4IO5A

Crystal structure of the avglur1 ligand binding domain complex with alanine at 1.72 angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
248
structure length
242
Chain Sequence
GSARLKGITLRIGVIESVPFTIVANVNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AvGluR1 ligand binding domain
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
molecule tags Membrane protein
total genus 75
structure length 242
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io5A02
2XXHA 2ALUA 5I57B 2PX1A 3G3FA 4QFNA 5IKBA 3CIJA 2DWJA 4OWDA 3VV5A 2Y7IA 3R7XA 3CR9A 4FAJA 4YKIA 1MM6A 3V89B 2XXWA 3CVGA 1Y3NA 5DEXB 3TQLA 3JV9A 3QXMA 3KOTA 4NTLA 3M3LA 5TPAB 4HCWA 1AMFA 1MH4A 4N6PA 3A3UA 3K00A 4GLIA 5ITOA 5BUUA 3F11A 1S7YA 3ILUB 4EQ9A 5AA2B 1Y1ZA 1RYXA 2V93A 4ZE9A 1JEUA 3PUXE 4BDNA 3TODA 4I62A 3VFJA 4NF4B 1Y1MA 4E0XA 1LLSA 3QUFA 5BWJA 4OFJA 4OHNA 1B3HA 4YZZA 3OO8A 3CRBA 3CFLA 3RY3A 3T93B 1MQDA 1SDXA 4EDPA 1QUJA 2H5YA 1Z7ME 4MF3A 1B52A 2QS4A 1LBCA 4LA9A 3RUMA 3KSJA 3RTFB 5DVFA 4KQPA 4FE8A 1B3EA 3PPRA 1SD3A 5AA4A 4X9TA 5H8NB 4Z7EA 1JVXA 1CE2A 1HSJA 4G2ZA 4IO5A 5I57A 4KD5A 2V3QA 3MAMA 1L5TA 4XIGQ 3E3KA 1B58A 4H5GA 4FIMA 3U94A 1MH3A 5DEXA 3PUYE 3N94A 3T9HB 1XVYA 3K6WA 1N76A 4IY6A 5ISUA 3K6VA 4C1UA 3JYRA 5L9MA 1QVSA 4YMAA 5JTYB 3CSGA 4ESWA 4EXKA 3MPLA 1FQEA 3C9HA 1N04A 3OO6A 1XC1A 5AA2A 3N6UA 1FQFA 4IB2A 3VVFA 3JZJA 2F7AA 4NMYA 2I0CA 2QMXA 3IJOB 2HQ0A 3G3IA 2AYSA 3HCQA 3LSLA 2OWTA 3K1MA 3O9PA 4WEPA 3O97A 4BDRA 1HSLA 2X26A 1EZOA 4HS7A 1PB8A 1LGBC 4H6DA 3LSFB 5H8HB 1A8EA 1PC3A 3C34A 3PUVE 1QUIA 5JK4A 4ZS9A 3IX1A 1A8FA 1B7ZA 1PB9A 1UIUA 3SERA 3HO7A 1A54A 5H8NA 5LOMA 3OSQA 5TU0A 3QIMA 1LAHE 1OMPA 1H76A 1B5IA 3KOSA 3FVOA 2V3UA 5DVIA 4H8IA 4OTEA 4F1YA 1MQGA 4YB6A 3TYHA 4JDFA 4IO4A 3W9VA 4F2OA 2ZYKA 4IGRA 3SEYA 3CFZA 5AA3A 3LBSA 1VE4A 3USDA 4LVQA 4BDOA 5I84A 1FQBA 3N5LA 1B46A 3TTMA 2DQVA 1MXZA 4FJPA 4NF6B 3Q28A 4WKMA 3B7DA 1SW2A 4H65A 2XXQA 4LP2B 5JTYA 5I2NB 