4IO5A

Crystal structure of the avglur1 ligand binding domain complex with alanine at 1.72 angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
248
structure length
242
Chain Sequence
GSARLKGITLRIGVIESVPFTIVANVNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
molecule tags Membrane protein
molecule keywords AvGluR1 ligand binding domain
total genus 75
structure length 242
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io5A02
3P7IA 1S9TA 2QS2A 4TOZA 3KJ7A 4JB7A 1KWHA 4RK2A 3CSBA 4NEDA 3TFLA 2O69A 4OXVA 2DYXA 3IOTA 4PFTA 4U4SA 1FTMA 3PMVA 4NMYA 1MXXA 3CSGA 4RYAA 2DOJA 3Q29A 2I58A 5I59B 4F1VA 4ZZEA 3T22A 5H8QB 1B05A 2UVGA 1GV8A 2OCUA 3K6UA 5TU0A 3T9UA 4HW8A 2RCAA 4FAJA 5ITPA 4RA1A 2QJEA 3C33A 3BFUA 2QPQA 2ZYMA 3TKDA 2F6PA 2OWSA 4ELQA 1EH3A 1MQJA 1SW1A 3A3CA 2H25A 3KOSA 3H6VA 3PGFA 5FHMA 3FVNA 1H43A 3IOVA 4H67A 4R6YA 2HQ0A 2H4IA 3G3IA 4BDMA 1SYIA 2I4CA 5DVJA 1MH4A 4OVJA 2V3TA 5BWJA 4ND9A 4WEPA 3OD7A 4NF8A 1LFGA 1R1NA 1RKMA 4NF5B 3O29A 2XXXA 1DTZA 3IOWA 4G4PA 4GXAA 3VXBA 2X26A 3PPRA 3PPPA 3ZKLA 4DZ1A 3JZJA 1ZU0A 4DDDA 1EZPA 4G8HA 1LAHE 3K02A 3QUFA 4GXSB 5LOMA 4R72A 4MLQA 3ZSFA 3HO7A 2P2AA 1AMFA 2X7QA 1ZBMA 2Y7KA 4FORA 3Q28A 1N7WA 4EF2A 3LUYA 5JTYA 3RPWA 5H8SA 1UIUA 1B3GA 1DPPA 1Z7ME 1HSEA 4NF6A 4U4XA 2HZLA 4DXCA 4F39A 5KCJB 3QXMA 4ELPA 3S9EA 1SQYA 4UA8A 3PUXE 2I4BA 1EU8A 4PFWA 4GVOA 4O3BA 5TPAA 4RJZA 1GGGA 1LAFE 1QJMA 2RC8A 1LAGE 3KJTA 1I6BA 3C9HA 2RKMA 2XX8A 2Y84A 2D21A 1II5A 3M8UA 4NWDA 5EHMA 3TPAA 4EQ9A 1D9VA 3I5OA 2QL3A 5DEXA 1LB9A 1ELJA 4LQ5A 2V3QA 2OZZA 3KSJA 2O1LA 3IORA 1WDNA 3O2AA 4KFQA 4OERA 2DXYA 5ITOA 2CZLA 1NNPA 1TXFA 3M3LA 1CB6A 4IY5A 3C31A 3E4RA 4IO2A 4R73A 3VLVA 5F7VA 1IIWA 1WVJA 3O9PA 1B6HA 3OO6A 3S2VA 4OHNA 3H6TA 1NH8A 5DEXB 4ZE9A 4GL0A 1A8FA 5IAIA 1IUDA 4GWOA 3N6TA 3OXNA 1LFIA 1OIBA 2B3BA 3FZVA 2AIXA 2HZKA 2D5WA 4KHZE 1MQDA 2KLFA 4IO7A 3QAXA 4U22A 4YKJA 5CI5A 4G77A 4HCWA 5EYFA 4F1YA 3PU5A 2NUVA 4I8CA 4GRKA 4X1DA 3U93A 1LSTA 1PBPA 3OOAA 1AL3A 1B51A 2XXUA 4GD5A 5I57A 3QK6A 3PUZE 2H5YA 1VR5A 2ZYNA 1DSNA 4JXIA 5AA3A 1B7UA 2O84X 1ZTYA 3K4UA 3S9LC 4NF5A 4OQOA 4QSCA 3KN3A 5I2NB 4OFJA 2DP8A 1MM7A 4R75A 1LGBC 3SEUA 3C4MA 4RNSA 1MXYA 3QIMA 3EHUA 4G68C 5JEIA 1XC1A 2THIA 1B9JA 3OEKA 4U23A 4TLLB 5CMBA 2ESNA 1AOVA 2GH9A 3IR1A 1N7XA 2Z8FA 2ONSA 3IB1A 1MG1A 2IEEA 2VGQA 3IX1A 5TPAB 5KDTB 3KN7A 4QFLA 1L5TA 3MVXA 3R6UA 1USYE 2QRYA 5F1QA 4F3GA 1D3KA 1VE4A 2VD3A 4G2ZA 1N0TA 4R74A 2R9JA 3EQ1A 3W15C 1B0LA 4ZEDA 2QSXA 1M5DA 1UIVA 2A5TB 3MJNA 4M4GA 5ICTA 1PDAA 2E1SA 3D4GA 1XT8A 4KCDA 5L8DA 3TCGA 1UTHB 3W9WA 1IXIA 1N84A 4OFLA 3O66A 4QSDA 4WKMA 4LVQA 1IXCA 4R6KA 4YMAA 1B4HA 3OO7A 4ZZAA 4IO4A 4NF4B 1MQGA 2F36A 3OO8A 1QW0A 2VOZA 1IZ1A 1JETA 2OBGA 3E9XA 1MPBA 3MP8A 3MWBA 3O6HA 3ODBA 4X9TA 1P1UA 1WODA 4OFOA 3QSLA 5IKBA 4YB5A 4H5FA 2Q8JA 3TAJA 1N3XA 1QUKA 4ZS9A 1B7HA 1D4NA 1J1NA 3PMXA 3RGYA 5I56B 1YCJA 2DVZA 3T9VA 2ONRA 3TEPA 4RY1A 4BDQA 3UGWA 1DOTA 2DWIA 2Q88A 3C32A 4KI0E 4X48A 2HXWA 5FTHA 2PX1A 2XXHA 4ZEIA 1B1HA 1URSA 4TLMB 1UQWA 5H8FA 3GBBA 2O51A 4FIMA 1M5EA 4MH5A 5CBRA 4ESWA 2XX7A 2HAVA 1Q35A 3TQWA 4KYDA 2F78A 3I3VA 2HAUA 1IQ7A 1I69A 4OWDA 3FVGA 5DVIA 4F22A 4YMBA 3H03A 1MXUA 2Z23A 3IJOB 3Q27A 4IGTA 1ZMGA 3O97A 3TTRA 4BDOA 4AQ4A 4LQ2A 4U21A 4Q30B 3K6XA 4H8IA 3PD9A 1H45A 1SW5A 2XXYA 4IO5A 1GVCA 1RYXA 3DP6A 1PEBA 3G3HA 3R7XA 3BFTA 1N04A 3DELB 2AYSA 2QS4A 4QFOA 3FD3A 3DM0A 4ISUA 4U2RA 4XTCQ 3SEVA 2F7AA 1A7LA 2Z22A 1DPEA 1R6ZA 3A3UA 5H8NA 3WAFA 3RY3A 4AB5A 4DCYA 2VP1A 5I58B 1SW4A 1PB7A 4KD5A 1FTJA 4P0GA 4FATA 2PVUA 4DIGA 2H99A 4RXLA 4OEUA 1FQCA 2YLNA 3H06B 4Q5TA 4BDNA 5AA4B 2G29A 5AE4A 3U8QA 5CM6A 2AL5A 2XXRA 3VV5A 3N94A 4JDFA 4QSEA 1H76A 2Q2CA 2ZNTA 5DVFA 3K0VA 4R9GA 2F35A 1B3HA 1IITA 5HPQA 4KPTA 1LLSA 1NMUA 1Q1KA 1B3FA 2V25A 2ZYOA 3MZ9A 4I62A 4NE4A 4EF1A 1QUIA 2ONKE 3G3KA 2DWAA 1JNFA 1Y4CA 5M2VA 2Y7IA 4F3SA 1B3EA 1Y3NA 1BP5A 4BLAA 2ALUA 1MXZA 2V93A 3HSTA 3KSXA 2F97A 1B4ZA 1DTGA 3PD8A 2Q9TA 1FTLA 2FNCA 1B32A 4HCYA 2NWJA 5I56A 2ANJA 4GIZA 3VE1B 5H8HA 3TTLA 4ZECA 1Y1ZA 3S9NC 4IO6A 4XKRA 1QVSA 2ZXTA 3VDFA 3K1PA 3FJ7A 4KQPA 5HBCA 1R9QA 2DE4A 3I6VA 1MY4A 3MPKA 4F18A 1JW5A 1VSOA 4IY6A 1T0KA 3ILTB 5I59A 1US5A 5HM4B 5CMMA 1MDP1 4JWOA 4F2OA 5I84A 4UACA 4K3FA 4DE8A 1B5JA 1H44A 2UVIA 1B58A 3EHSA 4P0IA 4E0XA 2HEUA 1MXWA 1FQDA 5KCJA 2Y7PA 4L17A 3MAMA 3VLWA 1N76A 3PPNA 2XXWA 4KYSA 4PQJA 1MY1A 1VFDA 2DWJA 2RCBA 1SD3A 4FEDA 3SEYA 4YU0A 1H3DA 4TQUQ 3L6GA 4G8NA 1MRPA 3UORA 3H7MA 2RC9A 3V5AA 1JVYA 2I3VA 3FJGA 3MP1A 4YAHX 1MY3A 3MPLA 3TUSA 3O28A 3EF7A 1BTJA 2XD3A 1PBQA 4KYEA 4N07A 2O68A 3N26A 1F9BA 1OQGA 4FJPA 3ECRA 5H8NB 5L9SA 1UTBB 2QS1A 3FV1A 3FVOA 4NWCA 2RC7A 3TCFA 1OMPA 2AL4A 3B7DA 4FE8A 4X1BA 4F1UA 2W7YA 4FECA 4LZ5A 3Q25A 2F6GA 3O6GA 3K00A 2Y7WA 1A8EA 1IEJA 1Y3PA 5TP9A 2F7BA 1MDQA 1N3WA 2ZNUA 4IGRA 1Y20A 4QFNA 1ZJLA 3IL1B 5JK4A 3SERA 3EHTA 2UVHA 2XD2A 3B6WA 3MQ9A 3VVFA 5I57B 2P0SA 3E13X 3JYRA 4GQOA 3TELA 1ANFA 1IXHA 4O3CA 2XXVA 1NFTA 3USDA 3K1MA 1TFDA 4KR5A 4OENA 4EQBA 3BBRA 2Q89A 3PMWA 5ISUA 3K2DA 2DE3A 1DMBA 2PT2A 3SKPA 4OMBA 3PUWE 4OYVA 3O6IA 4M1VA 3TQLA 5KZTA 1A40A 3U92A 1XHYA 1O64A 3K01A 3M3KA 4G8MA 4EXKA 4YKPA 3UIFA 5BUUA 5FHNA 4R2FA 2P1SA 2M8CA 3KG2A 3IB0A 1FQFA 2GHAA 1PC3A 3CIJA 4HTGA 4G68B 3ZKKA 4NTLA 2QMWA 4JWXA 1ATGA 3OSQA 1D9YA 3E3KA 2OK2A 3TMGA 3TODA 3G3GA 3THIA 3TTNA 1M5CA 4QF9A 2WKYA 2UYFA 4OEVA 3MC2A 3SETA 1P99A 3CG3A 2Y7RA 5K2YA 4H1XA 5L9MA 1BLFA 4F31B 4QRZA 5H8QA 2OJTA 4PFYA 3L6HA 1RYOA 2PMSA 2XXPA 1QKAA 3HCQA 3IK6B 1ZKBA 3OO9A 4GOTA 4NF4A 2ZNSA 1SYHA 1JEVA 2F34A 2VHAA 2XX9A 2UXAA 3U1OA 4ECFA 1MM6A 3HHGA 2G93A 2OWTA 1LBBA 3UA8A 1JVXA 2A5SA 3GLBA 4AB6A 3N6UA 3HPIA 3TTMA 4U1ZA 4KCCA 1AIVA 1FW0A 1S50A 5ELVA 3LR1A 4MLVA 4R6HA 3RUMA 3T9HB 3W9VA 2UYEA 1UTHA 1B5HA 4QHQA 5ICQA 1OLAA 4LA9A 2FYIA 1S7YA 2REGA 1MY2A 4OESA 2ZMBA 3CFXA 1P1WA 4EQ7A 3FIRA 1XOCA 2H98A 5H8FB 3RTFB 3TZAA 1M5FA 1POTA 2RF1A 3QYTA 3TTKA 2I0CA 3V89B 2DS9A 3OELA 2F5XA 5CC2A 1B3LA 5DTBA 3B6QA 1LCFA 3F11A 3H3GA 3HV1A 5DYHA 1VFEA 3T96B 4WEDA 1CE2A 2XXIA 3ILUB 3VFJA 4XIGQ 2PYYA 5EHSA 4QFPA 3EN3A 4ELRA 3BKIB 3TCHA 5B70A 3KFMA 2QS3A 3LSWA 3CFZA 4U1OA 4IO3A 4DLDA 1URDA 3SDFA 4PFUA 3G3JA 4YB7A 3TDJA 4YB6A 4OETA 4LUBA 3KN8A 3IB2A 2XXQA 3KBRA 4JSDA 3UP9A 1B46A 4NF6B 4DCXA 5FHOA 5CMKA 4MBPA 3RTWB 1YTVA 3V83A 4GF8A 4OTEA 1B52A 1SI0A 3B6TA 3MVZA 3OENA 5CRYA 1FCKA 3IOUA 1EZOA 1ZLQA 2DVCA 2O7IA 1SBPA 4BDLA 3K6VA 4OZ9A 4RK9A 2R71A 1MH3A 4H5GA 1PB8A 1GR2A 4ZEFA 2V3UA 4ZE8A 2PT1A 2NVUB 2HCAA 4G68A 5A5XA 5L9OA 4YICA 1TFAA 1B1XA 3C36A 1Y9UA 3CR9A 4XKPA 1SW2A 2QMXA 3IAZA 1FQBA 2I6EA 3S4UA 2E0SA 3KOTA 3EPEA 2DSFA 3D4CA 3C35A 3T93B 1A99A 3MVWA 3H4ZA 2VD2A 1EZ9A 2FA7A 3FGSA 3KGCA 2DE2A 3G7WA 4JWYA 3U94A 4Q8RA 4N13A 4ONYA 4EXLA 3LBSA 1SDXA 1P1NA 3SEWA 4BDRA 1MPCA 5FTIA 4Q0CA 2R6GE 3KZGA 3MVYA 4P11A 3PUVE 3H6WA 4GLIA 1NNKA 1OVTA 4H65A 1NKXA 4POWA 2GHBA 3VXCA 3MP6A 4EDPA 1HSJA 4IB2A 2O6AA 4DXBA 4F29A 2B65A 4F2QA 1SI1A 1SVXB 3WAEA 4ZEKA 2V84A 3FXRA 4THIA 3DP8A 4QFKA 5AA4A 3OMBA 1JQFA 1XS5A 2I0BA 4YZZA 2YJPA 1R9LA 2B3FA 1O7TA 4I9DA 3SEXA 1OQHA 2DXRA 2GRVA 2OLBA 1OVBA 3V8XB 4C0RA 1NNTA 1USYH 1XVYA 4JSOA 3GZGA 4PE5B 4GFRA 4I1DA 2Q2AA 4MF3A 1MPDA 5I2KA 5B7DA 3G3FA 5AA2D 1JEUA 1BKAA 1NNFA 2LAOA 4H6DA 1ZIUA 3FATA 4Z0IA 5H8HB 1QKBA 3S9MC 3PPOA 1NL5A 3FXUA 5CMCA 1OLCA 3MW0A 1GTKA 2CMOA 2O7UA 4POXA 1I6AA 4H0WA 3FV2A 3TYHA 4E0WA 3RT6B 1LB8A 2I48A 4ZEBA 3UN6A 4XKQA 5I58A 1NH7A 2A5TA 2IA4A 3FUZA 3K1NA 4F3BA 2NXOA 3LC8A 1B40A 1MXVA 3FXQA 4H8JA 1JW4A 1LCTA 4HS7A 3VLUA 2F8DA 4PP0A 4F3PA 1US4A 3CRBA 4F19A 1FQEA 1HSLA 1P1QA 1PB9A 2Z8EA 3GXAA 3ONMA 3QUJA 3AXFA 4LONB 3C34A 3R26A 5DT6A 3MUQA 4C1TA 2DQVA 3CFLA 3KEIA 5AA2B 2RINA 4LZ7A 4FEBA 3RN8A 3RLFE 3PV0E 3DP4A 4GL8A 1TT1A 4RPNA 5KDTA 2ABHA 1AH5A 2I3WA 3FJMA 3IO6A 1IXGA 1M5BA 1JW1A 1XVXA 1MS7A 3OEMA 1YAEA 3OSRA 4N6PA 1UTBA 4RPOA 1A54A 4WXJA 1Y1MA 3DLNA 5A5XB 1B2HA 1FTOA 1LFHA 4LP2B 1B0HA 2XXTA 3JV9A 4R9FA 2I49A 3HHFA 3IJXB 1Z7NE 4PETA 3RT8A 2YPNA 2O1MA 1Y3QA 4ZDMA 3T9XB 3MZBA 3CG1A 5CBSA 3ZS6A 3RNNA 1TWYA 3CVGA 1I6QA 5K2XA 1QUJA 2F7CA 4YKKA 3MZ1A 3U72A 3GBAA 4C1UA 5J1DA 1BIYA 3N5LA 3CI8A 3H6UA 4LZ8A 3K6WA 5I2NA 3FASA 3LSLA 2Z8DA 3A09A 1URGA 1MY0A 1O63A 1FTKA 4O3AA 1B7ZA 3IO4A 5JTYB 5AA1A 2H9BA 2GFEA 3MBPA 3PPQA 4Z7EA 3T66A 4LATA 1LAXA 5TP9B 4ELOA 5AA2A 2REJA 4EUOA 4XKNA 2NOOA 2X7PA 2XHDA 3UK4A 1Y4TA 2DWHA 3HN0A 1MQIA 2UVJA 1YPNA 4XXUA 4ESXA 2PBWA 4MFIA 1A55A 3LSFB 3VVEA 4NF8B 3FVKA 4DXUA 1B5IA 4R2BA 3SESA 1P1OA 2D3IA 2ZYKA 1FQAA 3M3FA 3VVDA 4JBZA 3RQTA 3PUYE 1QULA 1MQHA 1POY1 3Q26A 2HFBA 3LSXA 2BJJX 1LBCA 4YKIA 5I2KB
