 2I3VA 4XF5A 5AA2B 3QUJA 1OIBA 4P47A 2ZZVA 4G68A 1H45A 4NG7A 1NNFA 2AYSA 5H8SA 3IAZA 1VFDA 2OBGA 4JDFA 3A29A 2QMXA 1NI9A 1AL3A 3R6UA 4N15A 5T3JA 3S9MC 1BLFA 1KZ8A 3FBPA 2Z8DA 1M5FA 2FA7A 1PDAA 1FBGA 1SYHA 4BDOA 1KWHA 4QFNA 3TCFA 1Q9DA 2E1SA 2XXWA 5F1QA 2O6AA 5J16A 1MDP1 4HE0A 2HQ0A 2X7QA 1URDA 2R6GE 3ILUB 1P1NA 2V3QA 5EYFA 2H5YA 1Q35A 4G8MA 3ZS6A 4MFIA 2OWZA 1N3WA 1VR5A 2QVRA 3OSRA 2GQ1A 1SW2A 1FBCA 1MM6A 1TFAA 1OLAA 4MIJA 4QBAA 2HXRA 1QULA 4C1UA 1DMBA 1IIWA 1CE2A 2YLNA 3ODBA 1A8FA 4MNCA 4U22A 5DVFA 4OQOA 1MPDA 4O3BA 1QGXA 2ALUA 4Q8RA 4Q5TA 4NF4A 4F3BA 2Q74A 4FE8A 3L6HA 2R8TA 2XXXA 2Q8MA 3T9UA 1LAFE 4R2FA 5F7VA 4GF8A 1R6ZA 1RYOA 4PAIA 5AA3A 4LZ7A 3MVWA 1JNFA 2AL4A 1O63A 3GBBA 2DXRA 2QPQA 3U8QA 1Y3PA 1RDZA 3T96B 4GWOA 3SEUA 3V5AA 4BDLA 3MAMA 5CBSA 1SPIA 4ISUA 2F36A 1A40A 5EQ7A 1QVSA 4NF5A 2NVUB 1IZ1A 3HHGA 2V84A 4DXCA 4H6DA 2RF1A 1M5CA 3O6HA 1A7LA 2F7AA 5H8QB 4GBWA 3K4UA 5CRYA 3PGFA 2ONKE 1LBCA 1N04A 5IZ3A 4PQJA 4F1VA 4XKRA 4F3PA 1QKBA 1G0IA 4PP0A 4NF8B 3UIFA 3IOVA 1XS5A 2AIXA 2DWHA 5LDZA 2B65A 4G2ZA 3LC8A 4GWWA 4PE3A 5F24A 4DI4B 5KDTA 3EF7A 3E4RA 2XXVA 4PAKA 5EYHA 1FPKA 2D21A 1Z7ME 4FJPA 1FPEA 3FUZA 5IZZA 1LB9A 1TWYA 4G68C 1MPCA 4YB7A 3A3CA 2NOOA 1BK4A 1FPGA 1EU8A 4KQPA 2HFBA 4ZE8A 2A5SA 3H6TA 4OVJA 1B0LA 4HE2A 4GL8A 4PFRA 5L9MA 1LEVA 2RINA 4OVQA 4NN3A 2ZYKA 1MRPA 1XI6A 2OWTA 4O3AA 4X48A 2ZNUA 2PBWA 3CFXA 4LP2B 3K02A 1Y9UA 1YYZA 5I57A 2Y5LA 4JVIA 4UACA 2F3BA 2UYFA 1LBWA 3HSTA 1FBDA 4L17A 4GFRA 2KR0A 4ELPA 1ZTYA 4OVRA 4GX6A 3RPWA 3OOAA 3IOWA 2I6EA 3LUZA 4PETA 4PGNA 1VFEA 4IO5A 5CI5A 2PT1A 3C31A 3PPQA 1B52A 4NE4A 1NNKA 4IO7A 1B9JA 1XVYA 3OO8A 1RKMA 1B1XA 3FGSA 5L9SA 4AQ4A 3C35A 5AA2D 5I58A 3MVYA 4E0WA 3MP1A 4BDRA 1JEUA 3BFUA 1FQCA 3RT6B 3K0VA 4MCOA 3EQ1A 1SI1A 3MP8A 2Y84A 2P2AA 2RKMA 1OMPA 2ZMBA 4MLVA 3ILTB 1IMAA 2O1MA 3MZBA 2H9BA 1YZ0A 4O7IA 5TU0A 5I2NB 1QUJA 1SW1A 4UABA 4AS5A 3F11A 3W15C 3ISPA 2OCUA 3ZSFA 1ANFA 4GXAA 2ZNTA 3KZGA 5AA1A 3UGWA 2O69A 3DP6A 3OEKA 4P11A 4YB6A 1FSAA 3CG1A 5I7IA 1FBFA 5A5XB 4OFOA 1INPA 3H03A 2OLBA 4GXSB 2ZZWA 4IO6A 3OO9A 2F6GA 1SI0A 2D5WA 4AS4A 3O2AA 1IMFA 1NNTA 5I2KA 3W9VA 3MYUA 3SEXA 2WYKA 3I6VA 3LSFB 1XC1A 2XWIA 3IO6A 4P1EA 5DT6A 4C1TA 4ZDMA 1FW0A 2I4BA 3T9XB 2ZYMA 4X1DA 3S2VA 4EXKA 3IL1B 1QKAA 1T0KA 2O51A 3SERA 4OENA 1FTLA 3M3FA 3ZKLA 4QFPA 4JB7A 2ZNSA 3D4CA 2JJKA 3B50A 4MNPA 4DZ1A 3EHUA 2PYYA 3FVOA 3MW0A 4G4PA 3RLFE 4F3SA 3PD8A 3HCQA 2DWIA 1B40A 4G68B 1B3LA 3TODA 1NMUA 4P0IA 1D9YA 4QFOA 3PUZE 1I6QA 3KN7A 4PBQA 1B3FA 4YZZA 3O6GA 5HBCA 2DSFA 4LVQA 2PMSA 3OEMA 3OD7A 5ET6A 1EZ9A 2V93A 4U21A 1UIVA 3K1PA 5KCJA 4YAHX 4EQ7A 2PX1A 4FBPA 1JW1A 1LBVA 2GHBA 2ZXTA 3AXFA 2HXWA 2ANJA 2Y7KA 4IO4A 5IM2A 1RDXA 4GQOA 4NF0A 2CZIA 4MLQA 3TKDA 3CR9A 2Q8JA 3Q27A 2ONRA 3G3FA 5L9OA 3QUFA 1K9ZA 5A5LA 2DS9A 4NF6A 3SEWA 4ZEDA 1NV2A 4N6KA 3RN8A 2PFZA 2YJPA 1ZJLA 1OVBA 1SQYA 3FV1A 3KFMA 1GV8A 1N76A 4NQ8A 3VLVA 3KGCA 4MBPA 1AMFA 2Z22A 5DEXB 4NF4B 4U23A 2Y7IA 3JZJA 3VXBA 3U65A 2F3DA 3TEPA 2O7IA 1M5DA 5EYGA 1DPPA 2GFEA 3TQLA 1NFTA 3CFLA 1K9YA 3OO6A 2GHAA 3O29A 4POXA 4ELOA 4OHNA 3VLWA 3UA8A 3PUWE 1N3XA 3FXRA 1IEJA 4F3GA 1MQHA 2XX7A 4R74A 4ZZAA 3PMVA 2O84X 4NF5B 1FCKA 1B7HA 4ZECA 3GXAA 4WKMA 1SDXA 1N0TA 4KYSA 2VD3A 2RC7A 4O94A 2Q88A 1LBZA 5IZ3B 3K00A 4QXDA 4ZEBA 1Y1MA 4N13A 4PFIA 3E3KA 3T9HB 2B4MA 3B7DA 3VV5A 1YXIA 3QAXA 1B6HA 4XEQA 3K6VA 1A99A 2D3IA 1B46A 5KDTB 3LUYA 1QW0A 1FPJA 1OVTA 2QJEA 2UVJA 3H6VA 3PV0E 1IXIA 3HHFA 1DBZA 4JWYA 1NUZA 2QFLA 2QS3A 1EZOA 3FJ7A 3HV1A 4ND9A 4OFLA 5H8HA 3SESA 1AOVA 4N07A 3LV0A 4PC9A 4HXVA 3IO4A 4I62A 4KXPA 4GLIA 3RNNA 2Z8EA 1EH3A 3FASA 3TZAA 2XWOA 4FIMA 4M1VA 1PBPA 1DCUA 4G61A 3IJOB 3Q28A 4U1ZA 5CMMA 1JW4A 1Z7NE 5KZTA 3B6WA 3OXNA 1FRPA 4N4UA 1FPLA 5CMCA 4IB2A 1FPFA 4H46A 1Y1ZA 3GZGA 3P7IA 4H5GA 4PF8A 5CM6A 3EHSA 2NUVA 2UVIA 5TPAA 3RUMA 4H45A 4FEBA 4F1UA 1R9LA 1ZMGA 3O66A 4BDNA 4F2OA 2H98A 4LQ2A 3FZVA 3SETA 4THIA 1TXFA 2B3BA 1MH4A 1DK4A 4N6DA 5DYHA 2IA4A 1IQ7A 1FBHA 2BJIA 5I58B 1FQDA 4H67A 1FJ6A 4I8CA 1M5BA 2OZZA
chains in the Genus database with same CATH topology
1M5EA 1QJMA 3K2DA 2DQVA 4FAJA 3KJTA 1P1QA 1Y20A 4GVOA 2H4IA 4RXLA 3Q25A 4R2BA 3M3KA 4FATA 3N94A 2Z8FA 1JETA 1OQGA 2XXHA 3G3JA 3FJMA 4RPNA 4PE5B 4AB6A 3W9WA 3V83A 3GLBA 1IITA 3S9LC 5ICQA 1LB8A 1MY1A 1FQEA 1LAGE 4TOZA 3TYHA 4ZEIA 2HZKA 1QUKA 4LATA 3JV9A 1PEBA 1OLCA 4KYDA 1B0HA 2DE4A 1PB8A 2XD2A 4PFTA 3FATA 4POWA 4LUBA 1TT1A 3PD9A 3U94A 3HPIA 5I2KB 3PUXE 5L8DA 3VLUA 3TTLA 2F35A 3VFJA 1MQIA 3BFTA 1R9QA 1BP5A 5K2XA 3MP6A 3U1OA 3IB2A 4KD5A 2F8DA 3OSQA 1DOTA 4H8IA 2REJA 1VE4A 3IB0A 3R7XA 1D3KA 3TMGA 5IAIA 3VXCA 1B5JA 2RC8A 2F97A 4QF9A 2YPNA 1XVXA 3TTNA 1FTJA 1F9BA 3PMWA 3M3LA 5K2YA 3TTKA 4FECA 1D4NA 5I56A 2H99A 2OWSA 2HAVA 4GL0A 1H43A 1IXCA 1B7UA 5M2VA 3TELA 1US5A 5CMBA 1SW4A 2UVGA 2DP8A 1MXZA 2XXUA 1FTKA 4NWCA 1ZKBA 3FJGA 4KCCA 5I59A 1JEVA 3OELA 3VVFA 4IO2A 3C36A 3MQ9A 5CMKA 3CIJA 3D4GA 1B2HA 4O3CA 3THIA 3N6TA 2QS4A 2HZLA 2DWAA 1PC3A 4OZ9A 4UA8A 4F39A 1Q1KA 1MDQA 5TP9A 3OMBA 4YICA 3DP4A 3N5LA 2DWJA 4R9FA 4R73A 4R9GA 1MY2A 4RA1A 3DP8A 3O28A 3KJ7A 3B6QA 3QXMA 1B05A 1LAHE 4H1XA 2HCAA 2I3WA 1URSA 4NF6B 2XXPA 4YKJA 3H6UA 4F2QA 2M8CA 3MUQA 1FQFA 3LSWA 4P0GA 1JQFA 5FHNA 2FNCA 2F34A 1USYH 2DYXA 1MH3A 5DVIA 2ABHA 3C34A 2V3TA 3TFLA 5DVJA 1P1OA 2R71A 4XKPA 3TTRA 2HEUA 4AB5A 4EQBA 3H4ZA 3U93A 5HM4B 1UIUA 4F1YA 3FD3A 3S9NC 2P0SA 2QMWA 4Z0IA 1P99A 3PPPA 3G3GA 3G3KA 3PU5A 4DLDA 4PFUA 1PBQA 3ZKKA 1JW5A 4RK2A 5JTYA 4C0RA 4QFLA 2CZLA 5EHMA 5AA4A 3IJXB 4EUOA 3UK4A 5ELVA 3H6WA 4IO3A 2PVUA 3IOTA 3K1MA 3RQTA 3CRBA 3C4MA 3M8UA 5H8FA 1UTHA 2CMOA 3WAFA 2QS1A 4DCYA 2XXQA 4ESXA 1MXUA 2XXYA 4U4XA 2Y7WA 4DXUA 5CBRA 3VVEA 2G29A 3KN8A 3S4UA 4DDDA 2RCAA 3LSLA 3MWBA 3K1NA 3PPNA 1MM7A 4TLLB 2I49A 5EHSA 1SVXB 3DM0A 3CI8A 5JEIA 1LLSA 3S9EA 1FTOA 5H8HB 2NWJA 3Q29A 1NKXA 4U4SA 1LAXA 1YAEA 4OFJA 4HTGA 2QL3A 4WEPA 1PB9A 4OEVA 1FQBA 5FTIA 1ZIUA 2ZYOA 1LSTA 1UTBA 4TQUQ 5AE4A 1LFGA 3ONMA 1ATGA 5FHMA 3FIRA 4LZ8A 4KR5A 1HSEA 3H3GA 2LAOA 4IGTA 1IUDA 4BDMA 4FEDA 1FTMA 1I6AA 3ECRA 1HSLA 2I48A 5TPAB 4I1DA 2XHDA 4G77A 2F7BA 5B70A 3LSXA 4Q30B 4E0XA 3G3HA 4M4GA 3MBPA 4R6HA 4QSEA 1N84A 1O64A 2ESNA 1BTJA 1RYXA 4KFQA 3GBAA 3KSJA 4QRZA 3K6WA 3BKIB 5LOMA 2DXYA 4H0WA 3I5OA 1GVCA 3OENA 2I0BA 3RGYA 3IOUA 1MXXA 4U2RA 3K01A 1N7XA 5FTHA 4N6PA 4OMBA 2OK2A 4EQ9A 4GRKA 3PPOA 2QS2A 3IB1A 3FVNA 3VVDA 1NL5A 3QIMA 3LBSA 1POY1 4HCYA 5DTBA 1XOCA 4RJZA 1B4ZA 1S9TA 3LR1A 1B32A 2DOJA 3H7MA 2BJJX 3G3IA 1YCJA 2QSXA 