3T96B 4I9DA 4RPNA 3S9EA 1EZPA 1B0LA 4IO7A 1B9JA 2F34A 4IO2A 1B5HA 5CM6A 1H44A 4F1UA 2PT2A 2V25A 2O84X 3O6GA 4G4PA 1BTJA 2DE3A 3VLWA 1Y20A 4RK2A 4Q5TA 1RYOA 4U23A 2Q2CA 3PD8A 1GGGA 4GFRA 3UIFA 3SEWA 1I6QA 4ZZAA 1IIWA 1B4HA 3VDFA 3BFUA 3B6WA 3IO6A 2XXUA 2F78A 3IL1B 3L6HA 1QW0A 2Q89A 4ZDMA 3U8QA 4EF2A 3BFTA 1POY1 2DYXA 5AA1A 3FZVA 3UA8A 3IO4A 1MXWA 2O7UA 1USYE 2Y7WA 1YAEA 2XD2A 4MLQA 4JSOA 2UYEA 3H7MA 5L9SA 3TTLA 5FHMA 4GOTA 3HN0A 2O6AA 4OFOA 3TUSA 2QS3A 2KLFA 2I6EA 2OK2A 3IORA 1GTKA 2PMSA 4JBZA 2Z8EA 4LZ8A 4P0IA 3UK4A 3CG1A 4U1OA 4BDQA 2HZKA 3VLVA 5CBSA 1LFGA 2RC7A 3SEXA 4OQOA 1JNFA 1NNKA 3FGSA 3TTKA 3HV1A 4PQJA 4NF6A 3W15C 5FHNA 3TZAA 4WEDA 3KN7A 5I2NA 1IQ7A 2V3TA 4X1DA 1NMUA 1MPDA 2UVJA 4PFWA 3QSLA 2NUVA 2I0BA 3MP8A 1BP5A 2G93A 1SBPA 4OVJA 3GBBA 4ZEDA 2H25A 4MH5A 2W7YA 3DELB 3S9NC 5CC2A 1WVJA 4LQ5A 4F3SA 4LZ5A 1SYIA 3GXAA 3TAJA 3IAZA 4EQ7A 3KN3A 3M3FA 2OJTA 3V8XB 1BIYA 4YB5A 3QAXA 1FCKA 4ZE8A 2UVIA 3ZKKA 2XX8A 4JWXA 4QSEA 1ANFA 3PPOA 2FNCA 4EXLA 3H03A 4F31B 3R6UA 1NH7A 1ZU0A 4GXAA 5HPQA 3EN3A 3UORA 4YU0A 3TCHA 1XOCA 3ECRA 3K2DA 4GXSB 3ILTB 2FA7A 2PBWA 4WXJA 5EHSA 4P0GA 3PPNA 4QHQA 5B70A 3FV1A 4RK9A 4ESXA 4KCDA 2VD3A 4PFTA 1DPPA 1CB6A 3LSWA 1VFDA 1BKAA 4F19A 4R2BA 1EZ9A 4QSDA 3H6TA 2GRVA 3Q27A 5ICQA 2QPQA 3V5AA 1WODA 3FV2A 3K02A 1Y3QA 3T9UA 1Z7NE 3IK6B 4PETA 3FJMA 2ZYOA 4F1VA 2RINA 1QUKA 4QFKA 3H06B 1MG1A 1OQHA 1MQJA 3K0VA 1URGA 1R9QA 3IB0A 3KJ7A 4M4GA 2F36A 3PV0E 2A5SA 2PVUA 1MM7A 3MZ1A 1FTJA 1O63A 3TEPA 1SI1A 2HZLA 1FTMA 1QJMA 4RXLA 2RC9A 1MXVA 3G3KA 4F39A 4YKKA 3O6IA 2Z8FA 2UVHA 2NWJA 3FVNA 2D5WA 4BLAA 2UXAA 5HBCA 3I6VA 1M5FA 1OIBA 3M3KA 4OEVA 4QSCA 4TOZA 4DDDA 4BDLA 3MZ9A 2B3BA 3D4CA 3I5OA 2Z8DA 3PPQA 1D3KA 3M8UA 5KCJB 1US4A 1LFHA 4KI0E 4R2FA 3T9VA 4M1VA 3S9LC 2OLBA 1OQGA 4YAHX 4NF8B 2F6GA 3TELA 2F5XA 3DP6A 2O7IA 1T0KA 4G77A 4ZEKA 3EHTA 4H1XA 2D21A 4ZEFA 5H8FB 2IEEA 4F3GA 3MVXA 1LBBA 5EHMA 1LAFE 3FD3A 3UP9A 5I56B 4X1BA 1H45A 