3T22A

Crystal structure of oxyr mutant from porphyromonas gingivalis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
218
structure length
210
Chain Sequence
GRLNIAVLPTIAPYLLPRVFPIWKKELAGLEIHVSEMQTSRCLASLLSGEIDMAIIASKAETEGLEDDLLYYEEFLGYVSRCEPLFEQDVIRTTEVNPHRLWLLDEGHSFRDQLVRFCQMAYSGGSMEAFMRLVESGQGITFIPQLTVEQLSPSQKELVRPFGMPRPVREVRLAVRQDYSRRKLREQLIGLLRSAVPSDMHKLQTGQHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Redox-sensitive transcriptional activator OxyR
publication title Structures of the Porphyromonas gingivalis OxyR regulatory domain explain differences in expression of the OxyR regulon in Escherichia coli and P. gingivalis.
pubmed doi rcsb
source organism Porphyromonas gingivalis
total genus 66
structure length 210
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3t22A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3t22A02
1A8FA 3H6TA 3W9WA 3MP1A 1UTHA 1SYIA 2CZLA 3ILTB 2Z23A 4FJPA 4ZEFA 3ZKKA 2X7QA 1MY0A 1FTOA 4KQPA 3TZAA 3JV9A 3HN0A 2YJPA 1LSTA 1Y9UA 2Y84A 4G68A 3H4ZA 3TKDA 1MH4A 1Y3PA 3PUZE 1B05A 3T9XB 1MXYA 2AL4A 1SW2A 1B2HA 5B70A 3EF7A 4OEUA 3SEYA 2F7AA 4U4XA 2LAOA 1N7XA 4U4SA 1JW5A 3IB0A 1Y20A 4N13A 1TWYA 3H03A 3SKPA 3DP8A 2GHBA 3OO8A 4YB5A 1H3DA 3PPPA 3UP9A 5IKBA 1M5DA 2NXOA 2O7IA 1J1NA 1MQHA 3CFLA 5H8HA 2HQ0A 1USYE 2DXYA 2DQVA 1I6BA 2PVUA 2ZYKA 3ZKLA 2OK2A 3ZSFA 1DOTA 3CG3A 3MJNA 1MM6A 2DE4A 5K2XA 1UTHB 1A99A 4RXLA 3O9PA 3QSLA 3KOTA 4DE8A 3S9NC 4XKPA 1Y3NA 3MVWA 4EUOA 3TELA 2D21A 1LGBC 5H8FA 3CR9A 4NWDA 4F29A 1M5EA 3S4UA 4OTEA 2ZNSA 2F7BA 3RLFE 2DSFA 4MF3A 4TOZA 3G3FA 2PBWA 2Q8JA 4F3BA 2F34A 1US4A 4GWOA 3FVNA 1XS5A 2P0SA 5DVFA 1NH8A 4R72A 4FORA 2RINA 1MPBA 4QFKA 2F35A 2THIA 4QF9A 4H8JA 3EQ1A 1L5TA 4RPNA 3HO7A 2I0CA 2HCAA 4TLLB 5FTHA 3O6HA 3PPNA 5H8HB 5TPAA 1JETA 1TXFA 4KPTA 3RNNA 2XXXA 3RGYA 2OLBA 1IXHA 4DXCA 1D9YA 1LAGE 3OSQA 2IEEA 4G68C 1AMFA 4OFLA 1FTLA 3LR1A 4H0WA 5I58A 3MPLA 3FASA 5H8FB 5FHMA 4XKQA 3CG1A 1EH3A 5KCJA 3RT8A 3PPQA 1FQDA 3IX1A 2DP8A 1URSA 5AA2D 4R75A 3G3IA 3IR1A 1FTMA 2PT1A 3VLVA 2H98A 3H6VA 5H8SA 4BDMA 4PP0A 1MXWA 1XVYA 2QS4A 3VXBA 3MQ9A 2I4CA 3GXAA 3RUMA 2QPQA 3VV5A 3GBBA 3EHUA 3FIRA 2CMOA 3VLWA 2PYYA 3O66A 4QFLA 3R7XA 3U94A 3L6GA 4OWDA 4YICA 3G3KA 4NF8A 2UVGA 1LBBA 2UYFA 1UIVA 3KN3A 4KYSA 1VE4A 1NNTA 5JTYA 1XHYA 2Y7IA 1ZLQA 3CIJA 1O64A 4EF1A 3IAZA 5M2VA 1XC1A 3PMXA 2REJA 3OELA 4YMBA 4H67A 3K01A 4IO6A 2ZYMA 5EHMA 4R73A 3MWBA 1LB9A 3FVGA 5KZTA 2DWHA 4LP2B 4PETA 3TTNA 3CFZA 3SEUA 1S50A 4ISUA 2OWTA 4OENA 4H6DA 3VFJA 4BDQA 4F39A 3B6TA 4MLVA 3DP6A 1B3HA 2VGQA 3K6WA 4TQUQ 4OZ9A 3TTLA 1ANFA 2XXIA 1MDQA 1BP5A 4GXSB 4GFRA 3FVKA 1TFAA 2RCAA 2DXRA 4NF8B 1LFGA 1GTKA 4MFIA 4FIMA 2H99A 5BUUA 1B6HA 1D3KA 5JTYB 2F78A 3ILUB 2Y7WA 4NWCA 4F1YA 4JSOA 4ZEBA 2QS2A 4NF6A 3D4CA 1RYXA 1LCFA 3LBSA 2HZKA 1S7YA 2O68A 4OERA 3FV2A 3TDJA 4WXJA 4GOTA 4RY1A 4GIZA 1QULA 2HFBA 4RJZA 3B6WA 2DVZA 4YKIA 3QYTA 3PPOA 3DM0A 4IGTA 4R6KA 1ATGA 4JSDA 2O51A 4RPOA 3FVOA 2QS3A 3DP4A 3G3GA 4XIGQ 1F9BA 1I69A 3TCGA 1QJMA 4UA8A 3M8UA 3UGWA 3CRBA 2ZMBA 3RN8A 2YLNA 5DT6A 2O7UA 3HCQA 4KD5A 1T0KA 4ESXA 3GLBA 3PUXE 3T22A 5I2KA 1P1WA 4G8HA 4R2BA 5CI5A 1WODA 5DEXA 1USYH 3A3CA 4PFTA 2RKMA 4MBPA 4NF6B 1VSOA 1MY3A 2OBGA 3TAJA 2OJTA 4Z7EA 3PMWA 1MXUA 1B7ZA 3PUWE 1FQBA 3IK6B 5H8NB 1D9VA 3TFLA 1DSNA 1A55A 5AA3A 2H9BA 1FQFA 4QFOA 4UACA 2Q2AA 1Z7ME 3C36A 3DLNA 3A3UA 3UIFA 5I56B 3QUJA 1FTKA 2Z8DA 1BIYA 5CRYA 5DYHA 3IOWA 1HSLA 4X48A 2V84A 2XXWA 3PPRA 3U1OA 1B3GA 3G3JA 1SVXB 3K2DA 3VXCA 4TLMB 4BDLA 1YAEA 2G93A 4LATA 3OOAA 2UXAA 1MY2A 4LUBA 5I2KB 2HEUA 2A5TA 1NNPA 3UORA 2QJEA 5DEXB 4GVOA 4IY6A 1H44A 1UTBA 2Z8EA 1YTVA 4IO3A 4F19A 2VHAA 3IO4A 3PUVE 1QKAA 2HAUA 2XXYA 4GXAA 1MY4A 1JW4A 4F2QA 3B7DA 5KDTB 2PMSA 4ZEDA 3FV1A 3KG2A 3MVYA 3SERA 1NNFA 4F2OA 2RCBA 1AIVA 1I6QA 1MG1A 1JEVA 3CFXA 4I62A 5FHOA 3F11A 4LA9A 2NVUB 4AB5A 4I1DA 4MH5A 5FHNA 4LZ7A 1B46A 2XD3A 1A7LA 4X1BA 4R2FA 1GR2A 4U2RA 2Z22A 4IO7A 3TUSA 4YZZA 2ESNA 3PMVA 2REGA 1O63A 1IITA 1PB9A 1WVJA 1B0LA 4ZE8A 3T96B 2RC9A 3DELB 1QUJA 2A5TB 3MP8A 1A40A 4C1TA 4GQOA 4WEDA 1B51A 3FGSA 1QKBA 4GRKA 2DE3A 1UTBB 4JXIA 3PV0E 3KJ7A 4F3PA 1NH7A 1OQGA 2F97A 5EYFA 4HS7A 2HZLA 1JEUA 2VD3A 4YB6A 1B9JA 2XXQA 1P99A 2A5SA 2D3IA 3MPKA 1B58A 1LCTA 5I84A 4U23A 5AE4A 1NKXA 2NWJA 3HV1A 5AA2A 3USDA 4RYAA 3SESA 3PD8A 5I2NB 3MVXA 3O2AA 1DTZA 2PT2A 3IB1A 5LOMA 1NL5A 1LLSA 1PB8A 3TTRA 1URGA 4P0IA 3V8XB 4DZ1A 4E0WA 4G4PA 3O6GA 2QS1A 3K6VA 4NEDA 2V3QA 1HSJA 1BKAA 2DE2A 3FJMA 1P1UA 2ZYOA 3S9MC 1B0HA 1Y3QA 1CE2A 5L8DA 1MQIA 3MAMA 4HTGA 2UVHA 4ZDMA 2GFEA 5AA1A 3OD7A 1NFTA 1SDXA 4QFNA 3EN3A 1IUDA 1DMBA 3C34A 3IB2A 3BBRA 4K3FA 2H5YA 3MP6A 4GL0A 4G2ZA 1ELJA 4G77A 4H8IA 1OLAA 2Y7KA 4BDOA 3K00A 1B4HA 3W9VA 3TPAA 4M1VA 5AA2B 3E3KA 4ND9A 2OZZA 1M5CA 1H76A 1JVYA 1ZKBA 3BFTA 3O29A 3IOVA 4H1XA 1EZOA 3KJTA 5DTBA 2YPNA 4M4GA 4PFYA 2VD2A 1SW1A 4GD5A 2V3TA 4WEPA 5FTIA 1SI0A 4U21A 1B3EA 4KCDA 2UVIA 3PGFA 1SBPA 1MRPA 4POWA 1POTA 2DOJA 1YPNA 3B6QA 4LZ8A 3THIA 4NF5A 3TODA 2DVCA 2M8CA 3FJGA 4U1ZA 1MDP1 2XX7A 3OO9A 4XXUA 3Q25A 1LAXA 1FW0A 1GV8A 3I3VA 3OSRA 4POXA 4IO2A 1GVCA 4F3SA 1OMPA 2AYSA 4JBZA 1OQHA 4OFJA 3PU5A 1MY1A 3HHGA 2I6EA 2Z8FA 3LSWA 1XOCA 1LBCA 3G7WA 4YKKA 5A5XA 4KCCA 2WKYA 3OXNA 3V5AA 4R9GA 3IOUA 2X7PA 3FXRA 3MBPA 3PUYE 1WDNA 4EQ9A 5ELVA 1P1QA 3CSGA 1B5HA 1SW5A 5CMKA 2ALUA 1GGGA 2F5XA 4EDPA 1OVBA 3FUZA 1M5BA 3T9VA 1EU8A 1IIWA 3EHSA 4G8MA 3VVFA 3OO6A 1XVXA 5ICTA 1B32A 2XXUA 1LB8A 3VVDA 3TEPA 2F7CA 4YKPA 4NF5B 1P1NA 1AOVA 4EQBA 1Q1KA 5B7DA 2NUVA 3K1PA 3VLUA 4I8CA 5ITOA 4Q8RA 2NOOA 4MLQA 5H8NA 3IORA 1MXVA 1FQEA 2O84X 1PBQA 5AA4A 2QMWA 3S2VA 2H25A 5ITPA 5I56A 1BLFA 4LQ5A 5A5XB 2F6PA 4Q30B 4KR5A 3C32A 4XTCQ 4KHZE 3GBAA 4R9FA 5ISUA 1QUIA 3KZGA 5JEIA 3H6UA 1ZJLA 3QIMA 1EZ9A 1AH5A 5F7VA 4R74A 4AB6A 1ZMGA 4JWXA 4DDDA 2B3BA 5CBRA 5L9SA 1B4ZA 1ZBMA 4X1DA 4HCWA 3WAFA 1S9TA 4ELQA 1N7WA 5I59B 2E1SA 2RC8A 3V89B 2D5WA 4G8NA 2I3VA 4EQ7A 4U1OA 3IO6A 3KN7A 1VFDA 2DS9A 4ZECA 4OVJA 1B40A 3G3HA 5KDTA 4ELRA 4RK9A 1SQYA 3QAXA 2PX1A 3TYHA 2HAVA 1OLCA 4OYVA 1ZU0A 4DXUA 3MC2A 1QW0A 3MZ1A 5AA4B 3FZVA 1US5A 2Y7PA 3TCHA 3K0VA 3OENA 3L6HA 2ZNUA 1POY1 2XXPA 4P11A 2KLFA 1B3LA 1UIUA 1PBPA 3MVZA 4O3BA 3I6VA 1B52A 2AL5A 1SW4A 5DVIA 4IB2A 3TTKA 5CBSA 1MS7A 4LONB 3K6UA 4DXBA 4YMAA 2V93A 3SEVA 1JNFA 4E0XA 3SDFA 3K02A 5L9OA 2XXTA 2I4BA 1IXIA 2FYIA 3LSLA 3HSTA 2AIXA 1B7UA 4OMBA 3U8QA 4NE4A 2OCUA 4DIGA 3N6TA 5CMMA 4YU0A 1N3WA 3E4RA 4FECA 5I2NA 2IA4A 1DPEA 1MM7A 4QFPA 1B1XA 1Q35A 1O7TA 3O97A 1VR5A 3LC8A 3TCFA 5HPQA 3QXMA 3Q29A 3TMGA 1SD3A 5H8QA 3Q28A 5CC2A 3H7MA 4F31B 3D4GA 1IQ7A 4IO5A 3BKIB 4NF4A 5EHSA 4HW8A 3N5LA 1N04A 3O28A 4R6YA 5I57A 2I48A 1FQCA 2ONRA 4F1VA 1AL3A 1LFIA 4ECFA 3ZS6A 3C4MA 4ESWA 1Y4TA 4RNSA 2XXRA 2QSXA 3TQLA 3CI8A 3QK6A 1URDA 3LSXA 4OESA 4AQ4A 5L9MA 1RKMA 2ZYNA 4IO4A 1B5IA 3ONMA 1I6AA 1H45A 4NTLA 1II5A 4G68B 5TP9A 1R6ZA 3VDFA 2I58A 4ELPA 1N3XA 3KFMA 1FCKA 3VVEA 4OETA 2RF1A 1P1OA 4RK2A 4YAHX 4ZEKA 4KI0E 1RYOA 5CMCA 4GL8A 3P7IA 3SEXA 2R71A 5H8QB 4GLIA 4Q5TA 4ZZEA 3UK4A 1TT1A 1Y1ZA 2F36A 4LVQA 4NF4B 3UA8A 4H65A 3R6UA 1YCJA 1A8EA 5F1QA 2FA7A 5I57B 4OFOA 4H5GA 4DCYA 1LAHE 3T93B 2Q88A 3FD3A 4OQOA 3O6IA 4DLDA 4JB7A 4FE8A 1XT8A 4FEBA 3CSBA 4RA1A 2W7YA 1JVXA 4I9DA 2DWJA 5BWJA 4QSDA 3M3KA 3CVGA 3KBRA 3JYRA 4FATA 4QSCA 1IZ1A 3KSJA 4IY5A 4H5FA 4F3GA 1ZIUA 5JK4A 3M3LA 1A54A 4DCXA 2ZXTA 5K2YA 4F22A 4C1UA 4GF8A 1VFEA 4BLAA 1LAFE 3W15C 5TP9B 2Q89A 2ABHA 4JDFA 1D4NA 4BDNA 4XKRA 1BTJA 1KWHA 1R9LA 5HBCA 1Y1MA 1R9QA 3KN8A 3VE1B 5J1DA 3N26A 4ONYA 3T66A 1PEBA 4F18A 3MZ9A 3U72A 3C9HA 3MUQA 1R1NA 3E9XA 2B3FA 2QL3A 3I5OA 1MQGA 2I3WA 2R6GE 3SEWA 1PB7A 2E0SA 5TPAB 2F6GA 4R6HA 2DYXA 2R9JA 1TFDA 2HXWA 2Q9TA 4FEDA 1MQDA 1IXGA 2FNCA 4N6PA 4PFWA 3U92A 4YKJA 3C35A 4LQ2A 2QMXA 4Z0IA 5I58B 1MPDA 4OHNA 1NNKA 1DTGA 1FTJA 1N84A 1M5FA 4F1UA 5KCJB 1NMUA 3RY3A 3FXQA 2VP1A 1ZTYA 3RTWB 3TQWA 4U22A 3AXFA 4LZ5A 4O3AA 3IL1B 2O1MA 3K1MA 4QRZA 1B1HA 3BFUA 4ZZAA 1JQFA 3EHTA 4EXKA 1Y4CA 1QUKA 2ZNTA 4XKNA 3S9EA 1N76A 4WKMA 3V83A 2O1LA 3U93A 1HSEA 1OVTA 3C31A 4Q0CA 1MH3A 5I59A 1FQAA 4YB7A 1MXXA 4IGRA 3WAEA 3FJ7A 4ELOA 1MQJA 3T9HB 4JWOA 2B65A 2ANJA 3TTMA 3LUYA 3UN6A 3KEIA 1EZPA 1H43A 2XXHA 2RC7A 3Q26A 4HCYA 5IAIA 2V25A 3K1NA 1DPPA 2O69A 4BDRA 4KFQA 3OO7A 4QHQA 3HPIA 3FATA 2BJJX 4O3CA 1JW1A 2Q2CA 3IJOB 3H6WA 1B7HA 1SYHA 4THIA 4OXVA 4NMYA 4FAJA 3LSFB 5HM4B 1QVSA 4EF2A 1B5JA 4P0GA 1IXCA 1B3FA 5TU0A 3MW0A 3ECRA 2GRVA 2DWIA 2I0BA 1Z7NE 4QSEA 3SETA 3Q27A 3K4UA 4C0RA 3H3GA 2XHDA 3ODBA 3R26A 3OMBA 5DVJA 1OIBA 3EPEA 1LFHA 4EXLA 5CM6A 1UQWA 2ONKE 4OEVA 2P2AA 2OWSA 3M3FA 3C33A 3OEKA 4ZE9A 4PQJA 3T9UA 2G29A 2VOZA 1N0TA 1CB6A 3A09A 2P1SA 2H4IA 3KSXA 3E13X 4ZS9A 3KGCA 2XD2A 1PDAA 4N07A 4JWYA 3RPWA 2Y7RA 2QRYA 3PD9A 1IEJA 2X26A 4KYDA 3MZBA 5ICQA 2UYEA 4PE5B 3OEMA 3RT6B 2I49A 3N6UA 2UVJA 2F8DA 2XXVA 2XX8A 2XX9A 3H06B 5CMBA 2DWAA 3KOSA 3QUFA 3FXUA 4PFUA 3GZGA 4KYEA 2ONSA 3K6XA 3JZJA 3N94A 3RTFB 2GH9A 3IOTA 4ZEIA 2GHAA 3S9LC 1MPCA 4L17A 1SI1A 2V3UA 2O6AA 3IJXB 3RQTA 1PC3A 3HHFA 4X9TA 1MXZA
