4IO5A

Crystal structure of the avglur1 ligand binding domain complex with alanine at 1.72 angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
248
structure length
242
Chain Sequence
GSARLKGITLRIGVIESVPFTIVANVNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AvGluR1 ligand binding domain
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
molecule tags Membrane protein
total genus 75
structure length 242
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io5A02
3OO8A 4JWXA 4KCCA 2RC8A 1VE4A 2Z8EA 4G4PA 3KGCA 3TPAA 1O64A 1URGA 4UACA 1O63A 5ISUA 3QK6A 5I57B 1YCJA 2QJEA 4U2RA 3TYHA 4ZZAA 1XVYA 4R2FA 4WXJA 4RY1A 5H8QB 4G8HA 3OEMA 4H67A 2YLNA 3MVXA 2AIXA 3CSBA 5CBRA 4NF6B 2OWSA 3SEVA 1R9LA 5CMBA 4NE4A 3TAJA 1IITA 3TCHA 2VGQA 1NNTA 3RUMA 4N07A 2PT1A 4ND9A 5HBCA 3QUFA 2V93A 1FQAA 4R73A 1I6AA 3O66A 3K1NA 3THIA 1N04A 1PDAA 2XXRA 3R7XA 2BJJX 3PMVA 3MW0A 1SD3A 4OESA 2XXPA 3TCGA 3OMBA 3K6UA 4HCYA 3RTWB 1MQIA 5JTYB 3FZVA 3PGFA 3TQWA 5DEXB 4KD5A 3C34A 1SW4A 2X7QA 4NF8B 3VLVA 2O7IA 1QUJA 3T9UA 2HXWA 3DLNA 2P0SA 3QSLA 3OEKA 1ZJLA 5B7DA 3OSQA 3K0VA 3TTMA 2REGA 2FNCA 2I4BA 4XKQA 3LSWA 5L9MA 2RCBA 5ITOA 4E0WA 4U4XA 1FTLA 3SEUA 3ILUB 1MY3A 2REJA 5CRYA 1B7UA 4OFLA 4OERA 2V3UA 1SW5A 2F34A 3MP6A 1OIBA 1FQEA 1PB8A 3U93A 4BDMA 1UTBB 4FECA 2I49A 2NUVA 3MVWA 3HHGA 1AH5A 2ZYMA 1WVJA 4FJPA 2DOJA 4OFJA 2HCAA 1I6QA 4QFNA 1DTGA 4PE5B 1MXUA 3TKDA 2ZYOA 3B6TA 4GXSB 4LA9A 3ONMA 3KSJA 4H8IA 4ZEBA 4F2QA 3U72A 3TTLA 5H8HA 5I2KA 1B7HA 5I59A 2Q88A 1F9BA 3FUZA 4TLMB 1MPCA 3KEIA 1XT8A 1VFEA 3RN8A 4ZE9A 3B7DA 1LSTA 1ZBMA 5FHOA 2H99A 4Q8RA 4F3PA 2XX9A 1NNPA 4ESXA 4IO7A 2H9BA 4RPNA 3VXCA 3ODBA 5L9OA 1MH4A 3KOSA 2PMSA 1LCTA 5A5XA 3EHSA 3MPKA 4C0RA 3CFZA 4ISUA 2F36A 4KYDA 1B5JA 1B3HA 1MQDA 4ZZEA 3SEYA 5TP9A 4ELOA 1Y20A 1GV8A 5CMKA 3TEPA 1A8FA 3B6QA 2A5TB 4YB6A 4NEDA 1MXXA 2CZLA 3FJ7A 3PPRA 1EZPA 3CG3A 4IGRA 4XKNA 5ELVA 3G3HA 4AQ4A 3Q26A 1XHYA 1POTA 3L6HA 4WEDA 1FTKA 2DWIA 3TCFA 2PT2A 2DVCA 2HZLA 3MP8A 1OQHA 3SETA 4PQJA 3UK4A 4OETA 5IAIA 5I57A 4ONYA 3O28A 4H5GA 3KBRA 4YMAA 3PD8A 1JNFA 5H8QA 3O2AA 1MQJA 1FTMA 5J1DA 5KDTB 4NF6A 4MLQA 1D4NA 4LQ2A 2F5XA 2RKMA 5HM4B 3CG1A 1B3FA 3O6GA 3MVZA 2UXAA 5BWJA 3K2DA 3RY3A 4DXUA 3GZGA 4EQ9A 2DS9A 2PYYA 4YB5A 5LOMA 2GH9A 3DP6A 1H43A 2HZKA 1YTVA 2CMOA 1Y3PA 3N26A 5AA1A 1TFDA 1BKAA 1PB7A 2I48A 4ZEFA 5JTYA 2Z8DA 2D5WA 4F29A 3TMGA 5DEXA 4OEVA 2O68A 3KOTA 4IY5A 3MZ1A 3WAEA 2E0SA 2ZXTA 1GGGA 2M8CA 4FEDA 4R9FA 3IOWA 1JQFA 2I4CA 4QFKA 3H6WA 3QAXA 1ZTYA 4H0WA 4IO4A 1IEJA 3H03A 3CVGA 3C32A 1B6HA 1A99A 2THIA 4IO6A 4QRZA 4GD5A 2HFBA 3TUSA 3RPWA 3B6WA 4IO5A 4NWDA 3I3VA 3RLFE 3CRBA 3RQTA 1S9TA 3JV9A 2FYIA 2RCAA 5AA4B 3OOAA 3C36A 4QFLA 3OELA 4ZDMA 1UTBA 5DVIA 1T0KA 1NNFA 4YZZA 4ZE8A 3LSXA 3DP8A 1B05A 4M4GA 3CR9A 2XXUA 4UA8A 2ONKE 3FVNA 4TOZA 1I6BA 1DOTA 3I5OA 3EF7A 2HEUA 5AA2B 3IB0A 5I58B 2NXOA 1A40A 1P1WA 3H6TA 3FATA 2ZMBA 2DQVA 4ZECA 3D4CA 3FXRA 2ONRA 4FATA 5AA2D 4JDFA 1HSLA 3I6VA 3GBAA 1B4ZA 2DYXA 1ZLQA 3G3GA 4Q5TA 1P1NA 2I3VA 3MC2A 2KLFA 3E4RA 3UA8A 3MPLA 1IZ1A 1D9YA 2DWHA 3IORA 2XXIA 5FHMA 2R6GE 4ECFA 1TXFA 3PUXE 1SYHA 1AMFA 4U21A 4LP2B 1DPEA 4PFWA 4R75A 5H8FA 1LLSA 3FVGA 2A5TA 4EQ7A 1ANFA 4OEUA 2UVIA 4LZ8A 1MXWA 2HAUA 3O29A 3AXFA 1XC1A 4H65A 4GWOA 3M3KA 2OK2A 3IR1A 3U8QA 2XXVA 2H5YA 4NTLA 2Q9TA 4QSEA 2DWJA 4AB5A 1NL5A 4POWA 2OWTA 2Q2AA 1A54A 4RK2A 3PD9A 1P99A 2DE4A 3G3KA 4U1OA 3Q28A 3R26A 4YB7A 3ECRA 5I84A 4IO2A 4H6DA 3KJ7A 3UP9A 2ONSA 4F39A 1HSEA 4LZ7A 2DE3A 3C33A 1DSNA 1B32A 1M5DA 2DP8A 4OVJA 1RYXA 3H4ZA 4LATA 3IX1A 3EN3A 5JEIA 3PPOA 3TZAA 1B58A 4G68C 5KCJB 4KYEA 4WEPA 4FEBA 5F1QA 4O3AA 2Y84A 1I69A 3P7IA 4Q30B 2OLBA 2RC7A 4R2BA 3G3JA 4O3BA 3MBPA 4YKJA 1OLAA 3C35A 1S7YA 5ITPA 1M5FA 3T9VA 4YICA 1SQYA 1ZMGA 1DMBA 4OXVA 3DP4A 4U4SA 5CMCA 4EDPA 3ZS6A 1BTJA 1FTJA 4NF4B 1QVSA 1FQBA 3BKIB 4G68B 1B1HA 3EHUA 5CM6A 1M5CA 1NKXA 2ZNTA 3O6IA 4KYSA 1SW1A 3FV2A 5AA4A 1Y1ZA 1P1OA 4DCYA 4TLLB 3E9XA 5F7VA 4ZEKA 3RGYA 1N7WA 1MXYA 3CIJA 3QXMA 4Z0IA 5EYFA 3CFXA 1OLCA 1D9VA 2GFEA 1NMUA 1P1QA 3FASA 3T22A 4BDLA 4RK9A 4NWCA 5AA2A 3OSRA 3BFUA 1ZIUA 5I58A 1SI0A 2QRYA 3IO6A 4LVQA 4E0XA 1MG1A 2VD3A 3SEWA 2O51A 2OCUA 3OO9A 3IO4A 5B70A 1IXIA 4QSCA 4MH5A 1EZ9A 1NNKA 3IAZA 3UGWA 1H44A 1XS5A 4ELRA 3HN0A 3PU5A 4H5FA 1PB9A 2DXYA 5I2NA 3VE1B 1NH7A 5K2XA 3SDFA 3H6VA 2RF1A 4YAHX 4MF3A 3BBRA 4F31B 3LBSA 5HPQA 3KN8A 4I62A 4JSOA 5I56B 1OVTA 1QULA 2XXHA 5IKBA 5DVJA 1QJMA 2IEEA 2F7AA 3LSFB 5ICQA 1GVCA 2O69A 4F1UA 3VVDA 1D3KA 2F78A 2NVUB 1AOVA 2Y7PA 3ZKLA 3H7MA 1WDNA 1JW1A 4FORA 2RC9A 3OENA 4GFRA 1JETA 3N6UA 3U1OA 3M3LA 4DXCA 5L9SA 1LCFA 1J1NA 1NH8A 1EZOA 3QUJA 1SI1A 1H76A 3FXQA 1JW5A 1MRPA 1SW2A 3S9EA 3UN6A 3IK6B 2I0BA 4QHQA 3RNNA 2VOZA 3GLBA 3W9WA 3VLUA 2P1SA 3KSXA 4NF5B 4MBPA 2QS4A 1N7XA 1MM7A 2UYFA 3IOVA 2Z23A 1SBPA 3QIMA 3MZ9A 1PBQA 4C1UA 4X1DA 3PUZE 2Z8FA 4BDQA 4O3CA 1MQGA 4PFUA 2ESNA 1VFDA 2P2AA 1VR5A 4N13A 3Q29A 4RA1A 4XKPA 1FQFA 4EUOA 3VDFA 2Y7RA 1B3LA 4M1VA 1B1XA 3PUVE 4NF8A 3PUWE 2I0CA 4DCXA 1LAHE 2Y7WA 3V83A 4F19A 3CI8A 3G3IA 4DZ1A 1MQHA 3TELA 4G8NA 1DPPA 3IOTA 3CFLA 4OWDA 4HW8A 3KG2A 3PUYE 2QS2A 3WAFA 1CE2A 3MQ9A 4YKKA 1Y3NA 5H8NB 4JXIA 4ZEDA 3W15C 1URDA 3TTRA 1Y3QA 4OENA 2H4IA 3T96B 1B40A 1JW4A 3OO6A 3K00A 2AL5A 1USYE 3FIRA 4ELPA 4R6KA 2X7PA 4IGTA 1BLFA 2HQ0A 2D21A 3S9MC 1UQWA 3K01A 3G3FA 3GXAA 4U23A 3PPPA 2XXYA 3ZKKA 4GL0A 3PPQA 3W9VA 4FAJA 1A55A 2F35A 2XX7A 1LB8A 3TTKA 2QS1A 3UIFA 2Q8JA 3T66A 4KHZE 5CI5A 5CBSA 3A3CA 1PEBA 4FIMA 4PP0A 3JYRA 3DM0A 3O97A 3VVFA 2X26A 4KI0E 1IQ7A 1LBCA 3EHTA 2XX8A 4JSDA 4F18A 3MZBA 4K3FA 2I6EA 4BDNA 3SESA 1LAGE 3E3KA 4F2OA 5I2KB 4Z7EA 4R6YA 4JWYA 2F7BA 4ELQA 4DDDA 4X1BA 4GF8A 4KPTA 1JVYA 3VXBA 4OYVA 3K1MA 2AYSA 2D3IA 2XXTA 1US4A 2E1SA 4X9TA 4C1TA 1ATGA 5I56A 1MY1A 1MY0A 2Y7KA 2ABHA 1B0LA 4KR5A 1B2HA 4XKRA 4G77A 3FJMA 1ZKBA 5TP9B 4YKPA 3MUQA 3OD7A 4IO3A 3M8UA 2PX1A 3OO7A 4JB7A 3FXUA 3LC8A 1Y4TA 1TFAA 2QS3A 3N5LA 4U22A 3L6GA 2O7UA 3TQLA 3IJXB 4G8MA 4GLIA 4HTGA 2OJTA 3TFLA 2R9JA 5KDTA 4RNSA 2V3QA 2QMWA 3PPNA 1HSJA 1MY2A 4H1XA 4GVOA 3LUYA 4LUBA 5AA3A 4OTEA 1MM6A 3FJGA 4PETA 4P11A 3U94A 1UIUA 1FQCA 4I1DA 4NF5A 2NOOA 3K6WA 2F6GA 3EQ1A 2O1MA 4ZEIA 2ANJA 3V89B 2F6PA 2F7CA 5TPAB 3FVOA 3A3UA 1IUDA 3C9HA 3FV1A 4IB2A 1P1UA 2IA4A 4P0IA 3FVKA 5EHSA 4LZ5A 4OFOA 1UTHB 1FQDA 2PBWA 1L5TA 3VVEA 1N84A 2RINA 3FGSA 3T9XB 1PC3A 2O1LA 1JEVA 1JVXA 3K4UA 3ILTB 3M3FA 1IIWA 2V3TA 5AE4A 1IXCA 5FTIA 3C31A 1B46A 4N6PA 3VLWA 3KFMA 3KZGA 4EXKA 5H8NA 4WKMA 4EF1A 2AL4A 1N3XA 5TU0A 3HV1A 3N6TA 4U1ZA 4F22A 1N0TA 3TTNA 3RTFB 1QKAA 1XVXA 3S4UA 4LQ5A 4F3GA 3K02A 1II5A 2HAVA 4QSDA 1FCKA 5H8SA 2O84X 3IJOB 1N3WA 5DTBA 1Z7ME 3KN3A 3S9NC 1MXZA 2R71A 2F8DA 1URSA 4L17A 2Q2CA 4R9GA 4YU0A 4MLVA 3O9PA 3Q25A 1ELJA 5FHNA 3MP1A 4DLDA 4I9DA 2QPQA 3MJNA 3O6HA 4Q0CA 4ZS9A 4QF9A 1B5IA 2G29A 3KJTA 4R74A 3G7WA 1Z7NE 1GTKA 3HO7A 2DVZA 4QFPA 2FA7A 1OQGA 2ZYNA 4FE8A 2WKYA 1US5A 1R9QA 4P0GA 4F1VA 3RT8A 2GHBA 2ZNUA 2V84A 3HSTA 2V25A 1Q35A 1LBBA 1YAEA 1QUKA 4KQPA 1R6ZA 3VV5A 2DSFA 1UIVA 3A09A 2UVHA 1LB9A 1B52A 1Y1MA 3K1PA 4RJZA 1LFIA 1MH3A 1YPNA 4GRKA 2XXQA 5CC2A 2QSXA 1S50A 3MWBA 1B3GA 1B9JA 2H98A 5JK4A 1VSOA 1USYH 1N76A 2XXXA 2G93A 3TODA 5H8FB 3KN7A 4GOTA 3HHFA 5CMMA 1CB6A 3UORA 4TQUQ 4NMYA 1IXGA 2DE2A 3C4MA 1Y4CA 1MXVA 1LGBC 1Y9UA 4EXLA 1PBPA 4G2ZA 4QFOA 4OZ9A 1FW0A 1BIYA 1POY1 2F97A 2Y7IA 4ESWA 1LAXA 1B51A 5K2YA 2NWJA 3N94A 1ZU0A 3H3GA 3PV0E 2O6AA 4GQOA 3FD3A 4THIA 1A8EA 2Z22A 4XXUA 3V5AA 2VHAA 1QW0A 4XIGQ 1B0HA 3H6UA 4RYAA 3QYTA 3OXNA 3IB1A 4F3BA 3K6VA 2ZNSA 1TWYA 2XHDA 5BUUA 3BFTA 1MS7A 2UVGA 5KCJA 1DTZA 4OMBA 1XOCA 3DELB 5TPAA 1EU8A 1A7LA 3IL1B 4DXBA 4RPOA 3K6XA 4YMBA 2B65A 5DVFA 4MFIA 2XD3A 3E13X 5KZTA 1UTHA 3IB2A 1B7ZA 2DWAA 1O7TA 4RXLA 1B5HA 3T9HB 1LFGA 2ALUA 2QL3A 4R6HA 3U92A 4IY6A 3T93B 2I58A 5L8DA 4KFQA 2OZZA 4OQOA 2VD2A 3IOUA 4LONB 3ZSFA 4BLAA 2XXWA 1M5EA 4NF4A 3PMWA 1M5BA 4G68A 5FTHA 2GHAA 4DE8A 1IXHA 3RT6B 4HCWA 2XD2A 3Q27A 1RYOA 1QKBA 1MPDA 5ICTA 4I8CA 2I3WA 1Q1KA 1OVBA 4H8JA 4X48A 4BDRA 4GIZA 1MPBA 1AL3A 2DXRA 1NFTA 4POXA 4JBZA 4F1YA 1H3DA 2PVUA 2A5SA 1LFHA 4EQBA 4PFTA 1RKMA 3LSLA 4HS7A 3S9LC 4YKIA 1SDXA 1KWHA 1EH3A 1JEUA 1FTOA 3SKPA 1TT1A 2YPNA 4EF2A 1B3EA 3SEXA 4DIGA 3MAMA 4AB6A 1MY4A 4JWOA 3EPEA 1AIVA 1B4HA 2Q89A 5H8HB 2W7YA 4BDOA 5I59B 5EHMA 2B3FA 3H06B 5DYHA 3PMXA 4OHNA 4XTCQ 2QMXA 3VFJA 3S2VA 2H25A 3SERA 1H45A 1R1NA 1OMPA 1SVXB 2LAOA 3LR1A 3D4GA 2ZYKA 3USDA 2UVJA 2VP1A 5A5XB 4GXAA 3HCQA 2UYEA 3R6UA 3TDJA 5M2VA 1MDP1 1BP5A 4KCDA 4F3SA 4PFYA 5DT6A 3HPIA 1GR2A 1MDQA 1LAFE 5I2NB 2B3BA 3F11A 1QUIA 3CSGA 4R72A 2GRVA 2YJPA 1SYIA 4GL8A 3V8XB 2OBGA 1WODA 3JZJA 3GBBA 3MVYA
chains in the Genus database with same CATH superfamily
3OO8A 4JWXA 2XWVA 4KCCA 2RC8A 1VE4A 2Z8EA 4NHBA 4G4PA 3KGCA 3TPAA 1O64A 4I3YA 1URGA 4UACA 1O63A 5ISUA 4O8MA 3QK6A 5I57B 1YCJA 2QJEA 4MMPA 4U2RA 3TYHA 4ZZAA 1XVYA 4R2FA 4WXJA 1RDZA 4RY1A 4FBPA 5H8QB 4P3LA 4I3EA 4GWSA 2MKZA 4G8HA 3OEMA 4H67A 2YLNA 3MVXA 2AIXA 3CSBA 5CBRA 4NF6B 2OWSA 3SEVA 3LUZA 1FPJA 1R9LA 4GWUA 5CMBA 4NE4A 3TAJA 1IITA 3TCHA 2VGQA 1NNTA 3RUMA 4N07A 4PAKA 2PT1A 4ND9A 5EQAA 5I3SA 5HBCA 3QUFA 2V93A 1FQAA 4R73A 1I6AA 3O66A 4PFRA 4MAGA 3K1NA 3THIA 1N04A 1PDAA 2XXRA 5DW8A 3R7XA 2BJJX 3PMVA 3MW0A 1G0IA 1SD3A 4GBVA 4OESA 2XXPA 3TCGA 3OMBA 4KXPA 3K6UA 1KZ8A 4HCYA 1FPIA 3RTWB 1MQIA 5JTYB 3FZVA 1FJ9A 3PGFA 3TQWA 5DEXB 4KD5A 3C34A 1SW4A 2X7QA 4NF8B 3VLVA 2O7IA 4O7IA 1QUJA 3T9UA 2HXWA 3DLNA 4PF8A 2P0SA 3QSLA 1FPEA 1K9ZA 3OEKA 1ZJLA 5B7DA 3RPLA 3OSQA 3K0VA 3TTMA 2REGA 2FNCA 2I4BA 4XKQA 3LSWA 5L9MA 2RCBA 5ITOA 4N6KA 4E0WA 4U4XA 1FTLA 3SEUA 3ILUB 1MY3A 2REJA 5CRYA 1B7UA 4OFLA 4OERA 2V3UA 1SW5A 1NV2A 2F34A 1EYJA 3MP6A 1OIBA 1FBHA 1FQEA 1PB8A 3U93A 4N8GA 4BDMA 1UTBB 4QXDA 4FECA 2KR0A 2I49A 4HE1A 2NUVA 3MVWA 1NV3A 3FBPA 3HHGA 1AH5A 2ZYMA 1WVJA 4FJPA 3T0JA 2F3DA 2DOJA 4OFJA 2HCAA 1I6QA 4QFNA 1DTGA 4PFIA 4PE5B 1MXUA 3TKDA 2ZYOA 3B6TA 4GXSB 4LA9A 3ONMA 3KSJA 4H8IA 4ZEBA 2XA5A 4F2QA 3U72A 2PCRA 3TTLA 5H8HA 5I2KA 1B7HA 5I59A 1FBGA 2Q88A 1F9BA 3FUZA 4TLMB 1MPCA 3KEIA 1XT8A 1VFEA 3RN8A 4ZE9A 3B7DA 1LSTA 1NUZA 1ZBMA 5FHOA 2H99A 4Q8RA 4F3PA 2XWOA 2XX9A 1NNPA 4ESXA 4IO7A 2H9BA 4RPNA 3VXCA 1IMFA 3ODBA 5L9OA 1MH4A 3KOSA 2PMSA 1LCTA 5A5XA 3EHSA 3MPKA 4C0RA 5IZZA 3CFZA 4ISUA 2F36A 4KYDA 1B5JA 1B3HA 1MQDA 4ZZEA 3SEYA 5TP9A 4ELOA 1Y20A 1GV8A 5CMKA 3TEPA 1A8FA 3B6QA 2A5TB 4YB6A 4NEDA 1MXXA 1LBZA 2CZLA 3FJ7A 3PPRA 1EZPA 3CG3A 4IGRA 5IZ3B 4XKNA 5ELVA 3G3HA 4AQ4A 3Q26A 4PGNA 1XHYA 4O7MA 1POTA 3L6HA 4WEDA 2WBDA 5LDZA 1FTKA 2DWIA 3TCFA 2PT2A 1IMDA 2DVCA 2HZLA 3MP8A 4MCOA 1OQHA 3SETA 4PQJA 3UK4A 4OETA 5IAIA 5I57A 1FPLA 4ONYA 3O28A 4H5GA 3KBRA 4YMAA 3PD8A 1JNFA 5H8QA 2FVZA 3O2AA 1MQJA 1FTMA 5J1DA 5KDTB 5F24A 4NF6A 4MLQA 1D4NA 4LQ2A 4X8RA 2F5XA 2RKMA 5HM4B 3CG1A 1B3FA 3O6GA 3MVZA 2UXAA 5BWJA 3K2DA 3RY3A 4DXUA 3GZGA 4GBWA 4EQ9A 2DS9A 2PYYA 4OANA 4YB5A 5LOMA 2GH9A 3DP6A 1H43A 2HZKA 4G61A 2Q8MA 4N81A 2QVUA 1YTVA 3KC1A 3D1RA 2CMOA 2L5VA 1Y3PA 3N26A 5AA1A 1TFDA 1BKAA 1PB7A 4MNCA 2I48A 4ZEFA 5JTYA 2Z8DA 4N8YA 2D5WA 4F29A 3TMGA 5DEXA 4OEVA 2O68A 3KOTA 4IY5A 3MZ1A 3WAEA 2E0SA 2ZXTA 4I40A 1GGGA 2M8CA 4AS5A 4FEDA 4H46A 1D9QA 4R9FA 3IOWA 4NGUA 1JQFA 2I4CA 4QFKA 3H6WA 3QAXA 1ZTYA 4H0WA 4IO4A 1IEJA 3H03A 3CVGA 3C32A 1B6HA 1DBZA 4NF0A 3GYYA 1A99A 2THIA 4IO6A 4QRZA 4GD5A 3FXBA 2XWKA 2HFBA 2GQ1A 3TUSA 3RPWA 3B50A 3B6WA 4IO5A 4NWDA 1FPGA 4PBHA 3I3VA 3RLFE 3CRBA 3RQTA 1S9TA 3JV9A 2FYIA 2RCAA 5AA4B 3OOAA 3C36A 4NX1A 2VPNA 4O94A 4QFLA 3OELA 4ZDMA 1UTBA 5DVIA 1NV7A 1T0KA 1NNFA 4JVIA 4YZZA 4ZE8A 3LSXA 3DP8A 1B05A 2Y5KA 4M4GA 3CR9A 2XXUA 4OVPA 4UA8A 2ONKE 4NG7A 1KA0A 3FVNA 3NOHA 4TOZA 1I6BA 1DOTA 4IR8A 3I5OA 3EF7A 2HEUA 5AA2B 3IB0A 5I58B 2NXOA 1A40A 1P1WA 3H6TA 3FATA 2ZMBA 2DQVA 4ZECA 3D4CA 3FXRA 2ONRA 4FATA 5AA2D 4JDFA 1HSLA 1NV4A 3I6VA 3GBAA 1B4ZA 2DYXA 1FBDA 1ZLQA 3G3GA 1XI6A 4Q5TA 1P1NA 2I3VA 3MC2A 2KLFA 3E4RA 3UA8A 3MPLA 1IZ1A 1D9YA 2VPOA 5I5PA 2DWHA 3IORA 2XXIA 5FHMA 2R6GE 4ECFA 1TXFA 3PUXE 1SYHA 1AMFA 4U21A 1YXIA 4LP2B 4PFWA 1DPEA 4R75A 5H8FA 1LLSA 3FVGA 3E78A 2A5TA 4MJOA 4EQ7A 2R8TA 1ANFA 4OEUA 2UVIA 4PTKA 4LZ8A 3EKIA 1MXWA 2HAUA 5IZ3A 4PDDA 4PE3A 3O29A 3AXFA 1XC1A 4H65A 4GWOA 3M3KA 2WEFA 2OK2A 3IR1A 1NUYA 3U8QA 2XXVA 2H5YA 4QBAA 4NTLA 2Q9TA 4QSEA 2DWJA 1NUXA 4AB5A 1NL5A 4POWA 2OWTA 2Q2AA 1A54A 4RK2A 3PD9A 1P99A 2DE4A 3ROJA 3A29A 3G3KA 4N91A 4U1OA 3Q28A 3R26A 4MNPA 4YB7A 3ECRA 5I84A 4IO2A 4H6DA 3KJ7A 3BIGA 3UP9A 2ONSA 4F39A 1HSEA 4LZ7A 2DE3A 1G0HA 3C33A 1DSNA 1B32A 1M5DA 1NV5A 2DP8A 3MYUA 4OVJA 1RYXA 2ZZVA 3H4ZA 4LATA 3IX1A 4XF5A 3EN3A 5JEIA 3PPOA 3TZAA 1B58A 4G68C 1RDYA 5KCJB 4KYEA 4WEPA 4FEBA 5F1QA 4O3AA 1INPA 2Y84A 1I69A 3P7IA 4Q30B 1KA1A 3QMFA 2CEYA 2OLBA 2RC7A 4R2BA 3G3JA 1YZ0A 4O3BA 3MBPA 4YKJA 1IMAA 3ISPA 1OLAA 3C35A 1S7YA 5ITPA 1M5FA 3T9VA 4YICA 1SQYA 4GX6A 1ZMGA 1DMBA 4MHFA 3DP4A 4OXVA 4U4SA 5CMCA 4EDPA 3ZS6A 1BTJA 1FTJA 4NF4B 1QVSA 1FQBA 3BKIB 4G68B 1B1HA 3EHUA 5CM6A 1M5CA 4HE2A 4N17A 1NKXA 4HXVA 2ZNTA 3O6IA 5I7IA 4KYSA 1SW1A 3FV2A 5AA4A 1Y1ZA 2WX9A 1P1OA 4DCYA 4TLLB 3E9XA 4JVDA 4PAFA 5F7VA 4ZEKA 3RGYA 1MXYA 1N7WA 2XXKA 3CIJA 3QXMA 4Z0IA 3SZPA 5EYFA 1NI9A 3CFXA 1OLCA 2CZKA 1D9VA 2GFEA 1NMUA 1P1QA 3FASA 3T22A 2B4LA 5T3JA 4BDLA 4RK9A 4NWCA 5AA2A 3OSRA 3BFUA 1ZIUA 5I58A 2Y5LA 1SI0A 2BJIA 2QRYA 2FBPA 3IO6A 4MNIA 4LVQA 2HHMA 4E0XA 1MG1A 5A5LA 2VD3A 5EQ7A 1JP4A 3SEWA 2QVRA 2O51A 2OCUA 3OO9A 3PTYA 3IO4A 5B70A 1IXIA 4QSCA 4MH5A 1EZ9A 1NNKA 3IAZA 3UGWA 1H44A 1XS5A 4ELRA 3HN0A 3PU5A 4H5FA 1PB9A 2DXYA 5I2NA 3VE1B 1NH7A 5K2XA 3SDFA 3H6VA 2RF1A 4YAHX 4MF3A 3BBRA 4F31B 3LBSA 5HPQA 3KN8A 4I62A 1DK4A 4JSOA 5I56B 1OVTA 4OVTA 2WYKA 1QULA 2XXHA 4P1EA 5IKBA 5DVJA 1QJMA 2IEEA 2F7AA 3LSFB 5ICQA 2HXRA 4JVCA 1GVCA 2O69A 2Q74A 2OX3A 4F1UA 4DI3D 3VVDA 1D3KA 2F78A 1FBCA 2NVUB 1VDWA 1AOVA 2Y7PA 3ZKLA 3H7MA 3IFAA 1WDNA 1JW1A 4FORA 2RC9A 3OENA 1IMCA 4GFRA 1JETA 3N6UA 3U1OA 3M3LA 4DXCA 1EYKA 5L9SA 1LCFA 1J1NA 1NH8A 1EZOA 3QUJA 1SI1A 1H76A 3FXQA 4MEVA 1JW5A 1MRPA 1SW2A 3S9EA 1FBPA 3UN6A 3BIHA 3IK6B 2I0BA 4QHQA 3RNNA 2VOZA 5FBPA 3GLBA 3W9WA 3VLUA 2P1SA 3KSXA 4NF5B 4NN3A 1AWBA 4N4UA 5IM2A 4MBPA 2QS4A 1N7XA 1MM7A 4OVQA 2UYFA 3IOVA 2Z23A 1SBPA 4NAPA 3QIMA 3MZ9A 1PBQA 4C1UA 4PF6A 4X1DA 3PUZE 2Z8FA 4BDQA 4O3CA 1MQGA 4PFUA 2ESNA 1VFDA 2P2AA 1VR5A 4N13A 3Q29A 4RA1A 4XKPA 1FQFA 4EUOA 3VDFA 2Y7RA 1B3LA 4M1VA 1RDXA 1B1XA 3PUVE 4NF8A 3PUWE 2I0CA 4DCXA 1LAHE 2Y7WA 4X04A 3V83A 4P1LA 4F19A 3CI8A 3G3IA 4DZ1A 1MQHA 3TELA 4G8NA 1DPPA 3IOTA 3CFLA 4OWDA 4HW8A 3KG2A 3PUYE 2QS2A 3WAFA 1CE2A 3MQ9A 4YKKA 1Y3NA 5H8NB 2PFZA 4JXIA 4ZEDA 3MSTA 4GWYA 3W15C 4PGPA 1URDA 3TTRA 1Y3QA 2KQZA 4OENA 2H4IA 1LBVA 1B40A 3T96B 3RPLB 1JW4A 3OO6A 3K00A 2AL5A 1USYE 3FIRA 4ELPA 4N15A 4R6KA 2X7PA 4IGTA 1BLFA 2HQ0A 2D21A 3S9MC 1UQWA 3K01A 3G3FA 4GWXA 3GXAA 4U23A 3PPPA 2XXYA 3ZKKA 4GL0A 3PPQA 3W9VA 4FAJA 1A55A 2F35A 2XX7A 1LB8A 3TTKA 2QS1A 3UIFA 2Q8JA 3T66A 2ZZWA 4P47A 4KHZE 5CI5A 5CBSA 3A3CA 1PEBA 4FIMA 4PP0A 3JYRA 3DM0A 2PFYA 3O97A 3VVFA 1IMEA 2X26A 4KI0E 1IQ7A 1LBCA 3EHTA 4H45A 1LBXA 2XX8A 4JSDA 4F18A 3MZBA 4K3FA 2I6EA 4BDNA 3SESA 1LAGE 3E3KA 4F2OA 5I2KB 4Z7EA 1FTAA 4R6YA 4JWYA 2F7BA 4ELQA 4DDDA 4X1BA 4GF8A 1SPIA 4KPTA 2FIXA 1JVYA 3VXBA 4OYVA 3K1MA 2AYSA 2D3IA 2VT5A 2XXTA 1US4A 4PDHA 2E1SA 4X9TA 4C1TA 1ATGA 5I56A 1MY1A 1MY0A 2Y7KA 2ABHA 1B0LA 4KR5A 1B2HA 4XKRA 4G77A 3FJMA 1ZKBA 5TP9B 4YKPA 4XEQA 3MUQA 3OD7A 4IO3A 3M8UA 2PX1A 3OO7A 4JB7A 3FXUA 3LC8A 2P3NA 1Y4TA 1TFAA 2DDKA 2QS3A 3N5LA 4U22A 3L6GA 2O7UA 3TQLA 3IJXB 4G8MA 4GLIA 4HTGA 2OJTA 3TFLA 2R9JA 5KDTA 4RNSA 2V3QA 2QMWA 2XWIA 3PPNA 1HSJA 5IGAA 1NUWA 1MY2A 4H1XA 2CZIA 4GVOA 5J16A 3LUYA 1FSAA 4LUBA 5AA3A 4OTEA 1MM6A 3FJGA 4PCDA 4PETA 4P11A 3U94A 1CNQA 1UIUA 1FQCA 4I1DA 4NF5A 2NOOA 3K6WA 2F6GA 4PBQA 3IFCA 3EQ1A 3E79A 4AS4A 2O1MA 4ZEIA 2V4CA 2ANJA 3V89B 2F6PA 4MIJA 2F7CA 5TPAB 3FVOA 3A3UA 1IUDA 3C9HA 3FV1A 4IB2A 1P1UA 5IZ1A 2IA4A 2WBBA 4P0IA 3FVKA 5EHSA 4LZ5A 2JJKA 4OFOA 1UTHB 1FQDA 2PBWA 1L5TA 3VVEA 1N84A 2RINA 3FGSA 3T9XB 1PC3A 2O1LA 5EYHA 1JEVA 1JVXA 3K4UA 4XFEA 3ILTB 3M3FA 1IIWA 2V3TA 5AE4A 1IXCA 5FTIA 3C31A 1B46A 4N6PA 3VLWA 3KFMA 3KZGA 4EXKA 5H8NA 4WKMA 1FPDA 4EF1A 2AL4A 1N3XA 5TU0A 3HV1A 3N6TA 4U1ZA 4F22A 1N0TA 3TTNA 3RTFB 1QKAA 1XVXA 3S4UA 4LQ5A 4F3GA 1K9YA 3K02A 5EYGA 1II5A 2HAVA 4QSDA 1FCKA 4OVSA 5H8SA 4P56A 2O84X 3IJOB 1N3WA 3HFUA 5DTBA 1Z7ME 3KN3A 3S9NC 1MXZA 2R71A 2F8DA 1URSA 4L17A 2Q2CA 4R9GA 4YU0A 4MLVA 3O9PA 3Q25A 1ELJA 5FHNA 3MP1A 4DLDA 4I9DA 2QPQA 1LEVA 3KBZA 3MJNA 2FHYA 3O6HA 4Q0CA 5ET8A 2B4MA 4ZS9A 1LBYA 2CZHA 4MX6A 4QF9A 1B5IA 2G29A 3KJTA 4R74A 3G7WA 1Z7NE 1GTKA 4P9KA 2HPGA 3HO7A 2DVZA 4QFPA 1BK4A 3CHGA 2FA7A 1OQGA 2ZYNA 4FE8A 