4IO5A

Crystal structure of the avglur1 ligand binding domain complex with alanine at 1.72 angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
248
structure length
242
Chain Sequence
GSARLKGITLRIGVIESVPFTIVANVNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords AvGluR1 ligand binding domain
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
total genus 75
structure length 242
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io5A02
1QULA 3OXNA 4YU0A 1MQIA 4PFTA 3UA8A 5HM4B 3FZVA 3TTLA 1OIBA 1Y1ZA 2Y7KA 2V25A 1EU8A 1AH5A 2QS2A 1US4A 2Q8JA 1TT1A 4FJPA 3FV1A 1B40A 1VSOA 3JV9A 3TQWA 1CE2A 3S2VA 2Z23A 1YPNA 4AB6A 4H5FA 3SKPA 1EZPA 1JVYA 5H8FB 3TCGA 4XKNA 3CFZA 2F8DA 1B32A 2NVUB 2H4IA 1I6BA 3FXRA 2PT2A 3ONMA 2V84A 4G8MA 1MG1A 4JWXA 4BLAA 4KYDA 2DVZA 3UK4A 4OYVA 1OQGA 2QJEA 4G8NA 4QHQA 1LLSA 1LGBC 3PPNA 1NMUA 1B3FA 3KJ7A 2I3VA 3ZKLA 4HS7A 3SERA 5B70A 4H67A 3O28A 1IEJA 4DDDA 2Z8DA 1MXXA 3K1PA 2D21A 1PB7A 4BDRA 2G93A 2ONRA 1IXHA 3PV0E 1ZTYA 5CI5A 1OLAA 3E9XA 2F35A 4ZE8A 1Y3NA 1JETA 3C32A 1TFAA 3OO8A 1GGGA 4GQOA 2DP8A 4QF9A 2RF1A 2F78A 4G77A 2E1SA 1A55A 4F22A 4GXAA 3Q26A 3FATA 2THIA 2AL4A 3C31A 4FE8A 2XXUA 2DWAA 1URSA 1IITA 4XXUA 3G3KA 3KGCA 1QJMA 3EHSA 4ZEFA 4X1BA 3N26A 1SYHA 4G8HA 3OEKA 1MXZA 3C35A 4FATA 2UVIA 4LUBA 4HW8A 3ECRA 1B7HA 3AXFA 3UP9A 4FECA 4C1TA 5B7DA 4LONB 4LP2B 1PEBA 1B7UA 4OFJA 4ZDMA 1QKAA 3O6IA 1UTBA 5AA1A 4TLLB 4XKPA 4QFLA 1VFEA 4P0GA 5TU0A 4OWDA 1Y20A 5CBSA 3EHTA 3IR1A 4OTEA 2F6PA 4POWA 3TFLA 3RT8A 3PPPA 2FA7A 5IKBA 3K6VA 2A5TA 3JZJA 3T66A 2O69A 1RYOA 2Q2AA 3P7IA 4DLDA 2XX8A 1A99A 3IOWA 3O9PA 1AL3A 5F7VA 5ITPA 3PUZE 5DYHA 3U94A 4LA9A 4DE8A 5AA2A 4MFIA 4TLMB 2ZNSA 2VD3A 3BBRA 1NNFA 3VVEA 1RYXA 4NF4B 2RCBA 1D9VA 4NF5A 5ICQA 3RN8A 4EXLA 3MZBA 4GXSB 4I8CA 3KBRA 1MQGA 5DT6A 2XX9A 5EHMA 3G3FA 1R9QA 2O1LA 1GR2A 5AA2D 1N04A 2X26A 1B52A 4YB6A 2REGA 5CBRA 4L17A 4OMBA 2QRYA 5EHSA 5CMCA 4IO3A 5DTBA 1AIVA 5I57B 4EF2A 3LC8A 1OVBA 3BFTA 1O64A 3VXBA 4IO7A 4O3BA 4MF3A 2W7YA 1NH8A 4PP0A 4F2QA 1MRPA 3VFJA 1A7LA 3IX1A 3MP1A 4KPTA 3KSJA 4YKKA 1IXCA 1SW2A 2UVHA 1N3XA 1HSEA 2F7AA 5FTHA 2GFEA 4GL0A 5TPAA 1EZ9A 5DEXA 3S9EA 4I62A 3IO6A 5EYFA 2I4CA 2UVJA 1OQHA 1TFDA 4OZ9A 2XHDA 3QXMA 1FTMA 4MLQA 1LBBA 3TCHA 3PUVE 3LSXA 5ISUA 2UXAA 2V3UA 1B3LA 4GOTA 1JQFA 4RK2A 1MXWA 4X48A 1XT8A 1PB8A 3KOSA 2VHAA 3C4MA 3KN7A 1QVSA 4NTLA 4QFNA 1NL5A 4ONYA 3QIMA 2E0SA 3T96B 2QSXA 4Z7EA 3DP8A 2Y7IA 3FJGA 2B65A 4IGRA 2HZLA 2I48A 3VLWA 2H9BA 1ZJLA 4WEPA 3TELA 1JW4A 4G4PA 1MS7A 1DTGA 5K2YA 3S4UA 3E13X 3MW0A 2DQVA 3Q27A 2OZZA 1M5FA 3KFMA 2QMXA 3QAXA 5LOMA 4H65A 3O29A 1B6HA 5CM6A 1MY2A 1MM6A 1Y1MA 2QS1A 3PMXA 3U93A 3KJTA 2XXPA 3LBSA 4DCYA 1IXGA 2DVCA 3PD8A 3OO6A 3RUMA 3HPIA 4F3BA 3IB1A 2I4BA 3PPOA 1B05A 4KR5A 4JB7A 4BDOA 4K3FA 3G3IA 4IY6A 3WAEA 3N5LA 5K2XA 1L5TA 2OCUA 1MY3A 5CC2A 1Y9UA 5FHNA 2DE2A 4OFLA 4UACA 3SEXA 3CR9A 1B51A 3CFXA 4R73A 1JEVA 1UTHA 4F3GA 1S50A 3PUWE 2HQ0A 4R75A 1P99A 4OHNA 4R6HA 1WODA 1P1OA 4OEVA 4YMBA 1PBPA 5AA4A 3GLBA 1MXYA 4NF6A 4Q8RA 2Y7WA 3FXUA 3VE1B 4G2ZA 2VOZA 2DYXA 4ZEBA 4OVJA 1O63A 1YCJA 1MPBA 4JWOA 4PFWA 1XC1A 3RY3A 1B9JA 3PPRA 4XTCQ 3K1NA 3HV1A 2NXOA 4FEDA 5I58B 3R26A 3I3VA 5L8DA 4HTGA 2I49A 2V3TA 3GBBA 4IO4A 4ZZAA 1P1WA 4ZZEA 5CRYA 2XXHA 4EXKA 3S9MC 4H5GA 4ZEIA 1PB9A 3FVOA 4YMAA 3MC2A 3IOUA 1GVCA 1MQHA 3V5AA 4P11A 3TEPA 3O6HA 2Q2CA 1POY1 5HPQA 1SD3A 4EQBA 3FVGA 1OMPA 1SW5A 1XVXA 4C1UA 2DWHA 4U4SA 3TYHA 2ANJA 3QK6A 4GL8A 4U23A 3UN6A 2D5WA 1LFIA 3RNNA 3O6GA 4POXA 1LAFE 2I0BA 5H8NA 1P1UA 3TCFA 1LFHA 3FVKA 3RLFE 1MXVA 1F9BA 1MM7A 2RC7A 2BJJX 3K01A 1NFTA 2ZYMA 3VLUA 3OD7A 3GBAA 3O2AA 4NMYA 5I2NA 3THIA 4ECFA 3MUQA 2O7UA 3T22A 3FD3A 1RKMA 4GFRA 2RC9A 3B6TA 1TXFA 3IJXB 3ODBA 3H6WA 3V89B 1B7ZA 5A5XB 5H8FA 3KZGA 4QSDA 1PDAA 3M3KA 1J1NA 2H25A 2D3IA 2DE3A 3UORA 2YLNA 3MZ1A 4XIGQ 2A5TB 3TPAA 2Q9TA 3MP8A 1CB6A 3H4ZA 3OSRA 4ND9A 4KYEA 2R6GE 2I0CA 4BDMA 1ANFA 1XOCA 5KCJA 5J1DA 4GWOA 1MPDA 3T93B 2P0SA 1N0TA 1B0HA 5FHOA 3MPKA 1EZOA 1NNPA 2F7CA 5I2KB 3C36A 4IO6A 2A5SA 3H03A 1D9YA 3CFLA 1FQFA 3K4UA 3LSLA 3RQTA 1LB8A 4OESA 2RC8A 1VFDA 5I84A 2O6AA 3U72A 3K0VA 4OERA 1FCKA 5FHMA 1MY1A 1B3GA 4QFKA 3UIFA 5JK4A 4R2BA 3FXQA 2G29A 1B5IA 1IXIA 5L9MA 3N6UA 3E3KA 2R9JA 1UIUA 4RPNA 3CSBA 4H6DA 1S7YA 3M3FA 1Z7ME 1MH4A 1IUDA 3WAFA 4BDLA 4JSOA 3MVWA 2WKYA 1SYIA 3H6TA 3B6WA 1M5BA 2IA4A 1B3EA 3PMWA 3ZSFA 1H43A 2ONKE 2ZNTA 4H8IA 4YZZA 4JWYA 4AB5A 5CMBA 3IAZA 2XXWA 5FTIA 2FNCA 2O51A 3N94A 4P0IA 4YB7A 1O7TA 2X7QA 3SEWA 3OSQA 3FASA 2O1MA 3TKDA 1QW0A 1LB9A 3FGSA 3KN3A 4G68B 2IEEA 5DEXB 3VV5A 4Z0IA 4MH5A 1DTZA 4R6KA 3HCQA 3PUXE 5I59B 2Y84A 5AA3A 1LAXA 3EQ1A 1SQYA 4F1UA 3HN0A 4QRZA 3HHGA 1FQBA 3PD9A 1S9TA 5CMKA 4QFOA 4RA1A 3H6VA 3V8XB 4BDNA 3VLVA 3PGFA 1XS5A 5I56B 3TQLA 4KD5A 5JTYB 3EHUA 1Y3QA 3G7WA 3N6TA 1DPPA 2V93A 3FIRA 2DXYA 2XXYA 1M5DA 1URGA 2REJA 3SEVA 1IZ1A 4F1YA 4ZE9A 4EUOA 4NF4A 1DPEA 4JXIA 3K6UA 2ZNUA 4F19A 2XXIA 3U8QA 3TDJA 5AE4A 3K1MA 4XKRA 3QSLA 1B4ZA 4U22A 4N07A 4HCWA 3KOTA 3TTKA 3OO9A 3QUFA 5ICTA 1P1NA 3T9HB 1MDQA 3IOVA 3MBPA 4RXLA 4EQ9A 4ZEKA 1II5A 1B2HA 4KYSA 3OEMA 2HFBA 5I57A 3Q29A 1P1QA 3SETA 2Y7PA 4BDQA 1MH3A 3R7XA 3ZS6A 4R6YA 3A3CA 4YKJA 2H98A 2UVGA 5TP9B 2V3QA 1I6AA 4MLVA 3G3HA 4XKQA 1ZIUA 4KCDA 1FQCA 5H8QB 3VVFA 1Q1KA 3OMBA 2UYFA 1PC3A 2P2AA 3LSWA 4R72A 4NF8B 2ALUA 5M2VA 5H8SA 2OLBA 1B1XA 4OFOA 3UGWA 3USDA 5L9SA 1A54A 4I1DA 4NEDA 4LQ2A 1AOVA 4E0WA 1LBCA 2O84X 5KDTA 3K00A 2RCAA 3V83A 1JVXA 3OO7A 4Q0CA 4OENA 3D4CA 2ZMBA 3HHFA 4YB5A 2ABHA 4ESWA 3FJMA 4RK9A 5H8HB 4GLIA 1ZU0A 4NF6B 2OBGA 3IORA 1NNTA 4F1VA 4U1ZA 1B1HA 1R1NA 1D4NA 1Z7NE 4JSDA 1SVXB 3T9UA 1QKBA 2DE4A 4EQ7A 4DCXA 4PQJA 1BTJA 3OENA 3HO7A 4MBPA 3F11A 3GXAA 4GRKA 2QL3A 4KHZE 1JW1A 3RGYA 1FQDA 3FVNA 1XVYA 3ZKKA 4THIA 1SW4A 3CVGA 3DLNA 3MWBA 1B0LA 4RNSA 3I6VA 2ZYOA 4Q30B 2QS3A 4X1DA 1H45A 3DP4A 3JYRA 1A40A 2OWSA 3VVDA 4IO2A 3DELB 3BKIB 1Q35A 4R2FA 3IB0A 2F6GA 4LQ5A 3IK6B 4GIZA 4M1VA 4H0WA 3EF7A 2Y7RA 1Y4TA 2HAVA 2AIXA 4RY1A 4KCCA 1D3KA 2HAUA 4ZEDA 5H8NB 4UA8A 3CRBA 3LUYA 4PFUA 4DXUA 4LZ8A 1NKXA 1SDXA 4R9GA 2XXXA 1NNKA 3TTNA 1AMFA 1URDA 2Z22A 2Q89A 1SI1A 3I5OA 5I2NB 4YKPA 2HXWA 1I69A 1USYH 5HBCA 2F5XA 1IIWA 1DOTA 1BIYA 2XD3A 2HCAA 2GHBA 1N3WA 4OQOA 2YJPA 1FTJA 4F18A 3A09A 2GH9A 4ELPA 1TWYA 1FW0A 2FYIA 3IL1B 4WEDA 4Q5TA 2PVUA 4IGTA 3HSTA 3K6XA 3MVYA 5KCJB 1DMBA 2B3BA 4FORA 3C9HA 1FTOA 3C33A 1LCTA 3LSFB 1OLCA 5I58A 3FJ7A 3MPLA 4WXJA 3SDFA 2XXQA 3QYTA 1UTBB 2NUVA 1GTKA 3H6UA 1FTLA 1BKAA 3VDFA 5IAIA 1SW1A 4ELOA 1JEUA 1YAEA 1B46A 1MY0A 2LAOA 3G3GA 4O3AA 1ELJA 4FAJA 3K6WA 1BLFA 2B3FA 1USYE 1H3DA 1HSLA 1QUKA 4WKMA 3CG1A 1US5A 4KQPA 1B3HA 3M8UA 3KEIA 3D4GA 3TODA 4ZECA 1ATGA 5AA2B 1ZBMA 4F3PA 1HSJA 2XD2A 3CI8A 3S9NC 2X7PA 4H8JA 3MZ9A 1N84A 4NWCA 4OXVA 4FIMA 2QPQA 3TMGA 3RT6B 2F7BA 3ILTB 4KI0E 4HCYA 5L9OA 4NF5B 2DXRA 2RKMA 3L6GA 4OEUA 1MQDA 1OVTA 2DWJA 4X9TA 2VGQA 3PPQA 4YICA 1BP5A 4DZ1A 5A5XA 2VD2A 4LZ5A 4PETA 1MPCA 2ZXTA 3H3GA 2CMOA 4F39A 4F3SA 4IY5A 3PUYE 1MQJA 4JBZA 2ONSA 2PYYA 3FV2A 3ILUB 1B58A 1IQ7A 3U1OA 2PBWA 3SEUA 2H5YA 4ELRA 1KWHA 3IO4A 1LAGE 4N13A 2I6EA 3B7DA 4QSEA 1MXUA 1VE4A 1VR5A 2O68A 3W9WA 4F2OA 3E4RA 3QUJA 4N6PA 1DSNA 4EDPA 4H1XA 4ESXA 5I2KA 1ZMGA 4AQ4A 1GV8A 4RPOA 2H99A 3CIJA 4FEBA 2AYSA 2XXRA 5TPAB 1H76A 3VXCA 3SESA 4DXBA 3OELA 4IO5A 3BFUA 2QS4A 1H44A 2XXVA 1EH3A 3RTWB 4DIGA 3T9XB 4U4XA 3LR1A 1MY4A 3U92A 1LSTA 1N7XA 3OOAA 3MVZA 1M5EA 1POTA 1A8FA 2HZKA 3RPWA 1B4HA 2ZYKA 2RINA 4I9DA 4O3CA 3CSGA 4LZ7A 3TTMA 3KSXA 1XHYA 4U1OA 5BWJA 2UYEA 3FUZA 4DXCA 5CMMA 1SI0A 3G3JA 4GD5A 2P1SA 4U21A 1SBPA 1QUIA 3A3UA 2VP1A 2KLFA 3W15C 4TOZA 3B6QA 4IB2A 1FTKA 4G68A 3S9LC 1B5JA 3RTFB 3M3LA 3GZGA 3TZAA 5BUUA 4LVQA 5I59A 4YKIA 1Y4CA 4TQUQ 3IOTA 5DVIA 1UIVA 3Q25A 3DP6A 3KN8A 4QFPA 5KDTB 3TAJA 2PMSA 2ESNA 3EPEA 1JNFA 3PMVA 1N7WA 2R71A 2DWIA 4KFQA 4NE4A 4PFYA 4QSCA 5I56A 1Y3PA 5JTYA 2M8CA 1WDNA 1YTVA 1FQEA 2Z8FA 4EF1A 4R74A 2QMWA 3MP6A 2DOJA 4OETA 5KZTA 2Q88A 4G68C 1LFGA 3O97A 2XXTA 3H06B 4M4GA 4ZS9A 2F36A 4YAHX 5DVJA 1JW5A 5ELVA 3PU5A 1ZLQA 1UTHB 4ISUA 1T0KA 2NWJA 1LCFA 2F34A 2PT1A 5AA4B 2YPNA 3KG2A 3T9VA 1B5HA 1NH7A 5JEIA 4JDFA 4F29A 2AL5A 2DS9A 4R9FA 1UQWA 3EN3A 2ZYNA 5DVFA 4GF8A 4ELQA 3W9VA 4E0XA 3MVXA 3R6UA 2I58A 3L6HA 3O66A 1R9LA 2OJTA 5F1QA 2F97A 2NOOA 5TP9A 1QUJA 2GRVA 2Z8EA 3TUSA 3TTRA 1FQAA 3IJOB 1A8EA 2PX1A 2XX7A 3SEYA 3K02A 5H8QA 2OK2A 3MQ9A 1ZKBA 1WVJA 3CG3A 4NF8A 4F31B 1I6QA 3K2DA 3DM0A 1R6ZA 2O7IA 4LATA 3Q28A 2I3WA 4RYAA 1PBQA 2CZLA 1N76A 4C0RA 3MJNA 2OWTA 4RJZA 1LAHE 3C34A 2GHAA 2HEUA 4GVOA 4PE5B 3H7MA 5ITOA 2DSFA 3IB2A 4NWDA 1M5CA 4U2RA 1MDP1 5H8HA 3MAMA