chains in the Genus database with same CATH superfamily
1A8FA 3H6TA 3W9WA 3MP1A 4GBWA 1UTHA 1NV7A 4P8BA 1SYIA 2CZLA 3ILTB 2Z23A 4HXVA 1FJ6A 4FJPA 4ZEFA 3ZKKA 2X7QA 1MY0A 1FTOA 4KQPA 3TZAA 3JV9A 3HN0A 2YJPA 1LSTA 1Y9UA 1LBVA 2Y84A 2Q8MA 4G68A 3H4ZA 4I40A 3TKDA 1MH4A 1Y3PA 4MAGA 3PUZE 1B05A 3T9XB 1MXYA 2AL4A 1SW2A 1B2HA 5B70A 3EF7A 4OEUA 1FPGA 3SEYA 2F7AA 4U4XA 2LAOA 1N7XA 4MJOA 4U4SA 1JW5A 3IB0A 1Y20A 1YZ0A 4N13A 1TWYA 3H03A 3SKPA 2HHMA 3DP8A 2GHBA 2WBBA 3OO8A 4YB5A 1H3DA 3PPPA 3UP9A 2B4LA 5IKBA 1M5DA 4JVIA 2NXOA 2O7IA 4PGNA 1J1NA 1MQHA 3CFLA 5H8HA 2HQ0A 1NI9A 1USYE 2DXYA 2DQVA 1I6BA 1NV4A 2PVUA 2ZYKA 3ZKLA 2OK2A 3ZSFA 4GX6A 1DOTA 3CG3A 3MJNA 1MM6A 2DE4A 3A29A 5K2XA 1UTHB 1A99A 4RXLA 3O9PA 3QSLA 4OVPA 3KOTA 4DE8A 3S9NC 1IMAA 4XKPA 5EQAA 1Y3NA 3MVWA 4EUOA 3TELA 2D21A 1LGBC 5H8FA 3CR9A 4NWDA 4F29A 1M5EA 3S4UA 4OTEA 2ZNSA 2F7BA 2DSFA 4MF3A 3RLFE 3KC0A 4TOZA 3G3FA 2PBWA 4GWYA 2Q8JA 4F3BA 2F34A 1US4A 4GWOA 3FVNA 1XS5A 2P0SA 5DVFA 1NH8A 4R72A 4FORA 2RINA 1MPBA 4QFKA 4DI4B 4GWUA 2F35A 2THIA 4QF9A 3HFUA 5IGAA 4H8JA 3EQ1A 2XXKA 4RPNA 1L5TA 3HO7A 2I0CA 2HCAA 4TLLB 5FTHA 3O6HA 3PPNA 5H8HB 5TPAA 1JETA 1TXFA 4KPTA 2CZIA 2PCRA 3RNNA 2XXXA 3RGYA 2OLBA 1IXHA 3QMFA 2F3BA 4DXCA 1D9YA 4AS5A 1LAGE 3OSQA 2IEEA 4G68C 2MKZA 1AMFA 2B4MA 4OFLA 1FTLA 3LR1A 4H0WA 4QBAA 5I58A 3MPLA 3FASA 5H8FB 5FHMA 4XKQA 3CG1A 1EH3A 5KCJA 3RT8A 3PPQA 1FQDA 3IX1A 4PFIA 2DP8A 1URSA 5AA2D 4R75A 3G3IA 3IR1A 2QFLA 1FTMA 2PT1A 3VLVA 2H98A 3H6VA 3IFCA 5H8SA 4O7IA 4BDMA 4PP0A 4N8YA 4PF8A 1MXWA 1XVYA 2P3VA 2QS4A 3VXBA 3MQ9A 5ET7A 2I4CA 3GXAA 3RUMA 2QPQA 3VV5A 3GBBA 3EHUA 3FIRA 2CMOA 3VLWA 2PYYA 3O66A 4MX6A 4QFLA 3R7XA 2Q74A 3U94A 3L6GA 2WBDA 1FBFA 4OWDA 4YICA 3G3KA 4X04A 4NF8A 1LBZA 2UVGA 1LBBA 2UYFA 2WEFA 1UIVA 3KN3A 4KYSA 1VE4A 1NNTA 2KQZA 5JTYA 1XHYA 2Y7IA 1ZLQA 3CIJA 1O64A 3BIGA 4EF1A 3IAZA 5M2VA 1XC1A 3PMXA 2REJA 3OELA 4GWSA 3U65A 1EYKA 4YMBA 4H67A 3K01A 4IO6A 2ZYMA 4PAIA 5EHMA 4R73A 3MWBA 1LB9A 3NOHA 5IZ1A 3FVGA 1FPJA 2R8TA 1K9ZA 5KZTA 2DWHA 4LP2B 4PETA 3TTNA 2OWZA 3CFZA 3SEUA 1S50A 4ISUA 2OWTA 4OENA 4H6DA 1LBYA 3VFJA 4BDQA 4F39A 4UABA 3B6TA 4MLVA 3DP6A 3RPLA 1B3HA 2VGQA 3K6WA 4TQUQ 4OZ9A 3TTLA 1ANFA 2XXIA 1MDQA 1BP5A 1KA1A 4GXSB 4GFRA 3FVKA 1TFAA 2RCAA 2DXRA 4NF8B 1LFGA 1GTKA 4MFIA 4FIMA 2H99A 5BUUA 1B6HA 1D3KA 5JTYB 2CEXA 2F78A 3ILUB 4N81A 2Y7WA 4NWCA 4F1YA 4JSOA 4ZEBA 2QS2A 4QXDA 4NF6A 3D4CA 1RYXA 1LCFA 3LBSA 2HZKA 1FSAA 1S7YA 2O68A 4OERA 3FV2A 3TDJA 4WXJA 2BJIA 4GOTA 4RY1A 4XFEA 4GIZA 2WX9A 1QULA 2HFBA 4RJZA 3B6WA 2DVZA 4YKIA 3QYTA 3PPOA 1NV3A 3DM0A 3RPLB 4OVRA 4IGTA 4R6KA 5FBPA 1ATGA 4JSDA 2O51A 5IZ3A 4RPOA 3FVOA 2QS3A 3DP4A 3G3GA 4XIGQ 1F9BA 1I69A 3TCGA 1QJMA 4UA8A 3M8UA 3UGWA 3CRBA 5I5PA 2ZMBA 3RN8A 2YLNA 5DT6A 2O7UA 3HCQA 3MSTA 4KD5A 1T0KA 4PC9A 4ESXA 3GLBA 3PUXE 4N6KA 3T22A 5I2KA 1P1WA 1DK4A 4G8HA 3RYDA 4R2BA 5CI5A 1WODA 5DEXA 1USYH 3A3CA 4PFTA 2RKMA 4MBPA 4NF6B 1VSOA 1MY3A 2PFZA 2OBGA 3TAJA 4OVTA 2OJTA 4Z7EA 4MNIA 3PMWA 1MXUA 2ZZXA 1B7ZA 3PUWE 1FQBA 3IK6B 5H8NB 1D9VA 3TFLA 1DSNA 1A55A 5AA3A 2H9BA 1FQFA 2Y5KA 4O8MA 4QFOA 4UACA 2Q2AA 1Z7ME 3C36A 3DLNA 3A3UA 3UIFA 5I56B 3QUJA 1FRPA 1FTKA 2Z8DA 1BIYA 5CRYA 1YXIA 5DYHA 5EQ7A 4N17A 3IOWA 1IMCA 1HSLA 4X48A 2V84A 2XXWA 3PPRA 3U1OA 1B3GA 3G3JA 1SVXB 2FBPA 3K2DA 3VXCA 4TLMB 4BDLA 1YAEA 2G93A 2XWOA 4LATA 3OOAA 2UXAA 2JJKA 1MY2A 4LUBA 5IM2A 5I2KB 2HEUA 2A5TA 1NNPA 3UORA 2QJEA 5DEXB 4GVOA 4IY6A 1H44A 1UTBA 2Z8EA 1YTVA 4IO3A 4F19A 2CZKA 2VHAA 3IO4A 3PUVE 1QKAA 2HAUA 1NV1A 2OX3A 2XXYA 4GXAA 1MY4A 1JW4A 4F2QA 3B7DA 4MMPA 5KDTB 2PMSA 4ZEDA 3FV1A 3KG2A 3MVYA 5EQ8A 3SERA 1NNFA 4F2OA 2RCBA 1AIVA 4GBVA 1I6QA 2FHYA 1MG1A 1JEVA 4OA4A 3CFXA 4I62A 5FHOA 3F11A 4LA9A 2Y5LA 1NV5A 2NVUB 4AB5A 4I1DA 4MH5A 5FHNA 1IMDA 4LZ7A 1B46A 2XD3A 1A7LA 4X1BA 4R2FA 3T0JA 1GR2A 4U2RA 2Z22A 4IO7A 3TUSA 4YZZA 2ESNA 3PMVA 2REGA 1O63A 1IITA 4N4UA 1PB9A 4OVQA 1WVJA 1XI6A 1B0LA 4ZE8A 5J16A 3T96B 1AWBA 2RC9A 3DELB 1QUJA 4NN3A 2A5TB 3MP8A 1A40A 4N15A 4C1TA 4GQOA 4WEDA 1B51A 3FGSA 1QKBA 4GRKA 2DE3A 1IMFA 2HPGA 1UTBB 4JXIA 4P1LA 3PV0E 3KJ7A 4F3PA 1NH7A 1OQGA 2F97A 5EYFA 1FTAA 4HS7A 2HZLA 1JEUA 2VD3A 5I3SA 4YB6A 1B9JA 2XXQA 1P99A 2A5SA 2D3IA 4NX1A 3MPKA 1G0HA 1B58A 1LCTA 4PCDA 5I84A 4U23A 5AE4A 1NKXA 2NWJA 3HV1A 5AA2A 3USDA 4RYAA 3SESA 3PD8A 5I2NB 3MVXA 3O2AA 4PFRA 1DTZA 2PT2A 1K9YA 4O7MA 3IB1A 5LOMA 1NL5A 1LLSA 1PB8A 3TTRA 1URGA 4P0IA 5A5LA 3V8XB 4DZ1A 4E0WA 4G4PA 3O6GA 2QS1A 1FPDA 5F24A 1INPA 3K6VA 4NEDA 2V3QA 1HSJA 4NF0A 1BKAA 1FPIA 2DE2A 3FJMA 1P1UA 2ZYOA 3S9MC 1B0HA 1Y3QA 1CE2A 5L8DA 1MQIA 3MAMA 4HTGA 1RDYA 2UVHA 4I3YA 1NUWA 4ZDMA 2GFEA 5AA1A 3OD7A 1NFTA 1SDXA 4QFNA 3EN3A 1IUDA 1DMBA 1G0IA 3C34A 3IB2A 3BBRA 4K3FA 2H5YA 3MP6A 4GL0A 2QVVA 4G2ZA 1ELJA 4G77A 4H8IA 1OLAA 4XF5A 4H46A 2Y7KA 4BDOA 3K00A 4MEVA 1B4HA 3W9VA 3TPAA 4M1VA 5AA2B 2FIEA 5IZZA 3E3KA 4NGUA 4ND9A 2OZZA 1M5CA 1H76A 1JVYA 5LDZA 1ZKBA 4MIJA 3BFTA 3O29A 3IOVA 4H1XA 1EZOA 3KJTA 5DTBA 4JVCA 2YPNA 4M4GA 4PFYA 2VD2A 1SW1A 4GD5A 2V3TA 4WEPA 3E78A 5FTIA 1SI0A 4U21A 5ET8A 1B3EA 4KCDA 2UVIA 3PGFA 1SBPA 1MRPA 4POWA 3CHGA 1POTA 2DOJA 1YPNA 3B6QA 4LZ8A 3THIA 4NF5A 3TODA 2DVCA 4P56A 2M8CA 3FJGA 4U1ZA 1MDP1 4IR8A 2XX7A 5EYGA 3OO9A 4XXUA 3Q25A 1LAXA 1FW0A 1GV8A 3I3VA 3OSRA 4POXA 4IO2A 1GVCA 4F3SA 1OMPA 2AYSA 4JBZA 1OQHA 4N6DA 4OFJA 3PU5A 1MY1A 3MYUA 3HHGA 2I6EA 2Z8FA 3LSWA 1XOCA 1LBCA 3G7WA 1FBDA 4YKKA 5A5XA 4KCCA 2WKYA 3OXNA 3V5AA 4R9GA 3IOUA 2X7PA 3FXRA 3MBPA 3PUYE 1DBZA 1WDNA 4EQ9A 1FPBA 5ELVA 1P1QA 3CSGA 1B5HA 1SW5A 5CMKA 2ALUA 1GGGA 2F5XA 4EDPA 1NV6A 1OVBA 3FUZA 1M5BA 3T9VA 1EU8A 1IIWA 3EHSA 4OVSA 4G8MA 3VVFA 2WYPA 3OO6A 1XVXA 5ICTA 1B32A 2XXUA 4MNPA 1LB8A 3VVDA 3TEPA 2F7CA 4HE1A 4YKPA 4NF5B 1P1NA 1AOVA 4EQBA 4P3LA 1Q1KA 5B7DA 1D9QA 2NUVA 3K1PA 3VLUA 4I8CA 5ITOA 1NV2A 4Q8RA 2NOOA 4MLQA 5H8NA 3IORA 1MXVA 1FQEA 2O84X 1PBQA 4PDDA 5AA4A 2QMWA 3S2VA 2ZZVA 2H25A 5ITPA 5I56A 1QGXA 1BLFA 4LQ5A 5A5XB 2F6PA 4Q30B 1RDZA 4KR5A 3C32A 4XTCQ 4KHZE 3GBAA 4R9FA 5ISUA 1QUIA 3KZGA 5JEIA 3H6UA 1ZJLA 3QIMA 1EZ9A 1AH5A 5F7VA 4R74A 4AB6A 1ZMGA 4JWXA 4DDDA 2B3BA 5CBRA 5EYHA 5L9SA 1JP4A 1B4ZA 1ZBMA 4X1DA 4HCWA 3WAFA 5ET6A 1S9TA 4ELQA 1N7WA 5I59B 2E1SA 2RC8A 1FBHA 3V89B 5LTCA 2D5WA 4G8NA 2I3VA 4EQ7A 4U1OA 1EYJA 3IO6A 3KN7A 1VFDA 2DS9A 3GYYA 4ZECA 4OVJA 1B40A 3G3HA 5KDTA 4ELRA 4RK9A 1SQYA 3QAXA 2PX1A 3TYHA 2HAVA 1OLCA 4OYVA 4NAPA 1ZU0A 4DXUA 3MC2A 1QW0A 3MZ1A 5AA4B 3FZVA 1US5A 2Y7PA 3TCHA 2VPNA 3K0VA 3OENA 4GX3A 3L6HA 2ZNUA 1POY1 2XXPA 4P11A 2KLFA 5ESYA 1B3LA 1Q9DA 1FJ9A 1UIUA 3SZPA 1PBPA 3LUZA 3PTYA 3MVZA 4O3BA 3I6VA 1B52A 2AL5A 1SW4A 5DVIA 4IB2A 3TTKA 5CBSA 3IFAA 1MS7A 2P3NA 4LONB 3K6UA 4DXBA 1KZ8A 4YMAA 4NQ8A 2V93A 3SEVA 2HXRA 1JNFA 4E0XA 1EYIA 1BK4A 3SDFA 3K02A 5L9OA 1FBCA 2XXTA 2I4BA 1IXIA 4X8RA 2FYIA 3LSLA 5T3JA 2CEYA 3HSTA 2AIXA 1B7UA 4OMBA 3U8QA 4OANA 4NE4A 2OCUA 4DIGA 3N6TA 5CMMA 4YU0A 1N3WA 3E4RA 4FECA 5I2NA 2IA4A 1DPEA 1MM7A 4QFPA 1B1XA 1FPEA 1Q35A 1O7TA 3O97A 1VR5A 3LC8A 1KA0A 3TCFA 5HPQA 3QXMA 3B8BA 3Q29A 3TMGA 1SD3A 5H8QA 3Q28A 5CC2A 3H7MA 4F31B 3D4GA 1IQ7A 1FBPA 4IO5A 3BKIB 4NF4A 5EHSA 4HW8A 3N5LA 1N04A 3O28A 4LN5A 4FBPA 4R6YA 5I57A 2I48A 4P47A 1FQCA 2ONRA 4F1VA 1AL3A 1LFIA 4GWXA 2V4CA 4PE3A 4ECFA 3ZS6A 1YYZA 3C4MA 4ESWA 1Y4TA 4RNSA 2XXRA 3T1BA 2QSXA 3TQLA 3CI8A 3QK6A 1URDA 2ZZWA 3LSXA 4OESA 1NUZA 4N91A 4AQ4A 3FXBA 5L9MA 1RKMA 2ZYNA 4IO4A 1B5IA 3ONMA 1I6AA 1H45A 4MHFA 1FPLA 4NTLA 1II5A 4G68B 5TP9A 4MCOA 1R6ZA 3VDFA 2I58A 1N3XA 4ELPA 4PAKA 3KFMA 1FCKA 4PAFA 3VVEA 2FIXA 4OETA 2RF1A 1P1OA 4RK2A 4YAHX 4ZEKA 4KI0E 1RYOA 5CMCA 4GL8A 3P7IA 3SEXA 2VPOA 4PF6A 2R71A 5H8QB 4GLIA 4Q5TA 4ZZEA 3UK4A 1TT1A 1Y1ZA 2F36A 4LVQA 4NF4B 3UA8A 4H65A 3R6UA 1YCJA 1A8EA 5F1QA 2FA7A 