2WKYA 1US5A 1R9QA 4P0GA 3RYDA 4F1VA 3RT8A 2GHBA 2ZNUA 4LN5A 2V84A 3HSTA 2V25A 1Q35A 1LBBA 1YAEA 1QUKA 4KQPA 1R6ZA 1FPBA 3VV5A 2DSFA 1UIVA 3A09A 2UVHA 5EQ8A 1LB9A 5ESYA 1B52A 1Y1MA 3K1PA 5EQ9A 4RJZA 2WYPA 1LFIA 1DCUA 1MH3A 1YPNA 4GRKA 2XXQA 5CC2A 1QGXA 2QSXA 1S50A 3MWBA 1B3GA 1B9JA 4PC9A 2H98A 5JK4A 1VSOA 1USYH 1N76A 2XXXA 2G93A 3TODA 5H8FB 1NV1A 4OVRA 3KN7A 1FRPA 4GOTA 3HHFA 5CMMA 1CB6A 3B8BA 3UORA 4TQUQ 4NMYA 1IXGA 2DE2A 3C4MA 1Y4CA 1MXVA 1LGBC 1Y9UA 4DI4B 4EXLA 4NQ8A 1PBPA 4G2ZA 4QFOA 4OZ9A 1FW0A 1BIYA 1POY1 2F97A 2Y7IA 4ESWA 1LAXA 1B51A 5K2YA 2NWJA 3N94A 1ZU0A 3H3GA 3PV0E 1NV0A 2O6AA 1FPFA 4GQOA 3FD3A 4THIA 1A8EA 2Z22A 4XXUA 1FBEA 5ET5A 3V5AA 2VHAA 1FPKA 1QW0A 4XIGQ 1B0HA 3H6UA 4RYAA 3QYTA 3OXNA 4P8BA 3IB1A 4F3BA 3K6VA 2ZNSA 1TWYA 2XHDA 5BUUA 5ET6A 3BFTA 1MS7A 2UVGA 1NV6A 5KCJA 1DTZA 4OMBA 4HE0A 1XOCA 3DELB 5TPAA 1EU8A 2FIEA 1A7LA 3IL1B 4DXBA 4PAIA 4RPOA 3K6XA 4YMBA 2B65A 5DVFA 4PFBA 4MFIA 4UABA 2XD3A 3E13X 5KZTA 1UTHA 3IB2A 2ZZXA 1B7ZA 2DWAA 1FJ6A 1O7TA 4RXLA 1B5HA 3T9HB 4GX4A 1LFGA 2ALUA 2QL3A 4R6HA 3U92A 4IY6A 3T93B 2I58A 1EYIA 5L8DA 4KFQA 2OZZA 4OQOA 4GWWA 2VD2A 2P3VA 5LTCA 3IOUA 4LONB 3ZSFA 4BLAA 2XXWA 4GWZA 1M5EA 4NF4A 3PMWA 1M5BA 4G68A 5FTHA 2GHAA 4DE8A 1IXHA 3RT6B 4HCWA 2XD2A 3Q27A 1RYOA 1QKBA 1MPDA 5ICTA 4I8CA 2I3WA 1Q1KA 1OVBA 2OWZA 2CEXA 4H8JA 4X48A 4BDRA 4GIZA 1MPBA 1AL3A 2DXRA 1NFTA 4POXA 4JBZA 4F1YA 1H3DA 2PVUA 3U65A 2A5SA 1LFHA 4EQBA 4PFTA 1RKMA 3LSLA 4OA4A 4HS7A 3S9LC 4YKIA 1SDXA 1KWHA 2F3BA 1EH3A 1JEUA 1FTOA 1FBFA 3SKPA 1TT1A 2YPNA 4EF2A 1B3EA 3SEXA 4DIGA 3MAMA 4AB6A 4JWOA 1MY4A 3EPEA 3T1BA 2QFLA 1Q9DA 1AIVA 1B4HA 1IMBA 4GX3A 2Q89A 5H8HB 3KC0A 2W7YA 4BDOA 5I59B 5EHMA 2B3FA 3H06B 5DYHA 3PMXA 4N6DA 4OHNA 4XTCQ 2QMXA 3VFJA 3S2VA 2H25A 1LBWA 3SERA 1H45A 1R1NA 1OMPA 1SVXB 2LAOA 3LR1A 2QVVA 5ET7A 3D4GA 2ZYKA 3USDA 2UVJA 2VP1A 5A5XB 3LV0A 4GXAA 3HCQA 1YYZA 2UYEA 3R6UA 3TDJA 5M2VA 1MDP1 1BP5A 4KCDA 4F3SA 4PFYA 3HPIA 1GR2A 1MDQA 5DT6A 1LAFE 5I2NB 2B3BA 3F11A 1QUIA 3CSGA 4R72A 2GRVA 2YJPA 1SYIA 4GL8A 3V8XB 2OBGA 1WODA 3JZJA 3GBBA 3MVYA
chains in the Genus database with same CATH topology
3OO8A 4JWXA 4KCCA 2RC8A 1VE4A 2Z8EA 4G4PA 3KGCA 3TPAA 1O64A 1URGA 4UACA 1O63A 5ISUA 3QK6A 5I57B 1YCJA 2QJEA 4U2RA 3TYHA 4ZZAA 1XVYA 4R2FA 4WXJA 4RY1A 5H8QB 4G8HA 3OEMA 4H67A 2YLNA 3MVXA 2AIXA 3CSBA 5CBRA 4NF6B 2OWSA 3SEVA 1R9LA 5CMBA 4NE4A 3TAJA 1IITA 3TCHA 2VGQA 1NNTA 3RUMA 4N07A 2PT1A 4ND9A 5HBCA 3QUFA 2V93A 1FQAA 4R73A 1I6AA 3O66A 3K1NA 3THIA 1N04A 1PDAA 2XXRA 3R7XA 2BJJX 3PMVA 3MW0A 1SD3A 4OESA 2XXPA 3TCGA 3OMBA 3K6UA 4HCYA 3RTWB 1MQIA 5JTYB 3FZVA 3PGFA 3TQWA 5DEXB 4KD5A 3C34A 1SW4A 2X7QA 4NF8B 3VLVA 2O7IA 1QUJA 3T9UA 2HXWA 3DLNA 2P0SA 3QSLA 3OEKA 1ZJLA 5B7DA 3OSQA 3K0VA 3TTMA 2REGA 2FNCA 2I4BA 4XKQA 3LSWA 5L9MA 2RCBA 5ITOA 4E0WA 4U4XA 1FTLA 3SEUA 3ILUB 1MY3A 2REJA 5CRYA 1B7UA 4OFLA 4OERA 2V3UA 1SW5A 2F34A 3MP6A 1OIBA 1FQEA 1PB8A 3U93A 4BDMA 1UTBB 4FECA 2I49A 2NUVA 3MVWA 3HHGA 1AH5A 2ZYMA 1WVJA 4FJPA 2DOJA 4OFJA 2HCAA 1I6QA 4QFNA 1DTGA 4PE5B 1MXUA 3TKDA 2ZYOA 3B6TA 4GXSB 4LA9A 3ONMA 3KSJA 4H8IA 4ZEBA 4F2QA 3U72A 3TTLA 5H8HA 5I2KA 1B7HA 5I59A 2Q88A 1F9BA 3FUZA 4TLMB 1MPCA 3KEIA 1XT8A 1VFEA 3RN8A 4ZE9A 3B7DA 1LSTA 1ZBMA 5FHOA 2H99A 4Q8RA 4F3PA 2XX9A 1NNPA 4ESXA 4IO7A 2H9BA 4RPNA 3VXCA 3ODBA 5L9OA 1MH4A 3KOSA 2PMSA 1LCTA 5A5XA 3EHSA 3MPKA 4C0RA 3CFZA 4ISUA 2F36A 4KYDA 1B5JA 1B3HA 1MQDA 4ZZEA 3SEYA 5TP9A 4ELOA 1Y20A 1GV8A 5CMKA 3TEPA 1A8FA 3B6QA 2A5TB 4YB6A 4NEDA 1MXXA 2CZLA 3FJ7A 3PPRA 1EZPA 3CG3A 4IGRA 4XKNA 5ELVA 3G3HA 4AQ4A 3Q26A 1XHYA 1POTA 3L6HA 4WEDA 1FTKA 2DWIA 3TCFA 2PT2A 2DVCA 2HZLA 3MP8A 1OQHA 3SETA 4PQJA 3UK4A 4OETA 5IAIA 5I57A 4ONYA 3O28A 4H5GA 3KBRA 4YMAA 3PD8A 1JNFA 5H8QA 3O2AA 1MQJA 1FTMA 5J1DA 5KDTB 4NF6A 4MLQA 1D4NA 4LQ2A 2F5XA 2RKMA 5HM4B 3CG1A 1B3FA 3O6GA 3MVZA 2UXAA 5BWJA 3K2DA 3RY3A 4DXUA 3GZGA 4EQ9A 2DS9A 2PYYA 4YB5A 5LOMA 2GH9A 3DP6A 1H43A 2HZKA 1YTVA 2CMOA 1Y3PA 3N26A 5AA1A 1TFDA 1BKAA 1PB7A 2I48A 4ZEFA 5JTYA 2Z8DA 2D5WA 4F29A 3TMGA 5DEXA 4OEVA 2O68A 3KOTA 4IY5A 3MZ1A 3WAEA 2E0SA 2ZXTA 1GGGA 2M8CA 4FEDA 4R9FA 3IOWA 1JQFA 2I4CA 4QFKA 3H6WA 3QAXA 1ZTYA 4H0WA 4IO4A 1IEJA 3H03A 3CVGA 3C32A 1B6HA 1A99A 2THIA 4IO6A 4QRZA 4GD5A 2HFBA 3TUSA 3RPWA 3B6WA 4IO5A 4NWDA 3I3VA 3RLFE 3CRBA 3RQTA 1S9TA 3JV9A 2FYIA 2RCAA 5AA4B 3OOAA 3C36A 4QFLA 3OELA 4ZDMA 1UTBA 5DVIA 1T0KA 1NNFA 4YZZA 4ZE8A 3LSXA 3DP8A 1B05A 4M4GA 3CR9A 2XXUA 4UA8A 2ONKE 3FVNA 4TOZA 1I6BA 1DOTA 3I5OA 3EF7A 2HEUA 5AA2B 3IB0A 5I58B 2NXOA 1A40A 1P1WA 3H6TA 3FATA 2ZMBA 2DQVA 4ZECA 3D4CA 3FXRA 2ONRA 4FATA 5AA2D 4JDFA 1HSLA 3I6VA 3GBAA 1B4ZA 2DYXA 1ZLQA 3G3GA 4Q5TA 1P1NA 2I3VA 3MC2A 2KLFA 3E4RA 3UA8A 3MPLA 1IZ1A 1D9YA 2DWHA 3IORA 2XXIA 5FHMA 2R6GE 4ECFA 1TXFA 3PUXE 1SYHA 1AMFA 4U21A 4LP2B 1DPEA 4PFWA 4R75A 5H8FA 1LLSA 3FVGA 2A5TA 4EQ7A 1ANFA 4OEUA 2UVIA 4LZ8A 1MXWA 2HAUA 3O29A 3AXFA 1XC1A 4H65A 4GWOA 3M3KA 2OK2A 3IR1A 3U8QA 2XXVA 2H5YA 4NTLA 2Q9TA 4QSEA 2DWJA 4AB5A 1NL5A 4POWA 2OWTA 2Q2AA 1A54A 4RK2A 3PD9A 1P99A 2DE4A 3G3KA 4U1OA 3Q28A 3R26A 4YB7A 3ECRA 5I84A 4IO2A 4H6DA 3KJ7A 3UP9A 2ONSA 4F39A 1HSEA 4LZ7A 2DE3A 3C33A 1DSNA 1B32A 1M5DA 2DP8A 4OVJA 1RYXA 3H4ZA 4LATA 3IX1A 3EN3A 5JEIA 3PPOA 3TZAA 1B58A 4G68C 5KCJB 4KYEA 4WEPA 4FEBA 5F1QA 4O3AA 2Y84A 1I69A 3P7IA 4Q30B 2OLBA 2RC7A 4R2BA 3G3JA 4O3BA 3MBPA 4YKJA 1OLAA 3C35A 1S7YA 5ITPA 1M5FA 3T9VA 4YICA 1SQYA 1ZMGA 1DMBA 4OXVA 3DP4A 4U4SA 5CMCA 4EDPA 3ZS6A 1BTJA 1FTJA 4NF4B 1QVSA 1FQBA 3BKIB 4G68B 1B1HA 3EHUA 5CM6A 1M5CA 1NKXA 2ZNTA 3O6IA 4KYSA 1SW1A 3FV2A 5AA4A 1Y1ZA 1P1OA 4DCYA 4TLLB 3E9XA 5F7VA 4ZEKA 3RGYA 1N7WA 1MXYA 3CIJA 3QXMA 4Z0IA 5EYFA 3CFXA 1OLCA 1D9VA 2GFEA 1NMUA 1P1QA 3FASA 3T22A 4BDLA 4RK9A 4NWCA 5AA2A 3OSRA 3BFUA 1ZIUA 5I58A 1SI0A 2QRYA 3IO6A 4LVQA 4E0XA 1MG1A 2VD3A 3SEWA 2O51A 2OCUA 3OO9A 3IO4A 5B70A 1IXIA 4QSCA 4MH5A 1EZ9A 1NNKA 3IAZA 3UGWA 1H44A 1XS5A 4ELRA 3HN0A 3PU5A 4H5FA 1PB9A 2DXYA 5I2NA 3VE1B 1NH7A 5K2XA 3SDFA 3H6VA 2RF1A 4YAHX 4MF3A 3BBRA 4F31B 3LBSA 5HPQA 3KN8A 4I62A 4JSOA 5I56B 1OVTA 1QULA 2XXHA 5IKBA 5DVJA 1QJMA 2IEEA 2F7AA 3LSFB 5ICQA 1GVCA 2O69A 4F1UA 3VVDA 1D3KA 2F78A 2NVUB 1AOVA 2Y7PA 3ZKLA 3H7MA 1WDNA 1JW1A 4FORA 2RC9A 3OENA 4GFRA 1JETA 3N6UA 3U1OA 3M3LA 4DXCA 5L9SA 1LCFA 1J1NA 1NH8A 1EZOA 3QUJA 1SI1A 1H76A 3FXQA 1JW5A 1MRPA 1SW2A 3S9EA 3UN6A 3IK6B 2I0BA 4QHQA 3RNNA 2VOZA 3GLBA 3W9WA 3VLUA 2P1SA 3KSXA 4NF5B 4MBPA 2QS4A 1N7XA 1MM7A 2UYFA 3IOVA 2Z23A 1SBPA 3QIMA 3MZ9A 1PBQA 4C1UA 4X1DA 3PUZE 2Z8FA 4BDQA 4O3CA 1MQGA 4PFUA 2ESNA 1VFDA 2P2AA 1VR5A 4N13A 3Q29A 4RA1A 4XKPA 1FQFA 4EUOA 3VDFA 2Y7RA 1B3LA 4M1VA 1B1XA 3PUVE 4NF8A 3PUWE 2I0CA 4DCXA 1LAHE 2Y7WA 3V83A 4F19A 3CI8A 3G3IA 4DZ1A 1MQHA 3TELA 4G8NA 1DPPA 3IOTA 3CFLA 4OWDA 4HW8A 3KG2A 3PUYE 2QS2A 3WAFA 1CE2A 3MQ9A 4YKKA 1Y3NA 5H8NB 4JXIA 4ZEDA 3W15C 1URDA 3TTRA 1Y3QA 4OENA 2H4IA 3T96B 1B40A 1JW4A 3OO6A 3K00A 2AL5A 1USYE 3FIRA 4ELPA 4R6KA 2X7PA 4IGTA 1BLFA 2HQ0A 2D21A 3S9MC 1UQWA 3K01A 3G3FA 3GXAA 4U23A 3PPPA 2XXYA 3ZKKA 4GL0A 3PPQA 3W9VA 4FAJA 1A55A 2F35A 2XX7A 1LB8A 3TTKA 2QS1A 3UIFA 2Q8JA 3T66A 4KHZE 5CI5A 5CBSA 3A3CA 1PEBA 4FIMA 4PP0A 3JYRA 3DM0A 3O97A 3VVFA 2X26A 4KI0E 1IQ7A 1LBCA 3EHTA 2XX8A 4JSDA 4F18A 3MZBA 4K3FA 2I6EA 4BDNA 3SESA 1LAGE 3E3KA 4F2OA 5I2KB 4Z7EA 4R6YA 4JWYA 2F7BA 4ELQA 4DDDA 4X1BA 4GF8A 4KPTA 1JVYA 3VXBA 4OYVA 3K1MA 2AYSA 2D3IA 2XXTA 1US4A 2E1SA 4X9TA 4C1TA 1ATGA 5I56A 1MY1A 1MY0A 2Y7KA 2ABHA 1B0LA 4KR5A 1B2HA 4XKRA 4G77A 3FJMA 1ZKBA 5TP9B 4YKPA 3MUQA 3OD7A 4IO3A 3M8UA 2PX1A 3OO7A 4JB7A 3FXUA 3LC8A 1Y4TA 1TFAA 2QS3A 3N5LA 4U22A 3L6GA 2O7UA 3TQLA 3IJXB 4G8MA 4GLIA 4HTGA 2OJTA 3TFLA 2R9JA 5KDTA 4RNSA 2V3QA 2QMWA 3PPNA 1HSJA 1MY2A 4H1XA 4GVOA 3LUYA 4LUBA 5AA3A 4OTEA 1MM6A 3FJGA 4PETA 4P11A 3U94A 1UIUA 1FQCA 4I1DA 4NF5A 2NOOA 3K6WA 2F6GA 3EQ1A 2O1MA 4ZEIA 2ANJA 3V89B 2F6PA 2F7CA 5TPAB 3FVOA 3A3UA 1IUDA 3C9HA 3FV1A 4IB2A 1P1UA 2IA4A 4P0IA 3FVKA 5EHSA 4LZ5A 4OFOA 1UTHB 1FQDA 2PBWA 1L5TA 3VVEA 1N84A 2RINA 3FGSA 3T9XB 1PC3A 2O1LA 1JEVA 1JVXA 3K4UA 3ILTB 3M3FA 1IIWA 2V3TA 5AE4A 1IXCA 5FTIA 3C31A 1B46A 4N6PA 3VLWA 3KFMA 3KZGA 4EXKA 5H8NA 4WKMA 4EF1A 2AL4A 1N3XA 5TU0A 3HV1A 3N6TA 4U1ZA 4F22A 1N0TA 3TTNA 3RTFB 1QKAA 1XVXA 3S4UA 4LQ5A 4F3GA 3K02A 1II5A 2HAVA 4QSDA 1FCKA 5H8SA 2O84X 3IJOB 1N3WA 5DTBA 1Z7ME 3KN3A 3S9NC 1MXZA 2R71A 2F8DA 