5F1QA 2RF1A 4ND9A 2M8CA 3PMWA 1XVXA 4N13A 1YTVA 1FTOA 5CMBA 1DTGA 5TPAA 4LZ7A 4OZ9A 5HM4B 1B7UA 1SI0A 4OEUA 4XKNA 1WDNA 4RY1A 4OERA 1IXIA 2YJPA 3HHFA 4EUOA 1NFTA 1FTKA 3OXNA 1S9TA 2ZYMA 2E0SA 1NH8A 1PBPA 4JXIA 4NF4A 1ZMGA 2ANJA 1USYH 4R74A 5CMMA 1FQDA 3H6VA 2X7PA 4KR5A 3H3GA 5J1DA 1BLFA 1JW4A 2HFBA 2ONRA 2P0SA 3FATA 1B7HA 2F6PA 4GL8A 1FW0A 1GVCA 4PE5B 1MDQA 3BKIB 4NF5B 2BJJX 2ZNSA 4POWA 1OVBA 4XTCQ 1B1HA 3PPPA 3E4RA 3C33A 1MS7A 3GZGA 4TQUQ 4ECFA 3RTWB 2NVUB 1IXHA 4ISUA 5K2XA 4UA8A 3MP6A 1N0TA 1IXGA 2B65A 4RJZA 4DE8A 4KFQA 1UTHB 1XHYA 3TMGA 2Q88A 1OLCA 4C0RA 4BDMA 2B3FA 4YKJA 2R71A 4AB5A 4LUBA 3PGFA 1EH3A 3T9XB 4ZZEA 4IO6A 1DMBA 4R9FA 4OXVA 1LCFA 1Y9UA 1NKXA 1VFEA 3G7WA 1FQCA 4HTGA 3VXCA 3S4UA 3KG2A 1M5CA 1VR5A 2DXRA 4FECA 1B40A 1MY0A 1SQYA 4XKQA 4KHZE 2XXIA 4KYEA 4OMBA 2AIXA 3B6QA 4YMBA 1RKMA 5K2YA 1DSNA 4R6YA 2QSXA 4N07A 1MY4A 3LR1A 1VSOA 4IO3A 2YLNA 3PMVA 4NWDA 5I59B 2VGQA 3QK6A 5L9OA 1I6AA 1MXXA 3RQTA 3MVZA 3IOTA 1HSEA 1MQHA 4LONB 1MY1A 5H8SA 2DE4A 5FTIA 1JQFA 4Q30B 3O6HA 1S50A 3TTRA 1NNFA 2F7BA 2ZXTA 3ZSFA 2PT1A 4EF1A 3PUWE 3BBRA 1N3XA 4NF5A 3I3VA 1N84A 2OZZA 3LUYA 2I48A 5H8HA 2QJEA 2I49A 4F22A 4DXUA 1R6ZA 3MJNA 4DXBA 3AXFA 3PMXA 4R6KA 4KCCA 4R6HA 1YCJA 3FXQA 2GHBA 3RNNA 3MQ9A 5ELVA 4YICA 5L8DA 1UTHA 3PU5A 1P1WA 2Q9TA 4U22A 3MC2A 5CRYA 3H6WA 2OCUA 3N6TA 1P1QA 3VE1B 3O28A 3KSXA 4YKPA 3RT6B 3TCGA 2XXRA 3EQ1A 5FTHA 1MDP1 2ZMBA 3DP8A 4TLMB 3S2VA 3C35A 3KGCA 5CI5A 1LB9A 3VVDA 1B3GA 2RC8A 2FYIA 2Y84A 2O51A 4GQOA 1US5A 2AL5A 2ZNUA 4POXA 3U92A 5KZTA 2QMWA 4GRKA 5CMCA 3U93A 1JEVA 3KFMA 1M5EA 4X48A 2I3WA 4ZECA 3UN6A 1ZJLA 3E13X 3TQWA 3MZBA 5ITPA 5I59A 1POTA 3EHSA 1MY3A 1Q35A 3IOVA 4FORA 2CZLA 2P1SA 4QFPA 2RCAA 3KBRA 4GVOA 1AH5A 2DS9A 3PD9A 2DVZA 4U2RA 3GBAA 3OMBA 1O64A 2D3IA 3LSXA 4PFUA 4DCYA 2Q8JA 2DXYA 2LAOA 4THIA 3FXRA 5AA2D 1KWHA 1N3WA 4DXCA 1ATGA 3THIA 3D4GA 3MPKA 3VXBA 1B2HA 3QUJA 1B4ZA 3EHUA 1URDA 1QKAA 3IB1A 3KJTA 1B6HA 4KPTA 4GWOA 