chains in the Genus database with same CATH superfamily
1QULA 3OXNA 4YU0A 2V4CA 1MQIA 4PFTA 3UA8A 1G0HA 5HM4B 3FZVA 3TTLA 1OIBA 1Y1ZA 2VPNA 2Y7KA 2V25A 1EU8A 1FTAA 1AH5A 2QS2A 1US4A 3FXBA 2Q8JA 1TT1A 4FJPA 3FV1A 1B40A 1VSOA 3JV9A 3TQWA 1CE2A 3S2VA 2Z23A 1EYJA 1YPNA 4AB6A 4H5FA 3SKPA 1EZPA 1JVYA 1LBZA 5H8FB 3TCGA 4XKNA 3CFZA 2F8DA 1B32A 2NVUB 3B8BA 2H4IA 1I6BA 3FXRA 2PT2A 3ONMA 2V84A 4G8MA 1MG1A 4JWXA 4BLAA 2F3BA 5IZ3A 4KYDA 2DVZA 3UK4A 4OYVA 1OQGA 5I7IA 2QJEA 4G8NA 4QHQA 1LLSA 4LN5A 1LGBC 3PPNA 1NMUA 1B3FA 3KJ7A 2I3VA 3ZKLA 4HS7A 3SERA 5B70A 4H67A 3O28A 2FBPA 1IEJA 4DDDA 2Z8DA 1MXXA 3K1PA 4PBHA 2D21A 1PB7A 4BDRA 2G93A 2HXRA 2ONRA 1IXHA 3PV0E 1ZTYA 5CI5A 1OLAA 3E9XA 2F35A 4ZE8A 1Y3NA 1JETA 3C32A 1TFAA 3OO8A 1GGGA 4NN3A 4GQOA 2DP8A 4QF9A 2RF1A 2F78A 4G77A 2E1SA 1A55A 4F22A 4GXAA 3Q26A 1RDXA 3FATA 1RDYA 2THIA 2F3DA 4P1LA 2AL4A 3C31A 4FE8A 2XXUA 2DWAA 1URSA 1FBPA 1IITA 4XXUA 4PDHA 3G3KA 3KGCA 1QJMA 3EHSA 4ZEFA 4X1BA 3N26A 1SYHA 4G8HA 3OEKA 4N6KA 4PGNA 1YZ0A 1MXZA 3CHGA 3C35A 4FATA 2UVIA 4LUBA 4HW8A 3ECRA 1B7HA 3AXFA 3UP9A 1NUWA 4FECA 4C1TA 5B7DA 4LONB 4LP2B 1PEBA 1B7UA 4OFJA 4ZDMA 1QKAA 4MNPA 3O6IA 1UTBA 5AA1A 4TLLB 4XKPA 4QFLA 1VFEA 4P0GA 5TU0A 4OWDA 1Y20A 2P3VA 4MHFA 5CBSA 3EHTA 3IR1A 4OTEA 4PAIA 2F6PA 4JVIA 4POWA 3TFLA 3RT8A 3PPPA 2FA7A 5IKBA 3K6VA 2A5TA 3JZJA 3T66A 2O69A 1RYOA 2Q2AA 4O7IA 3P7IA 4DLDA 2XX8A 1A99A 3IOWA 3O9PA 3PTYA 1AL3A 1FPGA 5F7VA 5ITPA 3PUZE 5DYHA 2CEYA 3U94A 4LA9A 4DE8A 5AA2A 4MFIA 2FIXA 4TLMB 2ZNSA 1FBDA 2VD3A 3BBRA 1RDZA 1NNFA 3VVEA 3SZPA 5FBPA 1RYXA 5IM2A 2CZHA 4NF4B 2RCBA 1D9VA 2XWVA 4NF5A 5ICQA 2QVUA 3RN8A 4EXLA 3MZBA 3T0JA 4GXSB 4X8RA 4I8CA 3KBRA 1MQGA 5DT6A 2XX9A 5EHMA 4O7MA 3G3FA 1R9QA 4PDDA 2O1LA 1GR2A 5AA2D 1N04A 2X26A 1B52A 1EYKA 4AS5A 4YB6A 4G61A 2REGA 5CBRA 4L17A 4OMBA 2QRYA 5EHSA 4N8GA 5CMCA 4IO3A 5DTBA 1AIVA 5I57B 4EF2A 3LC8A 1OVBA 3BFTA 1O64A 4P3LA 3VXBA 4QBAA 4IO7A 4O3BA 4N8YA 4MF3A 2W7YA 1NH8A 4PP0A 4F2QA 1MRPA 3B50A 3VFJA 1A7LA 3IX1A 3MP1A 4KPTA 3KSJA 4YKKA 1IXCA 1SW2A 2UVHA 1N3XA 1HSEA 1FPJA 2F7AA 5FTHA 2GFEA 4GL0A 5TPAA 1EZ9A 5DEXA 3S9EA 4I62A 3IO6A 4PFIA 5EYFA 2I4CA 2UVJA 1OQHA 1TFDA 4OZ9A 2XHDA 4P9KA 3QXMA 1FTMA 4MLQA 1LBBA 3TCHA 3PUVE 3LSXA 5ISUA 2UXAA 2V3UA 1B3LA 4GOTA 1JQFA 4RK2A 1MXWA 4X48A 1XT8A 1PB8A 3KOSA 2VHAA 3C4MA 3KN7A 1QVSA 4NTLA 4QFNA 1NL5A 4ONYA 3QIMA 2E0SA 3T96B 2QSXA 4Z7EA 3DP8A 2Y7IA 3FJGA 2B65A 4IGRA 2HZLA 2I48A 3VLWA 2H9BA 1ZJLA 4WEPA 3TELA 1JW4A 4G4PA 1MS7A 1DTGA 2WBBA 5K2YA 3S4UA 3E13X 3MW0A 2DQVA 3Q27A 2OZZA 1M5FA 3KFMA 1FPLA 4PF8A 2QMXA 3HFUA 3QAXA 5LOMA 4H65A 2CEXA 3O29A 1B6HA 5CM6A 1MY2A 4GWSA 1MM6A 1Y1MA 3BIGA 2QS1A 3PMXA 5DW8A 3U93A 3KJTA 2XXPA 3LBSA 4DCYA 1NUYA 1IXGA 2DVCA 3PD8A 3OO6A 3RUMA 3HPIA 4F3BA 3IB1A 2Y5LA 2I4BA 3PPOA 1B05A 4KR5A 4N81A 4JB7A 4HE2A 4BDOA 3KBZA 3G3IA 4K3FA 4IY6A 3WAEA 3N5LA 5K2XA 1L5TA 1JP4A 2OCUA 1MY3A 5CC2A 1Y9UA 5FHNA 2DE2A 4OFLA 4UACA 2L5VA 3SEXA 3CR9A 1B51A 4P47A 3CFXA 4R73A 2XWOA 1JEVA 1UTHA 4F3GA 1S50A 3PUWE 4MEVA 2HQ0A 4R75A 1P99A 4OHNA 4R6HA 1YXIA 1WODA 1P1OA 4OEVA 4YMBA 1PBPA 2BJIA 5AA4A 3GLBA 1MXYA 4NF6A 4Q8RA 4PAKA 5IZ3B 2Y7WA 3FXUA 3KC1A 3VE1B 4PBQA 4G2ZA 2VOZA 2DYXA 4ZEBA 4OVJA 3MSTA 1O63A 1YCJA 4I3YA 4IR8A 1MPBA 4JWOA 4PFWA 1XC1A 4NG7A 3RY3A 1B9JA 3A29A 3PPRA 4X04A 4XTCQ 3K1NA 2OX3A 3HV1A 1FBHA 2NXOA 1NUZA 4FEDA 5I58B 4N6DA 3R26A 3I3VA 5L8DA 4HTGA 2I49A 2V3TA 3GBBA 5IGAA 4IO4A 4ZZAA 1P1WA 4ZZEA 5CRYA 2XXHA 4EXKA 3S9MC 4H5GA 4I40A 4ZEIA 1PB9A 3FVOA 4YMAA 3MC2A 5F24A 3IOUA 1DCUA 1GVCA 1MQHA 3V5AA 1FPBA 4GX4A 4P11A 3TEPA 3O6HA 2Q2CA 4MX6A 1POY1 2WBDA 5HPQA 2GQ1A 1SD3A 4EQBA 3FVGA 1OMPA 1SW5A 1XVXA 2XWKA 4C1UA 2DWHA 1LBVA 4U4SA 3TYHA 2ANJA 3QK6A 4GL8A 4U23A 3UN6A 4GBVA 5A5LA 4DI4B 2D5WA 1LFIA 3RNNA 3O6GA 4POXA 1LAFE 2I0BA 5H8NA 1P1UA 3TCFA 4PC9A 1LFHA 3FVKA 3RLFE 1MXVA 2PFYA 1F9BA 1MM7A 4OA4A 2RC7A 1LEVA 2BJJX 3K01A 1NFTA 2ZYMA 3VLUA 3OD7A 3GBAA 3O2AA 4NMYA 5I2NA 3THIA 4ECFA 3MYUA 3MUQA 2O7UA 3T22A 3FD3A 1RKMA 4GFRA 2RC9A 3B6TA 1TXFA 3IJXB 3ODBA 3H6WA 3V89B 1B7ZA 5A5XB 5H8FA 3KZGA 4QSDA 1PDAA 4MCOA 3M3KA 1J1NA 2H25A 2D3IA 2DE3A 3UORA 2YLNA 3MZ1A 4XIGQ 2A5TB 3TPAA 2Q9TA 4MNIA 4OVRA 3IFCA 3MP8A 1CB6A 4UABA 3H4ZA 3OSRA 4ND9A 4KYEA 2R6GE 2I0CA 4BDMA 1ANFA 4QXDA 1XOCA 5KCJA 5J1DA 4GWOA 1MPDA 3T93B 2P0SA 1N0TA 1B0HA 5FHOA 3MPKA 1EZOA 1NNPA 2XA5A 2F7CA 5I2KB 4NAPA 3C36A 4IO6A 1NV7A 2A5SA 3H03A 1QGXA 1LBXA 1D9YA 3CFLA 1FQFA 3K4UA 3LSLA 3RQTA 1LB8A 4OESA 2RC8A 1VFDA 5I84A 2O6AA 3U72A 3K0VA 4OERA 1FCKA 5FHMA 1MY1A 1B3GA 4QFKA 3UIFA 5JK4A 2B4MA 1NV5A 4R2BA 3FXQA 2G29A 1B5IA 1IXIA 5L9MA 3N6UA 3E3KA 2R9JA 3D1RA 1BK4A 1UIUA 4RPNA 3CSBA 4PCDA 2ZZVA 4H6DA 2FIEA 1S7YA 3M3FA 3ROJA 1Z7ME 1MH4A 1IUDA 5EYGA 4PTKA 3WAFA 4BDLA 4JSOA 3MVWA 2WKYA 1SYIA 3H6TA 3B6WA 1M5BA 2IA4A 1B3EA 3PMWA 3ZSFA 1FSAA 1H43A 2ONKE 5ESYA 3FBPA 2ZNTA 4H8IA 4YZZA 1K9YA 2DDKA 4JWYA 2FHYA 4AB5A 5CMBA 3IAZA 2XXWA 5FTIA 2FNCA 2O51A 3N94A 4P0IA 4YB7A 1O7TA 2HHMA 2X7QA 4GWXA 4KXPA 3SEWA 3OSQA 3FASA 2KQZA 2O1MA 3TKDA 1QW0A 1LB9A 3FGSA 4NX1A 3KN3A 1FJ9A 4G68B 1CNQA 2IEEA 5DEXB 3VV5A 4Z0IA 4PAFA 1IMDA 4MH5A 5I3SA 1DTZA 4R6KA 3HCQA 3PUXE 5I59B 2PFZA 1FPIA 2Y84A 3EKIA 5AA3A 1LAXA 3EQ1A 1SQYA 4F1UA 3HN0A 4QRZA 3HHGA 1FQBA 3PD9A 1S9TA 5CMKA 4QFOA 4RA1A 3H6VA 3V8XB 4BDNA 3VLVA 3PGFA 1XS5A 5I56B 3TQLA 4KD5A 1NV4A 5JTYB 3EHUA 1Y3QA 3G7WA 3N6TA 2XXKA 1DPPA 2V93A 3FIRA 4OVPA 2DXYA 2XXYA 1M5DA 1URGA 2REJA 3SEVA 1IZ1A 4F1YA 4ZE9A 4EUOA 4NF4A 1DPEA 5LDZA 4JXIA 3K6UA 2ZNUA 1INPA 4F19A 2XXIA 3U8QA 3TDJA 5AE4A 3K1MA 4XKRA 3QSLA 4I3EA 1B4ZA 4U22A 4N07A 4HCWA 3KOTA 3TTKA 3OO9A 3QUFA 5ICTA 1P1NA 3T9HB 1MDQA 3IOVA 3MBPA 4RXLA 4EQ9A 4GX6A 4ZEKA 1II5A 1B2HA 4KYSA 3OEMA 5ET6A 2HFBA 5I57A 3Q29A 1P1QA 3SETA 2Y7PA 4BDQA 1MH3A 3R7XA 3ZS6A 4R6YA 3A3CA 4YKJA 1NI9A 2H98A 2UVGA 5TP9B 2V3QA 4N15A 4N91A 5LTCA 1FBEA 1I6AA 4MLVA 3G3HA 4XKQA 1ZIUA 4KCDA 1FQCA 5H8QB 3VVFA 1Q1KA 1IMEA 3OMBA 2UYFA 1PC3A 4MNCA 2P2AA 3LSWA 4R72A 4NF8B 2ALUA 5M2VA 5H8SA 2OLBA 1B1XA 4OFOA 3UGWA 3USDA 4GWYA 5L9SA 1A54A 4I1DA 2PCRA 4NEDA 4LQ2A 1AOVA 4E0WA 1LBCA 2O84X 5KDTA 3K00A 4PF6A 2RCAA 3V83A 1JVXA 3OO7A 4Q0CA 4OENA 3D4CA 2ZMBA 3HHFA 4YB5A 2ABHA 4ESWA 3FJMA 4RK9A 5H8HB 4GLIA 1ZU0A 4NF6B 2OBGA 3IORA 3RPLA 3E79A 1FPFA 1NNTA 4F1VA 1IMCA 4U1ZA 3LUZA 1B1HA 1R1NA 1D4NA 1Z7NE 4MMPA 4JSDA 1SVXB 4NHBA 3T9UA 1QKBA 2DE4A 2QVVA 4EQ7A 4DCXA 4PQJA 1BTJA 4MJOA 3OENA 3HO7A 4MBPA 3F11A 3GXAA 4O8MA 4GRKA 2QL3A 4KHZE 1JW1A 3RGYA 1KA1A 2P3NA 1FQDA 3FVNA 1XVYA 5EQ7A 3ZKKA 4THIA 1SW4A 3CVGA 3DLNA 3MWBA 1B0LA 4HE0A 4RNSA 3I6VA 2ZYOA 4Q30B 2QS3A 1VDWA 4X1DA 1H45A 3DP4A 2Q8MA 3JYRA 1A40A 2OWSA 3VVDA 4IO2A 3DELB 3BKIB 1Q35A 4OVTA 2VPOA 2ZZXA 4R2FA 3IB0A 4JVCA 2F6GA 4LQ5A 4GX3A 3IK6B 4GIZA 4M1VA 4H0WA 3GYYA 3EF7A 2Y7RA 1Y4TA 4PFRA 2HAVA 2AIXA 1LBWA 4RY1A 4KCCA 5IZZA 1D3KA 2HAUA 4ZEDA 5H8NB 4UA8A 4P56A 3CRBA 3LUYA 4PFUA 4DXUA 4LZ8A 1NKXA 1SDXA 1IMFA 4R9GA 3BIHA 2XXXA 1FBFA 5ET5A 1NNKA 3TTNA 1AMFA 4N17A 1FBGA 1URDA 2Z22A 2Q89A 2XWIA 1SI1A 3I5OA 5I2NB 4YKPA 1Q9DA 4NF0A 2HXWA 1I69A 1USYH 5HBCA 2CZKA 4XFEA 2F5XA 4OVQA 1IIWA 4MAGA 1DOTA 1BIYA 2XD3A 4PFBA 3T1BA 2HCAA 2GHBA 3LV0A 1N3WA 4OQOA 2YJPA 1FTJA 4JVDA 4F18A 3A09A 2GH9A 4ELPA 1TWYA 1FW0A 4XEQA 2FYIA 3IL1B 4WEDA 4Q5TA 2PVUA 4IGTA 3HSTA 3K6XA 3MVYA 5KCJB 1DMBA 2B3BA 4FORA 2WX9A 3C9HA 1FTOA 3C33A 1LCTA 2ZZWA 3LSFB 1OLCA 2QVRA 5I58A 3FJ7A 2MKZA 1IMAA 3MPLA 4WXJA 3SDFA 2XXQA 3QYTA 1UTBB 2NUVA 1GTKA 3H6UA 1FTLA 1BKAA 3VDFA 5IAIA 1SW1A 4ELOA 1JEUA 2CZIA 1YAEA 1DK4A 4PGPA 1B46A 1MY0A 2LAOA 2OWZA 3G3GA 4O3AA 4PE3A 5ET7A 1ELJA 1YYZA 4FAJA 1FJ6A 4AS4A 3K6WA 1BLFA 4MIJA 2B3FA 1USYE 2Y5KA 1H3DA 1HSLA 1QUKA 4WKMA 3CG1A 4GWZA 1US5A 4KQPA 1B3HA 3M8UA 3KEIA 3D4GA 3TODA 4ZECA 1ATGA 5AA2B 1ZBMA 4F3PA 1HSJA 2XD2A 3CI8A 3S9NC 2X7PA 4H8JA 3MZ9A 1D9QA 4OVSA 5IZ1A 1N84A 4H45A 4NWCA 4OXVA 4FIMA 5T3JA 2QPQA 3TMGA 3RT6B 2F7BA 5EYHA 5EQAA 3ILTB 4KI0E 4HCYA 5L9OA 4NF5B 2DXRA 2RKMA 3L6GA 4P8BA 4OEUA 1MQDA 1OVTA 2DWJA 4X9TA 2VGQA 3PPQA 4YICA 1BP5A 4DZ1A 4GWUA 5A5XA 2VD2A 4LZ5A 