1URSA 4L17A 2Q2CA 4R9GA 4YU0A 4MLVA 3O9PA 3Q25A 1ELJA 5FHNA 3MP1A 4DLDA 4I9DA 2QPQA 3MJNA 3O6HA 4Q0CA 4ZS9A 4QF9A 1B5IA 2G29A 3KJTA 4R74A 3G7WA 1Z7NE 1GTKA 3HO7A 2DVZA 4QFPA 2FA7A 1OQGA 2ZYNA 4FE8A 2WKYA 1US5A 1R9QA 4P0GA 4F1VA 3RT8A 2GHBA 2ZNUA 2V84A 3HSTA 2V25A 1Q35A 1LBBA 1YAEA 1QUKA 4KQPA 1R6ZA 3VV5A 2DSFA 1UIVA 3A09A 2UVHA 1LB9A 1B52A 1Y1MA 3K1PA 4RJZA 1LFIA 1MH3A 1YPNA 4GRKA 2XXQA 5CC2A 2QSXA 1S50A 3MWBA 1B3GA 1B9JA 2H98A 5JK4A 1VSOA 1USYH 1N76A 2XXXA 2G93A 3TODA 5H8FB 3KN7A 4GOTA 3HHFA 5CMMA 1CB6A 3UORA 4TQUQ 4NMYA 1IXGA 2DE2A 3C4MA 1Y4CA 1MXVA 1LGBC 1Y9UA 4EXLA 1PBPA 4G2ZA 4QFOA 4OZ9A 1FW0A 1BIYA 1POY1 2F97A 2Y7IA 4ESWA 1LAXA 1B51A 5K2YA 2NWJA 3N94A 1ZU0A 3H3GA 3PV0E 2O6AA 4GQOA 3FD3A 4THIA 1A8EA 2Z22A 4XXUA 3V5AA 2VHAA 1QW0A 4XIGQ 1B0HA 3H6UA 4RYAA 3QYTA 3OXNA 3IB1A 4F3BA 3K6VA 2ZNSA 1TWYA 2XHDA 5BUUA 3BFTA 1MS7A 2UVGA 5KCJA 1DTZA 4OMBA 1XOCA 3DELB 5TPAA 1EU8A 1A7LA 3IL1B 4DXBA 4RPOA 3K6XA 4YMBA 2B65A 5DVFA 4MFIA 2XD3A 3E13X 5KZTA 1UTHA 3IB2A 1B7ZA 2DWAA 1O7TA 4RXLA 1B5HA 3T9HB 1LFGA 2ALUA 2QL3A 4R6HA 3U92A 4IY6A 3T93B 2I58A 5L8DA 4KFQA 2OZZA 4OQOA 2VD2A 3IOUA 4LONB 3ZSFA 4BLAA 2XXWA 1M5EA 4NF4A 3PMWA 1M5BA 4G68A 5FTHA 2GHAA 4DE8A 1IXHA 3RT6B 4HCWA 2XD2A 3Q27A 1RYOA 1QKBA 1MPDA 5ICTA 4I8CA 2I3WA 1Q1KA 1OVBA 4H8JA 4X48A 4BDRA 4GIZA 1MPBA 1AL3A 2DXRA 1NFTA 4POXA 4JBZA 4F1YA 1H3DA 2PVUA 2A5SA 1LFHA 4EQBA 4PFTA 1RKMA 3LSLA 4HS7A 3S9LC 4YKIA 1SDXA 1KWHA 1EH3A 1JEUA 1FTOA 3SKPA 1TT1A 2YPNA 4EF2A 1B3EA 3SEXA 4DIGA 3MAMA 4AB6A 1MY4A 4JWOA 3EPEA 1AIVA 1B4HA 2Q89A 5H8HB 2W7YA 4BDOA 5I59B 5EHMA 2B3FA 3H06B 5DYHA 3PMXA 4OHNA 4XTCQ 2QMXA 3VFJA 3S2VA 2H25A 3SERA 1H45A 1R1NA 1OMPA 1SVXB 2LAOA 3LR1A 3D4GA 2ZYKA 3USDA 2UVJA 2VP1A 5A5XB 4GXAA 3HCQA 2UYEA 3R6UA 3TDJA 5M2VA 1MDP1 1BP5A 4KCDA 4F3SA 4PFYA 5DT6A 3HPIA 1GR2A 1MDQA 1LAFE 5I2NB 2B3BA 3F11A 1QUIA 3CSGA 4R72A 2GRVA 2YJPA 1SYIA 4GL8A 3V8XB 2OBGA 1WODA 3JZJA 3GBBA 3MVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OO8 A;  4JWX A;  4KCC A;  2RC8 A;  1VE4 A;  2Z8E A;  4G4P A;  3KGC A;  3TPA A;  1O64 A;  1URG A;  4UAC A;  1O63 A;  5ISU A;  3QK6 A;  5I57 B;  1YCJ A;  2QJE A;  4U2R A;  3TYH A;  4ZZA A;  1XVY A;  4R2F A;  4WXJ A;  4RY1 A;  5H8Q B;  4G8H A;  3OEM A;  4H67 A;  2YLN A;  3MVX A;  2AIX A;  3CSB A;  5CBR A;  4NF6 B;  2OWS A;  3SEV A;  1R9L A;  5CMB A;  4NE4 A;  3TAJ A;  1IIT A;  3TCH A;  2VGQ A;  1NNT A;  3RUM A;  4N07 A;  2PT1 A;  4ND9 A;  5HBC A;  3QUF A;  2V93 A;  1FQA A;  4R73 A;  1I6A A;  3O66 A;  3K1N A;  3THI A;  1N04 A;  1PDA A;  2XXR A;  3R7X A;  2BJJ X;  3PMV A;  3MW0 A;  1SD3 A;  4OES A;  2XXP A;  3TCG A;  3OMB A;  3K6U A;  4HCY A;  3RTW B;  1MQI A;  5JTY B;  3FZV A;  3PGF A;  3TQW A;  5DEX B;  4KD5 A;  3C34 A;  1SW4 A;  2X7Q A;  4NF8 B;  3VLV A;  2O7I A;  1QUJ A;  3T9U A;  2HXW A;  3DLN A;  2P0S A;  3QSL A;  3OEK A;  1ZJL A;  5B7D A;  3OSQ A;  3K0V A;  3TTM A;  2REG A;  2FNC A;  2I4B A;  4XKQ A;  3LSW A;  5L9M A;  2RCB A;  5ITO A;  4E0W A;  4U4X A;  1FTL A;  3SEU A;  3ILU B;  1MY3 A;  2REJ A;  5CRY A;  1B7U A;  4OFL A;  4OER A;  2V3U A;  1SW5 A;  2F34 A;  3MP6 A;  1OIB A;  1FQE A;  1PB8 A;  3U93 A;  4BDM A;  1UTB B;  4FEC A;  2I49 A;  2NUV A;  3MVW A;  3HHG A;  1AH5 A;  2ZYM A;  1WVJ A;  4FJP A;  2DOJ A;  4OFJ A;  2HCA A;  1I6Q A;  4QFN A;  1DTG A;  4PE5 B;  1MXU A;  3TKD A;  2ZYO A;  3B6T A;  4GXS B;  4LA9 A;  3ONM A;  3KSJ A;  4H8I A;  4ZEB A;  4F2Q A;  3U72 A;  3TTL A;  5H8H A;  5I2K A;  1B7H A;  5I59 A;  2Q88 A;  1F9B A;  3FUZ A;  4TLM B;  1MPC A;  3KEI A;  1XT8 A;  1VFE A;  3RN8 A;  4ZE9 A;  3B7D A;  1LST A;  1ZBM A;  5FHO A;  2H99 A;  4Q8R A;  4F3P A;  2XX9 A;  1NNP A;  4ESX A;  4IO7 A;  2H9B A;  4RPN A;  3VXC A;  3ODB A;  5L9O A;  1MH4 A;  3KOS A;  2PMS A;  1LCT A;  5A5X A;  3EHS A;  3MPK A;  4C0R A;  3CFZ A;  4ISU A;  2F36 A;  4KYD A;  1B5J A;  1B3H A;  1MQD A;  4ZZE A;  3SEY A;  5TP9 A;  4ELO A;  1Y20 A;  1GV8 A;  5CMK A;  3TEP A;  1A8F A;  3B6Q A;  2A5T B;  4YB6 A;  4NED A;  1MXX A;  2CZL A;  3FJ7 A;  3PPR A;  1EZP A;  3CG3 A;  4IGR A;  4XKN A;  5ELV A;  3G3H A;  4AQ4 A;  3Q26 A;  1XHY A;  1POT A;  3L6H A;  4WED A;  1FTK A;  2DWI A;  3TCF A;  2PT2 A;  2DVC A;  2HZL A;  3MP8 A;  1OQH A;  3SET A;  4PQJ A;  3UK4 A;  4OET A;  5IAI A;  5I57 A;  4ONY A;  3O28 A;  4H5G A;  3KBR A;  4YMA A;  3PD8 A;  1JNF A;  5H8Q A;  3O2A A;  1MQJ A;  1FTM A;  5J1D A;  5KDT B;  4NF6 A;  4MLQ A;  1D4N A;  4LQ2 A;  2F5X A;  2RKM A;  5HM4 B;  3CG1 A;  1B3F A;  3O6G A;  3MVZ A;  2UXA A;  5BWJ A;  3K2D A;  3RY3 A;  4DXU A;  3GZG A;  4EQ9 A;  2DS9 A;  2PYY A;  4YB5 A;  5LOM A;  2GH9 A;  3DP6 A;  1H43 A;  2HZK A;  1YTV A;  2CMO A;  1Y3P A;  3N26 A;  5AA1 A;  1TFD A;  1BKA A;  1PB7 A;  2I48 A;  4ZEF A;  5JTY A;  2Z8D A;  2D5W A;  4F29 A;  3TMG A;  5DEX A;  4OEV A;  2O68 A;  3KOT A;  4IY5 A;  3MZ1 A;  3WAE A;  2E0S A;  2ZXT A;  1GGG A;  2M8C A;  4FED A;  4R9F A;  3IOW A;  1JQF A;  2I4C A;  4QFK A;  3H6W A;  3QAX A;  1ZTY A;  4H0W A;  4IO4 A;  1IEJ A;  3H03 A;  3CVG A;  3C32 A;  1B6H A;  1A99 A;  2THI A;  4IO6 A;  4QRZ A;  4GD5 A;  2HFB A;  3TUS A;  3RPW A;  3B6W A;  4IO5 A;  4NWD A;  3I3V A;  3RLF E;  3CRB A;  3RQT A;  1S9T A;  3JV9 A;  2FYI A;  2RCA A;  5AA4 B;  3OOA A;  3C36 A;  4QFL A;  3OEL A;  4ZDM A;  1UTB A;  5DVI A;  1T0K A;  1NNF A;  4YZZ A;  4ZE8 A;  3LSX A;  3DP8 A;  1B05 A;  4M4G A;  3CR9 A;  2XXU A;  4UA8 A;  2ONK E;  3FVN A;  4TOZ A;  1I6B A;  1DOT A;  3I5O A;  3EF7 A;  2HEU A;  5AA2 B;  3IB0 A;  5I58 B;  2NXO A;  1A40 A;  1P1W A;  3H6T A;  3FAT A;  2ZMB A;  2DQV A;  4ZEC A;  3D4C A;  3FXR A;  2ONR A;  4FAT A;  5AA2 D;  4JDF A;  1HSL A;  3I6V A;  3GBA A;  1B4Z A;  2DYX A;  1ZLQ A;  3G3G A;  4Q5T A;  1P1N A;  2I3V A;  3MC2 A;  2KLF A;  3E4R A;  3UA8 A;  3MPL A;  1IZ1 A;  1D9Y A;  2DWH A;  3IOR A;  2XXI A;  5FHM A;  2R6G E;  4ECF A;  1TXF A;  3PUX E;  1SYH A;  1AMF A;  4U21 A;  4LP2 B;  1DPE A;  4PFW A;  4R75 A;  5H8F A;  1LLS A;  3FVG A;  2A5T A;  4EQ7 A;  1ANF A;  4OEU A;  2UVI A;  4LZ8 A;  1MXW A;  2HAU A;  3O29 A;  3AXF A;  1XC1 A;  4H65 A;  4GWO A;  3M3K A;  2OK2 A;  3IR1 A;  3U8Q A;  2XXV A;  2H5Y A;  4NTL A;  2Q9T A;  4QSE A;  2DWJ A;  4AB5 A;  1NL5 A;  4POW A;  2OWT A;  2Q2A A;  1A54 A;  4RK2 A;  3PD9 A;  1P99 A;  2DE4 A;  3G3K A;  4U1O A;  3Q28 A;  3R26 A;  4YB7 A;  3ECR A;  5I84 A;  4IO2 A;  4H6D A;  3KJ7 A;  3UP9 A;  2ONS A;  4F39 A;  1HSE A;  4LZ7 A;  2DE3 A;  3C33 A;  1DSN A;  1B32 A;  1M5D A;  2DP8 A;  4OVJ A;  1RYX A;  3H4Z A;  4LAT A;  3IX1 A;  3EN3 A;  5JEI A;  3PPO A;  3TZA A;  1B58 A;  4G68 C;  5KCJ B;  4KYE A;  4WEP A;  4FEB A;  5F1Q A;  4O3A A;  2Y84 A;  1I69 A;  3P7I A;  4Q30 B;  2OLB A;  2RC7 A;  4R2B A;  3G3J A;  4O3B A;  3MBP A;  4YKJ A;  1OLA A;  3C35 A;  1S7Y A;  5ITP A;  1M5F A;  3T9V A;  4YIC A;  1SQY A;  1ZMG A;  1DMB A;  4OXV A;  3DP4 A;  4U4S A;  5CMC A;  4EDP A;  3ZS6 A;  1BTJ A;  1FTJ A;  4NF4 B;  1QVS A;  1FQB A;  3BKI B;  4G68 B;  1B1H A;  3EHU A;  5CM6 A;  1M5C A;  1NKX A;  2ZNT A;  3O6I A;  4KYS A;  1SW1 A;  3FV2 A;  5AA4 A;  1Y1Z A;  1P1O A;  4DCY A;  4TLL B;  3E9X A;  5F7V A;  4ZEK A;  3RGY A;  1N7W A;  1MXY A;  3CIJ A;  3QXM A;  4Z0I A;  5EYF A;  3CFX A;  1OLC A;  1D9V A;  2GFE A;  1NMU A;  1P1Q A;  3FAS A;  3T22 A;  4BDL A;  4RK9 A;  4NWC A;  5AA2 A;  3OSR A;  3BFU A;  1ZIU A;  5I58 A;  1SI0 A;  2QRY A;  3IO6 A;  4LVQ A;  4E0X A;  1MG1 A;  2VD3 A;  3SEW A;  2O51 A;  2OCU A;  3OO9 A;  3IO4 A;  5B70 A;  1IXI A;  4QSC A;  4MH5 A;  1EZ9 A;  1NNK A;  3IAZ A;  3UGW A;  1H44 A;  1XS5 A;  4ELR A;  3HN0 A;  3PU5 A;  4H5F A;  1PB9 A;  2DXY A;  5I2N A;  3VE1 B;  1NH7 A;  5K2X A;  3SDF A;  3H6V A;  2RF1 A;  4YAH X;  4MF3 A;  3BBR A;  4F31 B;  3LBS A;  5HPQ A;  3KN8 A;  4I62 A;  4JSO A;  5I56 B;  1OVT A;  1QUL A;  2XXH A;  5IKB A;  5DVJ A;  1QJM A;  2IEE A;  2F7A A;  3LSF B;  5ICQ A;  1GVC A;  2O69 A;  4F1U A;  3VVD A;  1D3K A;  2F78 A;  2NVU B;  1AOV A;  2Y7P A;  3ZKL A;  3H7M A;  1WDN A;  1JW1 A;  4FOR A;  2RC9 A;  3OEN A;  4GFR A;  1JET A;  3N6U A;  3U1O A;  3M3L A;  4DXC A;  5L9S A;  1LCF A;  1J1N A;  1NH8 A;  1EZO A;  3QUJ A;  1SI1 A;  1H76 A;  3FXQ A;  1JW5 A;  1MRP A;  1SW2 A;  3S9E A;  3UN6 A;  3IK6 B;  2I0B A;  4QHQ A;  3RNN A;  2VOZ A;  