chains in the Genus database with same CATH superfamily
4N8GA 2QS2A 1KZ8A 4JB7A 3TFLA 2FIEA 4U4SA 4F1VA 3T22A 1B05A 2OCUA 3K6UA 5ITPA 2RCAA 1IMDA 1EH3A 1MQJA 5EQ9A 4R6YA 2CEYA 2HQ0A 3G3IA 4WEPA 3OD7A 2OX3A 4NF8A 3O29A 4G4PA 3VXBA 2X26A 3PPRA 4GXSB 3LUZA 4FORA 2P2AA 2X7QA 2Y7KA 4EF2A 5JTYA 3RPWA 1UIUA 1B3GA 1Z7ME 1HSEA 4NF6A 4U4XA 2HZLA 3QXMA 4N91A 4ELPA 2I4BA 1IMAA 5TPAA 1GGGA 1LAFE 4GL8A 4I40A 2QL3A 3KSJA 2O1LA 4KFQA 4OERA 3M3LA 4IO2A 1IIWA 3O9PA 1NV1A 3H6TA 1NH8A 5IAIA 3OXNA 2B3BA 2HZKA 2KLFA 4IO7A 4GX6A 5CI5A 4F1YA 1LEVA 4N6KA 1LSTA 4JVCA 5I57A 4OVPA 1ZTYA 4NF5A 4OQOA 3KN3A 2DP8A 3C4MA 3EHUA 4G68C 4KXPA 4U23A 4TLLB 5EYHA 4MCOA 1MG1A 5TPAB 3KN7A 1L5TA 3MVXA 3R6UA 2QRYA 3W15C 2QSXA 2A5TB 3MJNA 5EQ7A 2WX9A 1IXIA 4OFLA 4QSDA 1B4HA 4UABA 4ZZAA 1MQGA 3MWBA 1MPBA 3O6HA 5IKBA 1N3XA 4MEVA 5IM2A 1J1NA 4NHBA 1DOTA 3C32A 1NUYA 1UQWA 2L5VA 4MH5A 4ESWA 2HAVA 1Q35A 3TQWA 5ET8A 4F22A 3H03A 3TTRA 1ZMGA 2XA5A 4Q30B 4H8IA 1H45A 3G3HA 3R7XA 3DELB 4XTCQ 1A7LA 5H8NA 3WAFA 5I58B 1FPKA 2VP1A 4FATA 3FXBA 1DBZA 5AA4B 2G29A 5AE4A 3U8QA 4QSEA 5DVFA 1NMUA 4I62A 2DWAA 4GWXA 5M2VA 4F3SA 3A29A 3KSXA 2F97A 3PD8A 2Q9TA 4HCYA 4N81A 4ZECA 3T1BA 1QGXA 1T0KA 1VSOA 1US5A 5CMMA 5I84A 4DE8A 3EHSA 4P0IA 5KCJA 2Y7PA 4F1UA 3MAMA 4PQJA 2DWJA 2RCBA 4FEDA 3H7MA 2I3VA 3FJGA 3TUSA 1MY3A 3O28A 4P1EA 4FJPA 5L9SA 3B7DA 4X1BA 4FECA 1A8EA 5I58A 1Y3PA 2F7BA 1LBWA 1MDQA 1N3WA 2XWVA 1Y20A 1ZJLA 3IL1B 1FBCA 3EHTA 3E13X 3JYRA 4GQOA 1IXHA 3PMWA 2Q89A 3K2DA 4OMBA 4OYVA 3TQLA 3U92A 3K01A 3M3KA 4YKPA 3UIFA 5BUUA 2M8CA 4P47A 3IB0A 4G68B 4JWXA 3E3KA 3TODA 3THIA 3TTNA 2UYFA 3CG3A 2Y7RA 4H1XA 5H8QA 3L6HA 1RYOA 3IK6B 4GOTA 2F34A 2VHAA 2UXAA 1MM6A 1LBBA 1JVXA 2A5SA 5DW8A 4KCCA 1EYJA 4R6HA 1FJ6A 4LA9A 2ZMBA 4OA4A 3CFXA 4EQ7A 2H98A 3TZAA 1POTA 3TTKA 3V89B 2I0CA 2DS9A 5CC2A 3B6QA 3F11A 3HV1A 5DYHA 1NUWA 1Q9DA 4WEDA 4XIGQ 5EHSA 4QFPA 5ET5A 4DLDA 3TDJA 4YB6A 3KN8A 2XXQA 1B46A 5FHOA 3QMFA 4OTEA 1B52A 3IOUA 2O7IA 5I5PA 1XI6A 2V3UA 2NVUB 5L9OA 3CR9A 2QMXA 2DSFA 3T93B 3MVWA 3U94A 3LBSA 3SEWA 4Q0CA 4IR8A 4LN5A 3MYUA 3H6WA 1NKXA 3VXCA 4MNCA 2B65A 3WAEA 4PFIA 3DP8A 1JQFA 1XS5A 1K9YA 3V8XB 3GZGA 4GFRA 2Q2AA 5AA2D 1NNFA 5H8HB 4Z0IA 4AS4A 3FATA 1QKBA 3FXUA 2FVZA 1I6AA 3UN6A 1LB8A 5IZ3B 4XKQA 2NXOA 1B40A 5IZ1A 3U65A 2F8DA 1US4A 1HSLA 1P1QA 4C1TA 3KEIA 4OVTA 3PV0E 4RPNA 5KDTA 1AH5A 3IO6A 1IXGA 1M5BA 1JW1A 1XVXA 3MSTA 4QXDA 1A54A 1Y1MA 3DLNA 4O7MA 1B2HA 1LFHA 4LP2B 1B0HA 2I49A 4PETA 2YPNA 4P9KA 3T9XB 3MZBA 3CG1A 5CBSA 3ZS6A 1QUJA 4YKKA 3BIHA 3H6UA 1FJ9A 5ET6A 4NG7A 5I2NA 3LSLA 1LBZA 3IO4A 3MBPA 3T66A 5LDZA 1LAXA 5AA2A 4O94A 3HN0A 1MQIA 1YPNA 4XXUA 4ESXA 4R2BA 1P1OA 3VVDA 3RQTA 1LBCA 1MQHA 3Q26A 2HFBA 2FA7A 4BDRA 1KWHA 4RK2A 4NEDA 3IOTA 4PFTA 3PMVA 1MXXA 4RYAA 2I58A 4PBHA 4FAJA 1YXIA 4NN3A 1D9QA 2ZYMA 3TKDA 5FHMA 4BDMA 1FTAA 1SYIA 2I4CA 4P56A 5BWJA 1LFGA 2VPNA 3ZKLA 4DZ1A 1EZPA 4G8HA 1LAHE 3K02A 5LOMA 4R72A 3HO7A 1AMFA 1ZBMA 4HE2A 4F39A 5KCJB 4UA8A 5IGAA 1QJMA 1LAGE 3M8UA 3TPAA 2XX8A 2D21A 4DI3D 5EHMA 3I5OA 5DEXA 4PDHA 1LB9A 2V3QA 3IORA 1FBHA 2PCRA 1NV2A 1WVJA 4ZE9A 1A8FA 3N6TA 4KHZE 4U22A 1MQDA 4YKJA 4G77A 4HCWA 3PU5A 2NUVA 1PBPA 3KC1A 4GD5A 3QK6A 3PUZE 2F3DA 2OWZA 2ZYNA 4JXIA 4GWZA 5AA3A 1B7UA 2VPOA 2PFZA 1AOVA 1IMBA 2Z8FA 1USYE 5F1QA 1VE4A 1D3KA 4R74A 1M5DA 1UIVA 4M4GA 1PDAA 5L8DA 4KCDA 1UTHB 3W9WA 1N84A 3KBZA 4IO4A 2B4LA 2F36A 4BLAA 4X9TA 3TAJA 1FBEA 4ZS9A 3RGYA 1D4NA 1YCJA 2ONRA 4RY1A 1IMCA 3UGWA 4X48A 2PX1A 4TLMB 5EQAA 1M5EA 4G61A 2XX7A 2CZKA 4JVDA 2F78A 5DVIA 3Q27A 3IJOB 2Z23A 4U21A 3K6XA 4N8YA 3PD9A 1GVCA 2P3NA 3BFTA 1N04A 3FD3A 4U2RA 2F7AA 2Z22A 3A3UA 1PB7A 4P0GA 4N6DA 4Q5TA 1H76A 2ZNTA 1FPDA 5HPQA 2ZYOA 1B3FA 4NE4A 3G3KA 1JNFA 2QVRA 1BP5A 2ALUA 1MXZA 2V93A 1DTGA 3B50A 3VE1B 1Y1ZA 2Y5LA 2ZXTA 3K1PA 4KQPA 1FRPA 5A5LA 1EYIA 4F18A 1JW5A 4UACA 2WYPA 1H44A 2FHYA 1B58A 4E0XA 1FQDA 3VLWA 2BJIA 3PPNA 1VFDA 3SEYA 4YU0A 3UORA 5IZ3A 3EF7A 1BTJA 2XD3A 4KYEA 1UTBB 2QS1A 3FVOA 4NWCA 3TCFA 2XWIA 2AL4A 4NX1A 2V4CA 2Y7WA 5AA2B 5JK4A 3RPLB 3SERA 3TELA 3USDA 3K1MA 3SKPA 1DMBA 3PUWE 4M1VA 1NV0A 4XEQA 4G8MA 2P1SA 1FQFA 2GHAA 3CIJA 1ATGA 1D9YA 2OK2A 4OEVA 1P99A 1BLFA 4I3EA 4F31B 4EQBA 4PFYA 4NF4A 3OO9A 1ZKBA 3U1OA 1JEVA 2G93A 1AIVA 1S50A 4I3YA 4QHQA 4X04A 4H46A 2REGA 1MY2A 2P3VA 5H8FB 4P3LA 4GBVA 4XFEA 4PF8A 3H3GA 3T96B 3EN3A 4ELRA 3TCHA 5B70A 2QS3A 3CFZA 2Q74A 4PFUA 3G3JA 4XF5A 1AWBA 3IB2A 4JSDA 3UP9A 4NF6B 4MBPA 4GF8A 1FCKA 1EZOA 1SBPA 3K6VA 1PB8A 1GR2A 1TFAA 1B1XA 3KOTA 4OVQA 3H4ZA 3KGCA 3G7WA 4N13A 3NOHA 3PUVE 1NNKA 1OVTA 4POWA 4MIJA 2GHBA 3MP6A 4F2QA 4IB2A 2O6AA 1SI1A 4ZEKA 3OMBA 2I0BA 2YJPA 1R9LA 2OLBA 1OVBA 1NNTA 1USYH 4PE5B 2XXKA 1MPDA 5B7DA 3G3FA 1BKAA 1ZIUA 1NL5A 5CMCA 1OLCA 1GTKA 4E0WA 2I48A 4PGPA 1NH7A 2A5TA 3FUZA 3LC8A 3FXQA 1LCTA 3VLUA 3CRBA 3AXFA 4LONB 3R26A 3MUQA 2RINA 3RLFE 3DP4A 3B8BA 4N6PA 3JV9A 4R9FA 3IJXB 4ZDMA 1Y3QA 3RNNA 1TWYA 2R8TA 1I6QA 4C1UA 3U72A 1BIYA 2XWKA 3K6WA 3FASA 1MY0A 5JTYB 2H9BA 4LATA 5TP9B 4ELOA 4XKNA 2NOOA 2X7PA 3UK4A 4MX6A 2PBWA 3LSFB 2ZZWA 4NF8B 3FVKA 5LTCA 4JBZA 1POY1 5DEXB 3LSXA 4YKIA 3P7IA 1S9TA 4TOZA 3KJ7A 4OXVA 1FTMA 2DOJA 3Q29A 5I59B 4ZZEA 5H8QB 4HW8A 3C33A 2QPQA 2OWSA 1SW1A 5EQ8A 3H6VA 4OANA 2H4IA 5DVJA 1MH4A 4OVJA 1RKMA 4NF5B 1IMEA 1DTZA 3IOWA 4GXAA 4OVSA 3JZJA 4DDDA 4MLQA 3ZSFA 3LUYA 1CNQA 1YYZA 4DXCA 1SQYA 4GVOA 3KJTA 3C9HA 2RKMA 2Y84A 4EQ9A 4NWDA 1D9VA 2OZZA 1WDNA 2DXYA 5ITOA 3IFAA 1NNPA 2CZLA 1TXFA 3VLVA 1CB6A 3C31A 3E4RA 4R73A 1B6HA 3OO6A 4OHNA 1IUDA 2WYKA 1LFIA 3FZVA 2GQ1A 2D5WA 3QAXA 4X1DA 4GRKA 3U93A 3OOAA 1AL3A 2H5YA 1DSNA 1G0HA 2O84X 4QBAA 4OFJA 4R75A 1LGBC 1MXYA 3QIMA 1XC1A 1B9JA 3OEKA 2GH9A 2ONSA 3IB1A 3IX1A 3IFCA 5KDTB 4QFLA 4F3GA 1KA0A 2R9JA 3EQ1A 1B0LA 2F3BA 5ICTA 2E1SA 3D4GA 1XT8A 3TCGA 4WKMA 4LVQA 4R6KA 4YMAA 3OO7A 4NF4B 1QW0A 5I2NB 1IZ1A 3MP8A 2OBGA 4PDDA 1P1UA 4OFOA 4YB5A 3KC0A 1QUKA 2ZZXA 1INPA 3T9VA 4N4UA 4BDQA 2DWIA 4KI0E 2HXWA 2CZHA 5H8FA 2O51A 4NQ8A 2KR0A 4GX3A 4YMBA 4IGTA 3O97A 4BDOA 4AQ4A 4LQ2A 4FBPA 4MJOA 2Q8MA 2XXYA 2B4MA 3DM0A 4ISUA 1R6ZA 4AB5A 3RY3A 4KD5A 2PVUA 4RXLA 4OEUA 3H06B 4MNPA 5CM6A 2HPGA 3CHGA 4R9GA 4KPTA 1LLSA 2V25A 1VDWA 3MZ9A 4P1LA 1FBFA 1QUIA 1Y4CA 4GWUA 2Y7IA 1B3EA 1Y3NA 3BIGA 1DK4A 4MNIA 1B4ZA 1FTLA 2NWJA 1B32A 5I56A 2ANJA 4GIZA 5H8HA 4IO6A 4XKRA 5HBCA 1R9QA 1MY4A 3MPKA 4JWOA 4F2OA 1B5JA 2XXWA 1SD3A 1H3DA 4TQUQ 3L6GA 4G8NA 4PGNA 1MRPA 3V5AA 2RC9A 1JVYA 3MP1A 4YAHX 1PBQA 4N07A 2QFLA 3N26A 1F9BA 1OQGA 1RDZA 1FPLA 3ECRA 5FBPA 5H8NB 3FV1A 1OMPA 4FE8A 2W7YA 3Q25A 2F6GA 3O6GA 3K00A 5TP9A 2ZNUA 4IGRA 5I57B 4KR5A 3HFUA 4OENA 2PT2A 1SPIA 3LV0A 4JVIA 5KZTA 1XHYA 1O64A 4EXKA 3KG2A 4HTGA 4N15A 3G3GA 1M5CA 4QF9A 2WKYA 1IMFA 3SETA 3MC2A 4PC9A 5L9MA 2OJTA 2XXPA 3S9EA 1QKAA 3HCQA 4DCYA 1SYHA 4ECFA 3HHGA 4H45A 2OWTA 3T0JA 3UA8A 3N6UA 3TTMA 4U1ZA 1FW0A 5ELVA 3LR1A 4MLVA 2UYEA 1RDYA 1B5HA 5ICQA 1OLAA 2FYIA 4NGUA 2FBPA 1P1WA 3FIRA 1M5FA 3QYTA 2RF1A 3GYYA 1B3LA 5DTBA 1LCFA 1CE2A 2XXIA 3VFJA 2PYYA 3BKIB 3KFMA 4U1OA 4IO3A 1URDA 4YB7A 4OETA 2HHMA 1FPFA 1YTVA 3MVZA 3B6TA 3OENA 4BDLA 4OZ9A 4RK9A 2R71A 1MH3A 4ZEFA 2JJKA 2HCAA 5A5XA 1Y9UA 3IAZA 1FQBA 2E0SA 3EPEA 3D4CA 3C35A 5EYGA 1A99A 3ROJA 2DE2A 4JWYA 4Q8RA 1MPCA 4P11A 4GLIA 4EDPA 1NV5A 4PAFA 3FXRA 4QFKA 1O7TA 4I9DA 2DXRA 2GRVA 1XVYA 4MF3A 5I2KA 2LAOA 2KQZA 3S9MC 3PPOA 4H0WA 3FV2A 1FPEA 4F3BA 2FIXA 4HS7A 1MXVA 1FPGA 1JW4A 4PP0A 1NV7A 2Y5KA 3GXAA 3C34A 4GWYA 5DT6A 2QVVA 1TT1A 2ABHA 2I3WA 2PFYA 4PE3A 3D1RA 3OEMA 1YAEA 1UTBA 4WXJA 2QVUA 3HHFA 3RT8A 3CVGA 5K2XA 3GBAA 1FBDA 3CI8A 4LZ8A 3A09A 1URGA 4O3AA 3PPQA 2XHDA 1NV6A 3VVEA 4MFIA 1B5IA 3SESA 2D3IA 2ZYKA 1FQAA 3PUYE 3CSBA 2O69A 2DYXA 4NMYA 3CSGA 1NV3A 2UVGA 1GV8A 1NI9A 3T9UA 5IZZA 5TU0A 4RA1A 2QJEA 3BFUA 2F6PA 4ELQA 3A3CA 3KOSA 2H25A 3PGFA 3FVNA 1H43A 3IOVA 4H67A 4O7IA 4OVRA 2V3TA 4ND9A 1R1NA 4PAIA 2XXXA 3PPPA 1ZU0A 2WBBA 4AS5A 3QUFA 4DI4B 3Q28A 1N7WA 5H8SA 1LBYA 1DPPA 5I3SA 3PUXE 1EU8A 4PFWA 4O3BA 4RJZA 2RC8A 1I6BA 1II5A 4MAGA 4GWSA 1ELJA 4LQ5A 4GBWA 3O2AA 4IY5A 2WBDA 5F7VA 4PFRA 3S2VA 5ET7A 4GL0A 4GWOA 