5I57B 4OFOA 4H5GA 4DCYA 1LAHE 3T93B 2Q88A 3FD3A 4OQOA 3O6IA 4DLDA 4JB7A 4FE8A 1XT8A 4FEBA 3CSBA 1IMEA 4RA1A 4HE0A 2W7YA 1JVXA 4I9DA 2DWJA 5BWJA 4QSDA 3M3KA 3CVGA 3KBRA 3JYRA 4FATA 4QSCA 1IZ1A 3KSJA 4IY5A 4H5FA 4F3GA 1ZIUA 5JK4A 3M3LA 1A54A 4DCXA 2ZXTA 5K2YA 4F22A 4C1UA 4GF8A 1VFEA 4JVDA 4BLAA 1LAFE 3W15C 5TP9B 2Q89A 1CNQA 2ABHA 4P1EA 4JDFA 1D4NA 4BDNA 4XKRA 1BTJA 1KWHA 1R9LA 5HBCA 1Y1MA 1R9QA 1FBEA 3KN8A 3VE1B 2VT5A 5J1DA 2DDKA 3N26A 4ONYA 3T66A 1PEBA 4N8GA 1FPFA 4F18A 3MZ9A 3U72A 3C9HA 3MUQA 1R1NA 3E9XA 2B3FA 2QL3A 3I5OA 2GQ1A 1MQGA 2I3WA 3EKIA 1FBGA 2R6GE 1NV0A 3SEWA 1PB7A 2E0SA 5TPAB 1NUYA 1LBXA 2QVRA 2F6GA 4R6HA 2DYXA 4PDHA 2R9JA 1TFDA 2HXWA 2Q9TA 4FEDA 1MQDA 1IXGA 2FNCA 4N6PA 4PTKA 4PFWA 3U92A 4YKJA 3C35A 3KC1A 4LQ2A 2QMXA 4Z0IA 5I58B 1MPDA 4OHNA 1NNKA 1DTGA 1FTJA 1N84A 1M5FA 4F1UA 5KCJB 1NMUA 3RY3A 3FXQA 2CZHA 2VP1A 1ZTYA 1DCUA 3RTWB 4KXPA 3TQWA 4U22A 3AXFA 4LZ5A 4O3AA 3IL1B 2O1MA 2F3DA 3K1MA 4QRZA 1B1HA 3BFUA 3ISPA 4AS4A 4ZZAA 1JQFA 3EHTA 4H45A 4EXKA 1FPKA 1Y4CA 1QUKA 2ZNTA 4XKNA 3S9EA 4MNCA 1N76A 4WKMA 3V83A 3E79A 2O1LA 3U93A 1IMBA 1HSEA 2L5VA 2PFYA 1OVTA 3C31A 4Q0CA 1MH3A 5I59A 2XA5A 1FQAA 4YB7A 1MXXA 4IGRA 3WAEA 3B50A 3D1RA 3FJ7A 1MQJA 3T9HB 4ELOA 3KBZA 4JWOA 5DW8A 2B65A 4P9KA 4PBHA 2ANJA 3TTMA 3LUYA 3UN6A 3KEIA 1EZPA 4O94A 1H43A 2XXHA 2RC7A 1RDXA 3Q26A 4HCYA 5IAIA 2V25A 1VDWA 3K1NA 4XEQA 1DPPA 2O69A 3BIHA 2XWKA 4BDRA 4KFQA 3OO7A 4HE2A 3ROJA 4G61A 4QHQA 3HPIA 3FATA 2BJJX 2QVUA 4O3CA 1JW1A 2Q2CA 3IJOB 3H6WA 4DI3D 1B7HA 1SYHA 5I7IA 4THIA 4OXVA 4NMYA 5EQ9A 4FAJA 3LSFB 5HM4B 1QVSA 4EF2A 1B5JA 4P0GA 1IXCA 1B3FA 5TU0A 2XWIA 3MW0A 3ECRA 1SPIA 2GRVA 4NHBA 2DWIA 2I0BA 1Z7NE 4QSEA 3SETA 5ET5A 3Q27A 3K4UA 4C0RA 3H3GA 2XHDA 3ODBA 3R26A 3OMBA 5DVJA 3LV0A 1OIBA 3EPEA 1LFHA 4EXLA 5CM6A 1UQWA 2ONKE 4OEVA 2P2AA 2OWSA 3M3FA 3C33A 3OEKA 4PGPA 4NG7A 4ZE9A 4PQJA 4GX4A 2G29A 3T9UA 2VOZA 1N0TA 1CB6A 3A09A 4GWWA 2P1SA 4PBQA 2H4IA 3KSXA 3E13X 2XD2A 3KGCA 4ZS9A 1PDAA 4N07A 4JWYA 3RPWA 2Y7RA 2QRYA 3PD9A 1IEJA 2X26A 4KYDA 3MZBA 5ICQA 2UYEA 4PFBA 4PE5B 3OEMA 3RT6B 2I49A 3N6UA 2UVJA 2F8DA 2XXVA 2XX8A 2XX9A 2FVZA 3H06B 5CMBA 2DWAA 3KOSA 3QUFA 3FXUA 2WYKA 4PFUA 3GZGA 4KYEA 2ONSA 3K6XA 3JZJA 3N94A 2KR0A 3RTFB 2GH9A 3IOTA 1LEVA 4ZEIA 2GHAA 3FBPA 4I3EA 5IZ3B 3S9LC 1MPCA 1LBWA 4L17A 1SI1A 2V3UA 2O6AA 3IJXB 3RQTA 1PC3A 3HHFA 4X9TA 1NUXA 1MXZA 2XWVA 4GWZA
chains in the Genus database with same CATH topology
1A8FA 3H6TA 3W9WA 3MP1A 1UTHA 1SYIA 2CZLA 3ILTB 2Z23A 4FJPA 4ZEFA 3ZKKA 2X7QA 1MY0A 1FTOA 4KQPA 3TZAA 3JV9A 3HN0A 2YJPA 1LSTA 1Y9UA 2Y84A 4G68A 3H4ZA 3TKDA 1MH4A 1Y3PA 3PUZE 1B05A 3T9XB 1MXYA 2AL4A 1SW2A 1B2HA 5B70A 3EF7A 4OEUA 3SEYA 2F7AA 4U4XA 2LAOA 1N7XA 4U4SA 1JW5A 3IB0A 1Y20A 4N13A 1TWYA 3H03A 3SKPA 3DP8A 2GHBA 3OO8A 4YB5A 1H3DA 3PPPA 3UP9A 5IKBA 1M5DA 2NXOA 2O7IA 1J1NA 1MQHA 3CFLA 5H8HA 2HQ0A 1USYE 2DXYA 2DQVA 1I6BA 2PVUA 2ZYKA 3ZKLA 2OK2A 3ZSFA 1DOTA 3CG3A 3MJNA 1MM6A 2DE4A 5K2XA 1UTHB 1A99A 4RXLA 3O9PA 3QSLA 3KOTA 4DE8A 3S9NC 4XKPA 1Y3NA 3MVWA 4EUOA 3TELA 2D21A 1LGBC 5H8FA 3CR9A 4NWDA 4F29A 1M5EA 3S4UA 4OTEA 2ZNSA 2F7BA 3RLFE 2DSFA 4MF3A 4TOZA 3G3FA 2PBWA 2Q8JA 4F3BA 2F34A 1US4A 4GWOA 3FVNA 1XS5A 2P0SA 5DVFA 1NH8A 4R72A 4FORA 2RINA 1MPBA 4QFKA 2F35A 2THIA 4QF9A 4H8JA 3EQ1A 1L5TA 4RPNA 3HO7A 2I0CA 2HCAA 4TLLB 5FTHA 3O6HA 3PPNA 5H8HB 5TPAA 1JETA 1TXFA 4KPTA 3RNNA 2XXXA 3RGYA 2OLBA 1IXHA 4DXCA 1D9YA 1LAGE 3OSQA 2IEEA 4G68C 1AMFA 4OFLA 1FTLA 3LR1A 4H0WA 5I58A 3MPLA 3FASA 5H8FB 5FHMA 4XKQA 3CG1A 1EH3A 5KCJA 3RT8A 3PPQA 1FQDA 3IX1A 2DP8A 1URSA 5AA2D 4R75A 3G3IA 3IR1A 1FTMA 2PT1A 3VLVA 2H98A 3H6VA 5H8SA 4BDMA 4PP0A 1MXWA 1XVYA 2QS4A 3VXBA 3MQ9A 2I4CA 3GXAA 3RUMA 2QPQA 3VV5A 3GBBA 3EHUA 3FIRA 2CMOA 3VLWA 2PYYA 3O66A 4QFLA 3R7XA 3U94A 3L6GA 4OWDA 4YICA 3G3KA 4NF8A 2UVGA 1LBBA 2UYFA 1UIVA 3KN3A 4KYSA 1VE4A 1NNTA 5JTYA 1XHYA 2Y7IA 1ZLQA 3CIJA 1O64A 4EF1A 3IAZA 5M2VA 1XC1A 3PMXA 2REJA 3OELA 4YMBA 4H67A 3K01A 4IO6A 2ZYMA 5EHMA 4R73A 3MWBA 1LB9A 3FVGA 5KZTA 2DWHA 4LP2B 4PETA 3TTNA 3CFZA 3SEUA 1S50A 4ISUA 2OWTA 4OENA 4H6DA 3VFJA 4BDQA 4F39A 3B6TA 4MLVA 3DP6A 1B3HA 2VGQA 3K6WA 4TQUQ 4OZ9A 3TTLA 1ANFA 2XXIA 1MDQA 1BP5A 4GXSB 4GFRA 3FVKA 1TFAA 2RCAA 2DXRA 4NF8B 1LFGA 1GTKA 4MFIA 4FIMA 2H99A 5BUUA 1B6HA 1D3KA 5JTYB 2F78A 3ILUB 2Y7WA 4NWCA 4F1YA 4JSOA 4ZEBA 2QS2A 4NF6A 3D4CA 1RYXA 1LCFA 3LBSA 2HZKA 1S7YA 2O68A 4OERA 3FV2A 3TDJA 4WXJA 4GOTA 4RY1A 4GIZA 1QULA 2HFBA 4RJZA 3B6WA 2DVZA 4YKIA 3QYTA 3PPOA 3DM0A 4IGTA 4R6KA 1ATGA 4JSDA 2O51A 4RPOA 3FVOA 2QS3A 3DP4A 3G3GA 4XIGQ 1F9BA 1I69A 3TCGA 1QJMA 4UA8A 3M8UA 3UGWA 3CRBA 2ZMBA 3RN8A 2YLNA 5DT6A 2O7UA 3HCQA 4KD5A 1T0KA 4ESXA 3GLBA 3PUXE 3T22A 5I2KA 1P1WA 4G8HA 4R2BA 5CI5A 1WODA 5DEXA 1USYH 3A3CA 4PFTA 2RKMA 4MBPA 4NF6B 1VSOA 1MY3A 2OBGA 3TAJA 2OJTA 4Z7EA 3PMWA 1MXUA 1B7ZA 3PUWE 1FQBA 3IK6B 5H8NB 1D9VA 3TFLA 1DSNA 1A55A 5AA3A 2H9BA 1FQFA 4QFOA 4UACA 2Q2AA 1Z7ME 3C36A 3DLNA 3A3UA 3UIFA 5I56B 3QUJA 1FTKA 2Z8DA 1BIYA 5CRYA 5DYHA 3IOWA 1HSLA 4X48A 2V84A 2XXWA 3PPRA 3U1OA 1B3GA 3G3JA 1SVXB 3K2DA 3VXCA 4TLMB 4BDLA 1YAEA 2G93A 4LATA 3OOAA 2UXAA 1MY2A 4LUBA 5I2KB 2HEUA 2A5TA 1NNPA 3UORA 2QJEA 5DEXB 4GVOA 4IY6A 1H44A 1UTBA 2Z8EA 1YTVA 4IO3A 4F19A 2VHAA 3IO4A 3PUVE 1QKAA 2HAUA 2XXYA 4GXAA 1MY4A 1JW4A 4F2QA 3B7DA 5KDTB 2PMSA 4ZEDA 3FV1A 3KG2A 3MVYA 3SERA 1NNFA 4F2OA 2RCBA 1AIVA 1I6QA 1MG1A 1JEVA 3CFXA 4I62A 5FHOA 3F11A 4LA9A 2NVUB 4AB5A 4I1DA 4MH5A 5FHNA 4LZ7A 1B46A 2XD3A 1A7LA 4X1BA 4R2FA 1GR2A 4U2RA 2Z22A 4IO7A 3TUSA 4YZZA 2ESNA 3PMVA 2REGA 1O63A 1IITA 1PB9A 1WVJA 1B0LA 4ZE8A 3T96B 2RC9A 3DELB 1QUJA 2A5TB 3MP8A 1A40A 4C1TA 4GQOA 4WEDA 1B51A 3FGSA 1QKBA 4GRKA 2DE3A 1UTBB 4JXIA 3PV0E 3KJ7A 4F3PA 1NH7A 1OQGA 2F97A 5EYFA 4HS7A 2HZLA 1JEUA 2VD3A 4YB6A 1B9JA 2XXQA 1P99A 2A5SA 2D3IA 3MPKA 1B58A 1LCTA 5I84A 4U23A 5AE4A 1NKXA 2NWJA 3HV1A 5AA2A 3USDA 4RYAA 3SESA 3PD8A 5I2NB 3MVXA 3O2AA 1DTZA 2PT2A 3IB1A 5LOMA 1NL5A 1LLSA 1PB8A 3TTRA 1URGA 4P0IA 3V8XB 4DZ1A 4E0WA 4G4PA 3O6GA 2QS1A 3K6VA 4NEDA 2V3QA 1HSJA 1BKAA 2DE2A 3FJMA 1P1UA 2ZYOA 3S9MC 1B0HA 1Y3QA 1CE2A 5L8DA 1MQIA 3MAMA 4HTGA 2UVHA 4ZDMA 2GFEA 5AA1A 3OD7A 1NFTA 1SDXA 4QFNA 3EN3A 1IUDA 1DMBA 3C34A 3IB2A 3BBRA 4K3FA 2H5YA 3MP6A 4GL0A 4G2ZA 1ELJA 4G77A 4H8IA 1OLAA 2Y7KA 4BDOA 3K00A 1B4HA 3W9VA 3TPAA 4M1VA 5AA2B 3E3KA 4ND9A 2OZZA 1M5CA 1H76A 1JVYA 1ZKBA 3BFTA 3O29A 3IOVA 4H1XA 1EZOA 3KJTA 5DTBA 2YPNA 4M4GA 4PFYA 2VD2A 1SW1A 4GD5A 2V3TA 4WEPA 5FTIA 1SI0A 4U21A 1B3EA 4KCDA 2UVIA 3PGFA 1SBPA 1MRPA 4POWA 1POTA 2DOJA 1YPNA 3B6QA 4LZ8A 3THIA 4NF5A 3TODA 2DVCA 2M8CA 3FJGA 4U1ZA 1MDP1 2XX7A 3OO9A 4XXUA 3Q25A 1LAXA 1FW0A 1GV8A 3I3VA 3OSRA 4POXA 4IO2A 1GVCA 4F3SA 1OMPA 2AYSA 4JBZA 1OQHA 4OFJA 3PU5A 1MY1A 3HHGA 2I6EA 2Z8FA 3LSWA 1XOCA 1LBCA 3G7WA 4YKKA 5A5XA 4KCCA 2WKYA 3OXNA 3V5AA 4R9GA 3IOUA 2X7PA 3FXRA 3MBPA 3PUYE 1WDNA 4EQ9A 5ELVA 1P1QA 3CSGA 1B5HA 1SW5A 5CMKA 2ALUA 1GGGA 2F5XA 4EDPA 1OVBA 3FUZA 1M5BA 3T9VA 1EU8A 1IIWA 3EHSA 4G8MA 3VVFA 3OO6A 1XVXA 5ICTA 1B32A 2XXUA 1LB8A 3VVDA 3TEPA 2F7CA 4YKPA 4NF5B 1P1NA 1AOVA 4EQBA 1Q1KA 5B7DA 2NUVA 3K1PA 3VLUA 4I8CA 5ITOA 4Q8RA 2NOOA 4MLQA 5H8NA 3IORA 1MXVA 1FQEA 2O84X 1PBQA 5AA4A 2QMWA 3S2VA 2H25A 5ITPA 5I56A 1BLFA 4LQ5A 5A5XB 2F6PA 4Q30B 4KR5A 3C32A 4XTCQ 4KHZE 3GBAA 4R9FA 5ISUA 1QUIA 3KZGA 5JEIA 3H6UA 1ZJLA 3QIMA 1EZ9A 1AH5A 5F7VA 4R74A 4AB6A 1ZMGA 4JWXA 4DDDA 2B3BA 5CBRA 5L9SA 1B4ZA 1ZBMA 4X1DA 4HCWA 3WAFA 1S9TA 4ELQA 1N7WA 5I59B 2E1SA 2RC8A 3V89B 2D5WA 4G8NA 2I3VA 4EQ7A 4U1OA 3IO6A 3KN7A 1VFDA 2DS9A 4ZECA 4OVJA 1B40A 3G3HA 5KDTA 4ELRA 4RK9A 1SQYA 3QAXA 2PX1A 3TYHA 2HAVA 1OLCA 4OYVA 1ZU0A 4DXUA 3MC2A 1QW0A 3MZ1A 5AA4B 3FZVA 1US5A 2Y7PA 3TCHA 3K0VA 3OENA 3L6HA 2ZNUA 1POY1 2XXPA 4P11A 2KLFA 1B3LA 1UIUA 1PBPA 3MVZA 4O3BA 3I6VA 1B52A 2AL5A 1SW4A 5DVIA 4IB2A 3TTKA 5CBSA 1MS7A 4LONB 3K6UA 4DXBA 4YMAA 2V93A 3SEVA 1JNFA 4E0XA 3SDFA 3K02A 5L9OA 2XXTA 2I4BA 1IXIA 2FYIA 3LSLA 3HSTA 2AIXA 1B7UA 4OMBA 3U8QA 4NE4A 2OCUA 4DIGA 3N6TA 5CMMA 4YU0A 1N3WA 3E4RA 4FECA 5I2NA 2IA4A 1DPEA 1MM7A 4QFPA 1B1XA 1Q35A 1O7TA 3O97A 1VR5A 3LC8A 3TCFA 5HPQA 3QXMA 3Q29A 3TMGA 1SD3A 5H8QA 3Q28A 5CC2A 3H7MA 4F31B 3D4GA 1IQ7A 4IO5A 3BKIB 4NF4A 5EHSA 4HW8A 3N5LA 1N04A 3O28A 4R6YA 5I57A 2I48A 1FQCA 2ONRA 4F1VA 1AL3A 1LFIA 4ECFA 3ZS6A 3C4MA 4ESWA 1Y4TA 4RNSA 2XXRA 2QSXA 3TQLA 3CI8A 3QK6A 1URDA 3LSXA 4OESA 4AQ4A 5L9MA 1RKMA 2ZYNA 4IO4A 1B5IA 3ONMA 