3GLB A;  3W9W A;  3VLU A;  2P1S A;  3KSX A;  4NF5 B;  4MBP A;  2QS4 A;  1N7X A;  1MM7 A;  2UYF A;  3IOV A;  2Z23 A;  1SBP A;  3QIM A;  3MZ9 A;  1PBQ A;  4C1U A;  4X1D A;  3PUZ E;  2Z8F A;  4BDQ A;  4O3C A;  1MQG A;  4PFU A;  2ESN A;  1VFD A;  2P2A A;  1VR5 A;  4N13 A;  3Q29 A;  4RA1 A;  4XKP A;  1FQF A;  4EUO A;  3VDF A;  2Y7R A;  1B3L A;  4M1V A;  1B1X A;  3PUV E;  4NF8 A;  3PUW E;  2I0C A;  4DCX A;  1LAH E;  2Y7W A;  3V83 A;  4F19 A;  3CI8 A;  3G3I A;  4DZ1 A;  1MQH A;  3TEL A;  4G8N A;  1DPP A;  3IOT A;  3CFL A;  4OWD A;  4HW8 A;  3KG2 A;  3PUY E;  2QS2 A;  3WAF A;  1CE2 A;  3MQ9 A;  4YKK A;  1Y3N A;  5H8N B;  4JXI A;  4ZED A;  3W15 C;  1URD A;  3TTR A;  1Y3Q A;  4OEN A;  2H4I A;  3T96 B;  1B40 A;  1JW4 A;  3OO6 A;  3K00 A;  2AL5 A;  1USY E;  3FIR A;  4ELP A;  4R6K A;  2X7P A;  4IGT A;  1BLF A;  2HQ0 A;  2D21 A;  3S9M C;  1UQW A;  3K01 A;  3G3F A;  3GXA A;  4U23 A;  3PPP A;  2XXY A;  3ZKK A;  4GL0 A;  3PPQ A;  3W9V A;  4FAJ A;  1A55 A;  2F35 A;  2XX7 A;  1LB8 A;  3TTK A;  2QS1 A;  3UIF A;  2Q8J A;  3T66 A;  4KHZ E;  5CI5 A;  5CBS A;  3A3C A;  1PEB A;  4FIM A;  4PP0 A;  3JYR A;  3DM0 A;  3O97 A;  3VVF A;  2X26 A;  4KI0 E;  1IQ7 A;  1LBC A;  3EHT A;  2XX8 A;  4JSD A;  4F18 A;  3MZB A;  4K3F A;  2I6E A;  4BDN A;  3SES A;  1LAG E;  3E3K A;  4F2O A;  5I2K B;  4Z7E A;  4R6Y A;  4JWY A;  2F7B A;  4ELQ A;  4DDD A;  4X1B A;  4GF8 A;  4KPT A;  1JVY A;  3VXB A;  4OYV A;  3K1M A;  2AYS A;  2D3I A;  2XXT A;  1US4 A;  2E1S A;  4X9T A;  4C1T A;  1ATG A;  5I56 A;  1MY1 A;  1MY0 A;  2Y7K A;  2ABH A;  1B0L A;  4KR5 A;  1B2H A;  4XKR A;  4G77 A;  3FJM A;  1ZKB A;  5TP9 B;  4YKP A;  3MUQ A;  3OD7 A;  4IO3 A;  3M8U A;  2PX1 A;  3OO7 A;  4JB7 A;  3FXU A;  3LC8 A;  1Y4T A;  1TFA A;  2QS3 A;  3N5L A;  4U22 A;  3L6G A;  2O7U A;  3TQL A;  3IJX B;  4G8M A;  4GLI A;  4HTG A;  2OJT A;  3TFL A;  2R9J A;  5KDT A;  4RNS A;  2V3Q A;  2QMW A;  3PPN A;  1HSJ A;  1MY2 A;  4H1X A;  4GVO A;  3LUY A;  4LUB A;  5AA3 A;  4OTE A;  1MM6 A;  3FJG A;  4PET A;  4P11 A;  3U94 A;  1UIU A;  1FQC A;  4I1D A;  4NF5 A;  2NOO A;  3K6W A;  2F6G A;  3EQ1 A;  2O1M A;  4ZEI A;  2ANJ A;  3V89 B;  2F6P A;  2F7C A;  5TPA B;  3FVO A;  3A3U A;  1IUD A;  3C9H A;  3FV1 A;  4IB2 A;  1P1U A;  2IA4 A;  4P0I A;  3FVK A;  5EHS A;  4LZ5 A;  4OFO A;  1UTH B;  1FQD A;  2PBW A;  1L5T A;  3VVE A;  1N84 A;  2RIN A;  3FGS A;  3T9X B;  1PC3 A;  2O1L A;  1JEV A;  1JVX A;  3K4U A;  3ILT B;  3M3F A;  1IIW A;  2V3T A;  5AE4 A;  1IXC A;  5FTI A;  3C31 A;  1B46 A;  4N6P A;  3VLW A;  3KFM A;  3KZG A;  4EXK A;  5H8N A;  4WKM A;  4EF1 A;  2AL4 A;  1N3X A;  5TU0 A;  3HV1 A;  3N6T A;  4U1Z A;  4F22 A;  1N0T A;  3TTN A;  3RTF B;  1QKA A;  1XVX A;  3S4U A;  4LQ5 A;  4F3G A;  3K02 A;  1II5 A;  2HAV A;  4QSD A;  1FCK A;  5H8S A;  2O84 X;  3IJO B;  1N3W A;  5DTB A;  1Z7M E;  3KN3 A;  3S9N C;  1MXZ A;  2R71 A;  2F8D A;  1URS A;  4L17 A;  2Q2C A;  4R9G A;  4YU0 A;  4MLV A;  3O9P A;  3Q25 A;  1ELJ A;  5FHN A;  3MP1 A;  4DLD A;  4I9D A;  2QPQ A;  3MJN A;  3O6H A;  4Q0C A;  4ZS9 A;  4QF9 A;  1B5I A;  2G29 A;  3KJT A;  4R74 A;  3G7W A;  1Z7N E;  1GTK A;  3HO7 A;  2DVZ A;  4QFP A;  2FA7 A;  1OQG A;  2ZYN A;  4FE8 A;  2WKY A;  1US5 A;  1R9Q A;  4P0G A;  4F1V A;  3RT8 A;  2GHB A;  2ZNU A;  2V84 A;  3HST A;  2V25 A;  1Q35 A;  1LBB A;  1YAE A;  1QUK A;  4KQP A;  1R6Z A;  3VV5 A;  2DSF A;  1UIV A;  3A09 A;  2UVH A;  1LB9 A;  1B52 A;  1Y1M A;  3K1P A;  4RJZ A;  1LFI A;  1MH3 A;  1YPN A;  4GRK A;  2XXQ A;  5CC2 A;  2QSX A;  1S50 A;  3MWB A;  1B3G A;  1B9J A;  2H98 A;  5JK4 A;  1VSO A;  1USY H;  1N76 A;  2XXX A;  2G93 A;  3TOD A;  5H8F B;  3KN7 A;  4GOT A;  3HHF A;  5CMM A;  1CB6 A;  3UOR A;  4TQU Q;  4NMY A;  1IXG A;  2DE2 A;  3C4M A;  1Y4C A;  1MXV A;  1LGB C;  1Y9U A;  4EXL A;  1PBP A;  4G2Z A;  4QFO A;  4OZ9 A;  1FW0 A;  1BIY A;  1POY 1;  2F97 A;  2Y7I A;  4ESW A;  1LAX A;  1B51 A;  5K2Y A;  2NWJ A;  3N94 A;  1ZU0 A;  3H3G A;  3PV0 E;  2O6A A;  4GQO A;  3FD3 A;  4THI A;  1A8E A;  2Z22 A;  4XXU A;  3V5A A;  2VHA A;  1QW0 A;  4XIG Q;  1B0H A;  3H6U A;  4RYA A;  3QYT A;  3OXN A;  3IB1 A;  4F3B A;  3K6V A;  2ZNS A;  1TWY A;  2XHD A;  5BUU A;  3BFT A;  1MS7 A;  2UVG A;  5KCJ A;  1DTZ A;  4OMB A;  1XOC A;  3DEL B;  5TPA A;  1EU8 A;  1A7L A;  3IL1 B;  4DXB A;  4RPO A;  3K6X A;  4YMB A;  2B65 A;  5DVF A;  4MFI A;  2XD3 A;  3E13 X;  5KZT A;  1UTH A;  3IB2 A;  1B7Z A;  2DWA A;  1O7T A;  4RXL A;  1B5H A;  3T9H B;  1LFG A;  2ALU A;  2QL3 A;  4R6H A;  3U92 A;  4IY6 A;  3T93 B;  2I58 A;  5L8D A;  4KFQ A;  2OZZ A;  4OQO A;  2VD2 A;  3IOU A;  4LON B;  3ZSF A;  4BLA A;  2XXW A;  1M5E A;  4NF4 A;  3PMW A;  1M5B A;  4G68 A;  5FTH A;  2GHA A;  4DE8 A;  1IXH A;  3RT6 B;  4HCW A;  2XD2 A;  3Q27 A;  1RYO A;  1QKB A;  1MPD A;  5ICT A;  4I8C A;  2I3W A;  1Q1K A;  1OVB A;  4H8J A;  4X48 A;  4BDR A;  4GIZ A;  1MPB A;  1AL3 A;  2DXR A;  1NFT A;  4POX A;  4JBZ A;  4F1Y A;  1H3D A;  2PVU A;  2A5S A;  1LFH A;  4EQB A;  4PFT A;  1RKM A;  3LSL A;  4HS7 A;  3S9L C;  4YKI A;  1SDX A;  1KWH A;  1EH3 A;  1JEU A;  1FTO A;  3SKP A;  1TT1 A;  2YPN A;  4EF2 A;  1B3E A;  3SEX A;  4DIG A;  3MAM A;  4AB6 A;  1MY4 A;  4JWO A;  3EPE A;  1AIV A;  1B4H A;  2Q89 A;  5H8H B;  2W7Y A;  4BDO A;  5I59 B;  5EHM A;  2B3F A;  3H06 B;  5DYH A;  3PMX A;  4OHN A;  4XTC Q;  2QMX A;  3VFJ A;  3S2V A;  2H25 A;  3SER A;  1H45 A;  1R1N A;  1OMP A;  1SVX B;  2LAO A;  3LR1 A;  3D4G A;  2ZYK A;  3USD A;  2UVJ A;  2VP1 A;  5A5X B;  4GXA A;  3HCQ A;  2UYE A;  3R6U A;  3TDJ A;  5M2V A;  1MDP 1;  1BP5 A;  4KCD A;  4F3S A;  4PFY A;  5DT6 A;  3HPI A;  1GR2 A;  1MDQ A;  1LAF E;  5I2N B;  2B3B A;  3F11 A;  1QUI A;  3CSG A;  4R72 A;  2GRV A;  2YJP A;  1SYI A;  4GL8 A;  3V8X B;  2OBG A;  1WOD A;  3JZJ A;  3GBB A;  3MVY A; 
#chains in the Genus database with same CATH topology
 3OO8 A;  4JWX A;  2XWV A;  4KCC A;  2RC8 A;  1VE4 A;  2Z8E A;  4NHB A;  4G4P A;  3KGC A;  3TPA A;  1O64 A;  4I3Y A;  1URG A;  4UAC A;  1O63 A;  5ISU A;  4O8M A;  3QK6 A;  5I57 B;  1YCJ A;  2QJE A;  4MMP A;  4U2R A;  3TYH A;  4ZZA A;  1XVY A;  4R2F A;  4WXJ A;  1RDZ A;  4RY1 A;  4FBP A;  5H8Q B;  4P3L A;  4I3E A;  4GWS A;  2MKZ A;  4G8H A;  3OEM A;  4H67 A;  2YLN A;  3MVX A;  2AIX A;  3CSB A;  5CBR A;  4NF6 B;  2OWS A;  3SEV A;  3LUZ A;  1FPJ A;  1R9L A;  4GWU A;  5CMB A;  4NE4 A;  3TAJ A;  1IIT A;  3TCH A;  2VGQ A;  1NNT A;  3RUM A;  4N07 A;  4PAK A;  2PT1 A;  4ND9 A;  5EQA A;  5I3S A;  5HBC A;  3QUF A;  2V93 A;  1FQA A;  4R73 A;  1I6A A;  3O66 A;  4PFR A;  4MAG A;  3K1N A;  3THI A;  1N04 A;  1PDA A;  2XXR A;  5DW8 A;  3R7X A;  2BJJ X;  3PMV A;  3MW0 A;  1G0I A;  1SD3 A;  4GBV A;  4OES A;  2XXP A;  3TCG A;  3OMB A;  4KXP A;  3K6U A;  1KZ8 A;  4HCY A;  1FPI A;  3RTW B;  1MQI A;  5JTY B;  3FZV A;  1FJ9 A;  3PGF A;  3TQW A;  5DEX B;  4KD5 A;  3C34 A;  1SW4 A;  2X7Q A;  4NF8 B;  3VLV A;  2O7I A;  4O7I A;  1QUJ A;  3T9U A;  2HXW A;  3DLN A;  4PF8 A;  2P0S A;  3QSL A;  1FPE A;  1K9Z A;  3OEK A;  1ZJL A;  5B7D A;  3RPL A;  3OSQ A;  3K0V A;  3TTM A;  2REG A;  2FNC A;  2I4B A;  4XKQ A;  3LSW A;  5L9M A;  2RCB A;  5ITO A;  4N6K A;  4E0W A;  4U4X A;  1FTL A;  3SEU A;  3ILU B;  1MY3 A;  2REJ A;  5CRY A;  1B7U A;  4OFL A;  4OER A;  2V3U A;  1SW5 A;  1NV2 A;  2F34 A;  1EYJ A;  3MP6 A;  1OIB A;  1FBH A;  1FQE A;  1PB8 A;  3U93 A;  4N8G A;  4BDM A;  1UTB B;  4QXD A;  4FEC A;  2KR0 A;  2I49 A;  4HE1 A;  2NUV A;  3MVW A;  1NV3 A;  3FBP A;  3HHG A;  1AH5 A;  2ZYM A;  1WVJ A;  4FJP A;  3T0J A;  2F3D A;  2DOJ A;  4OFJ A;  2HCA A;  1I6Q A;  4QFN A;  1DTG A;  4PFI A;  4PE5 B;  1MXU A;  3TKD A;  2ZYO A;  3B6T A;  4GXS B;  4LA9 A;  3ONM A;  3KSJ A;  4H8I A;  4ZEB A;  2XA5 A;  4F2Q A;  3U72 A;  2PCR A;  3TTL A;  5H8H A;  5I2K A;  1B7H A;  5I59 A;  1FBG A;  2Q88 A;  1F9B A;  3FUZ A;  4TLM B;  1MPC A;  3KEI A;  1XT8 A;  1VFE A;  3RN8 A;  4ZE9 A;  3B7D A;  1LST A;  1NUZ A;  1ZBM A;  5FHO A;  2H99 A;  4Q8R A;  4F3P A;  2XWO A;  2XX9 A;  1NNP A;  4ESX A;  4IO7 A;  2H9B A;  4RPN A;  3VXC A;  1IMF A;  3ODB A;  5L9O A;  1MH4 A;  3KOS A;  2PMS A;  1LCT A;  5A5X A;  3EHS A;  3MPK A;  4C0R A;  5IZZ A;  3CFZ A;  4ISU A;  2F36 A;  4KYD A;  1B5J A;  1B3H A;  1MQD A;  4ZZE