1OIBA 2AIXA 5EYFA 4I8CA 1NUZA 3RPLA 1B51A 2XXUA 1VR5A 3K4UA 3S9LC 4QSCA 1MM7A 3SEUA 3ISPA 5JEIA 4RNSA 2THIA 1JP4A 5CMBA 2ESNA 3IR1A 1N7XA 2IEEA 2VGQA 2CZIA 2VD3A 4G2ZA 1N0TA 4ZEDA 3O66A 1IXCA 3OO8A 2VOZA 3E9XA 1JETA 5J16A 3ODBA 1WODA 3QSLA 2Q8JA 4H5FA 1LBXA 1B7HA 3E79A 3PMXA 5I56B 2DVZA 3TEPA 2Q88A 5ESYA 5FTHA 2XXHA 4ZEIA 5T3JA 1B1HA 1URSA 3GBBA 4FIMA 5CBRA 4KYDA 3I3VA 2HAUA 1IQ7A 1I69A 4OWDA 3FVGA 1MXUA 1SW5A 4IO5A 2CEXA 1RYXA 3DP6A 1PEBA 2AYSA 2QS4A 4QFOA 1NUXA 1DPEA 4MMPA 1SW4A 1FTJA 4DIGA 2H99A 1FQCA 2YLNA 4BDNA 2AL5A 2XXRA 3VV5A 3N94A 4JDFA 2Q2CA 3K0VA 2F35A 1B3HA 1IITA 5I59A 1Q1KA 2ONKE 3HSTA 2FNCA 5I7IA 3TTLA 3S9NC 1QVSA 3VDFA 3FJ7A 1BK4A 2DE4A 3I6VA 4IY6A 3ILTB 3E78A 5HM4B 1MDP1 1FBPA 4K3FA 2UVIA 2HXRA 2HEUA 1MXWA 4L17A 1N76A 4KYSA 5F24A 1MY1A 2XWOA 3MPLA 2O68A 1EYKA 2RC7A 3EKIA 4LZ5A 4MHFA 1IEJA 4QFNA 3VVFA 2UVHA 2XD2A 3B6WA 3MQ9A 2P0SA 4NF0A 1ANFA 4O3CA 3SZPA 2XXVA 1NFTA 1TFDA 5ISUA 3BBRA 2DE3A 3O6IA 1A40A 1FPIA 5FHNA 4R2FA 2VT5A 4NAPA 1FPBA 1PC3A 3ZKKA 4NTLA 2QMWA 3TMGA 3OSQA 2WEFA 5K2YA 4QRZA 4GX4A 2PMSA 4AB6A 3T9HB 4EF1A 2ZNSA 4F29A 2XX9A 3GLBA 1RDXA 1YZ0A 3HPIA 3RUMA 3W9VA 4O8MA 1UTHA 1S7YA 4P8BA 4OESA 1XOCA 3RTFB 4DCXA 4HE1A 3OELA 2F5XA 1G0IA 1VFEA 3ILUB 3LSWA 3SDFA 4PFBA 4HE0A 4LUBA 3KBRA 1FBGA 5CMKA 3V83A 3RTWB 1SI0A 5CRYA 1ZLQA 2DVCA 4H5GA 1K9ZA 4ZE8A 2PT1A 4G68A 4YICA 3C36A 1FSAA 1DCUA 4XKPA 1SW2A 3S4UA 2I6EA 2VD2A 1EZ9A 3FGSA 4ONYA 4EXLA 1SDXA 1P1NA 2DDKA 5FTIA 4PF6A 2R6GE 3KZGA 3MVYA 4H65A 1HSJA 4DXBA 1SVXB 2V84A 4THIA 5AA4A 4YZZA 1NV4A 2B3FA 3SEXA 1OQHA 2MKZA 4PAKA 4C0RA 4JSOA 4I1DA 4HXVA 4GWWA 1JEUA 4H6DA 3MW0A 2CMOA 2O7UA 4POXA 3TYHA 3RT6B 4ZEBA 3K1NA 2IA4A 3RYDA 3PTYA 4H8JA 4F3PA 1LBVA 4F19A 1FQEA 1PB9A 2Z8EA 3ONMA 3QUJA 2DQVA 3CFLA 4LZ7A 4FEBA 3RN8A 4X8RA 3FJMA 1MS7A 1KA1A 4RPOA 3OSRA 5A5XB 1FTOA 2XXTA 1Z7NE 2O1MA 2ZZVA 5J1DA 2F7CA 3MZ1A 4PTKA 3N5LA 3FBPA 2Z8DA 1O63A 1FPJA 1FTKA 1B7ZA 5AA1A 2GFEA 4N17A 4Z7EA 2REJA 4EUOA 1Y4TA 2DWHA 2UVJA 4PCDA 1A55A 4DXUA 4PBQA 3M3FA 1QULA 2BJJX 3SEVA 5I2KB
chains in the Genus database with same CATH topology
3P7IA 1S9TA 2QS2A 4TOZA 3KJ7A 4JB7A 1KWHA 4RK2A 3CSBA 4NEDA 3TFLA 2O69A 4OXVA 2DYXA 3IOTA 4PFTA 4U4SA 1FTMA 3PMVA 4NMYA 1MXXA 3CSGA 4RYAA 2DOJA 3Q29A 2I58A 5I59B 4F1VA 4ZZEA 3T22A 5H8QB 1B05A 2UVGA 1GV8A 2OCUA 3K6UA 5TU0A 3T9UA 4HW8A 2RCAA 4FAJA 5ITPA 4RA1A 2QJEA 3C33A 3BFUA 2QPQA 2ZYMA 3TKDA 2F6PA 2OWSA 4ELQA 1EH3A 1MQJA 1SW1A 3A3CA 2H25A 3KOSA 3H6VA 3PGFA 5FHMA 3FVNA 1H43A 3IOVA 4H67A 4R6YA 2HQ0A 2H4IA 3G3IA 4BDMA 1SYIA 2I4CA 5DVJA 1MH4A 4OVJA 2V3TA 5BWJA 4ND9A 4WEPA 3OD7A 4NF8A 1LFGA 1R1NA 1RKMA 4NF5B 3O29A 2XXXA 1DTZA 3IOWA 4G4PA 4GXAA 3VXBA 2X26A 3PPRA 3PPPA 3ZKLA 4DZ1A 3JZJA 1ZU0A 4DDDA 1EZPA 4G8HA 1LAHE 3K02A 3QUFA 4GXSB 5LOMA 4R72A 4MLQA 3ZSFA 3HO7A 2P2AA 1AMFA 2X7QA 1ZBMA 2Y7KA 4FORA 3Q28A 1N7WA 4EF2A 3LUYA 5JTYA 3RPWA 5H8SA 1UIUA 1B3GA 1DPPA 1Z7ME 1HSEA 4NF6A 4U4XA 2HZLA 4DXCA 4F39A 5KCJB 3QXMA 4ELPA 3S9EA 1SQYA 4UA8A 3PUXE 2I4BA 1EU8A 4PFWA 4GVOA 4O3BA 5TPAA 4RJZA 1GGGA 1LAFE 1QJMA 2RC8A 1LAGE 3KJTA 1I6BA 3C9HA 2RKMA 2XX8A 2Y84A 2D21A 1II5A 3M8UA 4NWDA 5EHMA 3TPAA 4EQ9A 1D9VA 3I5OA 2QL3A 5DEXA 1LB9A 1ELJA 4LQ5A 2V3QA 2OZZA 3KSJA 2O1LA 3IORA 1WDNA 3O2AA 4KFQA 4OERA 2DXYA 5ITOA 2CZLA 1NNPA 1TXFA 3M3LA 1CB6A 4IY5A 3C31A 3E4RA 4IO2A 4R73A 3VLVA 5F7VA 1IIWA 1WVJA 3O9PA 1B6HA 3OO6A 3S2VA 4OHNA 3H6TA 1NH8A 5DEXB 4ZE9A 4GL0A 1A8FA 5IAIA 1IUDA 4GWOA 3N6TA 3OXNA 1LFIA 1OIBA 2B3BA 3FZVA 2AIXA 2HZKA 2D5WA 4KHZE 1MQDA 2KLFA 4IO7A 3QAXA 4U22A 4YKJA 5CI5A 4G77A 4HCWA 5EYFA 4F1YA 3PU5A 2NUVA 4I8CA 4GRKA 4X1DA 3U93A 1LSTA 1PBPA 3OOAA 1AL3A 1B51A 2XXUA 4GD5A 5I57A 3QK6A 3PUZE 2H5YA 1VR5A 2ZYNA 1DSNA 4JXIA 5AA3A 1B7UA 2O84X 1ZTYA 3K4UA 3S9LC 4NF5A 4OQOA 4QSCA 3KN3A 5I2NB 4OFJA 2DP8A 1MM7A 4R75A 1LGBC 3SEUA 3C4MA 4RNSA 1MXYA 3QIMA 3EHUA 4G68C 5JEIA 1XC1A 2THIA 1B9JA 3OEKA 4U23A 4TLLB 5CMBA 2ESNA 1AOVA 2GH9A 3IR1A 1N7XA 2Z8FA 2ONSA 3IB1A 1MG1A 2IEEA 2VGQA 3IX1A 5TPAB 5KDTB 3KN7A 4QFLA 1L5TA 3MVXA 3R6UA 1USYE 2QRYA 5F1QA 4F3GA 1D3KA 1VE4A 2VD3A 4G2ZA 1N0TA 4R74A 2R9JA 3EQ1A 3W15C 1B0LA 4ZEDA 2QSXA 1M5DA 1UIVA 2A5TB 3MJNA 4M4GA 5ICTA 1PDAA 2E1SA 3D4GA 1XT8A 4KCDA 5L8DA 3TCGA 1UTHB 3W9WA 1IXIA 1N84A 4OFLA 3O66A 4QSDA 4WKMA 4LVQA 1IXCA 4R6KA 4YMAA 1B4HA 3OO7A 4ZZAA 4IO4A 4NF4B 1MQGA 2F36A 3OO8A 1QW0A 2VOZA 1IZ1A 1JETA 2OBGA 3E9XA 1MPBA 3MP8A 3MWBA 3O6HA 3ODBA 4X9TA 1P1UA 1WODA 4OFOA 3QSLA 5IKBA 4YB5A 4H5FA 2Q8JA 3TAJA 1N3XA 1QUKA 4ZS9A 1B7HA 1D4NA 1J1NA 3PMXA 3RGYA 5I56B 1YCJA 2DVZA 3T9VA 2ONRA 3TEPA 4RY1A 4BDQA 3UGWA 1DOTA 2DWIA 2Q88A 3C32A 4KI0E 4X48A 2HXWA 5FTHA 2PX1A 2XXHA 4ZEIA 1B1HA 1URSA 4TLMB 1UQWA 5H8FA 3GBBA 2O51A 4FIMA 1M5EA 4MH5A 5CBRA 4ESWA 2XX7A 2HAVA 1Q35A 3TQWA 4KYDA 2F78A 3I3VA 2HAUA 1IQ7A 1I69A 4OWDA 3FVGA 5DVIA 4F22A 4YMBA 3H03A 1MXUA 2Z23A 3IJOB 3Q27A 4IGTA 1ZMGA 3O97A 3TTRA 4BDOA 4AQ4A 4LQ2A 4U21A 4Q30B 3K6XA 4H8IA 3PD9A 1H45A 1SW5A 2XXYA 4IO5A 1GVCA 1RYXA 3DP6A 1PEBA 3G3HA 3R7XA 3BFTA 1N04A 3DELB 2AYSA 2QS4A 4QFOA 3FD3A 3DM0A 4ISUA 4U2RA 4XTCQ 3SEVA 2F7AA 1A7LA 2Z22A 1DPEA 1R6ZA 3A3UA 5H8NA 3WAFA 3RY3A 4AB5A 4DCYA 2VP1A 5I58B 1SW4A 1PB7A 4KD5A 1FTJA 4P0GA 4FATA 2PVUA 4DIGA 2H99A 4RXLA 4OEUA 1FQCA 2YLNA 3H06B 4Q5TA 4BDNA 5AA4B 2G29A 5AE4A 3U8QA 5CM6A 2AL5A 2XXRA 3VV5A 3N94A 4JDFA 4QSEA 1H76A 2Q2CA 2ZNTA 5DVFA 3K0VA 4R9GA 2F35A 1B3HA 1IITA 5HPQA 4KPTA 1LLSA 1NMUA 1Q1KA 1B3FA 2V25A 2ZYOA 3MZ9A 4I62A 4NE4A 4EF1A 1QUIA 2ONKE 3G3KA 2DWAA 1JNFA 1Y4CA 5M2VA 2Y7IA 4F3SA 1B3EA 1Y3NA 1BP5A 4BLAA 2ALUA 1MXZA 2V93A 3HSTA 3KSXA 2F97A 1B4ZA 1DTGA 3PD8A 2Q9TA 1FTLA 2FNCA 1B32A 4HCYA 2NWJA 5I56A 2ANJA 4GIZA 3VE1B 5H8HA 3TTLA 4ZECA 1Y1ZA 3S9NC 4IO6A 4XKRA 1QVSA 2ZXTA 3VDFA 3K1PA 3FJ7A 4KQPA 5HBCA 1R9QA 2DE4A 3I6VA 1MY4A 3MPKA 4F18A 1JW5A 1VSOA 4IY6A 1T0KA 3ILTB 5I59A 1US5A 5HM4B 5CMMA 1MDP1 4JWOA 4F2OA 5I84A 4UACA 4K3FA 4DE8A 1B5JA 1H44A 2UVIA 1B58A 3EHSA 4P0IA 4E0XA 2HEUA 1MXWA 1FQDA 5KCJA 2Y7PA 4L17A 3MAMA 3VLWA 1N76A 3PPNA 2XXWA 4KYSA 4PQJA 1MY1A 1VFDA 2DWJA 2RCBA 1SD3A 4FEDA 3SEYA 4YU0A 1H3DA 4TQUQ 3L6GA 4G8NA 1MRPA 3UORA 3H7MA 2RC9A 3V5AA 1JVYA 2I3VA 3FJGA 3MP1A 4YAHX 1MY3A 3MPLA 3TUSA 3O28A 3EF7A 1BTJA 2XD3A 1PBQA 4KYEA 4N07A 2O68A 3N26A 1F9BA 1OQGA 4FJPA 3ECRA 5H8NB 5L9SA 1UTBB 2QS1A 3FV1A 3FVOA 4NWCA 2RC7A 3TCFA 1OMPA 2AL4A 3B7DA 4FE8A 4X1BA 4F1UA 2W7YA 4FECA 4LZ5A 3Q25A 2F6GA 3O6GA 3K00A 2Y7WA 1A8EA 1IEJA 1Y3PA 5TP9A 2F7BA 1MDQA 1N3WA 2ZNUA 4IGRA 1Y20A 4QFNA 1ZJLA 3IL1B 5JK4A 3SERA 3EHTA 2UVHA 2XD2A 3B6WA 3MQ9A 3VVFA 5I57B 2P0SA 3E13X 3JYRA 4GQOA 3TELA 1ANFA 1IXHA 4O3CA 2XXVA 1NFTA 3USDA 3K1MA 1TFDA 4KR5A 4OENA 4EQBA 3BBRA 2Q89A 3PMWA 5ISUA 3K2DA 2DE3A 1DMBA 2PT2A 3SKPA 4OMBA 3PUWE 4OYVA 3O6IA 4M1VA 3TQLA 5KZTA 1A40A 3U92A 1XHYA 1O64A 3K01A 3M3KA 4G8MA 4EXKA 4YKPA 3UIFA 5BUUA 5FHNA 4R2FA 2P1SA 2M8CA 3KG2A 3IB0A 1FQFA 2GHAA 1PC3A 3CIJA 4HTGA 4G68B 3ZKKA 4NTLA 2QMWA 4JWXA 1ATGA 3OSQA 1D9YA 3E3KA 2OK2A 3TMGA 3TODA 3G3GA 3THIA 3TTNA 1M5CA 4QF9A 2WKYA 2UYFA 4OEVA 3MC2A 3SETA 1P99A 3CG3A 2Y7RA 5K2YA 4H1XA 5L9MA 1BLFA 4F31B 4QRZA 5H8QA 2OJTA 4PFYA 3L6HA 1RYOA 2PMSA 2XXPA 1QKAA 3HCQA 3IK6B 1ZKBA 3OO9A 4GOTA 4NF4A 2ZNSA 1SYHA 1JEVA 2F34A 2VHAA 2XX9A 2UXAA 3U1OA 4ECFA 1MM6A 3HHGA 2G93A 2OWTA 1LBBA 3UA8A 1JVXA 2A5SA 3GLBA 4AB6A 3N6UA 3HPIA 3TTMA 4U1ZA 4KCCA 1AIVA 1FW0A 1S50A 5ELVA 3LR1A 4MLVA 4R6HA 3RUMA 3T9HB 3W9VA 2UYEA 1UTHA 1B5HA 4QHQA 5ICQA 1OLAA 4LA9A 2FYIA 1S7YA 2REGA 1MY2A 4OESA 2ZMBA 3CFXA 1P1WA 4EQ7A 3FIRA 1XOCA 2H98A 5H8FB 3RTFB 3TZAA 1M5FA 1POTA 2RF1A 3QYTA 3TTKA 2I0CA 3V89B 2DS9A 3OELA 2F5XA 5CC2A 1B3LA 5DTBA 3B6QA 1LCFA 3F11A 3H3GA 3HV1A 5DYHA 1VFEA 3T96B 4WEDA 1CE2A 2XXIA 3ILUB 3VFJA 4XIGQ 2PYYA 5EHSA 4QFPA 3EN3A 4ELRA 3BKIB 3TCHA 5B70A 3KFMA 2QS3A 3LSWA 3CFZA 4U1OA 4IO3A 4DLDA 1URDA 3SDFA 4PFUA 3G3JA 4YB7A 3TDJA 4YB6A 4OETA 4LUBA 3KN8A 3IB2A 2XXQA 3KBRA 4JSDA 3UP9A 1B46A 4NF6B 4DCXA 5FHOA 5CMKA 4MBPA 3RTWB 1YTVA 3V83A 4GF8A 4OTEA 1B52A 1SI0A 3B6TA 3MVZA 3OENA 5CRYA 1FCKA 3IOUA 1EZOA 1ZLQA 2DVCA 2O7IA 1SBPA 4BDLA 3K6VA 4OZ9A 4RK9A 2R71A 1MH3A 4H5GA 1PB8A 1GR2A 4ZEFA 2V3UA 4ZE8A 2PT1A 2NVUB 2HCAA 4G68A 5A5XA 5L9OA 4YICA 1TFAA 1B1XA 3C36A 1Y9UA 3CR9A 4XKPA 1SW2A 2QMXA 3IAZA 1FQBA 2I6EA 3S4UA 2E0SA 3KOTA 3EPEA 2DSFA 3D4CA 3C35A 3T93B 1A99A 3MVWA 3H4ZA 2VD2A 