1I6AA 1H45A 4NTLA 1II5A 4G68B 5TP9A 1R6ZA 3VDFA 2I58A 4ELPA 1N3XA 3KFMA 1FCKA 3VVEA 4OETA 2RF1A 1P1OA 4RK2A 4YAHX 4ZEKA 4KI0E 1RYOA 5CMCA 4GL8A 3P7IA 3SEXA 2R71A 5H8QB 4GLIA 4Q5TA 4ZZEA 3UK4A 1TT1A 1Y1ZA 2F36A 4LVQA 4NF4B 3UA8A 4H65A 3R6UA 1YCJA 1A8EA 5F1QA 2FA7A 5I57B 4OFOA 4H5GA 4DCYA 1LAHE 3T93B 2Q88A 3FD3A 4OQOA 3O6IA 4DLDA 4JB7A 4FE8A 1XT8A 4FEBA 3CSBA 4RA1A 2W7YA 1JVXA 4I9DA 2DWJA 5BWJA 4QSDA 3M3KA 3CVGA 3KBRA 3JYRA 4FATA 4QSCA 1IZ1A 3KSJA 4IY5A 4H5FA 4F3GA 1ZIUA 5JK4A 3M3LA 1A54A 4DCXA 2ZXTA 5K2YA 4F22A 4C1UA 4GF8A 1VFEA 4BLAA 1LAFE 3W15C 5TP9B 2Q89A 2ABHA 4JDFA 1D4NA 4BDNA 4XKRA 1BTJA 1KWHA 1R9LA 5HBCA 1Y1MA 1R9QA 3KN8A 3VE1B 5J1DA 3N26A 4ONYA 3T66A 1PEBA 4F18A 3MZ9A 3U72A 3C9HA 3MUQA 1R1NA 3E9XA 2B3FA 2QL3A 3I5OA 1MQGA 2I3WA 2R6GE 3SEWA 1PB7A 2E0SA 5TPAB 2F6GA 4R6HA 2DYXA 2R9JA 1TFDA 2HXWA 2Q9TA 4FEDA 1MQDA 1IXGA 2FNCA 4N6PA 4PFWA 3U92A 4YKJA 3C35A 4LQ2A 2QMXA 4Z0IA 5I58B 1MPDA 4OHNA 1NNKA 1DTGA 1FTJA 1N84A 1M5FA 4F1UA 5KCJB 1NMUA 3RY3A 3FXQA 2VP1A 1ZTYA 3RTWB 3TQWA 4U22A 3AXFA 4LZ5A 4O3AA 3IL1B 2O1MA 3K1MA 4QRZA 1B1HA 3BFUA 4ZZAA 1JQFA 3EHTA 4EXKA 1Y4CA 1QUKA 2ZNTA 4XKNA 3S9EA 1N76A 4WKMA 3V83A 2O1LA 3U93A 1HSEA 1OVTA 3C31A 4Q0CA 1MH3A 5I59A 1FQAA 4YB7A 1MXXA 4IGRA 3WAEA 3FJ7A 4ELOA 1MQJA 3T9HB 4JWOA 2B65A 2ANJA 3TTMA 3LUYA 3UN6A 3KEIA 1EZPA 1H43A 2XXHA 2RC7A 3Q26A 4HCYA 5IAIA 2V25A 3K1NA 1DPPA 2O69A 4BDRA 4KFQA 3OO7A 4QHQA 3HPIA 3FATA 2BJJX 4O3CA 1JW1A 2Q2CA 3IJOB 3H6WA 1B7HA 1SYHA 4THIA 4OXVA 4NMYA 4FAJA 3LSFB 5HM4B 1QVSA 4EF2A 1B5JA 4P0GA 1IXCA 1B3FA 5TU0A 3MW0A 3ECRA 2GRVA 2DWIA 2I0BA 1Z7NE 4QSEA 3SETA 3Q27A 3K4UA 4C0RA 3H3GA 2XHDA 3ODBA 3R26A 3OMBA 5DVJA 1OIBA 3EPEA 1LFHA 4EXLA 5CM6A 1UQWA 2ONKE 4OEVA 2P2AA 2OWSA 3M3FA 3C33A 3OEKA 4ZE9A 4PQJA 3T9UA 2G29A 2VOZA 1N0TA 1CB6A 3A09A 2P1SA 2H4IA 3KSXA 3E13X 4ZS9A 3KGCA 2XD2A 1PDAA 4N07A 4JWYA 3RPWA 2Y7RA 2QRYA 3PD9A 1IEJA 2X26A 4KYDA 3MZBA 5ICQA 2UYEA 4PE5B 3OEMA 3RT6B 2I49A 3N6UA 2UVJA 2F8DA 2XXVA 2XX8A 2XX9A 3H06B 5CMBA 2DWAA 3KOSA 3QUFA 3FXUA 4PFUA 3GZGA 4KYEA 2ONSA 3K6XA 3JZJA 3N94A 3RTFB 2GH9A 3IOTA 4ZEIA 2GHAA 3S9LC 1MPCA 4L17A 1SI1A 2V3UA 2O6AA 3IJXB 3RQTA 1PC3A 3HHFA 4X9TA 1MXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8F A;  3H6T A;  3W9W A;  3MP1 A;  1UTH A;  1SYI A;  2CZL A;  3ILT B;  2Z23 A;  4FJP A;  4ZEF A;  3ZKK A;  2X7Q A;  1MY0 A;  1FTO A;  4KQP A;  3TZA A;  3JV9 A;  3HN0 A;  2YJP A;  1LST A;  1Y9U A;  2Y84 A;  4G68 A;  3H4Z A;  3TKD A;  1MH4 A;  1Y3P A;  3PUZ E;  1B05 A;  3T9X B;  1MXY A;  2AL4 A;  1SW2 A;  1B2H A;  5B70 A;  3EF7 A;  4OEU A;  3SEY A;  2F7A A;  4U4X A;  2LAO A;  1N7X A;  4U4S A;  1JW5 A;  3IB0 A;  1Y20 A;  4N13 A;  1TWY A;  3H03 A;  3SKP A;  3DP8 A;  2GHB A;  3OO8 A;  4YB5 A;  1H3D A;  3PPP A;  3UP9 A;  5IKB A;  1M5D A;  2NXO A;  2O7I A;  1J1N A;  1MQH A;  3CFL A;  5H8H A;  2HQ0 A;  1USY E;  2DXY A;  2DQV A;  1I6B A;  2PVU A;  2ZYK A;  3ZKL A;  2OK2 A;  3ZSF A;  1DOT A;  3CG3 A;  3MJN A;  1MM6 A;  2DE4 A;  5K2X A;  1UTH B;  1A99 A;  4RXL A;  3O9P A;  3QSL A;  3KOT A;  4DE8 A;  3S9N C;  4XKP A;  1Y3N A;  3MVW A;  4EUO A;  3TEL A;  2D21 A;  1LGB C;  5H8F A;  3CR9 A;  4NWD A;  4F29 A;  1M5E A;  3S4U A;  4OTE A;  2ZNS A;  2F7B A;  3RLF E;  2DSF A;  4MF3 A;  4TOZ A;  3G3F A;  2PBW A;  2Q8J A;  4F3B A;  2F34 A;  1US4 A;  4GWO A;  3FVN A;  1XS5 A;  2P0S A;  5DVF A;  1NH8 A;  4R72 A;  4FOR A;  2RIN A;  1MPB A;  4QFK A;  2F35 A;  2THI A;  4QF9 A;  4H8J A;  3EQ1 A;  1L5T A;  4RPN A;  3HO7 A;  2I0C A;  2HCA A;  4TLL B;  5FTH A;  3O6H A;  3PPN A;  5H8H B;  5TPA A;  1JET A;  1TXF A;  4KPT A;  3RNN A;  2XXX A;  3RGY A;  2OLB A;  1IXH A;  4DXC A;  1D9Y A;  1LAG E;  3OSQ A;  2IEE A;  4G68 C;  1AMF A;  4OFL A;  1FTL A;  3LR1 A;  4H0W A;  5I58 A;  3MPL A;  3FAS A;  5H8F B;  5FHM A;  4XKQ A;  3CG1 A;  1EH3 A;  5KCJ A;  3RT8 A;  3PPQ A;  1FQD A;  3IX1 A;  2DP8 A;  1URS A;  5AA2 D;  4R75 A;  3G3I A;  3IR1 A;  1FTM A;  2PT1 A;  3VLV A;  2H98 A;  3H6V A;  5H8S A;  4BDM A;  4PP0 A;  1MXW A;  1XVY A;  2QS4 A;  3VXB A;  3MQ9 A;  2I4C A;  3GXA A;  3RUM A;  2QPQ A;  3VV5 A;  3GBB A;  3EHU A;  3FIR A;  2CMO A;  3VLW A;  2PYY A;  3O66 A;  4QFL A;  3R7X A;  3U94 A;  3L6G A;  4OWD A;  4YIC A;  3G3K A;  4NF8 A;  2UVG A;  1LBB A;  2UYF A;  1UIV A;  3KN3 A;  4KYS A;  1VE4 A;  1NNT A;  5JTY A;  1XHY A;  2Y7I A;  1ZLQ A;  3CIJ A;  1O64 A;  4EF1 A;  3IAZ A;  5M2V A;  1XC1 A;  3PMX A;  2REJ A;  3OEL A;  4YMB A;  4H67 A;  3K01 A;  4IO6 A;  2ZYM A;  5EHM A;  4R73 A;  3MWB A;  1LB9 A;  3FVG A;  5KZT A;  2DWH A;  4LP2 B;  4PET A;  3TTN A;  3CFZ A;  3SEU A;  1S50 A;  4ISU A;  2OWT A;  4OEN A;  4H6D A;  3VFJ A;  4BDQ A;  4F39 A;  3B6T A;  4MLV A;  3DP6 A;  1B3H A;  2VGQ A;  3K6W A;  4TQU Q;  4OZ9 A;  3TTL A;  1ANF A;  2XXI A;  1MDQ A;  1BP5 A;  4GXS B;  4GFR A;  3FVK A;  1TFA A;  2RCA A;  2DXR A;  4NF8 B;  1LFG A;  1GTK A;  4MFI A;  4FIM A;  2H99 A;  5BUU A;  1B6H A;  1D3K A;  5JTY B;  2F78 A;  3ILU B;  2Y7W A;  4NWC A;  4F1Y A;  4JSO A;  4ZEB A;  2QS2 A;  4NF6 A;  3D4C A;  1RYX A;  1LCF A;  3LBS A;  2HZK A;  1S7Y A;  2O68 A;  4OER A;  3FV2 A;  3TDJ A;  4WXJ A;  4GOT A;  4RY1 A;  4GIZ A;  1QUL A;  2HFB A;  4RJZ A;  3B6W A;  2DVZ A;  4YKI A;  3QYT A;  3PPO A;  3DM0 A;  4IGT A;  4R6K A;  1ATG A;  4JSD A;  2O51 A;  4RPO A;  3FVO A;  2QS3 A;  3DP4 A;  3G3G A;  4XIG Q;  1F9B A;  1I69 A;  3TCG A;  1QJM A;  4UA8 A;  3M8U A;  3UGW A;  3CRB A;  2ZMB A;  3RN8 A;  2YLN A;  5DT6 A;  2O7U A;  3HCQ A;  4KD5 A;  1T0K A;  4ESX A;  3GLB A;  3PUX E;  3T22 A;  5I2K A;  1P1W A;  4G8H A;  4R2B A;  5CI5 A;  1WOD A;  5DEX A;  1USY H;  3A3C A;  4PFT A;  2RKM A;  4MBP A;  4NF6 B;  1VSO A;  1MY3 A;  2OBG A;  3TAJ A;  2OJT A;  4Z7E A;  3PMW A;  1MXU A;  1B7Z A;  3PUW E;  1FQB A;  3IK6 B;  5H8N B;  1D9V A;  3TFL A;  1DSN A;  1A55 A;  5AA3 A;  2H9B A;  1FQF A;  4QFO A;  4UAC A;  2Q2A A;  1Z7M E;  3C36 A;  3DLN A;  3A3U A;  3UIF A;  5I56 B;  3QUJ A;  1FTK A;  2Z8D A;  1BIY A;  5CRY A;  5DYH A;  3IOW A;  1HSL A;  4X48 A;  2V84 A;  2XXW A;  3PPR A;  3U1O A;  1B3G A;  3G3J A;  1SVX B;  3K2D A;  3VXC A;  4TLM B;  4BDL A;  1YAE A;  2G93 A;  4LAT A;  3OOA A;  2UXA A;  1MY2 A;  4LUB A;  5I2K B;  2HEU A;  2A5T A;  1NNP A;  3UOR A;  2QJE A;  5DEX B;  4GVO A;  4IY6 A;  1H44 A;  1UTB A;  2Z8E A;  1YTV A;  4IO3 A;  4F19 A;  2VHA A;  3IO4 A;  3PUV E;  1QKA A;  2HAU A;  2XXY A;  4GXA A;  1MY4 A;  1JW4 A;  4F2Q A;  3B7D A;  5KDT B;  2PMS A;  4ZED A;  3FV1 A;  3KG2 A;  3MVY A;  3SER A;  1NNF A;  4F2O A;  2RCB A;  1AIV A;  1I6Q A;  1MG1 A;  1JEV A;  3CFX A;  4I62 A;  5FHO A;  3F11 A;  4LA9 A;  2NVU B;  4AB5 A;  4I1D A;  4MH5 A;  5FHN A;  4LZ7 A;  1B46 A;  2XD3 A;  1A7L A;  4X1B A;  4R2F A;  1GR2 A;  4U2R A;  2Z22 A;  4IO7 A;  3TUS A;  4YZZ A;  2ESN A;  3PMV A;  2REG A;  1O63 A;  1IIT A;  1PB9 A;  1WVJ A;  1B0L A;  4ZE8 A;  3T96 B;  2RC9 A;  3DEL B;  1QUJ A;  2A5T B;  3MP8 A;  1A40 A;  4C1T A;  4GQO A;  4WED A;  1B51 A;  3FGS A;  1QKB A;  4GRK A;  2DE3 A;  1UTB B;  4JXI A;  3PV0 E;  3KJ7 A;  4F3P A;  1NH7 A;  1OQG A;  2F97 A;  5EYF A;  4HS7 A;  2HZL A;  1JEU A;  2VD3 A;  4YB6 A;  1B9J A;  2XXQ A;  1P99 A;  2A5S A;  2D3I A;  3MPK A;  1B58 A;  1LCT A;  5I84 A;  4U23 A;  5AE4 A;  1NKX A;  2NWJ A;  3HV1 A;  5AA2 A;  3USD A;  4RYA A;  3SES A;  3PD8 A;  5I2N B;  3MVX A;  3O2A A;  1DTZ A;  2PT2 A;  3IB1 A;  5LOM A;  1NL5 A;  1LLS A;  1PB8 A;  3TTR A;  1URG A;  4P0I A;  3V8X B;  4DZ1 A;  4E0W A;  4G4P A;  3O6G A;  2QS1 A;  3K6V A;  4NED A;  2V3Q A;  1HSJ A;  1BKA A;  2DE2 A;  3FJM A;  1P1U A;  2ZYO A;  3S9M C;  1B0H A;  1Y3Q A;  1CE2 A;  5L8D A;  1MQI A;  3MAM A;  4HTG A;  2UVH A;  4ZDM A;  2GFE A;  5AA1 A;  3OD7 A;  1NFT A;  1SDX A;  4QFN A;  3EN3 A;  1IUD A;  1DMB A;  3C34 A;  3IB2 A;  3BBR A;  4K3F A;  2H5Y A;  3MP6 A;  4GL0 A;  4G2Z A;  1ELJ A;  4G77 A;  4H8I A;  1OLA A;  2Y7K A;  4BDO A;  3K00 A;  1B4H A;  3W9V A;  3TPA A;  4M1V A;  5AA2 B;  3E3K A;  4ND9 A;  2OZZ A;  1M5C A;  1H76 A;  1JVY A;  1ZKB A;  3BFT A;  3O29 A;  3IOV A;  4H1X A;  1EZO A;  3KJT A;  5DTB A;  2YPN A;  4M4G A;  4PFY A;  2VD2 A;  1SW1 A;  4GD5 A;  2V3T A;  4WEP A;  5FTI A;  1SI0 A;  4U21 A;  1B3E A;  4KCD A;  2UVI A;  3PGF A;  1SBP A;  1MRP A;  4POW A;  1POT A;  2DOJ A;  1YPN A;  3B6Q A;  4LZ8 A;  