A;  3SEY A;  5TP9 A;  4ELO A;  1Y20 A;  1GV8 A;  5CMK A;  3TEP A;  1A8F A;  3B6Q A;  2A5T B;  4YB6 A;  4NED A;  1MXX A;  1LBZ A;  2CZL A;  3FJ7 A;  3PPR A;  1EZP A;  3CG3 A;  4IGR A;  5IZ3 B;  4XKN A;  5ELV A;  3G3H A;  4AQ4 A;  3Q26 A;  4PGN A;  1XHY A;  4O7M A;  1POT A;  3L6H A;  4WED A;  2WBD A;  5LDZ A;  1FTK A;  2DWI A;  3TCF A;  2PT2 A;  1IMD A;  2DVC A;  2HZL A;  3MP8 A;  4MCO A;  1OQH A;  3SET A;  4PQJ A;  3UK4 A;  4OET A;  5IAI A;  5I57 A;  1FPL A;  4ONY A;  3O28 A;  4H5G A;  3KBR A;  4YMA A;  3PD8 A;  1JNF A;  5H8Q A;  2FVZ A;  3O2A A;  1MQJ A;  1FTM A;  5J1D A;  5KDT B;  5F24 A;  4NF6 A;  4MLQ A;  1D4N A;  4LQ2 A;  4X8R A;  2F5X A;  2RKM A;  5HM4 B;  3CG1 A;  1B3F A;  3O6G A;  3MVZ A;  2UXA A;  5BWJ A;  3K2D A;  3RY3 A;  4DXU A;  3GZG A;  4GBW A;  4EQ9 A;  2DS9 A;  2PYY A;  4OAN A;  4YB5 A;  5LOM A;  2GH9 A;  3DP6 A;  1H43 A;  2HZK A;  4G61 A;  2Q8M A;  4N81 A;  2QVU A;  1YTV A;  3KC1 A;  3D1R A;  2CMO A;  2L5V A;  1Y3P A;  3N26 A;  5AA1 A;  1TFD A;  1BKA A;  1PB7 A;  4MNC A;  2I48 A;  4ZEF A;  5JTY A;  2Z8D A;  4N8Y A;  2D5W A;  4F29 A;  3TMG A;  5DEX A;  4OEV A;  2O68 A;  3KOT A;  4IY5 A;  3MZ1 A;  3WAE A;  2E0S A;  2ZXT A;  4I40 A;  1GGG A;  2M8C A;  4AS5 A;  4FED A;  4H46 A;  1D9Q A;  4R9F A;  3IOW A;  4NGU A;  1JQF A;  2I4C A;  4QFK A;  3H6W A;  3QAX A;  1ZTY A;  4H0W A;  4IO4 A;  1IEJ A;  3H03 A;  3CVG A;  3C32 A;  1B6H A;  1DBZ A;  4NF0 A;  3GYY A;  1A99 A;  2THI A;  4IO6 A;  4QRZ A;  4GD5 A;  3FXB A;  2XWK A;  2HFB A;  2GQ1 A;  3TUS A;  3RPW A;  3B50 A;  3B6W A;  4IO5 A;  4NWD A;  1FPG A;  4PBH A;  3I3V A;  3RLF E;  3CRB A;  3RQT A;  1S9T A;  3JV9 A;  2FYI A;  2RCA A;  5AA4 B;  3OOA A;  3C36 A;  4NX1 A;  2VPN A;  4O94 A;  4QFL A;  3OEL A;  4ZDM A;  1UTB A;  5DVI A;  1NV7 A;  1T0K A;  1NNF A;  4JVI A;  4YZZ A;  4ZE8 A;  3LSX A;  3DP8 A;  1B05 A;  2Y5K A;  4M4G A;  3CR9 A;  2XXU A;  4OVP A;  4UA8 A;  2ONK E;  4NG7 A;  1KA0 A;  3FVN A;  3NOH A;  4TOZ A;  1I6B A;  1DOT A;  4IR8 A;  3I5O A;  3EF7 A;  2HEU A;  5AA2 B;  3IB0 A;  5I58 B;  2NXO A;  1A40 A;  1P1W A;  3H6T A;  3FAT A;  2ZMB A;  2DQV A;  4ZEC A;  3D4C A;  3FXR A;  2ONR A;  4FAT A;  5AA2 D;  4JDF A;  1HSL A;  1NV4 A;  3I6V A;  3GBA A;  1B4Z A;  2DYX A;  1FBD A;  1ZLQ A;  3G3G A;  1XI6 A;  4Q5T A;  1P1N A;  2I3V A;  3MC2 A;  2KLF A;  3E4R A;  3UA8 A;  3MPL A;  1IZ1 A;  1D9Y A;  2VPO A;  5I5P A;  2DWH A;  3IOR A;  2XXI A;  5FHM A;  2R6G E;  4ECF A;  1TXF A;  3PUX E;  1SYH A;  1AMF A;  4U21 A;  1YXI A;  4LP2 B;  4PFW A;  1DPE A;  4R75 A;  5H8F A;  1LLS A;  3FVG A;  3E78 A;  2A5T A;  4MJO A;  4EQ7 A;  2R8T A;  1ANF A;  4OEU A;  2UVI A;  4PTK A;  4LZ8 A;  3EKI A;  1MXW A;  2HAU A;  5IZ3 A;  4PDD A;  4PE3 A;  3O29 A;  3AXF A;  1XC1 A;  4H65 A;  4GWO A;  3M3K A;  2WEF A;  2OK2 A;  3IR1 A;  1NUY A;  3U8Q A;  2XXV A;  2H5Y A;  4QBA A;  4NTL A;  2Q9T A;  4QSE A;  2DWJ A;  1NUX A;  4AB5 A;  1NL5 A;  4POW A;  2OWT A;  2Q2A A;  1A54 A;  4RK2 A;  3PD9 A;  1P99 A;  2DE4 A;  3ROJ A;  3A29 A;  3G3K A;  4N91 A;  4U1O A;  3Q28 A;  3R26 A;  4MNP A;  4YB7 A;  3ECR A;  5I84 A;  4IO2 A;  4H6D A;  3KJ7 A;  3BIG A;  3UP9 A;  2ONS A;  4F39 A;  1HSE A;  4LZ7 A;  2DE3 A;  1G0H A;  3C33 A;  1DSN A;  1B32 A;  1M5D A;  1NV5 A;  2DP8 A;  3MYU A;  4OVJ A;  1RYX A;  2ZZV A;  3H4Z A;  4LAT A;  3IX1 A;  4XF5 A;  3EN3 A;  5JEI A;  3PPO A;  3TZA A;  1B58 A;  4G68 C;  1RDY A;  5KCJ B;  4KYE A;  4WEP A;  4FEB A;  5F1Q A;  4O3A A;  1INP A;  2Y84 A;  1I69 A;  3P7I A;  4Q30 B;  1KA1 A;  3QMF A;  2CEY A;  2OLB A;  2RC7 A;  4R2B A;  3G3J A;  1YZ0 A;  4O3B A;  3MBP A;  4YKJ A;  1IMA A;  3ISP A;  1OLA A;  3C35 A;  1S7Y A;  5ITP A;  1M5F A;  3T9V A;  4YIC A;  1SQY A;  4GX6 A;  1ZMG A;  1DMB A;  4MHF A;  3DP4 A;  4OXV A;  4U4S A;  5CMC A;  4EDP A;  3ZS6 A;  1BTJ A;  1FTJ A;  4NF4 B;  1QVS A;  1FQB A;  3BKI B;  4G68 B;  1B1H A;  3EHU A;  5CM6 A;  1M5C A;  4HE2 A;  4N17 A;  1NKX A;  4HXV A;  2ZNT A;  3O6I A;  5I7I A;  4KYS A;  1SW1 A;  3FV2 A;  5AA4 A;  1Y1Z A;  2WX9 A;  1P1O A;  4DCY A;  4TLL B;  3E9X A;  4JVD A;  4PAF A;  5F7V A;  4ZEK A;  3RGY A;  1MXY A;  1N7W A;  2XXK A;  3CIJ A;  3QXM A;  4Z0I A;  3SZP A;  5EYF A;  1NI9 A;  3CFX A;  1OLC A;  2CZK A;  1D9V A;  2GFE A;  1NMU A;  1P1Q A;  3FAS A;  3T22 A;  2B4L A;  5T3J A;  4BDL A;  4RK9 A;  4NWC A;  5AA2 A;  3OSR A;  3BFU A;  1ZIU A;  5I58 A;  2Y5L A;  1SI0 A;  2BJI A;  2QRY A;  2FBP A;  3IO6 A;  4MNI A;  4LVQ A;  2HHM A;  4E0X A;  1MG1 A;  5A5L A;  2VD3 A;  5EQ7 A;  1JP4 A;  3SEW A;  2QVR A;  2O51 A;  2OCU A;  3OO9 A;  3PTY A;  3IO4 A;  5B70 A;  1IXI A;  4QSC A;  4MH5 A;  1EZ9 A;  1NNK A;  3IAZ A;  3UGW A;  1H44 A;  1XS5 A;  4ELR A;  3HN0 A;  3PU5 A;  4H5F A;  1PB9 A;  2DXY A;  5I2N A;  3VE1 B;  1NH7 A;  5K2X A;  3SDF A;  3H6V A;  2RF1 A;  4YAH X;  4MF3 A;  3BBR A;  4F31 B;  3LBS A;  5HPQ A;  3KN8 A;  4I62 A;  1DK4 A;  4JSO A;  5I56 B;  1OVT A;  4OVT A;  2WYK A;  1QUL A;  2XXH A;  4P1E A;  5IKB A;  5DVJ A;  1QJM A;  2IEE A;  2F7A A;  3LSF B;  5ICQ A;  2HXR A;  4JVC A;  1GVC A;  2O69 A;  2Q74 A;  2OX3 A;  4F1U A;  4DI3 D;  3VVD A;  1D3K A;  2F78 A;  1FBC A;  2NVU B;  1VDW A;  1AOV A;  2Y7P A;  3ZKL A;  3H7M A;  3IFA A;  1WDN A;  1JW1 A;  4FOR A;  2RC9 A;  3OEN A;  1IMC A;  4GFR A;  1JET A;  3N6U A;  3U1O A;  3M3L A;  4DXC A;  1EYK A;  5L9S A;  1LCF A;  1J1N A;  1NH8 A;  1EZO A;  3QUJ A;  1SI1 A;  1H76 A;  3FXQ A;  4MEV A;  1JW5 A;  1MRP A;  1SW2 A;  3S9E A;  1FBP A;  3UN6 A;  3BIH A;  3IK6 B;  2I0B A;  4QHQ A;  3RNN A;  2VOZ A;  5FBP A;  3GLB A;  3W9W A;  3VLU A;  2P1S A;  3KSX A;  4NF5 B;  4NN3 A;  1AWB A;  4N4U A;  5IM2 A;  4MBP A;  2QS4 A;  1N7X A;  1MM7 A;  4OVQ A;  2UYF A;  3IOV A;  2Z23 A;  1SBP A;  4NAP A;  3QIM A;  3MZ9 A;  1PBQ A;  4C1U A;  4PF6 A;  4X1D A;  3PUZ E;  2Z8F A;  4BDQ A;  4O3C A;  1MQG A;  4PFU A;  2ESN A;  1VFD A;  2P2A A;  1VR5 A;  4N13 A;  3Q29 A;  4RA1 A;  4XKP A;  1FQF A;  4EUO A;  3VDF A;  2Y7R A;  1B3L A;  4M1V A;  1RDX A;  1B1X A;  3PUV E;  4NF8 A;  3PUW E;  2I0C A;  4DCX A;  1LAH E;  2Y7W A;  4X04 A;  3V83 A;  4P1L A;  4F19 A;  3CI8 A;  3G3I A;  4DZ1 A;  1MQH A;  3TEL A;  4G8N A;  1DPP A;  3IOT A;  3CFL A;  4OWD A;  4HW8 A;  3KG2 A;  3PUY E;  2QS2 A;  3WAF A;  1CE2 A;  3MQ9 A;  4YKK A;  1Y3N A;  5H8N B;  2PFZ A;  4JXI A;  4ZED A;  3MST A;  4GWY A;  3W15 C;  4PGP A;  1URD A;  3TTR A;  1Y3Q A;  2KQZ A;  4OEN A;  2H4I A;  1LBV A;  1B40 A;  3T96 B;  3RPL B;  1JW4 A;  3OO6 A;  3K00 A;  2AL5 A;  1USY E;  3FIR A;  4ELP A;  4N15 A;  4R6K A;  2X7P A;  4IGT A;  1BLF A;  2HQ0 A;  2D21 A;  3S9M C;  1UQW A;  3K01 A;  3G3F A;  4GWX A;  3GXA A;  4U23 A;  3PPP A;  2XXY A;  3ZKK A;  4GL0 A;  3PPQ A;  3W9V A;  4FAJ A;  1A55 A;  2F35 A;  2XX7 A;  1LB8 A;  3TTK A;  2QS1 A;  3UIF A;  2Q8J A;  3T66 A;  2ZZW A;  4P47 A;  4KHZ E;  5CI5 A;  5CBS A;  3A3C A;  1PEB A;  4FIM A;  4PP0 A;  3JYR A;  3DM0 A;  2PFY A;  3O97 A;  3VVF A;  1IME A;  2X26 A;  4KI0 E;  1IQ7 A;  1LBC A;  3EHT A;  4H45 A;  1LBX A;  2XX8 A;  4JSD A;  4F18 A;  3MZB A;  4K3F A;  2I6E A;  4BDN A;  3SES A;  1LAG E;  3E3K A;  4F2O A;  5I2K B;  4Z7E A;  1FTA A;  4R6Y A;  4JWY A;  2F7B A;  4ELQ A;  4DDD A;  4X1B A;  4GF8 A;  1SPI A;  4KPT A;  2FIX A;  1JVY A;  3VXB A;  4OYV A;  3K1M A;  2AYS A;  2D3I A;  2VT5 A;  2XXT A;  1US4 A;  4PDH A;  2E1S A;  4X9T A;  4C1T A;  1ATG A;  5I56 A;  1MY1 A;  1MY0 A;  2Y7K A;  2ABH A;  1B0L A;  4KR5 A;  1B2H A;  4XKR A;  4G77 A;  3FJM A;  1ZKB A;  5TP9 B;  4YKP A;  4XEQ A;  3MUQ A;  3OD7 A;  4IO3 A;  3M8U A;  2PX1 A;  3OO7 A;  4JB7 A;  3FXU A;  3LC8 A;  2P3N A;  1Y4T A;  1TFA A;  2DDK A;  2QS3 A;  3N5L A;  4U22 A;  3L6G A;  2O7U A;  3TQL A;  3IJX B;  4G8M A;  4GLI A;  4HTG A;  2OJT A;  3TFL A;  2R9J A;  5KDT A;  4RNS A;  2V3Q A;  2QMW A;  2XWI A;  3PPN A;  1HSJ A;  5IGA A;  1NUW A;  1MY2 A;  4H1X A;  2CZI A;  4GVO A;  5J16 A;  3LUY A;  1FSA A;  4LUB A;  5AA3 A;  4OTE A;  1MM6 A;  3FJG A;  4PCD A;  4PET A;  4P11 A;  3U94 A;  1CNQ A;  1UIU A;  1FQC A;  4I1D A;  4NF5 A;  2NOO A;  3K6W A;  2F6G A;  4PBQ A;  3IFC A;  3EQ1 A;  3E79 A;  4AS4 A;  2O1M A;  4ZEI A;  2V4C A;  2ANJ A;  3V89 B;  2F6P A;  4MIJ A;  2F7C A;  5TPA B;  3FVO A;  3A3U A;  1IUD A;  3C9H