2UYEA 1POTA 4I9DA 4H65A 1MS7A 3KG2A 1MPBA 4DIGA 2F7CA 1S7YA 3UP9A 4HS7A 1XHYA 1QUIA 3U92A 1B3GA 3RTWB 1N7WA 1R1NA 3T66A 4LA9A 2VGQA 1HSJA 1LCFA 1MXYA 3KOTA 4LQ5A 5H8NA 4JBZA 4KCDA 3MPKA 5I57B 4F18A 1IXGA 1OQHA 3N26A 1LBBA 4EF2A 2GRVA 4RK9A 2XXRA 2WKYA 4BDQA 2A5TA 1B3EA 3RTFB 4YB5A 5I56B 3FVGA 4X1BA 2H25A 5ISUA 2NXOA 1B5IA 1DTGA 2DE2A 1S50A 1EZPA 3PPRA 4KPTA 1NH8A 2XD3A 2RCBA 4JSOA 4R75A 4FORA 4XXUA 2VD2A 4XKNA 2Q2CA 5DEXA 1P1WA 1GGGA 4DCXA 2B3FA 1URGA 1SW5A 3Q26A 4ELQA 1Y3QA 3VE1B 4TLMB 5I59B 2O7UA 1MQGA 2AL5A 3O9PA 5IKBA 4EF1A 3RY3A 3T93B 1II5A 1FQAA 4ZEFA 4OXVA 1LFHA 2Q89A 1BKAA 3SKPA 4NTLA 5AA2A 4OYVA 5TP9B 4YMBA 3CFZA 1DTZA 3EHTA 3KSXA 4ZEKA 1WODA 5CC2A 1DPEA 4ELRA 3TDJA 3IORA 1A55A 3PUVE 3BBRA 4K3FA 1H44A 4YU0A 3TUSA 5I84A 4RPOA 3CSBA 2F78A 4KI0E 3R26A 1DSNA 1CB6A 2RC9A 3UORA 4X9TA 4GOTA 1I69A 4OWDA 4PFWA 1MG1A 1LCTA 3SEYA 2O1LA 1WVJA 4YKIA 3CVGA 3EPEA 4MF3A 3CG3A 4MH5A 1B3HA 5BWJA 1B51A 3HO7A 3T9VA 1MQDA 4ZS9A 5B7DA 4HW8A 1Y4CA 4RYAA 3KBRA 4JWXA 5ICTA 2Y7RA 4G8NA 4XTCQ 3VDFA 4R72A 2FYIA 3C33A 1GR2A 2ONSA 1VSOA 3PMXA 5JTYB 3TCHA 4OESA 5AA4B 5JK4A 5FHOA 1MXVA 1MY0A 4JSDA 4PFYA 3JYRA 1B5HA 3QK6A 4YMAA 4ONYA 3DLNA 4IY6A 3KEIA 3A3UA 1YTVA 1LGBC 4LONB 4DE8A 5H8FB 2Z23A 2Y7PA 1UTHB 2P1SA 1MY3A 3TCGA 4ECFA 3V8XB 4RNSA 3UN6A 4OETA 3N6UA 3B6TA 5KCJB 2Q2AA 1SBPA 5J1DA 2G93A 3MVZA 3DELB 3FXQA 4F22A 4IY5A 4OERA 1WDNA 1NNPA 3O6IA 3L6GA 3IX1A 2UVHA 3KOSA 1J1NA 1ZBMA 5H8QA 3SDFA 5ITOA 2DVCA 1LFIA 3FV2A 3K6XA 4YKKA 2XXIA 4NF8A 2XX8A 1O7TA 4KYEA 1B7ZA 1H3DA 4DXBA 2I0CA 1Y3NA 3TAJA 1UTBB 2I4CA 4Z7EA 1UQWA 2O68A 4F29A 4NMYA 5BUUA 2THIA 1SYIA 2E0SA 1B1HA 3MC2A 3FXUA 3QYTA 4NEDA 2ZYNA 1ZLQA 3E9XA 1JVXA 4U1OA 2DE3A 3H06B 2VHAA 1I6BA 4H5FA 1H76A 4ESWA 1Y4TA 3MPLA 1NH7A 2DVZA 2X7PA 4BLAA 3O97A 3PUYE 2W7YA 4EDPA 3WAEA 1A54A 3TTMA 4IGRA 3C9HA 2V25A 2REGA 4JXIA 3FVKA 4OEUA 1MY4A 2VP1A 2UXAA 4QFKA 4R6YA 1GTKA 1JVYA 1SD3A 2R9JA 3HN0A 4H8JA 2GH9A 2XX9A 4YKPA 3C32A 3RT8A 4RY1A 4OTEA 4XKQA 4GIZA 3TQWA 2Q9TA 1L5TA 1B4HA 5HPQA 4WEDA 3IK6B 4WXJA 1XT8A 1P1UA 1ZU0A 4QSCA 4F31B 5I2NA 2X26A 3MZ1A 2VOZA 3OO7A 2IEEA 1ELJA 2OJTA 3CSGA 3TPAA 5H8NB 3G7WA 2PT2A 4G8HA 3T22A 3I3VA 3QSLA 4QHQA 1US4A 2QRYA 5A5XA 4R6KA 1TFDA 3EN3A 5ITPA 3IR1A 3K6UA 1A8EA 4HCWA 2A5TB 4F19A 3MZ9A 2I58A 1PB7A 2HAUA 3SEVA 3E13X 1MXWA 3U72A 4NWDA 4QSDA 2F6PA 2XXTA 2KLFA 2V3UA 4GD5A 4EXLA 1MQJA 4ZZEA 3USDA 1D9VA 3MVXA 4KHZE 1AIVA 1AH5A 1YPNA 3KN3A 1USYE 1BIYA 2F5XA 3MJNA 4XIGQ 1IXHA 3A09A 1B58A 4ZE9A 4LZ5A 4Q0CA 4JWOA 3V89B 2I3VA 5AA2B 3QUJA 1OIBA 4G68A 1H45A 1NNFA 2AYSA 5H8SA 3IAZA 1VFDA 2OBGA 4JDFA 2QMXA 1AL3A 3R6UA 3S9MC 1BLFA 2Z8DA 1M5FA 2FA7A 1PDAA 1SYHA 4BDOA 1KWHA 4QFNA 3TCFA 2E1SA 2XXWA 5F1QA 2O6AA 1MDP1 2HQ0A 2X7QA 1URDA 2R6GE 3ILUB 1P1NA 2V3QA 5EYFA 2H5YA 1Q35A 4G8MA 3ZS6A 4MFIA 1N3WA 1VR5A 3OSRA 1SW2A 1MM6A 1TFAA 1OLAA 1QULA 4C1UA 1DMBA 1IIWA 1CE2A 2YLNA 3ODBA 1A8FA 4U22A 5DVFA 4OQOA 1MPDA 4O3BA 2ALUA 4Q8RA 4Q5TA 4NF4A 4F3BA 4FE8A 3L6HA 2XXXA 3T9UA 1LAFE 4R2FA 5F7VA 4GF8A 1R6ZA 1RYOA 5AA3A 4LZ7A 3MVWA 1JNFA 2AL4A 1O63A 3GBBA 2DXRA 2QPQA 3U8QA 1Y3PA 3T96B 4GWOA 3SEUA 3V5AA 4BDLA 3MAMA 5CBSA 4ISUA 2F36A 1A40A 1QVSA 4NF5A 2NVUB 1IZ1A 3HHGA 2V84A 4DXCA 4H6DA 2RF1A 1M5CA 3O6HA 1A7LA 2F7AA 5H8QB 3K4UA 5CRYA 3PGFA 2ONKE 1LBCA 1N04A 4PQJA 4F1VA 4XKRA 4F3PA 1QKBA 4PP0A 4NF8B 3UIFA 3IOVA 1XS5A 2AIXA 2DWHA 2B65A 4G2ZA 3LC8A 5KDTA 3EF7A 3E4RA 2XXVA 2D21A 1Z7ME 4FJPA 3FUZA 1LB9A 1TWYA 4G68C 1MPCA 4YB7A 3A3CA 2NOOA 1EU8A 4KQPA 2HFBA 4ZE8A 2A5SA 3H6TA 4OVJA 1B0LA 4GL8A 5L9MA 2RINA 2ZYKA 1MRPA 2OWTA 4O3AA 4X48A 2ZNUA 2PBWA 3CFXA 4LP2B 3K02A 1Y9UA 5I57A 4UACA 2UYFA 3HSTA 4L17A 4GFRA 4ELPA 1ZTYA 3RPWA 3OOAA 3IOWA 2I6EA 4PETA 1VFEA 4IO5A 5CI5A 2PT1A 3C31A 3PPQA 1B52A 4NE4A 1NNKA 4IO7A 1B9JA 1XVYA 3OO8A 1RKMA 1B1XA 3FGSA 5L9SA 4AQ4A 3C35A 5AA2D 5I58A 3MVYA 4E0WA 3MP1A 4BDRA 1JEUA 3BFUA 1FQCA 3RT6B 3K0VA 3EQ1A 1SI1A 3MP8A 2Y84A 2P2AA 2RKMA 1OMPA 2ZMBA 4MLVA 3ILTB 2O1MA 3MZBA 2H9BA 5TU0A 5I2NB 1QUJA 1SW1A 3F11A 3W15C 2OCUA 3ZSFA 1ANFA 4GXAA 2ZNTA 3KZGA 5AA1A 3UGWA 2O69A 3DP6A 3OEKA 4P11A 4YB6A 3CG1A 5A5XB 4OFOA 3H03A 2OLBA 4GXSB 4IO6A 3OO9A 2F6GA 1SI0A 2D5WA 3O2AA 1NNTA 5I2KA 3W9VA 3SEXA 3I6VA 3LSFB 1XC1A 3IO6A 5DT6A 4C1TA 4ZDMA 1FW0A 2I4BA 3T9XB 2ZYMA 4X1DA 3S2VA 4EXKA 3IL1B 1QKAA 1T0KA 2O51A 3SERA 4OENA 1FTLA 3M3FA 3ZKLA 4QFPA 4JB7A 2ZNSA 3D4CA 4DZ1A 3EHUA 2PYYA 3FVOA 3MW0A 4G4PA 3RLFE 4F3SA 3PD8A 3HCQA 2DWIA 1B40A 4G68B 1B3LA 3TODA 1NMUA 4P0IA 1D9YA 4QFOA 3PUZE 1I6QA 3KN7A 4YZZA 1B3FA 3O6GA 5HBCA 2DSFA 4LVQA 2PMSA 3OEMA 3OD7A 1EZ9A 2V93A 4U21A 1UIVA 3K1PA 5KCJA 4YAHX 4EQ7A 2PX1A 1JW1A 2GHBA 2ZXTA 3AXFA 2HXWA 2ANJA 2Y7KA 4IO4A 4GQOA 4MLQA 3TKDA 3CR9A 2Q8JA 3Q27A 2ONRA 3G3FA 5L9OA 3QUFA 2DS9A 4NF6A 3SEWA 4ZEDA 3RN8A 2YJPA 1ZJLA 1OVBA 1SQYA 3FV1A 3KFMA 1GV8A 1N76A 3VLVA 3KGCA 4MBPA 1AMFA 2Z22A 5DEXB 4NF4B 4U23A 2Y7IA 3JZJA 3VXBA 3TEPA 2O7IA 1M5DA 1DPPA 2GFEA 3TQLA 1NFTA 3CFLA 3OO6A 2GHAA 3O29A 4POXA 4ELOA 4OHNA 3VLWA 3UA8A 3PUWE 1N3XA 3FXRA 1IEJA 4F3GA 1MQHA 2XX7A 4R74A 4ZZAA 3PMVA 2O84X 4NF5B 1FCKA 1B7HA 4ZECA 3GXAA 4WKMA 1SDXA 1N0TA 4KYSA 2VD3A 2RC7A 2Q88A 3K00A 4ZEBA 1Y1MA 4N13A 3E3KA 3T9HB 3B7DA 3VV5A 3QAXA 1B6HA 3K6VA 1A99A 2D3IA 1B46A 5KDTB 3LUYA 1QW0A 1OVTA 2QJEA 2UVJA 3H6VA 3PV0E 1IXIA 3HHFA 4JWYA 2QS3A 1EZOA 3FJ7A 3HV1A 4ND9A 4OFLA 5H8HA 3SESA 1AOVA 4N07A 3IO4A 4I62A 4GLIA 3RNNA 2Z8EA 1EH3A 3FASA 3TZAA 4FIMA 4M1VA 1PBPA 3IJOB 3Q28A 4U1ZA 5CMMA 1JW4A 1Z7NE 5KZTA 3B6WA 3OXNA 5CMCA 4IB2A 1Y1ZA 3GZGA 3P7IA 4H5GA 5CM6A 3EHSA 2NUVA 2UVIA 5TPAA 3RUMA 4FEBA 4F1UA 1R9LA 1ZMGA 3O66A 4BDNA 4F2OA 2H98A 4LQ2A 3FZVA 3SETA 4THIA 1TXFA 2B3BA 1MH4A 5DYHA 2IA4A 1IQ7A 5I58B 1FQDA 4H67A 4I8CA 1M5BA 2OZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5E A;  1QJM A;  3K2D A;  2DQV A;  4FAJ A;  3KJT A;  1P1Q A;  1Y20 A;  4GVO A;  2H4I A;  4RXL A;  3Q25 A;  4R2B A;  3M3K A;  4FAT A;  3N94 A;  2Z8F A;  1JET A;  1OQG A;  2XXH A;  3G3J A;  3FJM A;  4RPN A;  4PE5 B;  4AB6 A;  3W9W A;  3V83 A;  3GLB A;  1IIT A;  3S9L C;  5ICQ A;  1LB8 A;  1MY1 A;  1FQE A;  1LAG E;  4TOZ A;  3TYH A;  4ZEI A;  2HZK A;  1QUK A;  4LAT A;  3JV9 A;  1PEB A;  1OLC A;  4KYD A;  1B0H A;  2DE4 A;  1PB8 A;  2XD2 A;  4PFT A;  3FAT A;  4POW A;  4LUB A;  1TT1 A;  3PD9 A;  3U94 A;  3HPI A;  5I2K B;  3PUX E;  5L8D A;  3VLU A;  3TTL A;  2F35 A;  3VFJ A;  1MQI A;  3BFT A;  1R9Q A;  1BP5 A;  5K2X A;  3MP6 A;  3U1O A;  3IB2 A;  4KD5 A;  2F8D A;  3OSQ A;  1DOT A;  4H8I A;  2REJ A;  1VE4 A;  3IB0 A;  3R7X A;  1D3K A;  3TMG A;  5IAI A;  3VXC A;  1B5J A;  2RC8 A;  2F97 A;  4QF9 A;  2YPN A;  1XVX A;  3TTN A;  1FTJ A;  1F9B A;  3PMW A;  3M3L A;  5K2Y A;  3TTK A;  4FEC A;  1D4N A;  5I56 A;  2H99 A;  2OWS A;  2HAV A;  4GL0 A;  1H43 A;  1IXC A;  1B7U A;  5M2V A;  3TEL A;  1US5 A;  5CMB A;  1SW4 A;  2UVG A;  2DP8 A;  1MXZ A;  2XXU A;  1FTK A;  4NWC A;  1ZKB A;  3FJG A;  4KCC A;  5I59 A;  1JEV A;  3OEL A;  3VVF A;  4IO2 A;  3C36 A;  3MQ9 A;  5CMK A;  3CIJ A;  3D4G A;  1B2H A;  4O3C A;  3THI A;  3N6T A;  2QS4 A;  2HZL A;  2DWA A;  1PC3 A;  4OZ9 A;  4UA8 A;  4F39 A;  1Q1K A;  1MDQ A;  5TP9 A;  3OMB A;  4YIC A;  3DP4 A;  3N5L A;  2DWJ A;  4R9F A;  4R73 A;  4R9G A;  1MY2 A;  4RA1 A;  3DP8 A;  3O28 A;  3KJ7 A;  3B6Q A;  3QXM A;  1B05 A;  1LAH E;  4H1X A;  2HCA A;  2I3W A;  1URS A;  4NF6 B;  2XXP A;  4YKJ A;  3H6U A;  4F2Q A;  2M8C A;  3MUQ A;  1FQF A;  3LSW A;  4P0G A;  1JQF A;  5FHN A;  2FNC A;  2F34 A;  1USY H;  2DYX A;  1MH3 A;  5DVI A;  2ABH A;  3C34 A;  2V3T A;  3TFL A;  5DVJ A;  1P1O A;  2R71 A;  4XKP A;  3TTR A;  2HEU A;  4AB5 A;  4EQB A;  3H4Z A;  3U93 A;  5HM4 B;  1UIU A;  4F1Y A;  3FD3 A;  3S9N C;  2P0S A;  2QMW A;  4Z0I A;  1P99 A;  3PPP A;  3G3G A;  3G3K A;  3PU5 A;  4DLD A;  4PFU A;  1PBQ A;  3ZKK A;  1JW5 A;  4RK2 A;  5JTY A;  4C0R A;  4QFL A;  2CZL A;  5EHM A;  5AA4 A;  3IJX B;  4EUO A;  3UK4 A;  5ELV A;  3H6W A;  4IO3 A;  2PVU A;  3IOT A;  3K1M A;  3RQT A;  3CRB A;  3C4M A;  3M8U A;  5H8F A;  1UTH A;  2CMO A;  3WAF A;  2QS1 A;  4DCY A;  2XXQ A;  4ESX A;  1MXU A;  2XXY A;  4U4X A;  2Y7W A;  4DXU A;  5CBR A;  3VVE A;  2G29 A;  3KN8 A;  3S4U A;  4DDD A;  2RCA A;  3LSL A;  3MWB A;  3K1N A;  3PPN A;  1MM7 A;  4TLL B;  2I49 A;  5EHS A;  1SVX B;  3DM0 A;  3CI8 A;  5JEI A;  1LLS A;  3S9E A;  1FTO A;  5H8H B;  2NWJ A;  3Q29 A;  1NKX A;  4U4S A;  1LAX A;  1YAE A;  4OFJ A;  4HTG A;  2QL3 A;  4WEP A;  1PB9 A;  4OEV A;  1FQB A;  5FTI A;  1ZIU A;  2ZYO A;  1LST A;  1UTB A;  4TQU Q;  5AE4 A;  1LFG A;  3ONM A;  1ATG A;  5FHM A;  3FIR A;  4LZ8 A;  4KR5 A;  1HSE A;  3H3G A;  2LAO A;  4IGT A;  1IUD A;  4BDM A;  4FED A;  1FTM A;  1I6A A;  3ECR A;  1HSL A;  2I48 A;  5TPA B;  4I1D A;  2XHD A;  4G77 A;  2F7B A;  5B70 A;  3LSX A;  4Q30 B;  4E0X A;  3G3H A;  4M4G A;  3MBP A;  4R6H A;  4QSE A;  1N84 A;  1O64 A;  2ESN A;  1BTJ A;  1RYX A;  4KFQ A;  3GBA A;  3KSJ A;  4QRZ A;  3K6W A;  3BKI B;  5LOM A;  2DXY A;  4H0W A;  3I5O A;  1GVC A;  3OEN A;  2I0B A;  3RGY A;  3IOU A;  1MXX A;  4U2R A;  3K01 A;  1N7X A;  5FTH A;  4N6P A;  4OMB A;  2OK2 A;  4EQ9 A;  4GRK A;  3PPO A;  2QS2 A;  3IB1 A;  3FVN A;  3VVD A;  1NL5 A;  3QIM A;  3LBS A;  1POY 1;  4HCY A;  5DTB A;  1XOC A;  4RJZ A;  1B4Z A;  1S9T A;  3LR1 A;  1B32 A;  2DOJ A;  3H7M A;  2BJJ X;  3G3I A;  1YCJ A;  2QSX A;  2UYE A;  1POT A;  4I9D A;  4H65 A;  1MS7 A;  3KG2 A;  1MPB A;  4DIG A;  2F7C A;  1S7Y A;  3UP9 A;  4HS7 A;  1XHY A;  1QUI A;  3U92 A;  1B3G A;  3RTW B;  1N7W A;  1R1N A;  3T66 A;  4LA9 A;  2VGQ A;  1HSJ A;  1LCF A;  1MXY A;  3KOT A;  4LQ5 A;  5H8N A;  4JBZ A;  4KCD A;  3MPK A;  5I57 B;  4F18 A;  1IXG A;  1OQH A;  3N26 A;  1LBB A;  4EF2 A;  2GRV A;  4RK9 A;  2XXR A;  2WKY A;  4BDQ A;  2A5T A;  1B3E A;  3RTF B;  4YB5 A;  5I56 B;  3FVG A;  4X1B A;  2H25 A;  5ISU A;  2NXO A;  1B5I A;  1DTG A;  2DE2 A;  1S50 A;  1EZP A;  3PPR A;  4KPT A;  1NH8 A;  2XD3 A;  2RCB A;  4JSO A;  4R75 A;  4FOR A;  4XXU A;  2VD2 A;  4XKN A;  2Q2C A;  5DEX A;  1P1W A;  1GGG A;  4DCX A;  2B3F A;  1URG A;  1SW5 A;  3Q26 A;  4ELQ A;  1Y3Q A;  3VE1 B;  4TLM B;  5I59 B;  2O7U A;  1MQG A;  2AL5 A;  3O9P A;  5IKB A;  4EF1 A;  3RY3 A;  3T93 B;  1II5 A;  1FQA A;  4ZEF A;  4OXV A;  1LFH A;  2Q89 A;  1BKA A;  3SKP A;  4NTL A;  5AA2 A;  4OYV A;  5TP9 B;  4YMB A;  3CFZ A;  1DTZ A;  3EHT A;  3KSX A;  4ZEK A;  1WOD A;  5CC2 A;  1DPE A;  4ELR A;  3TDJ A;  3IOR A;  1A55 A;  3PUV E;  3BBR A;  4K3F A;  1H44 A;  4YU0 A;  3TUS A;  5I84 A;  4RPO A;  3CSB A;  2F78 A;  4KI0 E;  3R26 A;  1DSN A;  1CB6 A;  2RC9 A;  3UOR A;  4X9T A;  4GOT A;  1I69 A;  4OWD A;  4PFW A;  1MG1 A;  1LCT A;  3SEY A;  2O1L A;  1WVJ A;  4YKI A;  3CVG A;  3EPE A;  4MF3 A;  3CG3 A;  4MH5 A;  1B3H A;  5BWJ A;  1B51 A;  3HO7 A;  3T9V A;  1MQD A;  4ZS9 A;  5B7D A;  4HW8 A;  1Y4C A;  4RYA A;  3KBR A;  4JWX A;  5ICT A;  2Y7R A;  4G8N A;  4XTC Q;  3VDF A;  4R72 A;  2FYI A;  3C33 A;  1GR2 A;  2ONS A;  1VSO A;  3PMX A;  5JTY B;  3TCH A;  4OES A;  5AA4 B;  5JK4 A;  5FHO A;  1MXV A;  1MY0 A;  4JSD A;  4PFY A;  3JYR A;  1B5H A;  3QK6 A;  4YMA A;  4ONY A;  3DLN A;  4IY6 A;  3KEI A;  3A3U A;  1YTV A;  1LGB C;  4LON B;  4DE8 A;  5H8F B;  2Z23 A;  2Y7P A;  1UTH B;  2P1S A;  1MY3 A;  3TCG A;  4ECF A;  3V8X B;  4RNS A;  3UN6 A;  4OET A;  3N6U A;  3B6T A;  5KCJ B;  2Q2A A;  1SBP A;  5J1D A;  2G93 A;  3MVZ A;  3DEL B;  3FXQ A;  4F22 A;  4IY5 A;  4OER A;  1WDN A;  1NNP A;  3O6I A;  3L6G A;  3IX1 A;  2UVH A;  3KOS A;  1J1N A;  1ZBM A;  5H8Q A;  3SDF A;  5ITO A;  2DVC A;  1LFI A;  3FV2 A;  3K6X A;  4YKK A;  2XXI A;  4NF8 A;  2XX8 A;  1O7T A;  4KYE A;  1B7Z A;  1H3D A;  4DXB A;  2I0C A;  1Y3N A;  3TAJ A;  1UTB B;  2I4C A;  4Z7E A;  1UQW A;  2O68 A;  4F29 A;  4NMY A;  5BUU A;  2THI A;  1SYI A;  2E0S A;  1B1H A;  3MC2 A;  3FXU A;  3QYT A;  4NED A;  2ZYN A;  1ZLQ A;  3E9X A;  1JVX A;  4U1O A;  2DE3 A;  3H06 B;  2VHA A;  1I6B A;  4H5F A;  1H76 A;  4ESW A;  1Y4T A;  3MPL A;  1NH7 A;  2DVZ A;  2X7P A;  4BLA A;  3O97 A;  3PUY E;  2W7Y A;  4EDP A;  3WAE A;  1A54 A;  3TTM A;  4IGR A;  3C9H A;  2V25 A;  2REG A;  4JXI A;  3FVK A;  4OEU A;  1MY4 A;  2VP1 A;  2UXA A;  4QFK A;  4R6Y A;  1GTK A;  1JVY A;  1SD3 A;  2R9J A;  3HN0 A;  4H8J A;  2GH9 A;  2XX9 A;  4YKP A;  3C32 A;  3RT8 A;  4RY1 A;  4OTE A;  4XKQ A;  4GIZ A;  3TQW A;  2Q9T A;  1L5T A;  1B4H A;  5HPQ A;  4WED A;  3IK6 B;  4WXJ A;  1XT8 A;  1P1U A;  1ZU0 A;  4QSC A;  4F31 B;  5I2N A;  2X26 A;  3MZ1 A;  2VOZ A;  3OO7 A;  2IEE A;  1ELJ A;  2OJT A;  3CSG A;  3TPA A;  5H8N B;  3G7W A;  2PT2 A;  4G8H A;  3T22 A;  3I3V A;  3QSL A;  4QHQ A;  1US4 A;  2QRY A;  5A5X A;  4R6K A;  1TFD A;  3EN3 A;  5ITP A;  3IR1 A;  3K6U A;  1A8E A;  4HCW A;  2A5T B;  4F19 A;  3MZ9 A;  2I58 A;  1PB7 A;  2HAU A;  3SEV A;  3E13 X;  1MXW A;  3U72 A;  4NWD A;  4QSD A;  2F6P A;  2XXT A;  2KLF A;  2V3U A;  4GD5 A;  4EXL A;  1MQJ A;  4ZZE A;  3USD A;  1D9V A;  3MVX A;  4KHZ E;  1AIV A;  1AH5 A;  1YPN A;  3KN3 A;  1USY E;  1BIY A;  2F5X A;  3MJN A;  4XIG Q;  1IXH A;  3A09 A;  1B58 A;  4ZE9 A;  4LZ5 A;  4Q0C A;  4JWO A;  3V89 B;  2I3V A;  5AA2 B;  3QUJ A;  1OIB A;  4G68 A;  1H45 A;  1NNF A;  2AYS A;  5H8S A;  3IAZ A;  1VFD A;  2OBG A;  4JDF A;  2QMX A;  1AL3 A;  3R6U A;  3S9M C;  1BLF A;  2Z8D A;  1M5F A;  2FA7 A;  1PDA A;  1SYH A;  4BDO A;  1KWH A;  4QFN A;  3TCF A;  2E1S A;  2XXW A;  5F1Q A;  2O6A A;  1MDP 1;  2HQ0 A;  2X7Q A;  1URD A;  2R6G E;  3ILU B;  1P1N A;  2V3Q A;  5EYF A;  2H5Y A;  1Q35 A;  4G8M A;  3ZS6 A;  4MFI A;  1N3W A;  1VR5 A;  3OSR A;  1SW2 A;  1MM6 A;  1TFA A;  1OLA A;  1QUL A;  4C1U A;  1DMB A;  1IIW A;  1CE2 A;  2YLN A;  3ODB A;  1A8F A;  4U22 A;  5DVF A;  4OQO A;  1MPD A;  4O3B A;  2ALU A;  4Q8R A;  4Q5T A;  4NF4 A;  4F3B A;  4FE8 A;  3L6H A;  2XXX A;  3T9U A;  1LAF E;  4R2F A;  5F7V A;  4GF8 A;  1R6Z A;  1RYO A;  5AA3 A;  4LZ7 A;  3MVW A;  1JNF A;  2AL4 A;  1O63 A;  3GBB A;  2DXR A;  2QPQ A;  3U8Q A;  1Y3P A;  3T96 B;  4GWO A;  3SEU A;  3V5A A;  4BDL A;  3MAM A;  5CBS A;  4ISU A;  2F36 A;  1A40 A;  1QVS A;  4NF5 A;  2NVU B;  1IZ1 A;  3HHG A;  2V84 A;  4DXC A;  4H6D A;  2RF1 A;  1M5C A;  3O6H A;  1A7L A;  2F7A A;  5H8Q B;  3K4U A;  5CRY A;  3PGF A;  2ONK E;  1LBC A;  1N04 A;  4PQJ A;  4F1V A;  4XKR A;  4F3P A;  1QKB A;  4PP0 A;  4NF8 B;  3UIF A;  3IOV A;  1XS5 A;  2AIX A;  2DWH A;  2B65 A;  4G2Z A;  3LC8 A;  5KDT A;  3EF7 A;  3E4R A;  2XXV A;  2D21 A;  1Z7M E;  4FJP A;  3FUZ A;  1LB9 A;  1TWY A;  4G68 C;  1MPC A;  4YB7 A;  3A3C A;  2NOO A;  1EU8 A;  4KQP A;  2HFB A;  4ZE8 A;  2A5S A;  3H6T A;  4OVJ A;  1B0L A;  4GL8 A;  5L9M A;  2RIN A;  2ZYK A;  1MRP A;  2OWT A;  4O3A A;  4X48 A;  2ZNU A;  2PBW A;  3CFX A;  4LP2 B;  3K02 A;  1Y9U A;  5I57 A;  4UAC A;  2UYF A;  3HST A;  4L17 A;  4GFR A;  4ELP A;  1ZTY A;  3RPW A;  3OOA A;  3IOW A;  2I6E A;  4PET A;  1VFE A;  4IO5 A;  5CI5 A;  2PT1 A;  3C31 A;  3PPQ A;  1B52 A;  4NE4 A;  1NNK A;  4IO7 A;  1B9J A;  1XVY A;  3OO8 A;  1RKM A;  1B1X A;  3FGS A;  5L9S A;  4AQ4 A;  3C35 A;  5AA2 D;  5I58 A;  3MVY A;  4E0W A;  3MP1 A;  4BDR A;  1JEU A;  3BFU A;  1FQC A;  3RT6 B;  3K0V A;  3EQ1 A;  1SI1 A;  3MP8 A;  2Y84 A;  2P2A A;  2RKM A;  1OMP A;  2ZMB A;  4MLV A;  3ILT B;  2O1M A;  3MZB A;  2H9B A;  5TU0 A;  5I2N B;  1QUJ A;  1SW1 A;  3F11 A;  3W15 C;  2OCU A;  3ZSF A;  1ANF A;  4GXA A;  2ZNT A;  3KZG A;  5AA1 A;  3UGW A;  2O69 A;  3DP6 A;  3OEK A;  4P11 A;  4YB6 A;  3CG1 A;  5A5X B;  4OFO A;  3H03 A;  2OLB A;  4GXS B;  4IO6 A;  3OO9 A;  2F6G A;  1SI0 A;  2D5W A;  3O2A A;  1NNT A;  5I2K A;  3W9V A;  3SEX A;  3I6V A;  3LSF B;  1XC1 A;  3IO6 A;  5DT6 A;  4C1T A;  4ZDM A;  1FW0 A;  2I4B A;  3T9X B;  2ZYM A;  4X1D A;  3S2V A;  4EXK A;  3IL1 B;  1QKA A;  1T0K A;  2O51 A;  3SER A;  4OEN A;  1FTL A;  3M3F A;  3ZKL A;  4QFP A;  4JB7 A;  2ZNS A;  3D4C A;  4DZ1 A;  3EHU A;  2PYY A;  3FVO A;  3MW0 A;  4G4P A;  3RLF E;  4F3S A;  3PD8 A;  3HCQ A;  2DWI A;  1B40 A;  4G68 B;  1B3L A;  3TOD A;  1NMU A;  4P0I A;  1D9Y A;  4QFO A;  3PUZ E;  1I6Q A;  3KN7 A;  4YZZ A;  1B3F A;  3O6G A;  5HBC A;  2DSF A;  4LVQ A;  2PMS A;  3OEM A;  3OD7 A;  1EZ9 A;  2V93 A;  4U21 A;  1UIV A;  3K1P A;  5KCJ A;  4YAH X;  4EQ7 A;  2PX1 A;  1JW1 A;  2GHB A;  2ZXT A;  3AXF A;  2HXW A;  2ANJ A;  2Y7K A;  4IO4 A;  4GQO A;  4MLQ A;  3TKD A;  3CR9 A;  2Q8J A;  3Q27 A;  2ONR A;  3G3F A;  5L9O A;  3QUF A;  2DS9 A;  4NF6 A;  3SEW A;  4ZED A;  3RN8 A;  2YJP A;  1ZJL A;  1OVB A;  1SQY A;  3FV1 A;  3KFM A;  1GV8 A;  1N76 A;  3VLV A;  3KGC A;  4MBP A;  1AMF A;  2Z22 A;  5DEX B;  4NF4 B;  4U23 A;  2Y7I A;  3JZJ A;  3VXB A;  3TEP A;  2O7I A;  1M5D A;  1DPP A;  2GFE A;  3TQL A;  1NFT A;  3CFL A;  3OO6 A;  2GHA A;  3O29 A;  4POX A;  4ELO A;  4OHN A;  3VLW A;  3UA8 A;  3PUW E;  1N3X A;  3FXR A;  1IEJ A;  4F3G A;  1MQH A;  2XX7 A;  4R74 A;  4ZZA A;  3PMV A;  2O84 X;  4NF5 B;  1FCK A;  1B7H A;  4ZEC A;  3GXA A;  4WKM A;  1SDX A;  1N0T A;  4KYS A;  2VD3 A;  2RC7 A;  2Q88 A;  3K00 A;  4ZEB A;  1Y1M A;  4N13 A;  3E3K A;  3T9H B;  3B7D A;  3VV5 A;  3QAX A;  1B6H A;  3K6V A;  1A99 A;  2D3I A;  1B46 A;  5KDT B;  3LUY A;  1QW0 A;  1OVT A;  2QJE A;  2UVJ A;  3H6V A;  3PV0 E;  1IXI A;  3HHF A;  4JWY A;  2QS3 A;  1EZO A;  3FJ7 A;  3HV1 A;  4ND9 A;  4OFL A;  5H8H A;  3SES A;  1AOV A;  4N07 A;  3IO4 A;  4I62 A;  4GLI A;  3RNN A;  2Z8E A;  1EH3 A;  3FAS A;  3TZA A;  4FIM A;  4M1V A;  1PBP A;  3IJO B;  3Q28 A;  4U1Z A;  5CMM A;  1JW4 A;  1Z7N E;  5KZT A;  3B6W A;  3OXN A;  5CMC A;  4IB2 A;  1Y1Z A;  3GZG A;  3P7I A;  4H5G A;  5CM6 A;  3EHS A;  2NUV A;  2UVI A;  5TPA A;  3RUM A;  4FEB A;  4F1U A;  1R9L A;  1ZMG A;  3O66 A;  4BDN A;  4F2O A;  2H98 A;  4LQ2 A;  3FZV A;  3SET A;  4THI A;  1TXF A;  2B3B A;  1MH4 A;  5DYH A;  2IA4 A;  1IQ7 A;  5I58 B;  1FQD A;  4H67 A;  4I8C A;  1M5B A;  2OZZ A; 
#chains in the Genus database with same CATH topology
 1M5E A;  1QJM A;  3K2D A;  2DQV A;  1IME A;  4FAJ A;  3KJT A;  1P1Q A;  1Y20 A;  4GVO A;  2H4I A;  4RXL A;  4PDH A;  3Q25 A;  4MAG A;  3M3K A;  4R2B A;  4FAT A;  3QMF A;  3N94 A;  4PTK A;  2Z8F A;  1JET A;  3T1B A;  1OQG A;  2XXH A;  4P56 A;  3G3J A;  3FJM A;  4RPN A;  4PE5 B;  4AB6 A;  3W9W A;  3V83 A;  3GLB A;  1IIT A;  4I3Y A;  3S9L C;  3IFC A;  3GYY A;  5ICQ A;  1LB8 A;  1MY1 A;  1FQE A;  1LAG E;  4TOZ A;  3TYH A;  4ZEI A;  2HZK A;  1QUK A;  4LAT A;  3JV9 A;  1PEB A;  1OLC A;  4KYD A;  1B0H A;  2DE4 A;  1PB8 A;  2XD2 A;  4PFT A;  1IMD A;  3FAT A;  4POW A;  4LUB A;  1TT1 A;  1IMB A;  3PD9 A;  3U94 A;  3HPI A;  5I2K B;  3PUX E;  5L8D A;  3BIG A;  3VLU A;  3TTL A;  4GWY A;  2F35 A;  3VFJ A;  1MQI A;  3BFT A;  1R9Q A;  1BP5 A;  5K2X A;  3MP6 A;  3U1O A;  3IB2 A;  4N8Y A;  4KD5 A;  2F8D A;  3OSQ A;  1DOT A;  4H8I A;  2REJ A;  1VE4 A;  3IB0 A;  3R7X A;  1D3K A;  3TMG A;  4P8B A;  5IAI A;  3VXC A;  1B5J A;  2RC8 A;  2F97 A;  4QF9 A;  2YPN A;  1XVX A;  3TTN A;  1FTJ A;  4O7M A;  4PCD A;  1F9B A;  3PMW A;  3M3L A;  5K2Y A;  3TTK A;  4FEC A;  1D4N A;  5I56 A;  2H99 A;  2OWS A;  5EQ9 A;  2HAV A;  4GL0 A;  1H43 A;  1IXC A;  1B7U A;  4XFE A;  5M2V A;  3TEL A;  1FPI A;  1US5 A;  5CMB A;  1SW4 A;  2UVG A;  2DP8 A;  2XWV A;  4IR8 A;  1MXZ A;  2XXU A;  4GWZ A;  1FTK A;  4NWC A;  1ZKB A;  1LBY A;  3FJG A;  4KCC A;  5I59 A;  1JEV A;  3OEL A;  2MKZ A;  3VVF A;  4IO2 A;  3C36 A;  3MQ9 A;  5CMK A;  3CIJ A;  3D4G A;  1B2H A;  4O3C A;  3THI A;  1NV0 A;  3N6T A;  2QS4 A;  2HZL A;  2DWA A;  1EYJ A;  1PC3 A;  4OZ9 A;  4UA8 A;  5EQA A;  2FBP A;  4F39 A;  1Q1K A;  2QVU A;  1MDQ A;  5ET7 A;  4O8M A;  5TP9 A;  3OMB A;  4YIC A;  3DP4 A;  3N5L A;  2DWJ A;  4R9F A;  4R73 A;  4R9G A;  1MY2 A;  4RA1 A;  3DP8 A;  3O28 A;  3KJ7 A;  3RPL A;  3B6Q A;  3QXM A;  1B05 A;  1LAH E;  4H1X A;  2HCA A;  2I3W A;  1URS A;  4NF6 B;  2XXP A;  4YKJ A;  3H6U A;  4F2Q A;  2M8C A;  2FIX A;  3MUQ A;  1FQF A;  3LSW A;  4P0G A;  1JQF A;  2DDK A;  5FHN A;  2WEF A;  2FNC A;  2F34 A;  1USY H;  2DYX A;  1MH3 A;  5DVI A;  2ABH A;  3KBZ A;  4GX3 A;  4JVD A;  4N81 A;  3C34 A;  2V3T A;  3TFL A;  2CZK A;  5DVJ A;  1P1O A;  3T0J A;  2R71 A;  3E79 A;  4XKP A;  3TTR A;  2HEU A;  4AB5 A;  4EQB A;  3H4Z A;  3U93 A;  5HM4 B;  1UIU A;  4F1Y A;  3FD3 A;  3S9N C;  2P0S A;  2QMW A;  4Z0I A;  1P99 A;  3PPP A;  3G3G A;  1RDY A;  3G3K A;  3PU5 A;  2B4L A;  4DLD A;  4PFU A;  1PBQ A;  3ZKK A;  1JW5 A;  4RK2 A;  5JTY A;  4C0R A;  4QFL A;  2CZL A;  5EHM A;  4OVP A;  5AA4 A;  3IJX B;  4EUO A;  3UK4 A;  5ELV A;  3H6W A;  4IO3 A;  2PVU A;  4I3E A;  3IOT A;  3K1M A;  3RQT A;  3CRB A;  3C4M A;  3M8U A;  5H8F A;  1UTH A;  2CMO A;  4PFB A;  2HPG A;  3WAF A;  2QS1 A;  4DCY A;  2XXQ A;  4OA4 A;  4ESX A;  1MXU A;  2XXY A;  4U4X A;  2Y7W A;  4DXU A;  5CBR A;  3VVE A;  2G29 A;  3KN8 A;  3S4U A;  4DDD A;  2RCA A;  3LSL A;  3MWB A;  3K1N A;  3PPN A;  1NV7 A;  1MM7 A;  4TLL B;  2I49 A;  5EHS A;  1SVX B;  3DM0 A;  3CI8 A;  5JEI A;  1LLS A;  3S9E A;  1FTO A;  5H8H B;  4N17 A;  1LBX A;  2NWJ A;  4HE1 A;  3Q29 A;  1NKX A;  4U4S A;  1LAX A;  1YAE A;  4OFJ A;  4HTG A;  2QL3 A;  4I40 A;  4WEP A;  1PB9 A;  4OEV A;  1FQB A;  5FTI A;  1ZIU A;  2HHM A;  2ZYO A;  1LST A;  1UTB A;  4PBH A;  4TQU Q;  5AE4 A;  1LFG A;  3ONM A;  1ATG A;  5FHM A;  3FIR A;  4LZ8 A;  3KC0 A;  4KR5 A;  1HSE A;  3H3G A;  2LAO A;  4IGT A;  1IUD A;  4BDM A;  4P3L A;  4FED A;  1FTM A;  4GBV A;  1I6A A;  3ECR A;  1HSL A;  2I48 A;  5TPA B;  4I1D A;  2XHD A;  4G77 A;  2F7B A;  5B70 A;  3LSX A;  4Q30 B;  1IMC A;  4E0X A;  3G3H A;  4X04 A;  3PTY A;  4M4G A;  3MBP A;  4P1L A;  1FBP A;  4R6H A;  4QSE A;  1N84 A;  3FXB A;  1O64 A;  2ESN A;  1BTJ A;  1RYX A;  4KFQ A;  3GBA A;  3KSJ A;  4QRZ A;  1G0H A;  3K6W A;  3BKI B;  1EYK A;  5LOM A;  2DXY A;  4H0W A;  3I5O A;  1GVC A;  1FTA A;  3OEN A;  3ROJ A;  3EKI A;  2L5V A;  2I0B A;  3RGY A;  3IOU A;  1MXX A;  4U2R A;  3K01 A;  1N7X A;  5FTH A;  4N6P A;  4OMB A;  2OK2 A;  4EQ9 A;  5I3S A;  4GRK A;  3PPO A;  2QS2 A;  3IB1 A;  3FVN A;  3VVD A;  1NL5 A;  3QIM A;  4MJO A;  3LBS A;  1POY 1;  4HCY A;  5DTB A;  1XOC A;  1FPD A;  4RJZ A;  1B4Z A;  1S9T A;  3LR1 A;  1B32 A;  2DOJ A;  3H7M A;  2FHY A;  2BJJ X;  3G3I A;  1YCJ A;  2QSX A;  2Y5K A;  2WYP A;  2UYE A;  1POT A;  1EYI A;  4I9D A;  2QVV A;  4H65 A;  1MS7 A;  4PF6 A;  4PDD A;  3KG2 A;  1MPB A;  4DIG A;  2F7C A;  1S7Y A;  3UP9 A;  4HS7 A;  1XHY A;  1QUI A;  3U92 A;  1B3G A;  3RTW B;  1N7W A;  2V4C A;  1R1N A;  2VPN A;  3T66 A;  4LA9 A;  2VGQ A;  1HSJ A;  1LCF A;  1MXY A;  3KOT A;  4LQ5 A;  5H8N A;  4JBZ A;  4KCD A;  3MPK A;  5I57 B;  4F18 A;  1IXG A;  1OQH A;  3N26 A;  1LBB A;  4EF2 A;  2GRV A;  4RK9 A;  2XXR A;  5IGA A;  5LTC A;  2WKY A;  4BDQ A;  5ET8 A;  2A5T A;  1B3E A;  3RTF B;  4YB5 A;  5I56 B;  3FVG A;  4GWU A;  4X1B A;  5FBP A;  2H25 A;  5ISU A;  2NXO A;  1B5I A;  1DTG A;  4NX1 A;  2DE2 A;  1S50 A;  1EZP A;  3PPR A;  4KPT A;  1NH8 A;  2XD3 A;  2RCB A;  4JSO A;  4R75 A;  4N8G A;  4FOR A;  4XXU A;  2VD2 A;  4XKN A;  2Q2C A;  5DEX A;  1P1W A;  1GGG A;  4DCX A;  2B3F A;  1URG A;  1SW5 A;  3Q26 A;  4ELQ A;  1Y3Q A;  2CEX A;  3VE1 B;  2PCR A;  4TLM B;  5I59 B;  2O7U A;  4NHB A;  1MQG A;  3HFU A;  2AL5 A;  3O9P A;  5IKB A;  4EF1 A;  2CEY A;  3RY3 A;  3T93 B;  1II5 A;  2XXK A;  1FQA A;  4ZEF A;  4OXV A;  1LFH A;  5EQ8 A;  2Q89 A;  1BKA A;  4PGP A;  3SKP A;  4NTL A;  5AA2 A;  4OYV A;  1KA0 A;  5TP9 B;  4YMB A;  3CFZ A;  1DTZ A;  3EHT A;  3KSX A;  4ZEK A;  2P3N A;  1WOD A;  5CC2 A;  1DPE A;  4ELR A;  3TDJ A;  3IOR A;  4OVS A;  4NGU A;  1A55 A;  3RPL B;  3MST A;  3PUV E;  4JVC A;  3BBR A;  4K3F A;  1H44 A;  4YU0 A;  3TUS A;  5I84 A;  4RPO A;  3CSB A;  1NV5 A;  2F78 A;  4KI0 E;  5IZ1 A;  3R26 A;  1DSN A;  1CB6 A;  2RC9 A;  3UOR A;  4X9T A;  4GOT A;  5I5P A;  1I69 A;  4OWD A;  4PFW A;  1MG1 A;  4DI3 D;  1LCT A;  3SEY A;  2O1L A;  1NV4 A;  1WVJ A;  4YKI A;  1NUY A;  3CVG A;  3EPE A;  1VDW A;  4MF3 A;  3CG3 A;  4MH5 A;  1B3H A;  2CZH A;  5BWJ A;  1B51 A;  1FPB A;  3HO7 A;  1NV6 A;  3T9V A;  1MQD A;  4ZS9 A;  5B7D A;  4HW8 A;  4X8R A;  1Y4C A;  4RYA A;  3KBR A;  2XA5 A;  4JWX A;  5ICT A;  2Y7R A;  4G8N A;  4XTC Q;  3VDF A;  4R72 A;  2FYI A;  3C33 A;  1GR2 A;  2ONS A;  1VSO A;  3PMX A;  5JTY B;  3TCH A;  4OES A;  5AA4 B;  5JK4 A;  5FHO A;  1MXV A;  1MY0 A;  4JSD A;  4PFY A;  3JYR A;  1B5H A;  3QK6 A;  4YMA A;  4ONY A;  3DLN A;  4IY6 A;  3KEI A;  3A3U A;  1YTV A;  1LGB C;  4LON B;  4DE8 A;  5H8F B;  2Z23 A;  2Y7P A;  1UTH B;  2VT5 A;  2P1S A;  1MY3 A;  3TCG A;  4ECF A;  3V8X B;  4RNS A;  3RYD A;  3UN6 A;  4OET A;  3N6U A;  3B6T A;  5KCJ B;  2P3V A;  2Q2A A;  1SBP A;  5J1D A;  2G93 A;  3MVZ A;  3DEL B;  5DW8 A;  3FXQ A;  4F22 A;  4GWX A;  4IY5 A;  4OER A;  1CNQ A;  1WDN A;  3CHG A;  1NNP A;  3O6I A;  3L6G A;  3IX1 A;  2UVH A;  3KOS A;  1J1N A;  1ZBM A;  5H8Q A;  3SDF A;  5ITO A;  2DVC A;  1LFI A;  3FV2 A;  3K6X A;  4YKK A;  1AWB A;  2XXI A;  4OVT A;  4MMP A;  4NF8 A;  1NUX A;  2XX8 A;  1O7T A;  4KYE A;  1B7Z A;  2FVZ A;  1H3D A;  4DXB A;  2I0C A;  1Y3N A;  3TAJ A;  5ESY A;  2VPO A;  1UTB B;  2I4C A;  4Z7E A;  1UQW A;  2O68 A;  2OX3 A;  4F29 A;  4NMY A;  5BUU A;  2THI A;  1SYI A;  2E0S A;  1B1H A;  3MC2 A;  3FXU A;  3QYT A;  1NV1 A;  4NED A;  2ZYN A;  1ZLQ A;  3E9X A;  4GWS A;  1JVX A;  4U1O A;  2DE3 A;  4MHF A;  4MNI A;  3H06 B;  2VHA A;  1I6B A;  1D9Q A;  4H5F A;  1H76 A;  4ESW A;  4OAN A;  1Y4T A;  3MPL A;  1NH7 A;  2DVZ A;  2X7P A;  4BLA A;  3O97 A;  3PUY E;  2W7Y A;  1JP4 A;  4EDP A;  3WAE A;  1A54 A;  1NUW A;  3TTM A;  2WX9 A;  4IGR A;  3NOH A;  3C9H A;  3D1R A;  2V25 A;  1KA1 A;  2REG A;  4JXI A;  3FVK A;  4OEU A;  4LN5 A;  1MY4 A;  2VP1 A;  2UXA A;  4QFK A;  2ZZX A;  4N91 A;  4R6Y A;  1GTK A;  5ET5 A;  1JVY