4HE1A 4DI3D 4PETA 1MPCA 2ZXTA 3H3GA 2CMOA 4F39A 4F3SA 4IY5A 3PUYE 1MQJA 4JBZA 2ONSA 2PYYA 3FV2A 3ILUB 1B58A 1IQ7A 3U1OA 2PBWA 1G0IA 3SEUA 3U65A 2H5YA 4ELRA 1KWHA 3KC0A 1DBZA 1NV3A 4H46A 3IO4A 1LAGE 4N13A 2I6EA 3B7DA 4QSEA 4FBPA 1MXUA 4GBWA 1VE4A 1VR5A 2O68A 3W9WA 4F2OA 3E4RA 3QUJA 4N6PA 1DSNA 1SPIA 4EDPA 1NUXA 4H1XA 4ESXA 5I2KA 1ZMGA 4AQ4A 1GV8A 4RPOA 2WEFA 2H99A 1KZ8A 3CIJA 4FEBA 2AYSA 2XXRA 5TPAB 1H76A 3VXCA 4P1EA 3SESA 4DXBA 3OELA 4IO5A 3BFUA 2QS4A 1H44A 2XXVA 1NV2A 1EH3A 1KA0A 3RTWB 4DIGA 3T9XB 4U4XA 3LR1A 1MY4A 3U92A 1LSTA 1N7XA 3OOAA 3MVZA 2B4LA 1M5EA 1POTA 1A8FA 2HZKA 1FRPA 3RPWA 1B4HA 2ZYKA 2RINA 4I9DA 4O3CA 1FBCA 5ET8A 3CSGA 4LZ7A 3TTMA 3KSXA 1XHYA 4U1OA 5BWJA 2UYEA 3FUZA 4DXCA 4NGUA 5CMMA 1SI0A 3G3JA 4GD5A 2P1SA 4U21A 1SBPA 1IMBA 1K9ZA 1QUIA 3A3UA 2VP1A 2KLFA 3W15C 4TOZA 3B6QA 3ISPA 4IB2A 1FTKA 1AWBA 4G68A 3S9LC 1B5JA 3RTFB 3M3LA 3GZGA 3TZAA 2HPGA 4LVQA 5BUUA 5I59A 4YKIA 1Y4CA 2JJKA 4TQUQ 3IOTA 3QMFA 5DVIA 1UIVA 3Q25A 3DP6A 3KN8A 4QFPA 5KDTB 3TAJA 2PMSA 1NV6A 2ESNA 3EPEA 1JNFA 3PMVA 1N7WA 2R71A 2DWIA 4KFQA 4NE4A 4PFYA 4QSCA 1XI6A 5I56A 1Y3PA 5JTYA 2M8CA 1WDNA 3RPLB 1YTVA 1FQEA 2Z8FA 4EF1A 2WYKA 4R74A 2QMWA 3MP6A 4HXVA 2DOJA 4OETA 5KZTA 4GWWA 2Q88A 4G68C 3NOHA 1NV0A 1LFGA 3O97A 2XXTA 3H06B 4M4GA 4ZS9A 2F36A 4YAHX 5DVJA 1JW5A 1FPKA 5ELVA 3PU5A 1ZLQA 1UTHB 4ISUA 1T0KA 2NWJA 1LCFA 2F34A 2PT1A 5EQ9A 5AA4B 2YPNA 3KG2A 3T9VA 1B5HA 1NH7A 5JEIA 4JDFA 4F29A 2AL5A 2DS9A 4O94A 4R9FA 1UQWA 3EN3A 5I5PA 2ZYNA 5DVFA 4GF8A 4ELQA 1NV1A 2FVZA 3W9VA 4E0XA 3MVXA 3R6UA 2I58A 4NQ8A 3L6HA 3O66A 4XF5A 1R9LA 4N4UA 2OJTA 5F1QA 2F97A 2NOOA 5TP9A 1QUJA 2GRVA 2Z8EA 3TUSA 3TTRA 1FQAA 3IJOB 1A8EA 2PX1A 3IFAA 2WYPA 2XX7A 3SEYA 3K02A 5H8QA 2OK2A 3MQ9A 1ZKBA 1WVJA 1EYIA 5EQ8A 3CG3A 4NF8A 4F31B 1I6QA 2QFLA 2R8TA 3RYDA 3K2DA 5J16A 3DM0A 1R6ZA 2O7IA 4LATA 3Q28A 2I3WA 1LBYA 4RYAA 2KR0A 1PBQA 1FPDA 2CZLA 1N76A 2VT5A 4C0RA 3MJNA 2OWTA 4RJZA 1LAHE 3C34A 2GHAA 3E78A 2HEUA 4GVOA 4PE5B 3H7MA 5ITOA 2Q74A 2DSFA 3IB2A 1FPEA 4NWDA 4OANA 1M5CA 4U2RA 1MDP1 5H8HA 3MAMA
chains in the Genus database with same CATH topology
1QULA 3OXNA 4YU0A 1MQIA 4PFTA 3UA8A 5HM4B 3FZVA 3TTLA 1OIBA 1Y1ZA 2Y7KA 2V25A 1EU8A 1AH5A 2QS2A 1US4A 2Q8JA 1TT1A 4FJPA 3FV1A 1B40A 1VSOA 3JV9A 3TQWA 1CE2A 3S2VA 2Z23A 1YPNA 4AB6A 4H5FA 3SKPA 1EZPA 1JVYA 5H8FB 3TCGA 4XKNA 3CFZA 2F8DA 1B32A 2NVUB 2H4IA 1I6BA 3FXRA 2PT2A 3ONMA 2V84A 4G8MA 1MG1A 4JWXA 4BLAA 4KYDA 2DVZA 3UK4A 4OYVA 1OQGA 2QJEA 4G8NA 4QHQA 1LLSA 1LGBC 3PPNA 1NMUA 1B3FA 3KJ7A 2I3VA 3ZKLA 4HS7A 3SERA 5B70A 4H67A 3O28A 1IEJA 4DDDA 2Z8DA 1MXXA 3K1PA 2D21A 1PB7A 4BDRA 2G93A 2ONRA 1IXHA 3PV0E 1ZTYA 5CI5A 1OLAA 3E9XA 2F35A 4ZE8A 1Y3NA 1JETA 3C32A 1TFAA 3OO8A 1GGGA 4GQOA 2DP8A 4QF9A 2RF1A 2F78A 4G77A 2E1SA 1A55A 4F22A 4GXAA 3Q26A 3FATA 2THIA 2AL4A 3C31A 4FE8A 2XXUA 2DWAA 1URSA 1IITA 4XXUA 3G3KA 3KGCA 1QJMA 3EHSA 4ZEFA 4X1BA 3N26A 1SYHA 4G8HA 3OEKA 1MXZA 3C35A 4FATA 2UVIA 4LUBA 4HW8A 3ECRA 1B7HA 3AXFA 3UP9A 4FECA 4C1TA 5B7DA 4LONB 4LP2B 1PEBA 1B7UA 4OFJA 4ZDMA 1QKAA 3O6IA 1UTBA 5AA1A 4TLLB 4XKPA 4QFLA 1VFEA 4P0GA 5TU0A 4OWDA 1Y20A 5CBSA 3EHTA 3IR1A 4OTEA 2F6PA 4POWA 3TFLA 3RT8A 3PPPA 2FA7A 5IKBA 3K6VA 2A5TA 3JZJA 3T66A 2O69A 1RYOA 2Q2AA 3P7IA 4DLDA 2XX8A 1A99A 3IOWA 3O9PA 1AL3A 5F7VA 5ITPA 3PUZE 5DYHA 3U94A 4LA9A 4DE8A 5AA2A 4MFIA 4TLMB 2ZNSA 2VD3A 3BBRA 1NNFA 3VVEA 1RYXA 4NF4B 2RCBA 1D9VA 4NF5A 5ICQA 3RN8A 4EXLA 3MZBA 4GXSB 4I8CA 3KBRA 1MQGA 5DT6A 2XX9A 5EHMA 3G3FA 1R9QA 2O1LA 1GR2A 5AA2D 1N04A 2X26A 1B52A 4YB6A 2REGA 5CBRA 4L17A 4OMBA 2QRYA 5EHSA 5CMCA 4IO3A 5DTBA 1AIVA 5I57B 4EF2A 3LC8A 1OVBA 3BFTA 1O64A 3VXBA 4IO7A 4O3BA 4MF3A 2W7YA 1NH8A 4PP0A 4F2QA 1MRPA 3VFJA 1A7LA 3IX1A 3MP1A 4KPTA 3KSJA 4YKKA 1IXCA 1SW2A 2UVHA 1N3XA 1HSEA 2F7AA 5FTHA 2GFEA 4GL0A 5TPAA 1EZ9A 5DEXA 3S9EA 4I62A 3IO6A 5EYFA 2I4CA 2UVJA 1OQHA 1TFDA 4OZ9A 2XHDA 3QXMA 1FTMA 4MLQA 1LBBA 3TCHA 3PUVE 3LSXA 5ISUA 2UXAA 2V3UA 1B3LA 4GOTA 1JQFA 4RK2A 1MXWA 4X48A 1XT8A 1PB8A 3KOSA 2VHAA 3C4MA 3KN7A 1QVSA 4NTLA 4QFNA 1NL5A 4ONYA 3QIMA 2E0SA 3T96B 2QSXA 4Z7EA 3DP8A 2Y7IA 3FJGA 2B65A 4IGRA 2HZLA 2I48A 3VLWA 2H9BA 1ZJLA 4WEPA 3TELA 1JW4A 4G4PA 1MS7A 1DTGA 5K2YA 3S4UA 3E13X 3MW0A 2DQVA 3Q27A 2OZZA 1M5FA 3KFMA 2QMXA 3QAXA 5LOMA 4H65A 3O29A 1B6HA 5CM6A 1MY2A 1MM6A 1Y1MA 2QS1A 3PMXA 3U93A 3KJTA 2XXPA 3LBSA 4DCYA 1IXGA 2DVCA 3PD8A 3OO6A 3RUMA 3HPIA 4F3BA 3IB1A 2I4BA 3PPOA 1B05A 4KR5A 4JB7A 4BDOA 4K3FA 3G3IA 4IY6A 3WAEA 3N5LA 5K2XA 1L5TA 2OCUA 1MY3A 5CC2A 1Y9UA 5FHNA 2DE2A 4OFLA 4UACA 3SEXA 3CR9A 1B51A 3CFXA 4R73A 1JEVA 1UTHA 4F3GA 1S50A 3PUWE 2HQ0A 4R75A 1P99A 4OHNA 4R6HA 1WODA 1P1OA 4OEVA 4YMBA 1PBPA 5AA4A 3GLBA 1MXYA 4NF6A 4Q8RA 2Y7WA 3FXUA 3VE1B 4G2ZA 2VOZA 2DYXA 4ZEBA 4OVJA 1O63A 1YCJA 1MPBA 4JWOA 4PFWA 1XC1A 3RY3A 1B9JA 3PPRA 4XTCQ 3K1NA 3HV1A 2NXOA 4FEDA 5I58B 3R26A 3I3VA 5L8DA 4HTGA 2I49A 2V3TA 3GBBA 4IO4A 4ZZAA 1P1WA 4ZZEA 5CRYA 2XXHA 4EXKA 3S9MC 4H5GA 4ZEIA 1PB9A 3FVOA 4YMAA 3MC2A 3IOUA 1GVCA 1MQHA 3V5AA 4P11A 3TEPA 3O6HA 2Q2CA 1POY1 5HPQA 1SD3A 4EQBA 3FVGA 1OMPA 1SW5A 1XVXA 4C1UA 2DWHA 4U4SA 3TYHA 2ANJA 3QK6A 4GL8A 4U23A 3UN6A 2D5WA 1LFIA 3RNNA 3O6GA 4POXA 1LAFE 2I0BA 5H8NA 1P1UA 3TCFA 1LFHA 3FVKA 3RLFE 1MXVA 1F9BA 1MM7A 2RC7A 2BJJX 3K01A 1NFTA 2ZYMA 3VLUA 3OD7A 3GBAA 3O2AA 4NMYA 5I2NA 3THIA 4ECFA 3MUQA 2O7UA 3T22A 3FD3A 1RKMA 4GFRA 2RC9A 3B6TA 1TXFA 3IJXB 3ODBA 3H6WA 3V89B 1B7ZA 5A5XB 5H8FA 3KZGA 4QSDA 1PDAA 3M3KA 1J1NA 2H25A 2D3IA 2DE3A 3UORA 2YLNA 3MZ1A 4XIGQ 2A5TB 3TPAA 2Q9TA 3MP8A 1CB6A 3H4ZA 3OSRA 4ND9A 4KYEA 2R6GE 2I0CA 4BDMA 1ANFA 1XOCA 5KCJA 5J1DA 4GWOA 1MPDA 3T93B 2P0SA 1N0TA 1B0HA 5FHOA 3MPKA 1EZOA 1NNPA 2F7CA 5I2KB 3C36A 4IO6A 2A5SA 3H03A 1D9YA 3CFLA 1FQFA 3K4UA 3LSLA 3RQTA 1LB8A 4OESA 2RC8A 1VFDA 5I84A 2O6AA 3U72A 3K0VA 4OERA 1FCKA 5FHMA 1MY1A 1B3GA 4QFKA 3UIFA 5JK4A 4R2BA 3FXQA 2G29A 1B5IA 1IXIA 5L9MA 3N6UA 3E3KA 2R9JA 1UIUA 4RPNA 3CSBA 4H6DA 1S7YA 3M3FA 1Z7ME 1MH4A 1IUDA 3WAFA 4BDLA 4JSOA 3MVWA 2WKYA 1SYIA 3H6TA 3B6WA 1M5BA 2IA4A 1B3EA 3PMWA 3ZSFA 1H43A 2ONKE 2ZNTA 4H8IA 4YZZA 4JWYA 4AB5A 5CMBA 3IAZA 2XXWA 5FTIA 2FNCA 2O51A 3N94A 4P0IA 4YB7A 1O7TA 2X7QA 3SEWA 3OSQA 3FASA 2O1MA 3TKDA 1QW0A 1LB9A 3FGSA 3KN3A 4G68B 2IEEA 5DEXB 3VV5A 4Z0IA 4MH5A 1DTZA 4R6KA 3HCQA 3PUXE 5I59B 2Y84A 5AA3A 1LAXA 3EQ1A 1SQYA 4F1UA 3HN0A 4QRZA 3HHGA 1FQBA 3PD9A 1S9TA 5CMKA 4QFOA 4RA1A 3H6VA 3V8XB 4BDNA 3VLVA 3PGFA 1XS5A 5I56B 3TQLA 4KD5A 5JTYB 3EHUA 1Y3QA 3G7WA 3N6TA 1DPPA 2V93A 3FIRA 2DXYA 2XXYA 1M5DA 1URGA 2REJA 3SEVA 1IZ1A 4F1YA 4ZE9A 4EUOA 4NF4A 1DPEA 4JXIA 3K6UA 2ZNUA 4F19A 2XXIA 3U8QA 3TDJA 5AE4A 3K1MA 4XKRA 3QSLA 1B4ZA 4U22A 4N07A 4HCWA 3KOTA 3TTKA 3OO9A 3QUFA 5ICTA 1P1NA 3T9HB 1MDQA 3IOVA 3MBPA 4RXLA 4EQ9A 4ZEKA 1II5A 1B2HA 4KYSA 3OEMA 2HFBA 5I57A 3Q29A 1P1QA 3SETA 2Y7PA 4BDQA 1MH3A 3R7XA 3ZS6A 4R6YA 3A3CA 4YKJA 2H98A 2UVGA 5TP9B 2V3QA 1I6AA 4MLVA 3G3HA 4XKQA 1ZIUA 4KCDA 1FQCA 5H8QB 3VVFA 1Q1KA 3OMBA 2UYFA 1PC3A 2P2AA 3LSWA 4R72A 4NF8B 2ALUA 5M2VA 5H8SA 2OLBA 1B1XA 4OFOA 3UGWA 3USDA 5L9SA 1A54A 4I1DA 4NEDA 4LQ2A 1AOVA 4E0WA 1LBCA 2O84X 5KDTA 3K00A 2RCAA 3V83A 1JVXA 3OO7A 4Q0CA 4OENA 3D4CA 2ZMBA 3HHFA 4YB5A 2ABHA 4ESWA 3FJMA 4RK9A 5H8HB 4GLIA 1ZU0A 4NF6B 2OBGA 3IORA 1NNTA 4F1VA 4U1ZA 1B1HA 1R1NA 1D4NA 1Z7NE 4JSDA 1SVXB 3T9UA 1QKBA 2DE4A 4EQ7A 4DCXA 4PQJA 1BTJA 3OENA 3HO7A 4MBPA 3F11A 3GXAA 4GRKA 2QL3A 4KHZE 1JW1A 3RGYA 1FQDA 3FVNA 1XVYA 3ZKKA 4THIA 1SW4A 3CVGA 3DLNA 3MWBA 1B0LA 4RNSA 3I6VA 2ZYOA 4Q30B 2QS3A 4X1DA 1H45A 3DP4A 3JYRA 1A40A 2OWSA 3VVDA 4IO2A 3DELB 3BKIB 1Q35A 4R2FA 3IB0A 2F6GA 4LQ5A 3IK6B 4GIZA 4M1VA 4H0WA 3EF7A 2Y7RA 1Y4TA 2HAVA 2AIXA 4RY1A 4KCCA 1D3KA 2HAUA 4ZEDA 5H8NB 4UA8A 3CRBA 3LUYA 4PFUA 4DXUA 4LZ8A 1NKXA 1SDXA 4R9GA 2XXXA 1NNKA 3TTNA 1AMFA 1URDA 2Z22A 2Q89A 1SI1A 3I5OA 5I2NB 4YKPA 2HXWA 1I69A 1USYH 5HBCA 2F5XA 1IIWA 1DOTA 1BIYA 2XD3A 2HCAA 2GHBA 1N3WA 4OQOA 2YJPA 1FTJA 4F18A 3A09A 2GH9A 4ELPA 1TWYA 1FW0A 2FYIA 3IL1B 4WEDA 4Q5TA 2PVUA 4IGTA 3HSTA 3K6XA 3MVYA 5KCJB 1DMBA 2B3BA 4FORA 3C9HA 1FTOA 3C33A 1LCTA 3LSFB 1OLCA 5I58A 3FJ7A 3MPLA 4WXJA 3SDFA 2XXQA 3QYTA 1UTBB 2NUVA 1GTKA 3H6UA 1FTLA 1BKAA 3VDFA 5IAIA 1SW1A 4ELOA 1JEUA 1YAEA 1B46A 1MY0A 2LAOA 3G3GA 4O3AA 1ELJA 4FAJA 3K6WA 1BLFA 2B3FA 1USYE 1H3DA 1HSLA 1QUKA 4WKMA 3CG1A 1US5A 4KQPA 1B3HA 3M8UA 3KEIA 3D4GA 3TODA 4ZECA 