A;  3FV1 A;  4IB2 A;  1P1U A;  5IZ1 A;  2IA4 A;  2WBB A;  4P0I A;  3FVK A;  5EHS A;  4LZ5 A;  2JJK A;  4OFO A;  1UTH B;  1FQD A;  2PBW A;  1L5T A;  3VVE A;  1N84 A;  2RIN A;  3FGS A;  3T9X B;  1PC3 A;  2O1L A;  5EYH A;  1JEV A;  1JVX A;  3K4U A;  4XFE A;  3ILT B;  3M3F A;  1IIW A;  2V3T A;  5AE4 A;  1IXC A;  5FTI A;  3C31 A;  1B46 A;  4N6P A;  3VLW A;  3KFM A;  3KZG A;  4EXK A;  5H8N A;  4WKM A;  1FPD A;  4EF1 A;  2AL4 A;  1N3X A;  5TU0 A;  3HV1 A;  3N6T A;  4U1Z A;  4F22 A;  1N0T A;  3TTN A;  3RTF B;  1QKA A;  1XVX A;  3S4U A;  4LQ5 A;  4F3G A;  1K9Y A;  3K02 A;  5EYG A;  1II5 A;  2HAV A;  4QSD A;  1FCK A;  4OVS A;  5H8S A;  4P56 A;  2O84 X;  3IJO B;  1N3W A;  3HFU A;  5DTB A;  1Z7M E;  3KN3 A;  3S9N C;  1MXZ A;  2R71 A;  2F8D A;  1URS A;  4L17 A;  2Q2C A;  4R9G A;  4YU0 A;  4MLV A;  3O9P A;  3Q25 A;  1ELJ A;  5FHN A;  3MP1 A;  4DLD A;  4I9D A;  2QPQ A;  1LEV A;  3KBZ A;  3MJN A;  2FHY A;  3O6H A;  4Q0C A;  5ET8 A;  2B4M A;  4ZS9 A;  1LBY A;  2CZH A;  4MX6 A;  4QF9 A;  1B5I A;  2G29 A;  3KJT A;  4R74 A;  3G7W A;  1Z7N E;  1GTK A;  4P9K A;  2HPG A;  3HO7 A;  2DVZ A;  4QFP A;  1BK4 A;  3CHG A;  2FA7 A;  1OQG A;  2ZYN A;  4FE8 A;  2WKY A;  1US5 A;  1R9Q A;  4P0G A;  3RYD A;  4F1V A;  3RT8 A;  2GHB A;  2ZNU A;  4LN5 A;  2V84 A;  3HST A;  2V25 A;  1Q35 A;  1LBB A;  1YAE A;  1QUK A;  4KQP A;  1R6Z A;  1FPB A;  3VV5 A;  2DSF A;  1UIV A;  3A09 A;  2UVH A;  5EQ8 A;  1LB9 A;  5ESY A;  1B52 A;  1Y1M A;  3K1P A;  5EQ9 A;  4RJZ A;  2WYP A;  1LFI A;  1DCU A;  1MH3 A;  1YPN A;  4GRK A;  2XXQ A;  5CC2 A;  1QGX A;  2QSX A;  1S50 A;  3MWB A;  1B3G A;  1B9J A;  4PC9 A;  2H98 A;  5JK4 A;  1VSO A;  1USY H;  1N76 A;  2XXX A;  2G93 A;  3TOD A;  5H8F B;  1NV1 A;  4OVR A;  3KN7 A;  1FRP A;  4GOT A;  3HHF A;  5CMM A;  1CB6 A;  3B8B A;  3UOR A;  4TQU Q;  4NMY A;  1IXG A;  2DE2 A;  3C4M A;  1Y4C A;  1MXV A;  1LGB C;  1Y9U A;  4DI4 B;  4EXL A;  4NQ8 A;  1PBP A;  4G2Z A;  4QFO A;  4OZ9 A;  1FW0 A;  1BIY A;  1POY 1;  2F97 A;  2Y7I A;  4ESW A;  1LAX A;  1B51 A;  5K2Y A;  2NWJ A;  3N94 A;  1ZU0 A;  3H3G A;  3PV0 E;  1NV0 A;  2O6A A;  1FPF A;  4GQO A;  3FD3 A;  4THI A;  1A8E A;  2Z22 A;  4XXU A;  1FBE A;  5ET5 A;  3V5A A;  2VHA A;  1FPK A;  1QW0 A;  4XIG Q;  1B0H A;  3H6U A;  4RYA A;  3QYT A;  3OXN A;  4P8B A;  3IB1 A;  4F3B A;  3K6V A;  2ZNS A;  1TWY A;  2XHD A;  5BUU A;  5ET6 A;  3BFT A;  1MS7 A;  2UVG A;  1NV6 A;  5KCJ A;  1DTZ A;  4OMB A;  4HE0 A;  1XOC A;  3DEL B;  5TPA A;  1EU8 A;  2FIE A;  1A7L A;  3IL1 B;  4DXB A;  4PAI A;  4RPO A;  3K6X A;  4YMB A;  2B65 A;  5DVF A;  4PFB A;  4MFI A;  4UAB A;  2XD3 A;  3E13 X;  5KZT A;  1UTH A;  3IB2 A;  2ZZX A;  1B7Z A;  2DWA A;  1FJ6 A;  1O7T A;  4RXL A;  1B5H A;  3T9H B;  4GX4 A;  1LFG A;  2ALU A;  2QL3 A;  4R6H A;  3U92 A;  4IY6 A;  3T93 B;  2I58 A;  1EYI A;  5L8D A;  4KFQ A;  2OZZ A;  4OQO A;  4GWW A;  2VD2 A;  2P3V A;  5LTC A;  3IOU A;  4LON B;  3ZSF A;  4BLA A;  2XXW A;  4GWZ A;  1M5E A;  4NF4 A;  3PMW A;  1M5B A;  4G68 A;  5FTH A;  2GHA A;  4DE8 A;  1IXH A;  3RT6 B;  4HCW A;  2XD2 A;  3Q27 A;  1RYO A;  1QKB A;  1MPD A;  5ICT A;  4I8C A;  2I3W A;  1Q1K A;  1OVB A;  2OWZ A;  2CEX A;  4H8J A;  4X48 A;  4BDR A;  4GIZ A;  1MPB A;  1AL3 A;  2DXR A;  1NFT A;  4POX A;  4JBZ A;  4F1Y A;  1H3D A;  2PVU A;  3U65 A;  2A5S A;  1LFH A;  4EQB A;  4PFT A;  1RKM A;  3LSL A;  4OA4 A;  4HS7 A;  3S9L C;  4YKI A;  1SDX A;  1KWH A;  2F3B A;  1EH3 A;  1JEU A;  1FTO A;  1FBF A;  3SKP A;  1TT1 A;  2YPN A;  4EF2 A;  1B3E A;  3SEX A;  4DIG A;  3MAM A;  4AB6 A;  4JWO A;  1MY4 A;  3EPE A;  3T1B A;  2QFL A;  1Q9D A;  1AIV A;  1B4H A;  1IMB A;  4GX3 A;  2Q89 A;  5H8H B;  3KC0 A;  2W7Y A;  4BDO A;  5I59 B;  5EHM A;  2B3F A;  3H06 B;  5DYH A;  3PMX A;  4N6D A;  4OHN A;  4XTC Q;  2QMX A;  3VFJ A;  3S2V A;  2H25 A;  1LBW A;  3SER A;  1H45 A;  1R1N A;  1OMP A;  1SVX B;  2LAO A;  3LR1 A;  2QVV A;  5ET7 A;  3D4G A;  2ZYK A;  3USD A;  2UVJ A;  2VP1 A;  5A5X B;  3LV0 A;  4GXA A;  3HCQ A;  1YYZ A;  2UYE A;  3R6U A;  3TDJ A;  5M2V A;  1MDP 1;  1BP5 A;  4KCD A;  4F3S A;  4PFY A;  3HPI A;  1GR2 A;  1MDQ A;  5DT6 A;  1LAF E;  5I2N B;  2B3B A;  3F11 A;  1QUI A;  3CSG A;  4R72 A;  2GRV A;  2YJP A;  1SYI A;  4GL8 A;  3V8X B;  2OBG A;  1WOD A;  3JZJ A;  3GBB A;  3MVY A; 
#chains in the Genus database with same CATH homology
 3OO8 A;  4JWX A;  4KCC A;  2RC8 A;  1VE4 A;  2Z8E A;  4G4P A;  3KGC A;  3TPA A;  1O64 A;  1URG A;  4UAC A;  1O63 A;  5ISU A;  3QK6 A;  5I57 B;  1YCJ A;  2QJE A;  4U2R A;  3TYH A;  4ZZA A;  1XVY A;  4R2F A;  4WXJ A;  4RY1 A;  5H8Q B;  4G8H A;  3OEM A;  4H67 A;  2YLN A;  3MVX A;  2AIX A;  3CSB A;  5CBR A;  4NF6 B;  2OWS A;  3SEV A;  1R9L A;  5CMB A;  4NE4 A;  3TAJ A;  1IIT A;  3TCH A;  2VGQ A;  1NNT A;  3RUM A;  4N07 A;  2PT1 A;  4ND9 A;  5HBC A;  3QUF A;  2V93 A;  1FQA A;  4R73 A;  1I6A A;  3O66 A;  3K1N A;  3THI A;  1N04 A;  1PDA A;  2XXR A;  3R7X A;  2BJJ X;  3PMV A;  3MW0 A;  1SD3 A;  4OES A;  2XXP A;  3TCG A;  3OMB A;  3K6U A;  4HCY A;  3RTW B;  1MQI A;  5JTY B;  3FZV A;  3PGF A;  3TQW A;  5DEX B;  4KD5 A;  3C34 A;  1SW4 A;  2X7Q A;  4NF8 B;  3VLV A;  2O7I A;  1QUJ A;  3T9U A;  2HXW A;  3DLN A;  2P0S A;  3QSL A;  3OEK A;  1ZJL A;  5B7D A;  3OSQ A;  3K0V A;  3TTM A;  2REG A;  2FNC A;  2I4B A;  4XKQ A;  3LSW A;  5L9M A;  2RCB A;  5ITO A;  4E0W A;  4U4X A;  1FTL A;  3SEU A;  3ILU B;  1MY3 A;  2REJ A;  5CRY A;  1B7U A;  4OFL A;  4OER A;  2V3U A;  1SW5 A;  2F34 A;  3MP6 A;  1OIB A;  1FQE A;  1PB8 A;  3U93 A;  4BDM A;  1UTB B;  4FEC A;  2I49 A;  2NUV A;  3MVW A;  3HHG A;  1AH5 A;  2ZYM A;  1WVJ A;  4FJP A;  2DOJ A;  4OFJ A;  2HCA A;  1I6Q A;  4QFN A;  1DTG A;  4PE5 B;  1MXU A;  3TKD A;  2ZYO A;  3B6T A;  4GXS B;  4LA9 A;  3ONM A;  3KSJ A;  4H8I A;  4ZEB A;  4F2Q A;  3U72 A;  3TTL A;  5H8H A;  5I2K A;  1B7H A;  5I59 A;  2Q88 A;  1F9B A;  3FUZ A;  4TLM B;  1MPC A;  3KEI A;  1XT8 A;  1VFE A;  3RN8 A;  4ZE9 A;  3B7D A;  1LST A;  1ZBM A;  5FHO A;  2H99 A;  4Q8R A;  4F3P A;  2XX9 A;  1NNP A;  4ESX A;  4IO7 A;  2H9B A;  4RPN A;  3VXC A;  3ODB A;  5L9O A;  1MH4 A;  3KOS A;  2PMS A;  1LCT A;  5A5X A;  3EHS A;  3MPK A;  4C0R A;  3CFZ A;  4ISU A;  2F36 A;  4KYD A;  1B5J A;  1B3H A;  1MQD A;  4ZZE A;  3SEY A;  5TP9 A;  4ELO A;  1Y20 A;  1GV8 A;  5CMK A;  3TEP A;  1A8F A;  3B6Q A;  2A5T B;  4YB6 A;  4NED A;  1MXX A;  2CZL A;  3FJ7 A;  3PPR A;  1EZP A;  3CG3 A;  4IGR A;  4XKN A;  5ELV A;  3G3H A;  4AQ4 A;  3Q26 A;  1XHY A;  1POT A;  3L6H A;  4WED A;  1FTK A;  2DWI A;  3TCF A;  2PT2 A;  2DVC A;  2HZL A;  3MP8 A;  1OQH A;  3SET A;  4PQJ A;  3UK4 A;  4OET A;  5IAI A;  5I57 A;  4ONY A;  3O28 A;  4H5G A;  3KBR A;  4YMA A;  3PD8 A;  1JNF A;  5H8Q A;  3O2A A;  1MQJ A;  1FTM A;  5J1D A;  5KDT B;  4NF6 A;  4MLQ A;  1D4N A;  4LQ2 A;  2F5X A;  2RKM A;  5HM4 B;  3CG1 A;  1B3F A;  3O6G A;  3MVZ A;  2UXA A;  5BWJ A;  3K2D A;  3RY3 A;  4DXU A;  3GZG A;  4EQ9 A;  2DS9 A;  2PYY A;  4YB5 A;  5LOM A;  2GH9 A;  3DP6 A;  1H43 A;  2HZK A;  1YTV A;  2CMO A;  1Y3P A;  3N26 A;  5AA1 A;  1TFD A;  1BKA A;  1PB7 A;  2I48 A;  4ZEF A;  5JTY A;  2Z8D A;  2D5W A;  4F29 A;  3TMG A;  5DEX A;  4OEV A;  2O68 A;  3KOT A;  4IY5 A;  3MZ1 A;  3WAE A;  2E0S A;  2ZXT A;  1GGG A;  2M8C A;  4FED A;  4R9F A;  3IOW A;  1JQF A;  2I4C A;  4QFK A;  3H6W A;  3QAX A;  1ZTY A;  4H0W A;  4IO4 A;  1IEJ A;  3H03 A;  3CVG A;  3C32 A;  1B6H A;  1A99 A;  2THI A;  4IO6 A;  4QRZ A;  4GD5 A;  2HFB A;  3TUS A;  3RPW A;  3B6W A;  4IO5 A;  4NWD A;  3I3V A;  3RLF E;  3CRB A;  3RQT A;  1S9T A;  3JV9 A;  2FYI A;  2RCA A;  5AA4 B;  3OOA A;  3C36 A;  4QFL A;  3OEL A;  4ZDM A;  1UTB A;  5DVI A;  1T0K A;  1NNF A;  4YZZ A;  4ZE8 A;  3LSX A;  3DP8 A;  1B05 A;  4M4G A;  3CR9 A;  2XXU A;  4UA8 A;  2ONK E;  3FVN A;  4TOZ A;  1I6B A;  1DOT A;  3I5O A;  3EF7 A;  2HEU A;  5AA2 B;  3IB0 A;  5I58 B;  2NXO A;  1A40 A;  1P1W A;  3H6T A;  3FAT A;  2ZMB A;  2DQV A;  4ZEC A;  3D4C A;  3FXR A;  2ONR A;  4FAT A;  5AA2 D;  4JDF A;  1HSL A;  3I6V A;  3GBA A;  1B4Z A;  2DYX A;  1ZLQ A;  3G3G A;  4Q5T A;  1P1N A;  2I3V A;  3MC2 A;  2KLF A;  3E4R A;  3UA8 A;  3MPL A;  1IZ1 A;  1D9Y A;  2DWH A;  3IOR A;  2XXI A;  5FHM A;  2R6G E;  4ECF A;  1TXF A;  