1EZ9A 2FA7A 3FGSA 3KGCA 2DE2A 3G7WA 4JWYA 3U94A 4Q8RA 4N13A 4ONYA 4EXLA 3LBSA 1SDXA 1P1NA 3SEWA 4BDRA 1MPCA 5FTIA 4Q0CA 2R6GE 3KZGA 3MVYA 4P11A 3PUVE 3H6WA 4GLIA 1NNKA 1OVTA 4H65A 1NKXA 4POWA 2GHBA 3VXCA 3MP6A 4EDPA 1HSJA 4IB2A 2O6AA 4DXBA 4F29A 2B65A 4F2QA 1SI1A 1SVXB 3WAEA 4ZEKA 2V84A 3FXRA 4THIA 3DP8A 4QFKA 5AA4A 3OMBA 1JQFA 1XS5A 2I0BA 4YZZA 2YJPA 1R9LA 2B3FA 1O7TA 4I9DA 3SEXA 1OQHA 2DXRA 2GRVA 2OLBA 1OVBA 3V8XB 4C0RA 1NNTA 1USYH 1XVYA 4JSOA 3GZGA 4PE5B 4GFRA 4I1DA 2Q2AA 4MF3A 1MPDA 5I2KA 5B7DA 3G3FA 5AA2D 1JEUA 1BKAA 1NNFA 2LAOA 4H6DA 1ZIUA 3FATA 4Z0IA 5H8HB 1QKBA 3S9MC 3PPOA 1NL5A 3FXUA 5CMCA 1OLCA 3MW0A 1GTKA 2CMOA 2O7UA 4POXA 1I6AA 4H0WA 3FV2A 3TYHA 4E0WA 3RT6B 1LB8A 2I48A 4ZEBA 3UN6A 4XKQA 5I58A 1NH7A 2A5TA 2IA4A 3FUZA 3K1NA 4F3BA 2NXOA 3LC8A 1B40A 1MXVA 3FXQA 4H8JA 1JW4A 1LCTA 4HS7A 3VLUA 2F8DA 4PP0A 4F3PA 1US4A 3CRBA 4F19A 1FQEA 1HSLA 1P1QA 1PB9A 2Z8EA 3GXAA 3ONMA 3QUJA 3AXFA 4LONB 3C34A 3R26A 5DT6A 3MUQA 4C1TA 2DQVA 3CFLA 3KEIA 5AA2B 2RINA 4LZ7A 4FEBA 3RN8A 3RLFE 3PV0E 3DP4A 4GL8A 1TT1A 4RPNA 5KDTA 2ABHA 1AH5A 2I3WA 3FJMA 3IO6A 1IXGA 1M5BA 1JW1A 1XVXA 1MS7A 3OEMA 1YAEA 3OSRA 4N6PA 1UTBA 4RPOA 1A54A 4WXJA 1Y1MA 3DLNA 5A5XB 1B2HA 1FTOA 1LFHA 4LP2B 1B0HA 2XXTA 3JV9A 4R9FA 2I49A 3HHFA 3IJXB 1Z7NE 4PETA 3RT8A 2YPNA 2O1MA 1Y3QA 4ZDMA 3T9XB 3MZBA 3CG1A 5CBSA 3ZS6A 3RNNA 1TWYA 3CVGA 1I6QA 5K2XA 1QUJA 2F7CA 4YKKA 3MZ1A 3U72A 3GBAA 4C1UA 5J1DA 1BIYA 3N5LA 3CI8A 3H6UA 4LZ8A 3K6WA 5I2NA 3FASA 3LSLA 2Z8DA 3A09A 1URGA 1MY0A 1O63A 1FTKA 4O3AA 1B7ZA 3IO4A 5JTYB 5AA1A 2H9BA 2GFEA 3MBPA 3PPQA 4Z7EA 3T66A 4LATA 1LAXA 5TP9B 4ELOA 5AA2A 2REJA 4EUOA 4XKNA 2NOOA 2X7PA 2XHDA 3UK4A 1Y4TA 2DWHA 3HN0A 1MQIA 2UVJA 1YPNA 4XXUA 4ESXA 2PBWA 4MFIA 1A55A 3LSFB 3VVEA 4NF8B 3FVKA 4DXUA 1B5IA 4R2BA 3SESA 1P1OA 2D3IA 2ZYKA 1FQAA 3M3FA 3VVDA 4JBZA 3RQTA 3PUYE 1QULA 1MQHA 1POY1 3Q26A 2HFBA 3LSXA 2BJJX 1LBCA 4YKIA 5I2KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7I A;  1S9T A;  2QS2 A;  4TOZ A;  3KJ7 A;  4JB7 A;  1KWH A;  4RK2 A;  3CSB A;  4NED A;  3TFL A;  2O69 A;  4OXV A;  2DYX A;  3IOT A;  4PFT A;  4U4S A;  1FTM A;  3PMV A;  4NMY A;  1MXX A;  3CSG A;  4RYA A;  2DOJ A;  3Q29 A;  2I58 A;  5I59 B;  4F1V A;  4ZZE A;  3T22 A;  5H8Q B;  1B05 A;  2UVG A;  1GV8 A;  2OCU A;  3K6U A;  5TU0 A;  3T9U A;  4HW8 A;  2RCA A;  4FAJ A;  5ITP A;  4RA1 A;  2QJE A;  3C33 A;  3BFU A;  2QPQ A;  2ZYM A;  3TKD A;  2F6P A;  2OWS A;  4ELQ A;  1EH3 A;  1MQJ A;  1SW1 A;  3A3C A;  2H25 A;  3KOS A;  3H6V A;  3PGF A;  5FHM A;  3FVN A;  1H43 A;  3IOV A;  4H67 A;  4R6Y A;  2HQ0 A;  2H4I A;  3G3I A;  4BDM A;  1SYI A;  2I4C A;  5DVJ A;  1MH4 A;  4OVJ A;  2V3T A;  5BWJ A;  4ND9 A;  4WEP A;  3OD7 A;  4NF8 A;  1LFG A;  1R1N A;  1RKM A;  4NF5 B;  3O29 A;  2XXX A;  1DTZ A;  3IOW A;  4G4P A;  4GXA A;  3VXB A;  2X26 A;  3PPR A;  3PPP A;  3ZKL A;  4DZ1 A;  3JZJ A;  1ZU0 A;  4DDD A;  1EZP A;  4G8H A;  1LAH E;  3K02 A;  3QUF A;  4GXS B;  5LOM A;  4R72 A;  4MLQ A;  3ZSF A;  3HO7 A;  2P2A A;  1AMF A;  2X7Q A;  1ZBM A;  2Y7K A;  4FOR A;  3Q28 A;  1N7W A;  4EF2 A;  3LUY A;  5JTY A;  3RPW A;  5H8S A;  1UIU A;  1B3G A;  1DPP A;  1Z7M E;  1HSE A;  4NF6 A;  4U4X A;  2HZL A;  4DXC A;  4F39 A;  5KCJ B;  3QXM A;  4ELP A;  3S9E A;  1SQY A;  4UA8 A;  3PUX E;  2I4B A;  1EU8 A;  4PFW A;  4GVO A;  4O3B A;  5TPA A;  4RJZ A;  1GGG A;  1LAF E;  1QJM A;  2RC8 A;  1LAG E;  3KJT A;  1I6B A;  3C9H A;  2RKM A;  2XX8 A;  2Y84 A;  2D21 A;  1II5 A;  3M8U A;  4NWD A;  5EHM A;  3TPA A;  4EQ9 A;  1D9V A;  3I5O A;  2QL3 A;  5DEX A;  1LB9 A;  1ELJ A;  4LQ5 A;  2V3Q A;  2OZZ A;  3KSJ A;  2O1L A;  3IOR A;  1WDN A;  3O2A A;  4KFQ A;  4OER A;  2DXY A;  5ITO A;  2CZL A;  1NNP A;  1TXF A;  3M3L A;  1CB6 A;  4IY5 A;  3C31 A;  3E4R A;  4IO2 A;  4R73 A;  3VLV A;  5F7V A;  1IIW A;  1WVJ A;  3O9P A;  1B6H A;  3OO6 A;  3S2V A;  4OHN A;  3H6T A;  1NH8 A;  5DEX B;  4ZE9 A;  4GL0 A;  1A8F A;  5IAI A;  1IUD A;  4GWO A;  3N6T A;  3OXN A;  1LFI A;  1OIB A;  2B3B A;  3FZV A;  2AIX A;  2HZK A;  2D5W A;  4KHZ E;  1MQD A;  2KLF A;  4IO7 A;  3QAX A;  4U22 A;  4YKJ A;  5CI5 A;  4G77 A;  4HCW A;  5EYF A;  4F1Y A;  3PU5 A;  2NUV A;  4I8C A;  4GRK A;  4X1D A;  3U93 A;  1LST A;  1PBP A;  3OOA A;  1AL3 A;  1B51 A;  2XXU A;  4GD5 A;  5I57 A;  3QK6 A;  3PUZ E;  2H5Y A;  1VR5 A;  2ZYN A;  1DSN A;  4JXI A;  5AA3 A;  1B7U A;  2O84 X;  1ZTY A;  3K4U A;  3S9L C;  4NF5 A;  4OQO A;  4QSC A;  3KN3 A;  5I2N B;  4OFJ A;  2DP8 A;  1MM7 A;  4R75 A;  1LGB C;  3SEU A;  3C4M A;  4RNS A;  1MXY A;  3QIM A;  3EHU A;  4G68 C;  5JEI A;  1XC1 A;  2THI A;  1B9J A;  3OEK A;  4U23 A;  4TLL B;  5CMB A;  2ESN A;  1AOV A;  2GH9 A;  3IR1 A;  1N7X A;  2Z8F A;  2ONS A;  3IB1 A;  1MG1 A;  2IEE A;  2VGQ A;  3IX1 A;  5TPA B;  5KDT B;  3KN7 A;  4QFL A;  1L5T A;  3MVX A;  3R6U A;  1USY E;  2QRY A;  5F1Q A;  4F3G A;  1D3K A;  1VE4 A;  2VD3 A;  4G2Z A;  1N0T A;  4R74 A;  2R9J A;  3EQ1 A;  3W15 C;  1B0L A;  4ZED A;  2QSX A;  1M5D A;  1UIV A;  2A5T B;  3MJN A;  4M4G A;  5ICT A;  1PDA A;  2E1S A;  3D4G A;  1XT8 A;  4KCD A;  5L8D A;  3TCG A;  1UTH B;  3W9W A;  1IXI A;  1N84 A;  4OFL A;  3O66 A;  4QSD A;  4WKM A;  4LVQ A;  1IXC A;  4R6K A;  4YMA A;  1B4H A;  3OO7 A;  4ZZA A;  4IO4 A;  4NF4 B;  1MQG A;  2F36 A;  3OO8 A;  1QW0 A;  2VOZ A;  1IZ1 A;  1JET A;  2OBG A;  3E9X A;  1MPB A;  3MP8 A;  3MWB A;  3O6H A;  3ODB A;  4X9T A;  1P1U A;  1WOD A;  4OFO A;  3QSL A;  5IKB A;  4YB5 A;  4H5F A;  2Q8J A;  3TAJ A;  1N3X A;  1QUK A;  4ZS9 A;  1B7H A;  1D4N A;  1J1N A;  3PMX A;  3RGY A;  5I56 B;  1YCJ A;  2DVZ A;  3T9V A;  2ONR A;  3TEP A;  4RY1 A;  4BDQ A;  3UGW A;  1DOT A;  2DWI A;  2Q88 A;  3C32 A;  4KI0 E;  4X48 A;  2HXW A;  5FTH A;  2PX1 A;  2XXH A;  4ZEI A;  1B1H A;  1URS A;  4TLM B;  1UQW A;  5H8F A;  3GBB A;  2O51 A;  4FIM A;  1M5E A;  4MH5 A;  5CBR A;  4ESW A;  2XX7 A;  2HAV A;  1Q35 A;  3TQW A;  4KYD A;  2F78 A;  3I3V A;  2HAU A;  1IQ7 A;  1I69 A;  4OWD A;  3FVG A;  5DVI A;  4F22 A;  4YMB A;  3H03 A;  1MXU A;  2Z23 A;  3IJO B;  3Q27 A;  4IGT A;  1ZMG A;  3O97 A;  3TTR A;  4BDO A;  4AQ4 A;  4LQ2 A;  4U21 A;  4Q30 B;  3K6X A;  4H8I A;  3PD9 A;  1H45 A;  1SW5 A;  2XXY A;  4IO5 A;  1GVC A;  1RYX A;  3DP6 A;  1PEB A;  3G3H A;  3R7X A;  3BFT A;  1N04 A;  3DEL B;  2AYS A;  2QS4 A;  4QFO A;  3FD3 A;  3DM0 A;  4ISU A;  4U2R A;  4XTC Q;  3SEV A;  2F7A A;  1A7L A;  2Z22 A;  1DPE A;  1R6Z A;  3A3U A;  5H8N A;  3WAF A;  3RY3 A;  4AB5 A;  4DCY A;  2VP1 A;  5I58 B;  1SW4 A;  1PB7 A;  4KD5 A;  1FTJ A;  4P0G A;  4FAT A;  2PVU A;  4DIG A;  2H99 A;  4RXL A;  4OEU A;  1FQC A;  2YLN A;  3H06 B;  4Q5T A;  4BDN A;  5AA4 B;  2G29 A;  5AE4 A;  3U8Q A;  5CM6 A;  2AL5 A;  2XXR A;  3VV5 A;  3N94 A;  4JDF A;  4QSE A;  1H76 A;  2Q2C A;  2ZNT A;  5DVF A;  3K0V A;  4R9G A;  2F35 A;  1B3H A;  1IIT A;  5HPQ A;  4KPT A;  1LLS A;  1NMU A;  1Q1K A;  1B3F A;  2V25 A;  2ZYO A;  3MZ9 A;  4I62 A;  4NE4 A;  4EF1 A;  1QUI A;  2ONK E;  3G3K A;  2DWA A;  1JNF A;  1Y4C A;  5M2V A;  2Y7I A;  4F3S A;  1B3E A;  1Y3N A;  1BP5 A;  4BLA A;  2ALU A;  1MXZ A;  2V93 A;  3HST A;  3KSX A;  2F97 A;  1B4Z A;  1DTG A;  3PD8 A;  2Q9T A;  1FTL A;  2FNC A;  1B32 A;  4HCY A;  2NWJ A;  5I56 A;  2ANJ A;  4GIZ A;  3VE1 B;  5H8H A;  3TTL A;  4ZEC A;  1Y1Z A;  3S9N C;  4IO6 A;  4XKR A;  1QVS A;  2ZXT A;  3VDF A;  3K1P A;  3FJ7 A;  4KQP A;  5HBC A;  1R9Q A;  2DE4 A;  3I6V A;  1MY4 A;  3MPK A;  4F18 A;  1JW5 A;  1VSO A;  4IY6 A;  1T0K A;  3ILT B;  5I59 A;  1US5 A;  5HM4 B;  5CMM A;  1MDP 1;  4JWO A;  4F2O A;  5I84 A;  4UAC A;  4K3F A;  4DE8 A;  1B5J A;  1H44 A;  2UVI A;  1B58 A;  3EHS A;  4P0I A;  4E0X A;  2HEU A;  1MXW A;  1FQD A;  5KCJ A;  2Y7P A;  4L17 A;  3MAM A;  3VLW A;  1N76 A;  3PPN A;  2XXW A;  4KYS A;  4PQJ A;  1MY1 A;  1VFD A;  2DWJ A;  2RCB A;  1SD3 A;  4FED A;  3SEY A;  4YU0 A;  1H3D A;  4TQU Q;  3L6G A;  4G8N A;  1MRP A;  3UOR A;  3H7M A;  2RC9 A;  3V5A A;  1JVY A;  2I3V A;  3FJG A;  3MP1 A;  4YAH X;  1MY3 A;  3MPL A;  3TUS A;  3O28 A;  3EF7 A;  1BTJ A;  2XD3 A;  1PBQ A;  4KYE A;  4N07 A;  2O68 A;  3N26 A;  1F9B A;  1OQG A;  4FJP A;  3ECR A;  5H8N B;  5L9S A;  1UTB B;  2QS1 A;  3FV1 A;  3FVO A;  4NWC A;  2RC7 A;  3TCF A;  1OMP A;  2AL4 A;  3B7D A;  