A;  1SD3 A;  2R9J A;  3BIH A;  3HN0 A;  4H8J A;  2GH9 A;  2XX9 A;  4YKP A;  3C32 A;  4PAF A;  3RT8 A;  3SZP A;  4RY1 A;  4OTE A;  4XKQ A;  4GIZ A;  3TQW A;  2Q9T A;  3E78 A;  1L5T A;  1B4H A;  5HPQ A;  4WED A;  3IK6 B;  4WXJ A;  2WBD A;  1XT8 A;  1NV3 A;  1P1U A;  1ZU0 A;  4QSC A;  3KC1 A;  4F31 B;  5I2N A;  2X26 A;  3IFA A;  3MZ1 A;  2VOZ A;  3OO7 A;  4GX4 A;  2IEE A;  1ELJ A;  2OJT A;  3CSG A;  1FJ9 A;  3TPA A;  5H8N B;  3G7W A;  2PT2 A;  4G8H A;  3T22 A;  3I3V A;  3QSL A;  2WBB A;  4QHQ A;  1US4 A;  2QRY A;  5A5X A;  4R6K A;  1TFD A;  3EN3 A;  5ITP A;  3IR1 A;  3K6U A;  1A8E A;  4HCW A;  2A5T B;  4F19 A;  3MZ9 A;  4NAP A;  2I58 A;  1PB7 A;  2HAU A;  2FIE A;  3SEV A;  3E13 X;  1MXW A;  3U72 A;  4NWD A;  4QSD A;  2F6P A;  2XXT A;  4P9K A;  2KLF A;  2PFY A;  3B8B A;  2XWK A;  2V3U A;  4GD5 A;  4EXL A;  1MQJ A;  4ZZE A;  3USD A;  1D9V A;  3MVX A;  4KHZ E;  4MEV A;  1AIV A;  2KQZ A;  1AH5 A;  1YPN A;  3KN3 A;  1USY E;  1BIY A;  2F5X A;  3MJN A;  4XIG Q;  1IXH A;  3A09 A;  1B58 A;  4ZE9 A;  4LZ5 A;  1FBE A;  4Q0C A;  4JWO A;  3V89 B;  4MX6 A;  2I3V A;  4XF5 A;  5AA2 B;  3QUJ A;  1OIB A;  4P47 A;  2ZZV A;  4G68 A;  1H45 A;  4NG7 A;  1NNF A;  2AYS A;  5H8S A;  3IAZ A;  1VFD A;  2OBG A;  4JDF A;  3A29 A;  2QMX A;  1NI9 A;  1AL3 A;  3R6U A;  4N15 A;  5T3J A;  3S9M C;  1BLF A;  1KZ8 A;  3FBP A;  2Z8D A;  1M5F A;  2FA7 A;  1PDA A;  1FBG A;  1SYH A;  4BDO A;  1KWH A;  4QFN A;  3TCF A;  1Q9D A;  2E1S A;  2XXW A;  5F1Q A;  2O6A A;  5J16 A;  1MDP 1;  4HE0 A;  2HQ0 A;  2X7Q A;  1URD A;  2R6G E;  3ILU B;  1P1N A;  2V3Q A;  5EYF A;  2H5Y A;  1Q35 A;  4G8M A;  3ZS6 A;  4MFI A;  2OWZ A;  1N3W A;  1VR5 A;  2QVR A;  3OSR A;  2GQ1 A;  1SW2 A;  1FBC A;  1MM6 A;  1TFA A;  1OLA A;  4MIJ A;  4QBA A;  2HXR A;  1QUL A;  4C1U A;  1DMB A;  1IIW A;  1CE2 A;  2YLN A;  3ODB A;  1A8F A;  4MNC A;  4U22 A;  5DVF A;  4OQO A;  1MPD A;  4O3B A;  1QGX A;  2ALU A;  4Q8R A;  4Q5T A;  4NF4 A;  4F3B A;  2Q74 A;  4FE8 A;  3L6H A;  2R8T A;  2XXX A;  2Q8M A;  3T9U A;  1LAF E;  4R2F A;  5F7V A;  4GF8 A;  1R6Z A;  1RYO A;  4PAI A;  5AA3 A;  4LZ7 A;  3MVW A;  1JNF A;  2AL4 A;  1O63 A;  3GBB A;  2DXR A;  2QPQ A;  3U8Q A;  1Y3P A;  1RDZ A;  3T96 B;  4GWO A;  3SEU A;  3V5A A;  4BDL A;  3MAM A;  5CBS A;  1SPI A;  4ISU A;  2F36 A;  1A40 A;  5EQ7 A;  1QVS A;  4NF5 A;  2NVU B;  1IZ1 A;  3HHG A;  2V84 A;  4DXC A;  4H6D A;  2RF1 A;  1M5C A;  3O6H A;  1A7L A;  2F7A A;  5H8Q B;  4GBW A;  3K4U A;  5CRY A;  3PGF A;  2ONK E;  1LBC A;  1N04 A;  5IZ3 A;  4PQJ A;  4F1V A;  4XKR A;  4F3P A;  1QKB A;  1G0I A;  4PP0 A;  4NF8 B;  3UIF A;  3IOV A;  1XS5 A;  2AIX A;  2DWH A;  5LDZ A;  2B65 A;  4G2Z A;  3LC8 A;  4GWW A;  4PE3 A;  5F24 A;  4DI4 B;  5KDT A;  3EF7 A;  3E4R A;  2XXV A;  4PAK A;  5EYH A;  1FPK A;  2D21 A;  1Z7M E;  4FJP A;  1FPE A;  3FUZ A;  5IZZ A;  1LB9 A;  1TWY A;  4G68 C;  1MPC A;  4YB7 A;  3A3C A;  2NOO A;  1BK4 A;  1FPG A;  1EU8 A;  4KQP A;  2HFB A;  4ZE8 A;  2A5S A;  3H6T A;  4OVJ A;  1B0L A;  4HE2 A;  4GL8 A;  4PFR A;  5L9M A;  1LEV A;  2RIN A;  4OVQ A;  4NN3 A;  2ZYK A;  1MRP A;  1XI6 A;  2OWT A;  4O3A A;  4X48 A;  2ZNU A;  2PBW A;  3CFX A;  4LP2 B;  3K02 A;  1Y9U A;  1YYZ A;  5I57 A;  2Y5L A;  4JVI A;  4UAC A;  2F3B A;  2UYF A;  1LBW A;  3HST A;  1FBD A;  4L17 A;  4GFR A;  2KR0 A;  4ELP A;  1ZTY A;  4OVR A;  4GX6 A;  3RPW A;  3OOA A;  3IOW A;  2I6E A;  3LUZ A;  4PET A;  4PGN A;  1VFE A;  4IO5 A;  5CI5 A;  2PT1 A;  3C31 A;  3PPQ A;  1B52 A;  4NE4 A;  1NNK A;  4IO7 A;  1B9J A;  1XVY A;  3OO8 A;  1RKM A;  1B1X A;  3FGS A;  5L9S A;  4AQ4 A;  3C35 A;  5AA2 D;  5I58 A;  3MVY A;  4E0W A;  3MP1 A;  4BDR A;  1JEU A;  3BFU A;  1FQC A;  3RT6 B;  3K0V A;  4MCO A;  3EQ1 A;  1SI1 A;  3MP8 A;  2Y84 A;  2P2A A;  2RKM A;  1OMP A;  2ZMB A;  4MLV A;  3ILT B;  1IMA A;  2O1M A;  3MZB A;  2H9B A;  1YZ0 A;  4O7I A;  5TU0 A;  5I2N B;  1QUJ A;  1SW1 A;  4UAB A;  4AS5 A;  3F11 A;  3W15 C;  3ISP A;  2OCU A;  3ZSF A;  1ANF A;  4GXA A;  2ZNT A;  3KZG A;  5AA1 A;  3UGW A;  2O69 A;  3DP6 A;  3OEK A;  4P11 A;  4YB6 A;  1FSA A;  3CG1 A;  5I7I A;  1FBF A;  5A5X B;  4OFO A;  1INP A;  3H03 A;  2OLB A;  4GXS B;  2ZZW A;  4IO6 A;  3OO9 A;  2F6G A;  1SI0 A;  2D5W A;  4AS4 A;  3O2A A;  1IMF A;  1NNT A;  5I2K A;  3W9V A;  3MYU A;  3SEX A;  2WYK A;  3I6V A;  3LSF B;  1XC1 A;  2XWI A;  3IO6 A;  4P1E A;  5DT6 A;  4C1T A;  4ZDM A;  1FW0 A;  2I4B A;  3T9X B;  2ZYM A;  4X1D A;  3S2V A;  4EXK A;  3IL1 B;  1QKA A;  1T0K A;  2O51 A;  3SER A;  4OEN A;  1FTL A;  3M3F A;  3ZKL A;  4QFP A;  4JB7 A;  2ZNS A;  3D4C A;  2JJK A;  3B50 A;  4MNP A;  4DZ1 A;  3EHU A;  2PYY A;  3FVO A;  3MW0 A;  4G4P A;  3RLF E;  4F3S A;  3PD8 A;  3HCQ A;  2DWI A;  1B40 A;  4G68 B;  1B3L A;  3TOD A;  1NMU A;  4P0I A;  1D9Y A;  4QFO A;  3PUZ E;  1I6Q A;  3KN7 A;  4PBQ A;  1B3F A;  4YZZ A;  3O6G A;  5HBC A;  2DSF A;  4LVQ A;  2PMS A;  3OEM A;  3OD7 A;  5ET6 A;  1EZ9 A;  2V93 A;  4U21 A;  1UIV A;  3K1P A;  5KCJ A;  4YAH X;  4EQ7 A;  2PX1 A;  4FBP A;  1JW1 A;  1LBV A;  2GHB A;  2ZXT A;  3AXF A;  2HXW A;  2ANJ A;  2Y7K A;  4IO4 A;  5IM2 A;  1RDX A;  4GQO A;  4NF0 A;  2CZI A;  4MLQ A;  3TKD A;  3CR9 A;  2Q8J A;  3Q27 A;  2ONR A;  3G3F A;  5L9O A;  3QUF A;  1K9Z A;  5A5L A;  2DS9 A;  4NF6 A;  3SEW A;  4ZED A;  1NV2 A;  4N6K A;  3RN8 A;  2PFZ A;  2YJP A;  1ZJL A;  1OVB A;  1SQY A;  3FV1 A;  3KFM A;  1GV8 A;  1N76 A;  4NQ8 A;  3VLV A;  3KGC A;  4MBP A;  1AMF A;  2Z22 A;  5DEX B;  4NF4 B;  4U23 A;  2Y7I A;  3JZJ A;  3VXB A;  3U65 A;  2F3D A;  3TEP A;  2O7I A;  1M5D A;  5EYG A;  1DPP A;  2GFE A;  3TQL A;  1NFT A;  3CFL A;  1K9Y A;  3OO6 A;  2GHA A;  3O29 A;  4POX A;  4ELO A;  4OHN A;  3VLW A;  3UA8 A;  3PUW E;  1N3X A;  3FXR A;  1IEJ A;  4F3G A;  1MQH A;  2XX7 A;  4R74 A;  4ZZA A;  3PMV A;  2O84 X;  4NF5 B;  1FCK A;  1B7H A;  4ZEC A;  3GXA A;  4WKM A;  1SDX A;  1N0T A;  4KYS A;  2VD3 A;  2RC7 A;  4O94 A;  2Q88 A;  1LBZ A;  5IZ3 B;  3K00 A;  4QXD A;  4ZEB A;  1Y1M A;  4N13 A;  4PFI A;  3E3K A;  3T9H B;  2B4M A;  3B7D A;  3VV5 A;  1YXI A;  3QAX A;  1B6H A;  4XEQ A;  3K6V A;  1A99 A;  2D3I A;  1B46 A;  5KDT B;  3LUY A;  1QW0 A;  1FPJ A;  1OVT A;  2QJE A;  2UVJ A;  3H6V A;  3PV0 E;  1IXI A;  3HHF A;  1DBZ A;  4JWY A;  1NUZ A;  2QFL A;  2QS3 A;  1EZO A;  3FJ7 A;  3HV1 A;  4ND9 A;  4OFL A;  5H8H A;  3SES A;  1AOV A;  4N07 A;  3LV0 A;  4PC9 A;  4HXV A;  3IO4 A;  4I62 A;  4KXP A;  4GLI A;  3RNN A;  2Z8E A;  1EH3 A;  3FAS A;  3TZA A;  2XWO A;  4FIM A;  4M1V A;  1PBP A;  1DCU A;  4G61 A;  3IJO B;  3Q28 A;  4U1Z A;  5CMM A;  1JW4 A;  1Z7N E;  5KZT A;  3B6W A;  3OXN A;  1FRP A;  4N4U A;  1FPL A;  5CMC A;  4IB2 A;  1FPF A;  4H46 A;  1Y1Z A;  3GZG A;  3P7I A;  4H5G A;  4PF8 A;  5CM6 A;  3EHS A;  2NUV A;  2UVI A;  5TPA A;  3RUM A;  4H45 A;  4FEB A;  4F1U A;  1R9L A;  1ZMG A;  3O66 A;  4BDN A;  4F2O A;  2H98 A;  4LQ2 A;  3FZV A;  3SET A;  4THI A;  1TXF A;  2B3B A;  1MH4 A;  1DK4 A;  4N6D A;  5DYH A;  2IA4 A;  1IQ7 A;  1FBH A;  2BJI A;  5I58 B;  1FQD A;  4H67 A;  1FJ6 A;  4I8C A;  1M5B A;  2OZZ A; 
#chains in the Genus database with same CATH homology
 1M5E A;  1QJM A;  3K2D A;  2DQV A;  4FAJ A;  3KJT A;  1P1Q A;  1Y20 A;  4GVO A;  2H4I A;  4RXL A;  3Q25 A;  4R2B A;  3M3K A;  4FAT A;  3N94 A;  2Z8F A;  1JET A;  1OQG A;  2XXH A;  3G3J A;  3FJM A;  4RPN A;  4PE5 B;  4AB6 A;  3W9W A;  3V83 A;  3GLB A;  1IIT A;  3S9L C;  5ICQ A;  1LB8 A;  1MY1 A;  1FQE A;  1LAG E;  4TOZ A;  3TYH A;  4ZEI A;  2HZK A;  1QUK A;  4LAT A;  3JV9 A;  1PEB A;  1OLC A;  4KYD A;  1B0H A;  2DE4 A;  1PB8 A;  2XD2 A;  4PFT A;  3FAT A;  4POW A;  4LUB A;  1TT1 A;  3PD9 A;  3U94 A;  3HPI A;  5I2K B;  3PUX E;  5L8D A;  3VLU A;  3TTL A;  2F35 A;  3VFJ A;  1MQI A;  3BFT A;  1R9Q A;  1BP5 A;  5K2X A;  3MP6 A;  3U1O A;  3IB2 A;  4KD5 A;  2F8D A;  3OSQ A;  1DOT A;  4H8I A;  2REJ A;  1VE4 A;  3IB0 A;  3R7X A;  1D3K A;  3TMG A;  5IAI A;  3VXC A;  1B5J A;  2RC8 A;  2F97 A;  4QF9 A;  2YPN A;  1XVX A;  3TTN A;  1FTJ A;  1F9B A;  3PMW A;  3M3L A;  5K2Y A;  3TTK A;  4FEC A;  1D4N A;  5I56 A;  2H99 A;  2OWS A;  2HAV A;  4GL0 A;  1H43 A;  1IXC A;  1B7U A;  5M2V A;  3TEL A;  1US5 A;  5CMB A;  1SW4 A;  2UVG A;  2DP8 A;  1MXZ A;  2XXU A;  1FTK A;  4NWC A;  1ZKB A;  3FJG A;  4KCC A;  5I59 A;  1JEV A;  3OEL A;  3VVF A;  4IO2 A;  3C36 A;  3MQ9 A;  5CMK A;  3CIJ A;  3D4G A;  1B2H A;  4O3C A;  3THI A;  3N6T A;  2QS4 A;  2HZL A;  2DWA A;  1PC3 A;  4OZ9 A;  4UA8 A;  4F39 A;  1Q1K A;  1MDQ A;  5TP9 A;  3OMB A;  4YIC A;  3DP4 A;  3N5L A;  2DWJ A;  4R9F A;  4R73 A;  4R9G A;  1MY2 A;  4RA1 A;  3DP8 A;  3O28 A;  3KJ7 A;  3B6Q A;  3QXM A;  1B05 A;  1LAH E;  4H1X A;  2HCA A;  2I3W A;  1URS A;  4NF6 B;  2XXP A;  4YKJ A;  3H6U A;  4F2Q A;  2M8C A;  3MUQ A;  1FQF A;  3LSW A;  4P0G A;  1JQF A;  5FHN A;  2FNC A;  2F34 A;  1USY H;  2DYX A;  1MH3 A;  5DVI A;  2ABH A;  3C34 A;  2V3T A;  3TFL A;  5DVJ A;  1P1O A;  2R71 A;  4XKP A;  3TTR A;  2HEU A;  4AB5 A;  4EQB A;  3H4Z A;  3U93 A;  5HM4 B;  1UIU A;  4F1Y A;  3FD3 A;  3S9N C;  2P0S A;  2QMW A;  4Z0I A;  1P99 A;  3PPP A;  3G3G A;  3G3K A;  3PU5 A;  4DLD A;  4PFU A;  1PBQ A;  3ZKK A;  1JW5 A;  4RK2 A;  5JTY A;  4C0R A;  4QFL A;  2CZL A;  5EHM A;  5AA4 A;  3IJX B;  4EUO A;  3UK4 A;  5ELV A;  3H6W A;  4IO3 A;  2PVU A;  3IOT A;  3K1M A;  3RQT A;  3CRB A;  3C4M A;  3M8U A;  5H8F A;  1UTH A;  2CMO A;  3WAF A;  2QS1 A;  4DCY A;  2XXQ A;  4ESX A;  1MXU A;  2XXY A;  4U4X A;  2Y7W A;  4DXU A;  5CBR A;  3VVE A;  2G29 A;  3KN8 A;  3S4U A;  4DDD A;  2RCA A;  3LSL A;  3MWB A;  3K1N A;  3PPN A;  1MM7 A;  4TLL B;  2I49 A;  5EHS A;  1SVX B;  3DM0 A;  3CI8 A;  5JEI A;  1LLS A;  3S9E A;  1FTO A;  5H8H B;  2NWJ A;  3Q29 A;  1NKX A;  4U4S A;  1LAX A;  1YAE A;  4OFJ A;  4HTG A;  2QL3 A;  4WEP A;  1PB9 A;  4OEV A;  1FQB A;  5FTI A;  1ZIU A;  2ZYO A;  1LST A;  1UTB A;  4TQU Q;  5AE4 A;  1LFG A;  3ONM A;  1ATG A;  5FHM A;  3FIR A;  4LZ8 A;  4KR5 A;  1HSE A;  3H3G A;  2LAO A;  4IGT A;  1IUD A;  4BDM A;  4FED A;  1FTM A;  1I6A A;  3ECR A;  1HSL A;  2I48 A;  5TPA B;  4I1D A;  2XHD A;  4G77 A;  2F7B A;  5B70 A;  3LSX A;  4Q30 B;  4E0X A;  3G3H A;  4M4G A;  3MBP A;  4R6H A;  4QSE A;  1N84 A;  1O64 A;  2ESN A;  1BTJ A;  1RYX A;  4KFQ A;  3GBA A;  3KSJ A;  4QRZ A;  3K6W A;  3BKI B;  5LOM A;  2DXY A;  4H0W A;  3I5O A;  1GVC A;  3OEN A;  2I0B A;  3RGY A;  3IOU A;  1MXX A;  4U2R A;  3K01 A;  1N7X A;  5FTH A;  4N6P A;  4OMB A;  2OK2 A;  4EQ9 A;  4GRK A;  3PPO A;  2QS2 A;  3IB1 A;  3FVN A;  3VVD A;  1NL5 A;  3QIM A;  3LBS A;  1POY 1;  4HCY A;  5DTB A;  1XOC A;  4RJZ A;  1B4Z A;  1S9T A;  3LR1 A;  1B32 A;  2DOJ A;  3H7M A;  2BJJ X;  3G3I A;  1YCJ A;  2QSX A;  2UYE A;  1POT A;  4I9D A;  4H65 A;  1MS7 A;  3KG2 A;  1MPB A;  4DIG A;  2F7C A;  1S7Y A;  3UP9 A;  4HS7 A;  1XHY A;  1QUI A;  3U92 A;  1B3G A;  3RTW B;  1N7W A;  1R1N A;  3T66 A;  4LA9 A;  2VGQ A;  1HSJ A;  1LCF A;  1MXY A;  3KOT A;  4LQ5 A;  5H8N A;  4JBZ A;  4KCD A;  3MPK A;  5I57 B;  4F18 A;  1IXG A;  1OQH A;  3N26 A;  1LBB A;  4EF2 A;  2GRV A;  4RK9 A;  2XXR A;  2WKY A;  4BDQ A;  2A5T A;  1B3E A;  3RTF B;  4YB5 A;  5I56 B;  3FVG A;  4X1B A;  2H25 A;  5ISU A;  2NXO A;  1B5I A;  1DTG A;  2DE2 A;  1S50 A;  1EZP A;  3PPR A;  4KPT A;  1NH8 A;  2XD3 A;  2RCB A;  4JSO A;  4R75 A;  4FOR A;  4XXU A;  2VD2 A;  4XKN A;  2Q2C A;  5DEX A;  1P1W A;  1GGG A;  4DCX A;  2B3F A;  1URG A;  1SW5 A;  3Q26 A;  4ELQ A;  1Y3Q A;  3VE1 B;  4TLM B;  5I59 B;  2O7U A;  1MQG A;  2AL5 A;  3O9P A;  5IKB A;  4EF1 A;  3RY3 A;  3T93 B;  1II5 A;  1FQA A;  4ZEF A;  4OXV A;  1LFH A;  2Q89 A;  1BKA A;  3SKP A;  4NTL A;  5AA2 A;  4OYV A;  5TP9 B;  4YMB A;  3CFZ A;  1DTZ A;  3EHT A;  3KSX A;  4ZEK A;  1WOD A;  5CC2 A;  1DPE A;  4ELR A;  3TDJ A;  3IOR A;  1A55 A;  3PUV E;  3BBR A;  4K3F A;  1H44 A;  4YU0 A;  3TUS A;  5I84 A;  4RPO A;  3CSB A;  2F78 A;  4KI0 E;  3R26 A;  1DSN A;  1CB6 A;  2RC9 A;  3UOR A;  4X9T A;  4GOT A;  1I69 A;  4OWD A;  4PFW A;  1MG1 A;  1LCT A;  3SEY A;  2O1L A;  1WVJ A;  4YKI A;  3CVG A;  3EPE A;  4MF3 A;  3CG3 A;  4MH5 A;  1B3H A;  5BWJ A;  1B51 A;  3HO7 A;  3T9V A;  1MQD A;  4ZS9 A;  5B7D A;  4HW8 A;  1Y4C A;  4RYA A;  3KBR A;  4JWX A;  5ICT A;  2Y7R A;  4G8N A;  4XTC Q;  3VDF A;  4R72 A;  2FYI A;  3C33 A;  1GR2 A;  2ONS A;  1VSO A;  3PMX A;  5JTY B;  3TCH A;  4OES A;  5AA4 B;  5JK4 A;  5FHO A;  1MXV A;  1MY0 A;  4JSD A;  4PFY A;  3JYR A;  1B5H A;  3QK6 A;  4YMA A;  4ONY A;  3DLN A;  4IY6 A;  3KEI A;  3A3U A;  1YTV A;  1LGB C;  4LON B;  4DE8 A;  5H8F B;  2Z23 A;  2Y7P A;  1UTH B;  2P1S A;  1MY3 A;  3TCG A;  4ECF A;  3V8X B;  4RNS A;  3UN6 A;  4OET A;  3N6U A;  3B6T A;  5KCJ B;  2Q2A A;  1SBP A;  5J1D A;  2G93 A;  3MVZ A;  3DEL B;  3FXQ A;  4F22 A;  4IY5 A;  4OER A;  1WDN A;  1NNP A;  3O6I A;  3L6G A;  3IX1 A;  2UVH