3PUX E;  1SYH A;  1AMF A;  4U21 A;  4LP2 B;  1DPE A;  4PFW A;  4R75 A;  5H8F A;  1LLS A;  3FVG A;  2A5T A;  4EQ7 A;  1ANF A;  4OEU A;  2UVI A;  4LZ8 A;  1MXW A;  2HAU A;  3O29 A;  3AXF A;  1XC1 A;  4H65 A;  4GWO A;  3M3K A;  2OK2 A;  3IR1 A;  3U8Q A;  2XXV A;  2H5Y A;  4NTL A;  2Q9T A;  4QSE A;  2DWJ A;  4AB5 A;  1NL5 A;  4POW A;  2OWT A;  2Q2A A;  1A54 A;  4RK2 A;  3PD9 A;  1P99 A;  2DE4 A;  3G3K A;  4U1O A;  3Q28 A;  3R26 A;  4YB7 A;  3ECR A;  5I84 A;  4IO2 A;  4H6D A;  3KJ7 A;  3UP9 A;  2ONS A;  4F39 A;  1HSE A;  4LZ7 A;  2DE3 A;  3C33 A;  1DSN A;  1B32 A;  1M5D A;  2DP8 A;  4OVJ A;  1RYX A;  3H4Z A;  4LAT A;  3IX1 A;  3EN3 A;  5JEI A;  3PPO A;  3TZA A;  1B58 A;  4G68 C;  5KCJ B;  4KYE A;  4WEP A;  4FEB A;  5F1Q A;  4O3A A;  2Y84 A;  1I69 A;  3P7I A;  4Q30 B;  2OLB A;  2RC7 A;  4R2B A;  3G3J A;  4O3B A;  3MBP A;  4YKJ A;  1OLA A;  3C35 A;  1S7Y A;  5ITP A;  1M5F A;  3T9V A;  4YIC A;  1SQY A;  1ZMG A;  1DMB A;  4OXV A;  3DP4 A;  4U4S A;  5CMC A;  4EDP A;  3ZS6 A;  1BTJ A;  1FTJ A;  4NF4 B;  1QVS A;  1FQB A;  3BKI B;  4G68 B;  1B1H A;  3EHU A;  5CM6 A;  1M5C A;  1NKX A;  2ZNT A;  3O6I A;  4KYS A;  1SW1 A;  3FV2 A;  5AA4 A;  1Y1Z A;  1P1O A;  4DCY A;  4TLL B;  3E9X A;  5F7V A;  4ZEK A;  3RGY A;  1N7W A;  1MXY A;  3CIJ A;  3QXM A;  4Z0I A;  5EYF A;  3CFX A;  1OLC A;  1D9V A;  2GFE A;  1NMU A;  1P1Q A;  3FAS A;  3T22 A;  4BDL A;  4RK9 A;  4NWC A;  5AA2 A;  3OSR A;  3BFU A;  1ZIU A;  5I58 A;  1SI0 A;  2QRY A;  3IO6 A;  4LVQ A;  4E0X A;  1MG1 A;  2VD3 A;  3SEW A;  2O51 A;  2OCU A;  3OO9 A;  3IO4 A;  5B70 A;  1IXI A;  4QSC A;  4MH5 A;  1EZ9 A;  1NNK A;  3IAZ A;  3UGW A;  1H44 A;  1XS5 A;  4ELR A;  3HN0 A;  3PU5 A;  4H5F A;  1PB9 A;  2DXY A;  5I2N A;  3VE1 B;  1NH7 A;  5K2X A;  3SDF A;  3H6V A;  2RF1 A;  4YAH X;  4MF3 A;  3BBR A;  4F31 B;  3LBS A;  5HPQ A;  3KN8 A;  4I62 A;  4JSO A;  5I56 B;  1OVT A;  1QUL A;  2XXH A;  5IKB A;  5DVJ A;  1QJM A;  2IEE A;  2F7A A;  3LSF B;  5ICQ A;  1GVC A;  2O69 A;  4F1U A;  3VVD A;  1D3K A;  2F78 A;  2NVU B;  1AOV A;  2Y7P A;  3ZKL A;  3H7M A;  1WDN A;  1JW1 A;  4FOR A;  2RC9 A;  3OEN A;  4GFR A;  1JET A;  3N6U A;  3U1O A;  3M3L A;  4DXC A;  5L9S A;  1LCF A;  1J1N A;  1NH8 A;  1EZO A;  3QUJ A;  1SI1 A;  1H76 A;  3FXQ A;  1JW5 A;  1MRP A;  1SW2 A;  3S9E A;  3UN6 A;  3IK6 B;  2I0B A;  4QHQ A;  3RNN A;  2VOZ A;  3GLB A;  3W9W A;  3VLU A;  2P1S A;  3KSX A;  4NF5 B;  4MBP A;  2QS4 A;  1N7X A;  1MM7 A;  2UYF A;  3IOV A;  2Z23 A;  1SBP A;  3QIM A;  3MZ9 A;  1PBQ A;  4C1U A;  4X1D A;  3PUZ E;  2Z8F A;  4BDQ A;  4O3C A;  1MQG A;  4PFU A;  2ESN A;  1VFD A;  2P2A A;  1VR5 A;  4N13 A;  3Q29 A;  4RA1 A;  4XKP A;  1FQF A;  4EUO A;  3VDF A;  2Y7R A;  1B3L A;  4M1V A;  1B1X A;  3PUV E;  4NF8 A;  3PUW E;  2I0C A;  4DCX A;  1LAH E;  2Y7W A;  3V83 A;  4F19 A;  3CI8 A;  3G3I A;  4DZ1 A;  1MQH A;  3TEL A;  4G8N A;  1DPP A;  3IOT A;  3CFL A;  4OWD A;  4HW8 A;  3KG2 A;  3PUY E;  2QS2 A;  3WAF A;  1CE2 A;  3MQ9 A;  4YKK A;  1Y3N A;  5H8N B;  4JXI A;  4ZED A;  3W15 C;  1URD A;  3TTR A;  1Y3Q A;  4OEN A;  2H4I A;  3T96 B;  1B40 A;  1JW4 A;  3OO6 A;  3K00 A;  2AL5 A;  1USY E;  3FIR A;  4ELP A;  4R6K A;  2X7P A;  4IGT A;  1BLF A;  2HQ0 A;  2D21 A;  3S9M C;  1UQW A;  3K01 A;  3G3F A;  3GXA A;  4U23 A;  3PPP A;  2XXY A;  3ZKK A;  4GL0 A;  3PPQ A;  3W9V A;  4FAJ A;  1A55 A;  2F35 A;  2XX7 A;  1LB8 A;  3TTK A;  2QS1 A;  3UIF A;  2Q8J A;  3T66 A;  4KHZ E;  5CI5 A;  5CBS A;  3A3C A;  1PEB A;  4FIM A;  4PP0 A;  3JYR A;  3DM0 A;  3O97 A;  3VVF A;  2X26 A;  4KI0 E;  1IQ7 A;  1LBC A;  3EHT A;  2XX8 A;  4JSD A;  4F18 A;  3MZB A;  4K3F A;  2I6E A;  4BDN A;  3SES A;  1LAG E;  3E3K A;  4F2O A;  5I2K B;  4Z7E A;  4R6Y A;  4JWY A;  2F7B A;  4ELQ A;  4DDD A;  4X1B A;  4GF8 A;  4KPT A;  1JVY A;  3VXB A;  4OYV A;  3K1M A;  2AYS A;  2D3I A;  2XXT A;  1US4 A;  2E1S A;  4X9T A;  4C1T A;  1ATG A;  5I56 A;  1MY1 A;  1MY0 A;  2Y7K A;  2ABH A;  1B0L A;  4KR5 A;  1B2H A;  4XKR A;  4G77 A;  3FJM A;  1ZKB A;  5TP9 B;  4YKP A;  3MUQ A;  3OD7 A;  4IO3 A;  3M8U A;  2PX1 A;  3OO7 A;  4JB7 A;  3FXU A;  3LC8 A;  1Y4T A;  1TFA A;  2QS3 A;  3N5L A;  4U22 A;  3L6G A;  2O7U A;  3TQL A;  3IJX B;  4G8M A;  4GLI A;  4HTG A;  2OJT A;  3TFL A;  2R9J A;  5KDT A;  4RNS A;  2V3Q A;  2QMW A;  3PPN A;  1HSJ A;  1MY2 A;  4H1X A;  4GVO A;  3LUY A;  4LUB A;  5AA3 A;  4OTE A;  1MM6 A;  3FJG A;  4PET A;  4P11 A;  3U94 A;  1UIU A;  1FQC A;  4I1D A;  4NF5 A;  2NOO A;  3K6W A;  2F6G A;  3EQ1 A;  2O1M A;  4ZEI A;  2ANJ A;  3V89 B;  2F6P A;  2F7C A;  5TPA B;  3FVO A;  3A3U A;  1IUD A;  3C9H A;  3FV1 A;  4IB2 A;  1P1U A;  2IA4 A;  4P0I A;  3FVK A;  5EHS A;  4LZ5 A;  4OFO A;  1UTH B;  1FQD A;  2PBW A;  1L5T A;  3VVE A;  1N84 A;  2RIN A;  3FGS A;  3T9X B;  1PC3 A;  2O1L A;  1JEV A;  1JVX A;  3K4U A;  3ILT B;  3M3F A;  1IIW A;  2V3T A;  5AE4 A;  1IXC A;  5FTI A;  3C31 A;  1B46 A;  4N6P A;  3VLW A;  3KFM A;  3KZG A;  4EXK A;  5H8N A;  4WKM A;  4EF1 A;  2AL4 A;  1N3X A;  5TU0 A;  3HV1 A;  3N6T A;  4U1Z A;  4F22 A;  1N0T A;  3TTN A;  3RTF B;  1QKA A;  1XVX A;  3S4U A;  4LQ5 A;  4F3G A;  3K02 A;  1II5 A;  2HAV A;  4QSD A;  1FCK A;  5H8S A;  2O84 X;  3IJO B;  1N3W A;  5DTB A;  1Z7M E;  3KN3 A;  3S9N C;  1MXZ A;  2R71 A;  2F8D A;  1URS A;  4L17 A;  2Q2C A;  4R9G A;  4YU0 A;  4MLV A;  3O9P A;  3Q25 A;  1ELJ A;  5FHN A;  3MP1 A;  4DLD A;  4I9D A;  2QPQ A;  3MJN A;  3O6H A;  4Q0C A;  4ZS9 A;  4QF9 A;  1B5I A;  2G29 A;  3KJT A;  4R74 A;  3G7W A;  1Z7N E;  1GTK A;  3HO7 A;  2DVZ A;  4QFP A;  2FA7 A;  1OQG A;  2ZYN A;  4FE8 A;  2WKY A;  1US5 A;  1R9Q A;  4P0G A;  4F1V A;  3RT8 A;  2GHB A;  2ZNU A;  2V84 A;  3HST A;  2V25 A;  1Q35 A;  1LBB A;  1YAE A;  1QUK A;  4KQP A;  1R6Z A;  3VV5 A;  2DSF A;  1UIV A;  3A09 A;  2UVH A;  1LB9 A;  1B52 A;  1Y1M A;  3K1P A;  4RJZ A;  1LFI A;  1MH3 A;  1YPN A;  4GRK A;  2XXQ A;  5CC2 A;  2QSX A;  1S50 A;  3MWB A;  1B3G A;  1B9J A;  2H98 A;  5JK4 A;  1VSO A;  1USY H;  1N76 A;  2XXX A;  2G93 A;  3TOD A;  5H8F B;  3KN7 A;  4GOT A;  3HHF A;  5CMM A;  1CB6 A;  3UOR A;  4TQU Q;  4NMY A;  1IXG A;  2DE2 A;  3C4M A;  1Y4C A;  1MXV A;  1LGB C;  1Y9U A;  4EXL A;  1PBP A;  4G2Z A;  4QFO A;  4OZ9 A;  1FW0 A;  1BIY A;  1POY 1;  2F97 A;  2Y7I A;  4ESW A;  1LAX A;  1B51 A;  5K2Y A;  2NWJ A;  3N94 A;  1ZU0 A;  3H3G A;  3PV0 E;  2O6A A;  4GQO A;  3FD3 A;  4THI A;  1A8E A;  2Z22 A;  4XXU A;  3V5A A;  2VHA A;  1QW0 A;  4XIG Q;  1B0H A;  3H6U A;  4RYA A;  3QYT A;  3OXN A;  3IB1 A;  4F3B A;  3K6V A;  2ZNS A;  1TWY A;  2XHD A;  5BUU A;  3BFT A;  1MS7 A;  2UVG A;  5KCJ A;  1DTZ A;  4OMB A;  1XOC A;  3DEL B;  5TPA A;  1EU8 A;  1A7L A;  3IL1 B;  4DXB A;  4RPO A;  3K6X A;  4YMB A;  2B65 A;  5DVF A;  4MFI A;  2XD3 A;  3E13 X;  5KZT A;  1UTH A;  3IB2 A;  1B7Z A;  2DWA A;  1O7T A;  4RXL A;  1B5H A;  3T9H B;  1LFG A;  2ALU A;  2QL3 A;  4R6H A;  3U92 A;  4IY6 A;  3T93 B;  2I58 A;  5L8D A;  4KFQ A;  2OZZ A;  4OQO A;  2VD2 A;  3IOU A;  4LON B;  3ZSF A;  4BLA A;  2XXW A;  1M5E A;  4NF4 A;  3PMW A;  1M5B A;  4G68 A;  5FTH A;  2GHA A;  4DE8 A;  1IXH A;  3RT6 B;  4HCW A;  2XD2 A;  3Q27 A;  1RYO A;  1QKB A;  1MPD A;  5ICT A;  4I8C A;  2I3W A;  1Q1K A;  1OVB A;  4H8J A;  4X48 A;  4BDR A;  4GIZ A;  1MPB A;  1AL3 A;  2DXR A;  1NFT A;  4POX A;  4JBZ A;  4F1Y A;  1H3D A;  2PVU A;  2A5S A;  1LFH A;  4EQB A;  4PFT A;  1RKM A;  3LSL A;  4HS7 A;  3S9L C;  4YKI A;  1SDX A;  1KWH A;  1EH3 A;  1JEU A;  1FTO A;  3SKP A;  1TT1 A;  2YPN A;  4EF2 A;  1B3E A;  3SEX A;  4DIG A;  3MAM A;  4AB6 A;  1MY4 A;  4JWO A;  3EPE A;  1AIV A;  1B4H A;  2Q89 A;  5H8H B;  2W7Y A;  4BDO A;  5I59 B;  5EHM A;  2B3F A;  3H06 B;  5DYH A;  3PMX A;  4OHN A;  4XTC Q;  2QMX A;  3VFJ A;  3S2V A;  2H25 A;  3SER A;  1H45 A;  1R1N A;  1OMP A;  1SVX B;  2LAO A;  3LR1 A;  3D4G A;  2ZYK A;  3USD A;  2UVJ A;  2VP1 A;  5A5X B;  4GXA A;  3HCQ A;  2UYE A;  3R6U A;  3TDJ A;  5M2V A;  1MDP 1;  1BP5 A;  4KCD A;  4F3S A;  4PFY A;  5DT6 A;  3HPI A;  1GR2 A;  1MDQ A;  1LAF E;  5I2N B;  2B3B A;  3F11 A;  1QUI A;  3CSG A;  4R72 A;  2GRV A;  2YJP A;  1SYI A;  4GL8 A;  3V8X B;  2OBG A;  1WOD A;  3JZJ A;  3GBB A;  3MVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...