1ATGA 5AA2B 1ZBMA 4F3PA 1HSJA 2XD2A 3CI8A 3S9NC 2X7PA 4H8JA 3MZ9A 1N84A 4NWCA 4OXVA 4FIMA 2QPQA 3TMGA 3RT6B 2F7BA 3ILTB 4KI0E 4HCYA 5L9OA 4NF5B 2DXRA 2RKMA 3L6GA 4OEUA 1MQDA 1OVTA 2DWJA 4X9TA 2VGQA 3PPQA 4YICA 1BP5A 4DZ1A 5A5XA 2VD2A 4LZ5A 4PETA 1MPCA 2ZXTA 3H3GA 2CMOA 4F39A 4F3SA 4IY5A 3PUYE 1MQJA 4JBZA 2ONSA 2PYYA 3FV2A 3ILUB 1B58A 1IQ7A 3U1OA 2PBWA 3SEUA 2H5YA 4ELRA 1KWHA 3IO4A 1LAGE 4N13A 2I6EA 3B7DA 4QSEA 1MXUA 1VE4A 1VR5A 2O68A 3W9WA 4F2OA 3E4RA 3QUJA 4N6PA 1DSNA 4EDPA 4H1XA 4ESXA 5I2KA 1ZMGA 4AQ4A 1GV8A 4RPOA 2H99A 3CIJA 4FEBA 2AYSA 2XXRA 5TPAB 1H76A 3VXCA 3SESA 4DXBA 3OELA 4IO5A 3BFUA 2QS4A 1H44A 2XXVA 1EH3A 3RTWB 4DIGA 3T9XB 4U4XA 3LR1A 1MY4A 3U92A 1LSTA 1N7XA 3OOAA 3MVZA 1M5EA 1POTA 1A8FA 2HZKA 3RPWA 1B4HA 2ZYKA 2RINA 4I9DA 4O3CA 3CSGA 4LZ7A 3TTMA 3KSXA 1XHYA 4U1OA 5BWJA 2UYEA 3FUZA 4DXCA 5CMMA 1SI0A 3G3JA 4GD5A 2P1SA 4U21A 1SBPA 1QUIA 3A3UA 2VP1A 2KLFA 3W15C 4TOZA 3B6QA 4IB2A 1FTKA 4G68A 3S9LC 1B5JA 3RTFB 3M3LA 3GZGA 3TZAA 5BUUA 4LVQA 5I59A 4YKIA 1Y4CA 4TQUQ 3IOTA 5DVIA 1UIVA 3Q25A 3DP6A 3KN8A 4QFPA 5KDTB 3TAJA 2PMSA 2ESNA 3EPEA 1JNFA 3PMVA 1N7WA 2R71A 2DWIA 4KFQA 4NE4A 4PFYA 4QSCA 5I56A 1Y3PA 5JTYA 2M8CA 1WDNA 1YTVA 1FQEA 2Z8FA 4EF1A 4R74A 2QMWA 3MP6A 2DOJA 4OETA 5KZTA 2Q88A 4G68C 1LFGA 3O97A 2XXTA 3H06B 4M4GA 4ZS9A 2F36A 4YAHX 5DVJA 1JW5A 5ELVA 3PU5A 1ZLQA 1UTHB 4ISUA 1T0KA 2NWJA 1LCFA 2F34A 2PT1A 5AA4B 2YPNA 3KG2A 3T9VA 1B5HA 1NH7A 5JEIA 4JDFA 4F29A 2AL5A 2DS9A 4R9FA 1UQWA 3EN3A 2ZYNA 5DVFA 4GF8A 4ELQA 3W9VA 4E0XA 3MVXA 3R6UA 2I58A 3L6HA 3O66A 1R9LA 2OJTA 5F1QA 2F97A 2NOOA 5TP9A 1QUJA 2GRVA 2Z8EA 3TUSA 3TTRA 1FQAA 3IJOB 1A8EA 2PX1A 2XX7A 3SEYA 3K02A 5H8QA 2OK2A 3MQ9A 1ZKBA 1WVJA 3CG3A 4NF8A 4F31B 1I6QA 3K2DA 3DM0A 1R6ZA 2O7IA 4LATA 3Q28A 2I3WA 4RYAA 1PBQA 2CZLA 1N76A 4C0RA 3MJNA 2OWTA 4RJZA 1LAHE 3C34A 2GHAA 2HEUA 4GVOA 4PE5B 3H7MA 5ITOA 2DSFA 3IB2A 4NWDA 1M5CA 4U2RA 1MDP1 5H8HA 3MAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QUL A;  3OXN A;  4YU0 A;  1MQI A;  4PFT A;  3UA8 A;  5HM4 B;  3FZV A;  3TTL A;  1OIB A;  1Y1Z A;  2Y7K A;  2V25 A;  1EU8 A;  1AH5 A;  2QS2 A;  1US4 A;  2Q8J A;  1TT1 A;  4FJP A;  3FV1 A;  1B40 A;  1VSO A;  3JV9 A;  3TQW A;  1CE2 A;  3S2V A;  2Z23 A;  1YPN A;  4AB6 A;  4H5F A;  3SKP A;  1EZP A;  1JVY A;  5H8F B;  3TCG A;  4XKN A;  3CFZ A;  2F8D A;  1B32 A;  2NVU B;  2H4I A;  1I6B A;  3FXR A;  2PT2 A;  3ONM A;  2V84 A;  4G8M A;  1MG1 A;  4JWX A;  4BLA A;  4KYD A;  2DVZ A;  3UK4 A;  4OYV A;  1OQG A;  2QJE A;  4G8N A;  4QHQ A;  1LLS A;  1LGB C;  3PPN A;  1NMU A;  1B3F A;  3KJ7 A;  2I3V A;  3ZKL A;  4HS7 A;  3SER A;  5B70 A;  4H67 A;  3O28 A;  1IEJ A;  4DDD A;  2Z8D A;  1MXX A;  3K1P A;  2D21 A;  1PB7 A;  4BDR A;  2G93 A;  2ONR A;  1IXH A;  3PV0 E;  1ZTY A;  5CI5 A;  1OLA A;  3E9X A;  2F35 A;  4ZE8 A;  1Y3N A;  1JET A;  3C32 A;  1TFA A;  3OO8 A;  1GGG A;  4GQO A;  2DP8 A;  4QF9 A;  2RF1 A;  2F78 A;  4G77 A;  2E1S A;  1A55 A;  4F22 A;  4GXA A;  3Q26 A;  3FAT A;  2THI A;  2AL4 A;  3C31 A;  4FE8 A;  2XXU A;  2DWA A;  1URS A;  1IIT A;  4XXU A;  3G3K A;  3KGC A;  1QJM A;  3EHS A;  4ZEF A;  4X1B A;  3N26 A;  1SYH A;  4G8H A;  3OEK A;  1MXZ A;  3C35 A;  4FAT A;  2UVI A;  4LUB A;  4HW8 A;  3ECR A;  1B7H A;  3AXF A;  3UP9 A;  4FEC A;  4C1T A;  5B7D A;  4LON B;  4LP2 B;  1PEB A;  1B7U A;  4OFJ A;  4ZDM A;  1QKA A;  3O6I A;  1UTB A;  5AA1 A;  4TLL B;  4XKP A;  4QFL A;  1VFE A;  4P0G A;  5TU0 A;  4OWD A;  1Y20 A;  5CBS A;  3EHT A;  3IR1 A;  4OTE A;  2F6P A;  4POW A;  3TFL A;  3RT8 A;  3PPP A;  2FA7 A;  5IKB A;  3K6V A;  2A5T A;  3JZJ A;  3T66 A;  2O69 A;  1RYO A;  2Q2A A;  3P7I A;  4DLD A;  2XX8 A;  1A99 A;  3IOW A;  3O9P A;  1AL3 A;  5F7V A;  5ITP A;  3PUZ E;  5DYH A;  3U94 A;  4LA9 A;  4DE8 A;  5AA2 A;  4MFI A;  4TLM B;  2ZNS A;  2VD3 A;  3BBR A;  1NNF A;  3VVE A;  1RYX A;  4NF4 B;  2RCB A;  1D9V A;  4NF5 A;  5ICQ A;  3RN8 A;  4EXL A;  3MZB A;  4GXS B;  4I8C A;  3KBR A;  1MQG A;  5DT6 A;  2XX9 A;  5EHM A;  3G3F A;  1R9Q A;  2O1L A;  1GR2 A;  5AA2 D;  1N04 A;  2X26 A;  1B52 A;  4YB6 A;  2REG A;  5CBR A;  4L17 A;  4OMB A;  2QRY A;  5EHS A;  5CMC A;  4IO3 A;  5DTB A;  1AIV A;  5I57 B;  4EF2 A;  3LC8 A;  1OVB A;  3BFT A;  1O64 A;  3VXB A;  4IO7 A;  4O3B A;  4MF3 A;  2W7Y A;  1NH8 A;  4PP0 A;  4F2Q A;  1MRP A;  3VFJ A;  1A7L A;  3IX1 A;  3MP1 A;  4KPT A;  3KSJ A;  4YKK A;  1IXC A;  1SW2 A;  2UVH A;  1N3X A;  1HSE A;  2F7A A;  5FTH A;  2GFE A;  4GL0 A;  5TPA A;  1EZ9 A;  5DEX A;  3S9E A;  4I62 A;  3IO6 A;  5EYF A;  2I4C A;  2UVJ A;  1OQH A;  1TFD A;  4OZ9 A;  2XHD A;  3QXM A;  1FTM A;  4MLQ A;  1LBB A;  3TCH A;  3PUV E;  3LSX A;  5ISU A;  2UXA A;  2V3U A;  1B3L A;  4GOT A;  1JQF A;  4RK2 A;  1MXW A;  4X48 A;  1XT8 A;  1PB8 A;  3KOS A;  2VHA A;  3C4M A;  3KN7 A;  1QVS A;  4NTL A;  4QFN A;  1NL5 A;  4ONY A;  3QIM A;  2E0S A;  3T96 B;  2QSX A;  4Z7E A;  3DP8 A;  2Y7I A;  3FJG A;  2B65 A;  4IGR A;  2HZL A;  2I48 A;  3VLW A;  2H9B A;  1ZJL A;  4WEP A;  3TEL A;  1JW4 A;  4G4P A;  1MS7 A;  1DTG A;  5K2Y A;  3S4U A;  3E13 X;  3MW0 A;  2DQV A;  3Q27 A;  2OZZ A;  1M5F A;  3KFM A;  2QMX A;  3QAX A;  5LOM A;  4H65 A;  3O29 A;  1B6H A;  5CM6 A;  1MY2 A;  1MM6 A;  1Y1M A;  2QS1 A;  3PMX A;  3U93 A;  3KJT A;  2XXP A;  3LBS A;  4DCY A;  1IXG A;  2DVC A;  3PD8 A;  3OO6 A;  3RUM A;  3HPI A;  4F3B A;  3IB1 A;  2I4B A;  3PPO A;  1B05 A;  4KR5 A;  4JB7 A;  4BDO A;  4K3F A;  3G3I A;  4IY6 A;  3WAE A;  3N5L A;  5K2X A;  1L5T A;  2OCU A;  1MY3 A;  5CC2 A;  1Y9U A;  5FHN A;  2DE2 A;  4OFL A;  4UAC A;  3SEX A;  3CR9 A;  1B51 A;  3CFX A;  4R73 A;  1JEV A;  1UTH A;  4F3G A;  1S50 A;  3PUW E;  2HQ0 A;  4R75 A;  1P99 A;  4OHN A;  4R6H A;  1WOD A;  1P1O A;  4OEV A;  4YMB A;  1PBP A;  5AA4 A;  3GLB A;  1MXY A;  4NF6 A;  4Q8R A;  2Y7W A;  3FXU A;  3VE1 B;  4G2Z A;  2VOZ A;  2DYX A;  4ZEB A;  4OVJ A;  1O63 A;  1YCJ A;  1MPB A;  4JWO A;  4PFW A;  1XC1 A;  3RY3 A;  1B9J A;  3PPR A;  4XTC Q;  3K1N A;  3HV1 A;  2NXO A;  4FED A;  5I58 B;  3R26 A;  3I3V A;  5L8D A;  4HTG A;  2I49 A;  2V3T A;  3GBB A;  4IO4 A;  4ZZA A;  1P1W A;  4ZZE A;  5CRY A;  2XXH A;  4EXK A;  3S9M C;  4H5G A;  4ZEI A;  1PB9 A;  3FVO A;  4YMA A;  3MC2 A;  3IOU A;  1GVC A;  1MQH A;  3V5A A;  4P11 A;  3TEP A;  3O6H A;  2Q2C A;  1POY 1;  5HPQ A;  1SD3 A;  4EQB A;  3FVG A;  1OMP A;  1SW5 A;  1XVX A;  4C1U A;  2DWH A;  4U4S A;  3TYH A;  2ANJ A;  3QK6 A;  4GL8 A;  4U23 A;  3UN6 A;  2D5W A;  1LFI A;  3RNN A;  3O6G A;  4POX A;  1LAF E;  2I0B A;  5H8N A;  1P1U A;  3TCF A;  1LFH A;  3FVK A;  3RLF E;  1MXV A;  1F9B A;  1MM7 A;  2RC7 A;  2BJJ X;  3K01 A;  1NFT A;  2ZYM A;  3VLU A;  3OD7 A;  3GBA A;  3O2A A;  4NMY A;  5I2N A;  3THI A;  4ECF A;  3MUQ A;  2O7U A;  3T22 A;  3FD3 A;  1RKM A;  4GFR A;  2RC9 A;  3B6T A;  1TXF A;  3IJX B;  3ODB A;  3H6W A;  3V89 B;  1B7Z A;  5A5X B;  5H8F A;  3KZG A;  4QSD A;  1PDA A;  3M3K A;  1J1N A;  2H25 A;  2D3I A;  2DE3 A;  3UOR A;  2YLN A;  3MZ1 A;  4XIG Q;  2A5T B;  3TPA A;  2Q9T A;  3MP8 A;  1CB6 A;  3H4Z A;  3OSR A;  4ND9 A;  4KYE A;  2R6G E;  2I0C A;  4BDM A;  1ANF A;  1XOC A;  5KCJ A;  5J1D A;  4GWO A;  1MPD A;  3T93 B;  2P0S A;  1N0T A;  1B0H A;  5FHO A;  3MPK A;  1EZO A;  1NNP A;  2F7C A;  5I2K B;  3C36 A;  4IO6 A;  2A5S A;  3H03 A;  1D9Y A;  3CFL A;  1FQF A;  3K4U A;  3LSL A;  3RQT A;  1LB8 A;  4OES A;  2RC8 A;  1VFD A;  5I84 A;  2O6A A;  3U72 A;  3K0V A;  4OER A;  1FCK A;  5FHM A;  1MY1 A;  1B3G A;  4QFK A;  3UIF A;  5JK4 A;  4R2B A;  3FXQ A;  2G29 A;  1B5I A;  1IXI A;  5L9M A;  3N6U A;  3E3K A;  2R9J A;  1UIU A;  4RPN A;  3CSB A;  4H6D A;  1S7Y A;  3M3F A;  1Z7M E;  1MH4 A;  1IUD A;  3WAF A;  4BDL A;  4JSO A;  3MVW A;  2WKY A;  1SYI A;  3H6T A;  3B6W A;  1M5B A;  2IA4 A;  1B3E A;  3PMW A;  3ZSF A;  1H43 A;  2ONK E;  2ZNT A;  4H8I A;  4YZZ A;  4JWY A;  4AB5 A;  5CMB A;  3IAZ A;  2XXW A;  5FTI A;  2FNC A;  2O51 A;  3N94 A;  4P0I A;  4YB7 A;  1O7T A;  2X7Q A;  3SEW A;  3OSQ A;  3FAS A;  2O1M A;  3TKD A;  1QW0 A;  1LB9 A;  3FGS A;  3KN3 A;  4G68 B;  2IEE A;  5DEX B;  3VV5 A;  4Z0I A;  4MH5 A;  1DTZ A;  4R6K A;  3HCQ A;  3PUX E;  5I59 B;  2Y84 A;  5AA3 A;  1LAX A;  3EQ1 A;  1SQY A;  4F1U A;  3HN0 A;  4QRZ A;  3HHG A;  1FQB A;  3PD9 A;  1S9T A;  5CMK