3THI A;  4NF5 A;  3TOD A;  2DVC A;  2M8C A;  3FJG A;  4U1Z A;  1MDP 1;  2XX7 A;  3OO9 A;  4XXU A;  3Q25 A;  1LAX A;  1FW0 A;  1GV8 A;  3I3V A;  3OSR A;  4POX A;  4IO2 A;  1GVC A;  4F3S A;  1OMP A;  2AYS A;  4JBZ A;  1OQH A;  4OFJ A;  3PU5 A;  1MY1 A;  3HHG A;  2I6E A;  2Z8F A;  3LSW A;  1XOC A;  1LBC A;  3G7W A;  4YKK A;  5A5X A;  4KCC A;  2WKY A;  3OXN A;  3V5A A;  4R9G A;  3IOU A;  2X7P A;  3FXR A;  3MBP A;  3PUY E;  1WDN A;  4EQ9 A;  5ELV A;  1P1Q A;  3CSG A;  1B5H A;  1SW5 A;  5CMK A;  2ALU A;  1GGG A;  2F5X A;  4EDP A;  1OVB A;  3FUZ A;  1M5B A;  3T9V A;  1EU8 A;  1IIW A;  3EHS A;  4G8M A;  3VVF A;  3OO6 A;  1XVX A;  5ICT A;  1B32 A;  2XXU A;  1LB8 A;  3VVD A;  3TEP A;  2F7C A;  4YKP A;  4NF5 B;  1P1N A;  1AOV A;  4EQB A;  1Q1K A;  5B7D A;  2NUV A;  3K1P A;  3VLU A;  4I8C A;  5ITO A;  4Q8R A;  2NOO A;  4MLQ A;  5H8N A;  3IOR A;  1MXV A;  1FQE A;  2O84 X;  1PBQ A;  5AA4 A;  2QMW A;  3S2V A;  2H25 A;  5ITP A;  5I56 A;  1BLF A;  4LQ5 A;  5A5X B;  2F6P A;  4Q30 B;  4KR5 A;  3C32 A;  4XTC Q;  4KHZ E;  3GBA A;  4R9F A;  5ISU A;  1QUI A;  3KZG A;  5JEI A;  3H6U A;  1ZJL A;  3QIM A;  1EZ9 A;  1AH5 A;  5F7V A;  4R74 A;  4AB6 A;  1ZMG A;  4JWX A;  4DDD A;  2B3B A;  5CBR A;  5L9S A;  1B4Z A;  1ZBM A;  4X1D A;  4HCW A;  3WAF A;  1S9T A;  4ELQ A;  1N7W A;  5I59 B;  2E1S A;  2RC8 A;  3V89 B;  2D5W A;  4G8N A;  2I3V A;  4EQ7 A;  4U1O A;  3IO6 A;  3KN7 A;  1VFD A;  2DS9 A;  4ZEC A;  4OVJ A;  1B40 A;  3G3H A;  5KDT A;  4ELR A;  4RK9 A;  1SQY A;  3QAX A;  2PX1 A;  3TYH A;  2HAV A;  1OLC A;  4OYV A;  1ZU0 A;  4DXU A;  3MC2 A;  1QW0 A;  3MZ1 A;  5AA4 B;  3FZV A;  1US5 A;  2Y7P A;  3TCH A;  3K0V A;  3OEN A;  3L6H A;  2ZNU A;  1POY 1;  2XXP A;  4P11 A;  2KLF A;  1B3L A;  1UIU A;  1PBP A;  3MVZ A;  4O3B A;  3I6V A;  1B52 A;  2AL5 A;  1SW4 A;  5DVI A;  4IB2 A;  3TTK A;  5CBS A;  1MS7 A;  4LON B;  3K6U A;  4DXB A;  4YMA A;  2V93 A;  3SEV A;  1JNF A;  4E0X A;  3SDF A;  3K02 A;  5L9O A;  2XXT A;  2I4B A;  1IXI A;  2FYI A;  3LSL A;  3HST A;  2AIX A;  1B7U A;  4OMB A;  3U8Q A;  4NE4 A;  2OCU A;  4DIG A;  3N6T A;  5CMM A;  4YU0 A;  1N3W A;  3E4R A;  4FEC A;  5I2N A;  2IA4 A;  1DPE A;  1MM7 A;  4QFP A;  1B1X A;  1Q35 A;  1O7T A;  3O97 A;  1VR5 A;  3LC8 A;  3TCF A;  5HPQ A;  3QXM A;  3Q29 A;  3TMG A;  1SD3 A;  5H8Q A;  3Q28 A;  5CC2 A;  3H7M A;  4F31 B;  3D4G A;  1IQ7 A;  4IO5 A;  3BKI B;  4NF4 A;  5EHS A;  4HW8 A;  3N5L A;  1N04 A;  3O28 A;  4R6Y A;  5I57 A;  2I48 A;  1FQC A;  2ONR A;  4F1V A;  1AL3 A;  1LFI A;  4ECF A;  3ZS6 A;  3C4M A;  4ESW A;  1Y4T A;  4RNS A;  2XXR A;  2QSX A;  3TQL A;  3CI8 A;  3QK6 A;  1URD A;  3LSX A;  4OES A;  4AQ4 A;  5L9M A;  1RKM A;  2ZYN A;  4IO4 A;  1B5I A;  3ONM A;  1I6A A;  1H45 A;  4NTL A;  1II5 A;  4G68 B;  5TP9 A;  1R6Z A;  3VDF A;  2I58 A;  4ELP A;  1N3X A;  3KFM A;  1FCK A;  3VVE A;  4OET A;  2RF1 A;  1P1O A;  4RK2 A;  4YAH X;  4ZEK A;  4KI0 E;  1RYO A;  5CMC A;  4GL8 A;  3P7I A;  3SEX A;  2R71 A;  5H8Q B;  4GLI A;  4Q5T A;  4ZZE A;  3UK4 A;  1TT1 A;  1Y1Z A;  2F36 A;  4LVQ A;  4NF4 B;  3UA8 A;  4H65 A;  3R6U A;  1YCJ A;  1A8E A;  5F1Q A;  2FA7 A;  5I57 B;  4OFO A;  4H5G A;  4DCY A;  1LAH E;  3T93 B;  2Q88 A;  3FD3 A;  4OQO A;  3O6I A;  4DLD A;  4JB7 A;  4FE8 A;  1XT8 A;  4FEB A;  3CSB A;  4RA1 A;  2W7Y A;  1JVX A;  4I9D A;  2DWJ A;  5BWJ A;  4QSD A;  3M3K A;  3CVG A;  3KBR A;  3JYR A;  4FAT A;  4QSC A;  1IZ1 A;  3KSJ A;  4IY5 A;  4H5F A;  4F3G A;  1ZIU A;  5JK4 A;  3M3L A;  1A54 A;  4DCX A;  2ZXT A;  5K2Y A;  4F22 A;  4C1U A;  4GF8 A;  1VFE A;  4BLA A;  1LAF E;  3W15 C;  5TP9 B;  2Q89 A;  2ABH A;  4JDF A;  1D4N A;  4BDN A;  4XKR A;  1BTJ A;  1KWH A;  1R9L A;  5HBC A;  1Y1M A;  1R9Q A;  3KN8 A;  3VE1 B;  5J1D A;  3N26 A;  4ONY A;  3T66 A;  1PEB A;  4F18 A;  3MZ9 A;  3U72 A;  3C9H A;  3MUQ A;  1R1N A;  3E9X A;  2B3F A;  2QL3 A;  3I5O A;  1MQG A;  2I3W A;  2R6G E;  3SEW A;  1PB7 A;  2E0S A;  5TPA B;  2F6G A;  4R6H A;  2DYX A;  2R9J A;  1TFD A;  2HXW A;  2Q9T A;  4FED A;  1MQD A;  1IXG A;  2FNC A;  4N6P A;  4PFW A;  3U92 A;  4YKJ A;  3C35 A;  4LQ2 A;  2QMX A;  4Z0I A;  5I58 B;  1MPD A;  4OHN A;  1NNK A;  1DTG A;  1FTJ A;  1N84 A;  1M5F A;  4F1U A;  5KCJ B;  1NMU A;  3RY3 A;  3FXQ A;  2VP1 A;  1ZTY A;  3RTW B;  3TQW A;  4U22 A;  3AXF A;  4LZ5 A;  4O3A A;  3IL1 B;  2O1M A;  3K1M A;  4QRZ A;  1B1H A;  3BFU A;  4ZZA A;  1JQF A;  3EHT A;  4EXK A;  1Y4C A;  1QUK A;  2ZNT A;  4XKN A;  3S9E A;  1N76 A;  4WKM A;  3V83 A;  2O1L A;  3U93 A;  1HSE A;  1OVT A;  3C31 A;  4Q0C A;  1MH3 A;  5I59 A;  1FQA A;  4YB7 A;  1MXX A;  4IGR A;  3WAE A;  3FJ7 A;  4ELO A;  1MQJ A;  3T9H B;  4JWO A;  2B65 A;  2ANJ A;  3TTM A;  3LUY A;  3UN6 A;  3KEI A;  1EZP A;  1H43 A;  2XXH A;  2RC7 A;  3Q26 A;  4HCY A;  5IAI A;  2V25 A;  3K1N A;  1DPP A;  2O69 A;  4BDR A;  4KFQ A;  3OO7 A;  4QHQ A;  3HPI A;  3FAT A;  2BJJ X;  4O3C A;  1JW1 A;  2Q2C A;  3IJO B;  3H6W A;  1B7H A;  1SYH A;  4THI A;  4OXV A;  4NMY A;  4FAJ A;  3LSF B;  5HM4 B;  1QVS A;  4EF2 A;  1B5J A;  4P0G A;  1IXC A;  1B3F A;  5TU0 A;  3MW0 A;  3ECR A;  2GRV A;  2DWI A;  2I0B A;  1Z7N E;  4QSE A;  3SET A;  3Q27 A;  3K4U A;  4C0R A;  3H3G A;  2XHD A;  3ODB A;  3R26 A;  3OMB A;  5DVJ A;  1OIB A;  3EPE A;  1LFH A;  4EXL A;  5CM6 A;  1UQW A;  2ONK E;  4OEV A;  2P2A A;  2OWS A;  3M3F A;  3C33 A;  3OEK A;  4ZE9 A;  4PQJ A;  3T9U A;  2G29 A;  2VOZ A;  1N0T A;  1CB6 A;  3A09 A;  2P1S A;  2H4I A;  3KSX A;  3E13 X;  4ZS9 A;  3KGC A;  2XD2 A;  1PDA A;  4N07 A;  4JWY A;  3RPW A;  2Y7R A;  2QRY A;  3PD9 A;  1IEJ A;  2X26 A;  4KYD A;  3MZB A;  5ICQ A;  2UYE A;  4PE5 B;  3OEM A;  3RT6 B;  2I49 A;  3N6U A;  2UVJ A;  2F8D A;  2XXV A;  2XX8 A;  2XX9 A;  3H06 B;  5CMB A;  2DWA A;  3KOS A;  3QUF A;  3FXU A;  4PFU A;  3GZG A;  4KYE A;  2ONS A;  3K6X A;  3JZJ A;  3N94 A;  3RTF B;  2GH9 A;  3IOT A;  4ZEI A;  2GHA A;  3S9L C;  1MPC A;  4L17 A;  1SI1 A;  2V3U A;  2O6A A;  3IJX B;  3RQT A;  1PC3 A;  3HHF A;  4X9T A;  1MXZ A; 
#chains in the Genus database with same CATH topology
 1A8F A;  3H6T A;  3W9W A;  3MP1 A;  4GBW A;  1UTH A;  1NV7 A;  4P8B A;  1SYI A;  2CZL A;  3ILT B;  2Z23 A;  4HXV A;  1FJ6 A;  4FJP A;  4ZEF A;  3ZKK A;  2X7Q A;  1MY0 A;  1FTO A;  4KQP A;  3TZA A;  3JV9 A;  3HN0 A;  2YJP A;  1LST A;  1Y9U A;  1LBV A;  2Y84 A;  2Q8M A;  4G68 A;  3H4Z A;  4I40 A;  3TKD A;  1MH4 A;  1Y3P A;  4MAG A;  3PUZ E;  1B05 A;  3T9X B;  1MXY A;  2AL4 A;  1SW2 A;  1B2H A;  5B70 A;  3EF7 A;  4OEU A;  1FPG A;  3SEY A;  2F7A A;  4U4X A;  2LAO A;  1N7X A;  4MJO A;  4U4S A;  1JW5 A;  3IB0 A;  1Y20 A;  1YZ0 A;  4N13 A;  1TWY A;  3H03 A;  3SKP A;  2HHM A;  3DP8 A;  2GHB A;  2WBB A;  3OO8 A;  4YB5 A;  1H3D A;  3PPP A;  3UP9 A;  2B4L A;  5IKB A;  1M5D A;  4JVI A;  2NXO A;  2O7I A;  4PGN A;  1J1N A;  1MQH A;  3CFL A;  5H8H A;  2HQ0 A;  1NI9 A;  1USY E;  2DXY A;  2DQV A;  1I6B A;  1NV4 A;  2PVU A;  2ZYK A;  3ZKL A;  2OK2 A;  3ZSF A;  4GX6 A;  1DOT A;  3CG3 A;  3MJN A;  1MM6 A;  2DE4 A;  3A29 A;  5K2X A;  1UTH B;  1A99 A;  4RXL A;  3O9P A;  3QSL A;  4OVP A;  3KOT A;  4DE8 A;  3S9N C;  1IMA A;  4XKP A;  5EQA A;  1Y3N A;  3MVW A;  4EUO A;  3TEL A;  2D21 A;  1LGB C;  5H8F A;  3CR9 A;  4NWD A;  4F29 A;  1M5E A;  3S4U A;  4OTE A;  2ZNS A;  2F7B A;  2DSF A;  4MF3 A;  3RLF E;  3KC0 A;  4TOZ A;  3G3F A;  2PBW A;  4GWY A;  2Q8J A;  4F3B A;  2F34 A;  1US4 A;  4GWO A;  3FVN A;  1XS5 A;  2P0S A;  5DVF A;  1NH8 A;  4R72 A;  4FOR A;  2RIN A;  1MPB A;  4QFK A;  4DI4 B;  4GWU A;  2F35 A;  2THI A;  4QF9 A;  3HFU A;  5IGA A;  4H8J A;  3EQ1 A;  2XXK A;  4RPN A;  1L5T A;  3HO7 A;  2I0C A;  2HCA A;  4TLL B;  5FTH A;  3O6H A;  3PPN A;  5H8H B;  5TPA A;  1JET A;  1TXF A;  4KPT A;  2CZI A;  2PCR A;  3RNN A;  2XXX A;  3RGY A;  2OLB A;  1IXH A;  3QMF A;  2F3B A;  4DXC A;  1D9Y A;  4AS5 A;  1LAG E;  3OSQ A;  2IEE A;  4G68 C;  2MKZ A;  1AMF A;  2B4M A;  4OFL A;  1FTL A;  3LR1 A;  4H0W A;  4QBA A;  5I58 A;  3MPL A;  3FAS A;  5H8F B;  5FHM A;  4XKQ A;  3CG1 A;  1EH3 A;  5KCJ A;  3RT8 A;  3PPQ A;  1FQD A;  3IX1 A;  4PFI A;  2DP8 A;  1URS A;  5AA2 D;  4R75 A;  3G3I A;  3IR1 A;  2QFL A;  1FTM A;  2PT1 A;  3VLV A;  2H98 A;  3H6V A;  3IFC A;  5H8S A;  4O7I A;  4BDM A;  4PP0 A;  4N8Y A;  4PF8 A;  1MXW A;  1XVY A;  2P3V