4FE8 A;  4X1B A;  4F1U A;  2W7Y A;  4FEC A;  4LZ5 A;  3Q25 A;  2F6G A;  3O6G A;  3K00 A;  2Y7W A;  1A8E A;  1IEJ A;  1Y3P A;  5TP9 A;  2F7B A;  1MDQ A;  1N3W A;  2ZNU A;  4IGR A;  1Y20 A;  4QFN A;  1ZJL A;  3IL1 B;  5JK4 A;  3SER A;  3EHT A;  2UVH A;  2XD2 A;  3B6W A;  3MQ9 A;  3VVF A;  5I57 B;  2P0S A;  3E13 X;  3JYR A;  4GQO A;  3TEL A;  1ANF A;  1IXH A;  4O3C A;  2XXV A;  1NFT A;  3USD A;  3K1M A;  1TFD A;  4KR5 A;  4OEN A;  4EQB A;  3BBR A;  2Q89 A;  3PMW A;  5ISU A;  3K2D A;  2DE3 A;  1DMB A;  2PT2 A;  3SKP A;  4OMB A;  3PUW E;  4OYV A;  3O6I A;  4M1V A;  3TQL A;  5KZT A;  1A40 A;  3U92 A;  1XHY A;  1O64 A;  3K01 A;  3M3K A;  4G8M A;  4EXK A;  4YKP A;  3UIF A;  5BUU A;  5FHN A;  4R2F A;  2P1S A;  2M8C A;  3KG2 A;  3IB0 A;  1FQF A;  2GHA A;  1PC3 A;  3CIJ A;  4HTG A;  4G68 B;  3ZKK A;  4NTL A;  2QMW A;  4JWX A;  1ATG A;  3OSQ A;  1D9Y A;  3E3K A;  2OK2 A;  3TMG A;  3TOD A;  3G3G A;  3THI A;  3TTN A;  1M5C A;  4QF9 A;  2WKY A;  2UYF A;  4OEV A;  3MC2 A;  3SET A;  1P99 A;  3CG3 A;  2Y7R A;  5K2Y A;  4H1X A;  5L9M A;  1BLF A;  4F31 B;  4QRZ A;  5H8Q A;  2OJT A;  4PFY A;  3L6H A;  1RYO A;  2PMS A;  2XXP A;  1QKA A;  3HCQ A;  3IK6 B;  1ZKB A;  3OO9 A;  4GOT A;  4NF4 A;  2ZNS A;  1SYH A;  1JEV A;  2F34 A;  2VHA A;  2XX9 A;  2UXA A;  3U1O A;  4ECF A;  1MM6 A;  3HHG A;  2G93 A;  2OWT A;  1LBB A;  3UA8 A;  1JVX A;  2A5S A;  3GLB A;  4AB6 A;  3N6U A;  3HPI A;  3TTM A;  4U1Z A;  4KCC A;  1AIV A;  1FW0 A;  1S50 A;  5ELV A;  3LR1 A;  4MLV A;  4R6H A;  3RUM A;  3T9H B;  3W9V A;  2UYE A;  1UTH A;  1B5H A;  4QHQ A;  5ICQ A;  1OLA A;  4LA9 A;  2FYI A;  1S7Y A;  2REG A;  1MY2 A;  4OES A;  2ZMB A;  3CFX A;  1P1W A;  4EQ7 A;  3FIR A;  1XOC A;  2H98 A;  5H8F B;  3RTF B;  3TZA A;  1M5F A;  1POT A;  2RF1 A;  3QYT A;  3TTK A;  2I0C A;  3V89 B;  2DS9 A;  3OEL A;  2F5X A;  5CC2 A;  1B3L A;  5DTB A;  3B6Q A;  1LCF A;  3F11 A;  3H3G A;  3HV1 A;  5DYH A;  1VFE A;  3T96 B;  4WED A;  1CE2 A;  2XXI A;  3ILU B;  3VFJ A;  4XIG Q;  2PYY A;  5EHS A;  4QFP A;  3EN3 A;  4ELR A;  3BKI B;  3TCH A;  5B70 A;  3KFM A;  2QS3 A;  3LSW A;  3CFZ A;  4U1O A;  4IO3 A;  4DLD A;  1URD A;  3SDF A;  4PFU A;  3G3J A;  4YB7 A;  3TDJ A;  4YB6 A;  4OET A;  4LUB A;  3KN8 A;  3IB2 A;  2XXQ A;  3KBR A;  4JSD A;  3UP9 A;  1B46 A;  4NF6 B;  4DCX A;  5FHO A;  5CMK A;  4MBP A;  3RTW B;  1YTV A;  3V83 A;  4GF8 A;  4OTE A;  1B52 A;  1SI0 A;  3B6T A;  3MVZ A;  3OEN A;  5CRY A;  1FCK A;  3IOU A;  1EZO A;  1ZLQ A;  2DVC A;  2O7I A;  1SBP A;  4BDL A;  3K6V A;  4OZ9 A;  4RK9 A;  2R71 A;  1MH3 A;  4H5G A;  1PB8 A;  1GR2 A;  4ZEF A;  2V3U A;  4ZE8 A;  2PT1 A;  2NVU B;  2HCA A;  4G68 A;  5A5X A;  5L9O A;  4YIC A;  1TFA A;  1B1X A;  3C36 A;  1Y9U A;  3CR9 A;  4XKP A;  1SW2 A;  2QMX A;  3IAZ A;  1FQB A;  2I6E A;  3S4U A;  2E0S A;  3KOT A;  3EPE A;  2DSF A;  3D4C A;  3C35 A;  3T93 B;  1A99 A;  3MVW A;  3H4Z A;  2VD2 A;  1EZ9 A;  2FA7 A;  3FGS A;  3KGC A;  2DE2 A;  3G7W A;  4JWY A;  3U94 A;  4Q8R A;  4N13 A;  4ONY A;  4EXL A;  3LBS A;  1SDX A;  1P1N A;  3SEW A;  4BDR A;  1MPC A;  5FTI A;  4Q0C A;  2R6G E;  3KZG A;  3MVY A;  4P11 A;  3PUV E;  3H6W A;  4GLI A;  1NNK A;  1OVT A;  4H65 A;  1NKX A;  4POW A;  2GHB A;  3VXC A;  3MP6 A;  4EDP A;  1HSJ A;  4IB2 A;  2O6A A;  4DXB A;  4F29 A;  2B65 A;  4F2Q A;  1SI1 A;  1SVX B;  3WAE A;  4ZEK A;  2V84 A;  3FXR A;  4THI A;  3DP8 A;  4QFK A;  5AA4 A;  3OMB A;  1JQF A;  1XS5 A;  2I0B A;  4YZZ A;  2YJP A;  1R9L A;  2B3F A;  1O7T A;  4I9D A;  3SEX A;  1OQH A;  2DXR A;  2GRV A;  2OLB A;  1OVB A;  3V8X B;  4C0R A;  1NNT A;  1USY H;  1XVY A;  4JSO A;  3GZG A;  4PE5 B;  4GFR A;  4I1D A;  2Q2A A;  4MF3 A;  1MPD A;  5I2K A;  5B7D A;  3G3F A;  5AA2 D;  1JEU A;  1BKA A;  1NNF A;  2LAO A;  4H6D A;  1ZIU A;  3FAT A;  4Z0I A;  5H8H B;  1QKB A;  3S9M C;  3PPO A;  1NL5 A;  3FXU A;  5CMC A;  1OLC A;  3MW0 A;  1GTK A;  2CMO A;  2O7U A;  4POX A;  1I6A A;  4H0W A;  3FV2 A;  3TYH A;  4E0W A;  3RT6 B;  1LB8 A;  2I48 A;  4ZEB A;  3UN6 A;  4XKQ A;  5I58 A;  1NH7 A;  2A5T A;  2IA4 A;  3FUZ A;  3K1N A;  4F3B A;  2NXO A;  3LC8 A;  1B40 A;  1MXV A;  3FXQ A;  4H8J A;  1JW4 A;  1LCT A;  4HS7 A;  3VLU A;  2F8D A;  4PP0 A;  4F3P A;  1US4 A;  3CRB A;  4F19 A;  1FQE A;  1HSL A;  1P1Q A;  1PB9 A;  2Z8E A;  3GXA A;  3ONM A;  3QUJ A;  3AXF A;  4LON B;  3C34 A;  3R26 A;  5DT6 A;  3MUQ A;  4C1T A;  2DQV A;  3CFL A;  3KEI A;  5AA2 B;  2RIN A;  4LZ7 A;  4FEB A;  3RN8 A;  3RLF E;  3PV0 E;  3DP4 A;  4GL8 A;  1TT1 A;  4RPN A;  5KDT A;  2ABH A;  1AH5 A;  2I3W A;  3FJM A;  3IO6 A;  1IXG A;  1M5B A;  1JW1 A;  1XVX A;  1MS7 A;  3OEM A;  1YAE A;  3OSR A;  4N6P A;  1UTB A;  4RPO A;  1A54 A;  4WXJ A;  1Y1M A;  3DLN A;  5A5X B;  1B2H A;  1FTO A;  1LFH A;  4LP2 B;  1B0H A;  2XXT A;  3JV9 A;  4R9F A;  2I49 A;  3HHF A;  3IJX B;  1Z7N E;  4PET A;  3RT8 A;  2YPN A;  2O1M A;  1Y3Q A;  4ZDM A;  3T9X B;  3MZB A;  3CG1 A;  5CBS A;  3ZS6 A;  3RNN A;  1TWY A;  3CVG A;  1I6Q A;  5K2X A;  1QUJ A;  2F7C A;  4YKK A;  3MZ1 A;  3U72 A;  3GBA A;  4C1U A;  5J1D A;  1BIY A;  3N5L A;  3CI8 A;  3H6U A;  4LZ8 A;  3K6W A;  5I2N A;  3FAS A;  3LSL A;  2Z8D A;  3A09 A;  1URG A;  1MY0 A;  1O63 A;  1FTK A;  4O3A A;  1B7Z A;  3IO4 A;  5JTY B;  5AA1 A;  2H9B A;  2GFE A;  3MBP A;  3PPQ A;  4Z7E A;  3T66 A;  4LAT A;  1LAX A;  5TP9 B;  4ELO A;  5AA2 A;  2REJ A;  4EUO A;  4XKN A;  2NOO A;  2X7P A;  2XHD A;  3UK4 A;  1Y4T A;  2DWH A;  3HN0 A;  1MQI A;  2UVJ A;  1YPN A;  4XXU A;  4ESX A;  2PBW A;  4MFI A;  1A55 A;  3LSF B;  3VVE A;  4NF8 B;  3FVK A;  4DXU A;  1B5I A;  4R2B A;  3SES A;  1P1O A;  2D3I A;  2ZYK A;  1FQA A;  3M3F A;  3VVD A;  4JBZ A;  3RQT A;  3PUY E;  1QUL A;  1MQH A;  1POY 1;  3Q26 A;  2HFB A;  3LSX A;  2BJJ X;  1LBC A;  4YKI A;  5I2K B; 
#chains in the Genus database with same CATH topology
 4N8G A;  2QS2 A;  1KZ8 A;  4JB7 A;  3TFL A;  2FIE A;  4U4S A;  4F1V A;  3T22 A;  1B05 A;  2OCU A;  3K6U A;  5ITP A;  2RCA A;  1IMD A;  1EH3 A;  1MQJ A;  5EQ9 A;  4R6Y A;  2CEY A;  2HQ0 A;  3G3I A;  4WEP A;  3OD7 A;  2OX3 A;  4NF8 A;  3O29 A;  4G4P A;  3VXB A;  2X26 A;  3PPR A;  4GXS B;  3LUZ A;  4FOR A;  2P2A A;  2X7Q A;  2Y7K A;  4EF2 A;  5JTY A;  3RPW A;  1UIU A;  1B3G A;  1Z7M E;  1HSE A;  4NF6 A;  4U4X A;  2HZL A;  3QXM A;  4N91 A;  4ELP A;  2I4B A;  1IMA A;  5TPA A;  1GGG A;  1LAF E;  4GL8 A;  4I40 A;  2QL3 A;  3KSJ A;  2O1L A;  4KFQ A;  4OER A;  3M3L A;  4IO2 A;  1IIW A;  3O9P A;  1NV1 A;  3H6T A;  1NH8 A;  5IAI A;  3OXN A;  2B3B A;  2HZK A;  2KLF A;  4IO7 A;  4GX6 A;  5CI5 A;  4F1Y A;  1LEV A;  4N6K A;  1LST A;  4JVC A;  5I57 A;  4OVP A;  1ZTY A;  4NF5 A;  4OQO A;  3KN3 A;  2DP8 A;  3C4M A;  3EHU A;  4G68 C;  4KXP A;  4U23 A;  4TLL B;  5EYH A;  4MCO A;  1MG1 A;  5TPA B;  3KN7 A;  1L5T A;  3MVX A;  3R6U A;  2QRY A;  3W15 C;  2QSX A;  2A5T B;  3MJN A;  5EQ7 A;  2WX9 A;  1IXI A;  4OFL A;  4QSD A;  1B4H A;  4UAB A;  4ZZA A;  1MQG A;  3MWB A;  1MPB A;  3O6H A;  5IKB A;  1N3X A;  4MEV A;  5IM2 A;  1J1N A;  4NHB A;  1DOT A;  3C32 A;  1NUY A;  1UQW A;  2L5V A;  4MH5 A;  4ESW A;  2HAV A;  1Q35 A;  3TQW A;  5ET8 A;  4F22 A;  3H03 A;  3TTR A;  1ZMG A;  2XA5 A;  4Q30 B;  4H8I A;  1H45 A;  3G3H A;  3R7X A;  3DEL B;  4XTC Q;  1A7L A;  5H8N A;  3WAF A;  5I58 B;  1FPK A;  2VP1 A;  4FAT A;  3FXB A;  1DBZ A;  5AA4 B;  2G29 A;  5AE4 A;  3U8Q A;  4QSE A;  5DVF A;  1NMU A;  4I62 A;  2DWA A;  4GWX A;  5M2V A;  4F3S A;  3A29 A;  3KSX A;  2F97 A;  3PD8 A;  2Q9T A;  4HCY A;  4N81 A;  4ZEC A;  3T1B A;  1QGX A;  1T0K A;  1VSO A;  1US5 A;  5CMM A;  5I84 A;  4DE8 A;  3EHS A;  4P0I A;  5KCJ A;  2Y7P A;  4F1U A;  3MAM A;  4PQJ A;  2DWJ A;  2RCB A;  4FED A;  3H7M A;  2I3V A;  3FJG A;  3TUS A;  1MY3 A;  3O28 A;  4P1E A;  4FJP A;  5L9S A;  3B7D A;  4X1B A;  4FEC A;  1A8E A;  5I58 A;  1Y3P A;  2F7B A;  1LBW A;  1MDQ A;  1N3W A;  2XWV A;  1Y20 A;  1ZJL A;  3IL1 B;  1FBC A;  3EHT A;  3E13 X;  3JYR A;  4GQO A;  1IXH A;  3PMW A;  2Q89 A;  3K2D A;  4OMB A;  4OYV A;  3TQL A;  3U92 A;  3K01 A;  3M3K A;  4YKP A;  3UIF A;  5BUU A;  2M8C A;  4P47 A;  3IB0 A;  4G68 B;  4JWX A;  3E3K A;  3TOD A;  3THI A;  3TTN A;  2UYF A;  3CG3 A;  2Y7R A;  4H1X A;  5H8Q A;  3L6H A;  1RYO A;  3IK6 B;  