A;  4QFO A;  4RA1 A;  3H6V A;  3V8X B;  4BDN A;  3VLV A;  3PGF A;  1XS5 A;  5I56 B;  3TQL A;  4KD5 A;  5JTY B;  3EHU A;  1Y3Q A;  3G7W A;  3N6T A;  1DPP A;  2V93 A;  3FIR A;  2DXY A;  2XXY A;  1M5D A;  1URG A;  2REJ A;  3SEV A;  1IZ1 A;  4F1Y A;  4ZE9 A;  4EUO A;  4NF4 A;  1DPE A;  4JXI A;  3K6U A;  2ZNU A;  4F19 A;  2XXI A;  3U8Q A;  3TDJ A;  5AE4 A;  3K1M A;  4XKR A;  3QSL A;  1B4Z A;  4U22 A;  4N07 A;  4HCW A;  3KOT A;  3TTK A;  3OO9 A;  3QUF A;  5ICT A;  1P1N A;  3T9H B;  1MDQ A;  3IOV A;  3MBP A;  4RXL A;  4EQ9 A;  4ZEK A;  1II5 A;  1B2H A;  4KYS A;  3OEM A;  2HFB A;  5I57 A;  3Q29 A;  1P1Q A;  3SET A;  2Y7P A;  4BDQ A;  1MH3 A;  3R7X A;  3ZS6 A;  4R6Y A;  3A3C A;  4YKJ A;  2H98 A;  2UVG A;  5TP9 B;  2V3Q A;  1I6A A;  4MLV A;  3G3H A;  4XKQ A;  1ZIU A;  4KCD A;  1FQC A;  5H8Q B;  3VVF A;  1Q1K A;  3OMB A;  2UYF A;  1PC3 A;  2P2A A;  3LSW A;  4R72 A;  4NF8 B;  2ALU A;  5M2V A;  5H8S A;  2OLB A;  1B1X A;  4OFO A;  3UGW A;  3USD A;  5L9S A;  1A54 A;  4I1D A;  4NED A;  4LQ2 A;  1AOV A;  4E0W A;  1LBC A;  2O84 X;  5KDT A;  3K00 A;  2RCA A;  3V83 A;  1JVX A;  3OO7 A;  4Q0C A;  4OEN A;  3D4C A;  2ZMB A;  3HHF A;  4YB5 A;  2ABH A;  4ESW A;  3FJM A;  4RK9 A;  5H8H B;  4GLI A;  1ZU0 A;  4NF6 B;  2OBG A;  3IOR A;  1NNT A;  4F1V A;  4U1Z A;  1B1H A;  1R1N A;  1D4N A;  1Z7N E;  4JSD A;  1SVX B;  3T9U A;  1QKB A;  2DE4 A;  4EQ7 A;  4DCX A;  4PQJ A;  1BTJ A;  3OEN A;  3HO7 A;  4MBP A;  3F11 A;  3GXA A;  4GRK A;  2QL3 A;  4KHZ E;  1JW1 A;  3RGY A;  1FQD A;  3FVN A;  1XVY A;  3ZKK A;  4THI A;  1SW4 A;  3CVG A;  3DLN A;  3MWB A;  1B0L A;  4RNS A;  3I6V A;  2ZYO A;  4Q30 B;  2QS3 A;  4X1D A;  1H45 A;  3DP4 A;  3JYR A;  1A40 A;  2OWS A;  3VVD A;  4IO2 A;  3DEL B;  3BKI B;  1Q35 A;  4R2F A;  3IB0 A;  2F6G A;  4LQ5 A;  3IK6 B;  4GIZ A;  4M1V A;  4H0W A;  3EF7 A;  2Y7R A;  1Y4T A;  2HAV A;  2AIX A;  4RY1 A;  4KCC A;  1D3K A;  2HAU A;  4ZED A;  5H8N B;  4UA8 A;  3CRB A;  3LUY A;  4PFU A;  4DXU A;  4LZ8 A;  1NKX A;  1SDX A;  4R9G A;  2XXX A;  1NNK A;  3TTN A;  1AMF A;  1URD A;  2Z22 A;  2Q89 A;  1SI1 A;  3I5O A;  5I2N B;  4YKP A;  2HXW A;  1I69 A;  1USY H;  5HBC A;  2F5X A;  1IIW A;  1DOT A;  1BIY A;  2XD3 A;  2HCA A;  2GHB A;  1N3W A;  4OQO A;  2YJP A;  1FTJ A;  4F18 A;  3A09 A;  2GH9 A;  4ELP A;  1TWY A;  1FW0 A;  2FYI A;  3IL1 B;  4WED A;  4Q5T A;  2PVU A;  4IGT A;  3HST A;  3K6X A;  3MVY A;  5KCJ B;  1DMB A;  2B3B A;  4FOR A;  3C9H A;  1FTO A;  3C33 A;  1LCT A;  3LSF B;  1OLC A;  5I58 A;  3FJ7 A;  3MPL A;  4WXJ A;  3SDF A;  2XXQ A;  3QYT A;  1UTB B;  2NUV A;  1GTK A;  3H6U A;  1FTL A;  1BKA A;  3VDF A;  5IAI A;  1SW1 A;  4ELO A;  1JEU A;  1YAE A;  1B46 A;  1MY0 A;  2LAO A;  3G3G A;  4O3A A;  1ELJ A;  4FAJ A;  3K6W A;  1BLF A;  2B3F A;  1USY E;  1H3D A;  1HSL A;  1QUK A;  4WKM A;  3CG1 A;  1US5 A;  4KQP A;  1B3H A;  3M8U A;  3KEI A;  3D4G A;  3TOD A;  4ZEC A;  1ATG A;  5AA2 B;  1ZBM A;  4F3P A;  1HSJ A;  2XD2 A;  3CI8 A;  3S9N C;  2X7P A;  4H8J A;  3MZ9 A;  1N84 A;  4NWC A;  4OXV A;  4FIM A;  2QPQ A;  3TMG A;  3RT6 B;  2F7B A;  3ILT B;  4KI0 E;  4HCY A;  5L9O A;  4NF5 B;  2DXR A;  2RKM A;  3L6G A;  4OEU A;  1MQD A;  1OVT A;  2DWJ A;  4X9T A;  2VGQ A;  3PPQ A;  4YIC A;  1BP5 A;  4DZ1 A;  5A5X A;  2VD2 A;  4LZ5 A;  4PET A;  1MPC A;  2ZXT A;  3H3G A;  2CMO A;  4F39 A;  4F3S A;  4IY5 A;  3PUY E;  1MQJ A;  4JBZ A;  2ONS A;  2PYY A;  3FV2 A;  3ILU B;  1B58 A;  1IQ7 A;  3U1O A;  2PBW A;  3SEU A;  2H5Y A;  4ELR A;  1KWH A;  3IO4 A;  1LAG E;  4N13 A;  2I6E A;  3B7D A;  4QSE A;  1MXU A;  1VE4 A;  1VR5 A;  2O68 A;  3W9W A;  4F2O A;  3E4R A;  3QUJ A;  4N6P A;  1DSN A;  4EDP A;  4H1X A;  4ESX A;  5I2K A;  1ZMG A;  4AQ4 A;  1GV8 A;  4RPO A;  2H99 A;  3CIJ A;  4FEB A;  2AYS A;  2XXR A;  5TPA B;  1H76 A;  3VXC A;  3SES A;  4DXB A;  3OEL A;  4IO5 A;  3BFU A;  2QS4 A;  1H44 A;  2XXV A;  1EH3 A;  3RTW B;  4DIG A;  3T9X B;  4U4X A;  3LR1 A;  1MY4 A;  3U92 A;  1LST A;  1N7X A;  3OOA A;  3MVZ A;  1M5E A;  1POT A;  1A8F A;  2HZK A;  3RPW A;  1B4H A;  2ZYK A;  2RIN A;  4I9D A;  4O3C A;  3CSG A;  4LZ7 A;  3TTM A;  3KSX A;  1XHY A;  4U1O A;  5BWJ A;  2UYE A;  3FUZ A;  4DXC A;  5CMM A;  1SI0 A;  3G3J A;  4GD5 A;  2P1S A;  4U21 A;  1SBP A;  1QUI A;  3A3U A;  2VP1 A;  2KLF A;  3W15 C;  4TOZ A;  3B6Q A;  4IB2 A;  1FTK A;  4G68 A;  3S9L C;  1B5J A;  3RTF B;  3M3L A;  3GZG A;  3TZA A;  5BUU A;  4LVQ A;  5I59 A;  4YKI A;  1Y4C A;  4TQU Q;  3IOT A;  5DVI A;  1UIV A;  3Q25 A;  3DP6 A;  3KN8 A;  4QFP A;  5KDT B;  3TAJ A;  2PMS A;  2ESN A;  3EPE A;  1JNF A;  3PMV A;  1N7W A;  2R71 A;  2DWI A;  4KFQ A;  4NE4 A;  4PFY A;  4QSC A;  5I56 A;  1Y3P A;  5JTY A;  2M8C A;  1WDN A;  1YTV A;  1FQE A;  2Z8F A;  4EF1 A;  4R74 A;  2QMW A;  3MP6 A;  2DOJ A;  4OET A;  5KZT A;  2Q88 A;  4G68 C;  1LFG A;  3O97 A;  2XXT A;  3H06 B;  4M4G A;  4ZS9 A;  2F36 A;  4YAH X;  5DVJ A;  1JW5 A;  5ELV A;  3PU5 A;  1ZLQ A;  1UTH B;  4ISU A;  1T0K A;  2NWJ A;  1LCF A;  2F34 A;  2PT1 A;  5AA4 B;  2YPN A;  3KG2 A;  3T9V A;  1B5H A;  1NH7 A;  5JEI A;  4JDF A;  4F29 A;  2AL5 A;  2DS9 A;  4R9F A;  1UQW A;  3EN3 A;  2ZYN A;  5DVF A;  4GF8 A;  4ELQ A;  3W9V A;  4E0X A;  3MVX A;  3R6U A;  2I58 A;  3L6H A;  3O66 A;  1R9L A;  2OJT A;  5F1Q A;  2F97 A;  2NOO A;  5TP9 A;  1QUJ A;  2GRV A;  2Z8E A;  3TUS A;  3TTR A;  1FQA A;  3IJO B;  1A8E A;  2PX1 A;  2XX7 A;  3SEY A;  3K02 A;  5H8Q A;  2OK2 A;  3MQ9 A;  1ZKB A;  1WVJ A;  3CG3 A;  4NF8 A;  4F31 B;  1I6Q A;  3K2D A;  3DM0 A;  1R6Z A;  2O7I A;  4LAT A;  3Q28 A;  2I3W A;  4RYA A;  1PBQ A;  2CZL A;  1N76 A;  4C0R A;  3MJN A;  2OWT A;  4RJZ A;  1LAH E;  3C34 A;  2GHA A;  2HEU A;  4GVO A;  4PE5 B;  3H7M A;  5ITO A;  2DSF A;  3IB2 A;  4NWD A;  1M5C A;  4U2R A;  1MDP 1;  5H8H A;  3MAM A; 
#chains in the Genus database with same CATH topology
 1QUL A;  3OXN A;  4YU0 A;  2V4C A;  1MQI A;  4PFT A;  3UA8 A;  1G0H A;  5HM4 B;  3FZV A;  3TTL A;  1OIB A;  1Y1Z A;  2VPN A;  2Y7K A;  2V25 A;  1EU8 A;  1FTA A;  1AH5 A;  2QS2 A;  1US4 A;  3FXB A;  2Q8J A;  1TT1 A;  4FJP A;  3FV1 A;  1B40 A;  1VSO A;  3JV9 A;  3TQW A;  1CE2 A;  3S2V A;  2Z23 A;  1EYJ A;  1YPN A;  4AB6 A;  4H5F A;  3SKP A;  1EZP A;  1JVY A;  1LBZ A;  5H8F B;  3TCG A;  4XKN A;  3CFZ A;  2F8D A;  1B32 A;  2NVU B;  3B8B A;  2H4I A;  1I6B A;  3FXR A;  2PT2 A;  3ONM A;  2V84 A;  4G8M A;  1MG1 A;  4JWX A;  4BLA A;  2F3B A;  5IZ3 A;  4KYD A;  2DVZ A;  3UK4 A;  4OYV A;  1OQG A;  5I7I A;  2QJE A;  4G8N A;  4QHQ A;  1LLS A;  4LN5 A;  1LGB C;  3PPN A;  1NMU A;  1B3F A;  3KJ7 A;  2I3V A;  3ZKL A;  4HS7 A;  3SER A;  5B70 A;  4H67 A;  3O28 A;  2FBP A;  1IEJ A;  4DDD A;  2Z8D A;  1MXX A;  3K1P A;  4PBH A;  2D21 A;  1PB7 A;  4BDR A;  2G93 A;  2HXR A;  2ONR A;  1IXH A;  3PV0 E;  1ZTY A;  5CI5 A;  1OLA A;  3E9X A;  2F35 A;  4ZE8 A;  1Y3N A;  1JET A;  3C32 A;  1TFA A;  3OO8 A;  1GGG A;  4NN3 A;  4GQO A;  2DP8 A;  4QF9 A;  2RF1 A;  2F78 A;  4G77 A;  2E1S A;  1A55 A;  4F22 A;  4GXA A;  3Q26 A;  1RDX A;  3FAT A;  1RDY A;  2THI A;  2F3D A;  4P1L A;  2AL4 A;  3C31 A;  4FE8 A;  2XXU A;  2DWA A;  1URS A;  1FBP A;  1IIT A;  4XXU A;  4PDH A;  3G3K A;  3KGC A;  1QJM A;  3EHS A;  4ZEF A;  4X1B A;  3N26 A;  1SYH A;  4G8H A;  3OEK A;  4N6K A;  4PGN A;  1YZ0 A;  1MXZ A;  3CHG A;  3C35 A;  4FAT A;  2UVI A;  4LUB A;  4HW8 A;  3ECR A;  1B7H A;  3AXF A;  3UP9 A;  1NUW A;  4FEC A;  4C1T A;  5B7D A;  4LON B;  4LP2 B;  1PEB A;  1B7U A;  4OFJ A;  4ZDM A;  1QKA A;  4MNP A;  3O6I A;  1UTB A;  5AA1 A;  4TLL B;  4XKP A;  4QFL A;  1VFE A;  4P0G A;  5TU0 A;  4OWD A;  1Y20 A;  2P3V A;  4MHF A;  5CBS A;  3EHT A;  3IR1 A;  4OTE A;  4PAI A;  2F6P A;  4JVI A;  4POW A;  3TFL A;  3RT8 A;  3PPP A;  2FA7 A;  5IKB A;  3K6V A;  2A5T A;  3JZJ A;  3T66 A;  2O69 A;  1RYO A;  2Q2A A;  4O7I A;  3P7I A;  4DLD A;  2XX8 A;  1A99 A;  3IOW A;  3O9P A;  3PTY A;  1AL3 A;  1FPG A;  5F7V A;  5ITP A;  3PUZ E;  5DYH A;  2CEY A;  3U94 A;  4LA9 A;  4DE8 A;  5AA2 A;  4MFI A;  2FIX A;  4TLM B;  2ZNS A;  1FBD A;  2VD3 A;  3BBR A;  1RDZ A;  1NNF A;  3VVE A;  3SZP A;  5FBP A;  1RYX A;  5IM2 A;  2CZH A;  4NF4 B;  2RCB A;  1D9V A;  2XWV A;  4NF5 A;  5ICQ A;  2QVU A;  3RN8 A;  4EXL A;  3MZB A;  3T0J A;  4GXS