A;  2QS4 A;  3VXB A;  3MQ9 A;  5ET7 A;  2I4C A;  3GXA A;  3RUM A;  2QPQ A;  3VV5 A;  3GBB A;  3EHU A;  3FIR A;  2CMO A;  3VLW A;  2PYY A;  3O66 A;  4MX6 A;  4QFL A;  3R7X A;  2Q74 A;  3U94 A;  3L6G A;  2WBD A;  1FBF A;  4OWD A;  4YIC A;  3G3K A;  4X04 A;  4NF8 A;  1LBZ A;  2UVG A;  1LBB A;  2UYF A;  2WEF A;  1UIV A;  3KN3 A;  4KYS A;  1VE4 A;  1NNT A;  2KQZ A;  5JTY A;  1XHY A;  2Y7I A;  1ZLQ A;  3CIJ A;  1O64 A;  3BIG A;  4EF1 A;  3IAZ A;  5M2V A;  1XC1 A;  3PMX A;  2REJ A;  3OEL A;  4GWS A;  3U65 A;  1EYK A;  4YMB A;  4H67 A;  3K01 A;  4IO6 A;  2ZYM A;  4PAI A;  5EHM A;  4R73 A;  3MWB A;  1LB9 A;  3NOH A;  5IZ1 A;  3FVG A;  1FPJ A;  2R8T A;  1K9Z A;  5KZT A;  2DWH A;  4LP2 B;  4PET A;  3TTN A;  2OWZ A;  3CFZ A;  3SEU A;  1S50 A;  4ISU A;  2OWT A;  4OEN A;  4H6D A;  1LBY A;  3VFJ A;  4BDQ A;  4F39 A;  4UAB A;  3B6T A;  4MLV A;  3DP6 A;  3RPL A;  1B3H A;  2VGQ A;  3K6W A;  4TQU Q;  4OZ9 A;  3TTL A;  1ANF A;  2XXI A;  1MDQ A;  1BP5 A;  1KA1 A;  4GXS B;  4GFR A;  3FVK A;  1TFA A;  2RCA A;  2DXR A;  4NF8 B;  1LFG A;  1GTK A;  4MFI A;  4FIM A;  2H99 A;  5BUU A;  1B6H A;  1D3K A;  5JTY B;  2CEX A;  2F78 A;  3ILU B;  4N81 A;  2Y7W A;  4NWC A;  4F1Y A;  4JSO A;  4ZEB A;  2QS2 A;  4QXD A;  4NF6 A;  3D4C A;  1RYX A;  1LCF A;  3LBS A;  2HZK A;  1FSA A;  1S7Y A;  2O68 A;  4OER A;  3FV2 A;  3TDJ A;  4WXJ A;  2BJI A;  4GOT A;  4RY1 A;  4XFE A;  4GIZ A;  2WX9 A;  1QUL A;  2HFB A;  4RJZ A;  3B6W A;  2DVZ A;  4YKI A;  3QYT A;  3PPO A;  1NV3 A;  3DM0 A;  3RPL B;  4OVR A;  4IGT A;  4R6K A;  5FBP A;  1ATG A;  4JSD A;  2O51 A;  5IZ3 A;  4RPO A;  3FVO A;  2QS3 A;  3DP4 A;  3G3G A;  4XIG Q;  1F9B A;  1I69 A;  3TCG A;  1QJM A;  4UA8 A;  3M8U A;  3UGW A;  3CRB A;  5I5P A;  2ZMB A;  3RN8 A;  2YLN A;  5DT6 A;  2O7U A;  3HCQ A;  3MST A;  4KD5 A;  1T0K A;  4PC9 A;  4ESX A;  3GLB A;  3PUX E;  4N6K A;  3T22 A;  5I2K A;  1P1W A;  1DK4 A;  4G8H A;  3RYD A;  4R2B A;  5CI5 A;  1WOD A;  5DEX A;  1USY H;  3A3C A;  4PFT A;  2RKM A;  4MBP A;  4NF6 B;  1VSO A;  1MY3 A;  2PFZ A;  2OBG A;  3TAJ A;  4OVT A;  2OJT A;  4Z7E A;  4MNI A;  3PMW A;  1MXU A;  2ZZX A;  1B7Z A;  3PUW E;  1FQB A;  3IK6 B;  5H8N B;  1D9V A;  3TFL A;  1DSN A;  1A55 A;  5AA3 A;  2H9B A;  1FQF A;  2Y5K A;  4O8M A;  4QFO A;  4UAC A;  2Q2A A;  1Z7M E;  3C36 A;  3DLN A;  3A3U A;  3UIF A;  5I56 B;  3QUJ A;  1FRP A;  1FTK A;  2Z8D A;  1BIY A;  5CRY A;  1YXI A;  5DYH A;  5EQ7 A;  4N17 A;  3IOW A;  1IMC A;  1HSL A;  4X48 A;  2V84 A;  2XXW A;  3PPR A;  3U1O A;  1B3G A;  3G3J A;  1SVX B;  2FBP A;  3K2D A;  3VXC A;  4TLM B;  4BDL A;  1YAE A;  2G93 A;  2XWO A;  4LAT A;  3OOA A;  2UXA A;  2JJK A;  1MY2 A;  4LUB A;  5IM2 A;  5I2K B;  2HEU A;  2A5T A;  1NNP A;  3UOR A;  2QJE A;  5DEX B;  4GVO A;  4IY6 A;  1H44 A;  1UTB A;  2Z8E A;  1YTV A;  4IO3 A;  4F19 A;  2CZK A;  2VHA A;  3IO4 A;  3PUV E;  1QKA A;  2HAU A;  1NV1 A;  2OX3 A;  2XXY A;  4GXA A;  1MY4 A;  1JW4 A;  4F2Q A;  3B7D A;  4MMP A;  5KDT B;  2PMS A;  4ZED A;  3FV1 A;  3KG2 A;  3MVY A;  5EQ8 A;  3SER A;  1NNF A;  4F2O A;  2RCB A;  1AIV A;  4GBV A;  1I6Q A;  2FHY A;  1MG1 A;  1JEV A;  4OA4 A;  3CFX A;  4I62 A;  5FHO A;  3F11 A;  4LA9 A;  2Y5L A;  1NV5 A;  2NVU B;  4AB5 A;  4I1D A;  4MH5 A;  5FHN A;  1IMD A;  4LZ7 A;  1B46 A;  2XD3 A;  1A7L A;  4X1B A;  4R2F A;  3T0J A;  1GR2 A;  4U2R A;  2Z22 A;  4IO7 A;  3TUS A;  4YZZ A;  2ESN A;  3PMV A;  2REG A;  1O63 A;  1IIT A;  4N4U A;  1PB9 A;  4OVQ A;  1WVJ A;  1XI6 A;  1B0L A;  4ZE8 A;  5J16 A;  3T96 B;  1AWB A;  2RC9 A;  3DEL B;  1QUJ A;  4NN3 A;  2A5T B;  3MP8 A;  1A40 A;  4N15 A;  4C1T A;  4GQO A;  4WED A;  1B51 A;  3FGS A;  1QKB A;  4GRK A;  2DE3 A;  1IMF A;  2HPG A;  1UTB B;  4JXI A;  4P1L A;  3PV0 E;  3KJ7 A;  4F3P A;  1NH7 A;  1OQG A;  2F97 A;  5EYF A;  1FTA A;  4HS7 A;  2HZL A;  1JEU A;  2VD3 A;  5I3S A;  4YB6 A;  1B9J A;  2XXQ A;  1P99 A;  2A5S A;  2D3I A;  4NX1 A;  3MPK A;  1G0H A;  1B58 A;  1LCT A;  4PCD A;  5I84 A;  4U23 A;  5AE4 A;  1NKX A;  2NWJ A;  3HV1 A;  5AA2 A;  3USD A;  4RYA A;  3SES A;  3PD8 A;  5I2N B;  3MVX A;  3O2A A;  4PFR A;  1DTZ A;  2PT2 A;  1K9Y A;  4O7M A;  3IB1 A;  5LOM A;  1NL5 A;  1LLS A;  1PB8 A;  3TTR A;  1URG A;  4P0I A;  5A5L A;  3V8X B;  4DZ1 A;  4E0W A;  4G4P A;  3O6G A;  2QS1 A;  1FPD A;  5F24 A;  1INP A;  3K6V A;  4NED A;  2V3Q A;  1HSJ A;  4NF0 A;  1BKA A;  1FPI A;  2DE2 A;  3FJM A;  1P1U A;  2ZYO A;  3S9M C;  1B0H A;  1Y3Q A;  1CE2 A;  5L8D A;  1MQI A;  3MAM A;  4HTG A;  1RDY A;  2UVH A;  4I3Y A;  1NUW A;  4ZDM A;  2GFE A;  5AA1 A;  3OD7 A;  1NFT A;  1SDX A;  4QFN A;  3EN3 A;  1IUD A;  1DMB A;  1G0I A;  3C34 A;  3IB2 A;  3BBR A;  4K3F A;  2H5Y A;  3MP6 A;  4GL0 A;  2QVV A;  4G2Z A;  1ELJ A;  4G77 A;  4H8I A;  1OLA A;  4XF5 A;  4H46 A;  2Y7K A;  4BDO A;  3K00 A;  4MEV A;  1B4H A;  3W9V A;  3TPA A;  4M1V A;  5AA2 B;  2FIE A;  5IZZ A;  3E3K A;  4NGU A;  4ND9 A;  2OZZ A;  1M5C A;  1H76 A;  1JVY A;  5LDZ A;  1ZKB A;  4MIJ A;  3BFT A;  3O29 A;  3IOV A;  4H1X A;  1EZO A;  3KJT A;  5DTB A;  4JVC A;  2YPN A;  4M4G A;  4PFY A;  2VD2 A;  1SW1 A;  4GD5 A;  2V3T A;  4WEP A;  3E78 A;  5FTI A;  1SI0 A;  4U21 A;  5ET8 A;  1B3E A;  4KCD A;  2UVI A;  3PGF A;  1SBP A;  1MRP A;  4POW A;  3CHG A;  1POT A;  2DOJ A;  1YPN A;  3B6Q A;  4LZ8 A;  3THI A;  4NF5 A;  3TOD A;  2DVC A;  4P56 A;  2M8C A;  3FJG A;  4U1Z A;  1MDP 1;  4IR8 A;  2XX7 A;  5EYG A;  3OO9 A;  4XXU A;  3Q25 A;  1LAX A;  1FW0 A;  1GV8 A;  3I3V A;  3OSR A;  4POX A;  4IO2 A;  1GVC A;  4F3S A;  1OMP A;  2AYS A;  4JBZ A;  1OQH A;  4N6D A;  4OFJ A;  3PU5 A;  1MY1 A;  3MYU A;  3HHG A;  2I6E A;  2Z8F A;  3LSW A;  1XOC A;  1LBC A;  3G7W A;  1FBD A;  4YKK A;  5A5X A;  4KCC A;  2WKY A;  3OXN A;  3V5A A;  4R9G A;  3IOU A;  2X7P A;  3FXR A;  3MBP A;  3PUY E;  1DBZ A;  1WDN A;  4EQ9 A;  1FPB A;  5ELV A;  1P1Q A;  3CSG A;  1B5H A;  1SW5 A;  5CMK A;  2ALU A;  1GGG A;  2F5X A;  4EDP A;  1NV6 A;  1OVB A;  3FUZ A;  1M5B A;  3T9V A;  1EU8 A;  1IIW A;  3EHS A;  4OVS A;  4G8M A;  3VVF A;  2WYP A;  3OO6 A;  1XVX A;  5ICT A;  1B32 A;  2XXU A;  4MNP A;  1LB8 A;  3VVD A;  3TEP A;  2F7C A;  4HE1 A;  4YKP A;  4NF5 B;  1P1N A;  1AOV A;  4EQB A;  4P3L A;  1Q1K A;  5B7D A;  1D9Q A;  2NUV A;  3K1P A;  3VLU A;  4I8C A;  5ITO A;  1NV2 A;  4Q8R A;  2NOO A;  4MLQ A;  5H8N A;  3IOR A;  1MXV A;  1FQE A;  2O84 X;  1PBQ A;  4PDD A;  5AA4 A;  2QMW A;  3S2V A;  2ZZV A;  2H25 A;  5ITP A;  5I56 A;  1QGX A;  1BLF A;  4LQ5 A;  5A5X B;  2F6P A;  4Q30 B;  1RDZ A;  4KR5 A;  3C32 A;  4XTC Q;  4KHZ E;  3GBA A;  4R9F A;  5ISU A;  1QUI A;  3KZG A;  5JEI A;  3H6U A;  1ZJL A;  3QIM A;  1EZ9 A;  1AH5 A;  5F7V A;  4R74 A;  4AB6 A;  1ZMG A;  4JWX A;  4DDD A;  2B3B A;  5CBR A;  5EYH A;  5L9S A;  1JP4 A;  1B4Z A;  1ZBM A;  4X1D A;  4HCW A;  3WAF A;  5ET6 A;  1S9T A;  4ELQ A;  1N7W A;  5I59 B;  2E1S A;  2RC8 A;  1FBH A;  3V89 B;  5LTC A;  2D5W A;  4G8N A;  2I3V A;  4EQ7 A;  4U1O A;  1EYJ A;  3IO6 A;  3KN7 A;  1VFD A;  2DS9 A;  3GYY A;  4ZEC A;  4OVJ A;  1B40 A;  3G3H A;  5KDT A;  4ELR A;  4RK9 A;  1SQY A;  3QAX A;  2PX1 A;  3TYH A;  2HAV A;  1OLC A;  4OYV A;  4NAP A;  1ZU0 A;  4DXU A;  3MC2 A;  1QW0 A;  3MZ1 A;  5AA4 B;  3FZV A;  1US5 A;  2Y7P A;  3TCH A;  2VPN A;  3K0V A;  3OEN A;  4GX3 A;  3L6H A;  2ZNU A;  1POY 1;  2XXP A;  4P11 A;  2KLF A;  5ESY A;  1B3L A;  1Q9D A;  1FJ9 A;  1UIU A;  3SZP A;  1PBP A;  3LUZ A;  3PTY A;  3MVZ A;  4O3B A;  3I6V A;  1B52 A;  2AL5 A;  1SW4 A;  5DVI A;  4IB2 A;  3TTK A;  5CBS A;  3IFA A;  1MS7 A;  2P3N A;  4LON B;  3K6U A;  4DXB A;  1KZ8 A;  4YMA A;  4NQ8 A;  2V93 A;  3SEV A;  2HXR A;  1JNF A;  4E0X A;  1EYI A;  1BK4 A;  3SDF A;  3K02 A;  5L9O A;  1FBC A;  2XXT A;  2I4B A;  1IXI A;  4X8R A;  2FYI A;  3LSL A;  5T3J A;  2CEY A;  3HST A;  2AIX A;  1B7U A;  4OMB A;  3U8Q A;  4OAN A;  4NE4 A;  2OCU A;  4DIG A;  3N6T A;  5CMM A;  4YU0 A;  1N3W A;  3E4R A;  4FEC A;  5I2N A;  2IA4 A;  1DPE A;  1MM7 A;  4QFP A;  1B1X A;  1FPE A;  1Q35 A;  1O7T A;  3O97 A;  1VR5 A;  3LC8 A;  1KA0 A;  3TCF A;  5HPQ A;  3QXM A;  3B8B A;  3Q29 A;  3TMG A;  1SD3 A;  5H8Q A;  3Q28 A;  5CC2 A;  3H7M A;  4F31 B;  3D4G A;  1IQ7 A;  1FBP A;  4IO5 A;  3BKI B;  4NF4 A;  5EHS A;  4HW8 A;  3N5L A;  1N04 A;  3O28 A;  4LN5 A;  4FBP A;  4R6Y A;  