4GOT A;  2F34 A;  2VHA A;  2UXA A;  1MM6 A;  1LBB A;  1JVX A;  2A5S A;  5DW8 A;  4KCC A;  1EYJ A;  4R6H A;  1FJ6 A;  4LA9 A;  2ZMB A;  4OA4 A;  3CFX A;  4EQ7 A;  2H98 A;  3TZA A;  1POT A;  3TTK A;  3V89 B;  2I0C A;  2DS9 A;  5CC2 A;  3B6Q A;  3F11 A;  3HV1 A;  5DYH A;  1NUW A;  1Q9D A;  4WED A;  4XIG Q;  5EHS A;  4QFP A;  5ET5 A;  4DLD A;  3TDJ A;  4YB6 A;  3KN8 A;  2XXQ A;  1B46 A;  5FHO A;  3QMF A;  4OTE A;  1B52 A;  3IOU A;  2O7I A;  5I5P A;  1XI6 A;  2V3U A;  2NVU B;  5L9O A;  3CR9 A;  2QMX A;  2DSF A;  3T93 B;  3MVW A;  3U94 A;  3LBS A;  3SEW A;  4Q0C A;  4IR8 A;  4LN5 A;  3MYU A;  3H6W A;  1NKX A;  3VXC A;  4MNC A;  2B65 A;  3WAE A;  4PFI A;  3DP8 A;  1JQF A;  1XS5 A;  1K9Y A;  3V8X B;  3GZG A;  4GFR A;  2Q2A A;  5AA2 D;  1NNF A;  5H8H B;  4Z0I A;  4AS4 A;  3FAT A;  1QKB A;  3FXU A;  2FVZ A;  1I6A A;  3UN6 A;  1LB8 A;  5IZ3 B;  4XKQ A;  2NXO A;  1B40 A;  5IZ1 A;  3U65 A;  2F8D A;  1US4 A;  1HSL A;  1P1Q A;  4C1T A;  3KEI A;  4OVT A;  3PV0 E;  4RPN A;  5KDT A;  1AH5 A;  3IO6 A;  1IXG A;  1M5B A;  1JW1 A;  1XVX A;  3MST A;  4QXD A;  1A54 A;  1Y1M A;  3DLN A;  4O7M A;  1B2H A;  1LFH A;  4LP2 B;  1B0H A;  2I49 A;  4PET A;  2YPN A;  4P9K A;  3T9X B;  3MZB A;  3CG1 A;  5CBS A;  3ZS6 A;  1QUJ A;  4YKK A;  3BIH A;  3H6U A;  1FJ9 A;  5ET6 A;  4NG7 A;  5I2N A;  3LSL A;  1LBZ A;  3IO4 A;  3MBP A;  3T66 A;  5LDZ A;  1LAX A;  5AA2 A;  4O94 A;  3HN0 A;  1MQI A;  1YPN A;  4XXU A;  4ESX A;  4R2B A;  1P1O A;  3VVD A;  3RQT A;  1LBC A;  1MQH A;  3Q26 A;  2HFB A;  2FA7 A;  4BDR A;  1KWH A;  4RK2 A;  4NED A;  3IOT A;  4PFT A;  3PMV A;  1MXX A;  4RYA A;  2I58 A;  4PBH A;  4FAJ A;  1YXI A;  4NN3 A;  1D9Q A;  2ZYM A;  3TKD A;  5FHM A;  4BDM A;  1FTA A;  1SYI A;  2I4C A;  4P56 A;  5BWJ A;  1LFG A;  2VPN A;  3ZKL A;  4DZ1 A;  1EZP A;  4G8H A;  1LAH E;  3K02 A;  5LOM A;  4R72 A;  3HO7 A;  1AMF A;  1ZBM A;  4HE2 A;  4F39 A;  5KCJ B;  4UA8 A;  5IGA A;  1QJM A;  1LAG E;  3M8U A;  3TPA A;  2XX8 A;  2D21 A;  4DI3 D;  5EHM A;  3I5O A;  5DEX A;  4PDH A;  1LB9 A;  2V3Q A;  3IOR A;  1FBH A;  2PCR A;  1NV2 A;  1WVJ A;  4ZE9 A;  1A8F A;  3N6T A;  4KHZ E;  4U22 A;  1MQD A;  4YKJ A;  4G77 A;  4HCW A;  3PU5 A;  2NUV A;  1PBP A;  3KC1 A;  4GD5 A;  3QK6 A;  3PUZ E;  2F3D A;  2OWZ A;  2ZYN A;  4JXI A;  4GWZ A;  5AA3 A;  1B7U A;  2VPO A;  2PFZ A;  1AOV A;  1IMB A;  2Z8F A;  1USY E;  5F1Q A;  1VE4 A;  1D3K A;  4R74 A;  1M5D A;  1UIV A;  4M4G A;  1PDA A;  5L8D A;  4KCD A;  1UTH B;  3W9W A;  1N84 A;  3KBZ A;  4IO4 A;  2B4L A;  2F36 A;  4BLA A;  4X9T A;  3TAJ A;  1FBE A;  4ZS9 A;  3RGY A;  1D4N A;  1YCJ A;  2ONR A;  4RY1 A;  1IMC A;  3UGW A;  4X48 A;  2PX1 A;  4TLM B;  5EQA A;  1M5E A;  4G61 A;  2XX7 A;  2CZK A;  4JVD A;  2F78 A;  5DVI A;  3Q27 A;  3IJO B;  2Z23 A;  4U21 A;  3K6X A;  4N8Y A;  3PD9 A;  1GVC A;  2P3N A;  3BFT A;  1N04 A;  3FD3 A;  4U2R A;  2F7A A;  2Z22 A;  3A3U A;  1PB7 A;  4P0G A;  4N6D A;  4Q5T A;  1H76 A;  2ZNT A;  1FPD A;  5HPQ A;  2ZYO A;  1B3F A;  4NE4 A;  3G3K A;  1JNF A;  2QVR A;  1BP5 A;  2ALU A;  1MXZ A;  2V93 A;  1DTG A;  3B50 A;  3VE1 B;  1Y1Z A;  2Y5L A;  2ZXT A;  3K1P A;  4KQP A;  1FRP A;  5A5L A;  1EYI A;  4F18 A;  1JW5 A;  4UAC A;  2WYP A;  1H44 A;  2FHY A;  1B58 A;  4E0X A;  1FQD A;  3VLW A;  2BJI A;  3PPN A;  1VFD A;  3SEY A;  4YU0 A;  3UOR A;  5IZ3 A;  3EF7 A;  1BTJ A;  2XD3 A;  4KYE A;  1UTB B;  2QS1 A;  3FVO A;  4NWC A;  3TCF A;  2XWI A;  2AL4 A;  4NX1 A;  2V4C A;  2Y7W A;  5AA2 B;  5JK4 A;  3RPL B;  3SER A;  3TEL A;  3USD A;  3K1M A;  3SKP A;  1DMB A;  3PUW E;  4M1V A;  1NV0 A;  4XEQ A;  4G8M A;  2P1S A;  1FQF A;  2GHA A;  3CIJ A;  1ATG A;  1D9Y A;  2OK2 A;  4OEV A;  1P99 A;  1BLF A;  4I3E A;  4F31 B;  4EQB A;  4PFY A;  4NF4 A;  3OO9 A;  1ZKB A;  3U1O A;  1JEV A;  2G93 A;  1AIV A;  1S50 A;  4I3Y A;  4QHQ A;  4X04 A;  4H46 A;  2REG A;  1MY2 A;  2P3V A;  5H8F B;  4P3L A;  4GBV A;  4XFE A;  4PF8 A;  3H3G A;  3T96 B;  3EN3 A;  4ELR A;  3TCH A;  5B70 A;  2QS3 A;  3CFZ A;  2Q74 A;  4PFU A;  3G3J A;  4XF5 A;  1AWB A;  3IB2 A;  4JSD A;  3UP9 A;  4NF6 B;  4MBP A;  4GF8 A;  1FCK A;  1EZO A;  1SBP A;  3K6V A;  1PB8 A;  1GR2 A;  1TFA A;  1B1X A;  3KOT A;  4OVQ A;  3H4Z A;  3KGC A;  3G7W A;  4N13 A;  3NOH A;  3PUV E;  1NNK A;  1OVT A;  4POW A;  4MIJ A;  2GHB A;  3MP6 A;  4F2Q A;  4IB2 A;  2O6A A;  1SI1 A;  4ZEK A;  3OMB A;  2I0B A;  2YJP A;  1R9L A;  2OLB A;  1OVB A;  1NNT A;  1USY H;  4PE5 B;  2XXK A;  1MPD A;  5B7D A;  3G3F A;  1BKA A;  1ZIU A;  1NL5 A;  5CMC A;  1OLC A;  1GTK A;  4E0W A;  2I48 A;  4PGP A;  1NH7 A;  2A5T A;  3FUZ A;  3LC8 A;  3FXQ A;  1LCT A;  3VLU A;  3CRB A;  3AXF A;  4LON B;  3R26 A;  3MUQ A;  2RIN A;  3RLF E;  3DP4 A;  3B8B A;  4N6P A;  3JV9 A;  4R9F A;  3IJX B;  4ZDM A;  1Y3Q A;  3RNN A;  1TWY A;  2R8T A;  1I6Q A;  4C1U A;  3U72 A;  1BIY A;  2XWK A;  3K6W A;  3FAS A;  1MY0 A;  5JTY B;  2H9B A;  4LAT A;  5TP9 B;  4ELO A;  4XKN A;  2NOO A;  2X7P A;  3UK4 A;  4MX6 A;  2PBW A;  3LSF B;  2ZZW A;  4NF8 B;  3FVK A;  5LTC A;  4JBZ A;  1POY 1;  5DEX B;  3LSX A;  4YKI A;  3P7I A;  1S9T A;  4TOZ A;  3KJ7 A;  4OXV A;  1FTM A;  2DOJ A;  3Q29 A;  5I59 B;  4ZZE A;  5H8Q B;  4HW8 A;  3C33 A;  2QPQ A;  2OWS A;  1SW1 A;  5EQ8 A;  3H6V A;  4OAN A;  2H4I A;  5DVJ A;  1MH4 A;  4OVJ A;  1RKM A;  4NF5 B;  1IME A;  1DTZ A;  3IOW A;  4GXA A;  4OVS A;  3JZJ A;  4DDD A;  4MLQ A;  3ZSF A;  3LUY A;  1CNQ A;  1YYZ A;  4DXC A;  1SQY A;  4GVO A;  3KJT A;  3C9H A;  2RKM A;  2Y84 A;  4EQ9 A;  4NWD A;  1D9V A;  2OZZ A;  1WDN A;  2DXY A;  5ITO A;  3IFA A;  1NNP A;  2CZL A;  1TXF A;  3VLV A;  1CB6 A;  3C31 A;  3E4R A;  4R73 A;  1B6H A;  3OO6 A;  4OHN A;  1IUD A;  2WYK A;  1LFI A;  3FZV A;  2GQ1 A;  2D5W A;  3QAX A;  4X1D A;  4GRK A;  3U93 A;  3OOA A;  1AL3 A;  2H5Y A;  1DSN A;  1G0H A;  2O84 X;  4QBA A;  4OFJ A;  4R75 A;  1LGB C;  1MXY A;  3QIM A;  1XC1 A;  1B9J A;  3OEK A;  2GH9 A;  2ONS A;  3IB1 A;  3IX1 A;  3IFC A;  5KDT B;  4QFL A;  4F3G A;  1KA0 A;  2R9J A;  3EQ1 A;  1B0L A;  2F3B A;  5ICT A;  2E1S A;  3D4G A;  1XT8 A;  3TCG A;  4WKM A;  4LVQ A;  4R6K A;  4YMA A;  3OO7 A;  4NF4 B;  1QW0 A;  5I2N B;  1IZ1 A;  3MP8 A;  2OBG A;  4PDD A;  1P1U A;  4OFO A;  4YB5 A;  3KC0 A;  1QUK A;  2ZZX A;  1INP A;  3T9V A;  4N4U A;  4BDQ A;  2DWI A;  4KI0 E;  2HXW A;  2CZH A;  5H8F A;  2O51 A;  4NQ8 A;  2KR0 A;  4GX3 A;  4YMB A;  4IGT A;  3O97 A;  4BDO A;  4AQ4 A;  4LQ2 A;  4FBP A;  4MJO A;  2Q8M A;  2XXY A;  2B4M A;  3DM0 A;  4ISU A;  1R6Z A;  4AB5 A;  3RY3 A;  4KD5 A;  2PVU A;  4RXL A;  4OEU A;  3H06 B;  4MNP A;  5CM6 A;  2HPG A;  3CHG A;  4R9G A;  4KPT A;  1LLS A;  2V25 A;  1VDW A;  3MZ9 A;  4P1L A;  1FBF A;  1QUI A;  1Y4C A;  4GWU A;  2Y7I A;  1B3E A;  1Y3N A;  3BIG A;  1DK4 A;  4MNI A;  1B4Z A;  1FTL A;  2NWJ A;  1B32 A;  5I56 A;  2ANJ A;  4GIZ A;  5H8H A;  4IO6 A;  4XKR A;  5HBC A;  1R9Q A;  1MY4 A;  3MPK A;  4JWO A;  4F2O A;  1B5J A;  2XXW A;  1SD3 A;  1H3D A;  4TQU Q;  3L6G A;  4G8N A;  4PGN A;  1MRP A;  3V5A A;  2RC9 A;  1JVY A;  3MP1 A;  4YAH X;  1PBQ A;  4N07 A;  2QFL A;  3N26 A;  1F9B A;  1OQG A;  1RDZ A;  1FPL A;  3ECR A;  5FBP A;  5H8N B;  3FV1 A;  1OMP A;  4FE8 A;  2W7Y A;  3Q25 A;  2F6G A;  3O6G A;  3K00 A;  5TP9 A;  2ZNU A;  4IGR A;  5I57 B;  4KR5 A;  3HFU A;  4OEN A;  2PT2 A;  1SPI A;  3LV0 A;  4JVI A;  5KZT A;  1XHY A;  1O64 A;  4EXK A;  3KG2 A;  4HTG A;  4N15 A;  3G3G A;  1M5C A;  4QF9 A;  2WKY A;  1IMF A;  3SET A;  3MC2 A;  4PC9 A;  5L9M A;  2OJT A;  2XXP A;  3S9E A;  1QKA A;  3HCQ A;  4DCY A;  1SYH A;  4ECF A;  3HHG A;  4H45 A;  2OWT A;  3T0J A;  3UA8 A;  3N6U A;  3TTM A;  4U1Z A;  1FW0 A;  5ELV A;  3LR1 A;  4MLV A;  2UYE A;  1RDY A;  1B5H A;  5ICQ A;  1OLA A;  2FYI A;  4NGU A;  2FBP A;  1P1W A;  3FIR A;  1M5F A;  3QYT A;  2RF1 A;  3GYY A;  1B3L A;  5DTB A;  1LCF A;  1CE2 A;  2XXI A;  3VFJ A;  2PYY A;  3BKI B;  3KFM A;  4U1O A;  4IO3 A;  1URD A;  4YB7 A;  4OET A;  2HHM A;  1FPF A;  1YTV A;  3MVZ A;  3B6T A;  3OEN A;  4BDL A;  4OZ9 A;  4RK9 A;  2R71 A;  1MH3 A;  4ZEF A;  2JJK A;  2HCA A;  5A5X A;  1Y9U A;  3IAZ A;  1FQB A;  2E0S A;  3EPE A;  3D4C A;  3C35 A;  5EYG A;  1A99 A;  3ROJ A;  2DE2 A;  4JWY A;  4Q8R A;  1MPC A;  4P11 A;  4GLI A;  4EDP A;  