B;  4X8R A;  4I8C A;  3KBR A;  1MQG A;  5DT6 A;  2XX9 A;  5EHM A;  4O7M A;  3G3F A;  1R9Q A;  4PDD A;  2O1L A;  1GR2 A;  5AA2 D;  1N04 A;  2X26 A;  1B52 A;  1EYK A;  4AS5 A;  4YB6 A;  4G61 A;  2REG A;  5CBR A;  4L17 A;  4OMB A;  2QRY A;  5EHS A;  4N8G A;  5CMC A;  4IO3 A;  5DTB A;  1AIV A;  5I57 B;  4EF2 A;  3LC8 A;  1OVB A;  3BFT A;  1O64 A;  4P3L A;  3VXB A;  4QBA A;  4IO7 A;  4O3B A;  4N8Y A;  4MF3 A;  2W7Y A;  1NH8 A;  4PP0 A;  4F2Q A;  1MRP A;  3B50 A;  3VFJ A;  1A7L A;  3IX1 A;  3MP1 A;  4KPT A;  3KSJ A;  4YKK A;  1IXC A;  1SW2 A;  2UVH A;  1N3X A;  1HSE A;  1FPJ A;  2F7A A;  5FTH A;  2GFE A;  4GL0 A;  5TPA A;  1EZ9 A;  5DEX A;  3S9E A;  4I62 A;  3IO6 A;  4PFI A;  5EYF A;  2I4C A;  2UVJ A;  1OQH A;  1TFD A;  4OZ9 A;  2XHD A;  4P9K A;  3QXM A;  1FTM A;  4MLQ A;  1LBB A;  3TCH A;  3PUV E;  3LSX A;  5ISU A;  2UXA A;  2V3U A;  1B3L A;  4GOT A;  1JQF A;  4RK2 A;  1MXW A;  4X48 A;  1XT8 A;  1PB8 A;  3KOS A;  2VHA A;  3C4M A;  3KN7 A;  1QVS A;  4NTL A;  4QFN A;  1NL5 A;  4ONY A;  3QIM A;  2E0S A;  3T96 B;  2QSX A;  4Z7E A;  3DP8 A;  2Y7I A;  3FJG A;  2B65 A;  4IGR A;  2HZL A;  2I48 A;  3VLW A;  2H9B A;  1ZJL A;  4WEP A;  3TEL A;  1JW4 A;  4G4P A;  1MS7 A;  1DTG A;  2WBB A;  5K2Y A;  3S4U A;  3E13 X;  3MW0 A;  2DQV A;  3Q27 A;  2OZZ A;  1M5F A;  3KFM A;  1FPL A;  4PF8 A;  2QMX A;  3HFU A;  3QAX A;  5LOM A;  4H65 A;  2CEX A;  3O29 A;  1B6H A;  5CM6 A;  1MY2 A;  4GWS A;  1MM6 A;  1Y1M A;  3BIG A;  2QS1 A;  3PMX A;  5DW8 A;  3U93 A;  3KJT A;  2XXP A;  3LBS A;  4DCY A;  1NUY A;  1IXG A;  2DVC A;  3PD8 A;  3OO6 A;  3RUM A;  3HPI A;  4F3B A;  3IB1 A;  2Y5L A;  2I4B A;  3PPO A;  1B05 A;  4KR5 A;  4N81 A;  4JB7 A;  4HE2 A;  4BDO A;  3KBZ A;  3G3I A;  4K3F A;  4IY6 A;  3WAE A;  3N5L A;  5K2X A;  1L5T A;  1JP4 A;  2OCU A;  1MY3 A;  5CC2 A;  1Y9U A;  5FHN A;  2DE2 A;  4OFL A;  4UAC A;  2L5V A;  3SEX A;  3CR9 A;  1B51 A;  4P47 A;  3CFX A;  4R73 A;  2XWO A;  1JEV A;  1UTH A;  4F3G A;  1S50 A;  3PUW E;  4MEV A;  2HQ0 A;  4R75 A;  1P99 A;  4OHN A;  4R6H A;  1YXI A;  1WOD A;  1P1O A;  4OEV A;  4YMB A;  1PBP A;  2BJI A;  5AA4 A;  3GLB A;  1MXY A;  4NF6 A;  4Q8R A;  4PAK A;  5IZ3 B;  2Y7W A;  3FXU A;  3KC1 A;  3VE1 B;  4PBQ A;  4G2Z A;  2VOZ A;  2DYX A;  4ZEB A;  4OVJ A;  3MST A;  1O63 A;  1YCJ A;  4I3Y A;  4IR8 A;  1MPB A;  4JWO A;  4PFW A;  1XC1 A;  4NG7 A;  3RY3 A;  1B9J A;  3A29 A;  3PPR A;  4X04 A;  4XTC Q;  3K1N A;  2OX3 A;  3HV1 A;  1FBH A;  2NXO A;  1NUZ A;  4FED A;  5I58 B;  4N6D A;  3R26 A;  3I3V A;  5L8D A;  4HTG A;  2I49 A;  2V3T A;  3GBB A;  5IGA A;  4IO4 A;  4ZZA A;  1P1W A;  4ZZE A;  5CRY A;  2XXH A;  4EXK A;  3S9M C;  4H5G A;  4I40 A;  4ZEI A;  1PB9 A;  3FVO A;  4YMA A;  3MC2 A;  5F24 A;  3IOU A;  1DCU A;  1GVC A;  1MQH A;  3V5A A;  1FPB A;  4GX4 A;  4P11 A;  3TEP A;  3O6H A;  2Q2C A;  4MX6 A;  1POY 1;  2WBD A;  5HPQ A;  2GQ1 A;  1SD3 A;  4EQB A;  3FVG A;  1OMP A;  1SW5 A;  1XVX A;  2XWK A;  4C1U A;  2DWH A;  1LBV A;  4U4S A;  3TYH A;  2ANJ A;  3QK6 A;  4GL8 A;  4U23 A;  3UN6 A;  4GBV A;  5A5L A;  4DI4 B;  2D5W A;  1LFI A;  3RNN A;  3O6G A;  4POX A;  1LAF E;  2I0B A;  5H8N A;  1P1U A;  3TCF A;  4PC9 A;  1LFH A;  3FVK A;  3RLF E;  1MXV A;  2PFY A;  1F9B A;  1MM7 A;  4OA4 A;  2RC7 A;  1LEV A;  2BJJ X;  3K01 A;  1NFT A;  2ZYM A;  3VLU A;  3OD7 A;  3GBA A;  3O2A A;  4NMY A;  5I2N A;  3THI A;  4ECF A;  3MYU A;  3MUQ A;  2O7U A;  3T22 A;  3FD3 A;  1RKM A;  4GFR A;  2RC9 A;  3B6T A;  1TXF A;  3IJX B;  3ODB A;  3H6W A;  3V89 B;  1B7Z A;  5A5X B;  5H8F A;  3KZG A;  4QSD A;  1PDA A;  4MCO A;  3M3K A;  1J1N A;  2H25 A;  2D3I A;  2DE3 A;  3UOR A;  2YLN A;  3MZ1 A;  4XIG Q;  2A5T B;  3TPA A;  2Q9T A;  4MNI A;  4OVR A;  3IFC A;  3MP8 A;  1CB6 A;  4UAB A;  3H4Z A;  3OSR A;  4ND9 A;  4KYE A;  2R6G E;  2I0C A;  4BDM A;  1ANF A;  4QXD A;  1XOC A;  5KCJ A;  5J1D A;  4GWO A;  1MPD A;  3T93 B;  2P0S A;  1N0T A;  1B0H A;  5FHO A;  3MPK A;  1EZO A;  1NNP A;  2XA5 A;  2F7C A;  5I2K B;  4NAP A;  3C36 A;  4IO6 A;  1NV7 A;  2A5S A;  3H03 A;  1QGX A;  1LBX A;  1D9Y A;  3CFL A;  1FQF A;  3K4U A;  3LSL A;  3RQT A;  1LB8 A;  4OES A;  2RC8 A;  1VFD A;  5I84 A;  2O6A A;  3U72 A;  3K0V A;  4OER A;  1FCK A;  5FHM A;  1MY1 A;  1B3G A;  4QFK A;  3UIF A;  5JK4 A;  2B4M A;  1NV5 A;  4R2B A;  3FXQ A;  2G29 A;  1B5I A;  1IXI A;  5L9M A;  3N6U A;  3E3K A;  2R9J A;  3D1R A;  1BK4 A;  1UIU A;  4RPN A;  3CSB A;  4PCD A;  2ZZV A;  4H6D A;  2FIE A;  1S7Y A;  3M3F A;  3ROJ A;  1Z7M E;  1MH4 A;  1IUD A;  5EYG A;  4PTK A;  3WAF A;  4BDL A;  4JSO A;  3MVW A;  2WKY A;  1SYI A;  3H6T A;  3B6W A;  1M5B A;  2IA4 A;  1B3E A;  3PMW A;  3ZSF A;  1FSA A;  1H43 A;  2ONK E;  5ESY A;  3FBP A;  2ZNT A;  4H8I A;  4YZZ A;  1K9Y A;  2DDK A;  4JWY A;  2FHY A;  4AB5 A;  5CMB A;  3IAZ A;  2XXW A;  5FTI A;  2FNC A;  2O51 A;  3N94 A;  4P0I A;  4YB7 A;  1O7T A;  2HHM A;  2X7Q A;  4GWX A;  4KXP A;  3SEW A;  3OSQ A;  3FAS A;  2KQZ A;  2O1M A;  3TKD A;  1QW0 A;  1LB9 A;  3FGS A;  4NX1 A;  3KN3 A;  1FJ9 A;  4G68 B;  1CNQ A;  2IEE A;  5DEX B;  3VV5 A;  4Z0I A;  4PAF A;  1IMD A;  4MH5 A;  5I3S A;  1DTZ A;  4R6K A;  3HCQ A;  3PUX E;  5I59 B;  2PFZ A;  1FPI A;  2Y84 A;  3EKI A;  5AA3 A;  1LAX A;  3EQ1 A;  1SQY A;  4F1U A;  3HN0 A;  4QRZ A;  3HHG A;  1FQB A;  3PD9 A;  1S9T A;  5CMK A;  4QFO A;  4RA1 A;  3H6V A;  3V8X B;  4BDN A;  3VLV A;  3PGF A;  1XS5 A;  5I56 B;  3TQL A;  4KD5 A;  1NV4 A;  5JTY B;  3EHU A;  1Y3Q A;  3G7W A;  3N6T A;  2XXK A;  1DPP A;  2V93 A;  3FIR A;  4OVP A;  2DXY A;  2XXY A;  1M5D A;  1URG A;  2REJ A;  3SEV A;  1IZ1 A;  4F1Y A;  4ZE9 A;  4EUO A;  4NF4 A;  1DPE A;  5LDZ A;  4JXI A;  3K6U A;  2ZNU A;  1INP A;  4F19 A;  2XXI A;  3U8Q A;  3TDJ A;  5AE4 A;  3K1M A;  4XKR A;  3QSL A;  4I3E A;  1B4Z A;  4U22 A;  4N07 A;  4HCW A;  3KOT A;  3TTK A;  3OO9 A;  3QUF A;  5ICT A;  1P1N A;  3T9H B;  1MDQ A;  3IOV A;  3MBP A;  4RXL A;  4EQ9 A;  4GX6 A;  4ZEK A;  1II5 A;  1B2H A;  4KYS A;  3OEM A;  5ET6 A;  2HFB A;  5I57 A;  3Q29 A;  1P1Q A;  3SET A;  2Y7P A;  4BDQ A;  1MH3 A;  3R7X A;  3ZS6 A;  4R6Y A;  3A3C A;  4YKJ A;  1NI9 A;  2H98 A;  2UVG A;  5TP9 B;  2V3Q A;  4N15 A;  4N91 A;  5LTC A;  1FBE A;  1I6A A;  4MLV A;  3G3H A;  4XKQ A;  1ZIU A;  4KCD A;  1FQC A;  5H8Q B;  3VVF A;  1Q1K A;  1IME A;  3OMB A;  2UYF A;  1PC3 A;  4MNC A;  2P2A A;  3LSW A;  4R72 A;  4NF8 B;  2ALU A;  5M2V A;  5H8S A;  2OLB A;  1B1X A;  4OFO A;  3UGW A;  3USD A;  4GWY A;  5L9S A;  1A54 A;  4I1D A;  2PCR A;  4NED A;  4LQ2 A;  1AOV A;  4E0W A;  1LBC A;  2O84 X;  5KDT A;  3K00 A;  4PF6 A;  2RCA A;  3V83 A;  1JVX A;  3OO7 A;  4Q0C A;  4OEN A;  3D4C A;  2ZMB A;  3HHF A;  4YB5 A;  2ABH A;  4ESW A;  3FJM A;  4RK9 A;  5H8H B;  4GLI A;  1ZU0 A;  4NF6 B;  2OBG A;  3IOR A;  3RPL A;  3E79 A;  1FPF A;  1NNT A;  4F1V A;  1IMC A;  4U1Z A;  3LUZ A;  1B1H A;  1R1N A;  1D4N A;  1Z7N E;  4MMP A;  4JSD A;  1SVX B;  4NHB A;  3T9U A;  1QKB A;  2DE4 A;  2QVV A;  4EQ7 A;  4DCX A;  4PQJ A;  1BTJ A;  4MJO A;  3OEN A;  3HO7 A;  4MBP A;  3F11 A;  3GXA A;  4O8M A;  4GRK A;  2QL3 A;  4KHZ E;  1JW1 A;  3RGY A;  1KA1 A;  2P3N A;  1FQD A;  3FVN A;  1XVY A;  5EQ7 A;  3ZKK A;  4THI A;  1SW4 A;  3CVG A;  3DLN A;  3MWB A;  1B0L A;  4HE0 A;  4RNS A;  3I6V A;  2ZYO A;  4Q30 B;  2QS3 A;  1VDW A;  4X1D A;  1H45 A;  3DP4 A;  2Q8M A;  3JYR A;  1A40 A;  2OWS A;  3VVD A;  4IO2 A;  3DEL B;  3BKI B;  1Q35 A;  4OVT A;  2VPO A;  2ZZX A;  4R2F A;  3IB0 A;  4JVC A;  2F6G A;  4LQ5 A;  4GX3 A;  3IK6 B;  4GIZ A;  4M1V A;  4H0W A;  3GYY A;  3EF7 A;  2Y7R A;  1Y4T A;  4PFR A;  2HAV A;  2AIX A;  1LBW A;  4RY1 A;  4KCC A;  5IZZ A;  1D3K A;  2HAU A;  4ZED A;  5H8N B;  4UA8 A;  4P56 A;  3CRB A;  3LUY A;  4PFU A;  4DXU A;  4LZ8 A;  1NKX A;  1SDX A;  1IMF A;  4R9G A;  3BIH A;  2XXX A;  1FBF A;  5ET5 A;  1NNK A;  3TTN A;  1AMF A;  4N17 A;  1FBG A;  1URD A;  2Z22 A;  2Q89 A;  2XWI A;  1SI1 A;  3I5O A;  5I2N B;  4YKP A;  1Q9D A;  4NF0 A;  2HXW A;  1I69 A;  1USY H;  5HBC A;  2CZK A;  4XFE A;  2F5X A;  4OVQ A;  1IIW A;  4MAG A;  1DOT A;  1BIY A;  2XD3 A;  4PFB A;  3T1B A;  2HCA A;  2GHB A;  3LV0 A;  1N3W A;  4OQO A;  2YJP A;  1FTJ A;  4JVD A;  4F18 A;  3A09 A;  2GH9 A;  4ELP A;  1TWY A;  1FW0 