5I57 A;  2I48 A;  4P47 A;  1FQC A;  2ONR A;  4F1V A;  1AL3 A;  1LFI A;  4GWX A;  2V4C A;  4PE3 A;  4ECF A;  3ZS6 A;  1YYZ A;  3C4M A;  4ESW A;  1Y4T A;  4RNS A;  2XXR A;  3T1B A;  2QSX A;  3TQL A;  3CI8 A;  3QK6 A;  1URD A;  2ZZW A;  3LSX A;  4OES A;  1NUZ A;  4N91 A;  4AQ4 A;  3FXB A;  5L9M A;  1RKM A;  2ZYN A;  4IO4 A;  1B5I A;  3ONM A;  1I6A A;  1H45 A;  4MHF A;  1FPL A;  4NTL A;  1II5 A;  4G68 B;  5TP9 A;  4MCO A;  1R6Z A;  3VDF A;  2I58 A;  1N3X A;  4ELP A;  4PAK A;  3KFM A;  1FCK A;  4PAF A;  3VVE A;  2FIX A;  4OET A;  2RF1 A;  1P1O A;  4RK2 A;  4YAH X;  4ZEK A;  4KI0 E;  1RYO A;  5CMC A;  4GL8 A;  3P7I A;  3SEX A;  2VPO A;  4PF6 A;  2R71 A;  5H8Q B;  4GLI A;  4Q5T A;  4ZZE A;  3UK4 A;  1TT1 A;  1Y1Z A;  2F36 A;  4LVQ A;  4NF4 B;  3UA8 A;  4H65 A;  3R6U A;  1YCJ A;  1A8E A;  5F1Q A;  2FA7 A;  5I57 B;  4OFO A;  4H5G A;  4DCY A;  1LAH E;  3T93 B;  2Q88 A;  3FD3 A;  4OQO A;  3O6I A;  4DLD A;  4JB7 A;  4FE8 A;  1XT8 A;  4FEB A;  3CSB A;  1IME A;  4RA1 A;  4HE0 A;  2W7Y A;  1JVX A;  4I9D A;  2DWJ A;  5BWJ A;  4QSD A;  3M3K A;  3CVG A;  3KBR A;  3JYR A;  4FAT A;  4QSC A;  1IZ1 A;  3KSJ A;  4IY5 A;  4H5F A;  4F3G A;  1ZIU A;  5JK4 A;  3M3L A;  1A54 A;  4DCX A;  2ZXT A;  5K2Y A;  4F22 A;  4C1U A;  4GF8 A;  1VFE A;  4JVD A;  4BLA A;  1LAF E;  3W15 C;  5TP9 B;  2Q89 A;  1CNQ A;  2ABH A;  4P1E A;  4JDF A;  1D4N A;  4BDN A;  4XKR A;  1BTJ A;  1KWH A;  1R9L A;  5HBC A;  1Y1M A;  1R9Q A;  1FBE A;  3KN8 A;  3VE1 B;  2VT5 A;  5J1D A;  2DDK A;  3N26 A;  4ONY A;  3T66 A;  1PEB A;  4N8G A;  1FPF A;  4F18 A;  3MZ9 A;  3U72 A;  3C9H A;  3MUQ A;  1R1N A;  3E9X A;  2B3F A;  2QL3 A;  3I5O A;  2GQ1 A;  1MQG A;  2I3W A;  3EKI A;  1FBG A;  2R6G E;  1NV0 A;  3SEW A;  1PB7 A;  2E0S A;  5TPA B;  1NUY A;  1LBX A;  2QVR A;  2F6G A;  4R6H A;  2DYX A;  4PDH A;  2R9J A;  1TFD A;  2HXW A;  2Q9T A;  4FED A;  1MQD A;  1IXG A;  2FNC A;  4N6P A;  4PTK A;  4PFW A;  3U92 A;  4YKJ A;  3C35 A;  3KC1 A;  4LQ2 A;  2QMX A;  4Z0I A;  5I58 B;  1MPD A;  4OHN A;  1NNK A;  1DTG A;  1FTJ A;  1N84 A;  1M5F A;  4F1U A;  5KCJ B;  1NMU A;  3RY3 A;  3FXQ A;  2CZH A;  2VP1 A;  1ZTY A;  1DCU A;  3RTW B;  4KXP A;  3TQW A;  4U22 A;  3AXF A;  4LZ5 A;  4O3A A;  3IL1 B;  2O1M A;  2F3D A;  3K1M A;  4QRZ A;  1B1H A;  3BFU A;  3ISP A;  4AS4 A;  4ZZA A;  1JQF A;  3EHT A;  4H45 A;  4EXK A;  1FPK A;  1Y4C A;  1QUK A;  2ZNT A;  4XKN A;  3S9E A;  4MNC A;  1N76 A;  4WKM A;  3V83 A;  3E79 A;  2O1L A;  3U93 A;  1IMB A;  1HSE A;  2L5V A;  2PFY A;  1OVT A;  3C31 A;  4Q0C A;  1MH3 A;  5I59 A;  2XA5 A;  1FQA A;  4YB7 A;  1MXX A;  4IGR A;  3WAE A;  3B50 A;  3D1R A;  3FJ7 A;  1MQJ A;  3T9H B;  4ELO A;  3KBZ A;  4JWO A;  5DW8 A;  2B65 A;  4P9K A;  4PBH A;  2ANJ A;  3TTM A;  3LUY A;  3UN6 A;  3KEI A;  1EZP A;  4O94 A;  1H43 A;  2XXH A;  2RC7 A;  1RDX A;  3Q26 A;  4HCY A;  5IAI A;  2V25 A;  1VDW A;  3K1N A;  4XEQ A;  1DPP A;  2O69 A;  3BIH A;  2XWK A;  4BDR A;  4KFQ A;  3OO7 A;  4HE2 A;  3ROJ A;  4G61 A;  4QHQ A;  3HPI A;  3FAT A;  2BJJ X;  2QVU A;  4O3C A;  1JW1 A;  2Q2C A;  3IJO B;  3H6W A;  4DI3 D;  1B7H A;  1SYH A;  5I7I A;  4THI A;  4OXV A;  4NMY A;  5EQ9 A;  4FAJ A;  3LSF B;  5HM4 B;  1QVS A;  4EF2 A;  1B5J A;  4P0G A;  1IXC A;  1B3F A;  5TU0 A;  2XWI A;  3MW0 A;  3ECR A;  1SPI A;  2GRV A;  4NHB A;  2DWI A;  2I0B A;  1Z7N E;  4QSE A;  3SET A;  5ET5 A;  3Q27 A;  3K4U A;  4C0R A;  3H3G A;  2XHD A;  3ODB A;  3R26 A;  3OMB A;  5DVJ A;  3LV0 A;  1OIB A;  3EPE A;  1LFH A;  4EXL A;  5CM6 A;  1UQW A;  2ONK E;  4OEV A;  2P2A A;  2OWS A;  3M3F A;  3C33 A;  3OEK A;  4PGP A;  4NG7 A;  4ZE9 A;  4PQJ A;  4GX4 A;  2G29 A;  3T9U A;  2VOZ A;  1N0T A;  1CB6 A;  3A09 A;  4GWW A;  2P1S A;  4PBQ A;  2H4I A;  3KSX A;  3E13 X;  2XD2 A;  3KGC A;  4ZS9 A;  1PDA A;  4N07 A;  4JWY A;  3RPW A;  2Y7R A;  2QRY A;  3PD9 A;  1IEJ A;  2X26 A;  4KYD A;  3MZB A;  5ICQ A;  2UYE A;  4PFB A;  4PE5 B;  3OEM A;  3RT6 B;  2I49 A;  3N6U A;  2UVJ A;  2F8D A;  2XXV A;  2XX8 A;  2XX9 A;  2FVZ A;  3H06 B;  5CMB A;  2DWA A;  3KOS A;  3QUF A;  3FXU A;  2WYK A;  4PFU A;  3GZG A;  4KYE A;  2ONS A;  3K6X A;  3JZJ A;  3N94 A;  2KR0 A;  3RTF B;  2GH9 A;  3IOT A;  1LEV A;  4ZEI A;  2GHA A;  3FBP A;  4I3E A;  5IZ3 B;  3S9L C;  1MPC A;  1LBW A;  4L17 A;  1SI1 A;  2V3U A;  2O6A A;  3IJX B;  3RQT A;  1PC3 A;  3HHF A;  4X9T A;  1NUX A;  1MXZ A;  2XWV A;  4GWZ A; 
#chains in the Genus database with same CATH homology
 1A8F A;  3H6T A;  3W9W A;  3MP1 A;  1UTH A;  1SYI A;  2CZL A;  3ILT B;  2Z23 A;  4FJP A;  4ZEF A;  3ZKK A;  2X7Q A;  1MY0 A;  1FTO A;  4KQP A;  3TZA A;  3JV9 A;  3HN0 A;  2YJP A;  1LST A;  1Y9U A;  2Y84 A;  4G68 A;  3H4Z A;  3TKD A;  1MH4 A;  1Y3P A;  3PUZ E;  1B05 A;  3T9X B;  1MXY A;  2AL4 A;  1SW2 A;  1B2H A;  5B70 A;  3EF7 A;  4OEU A;  3SEY A;  2F7A A;  4U4X A;  2LAO A;  1N7X A;  4U4S A;  1JW5 A;  3IB0 A;  1Y20 A;  4N13 A;  1TWY A;  3H03 A;  3SKP A;  3DP8 A;  2GHB A;  3OO8 A;  4YB5 A;  1H3D A;  3PPP A;  3UP9 A;  5IKB A;  1M5D A;  2NXO A;  2O7I A;  1J1N A;  1MQH A;  3CFL A;  5H8H A;  2HQ0 A;  1USY E;  2DXY A;  2DQV A;  1I6B A;  2PVU A;  2ZYK A;  3ZKL A;  2OK2 A;  3ZSF A;  1DOT A;  3CG3 A;  3MJN A;  1MM6 A;  2DE4 A;  5K2X A;  1UTH B;  1A99 A;  4RXL A;  3O9P A;  3QSL A;  3KOT A;  4DE8 A;  3S9N C;  4XKP A;  1Y3N A;  3MVW A;  4EUO A;  3TEL A;  2D21 A;  1LGB C;  5H8F A;  3CR9 A;  4NWD A;  4F29 A;  1M5E A;  3S4U A;  4OTE A;  2ZNS A;  2F7B A;  3RLF E;  2DSF A;  4MF3 A;  4TOZ A;  3G3F A;  2PBW A;  2Q8J A;  4F3B A;  2F34 A;  1US4 A;  4GWO A;  3FVN A;  1XS5 A;  2P0S A;  5DVF A;  1NH8 A;  4R72 A;  4FOR A;  2RIN A;  1MPB A;  4QFK A;  2F35 A;  2THI A;  4QF9 A;  4H8J A;  3EQ1 A;  1L5T A;  4RPN A;  3HO7 A;  2I0C A;  2HCA A;  4TLL B;  5FTH A;  3O6H A;  3PPN A;  5H8H B;  5TPA A;  1JET A;  1TXF A;  4KPT A;  3RNN A;  2XXX A;  3RGY A;  2OLB A;  1IXH A;  4DXC A;  1D9Y A;  1LAG E;  3OSQ A;  2IEE A;  4G68 C;  1AMF A;  4OFL A;  1FTL A;  3LR1 A;  4H0W A;  5I58 A;  3MPL A;  3FAS A;  5H8F B;  5FHM A;  4XKQ A;  3CG1 A;  1EH3 A;  5KCJ A;  3RT8 A;  3PPQ A;  1FQD A;  3IX1 A;  2DP8 A;  1URS A;  5AA2 D;  4R75 A;  3G3I A;  3IR1 A;  1FTM A;  2PT1 A;  3VLV A;  2H98 A;  3H6V A;  5H8S A;  4BDM A;  4PP0 A;  1MXW A;  1XVY A;  2QS4 A;  3VXB A;  3MQ9 A;  2I4C A;  3GXA A;  3RUM A;  2QPQ A;  3VV5 A;  3GBB A;  3EHU A;  3FIR A;  2CMO A;  3VLW A;  2PYY A;  3O66 A;  4QFL A;  3R7X A;  3U94 A;  3L6G A;  4OWD A;  4YIC A;  3G3K A;  4NF8 A;  2UVG A;  1LBB A;  2UYF A;  1UIV A;  3KN3 A;  4KYS A;  1VE4 A;  1NNT A;  5JTY A;  1XHY A;  2Y7I A;  1ZLQ A;  3CIJ A;  1O64 A;  4EF1 A;  3IAZ A;  5M2V A;  1XC1 A;  3PMX A;  2REJ A;  3OEL A;  4YMB A;  4H67 A;  3K01 A;  4IO6 A;  2ZYM A;  5EHM A;  4R73 A;  3MWB A;  1LB9 A;  3FVG A;  5KZT A;  2DWH A;  4LP2 B;  4PET A;  3TTN A;  3CFZ A;  3SEU A;  1S50 A;  4ISU A;  2OWT A;  4OEN A;  4H6D A;  3VFJ A;  4BDQ A;  4F39 A;  3B6T A;  4MLV A;  3DP6 A;  1B3H A;  2VGQ A;  3K6W A;  4TQU Q;  4OZ9 A;  3TTL A;  1ANF A;  2XXI A;  1MDQ A;  1BP5 A;  4GXS B;  4GFR A;  3FVK A;  1TFA A;  2RCA A;  2DXR A;  4NF8 B;  1LFG A;  1GTK A;  4MFI A;  4FIM A;  2H99 A;  5BUU A;  1B6H A;  1D3K A;  5JTY B;  2F78 A;  3ILU B;  2Y7W A;  4NWC A;  4F1Y A;  4JSO A;  4ZEB A;  2QS2 A;  4NF6 A;  3D4C A;  1RYX A;  1LCF A;  3LBS A;  2HZK A;  1S7Y A;  2O68 A;  4OER A;  3FV2 A;  3TDJ A;  4WXJ A;  4GOT A;  4RY1 A;  4GIZ A;  1QUL A;  2HFB A;  4RJZ A;  3B6W A;  2DVZ A;  4YKI A;  3QYT A;  3PPO A;  3DM0 A;  4IGT A;  4R6K A;  1ATG A;  4JSD A;  2O51 A;  4RPO A;  3FVO A;  2QS3 A;  3DP4 A;  3G3G A;  4XIG Q;  1F9B A;  1I69 A;  3TCG A;  1QJM A;  4UA8 A;  3M8U A;  3UGW A;  3CRB A;  2ZMB A;  3RN8 A;  2YLN A;  5DT6 A;  2O7U A;  3HCQ A;  4KD5 A;  1T0K A;  4ESX A;  3GLB A;  3PUX E;  3T22 A;  5I2K A;  1P1W A;  4G8H A;  4R2B A;  5CI5 A;  1WOD A;  5DEX A;  1USY H;  3A3C A;  4PFT A;  2RKM A;  4MBP A;  4NF6 B;  1VSO A;  1MY3 A;  2OBG A;  3TAJ A;  2OJT A;  4Z7E A;  3PMW A;  1MXU A;  1B7Z A;  3PUW E;  1FQB A;  3IK6 B;  5H8N B;  1D9V A;  3TFL A;  1DSN A;  1A55 A;  5AA3 A;  2H9B A;  1FQF A;  4QFO A;  4UAC A;  2Q2A A;  1Z7M E;  3C36 A;  3DLN A;  3A3U A;  3UIF A;  5I56 B;  3QUJ A;  1FTK A;  2Z8D A;  1BIY A;  5CRY A;  5DYH A;  3IOW A;  1HSL A;  4X48 A;  2V84 A;  2XXW A;  3PPR A;  3U1O A;  