1NV5 A;  4PAF A;  3FXR A;  4QFK A;  1O7T A;  4I9D A;  2DXR A;  2GRV A;  1XVY A;  4MF3 A;  5I2K A;  2LAO A;  2KQZ A;  3S9M C;  3PPO A;  4H0W A;  3FV2 A;  1FPE A;  4F3B A;  2FIX A;  4HS7 A;  1MXV A;  1FPG A;  1JW4 A;  4PP0 A;  1NV7 A;  2Y5K A;  3GXA A;  3C34 A;  4GWY A;  5DT6 A;  2QVV A;  1TT1 A;  2ABH A;  2I3W A;  2PFY A;  4PE3 A;  3D1R A;  3OEM A;  1YAE A;  1UTB A;  4WXJ A;  2QVU A;  3HHF A;  3RT8 A;  3CVG A;  5K2X A;  3GBA A;  1FBD A;  3CI8 A;  4LZ8 A;  3A09 A;  1URG A;  4O3A A;  3PPQ A;  2XHD A;  1NV6 A;  3VVE A;  4MFI A;  1B5I A;  3SES A;  2D3I A;  2ZYK A;  1FQA A;  3PUY E;  3CSB A;  2O69 A;  2DYX A;  4NMY A;  3CSG A;  1NV3 A;  2UVG A;  1GV8 A;  1NI9 A;  3T9U A;  5IZZ A;  5TU0 A;  4RA1 A;  2QJE A;  3BFU A;  2F6P A;  4ELQ A;  3A3C A;  3KOS A;  2H25 A;  3PGF A;  3FVN A;  1H43 A;  3IOV A;  4H67 A;  4O7I A;  4OVR A;  2V3T A;  4ND9 A;  1R1N A;  4PAI A;  2XXX A;  3PPP A;  1ZU0 A;  2WBB A;  4AS5 A;  3QUF A;  4DI4 B;  3Q28 A;  1N7W A;  5H8S A;  1LBY A;  1DPP A;  5I3S A;  3PUX E;  1EU8 A;  4PFW A;  4O3B A;  4RJZ A;  2RC8 A;  1I6B A;  1II5 A;  4MAG A;  4GWS A;  1ELJ A;  4LQ5 A;  4GBW A;  3O2A A;  4IY5 A;  2WBD A;  5F7V A;  4PFR A;  3S2V A;  5ET7 A;  4GL0 A;  4GWO A;  1OIB A;  2AIX A;  5EYF A;  4I8C A;  1NUZ A;  3RPL A;  1B51 A;  2XXU A;  1VR5 A;  3K4U A;  3S9L C;  4QSC A;  1MM7 A;  3SEU A;  3ISP A;  5JEI A;  4RNS A;  2THI A;  1JP4 A;  5CMB A;  2ESN A;  3IR1 A;  1N7X A;  2IEE A;  2VGQ A;  2CZI A;  2VD3 A;  4G2Z A;  1N0T A;  4ZED A;  3O66 A;  1IXC A;  3OO8 A;  2VOZ A;  3E9X A;  1JET A;  5J16 A;  3ODB A;  1WOD A;  3QSL A;  2Q8J A;  4H5F A;  1LBX A;  1B7H A;  3E79 A;  3PMX A;  5I56 B;  2DVZ A;  3TEP A;  2Q88 A;  5ESY A;  5FTH A;  2XXH A;  4ZEI A;  5T3J A;  1B1H A;  1URS A;  3GBB A;  4FIM A;  5CBR A;  4KYD A;  3I3V A;  2HAU A;  1IQ7 A;  1I69 A;  4OWD A;  3FVG A;  1MXU A;  1SW5 A;  4IO5 A;  2CEX A;  1RYX A;  3DP6 A;  1PEB A;  2AYS A;  2QS4 A;  4QFO A;  1NUX A;  1DPE A;  4MMP A;  1SW4 A;  1FTJ A;  4DIG A;  2H99 A;  1FQC A;  2YLN A;  4BDN A;  2AL5 A;  2XXR A;  3VV5 A;  3N94 A;  4JDF A;  2Q2C A;  3K0V A;  2F35 A;  1B3H A;  1IIT A;  5I59 A;  1Q1K A;  2ONK E;  3HST A;  2FNC A;  5I7I A;  3TTL A;  3S9N C;  1QVS A;  3VDF A;  3FJ7 A;  1BK4 A;  2DE4 A;  3I6V A;  4IY6 A;  3ILT B;  3E78 A;  5HM4 B;  1MDP 1;  1FBP A;  4K3F A;  2UVI A;  2HXR A;  2HEU A;  1MXW A;  4L17 A;  1N76 A;  4KYS A;  5F24 A;  1MY1 A;  2XWO A;  3MPL A;  2O68 A;  1EYK A;  2RC7 A;  3EKI A;  4LZ5 A;  4MHF A;  1IEJ A;  4QFN A;  3VVF A;  2UVH A;  2XD2 A;  3B6W A;  3MQ9 A;  2P0S A;  4NF0 A;  1ANF A;  4O3C A;  3SZP A;  2XXV A;  1NFT A;  1TFD A;  5ISU A;  3BBR A;  2DE3 A;  3O6I A;  1A40 A;  1FPI A;  5FHN A;  4R2F A;  2VT5 A;  4NAP A;  1FPB A;  1PC3 A;  3ZKK A;  4NTL A;  2QMW A;  3TMG A;  3OSQ A;  2WEF A;  5K2Y A;  4QRZ A;  4GX4 A;  2PMS A;  4AB6 A;  3T9H B;  4EF1 A;  2ZNS A;  4F29 A;  2XX9 A;  3GLB A;  1RDX A;  1YZ0 A;  3HPI A;  3RUM A;  3W9V A;  4O8M A;  1UTH A;  1S7Y A;  4P8B A;  4OES A;  1XOC A;  3RTF B;  4DCX A;  4HE1 A;  3OEL A;  2F5X A;  1G0I A;  1VFE A;  3ILU B;  3LSW A;  3SDF A;  4PFB A;  4HE0 A;  4LUB A;  3KBR A;  1FBG A;  5CMK A;  3V83 A;  3RTW B;  1SI0 A;  5CRY A;  1ZLQ A;  2DVC A;  4H5G A;  1K9Z A;  4ZE8 A;  2PT1 A;  4G68 A;  4YIC A;  3C36 A;  1FSA A;  1DCU A;  4XKP A;  1SW2 A;  3S4U A;  2I6E A;  2VD2 A;  1EZ9 A;  3FGS A;  4ONY A;  4EXL A;  1SDX A;  1P1N A;  2DDK A;  5FTI A;  4PF6 A;  2R6G E;  3KZG A;  3MVY A;  4H65 A;  1HSJ A;  4DXB A;  1SVX B;  2V84 A;  4THI A;  5AA4 A;  4YZZ A;  1NV4 A;  2B3F A;  3SEX A;  1OQH A;  2MKZ A;  4PAK A;  4C0R A;  4JSO A;  4I1D A;  4HXV A;  4GWW A;  1JEU A;  4H6D A;  3MW0 A;  2CMO A;  2O7U A;  4POX A;  3TYH A;  3RT6 B;  4ZEB A;  3K1N A;  2IA4 A;  3RYD A;  3PTY A;  4H8J A;  4F3P A;  1LBV A;  4F19 A;  1FQE A;  1PB9 A;  2Z8E A;  3ONM A;  3QUJ A;  2DQV A;  3CFL A;  4LZ7 A;  4FEB A;  3RN8 A;  4X8R A;  3FJM A;  1MS7 A;  1KA1 A;  4RPO A;  3OSR A;  5A5X B;  1FTO A;  2XXT A;  1Z7N E;  2O1M A;  2ZZV A;  5J1D A;  2F7C A;  3MZ1 A;  4PTK A;  3N5L A;  3FBP A;  2Z8D A;  1O63 A;  1FPJ A;  1FTK A;  1B7Z A;  5AA1 A;  2GFE A;  4N17 A;  4Z7E A;  2REJ A;  4EUO A;  1Y4T A;  2DWH A;  2UVJ A;  4PCD A;  1A55 A;  4DXU A;  4PBQ A;  3M3F A;  1QUL A;  2BJJ X;  3SEV A;  5I2K B; 
#chains in the Genus database with same CATH homology
 3P7I A;  1S9T A;  2QS2 A;  4TOZ A;  3KJ7 A;  4JB7 A;  1KWH A;  4RK2 A;  3CSB A;  4NED A;  3TFL A;  2O69 A;  4OXV A;  2DYX A;  3IOT A;  4PFT A;  4U4S A;  1FTM A;  3PMV A;  4NMY A;  1MXX A;  3CSG A;  4RYA A;  2DOJ A;  3Q29 A;  2I58 A;  5I59 B;  4F1V A;  4ZZE A;  3T22 A;  5H8Q B;  1B05 A;  2UVG A;  1GV8 A;  2OCU A;  3K6U A;  5TU0 A;  3T9U A;  4HW8 A;  2RCA A;  4FAJ A;  5ITP A;  4RA1 A;  2QJE A;  3C33 A;  3BFU A;  2QPQ A;  2ZYM A;  3TKD A;  2F6P A;  2OWS A;  4ELQ A;  1EH3 A;  1MQJ A;  1SW1 A;  3A3C A;  2H25 A;  3KOS A;  3H6V A;  3PGF A;  5FHM A;  3FVN A;  1H43 A;  3IOV A;  4H67 A;  4R6Y A;  2HQ0 A;  2H4I A;  3G3I A;  4BDM A;  1SYI A;  2I4C A;  5DVJ A;  1MH4 A;  4OVJ A;  2V3T A;  5BWJ A;  4ND9 A;  4WEP A;  3OD7 A;  4NF8 A;  1LFG A;  1R1N A;  1RKM A;  4NF5 B;  3O29 A;  2XXX A;  1DTZ A;  3IOW A;  4G4P A;  4GXA A;  3VXB A;  2X26 A;  3PPR A;  3PPP A;  3ZKL A;  4DZ1 A;  3JZJ A;  1ZU0 A;  4DDD A;  1EZP A;  4G8H A;  1LAH E;  3K02 A;  3QUF A;  4GXS B;  5LOM A;  4R72 A;  4MLQ A;  3ZSF A;  3HO7 A;  2P2A A;  1AMF A;  2X7Q A;  1ZBM A;  2Y7K A;  4FOR A;  3Q28 A;  1N7W A;  4EF2 A;  3LUY A;  5JTY A;  3RPW A;  5H8S A;  1UIU A;  1B3G A;  1DPP A;  1Z7M E;  1HSE A;  4NF6 A;  4U4X A;  2HZL A;  4DXC A;  4F39 A;  5KCJ B;  3QXM A;  4ELP A;  3S9E A;  1SQY A;  4UA8 A;  3PUX E;  2I4B A;  1EU8 A;  4PFW A;  4GVO A;  4O3B A;  5TPA A;  4RJZ A;  1GGG A;  1LAF E;  1QJM A;  2RC8 A;  1LAG E;  3KJT A;  1I6B A;  3C9H A;  2RKM A;  2XX8 A;  2Y84 A;  2D21 A;  1II5 A;  3M8U A;  4NWD A;  5EHM A;  3TPA A;  4EQ9 A;  1D9V A;  3I5O A;  2QL3 A;  5DEX A;  1LB9 A;  1ELJ A;  4LQ5 A;  2V3Q A;  2OZZ A;  3KSJ A;  2O1L A;  3IOR A;  1WDN A;  3O2A A;  4KFQ A;  4OER A;  2DXY A;  5ITO A;  2CZL A;  1NNP A;  1TXF A;  3M3L A;  1CB6 A;  4IY5 A;  3C31 A;  3E4R A;  4IO2 A;  4R73 A;  3VLV A;  5F7V A;  1IIW A;  1WVJ A;  3O9P A;  1B6H A;  3OO6 A;  3S2V A;  4OHN A;  3H6T A;  1NH8 A;  5DEX B;  4ZE9 A;  4GL0 A;  1A8F A;  5IAI A;  1IUD A;  4GWO A;  3N6T A;  3OXN A;  1LFI A;  1OIB A;  2B3B A;  3FZV A;  2AIX A;  2HZK A;  2D5W A;  4KHZ E;  1MQD A;  2KLF A;  4IO7 A;  3QAX A;  4U22 A;  4YKJ A;  5CI5 A;  4G77 A;  4HCW A;  5EYF A;  4F1Y A;  3PU5 A;  2NUV A;  4I8C A;  4GRK A;  4X1D A;  3U93 A;  1LST A;  1PBP A;  3OOA A;  1AL3 A;  1B51 A;  2XXU A;  4GD5 A;  5I57 A;  3QK6 A;  3PUZ E;  2H5Y A;  1VR5 A;  2ZYN A;  1DSN A;  4JXI A;  5AA3 A;  1B7U A;  2O84 X;  1ZTY A;  3K4U A;  3S9L C;  4NF5 A;  4OQO A;  4QSC A;  3KN3 A;  5I2N B;  4OFJ A;  2DP8 A;  1MM7 A;  4R75 A;  1LGB C;  3SEU A;  3C4M A;  4RNS A;  1MXY A;  3QIM A;  3EHU A;  4G68 C;  5JEI A;  1XC1 A;  2THI A;  1B9J A;  3OEK A;  4U23 A;  4TLL B;  5CMB A;  2ESN A;  1AOV A;  2GH9 A;  3IR1 A;  1N7X A;  2Z8F A;  2ONS A;  3IB1 A;  1MG1 A;  2IEE A;  2VGQ A;  3IX1 A;  5TPA B;  5KDT B;  3KN7 A;  4QFL A;  1L5T A;  3MVX A;  3R6U A;  1USY E;  2QRY A;  5F1Q A;  4F3G A;  1D3K A;  1VE4 A;  2VD3 A;  4G2Z A;  1N0T A;  4R74 A;  2R9J A;  3EQ1 A;  3W15 C;  1B0L A;  4ZED A;  2QSX A;  1M5D A;  1UIV A;  2A5T B;  3MJN A;  4M4G A;  5ICT A;  1PDA A;  2E1S A;  3D4G A;  1XT8 A;  4KCD A;  5L8D A;  3TCG A;  1UTH B;  3W9W A;  1IXI A;  1N84 A;  4OFL A;  3O66 A;  4QSD A;  4WKM A;  4LVQ A;  1IXC A;  4R6K A;  4YMA A;  1B4H A;  3OO7 A;  4ZZA A;  4IO4 A;  4NF4 B;  1MQG A;  2F36 A;  3OO8 A;  1QW0 A;  2VOZ A;  1IZ1 A;  1JET A;  2OBG A;  3E9X A;  1MPB A;  3MP8 A;  3MWB A;  3O6H A;  3ODB A;  4X9T A;  1P1U A;  1WOD A;  4OFO A;  3QSL A;  5IKB A;  4YB5 A;  4H5F A;  2Q8J A;  3TAJ A;  1N3X A;  1QUK A;  4ZS9 A;  1B7H A;  1D4N A;  1J1N A;  3PMX A;  3RGY A;  5I56 B;  1YCJ A;  2DVZ A;  3T9V A;  2ONR A;  3TEP A;  4RY1 A;  4BDQ A;  3UGW A;  1DOT A;  2DWI A;  2Q88 A;  3C32 A;  4KI0 E;  4X48 A;  2HXW A;  5FTH A;  2PX1 A;  2XXH A;  4ZEI A;  1B1H A;  1URS A;  4TLM B;  1UQW A;  5H8F A;  3GBB A;  2O51 A;  4FIM A;  1M5E A;  4MH5 A;  5CBR