A;  4XEQ A;  2FYI A;  3IL1 B;  4WED A;  4Q5T A;  2PVU A;  4IGT A;  3HST A;  3K6X A;  3MVY A;  5KCJ B;  1DMB A;  2B3B A;  4FOR A;  2WX9 A;  3C9H A;  1FTO A;  3C33 A;  1LCT A;  2ZZW A;  3LSF B;  1OLC A;  2QVR A;  5I58 A;  3FJ7 A;  2MKZ A;  1IMA A;  3MPL A;  4WXJ A;  3SDF A;  2XXQ A;  3QYT A;  1UTB B;  2NUV A;  1GTK A;  3H6U A;  1FTL A;  1BKA A;  3VDF A;  5IAI A;  1SW1 A;  4ELO A;  1JEU A;  2CZI A;  1YAE A;  1DK4 A;  4PGP A;  1B46 A;  1MY0 A;  2LAO A;  2OWZ A;  3G3G A;  4O3A A;  4PE3 A;  5ET7 A;  1ELJ A;  1YYZ A;  4FAJ A;  1FJ6 A;  4AS4 A;  3K6W A;  1BLF A;  4MIJ A;  2B3F A;  1USY E;  2Y5K A;  1H3D A;  1HSL A;  1QUK A;  4WKM A;  3CG1 A;  4GWZ A;  1US5 A;  4KQP A;  1B3H A;  3M8U A;  3KEI A;  3D4G A;  3TOD A;  4ZEC A;  1ATG A;  5AA2 B;  1ZBM A;  4F3P A;  1HSJ A;  2XD2 A;  3CI8 A;  3S9N C;  2X7P A;  4H8J A;  3MZ9 A;  1D9Q A;  4OVS A;  5IZ1 A;  1N84 A;  4H45 A;  4NWC A;  4OXV A;  4FIM A;  5T3J A;  2QPQ A;  3TMG A;  3RT6 B;  2F7B A;  5EYH A;  5EQA A;  3ILT B;  4KI0 E;  4HCY A;  5L9O A;  4NF5 B;  2DXR A;  2RKM A;  3L6G A;  4P8B A;  4OEU A;  1MQD A;  1OVT A;  2DWJ A;  4X9T A;  2VGQ A;  3PPQ A;  4YIC A;  1BP5 A;  4DZ1 A;  4GWU A;  5A5X A;  2VD2 A;  4LZ5 A;  4HE1 A;  4DI3 D;  4PET A;  1MPC A;  2ZXT A;  3H3G A;  2CMO A;  4F39 A;  4F3S A;  4IY5 A;  3PUY E;  1MQJ A;  4JBZ A;  2ONS A;  2PYY A;  3FV2 A;  3ILU B;  1B58 A;  1IQ7 A;  3U1O A;  2PBW A;  1G0I A;  3SEU A;  3U65 A;  2H5Y A;  4ELR A;  1KWH A;  3KC0 A;  1DBZ A;  1NV3 A;  4H46 A;  3IO4 A;  1LAG E;  4N13 A;  2I6E A;  3B7D A;  4QSE A;  4FBP A;  1MXU A;  4GBW A;  1VE4 A;  1VR5 A;  2O68 A;  3W9W A;  4F2O A;  3E4R A;  3QUJ A;  4N6P A;  1DSN A;  1SPI A;  4EDP A;  1NUX A;  4H1X A;  4ESX A;  5I2K A;  1ZMG A;  4AQ4 A;  1GV8 A;  4RPO A;  2WEF A;  2H99 A;  1KZ8 A;  3CIJ A;  4FEB A;  2AYS A;  2XXR A;  5TPA B;  1H76 A;  3VXC A;  4P1E A;  3SES A;  4DXB A;  3OEL A;  4IO5 A;  3BFU A;  2QS4 A;  1H44 A;  2XXV A;  1NV2 A;  1EH3 A;  1KA0 A;  3RTW B;  4DIG A;  3T9X B;  4U4X A;  3LR1 A;  1MY4 A;  3U92 A;  1LST A;  1N7X A;  3OOA A;  3MVZ A;  2B4L A;  1M5E A;  1POT A;  1A8F A;  2HZK A;  1FRP A;  3RPW A;  1B4H A;  2ZYK A;  2RIN A;  4I9D A;  4O3C A;  1FBC A;  5ET8 A;  3CSG A;  4LZ7 A;  3TTM A;  3KSX A;  1XHY A;  4U1O A;  5BWJ A;  2UYE A;  3FUZ A;  4DXC A;  4NGU A;  5CMM A;  1SI0 A;  3G3J A;  4GD5 A;  2P1S A;  4U21 A;  1SBP A;  1IMB A;  1K9Z A;  1QUI A;  3A3U A;  2VP1 A;  2KLF A;  3W15 C;  4TOZ A;  3B6Q A;  3ISP A;  4IB2 A;  1FTK A;  1AWB A;  4G68 A;  3S9L C;  1B5J A;  3RTF B;  3M3L A;  3GZG A;  3TZA A;  2HPG A;  4LVQ A;  5BUU A;  5I59 A;  4YKI A;  1Y4C A;  2JJK A;  4TQU Q;  3IOT A;  3QMF A;  5DVI A;  1UIV A;  3Q25 A;  3DP6 A;  3KN8 A;  4QFP A;  5KDT B;  3TAJ A;  2PMS A;  1NV6 A;  2ESN A;  3EPE A;  1JNF A;  3PMV A;  1N7W A;  2R71 A;  2DWI A;  4KFQ A;  4NE4 A;  4PFY A;  4QSC A;  1XI6 A;  5I56 A;  1Y3P A;  5JTY A;  2M8C A;  1WDN A;  3RPL B;  1YTV A;  1FQE A;  2Z8F A;  4EF1 A;  2WYK A;  4R74 A;  2QMW A;  3MP6 A;  4HXV A;  2DOJ A;  4OET A;  5KZT A;  4GWW A;  2Q88 A;  4G68 C;  3NOH A;  1NV0 A;  1LFG A;  3O97 A;  2XXT A;  3H06 B;  4M4G A;  4ZS9 A;  2F36 A;  4YAH X;  5DVJ A;  1JW5 A;  1FPK A;  5ELV A;  3PU5 A;  1ZLQ A;  1UTH B;  4ISU A;  1T0K A;  2NWJ A;  1LCF A;  2F34 A;  2PT1 A;  5EQ9 A;  5AA4 B;  2YPN A;  3KG2 A;  3T9V A;  1B5H A;  1NH7 A;  5JEI A;  4JDF A;  4F29 A;  2AL5 A;  2DS9 A;  4O94 A;  4R9F A;  1UQW A;  3EN3 A;  5I5P A;  2ZYN A;  5DVF A;  4GF8 A;  4ELQ A;  1NV1 A;  2FVZ A;  3W9V A;  4E0X A;  3MVX A;  3R6U A;  2I58 A;  4NQ8 A;  3L6H A;  3O66 A;  4XF5 A;  1R9L A;  4N4U A;  2OJT A;  5F1Q A;  2F97 A;  2NOO A;  5TP9 A;  1QUJ A;  2GRV A;  2Z8E A;  3TUS A;  3TTR A;  1FQA A;  3IJO B;  1A8E A;  2PX1 A;  3IFA A;  2WYP A;  2XX7 A;  3SEY A;  3K02 A;  5H8Q A;  2OK2 A;  3MQ9 A;  1ZKB A;  1WVJ A;  1EYI A;  5EQ8 A;  3CG3 A;  4NF8 A;  4F31 B;  1I6Q A;  2QFL A;  2R8T A;  3RYD A;  3K2D A;  5J16 A;  3DM0 A;  1R6Z A;  2O7I A;  4LAT A;  3Q28 A;  2I3W A;  1LBY A;  4RYA A;  2KR0 A;  1PBQ A;  1FPD A;  2CZL A;  1N76 A;  2VT5 A;  4C0R A;  3MJN A;  2OWT A;  4RJZ A;  1LAH E;  3C34 A;  2GHA A;  3E78 A;  2HEU A;  4GVO A;  4PE5 B;  3H7M A;  5ITO A;  2Q74 A;  2DSF A;  3IB2 A;  1FPE A;  4NWD A;  4OAN A;  1M5C A;  4U2R A;  1MDP 1;  5H8H A;  3MAM A; 
#chains in the Genus database with same CATH homology
 1QUL A;  3OXN A;  4YU0 A;  1MQI A;  4PFT A;  3UA8 A;  5HM4 B;  3FZV A;  3TTL A;  1OIB A;  1Y1Z A;  2Y7K A;  2V25 A;  1EU8 A;  1AH5 A;  2QS2 A;  1US4 A;  2Q8J A;  1TT1 A;  4FJP A;  3FV1 A;  1B40 A;  1VSO A;  3JV9 A;  3TQW A;  1CE2 A;  3S2V A;  2Z23 A;  1YPN A;  4AB6 A;  4H5F A;  3SKP A;  1EZP A;  1JVY A;  5H8F B;  3TCG A;  4XKN A;  3CFZ A;  2F8D A;  1B32 A;  2NVU B;  2H4I A;  1I6B A;  3FXR A;  2PT2 A;  3ONM A;  2V84 A;  4G8M A;  1MG1 A;  4JWX A;  4BLA A;  4KYD A;  2DVZ A;  3UK4 A;  4OYV A;  1OQG A;  2QJE A;  4G8N A;  4QHQ A;  1LLS A;  1LGB C;  3PPN A;  1NMU A;  1B3F A;  3KJ7 A;  2I3V A;  3ZKL A;  4HS7 A;  3SER A;  5B70 A;  4H67 A;  3O28 A;  1IEJ A;  4DDD A;  2Z8D A;  1MXX A;  3K1P A;  2D21 A;  1PB7 A;  4BDR A;  2G93 A;  2ONR A;  1IXH A;  3PV0 E;  1ZTY A;  5CI5 A;  1OLA A;  3E9X A;  2F35 A;  4ZE8 A;  1Y3N A;  1JET A;  3C32 A;  1TFA A;  3OO8 A;  1GGG A;  4GQO A;  2DP8 A;  4QF9 A;  2RF1 A;  2F78 A;  4G77 A;  2E1S A;  1A55 A;  4F22 A;  4GXA A;  3Q26 A;  3FAT A;  2THI A;  2AL4 A;  3C31 A;  4FE8 A;  2XXU A;  2DWA A;  1URS A;  1IIT A;  4XXU A;  3G3K A;  3KGC A;  1QJM A;  3EHS A;  4ZEF A;  4X1B A;  3N26 A;  1SYH A;  4G8H A;  3OEK A;  1MXZ A;  3C35 A;  4FAT A;  2UVI A;  4LUB A;  4HW8 A;  3ECR A;  1B7H A;  3AXF A;  3UP9 A;  4FEC A;  4C1T A;  5B7D A;  4LON B;  4LP2 B;  1PEB A;  1B7U A;  4OFJ A;  4ZDM A;  1QKA A;  3O6I A;  1UTB A;  5AA1 A;  4TLL B;  4XKP A;  4QFL A;  1VFE A;  4P0G A;  5TU0 A;  4OWD A;  1Y20 A;  5CBS A;  3EHT A;  3IR1 A;  4OTE A;  2F6P A;  4POW A;  3TFL A;  3RT8 A;  3PPP A;  2FA7 A;  5IKB A;  3K6V A;  2A5T A;  3JZJ A;  3T66 A;  2O69 A;  1RYO A;  2Q2A A;  3P7I A;  4DLD A;  2XX8 A;  1A99 A;  3IOW A;  3O9P A;  1AL3 A;  5F7V A;  5ITP A;  3PUZ E;  5DYH A;  3U94 A;  4LA9 A;  4DE8 A;  5AA2 A;  4MFI A;  4TLM B;  2ZNS A;  2VD3 A;  3BBR A;  1NNF A;  3VVE A;  1RYX A;  4NF4 B;  2RCB A;  1D9V A;  4NF5 A;  5ICQ A;  3RN8 A;  4EXL A;  3MZB A;  4GXS B;  4I8C A;  3KBR A;  1MQG A;  5DT6 A;  2XX9 A;  5EHM A;  3G3F A;  1R9Q A;  2O1L A;  1GR2 A;  5AA2 D;  1N04 A;  2X26 A;  1B52 A;  4YB6 A;  2REG A;  5CBR A;  4L17 A;  4OMB A;  2QRY A;  5EHS A;  5CMC A;  4IO3 A;  5DTB A;  1AIV A;  5I57 B;  4EF2 A;  3LC8 A;  1OVB A;  3BFT A;  1O64 A;  3VXB A;  4IO7 A;  4O3B A;  4MF3 A;  2W7Y A;  1NH8 A;  4PP0 A;  4F2Q A;  1MRP A;  3VFJ A;  1A7L A;  3IX1 A;  3MP1 A;  4KPT A;  3KSJ A;  4YKK A;  1IXC A;  1SW2 A;  2UVH A;  1N3X A;  1HSE A;  2F7A A;  5FTH A;  2GFE A;  4GL0 A;  5TPA A;  1EZ9 A;  5DEX A;  3S9E A;  4I62 A;  3IO6 A;  5EYF A;  2I4C A;  2UVJ A;  1OQH A;  1TFD A;  4OZ9 A;  2XHD A;  3QXM A;  1FTM A;  4MLQ A;  1LBB A;  3TCH A;  3PUV E;  3LSX A;  5ISU A;  2UXA A;  2V3U A;  1B3L A;  4GOT A;  1JQF A;  4RK2 A;  1MXW A;  4X48 A;  1XT8 A;  1PB8 A;  3KOS A;  2VHA A;  3C4M A;  3KN7 A;  1QVS A;  4NTL A;  4QFN A;  1NL5 A;  4ONY A;  3QIM A;  2E0S A;  3T96 B;  2QSX A;  4Z7E A;  3DP8 A;  2Y7I A;  3FJG A;  2B65 A;  4IGR A;  2HZL A;  2I48 A;  3VLW A;  2H9B A;  1ZJL A;  4WEP A;  3TEL A;  1JW4 A;  4G4P A;  1MS7 A;  1DTG A;  5K2Y A;  3S4U A;  3E13 X;  3MW0 A;  2DQV A;  3Q27 A;  2OZZ A;  1M5F A;  3KFM A;  2QMX A;  3QAX A;  5LOM A;  4H65 A;  3O29 A;  1B6H A;  5CM6 A;  1MY2 A;  1MM6 A;  1Y1M A;  2QS1 A;  3PMX A;  3U93 A;  3KJT A;  2XXP A;  3LBS A;  4DCY A;  1IXG A;  2DVC A;  3PD8 A;  3OO6 A;  3RUM A;  3HPI A;  4F3B A;  3IB1 A;  2I4B A;  3PPO A;  1B05 A;  4KR5 A;  4JB7 A;  4BDO A;  4K3F A;  3G3I A;  4IY6 A;  3WAE A;  3N5L A;  5K2X A;  1L5T A;  2OCU A;  1MY3 A;  5CC2 A;  1Y9U A;  5FHN A;  2DE2 A;  4OFL A;  4UAC A;  3SEX A;  3CR9 A;  1B51 A;  3CFX A;  4R73 A;  1JEV A;  1UTH A;  4F3G A;  1S50 A;  3PUW E;  2HQ0 A;  4R75 A;  1P99 A;  4OHN A;  4R6H A;  1WOD A;  1P1O A;  4OEV A;  4YMB A;  1PBP A;  5AA4 A;  3GLB A;  1MXY A;  4NF6 A;  4Q8R A;  2Y7W A;  3FXU A;  3VE1 B;  4G2Z A;  2VOZ A;  2DYX A;  4ZEB A;  4OVJ A;  1O63 A;  1YCJ A;  1MPB A;  4JWO A;  4PFW A;  1XC1 A;  3RY3 A;  1B9J A;  3PPR A;  4XTC Q;  3K1N A;  3HV1 A;  2NXO A;  4FED A;  5I58 B;  3R26 A;  3I3V A;  5L8D A;  4HTG A;  2I49 A;  2V3T A;  3GBB A;  4IO4 A;  4ZZA A;  1P1W A;  4ZZE A;  5CRY A;  2XXH A;  4EXK A;  3S9M C;  4H5G A;  4ZEI A;  1PB9 A;  3FVO A;  4YMA A;  3MC2 A;  3IOU A;  1GVC A;  1MQH A;  3V5A A;  4P11 A;  3TEP A;  3O6H A;  2Q2C A;  1POY 1;  5HPQ A;  1SD3 A;  4EQB A;  3FVG A;  1OMP A;  1SW5 A;  1XVX A;  4C1U A;  2DWH A;  4U4S A;  3TYH A;  2ANJ A;  3QK6 A;  4GL8 A;  4U23 A;  3UN6 A;  2D5W A;  1LFI A;  3RNN A;  3O6G A;  4POX A;  1LAF E;  2I0B A;  5H8N A;  1P1U A;  3TCF A;  1LFH A;  3FVK A;  3RLF E;  1MXV A;  1F9B A;  1MM7 A;  2RC7 A;  2BJJ X;  3K01 A;  1NFT A;  2ZYM A;  3VLU A;  3OD7 A;  3GBA A;  3O2A A;  4NMY A;  5I2N A;  3THI A;  4ECF A;  3MUQ A;  2O7U A;  3T22 A;  3FD3 A;  1RKM A;  4GFR A;  2RC9 A;  3B6T A;  1TXF A;  3IJX B;  3ODB A;  3H6W A;  3V89 B;  1B7Z A;  5A5X B;  5H8F A;  3KZG A;  4QSD A;  1PDA A;  3M3K A;  1J1N A;  2H25 A;  2D3I A;  2DE3 A;  3UOR A;  2YLN A;  3MZ1 A;  4XIG Q;  2A5T B;  3TPA A;  2Q9T A;  3MP8 A;  1CB6 A;  3H4Z A;  3OSR A;  4ND9 A;  4KYE A;  2R6G E;  2I0C A;  4BDM A;  1ANF A;  1XOC A;  5KCJ A;  5J1D A;  4GWO A;  1MPD A;  3T93 B;  2P0S A;  1N0T A;  1B0H A;  5FHO A;  3MPK A;  1EZO A;  1NNP A;  2F7C A;  5I2K B;  3C36 A;  4IO6 A;  2A5S A;  3H03 A;  1D9Y A;  3CFL A;  1FQF A;  3K4U A;  3LSL A;  3RQT A;  1LB8 A;  4OES A;  2RC8 A;  1VFD A;  5I84 A;  2O6A A;  3U72 A;  3K0V A;  4OER A;  1FCK A;  5FHM A;  1MY1 A;  1B3G A;  4QFK A;  3UIF A;  5JK4 A;  4R2B A;  3FXQ A;  2G29 A;  1B5I A;  1IXI A;  5L9M A;  3N6U A;  3E3K A;  2R9J A;  1UIU A;  4RPN A;  3CSB A;  4H6D A;  1S7Y A;  3M3F A;  1Z7M E;  1MH4 A;  1IUD A;  3WAF A;  4BDL A;  4JSO A;  3MVW A;  2WKY A;  1SYI A;  3H6T A;  3B6W A;  1M5B A;  2IA4 A;  1B3E A;  3PMW A;  3ZSF A;  1H43 A;  2ONK E;  2ZNT A;  4H8I A;  4YZZ A;  4JWY A;  4AB5 A;  5CMB A;  3IAZ A;  2XXW A;  5FTI A;  2FNC A;  2O51 A;  3N94 A;  4P0I A;  4YB7 A;  1O7T A;  2X7Q A;  3SEW A;  3OSQ A;  3FAS A;  2O1M A;  3TKD A;  1QW0 A;  1LB9 A;  3FGS A;  3KN3 A;  4G68 B;  2IEE A;  5DEX B;  3VV5 A;  4Z0I A;  4MH5 A;  1DTZ A;  4R6K A;  3HCQ A;  3PUX E;  5I59 B;  2Y84 A;  5AA3 A;  1LAX A;  3EQ1 A;  1SQY A;  4F1U A;  3HN0 A;  4QRZ A;  3HHG A;  1FQB A;  3PD9 A;  1S9T A;  5CMK A;  4QFO A;  4RA1 A;  3H6V A;  3V8X B;  4BDN A;  3VLV A;  3PGF A;  1XS5 A;  5I56 B;  3TQL A;  4KD5 A;  5JTY B;  3EHU A;  1Y3Q A;  3G7W A;  3N6T A;  1DPP A;  2V93 A;  3FIR A;  2DXY A;  2XXY A;  1M5D A;  1URG A;  2REJ A;  3SEV A;  1IZ1 A;  4F1Y A;  4ZE9 A;  4EUO A;  4NF4 A;  1DPE A;  4JXI A;  3K6U A;  2ZNU A;  4F19 A;  2XXI A;  3U8Q A;  3TDJ A;  5AE4 A;  3K1M A;  4XKR A;  3QSL A;  1B4Z A;  4U22 A;  4N07 A;  4HCW A;  3KOT A;  3TTK A;  3OO9 A;  3QUF A;  5ICT A;  1P1N A;  3T9H B;  1MDQ A;  3IOV A;  3MBP A;  4RXL A;  4EQ9 A;  4ZEK A;  1II5 A;  1B2H A;  4KYS A;  3OEM A;  2HFB A;  5I57 A;  3Q29 A;  1P1Q A;  3SET A;  2Y7P A;  4BDQ A;  1MH3 A;  3R7X A;  3ZS6 A;  4R6Y A;  3A3C A;  4YKJ A;  2H98 A;  2UVG A;  5TP9 B;  2V3Q A;  1I6A A;  4MLV A;  3G3H A;  4XKQ A;  1ZIU A;  4KCD A;  1FQC A;  5H8Q B;  3VVF A;  1Q1K A;  3OMB A;  2UYF A;  1PC3 A;  2P2A A;  3LSW A;  4R72 A;  4NF8 B;  2ALU A;  5M2V A;  5H8S A;  2OLB A;  1B1X A;  4OFO A;  3UGW A;  3USD A;  5L9S A;  1A54 A;  4I1D A;  4NED A;  4LQ2 A;  1AOV A;  4E0W A;  1LBC A;  2O84 X;  5KDT A;  3K00 A;  2RCA A;  3V83 A;  1JVX A;  3OO7 A;  4Q0C A;  4OEN A;  3D4C A;  2ZMB A;  3HHF A;  4YB5 A;  2ABH A;  4ESW A;  3FJM A;  4RK9 A;  5H8H B;  4GLI A;  1ZU0 A;  4NF6 B;  2OBG A;  3IOR A;  1NNT A;  4F1V A;  4U1Z A;  1B1H A;  1R1N A;  1D4N A;  1Z7N E;  4JSD A;  1SVX B;  3T9U A;  1QKB A;  2DE4 A;  4EQ7 A;  4DCX A;  4PQJ A;  1BTJ A;  3OEN A;  3HO7 A;  4MBP A;  3F11 A;  3GXA A;  4GRK A;  2QL3 A;  4KHZ E;  1JW1 A;  3RGY A;  1FQD A;  3FVN A;  1XVY A;  3ZKK A;  4THI A;  1SW4 A;  3CVG A;  3DLN A;  3MWB A;  1B0L A;  4RNS A;  3I6V A;  2ZYO A;  4Q30 B;  2QS3 A;  4X1D A;  1H45 A;  3DP4 A;  3JYR A;  1A40 A;  2OWS A;  3VVD A;  4IO2 A;  3DEL B;  3BKI B;  1Q35 A;  4R2F A;  3IB0 A;  2F6G A;  4LQ5 A;  3IK6 B;  4GIZ A;  4M1V A;  4H0W A;  3EF7 A;  2Y7R A;  1Y4T A;  2HAV A;  2AIX A;  4RY1 A;  4KCC A;  1D3K A;  2HAU A;  4ZED A;  5H8N B;  4UA8 A;  3CRB A;  3LUY A;  4PFU A;  4DXU A;  4LZ8 A;  1NKX A;  1SDX A;  4R9G A;  2XXX A;  1NNK A;  3TTN A;  1AMF A;  1URD A;  2Z22 A;  2Q89 A;  1SI1 A;  3I5O A;  5I2N B;  4YKP A;  2HXW A;  1I69 A;  1USY H;  5HBC A;  2F5X A;  1IIW A;  1DOT A;  1BIY A;  2XD3 A;  2HCA A;  2GHB A;  1N3W A;  4OQO A;  2YJP A;  1FTJ A;  4F18 A;  3A09 A;  2GH9 A;  4ELP A;  1TWY A;  1FW0 A;  2FYI A;  3IL1 B;  4WED A;  4Q5T A;  2PVU A;  4IGT A;  3HST A;  3K6X A;  3MVY A;  5KCJ B;  1DMB A;  2B3B A;  4FOR A;  3C9H A;  1FTO A;  3C33 A;  1LCT A;  3LSF B;  1OLC A;  5I58 A;  3FJ7 A;  3MPL A;  4WXJ A;  3SDF A;  2XXQ A;  3QYT A;  1UTB B;  2NUV A;  1GTK A;  3H6U A;  1FTL A;  1BKA A;  3VDF A;  5IAI A;  1SW1 A;  4ELO A;  1JEU A;  1YAE A;  1B46 A;  1MY0 A;  2LAO A;  3G3G A;  4O3A A;  1ELJ A;  4FAJ A;  3K6W A;  1BLF A;  2B3F A;  1USY E;  1H3D A;  1HSL A;  1QUK A;  4WKM A;  3CG1 A;  1US5 A;  4KQP A;  1B3H A;  3M8U A;  3KEI A;  3D4G A;  3TOD A;  4ZEC A;  1ATG A;  5AA2 B;  1ZBM A;  4F3P A;  1HSJ A;  2XD2 A;  3CI8 A;  3S9N C;  2X7P A;  4H8J A;  3MZ9 A;  1N84 A;  4NWC A;  4OXV A;  4FIM A;  2QPQ A;  3TMG A;  3RT6 B;  2F7B A;  3ILT B;  4KI0 E;  4HCY A;  5L9O A;  4NF5 B;  2DXR A;  2RKM A;  3L6G A;  4OEU A;  1MQD A;  1OVT A;  2DWJ A;  4X9T A;  2VGQ A;  3PPQ A;  4YIC A;  1BP5 A;  4DZ1 A;  5A5X A;  2VD2 A;  4LZ5 A;  4PET A;  1MPC A;  2ZXT A;  3H3G A;  2CMO A;  4F39 A;  4F3S A;  4IY5 A;  3PUY E;  1MQJ A;  4JBZ A;  2ONS A;  2PYY A;  3FV2 A;  3ILU B;  1B58 A;  1IQ7 A;  3U1O A;  2PBW A;  3SEU A;  2H5Y A;  4ELR A;  1KWH A;  3IO4 A;  1LAG E;  4N13 A;  2I6E A;  3B7D A;  4QSE A;  1MXU A;  1VE4 A;  1VR5 A;  2O68 A;  3W9W A;  4F2O A;  3E4R A;  3QUJ A;  4N6P A;  1DSN A;  4EDP A;  4H1X A;  4ESX A;  5I2K A;  1ZMG A;  4AQ4 A;  1GV8 A;  4RPO A;  2H99 A;  3CIJ A;  4FEB A;  2AYS A;  2XXR A;  5TPA B;  1H76 A;  3VXC A;  3SES A;  4DXB A;  3OEL A;  4IO5 A;  3BFU A;  2QS4 A;  1H44 A;  2XXV A;  1EH3 A;  3RTW B;  4DIG A;  3T9X B;  4U4X A;  3LR1 A;  1MY4 A;  3U92 A;  1LST A;  1N7X A;  3OOA A;  3MVZ A;  1M5E A;  1POT A;  1A8F A;  2HZK A;  3RPW A;  1B4H A;  2ZYK A;  2RIN A;  4I9D A;  4O3C A;  3CSG A;  4LZ7 A;  3TTM A;  3KSX A;  1XHY A;  4U1O A;  5BWJ A;  2UYE A;  3FUZ A;  4DXC A;  5CMM A;  1SI0 A;  3G3J A;  4GD5 A;  2P1S A;  4U21 A;  1SBP A;  1QUI A;  3A3U A;  2VP1 A;  2KLF A;  3W15 C;  4TOZ A;  3B6Q A;  4IB2 A;  1FTK A;  4G68 A;  3S9L C;  1B5J A;  3RTF B;  3M3L A;  3GZG A;  3TZA A;  5BUU A;  4LVQ A;  5I59 A;  4YKI A;  1Y4C A;  4TQU Q;  3IOT A;  5DVI A;  1UIV A;  3Q25 A;  3DP6 A;  3KN8 A;  4QFP A;  5KDT B;  3TAJ A;  2PMS A;  2ESN A;  3EPE A;  1JNF A;  3PMV A;  1N7W A;  2R71 A;  2DWI A;  4KFQ A;  4NE4 A;  4PFY A;  4QSC A;  5I56 A;  1Y3P A;  5JTY A;  2M8C A;  1WDN A;  1YTV A;  1FQE A;  2Z8F A;  4EF1 A;  4R74 A;  2QMW A;  3MP6 A;  2DOJ A;  4OET A;  5KZT A;  2Q88 A;  4G68 C;  1LFG A;  3O97 A;  2XXT A;  3H06 B;  4M4G A;  4ZS9 A;  2F36 A;  4YAH X;  5DVJ A;  1JW5 A;  5ELV A;  3PU5 A;  1ZLQ A;  1UTH B;  4ISU A;  1T0K A;  2NWJ A;  1LCF A;  2F34 A;  2PT1 A;  5AA4 B;  2YPN A;  3KG2 A;  3T9V A;  1B5H A;  1NH7 A;  5JEI A;  4JDF A;  4F29 A;  2AL5 A;  2DS9 A;  4R9F A;  1UQW A;  3EN3 A;  2ZYN A;  5DVF A;  4GF8 A;  4ELQ A;  3W9V A;  4E0X A;  3MVX A;  3R6U A;  2I58 A;  3L6H A;  3O66 A;  1R9L A;  2OJT A;  5F1Q A;  2F97 A;  2NOO A;  5TP9 A;  1QUJ A;  2GRV A;  2Z8E A;  3TUS A;  3TTR A;  1FQA A;  3IJO B;  1A8E A;  2PX1 A;  2XX7 A;  3SEY A;  3K02 A;  5H8Q A;  2OK2 A;  3MQ9 A;  1ZKB A;  1WVJ A;  3CG3 A;  4NF8 A;  4F31 B;  1I6Q A;  3K2D A;  3DM0 A;  1R6Z A;  2O7I A;  4LAT A;  3Q28 A;  2I3W A;  4RYA A;  1PBQ A;  2CZL A;  1N76 A;  4C0R A;  3MJN A;  2OWT A;  4RJZ A;  1LAH E;  3C34 A;  2GHA A;  2HEU A;  4GVO A;  4PE5 B;  3H7M A;  5ITO A;  2DSF A;  3IB2 A;  4NWD A;  1M5C A;  4U2R A;  1MDP 1;  5H8H A;  3MAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...