1B3G A;  3G3J A;  1SVX B;  3K2D A;  3VXC A;  4TLM B;  4BDL A;  1YAE A;  2G93 A;  4LAT A;  3OOA A;  2UXA A;  1MY2 A;  4LUB A;  5I2K B;  2HEU A;  2A5T A;  1NNP A;  3UOR A;  2QJE A;  5DEX B;  4GVO A;  4IY6 A;  1H44 A;  1UTB A;  2Z8E A;  1YTV A;  4IO3 A;  4F19 A;  2VHA A;  3IO4 A;  3PUV E;  1QKA A;  2HAU A;  2XXY A;  4GXA A;  1MY4 A;  1JW4 A;  4F2Q A;  3B7D A;  5KDT B;  2PMS A;  4ZED A;  3FV1 A;  3KG2 A;  3MVY A;  3SER A;  1NNF A;  4F2O A;  2RCB A;  1AIV A;  1I6Q A;  1MG1 A;  1JEV A;  3CFX A;  4I62 A;  5FHO A;  3F11 A;  4LA9 A;  2NVU B;  4AB5 A;  4I1D A;  4MH5 A;  5FHN A;  4LZ7 A;  1B46 A;  2XD3 A;  1A7L A;  4X1B A;  4R2F A;  1GR2 A;  4U2R A;  2Z22 A;  4IO7 A;  3TUS A;  4YZZ A;  2ESN A;  3PMV A;  2REG A;  1O63 A;  1IIT A;  1PB9 A;  1WVJ A;  1B0L A;  4ZE8 A;  3T96 B;  2RC9 A;  3DEL B;  1QUJ A;  2A5T B;  3MP8 A;  1A40 A;  4C1T A;  4GQO A;  4WED A;  1B51 A;  3FGS A;  1QKB A;  4GRK A;  2DE3 A;  1UTB B;  4JXI A;  3PV0 E;  3KJ7 A;  4F3P A;  1NH7 A;  1OQG A;  2F97 A;  5EYF A;  4HS7 A;  2HZL A;  1JEU A;  2VD3 A;  4YB6 A;  1B9J A;  2XXQ A;  1P99 A;  2A5S A;  2D3I A;  3MPK A;  1B58 A;  1LCT A;  5I84 A;  4U23 A;  5AE4 A;  1NKX A;  2NWJ A;  3HV1 A;  5AA2 A;  3USD A;  4RYA A;  3SES A;  3PD8 A;  5I2N B;  3MVX A;  3O2A A;  1DTZ A;  2PT2 A;  3IB1 A;  5LOM A;  1NL5 A;  1LLS A;  1PB8 A;  3TTR A;  1URG A;  4P0I A;  3V8X B;  4DZ1 A;  4E0W A;  4G4P A;  3O6G A;  2QS1 A;  3K6V A;  4NED A;  2V3Q A;  1HSJ A;  1BKA A;  2DE2 A;  3FJM A;  1P1U A;  2ZYO A;  3S9M C;  1B0H A;  1Y3Q A;  1CE2 A;  5L8D A;  1MQI A;  3MAM A;  4HTG A;  2UVH A;  4ZDM A;  2GFE A;  5AA1 A;  3OD7 A;  1NFT A;  1SDX A;  4QFN A;  3EN3 A;  1IUD A;  1DMB A;  3C34 A;  3IB2 A;  3BBR A;  4K3F A;  2H5Y A;  3MP6 A;  4GL0 A;  4G2Z A;  1ELJ A;  4G77 A;  4H8I A;  1OLA A;  2Y7K A;  4BDO A;  3K00 A;  1B4H A;  3W9V A;  3TPA A;  4M1V A;  5AA2 B;  3E3K A;  4ND9 A;  2OZZ A;  1M5C A;  1H76 A;  1JVY A;  1ZKB A;  3BFT A;  3O29 A;  3IOV A;  4H1X A;  1EZO A;  3KJT A;  5DTB A;  2YPN A;  4M4G A;  4PFY A;  2VD2 A;  1SW1 A;  4GD5 A;  2V3T A;  4WEP A;  5FTI A;  1SI0 A;  4U21 A;  1B3E A;  4KCD A;  2UVI A;  3PGF A;  1SBP A;  1MRP A;  4POW A;  1POT A;  2DOJ A;  1YPN A;  3B6Q A;  4LZ8 A;  3THI A;  4NF5 A;  3TOD A;  2DVC A;  2M8C A;  3FJG A;  4U1Z A;  1MDP 1;  2XX7 A;  3OO9 A;  4XXU A;  3Q25 A;  1LAX A;  1FW0 A;  1GV8 A;  3I3V A;  3OSR A;  4POX A;  4IO2 A;  1GVC A;  4F3S A;  1OMP A;  2AYS A;  4JBZ A;  1OQH A;  4OFJ A;  3PU5 A;  1MY1 A;  3HHG A;  2I6E A;  2Z8F A;  3LSW A;  1XOC A;  1LBC A;  3G7W A;  4YKK A;  5A5X A;  4KCC A;  2WKY A;  3OXN A;  3V5A A;  4R9G A;  3IOU A;  2X7P A;  3FXR A;  3MBP A;  3PUY E;  1WDN A;  4EQ9 A;  5ELV A;  1P1Q A;  3CSG A;  1B5H A;  1SW5 A;  5CMK A;  2ALU A;  1GGG A;  2F5X A;  4EDP A;  1OVB A;  3FUZ A;  1M5B A;  3T9V A;  1EU8 A;  1IIW A;  3EHS A;  4G8M A;  3VVF A;  3OO6 A;  1XVX A;  5ICT A;  1B32 A;  2XXU A;  1LB8 A;  3VVD A;  3TEP A;  2F7C A;  4YKP A;  4NF5 B;  1P1N A;  1AOV A;  4EQB A;  1Q1K A;  5B7D A;  2NUV A;  3K1P A;  3VLU A;  4I8C A;  5ITO A;  4Q8R A;  2NOO A;  4MLQ A;  5H8N A;  3IOR A;  1MXV A;  1FQE A;  2O84 X;  1PBQ A;  5AA4 A;  2QMW A;  3S2V A;  2H25 A;  5ITP A;  5I56 A;  1BLF A;  4LQ5 A;  5A5X B;  2F6P A;  4Q30 B;  4KR5 A;  3C32 A;  4XTC Q;  4KHZ E;  3GBA A;  4R9F A;  5ISU A;  1QUI A;  3KZG A;  5JEI A;  3H6U A;  1ZJL A;  3QIM A;  1EZ9 A;  1AH5 A;  5F7V A;  4R74 A;  4AB6 A;  1ZMG A;  4JWX A;  4DDD A;  2B3B A;  5CBR A;  5L9S A;  1B4Z A;  1ZBM A;  4X1D A;  4HCW A;  3WAF A;  1S9T A;  4ELQ A;  1N7W A;  5I59 B;  2E1S A;  2RC8 A;  3V89 B;  2D5W A;  4G8N A;  2I3V A;  4EQ7 A;  4U1O A;  3IO6 A;  3KN7 A;  1VFD A;  2DS9 A;  4ZEC A;  4OVJ A;  1B40 A;  3G3H A;  5KDT A;  4ELR A;  4RK9 A;  1SQY A;  3QAX A;  2PX1 A;  3TYH A;  2HAV A;  1OLC A;  4OYV A;  1ZU0 A;  4DXU A;  3MC2 A;  1QW0 A;  3MZ1 A;  5AA4 B;  3FZV A;  1US5 A;  2Y7P A;  3TCH A;  3K0V A;  3OEN A;  3L6H A;  2ZNU A;  1POY 1;  2XXP A;  4P11 A;  2KLF A;  1B3L A;  1UIU A;  1PBP A;  3MVZ A;  4O3B A;  3I6V A;  1B52 A;  2AL5 A;  1SW4 A;  5DVI A;  4IB2 A;  3TTK A;  5CBS A;  1MS7 A;  4LON B;  3K6U A;  4DXB A;  4YMA A;  2V93 A;  3SEV A;  1JNF A;  4E0X A;  3SDF A;  3K02 A;  5L9O A;  2XXT A;  2I4B A;  1IXI A;  2FYI A;  3LSL A;  3HST A;  2AIX A;  1B7U A;  4OMB A;  3U8Q A;  4NE4 A;  2OCU A;  4DIG A;  3N6T A;  5CMM A;  4YU0 A;  1N3W A;  3E4R A;  4FEC A;  5I2N A;  2IA4 A;  1DPE A;  1MM7 A;  4QFP A;  1B1X A;  1Q35 A;  1O7T A;  3O97 A;  1VR5 A;  3LC8 A;  3TCF A;  5HPQ A;  3QXM A;  3Q29 A;  3TMG A;  1SD3 A;  5H8Q A;  3Q28 A;  5CC2 A;  3H7M A;  4F31 B;  3D4G A;  1IQ7 A;  4IO5 A;  3BKI B;  4NF4 A;  5EHS A;  4HW8 A;  3N5L A;  1N04 A;  3O28 A;  4R6Y A;  5I57 A;  2I48 A;  1FQC A;  2ONR A;  4F1V A;  1AL3 A;  1LFI A;  4ECF A;  3ZS6 A;  3C4M A;  4ESW A;  1Y4T A;  4RNS A;  2XXR A;  2QSX A;  3TQL A;  3CI8 A;  3QK6 A;  1URD A;  3LSX A;  4OES A;  4AQ4 A;  5L9M A;  1RKM A;  2ZYN A;  4IO4 A;  1B5I A;  3ONM A;  1I6A A;  1H45 A;  4NTL A;  1II5 A;  4G68 B;  5TP9 A;  1R6Z A;  3VDF A;  2I58 A;  4ELP A;  1N3X A;  3KFM A;  1FCK A;  3VVE A;  4OET A;  2RF1 A;  1P1O A;  4RK2 A;  4YAH X;  4ZEK A;  4KI0 E;  1RYO A;  5CMC A;  4GL8 A;  3P7I A;  3SEX A;  2R71 A;  5H8Q B;  4GLI A;  4Q5T A;  4ZZE A;  3UK4 A;  1TT1 A;  1Y1Z A;  2F36 A;  4LVQ A;  4NF4 B;  3UA8 A;  4H65 A;  3R6U A;  1YCJ A;  1A8E A;  5F1Q A;  2FA7 A;  5I57 B;  4OFO A;  4H5G A;  4DCY A;  1LAH E;  3T93 B;  2Q88 A;  3FD3 A;  4OQO A;  3O6I A;  4DLD A;  4JB7 A;  4FE8 A;  1XT8 A;  4FEB A;  3CSB A;  4RA1 A;  2W7Y A;  1JVX A;  4I9D A;  2DWJ A;  5BWJ A;  4QSD A;  3M3K A;  3CVG A;  3KBR A;  3JYR A;  4FAT A;  4QSC A;  1IZ1 A;  3KSJ A;  4IY5 A;  4H5F A;  4F3G A;  1ZIU A;  5JK4 A;  3M3L A;  1A54 A;  4DCX A;  2ZXT A;  5K2Y A;  4F22 A;  4C1U A;  4GF8 A;  1VFE A;  4BLA A;  1LAF E;  3W15 C;  5TP9 B;  2Q89 A;  2ABH A;  4JDF A;  1D4N A;  4BDN A;  4XKR A;  1BTJ A;  1KWH A;  1R9L A;  5HBC A;  1Y1M A;  1R9Q A;  3KN8 A;  3VE1 B;  5J1D A;  3N26 A;  4ONY A;  3T66 A;  1PEB A;  4F18 A;  3MZ9 A;  3U72 A;  3C9H A;  3MUQ A;  1R1N A;  3E9X A;  2B3F A;  2QL3 A;  3I5O A;  1MQG A;  2I3W A;  2R6G E;  3SEW A;  1PB7 A;  2E0S A;  5TPA B;  2F6G A;  4R6H A;  2DYX A;  2R9J A;  1TFD A;  2HXW A;  2Q9T A;  4FED A;  1MQD A;  1IXG A;  2FNC A;  4N6P A;  4PFW A;  3U92 A;  4YKJ A;  3C35 A;  4LQ2 A;  2QMX A;  4Z0I A;  5I58 B;  1MPD A;  4OHN A;  1NNK A;  1DTG A;  1FTJ A;  1N84 A;  1M5F A;  4F1U A;  5KCJ B;  1NMU A;  3RY3 A;  3FXQ A;  2VP1 A;  1ZTY A;  3RTW B;  3TQW A;  4U22 A;  3AXF A;  4LZ5 A;  4O3A A;  3IL1 B;  2O1M A;  3K1M A;  4QRZ A;  1B1H A;  3BFU A;  4ZZA A;  1JQF A;  3EHT A;  4EXK A;  1Y4C A;  1QUK A;  2ZNT A;  4XKN A;  3S9E A;  1N76 A;  4WKM A;  3V83 A;  2O1L A;  3U93 A;  1HSE A;  1OVT A;  3C31 A;  4Q0C A;  1MH3 A;  5I59 A;  1FQA A;  4YB7 A;  1MXX A;  4IGR A;  3WAE A;  3FJ7 A;  4ELO A;  1MQJ A;  3T9H B;  4JWO A;  2B65 A;  2ANJ A;  3TTM A;  3LUY A;  3UN6 A;  3KEI A;  1EZP A;  1H43 A;  2XXH A;  2RC7 A;  3Q26 A;  4HCY A;  5IAI A;  2V25 A;  3K1N A;  1DPP A;  2O69 A;  4BDR A;  4KFQ A;  3OO7 A;  4QHQ A;  3HPI A;  3FAT A;  2BJJ X;  4O3C A;  1JW1 A;  2Q2C A;  3IJO B;  3H6W A;  1B7H A;  1SYH A;  4THI A;  4OXV A;  4NMY A;  4FAJ A;  3LSF B;  5HM4 B;  1QVS A;  4EF2 A;  1B5J A;  4P0G A;  1IXC A;  1B3F A;  5TU0 A;  3MW0 A;  3ECR A;  2GRV A;  2DWI A;  2I0B A;  1Z7N E;  4QSE A;  3SET A;  3Q27 A;  3K4U A;  4C0R A;  3H3G A;  2XHD A;  3ODB A;  3R26 A;  3OMB A;  5DVJ A;  1OIB A;  3EPE A;  1LFH A;  4EXL A;  5CM6 A;  1UQW A;  2ONK E;  4OEV A;  2P2A A;  2OWS A;  3M3F A;  3C33 A;  3OEK A;  4ZE9 A;  4PQJ A;  3T9U A;  2G29 A;  2VOZ A;  1N0T A;  1CB6 A;  3A09 A;  2P1S A;  2H4I A;  3KSX A;  3E13 X;  4ZS9 A;  3KGC A;  2XD2 A;  1PDA A;  4N07 A;  4JWY A;  3RPW A;  2Y7R A;  2QRY A;  3PD9 A;  1IEJ A;  2X26 A;  4KYD A;  3MZB A;  5ICQ A;  2UYE A;  4PE5 B;  3OEM A;  3RT6 B;  2I49 A;  3N6U A;  2UVJ A;  2F8D A;  2XXV A;  2XX8 A;  2XX9 A;  3H06 B;  5CMB A;  2DWA A;  3KOS A;  3QUF A;  3FXU A;  4PFU A;  3GZG A;  4KYE A;  2ONS A;  3K6X A;  3JZJ A;  3N94 A;  3RTF B;  2GH9 A;  3IOT A;  4ZEI A;  2GHA A;  3S9L C;  1MPC A;  4L17 A;  1SI1 A;  2V3U A;  2O6A A;  3IJX B;  3RQT A;  1PC3 A;  3HHF A;  4X9T A;  1MXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...