A;  4ESW A;  2XX7 A;  2HAV A;  1Q35 A;  3TQW A;  4KYD A;  2F78 A;  3I3V A;  2HAU A;  1IQ7 A;  1I69 A;  4OWD A;  3FVG A;  5DVI A;  4F22 A;  4YMB A;  3H03 A;  1MXU A;  2Z23 A;  3IJO B;  3Q27 A;  4IGT A;  1ZMG A;  3O97 A;  3TTR A;  4BDO A;  4AQ4 A;  4LQ2 A;  4U21 A;  4Q30 B;  3K6X A;  4H8I A;  3PD9 A;  1H45 A;  1SW5 A;  2XXY A;  4IO5 A;  1GVC A;  1RYX A;  3DP6 A;  1PEB A;  3G3H A;  3R7X A;  3BFT A;  1N04 A;  3DEL B;  2AYS A;  2QS4 A;  4QFO A;  3FD3 A;  3DM0 A;  4ISU A;  4U2R A;  4XTC Q;  3SEV A;  2F7A A;  1A7L A;  2Z22 A;  1DPE A;  1R6Z A;  3A3U A;  5H8N A;  3WAF A;  3RY3 A;  4AB5 A;  4DCY A;  2VP1 A;  5I58 B;  1SW4 A;  1PB7 A;  4KD5 A;  1FTJ A;  4P0G A;  4FAT A;  2PVU A;  4DIG A;  2H99 A;  4RXL A;  4OEU A;  1FQC A;  2YLN A;  3H06 B;  4Q5T A;  4BDN A;  5AA4 B;  2G29 A;  5AE4 A;  3U8Q A;  5CM6 A;  2AL5 A;  2XXR A;  3VV5 A;  3N94 A;  4JDF A;  4QSE A;  1H76 A;  2Q2C A;  2ZNT A;  5DVF A;  3K0V A;  4R9G A;  2F35 A;  1B3H A;  1IIT A;  5HPQ A;  4KPT A;  1LLS A;  1NMU A;  1Q1K A;  1B3F A;  2V25 A;  2ZYO A;  3MZ9 A;  4I62 A;  4NE4 A;  4EF1 A;  1QUI A;  2ONK E;  3G3K A;  2DWA A;  1JNF A;  1Y4C A;  5M2V A;  2Y7I A;  4F3S A;  1B3E A;  1Y3N A;  1BP5 A;  4BLA A;  2ALU A;  1MXZ A;  2V93 A;  3HST A;  3KSX A;  2F97 A;  1B4Z A;  1DTG A;  3PD8 A;  2Q9T A;  1FTL A;  2FNC A;  1B32 A;  4HCY A;  2NWJ A;  5I56 A;  2ANJ A;  4GIZ A;  3VE1 B;  5H8H A;  3TTL A;  4ZEC A;  1Y1Z A;  3S9N C;  4IO6 A;  4XKR A;  1QVS A;  2ZXT A;  3VDF A;  3K1P A;  3FJ7 A;  4KQP A;  5HBC A;  1R9Q A;  2DE4 A;  3I6V A;  1MY4 A;  3MPK A;  4F18 A;  1JW5 A;  1VSO A;  4IY6 A;  1T0K A;  3ILT B;  5I59 A;  1US5 A;  5HM4 B;  5CMM A;  1MDP 1;  4JWO A;  4F2O A;  5I84 A;  4UAC A;  4K3F A;  4DE8 A;  1B5J A;  1H44 A;  2UVI A;  1B58 A;  3EHS A;  4P0I A;  4E0X A;  2HEU A;  1MXW A;  1FQD A;  5KCJ A;  2Y7P A;  4L17 A;  3MAM A;  3VLW A;  1N76 A;  3PPN A;  2XXW A;  4KYS A;  4PQJ A;  1MY1 A;  1VFD A;  2DWJ A;  2RCB A;  1SD3 A;  4FED A;  3SEY A;  4YU0 A;  1H3D A;  4TQU Q;  3L6G A;  4G8N A;  1MRP A;  3UOR A;  3H7M A;  2RC9 A;  3V5A A;  1JVY A;  2I3V A;  3FJG A;  3MP1 A;  4YAH X;  1MY3 A;  3MPL A;  3TUS A;  3O28 A;  3EF7 A;  1BTJ A;  2XD3 A;  1PBQ A;  4KYE A;  4N07 A;  2O68 A;  3N26 A;  1F9B A;  1OQG A;  4FJP A;  3ECR A;  5H8N B;  5L9S A;  1UTB B;  2QS1 A;  3FV1 A;  3FVO A;  4NWC A;  2RC7 A;  3TCF A;  1OMP A;  2AL4 A;  3B7D A;  4FE8 A;  4X1B A;  4F1U A;  2W7Y A;  4FEC A;  4LZ5 A;  3Q25 A;  2F6G A;  3O6G A;  3K00 A;  2Y7W A;  1A8E A;  1IEJ A;  1Y3P A;  5TP9 A;  2F7B A;  1MDQ A;  1N3W A;  2ZNU A;  4IGR A;  1Y20 A;  4QFN A;  1ZJL A;  3IL1 B;  5JK4 A;  3SER A;  3EHT A;  2UVH A;  2XD2 A;  3B6W A;  3MQ9 A;  3VVF A;  5I57 B;  2P0S A;  3E13 X;  3JYR A;  4GQO A;  3TEL A;  1ANF A;  1IXH A;  4O3C A;  2XXV A;  1NFT A;  3USD A;  3K1M A;  1TFD A;  4KR5 A;  4OEN A;  4EQB A;  3BBR A;  2Q89 A;  3PMW A;  5ISU A;  3K2D A;  2DE3 A;  1DMB A;  2PT2 A;  3SKP A;  4OMB A;  3PUW E;  4OYV A;  3O6I A;  4M1V A;  3TQL A;  5KZT A;  1A40 A;  3U92 A;  1XHY A;  1O64 A;  3K01 A;  3M3K A;  4G8M A;  4EXK A;  4YKP A;  3UIF A;  5BUU A;  5FHN A;  4R2F A;  2P1S A;  2M8C A;  3KG2 A;  3IB0 A;  1FQF A;  2GHA A;  1PC3 A;  3CIJ A;  4HTG A;  4G68 B;  3ZKK A;  4NTL A;  2QMW A;  4JWX A;  1ATG A;  3OSQ A;  1D9Y A;  3E3K A;  2OK2 A;  3TMG A;  3TOD A;  3G3G A;  3THI A;  3TTN A;  1M5C A;  4QF9 A;  2WKY A;  2UYF A;  4OEV A;  3MC2 A;  3SET A;  1P99 A;  3CG3 A;  2Y7R A;  5K2Y A;  4H1X A;  5L9M A;  1BLF A;  4F31 B;  4QRZ A;  5H8Q A;  2OJT A;  4PFY A;  3L6H A;  1RYO A;  2PMS A;  2XXP A;  1QKA A;  3HCQ A;  3IK6 B;  1ZKB A;  3OO9 A;  4GOT A;  4NF4 A;  2ZNS A;  1SYH A;  1JEV A;  2F34 A;  2VHA A;  2XX9 A;  2UXA A;  3U1O A;  4ECF A;  1MM6 A;  3HHG A;  2G93 A;  2OWT A;  1LBB A;  3UA8 A;  1JVX A;  2A5S A;  3GLB A;  4AB6 A;  3N6U A;  3HPI A;  3TTM A;  4U1Z A;  4KCC A;  1AIV A;  1FW0 A;  1S50 A;  5ELV A;  3LR1 A;  4MLV A;  4R6H A;  3RUM A;  3T9H B;  3W9V A;  2UYE A;  1UTH A;  1B5H A;  4QHQ A;  5ICQ A;  1OLA A;  4LA9 A;  2FYI A;  1S7Y A;  2REG A;  1MY2 A;  4OES A;  2ZMB A;  3CFX A;  1P1W A;  4EQ7 A;  3FIR A;  1XOC A;  2H98 A;  5H8F B;  3RTF B;  3TZA A;  1M5F A;  1POT A;  2RF1 A;  3QYT A;  3TTK A;  2I0C A;  3V89 B;  2DS9 A;  3OEL A;  2F5X A;  5CC2 A;  1B3L A;  5DTB A;  3B6Q A;  1LCF A;  3F11 A;  3H3G A;  3HV1 A;  5DYH A;  1VFE A;  3T96 B;  4WED A;  1CE2 A;  2XXI A;  3ILU B;  3VFJ A;  4XIG Q;  2PYY A;  5EHS A;  4QFP A;  3EN3 A;  4ELR A;  3BKI B;  3TCH A;  5B70 A;  3KFM A;  2QS3 A;  3LSW A;  3CFZ A;  4U1O A;  4IO3 A;  4DLD A;  1URD A;  3SDF A;  4PFU A;  3G3J A;  4YB7 A;  3TDJ A;  4YB6 A;  4OET A;  4LUB A;  3KN8 A;  3IB2 A;  2XXQ A;  3KBR A;  4JSD A;  3UP9 A;  1B46 A;  4NF6 B;  4DCX A;  5FHO A;  5CMK A;  4MBP A;  3RTW B;  1YTV A;  3V83 A;  4GF8 A;  4OTE A;  1B52 A;  1SI0 A;  3B6T A;  3MVZ A;  3OEN A;  5CRY A;  1FCK A;  3IOU A;  1EZO A;  1ZLQ A;  2DVC A;  2O7I A;  1SBP A;  4BDL A;  3K6V A;  4OZ9 A;  4RK9 A;  2R71 A;  1MH3 A;  4H5G A;  1PB8 A;  1GR2 A;  4ZEF A;  2V3U A;  4ZE8 A;  2PT1 A;  2NVU B;  2HCA A;  4G68 A;  5A5X A;  5L9O A;  4YIC A;  1TFA A;  1B1X A;  3C36 A;  1Y9U A;  3CR9 A;  4XKP A;  1SW2 A;  2QMX A;  3IAZ A;  1FQB A;  2I6E A;  3S4U A;  2E0S A;  3KOT A;  3EPE A;  2DSF A;  3D4C A;  3C35 A;  3T93 B;  1A99 A;  3MVW A;  3H4Z A;  2VD2 A;  1EZ9 A;  2FA7 A;  3FGS A;  3KGC A;  2DE2 A;  3G7W A;  4JWY A;  3U94 A;  4Q8R A;  4N13 A;  4ONY A;  4EXL A;  3LBS A;  1SDX A;  1P1N A;  3SEW A;  4BDR A;  1MPC A;  5FTI A;  4Q0C A;  2R6G E;  3KZG A;  3MVY A;  4P11 A;  3PUV E;  3H6W A;  4GLI A;  1NNK A;  1OVT A;  4H65 A;  1NKX A;  4POW A;  2GHB A;  3VXC A;  3MP6 A;  4EDP A;  1HSJ A;  4IB2 A;  2O6A A;  4DXB A;  4F29 A;  2B65 A;  4F2Q A;  1SI1 A;  1SVX B;  3WAE A;  4ZEK A;  2V84 A;  3FXR A;  4THI A;  3DP8 A;  4QFK A;  5AA4 A;  3OMB A;  1JQF A;  1XS5 A;  2I0B A;  4YZZ A;  2YJP A;  1R9L A;  2B3F A;  1O7T A;  4I9D A;  3SEX A;  1OQH A;  2DXR A;  2GRV A;  2OLB A;  1OVB A;  3V8X B;  4C0R A;  1NNT A;  1USY H;  1XVY A;  4JSO A;  3GZG A;  4PE5 B;  4GFR A;  4I1D A;  2Q2A A;  4MF3 A;  1MPD A;  5I2K A;  5B7D A;  3G3F A;  5AA2 D;  1JEU A;  1BKA A;  1NNF A;  2LAO A;  4H6D A;  1ZIU A;  3FAT A;  4Z0I A;  5H8H B;  1QKB A;  3S9M C;  3PPO A;  1NL5 A;  3FXU A;  5CMC A;  1OLC A;  3MW0 A;  1GTK A;  2CMO A;  2O7U A;  4POX A;  1I6A A;  4H0W A;  3FV2 A;  3TYH A;  4E0W A;  3RT6 B;  1LB8 A;  2I48 A;  4ZEB A;  3UN6 A;  4XKQ A;  5I58 A;  1NH7 A;  2A5T A;  2IA4 A;  3FUZ A;  3K1N A;  4F3B A;  2NXO A;  3LC8 A;  1B40 A;  1MXV A;  3FXQ A;  4H8J A;  1JW4 A;  1LCT A;  4HS7 A;  3VLU A;  2F8D A;  4PP0 A;  4F3P A;  1US4 A;  3CRB A;  4F19 A;  1FQE A;  1HSL A;  1P1Q A;  1PB9 A;  2Z8E A;  3GXA A;  3ONM A;  3QUJ A;  3AXF A;  4LON B;  3C34 A;  3R26 A;  5DT6 A;  3MUQ A;  4C1T A;  2DQV A;  3CFL A;  3KEI A;  5AA2 B;  2RIN A;  4LZ7 A;  4FEB A;  3RN8 A;  3RLF E;  3PV0 E;  3DP4 A;  4GL8 A;  1TT1 A;  4RPN A;  5KDT A;  2ABH A;  1AH5 A;  2I3W A;  3FJM A;  3IO6 A;  1IXG A;  1M5B A;  1JW1 A;  1XVX A;  1MS7 A;  3OEM A;  1YAE A;  3OSR A;  4N6P A;  1UTB A;  4RPO A;  1A54 A;  4WXJ A;  1Y1M A;  3DLN A;  5A5X B;  1B2H A;  1FTO A;  1LFH A;  4LP2 B;  1B0H A;  2XXT A;  3JV9 A;  4R9F A;  2I49 A;  3HHF A;  3IJX B;  1Z7N E;  4PET A;  3RT8 A;  2YPN A;  2O1M A;  1Y3Q A;  4ZDM A;  3T9X B;  3MZB A;  3CG1 A;  5CBS A;  3ZS6 A;  3RNN A;  1TWY A;  3CVG A;  1I6Q A;  5K2X A;  1QUJ A;  2F7C A;  4YKK A;  3MZ1 A;  3U72 A;  3GBA A;  4C1U A;  5J1D A;  1BIY A;  3N5L A;  3CI8 A;  3H6U A;  4LZ8 A;  3K6W A;  5I2N A;  3FAS A;  3LSL A;  2Z8D A;  3A09 A;  1URG A;  1MY0 A;  1O63 A;  1FTK A;  4O3A A;  1B7Z A;  3IO4 A;  5JTY B;  5AA1 A;  2H9B A;  2GFE A;  3MBP A;  3PPQ A;  4Z7E A;  3T66 A;  4LAT A;  1LAX A;  5TP9 B;  4ELO A;  5AA2 A;  2REJ A;  4EUO A;  4XKN A;  2NOO A;  2X7P A;  2XHD A;  3UK4 A;  1Y4T A;  2DWH A;  3HN0 A;  1MQI A;  2UVJ A;  1YPN A;  4XXU A;  4ESX A;  2PBW A;  4MFI A;  1A55 A;  3LSF B;  3VVE A;  4NF8 B;  3FVK A;  4DXU A;  1B5I A;  4R2B A;  3SES A;  1P1O A;  2D3I A;  2ZYK A;  1FQA A;  3M3F A;  3VVD A;  4JBZ A;  3RQT A;  3PUY E;  1QUL A;  1MQH A;  1POY 1;  3Q26 A;  2HFB A;  3LSX A;  2BJJ X;  1LBC A;  4YKI A;  5I2K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...