A;  3KOS A;  1J1N A;  1ZBM A;  5H8Q A;  3SDF A;  5ITO A;  2DVC A;  1LFI A;  3FV2 A;  3K6X A;  4YKK A;  2XXI A;  4NF8 A;  2XX8 A;  1O7T A;  4KYE A;  1B7Z A;  1H3D A;  4DXB A;  2I0C A;  1Y3N A;  3TAJ A;  1UTB B;  2I4C A;  4Z7E A;  1UQW A;  2O68 A;  4F29 A;  4NMY A;  5BUU A;  2THI A;  1SYI A;  2E0S A;  1B1H A;  3MC2 A;  3FXU A;  3QYT A;  4NED A;  2ZYN A;  1ZLQ A;  3E9X A;  1JVX A;  4U1O A;  2DE3 A;  3H06 B;  2VHA A;  1I6B A;  4H5F A;  1H76 A;  4ESW A;  1Y4T A;  3MPL A;  1NH7 A;  2DVZ A;  2X7P A;  4BLA A;  3O97 A;  3PUY E;  2W7Y A;  4EDP A;  3WAE A;  1A54 A;  3TTM A;  4IGR A;  3C9H A;  2V25 A;  2REG A;  4JXI A;  3FVK A;  4OEU A;  1MY4 A;  2VP1 A;  2UXA A;  4QFK A;  4R6Y A;  1GTK A;  1JVY A;  1SD3 A;  2R9J A;  3HN0 A;  4H8J A;  2GH9 A;  2XX9 A;  4YKP A;  3C32 A;  3RT8 A;  4RY1 A;  4OTE A;  4XKQ A;  4GIZ A;  3TQW A;  2Q9T A;  1L5T A;  1B4H A;  5HPQ A;  4WED A;  3IK6 B;  4WXJ A;  1XT8 A;  1P1U A;  1ZU0 A;  4QSC A;  4F31 B;  5I2N A;  2X26 A;  3MZ1 A;  2VOZ A;  3OO7 A;  2IEE A;  1ELJ A;  2OJT A;  3CSG A;  3TPA A;  5H8N B;  3G7W A;  2PT2 A;  4G8H A;  3T22 A;  3I3V A;  3QSL A;  4QHQ A;  1US4 A;  2QRY A;  5A5X A;  4R6K A;  1TFD A;  3EN3 A;  5ITP A;  3IR1 A;  3K6U A;  1A8E A;  4HCW A;  2A5T B;  4F19 A;  3MZ9 A;  2I58 A;  1PB7 A;  2HAU A;  3SEV A;  3E13 X;  1MXW A;  3U72 A;  4NWD A;  4QSD A;  2F6P A;  2XXT A;  2KLF A;  2V3U A;  4GD5 A;  4EXL A;  1MQJ A;  4ZZE A;  3USD A;  1D9V A;  3MVX A;  4KHZ E;  1AIV A;  1AH5 A;  1YPN A;  3KN3 A;  1USY E;  1BIY A;  2F5X A;  3MJN A;  4XIG Q;  1IXH A;  3A09 A;  1B58 A;  4ZE9 A;  4LZ5 A;  4Q0C A;  4JWO A;  3V89 B;  2I3V A;  5AA2 B;  3QUJ A;  1OIB A;  4G68 A;  1H45 A;  1NNF A;  2AYS A;  5H8S A;  3IAZ A;  1VFD A;  2OBG A;  4JDF A;  2QMX A;  1AL3 A;  3R6U A;  3S9M C;  1BLF A;  2Z8D A;  1M5F A;  2FA7 A;  1PDA A;  1SYH A;  4BDO A;  1KWH A;  4QFN A;  3TCF A;  2E1S A;  2XXW A;  5F1Q A;  2O6A A;  1MDP 1;  2HQ0 A;  2X7Q A;  1URD A;  2R6G E;  3ILU B;  1P1N A;  2V3Q A;  5EYF A;  2H5Y A;  1Q35 A;  4G8M A;  3ZS6 A;  4MFI A;  1N3W A;  1VR5 A;  3OSR A;  1SW2 A;  1MM6 A;  1TFA A;  1OLA A;  1QUL A;  4C1U A;  1DMB A;  1IIW A;  1CE2 A;  2YLN A;  3ODB A;  1A8F A;  4U22 A;  5DVF A;  4OQO A;  1MPD A;  4O3B A;  2ALU A;  4Q8R A;  4Q5T A;  4NF4 A;  4F3B A;  4FE8 A;  3L6H A;  2XXX A;  3T9U A;  1LAF E;  4R2F A;  5F7V A;  4GF8 A;  1R6Z A;  1RYO A;  5AA3 A;  4LZ7 A;  3MVW A;  1JNF A;  2AL4 A;  1O63 A;  3GBB A;  2DXR A;  2QPQ A;  3U8Q A;  1Y3P A;  3T96 B;  4GWO A;  3SEU A;  3V5A A;  4BDL A;  3MAM A;  5CBS A;  4ISU A;  2F36 A;  1A40 A;  1QVS A;  4NF5 A;  2NVU B;  1IZ1 A;  3HHG A;  2V84 A;  4DXC A;  4H6D A;  2RF1 A;  1M5C A;  3O6H A;  1A7L A;  2F7A A;  5H8Q B;  3K4U A;  5CRY A;  3PGF A;  2ONK E;  1LBC A;  1N04 A;  4PQJ A;  4F1V A;  4XKR A;  4F3P A;  1QKB A;  4PP0 A;  4NF8 B;  3UIF A;  3IOV A;  1XS5 A;  2AIX A;  2DWH A;  2B65 A;  4G2Z A;  3LC8 A;  5KDT A;  3EF7 A;  3E4R A;  2XXV A;  2D21 A;  1Z7M E;  4FJP A;  3FUZ A;  1LB9 A;  1TWY A;  4G68 C;  1MPC A;  4YB7 A;  3A3C A;  2NOO A;  1EU8 A;  4KQP A;  2HFB A;  4ZE8 A;  2A5S A;  3H6T A;  4OVJ A;  1B0L A;  4GL8 A;  5L9M A;  2RIN A;  2ZYK A;  1MRP A;  2OWT A;  4O3A A;  4X48 A;  2ZNU A;  2PBW A;  3CFX A;  4LP2 B;  3K02 A;  1Y9U A;  5I57 A;  4UAC A;  2UYF A;  3HST A;  4L17 A;  4GFR A;  4ELP A;  1ZTY A;  3RPW A;  3OOA A;  3IOW A;  2I6E A;  4PET A;  1VFE A;  4IO5 A;  5CI5 A;  2PT1 A;  3C31 A;  3PPQ A;  1B52 A;  4NE4 A;  1NNK A;  4IO7 A;  1B9J A;  1XVY A;  3OO8 A;  1RKM A;  1B1X A;  3FGS A;  5L9S A;  4AQ4 A;  3C35 A;  5AA2 D;  5I58 A;  3MVY A;  4E0W A;  3MP1 A;  4BDR A;  1JEU A;  3BFU A;  1FQC A;  3RT6 B;  3K0V A;  3EQ1 A;  1SI1 A;  3MP8 A;  2Y84 A;  2P2A A;  2RKM A;  1OMP A;  2ZMB A;  4MLV A;  3ILT B;  2O1M A;  3MZB A;  2H9B A;  5TU0 A;  5I2N B;  1QUJ A;  1SW1 A;  3F11 A;  3W15 C;  2OCU A;  3ZSF A;  1ANF A;  4GXA A;  2ZNT A;  3KZG A;  5AA1 A;  3UGW A;  2O69 A;  3DP6 A;  3OEK A;  4P11 A;  4YB6 A;  3CG1 A;  5A5X B;  4OFO A;  3H03 A;  2OLB A;  4GXS B;  4IO6 A;  3OO9 A;  2F6G A;  1SI0 A;  2D5W A;  3O2A A;  1NNT A;  5I2K A;  3W9V A;  3SEX A;  3I6V A;  3LSF B;  1XC1 A;  3IO6 A;  5DT6 A;  4C1T A;  4ZDM A;  1FW0 A;  2I4B A;  3T9X B;  2ZYM A;  4X1D A;  3S2V A;  4EXK A;  3IL1 B;  1QKA A;  1T0K A;  2O51 A;  3SER A;  4OEN A;  1FTL A;  3M3F A;  3ZKL A;  4QFP A;  4JB7 A;  2ZNS A;  3D4C A;  4DZ1 A;  3EHU A;  2PYY A;  3FVO A;  3MW0 A;  4G4P A;  3RLF E;  4F3S A;  3PD8 A;  3HCQ A;  2DWI A;  1B40 A;  4G68 B;  1B3L A;  3TOD A;  1NMU A;  4P0I A;  1D9Y A;  4QFO A;  3PUZ E;  1I6Q A;  3KN7 A;  4YZZ A;  1B3F A;  3O6G A;  5HBC A;  2DSF A;  4LVQ A;  2PMS A;  3OEM A;  3OD7 A;  1EZ9 A;  2V93 A;  4U21 A;  1UIV A;  3K1P A;  5KCJ A;  4YAH X;  4EQ7 A;  2PX1 A;  1JW1 A;  2GHB A;  2ZXT A;  3AXF A;  2HXW A;  2ANJ A;  2Y7K A;  4IO4 A;  4GQO A;  4MLQ A;  3TKD A;  3CR9 A;  2Q8J A;  3Q27 A;  2ONR A;  3G3F A;  5L9O A;  3QUF A;  2DS9 A;  4NF6 A;  3SEW A;  4ZED A;  3RN8 A;  2YJP A;  1ZJL A;  1OVB A;  1SQY A;  3FV1 A;  3KFM A;  1GV8 A;  1N76 A;  3VLV A;  3KGC A;  4MBP A;  1AMF A;  2Z22 A;  5DEX B;  4NF4 B;  4U23 A;  2Y7I A;  3JZJ A;  3VXB A;  3TEP A;  2O7I A;  1M5D A;  1DPP A;  2GFE A;  3TQL A;  1NFT A;  3CFL A;  3OO6 A;  2GHA A;  3O29 A;  4POX A;  4ELO A;  4OHN A;  3VLW A;  3UA8 A;  3PUW E;  1N3X A;  3FXR A;  1IEJ A;  4F3G A;  1MQH A;  2XX7 A;  4R74 A;  4ZZA A;  3PMV A;  2O84 X;  4NF5 B;  1FCK A;  1B7H A;  4ZEC A;  3GXA A;  4WKM A;  1SDX A;  1N0T A;  4KYS A;  2VD3 A;  2RC7 A;  2Q88 A;  3K00 A;  4ZEB A;  1Y1M A;  4N13 A;  3E3K A;  3T9H B;  3B7D A;  3VV5 A;  3QAX A;  1B6H A;  3K6V A;  1A99 A;  2D3I A;  1B46 A;  5KDT B;  3LUY A;  1QW0 A;  1OVT A;  2QJE A;  2UVJ A;  3H6V A;  3PV0 E;  1IXI A;  3HHF A;  4JWY A;  2QS3 A;  1EZO A;  3FJ7 A;  3HV1 A;  4ND9 A;  4OFL A;  5H8H A;  3SES A;  1AOV A;  4N07 A;  3IO4 A;  4I62 A;  4GLI A;  3RNN A;  2Z8E A;  1EH3 A;  3FAS A;  3TZA A;  4FIM A;  4M1V A;  1PBP A;  3IJO B;  3Q28 A;  4U1Z A;  5CMM A;  1JW4 A;  1Z7N E;  5KZT A;  3B6W A;  3OXN A;  5CMC A;  4IB2 A;  1Y1Z A;  3GZG A;  3P7I A;  4H5G A;  5CM6 A;  3EHS A;  2NUV A;  2UVI A;  5TPA A;  3RUM A;  4FEB A;  4F1U A;  1R9L A;  1ZMG A;  3O66 A;  4BDN A;  4F2O A;  2H98 A;  4LQ2 A;  3FZV A;  3SET A;  4THI A;  1TXF A;  2B3B A;  1MH4 A;  5DYH A;  2IA4 A;  1IQ7 A;  5I58 B;  1FQD A;  4H67 A;  4I8C A;  1M5B A;  2OZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...