4P11A 5JEIA 2XXVA 2Y7RA 3EPEA 4G68B 2QRYA 4IY5A 2Z23A 2GFEA 3SESA 2XHDA 2RKMA 3B6TA 2YPNA 5DYHA 4I1DA 2ESNA 1LSTA 3FUZA 4OESA 4G8HA 4U4SA 2DP8A 4H8JA 3HSTA 2I4CA 2I58A 2NOOA 4U4XA 1I69A 2F7CA 1Y3PA 3L6GA 5I2KB 3ZKLA 3OELA 4DCXA 5M2VA 4G8NA 3K1NA 4JB7A 1XT8A 2VP1A 2QS1A 3SEUA 1LCTA 3EF7A 2THIA 4RA1A 4OFLA 1A7LA 1SW5A 3TCFA 1UTBB 1Y4CA 1MQIA 1B1XA 1OVTA 4R9GA 3HHGA 1D4NA 3C31A 3TTNA 4I8CA 4DIGA 2DE2A 2DVCA 5H8QB 2O1LA 1MXYA 1SW4A 4FEDA 4MFIA 1MY2A 3G3HA 1A40A 3K1PA 4GL0A 1SVXB 4R73A 3KEIA 1A55A 4K3FA 3R26A 2REJA 1JW5A 3GLBA 3KN8A 3MWBA 2F8DA 3W9WA 3CFXA 1MPCA 4AQ4A 1N7WA 3Q29A 1QKBA 1GV8A 1TXFA 4JWYA 4OETA 3VVEA 4C1TA 2VOZA 1DPEA 2HCAA 2A5TB 1O7TA 3C4MA 3U1OA 4RYAA 2GH9A 2Q2AA 3O29A 5KDTB 4H67A 4F18A 2XX9A 2F97A 5DVJA 4G68A 4IGTA 1M5DA 3Q26A 3WAFA 2VD2A 2QL3A 3DM0A 1PEBA 3CSBA 3OENA 3ODBA 1P1UA 4ELQA 1MXUA 2NXOA 5ICTA 3O66A 2WKYA 1SW1A 1LB8A 1F9BA 3SDFA 2E1SA 4ELPA 1B5JA 4GD5A 3IOUA 2DOJA 5I2KA 1II5A 1N7XA 1QULA 4U1ZA 4O3CA 4F3BA 2DSFA 3FXUA 4F2QA 1LAGE 1M5BA 1PDAA 1DTZA 1P99A 1UTBA 2H9BA 5F7VA 4EQBA 5EYFA 2I3VA 1OLAA 1LFIA 2G29A 1H3DA 1P1NA 1B05A 3IJXB 5H8QA 2PYYA 4Q0CA 5A5XB 3DLNA 2H99A 3K01A 3OSRA 4Z0IA 1TFAA 2CMOA 1A99A 1MPBA 4JWOA 3O2AA 3H6UA 1DOTA 2ZYNA 3OOAA 4QRZA 4F3PA 1MRPA 2XXPA 3MW0A 3A09A 3OO9A 4OYVA 3UGWA 3MUQA 3G3GA 5B7DA 3C36A 3FJGA 5TP9B 3KZGA 5KCJA 2F35A 2UYFA 2O69A 3H4ZA 3S9MC 2A5TA 1Q1KA 4KYSA 4NF8A 1B32A 5CBRA 3TKDA 2UVGA 5KDTA 3ZS6A 4RNSA 3TDJA 3OEKA 5H8FA 3V83A 5CMKA 5I56A 2H4IA 2O68A 2IA4A 4LQ2A 3FIRA 3TPAA 4ELOA 3E9XA 2QS2A 1AOVA 3RN8A 1TT1A 2GHAA 3RGYA 1B51A 3ONMA 2DWHA 2R6GE 4AB6A 3FASA 2XD3A 1IUDA 2R9JA 4YB7A 4UACA 2OWSA 5FHOA 3MVWA 4GIZA 5DT6A 1ZLQA 1URSA 3FJ7A 1H43A 4Q8RA 1NNPA 5DTBA 3WAEA 3DP4A 1R1NA 1YPNA 4TLLB 2DWAA 3T66A 3K4UA 4OENA 4HCYA 4DZ1A 3HPIA 2XXTA 5A5XA 1EU8A 2H98A 1ZKBA 1ZTYA 3CI8A 3Q25A 3FVKA 4JSDA 4NEDA 4GF8A 4XKPA 3P7IA 3T22A 3MBPA 4R75A 4MLVA 1TFDA 1FTLA 4O3BA 4HW8A 3QYTA 1R9LA 5I58B 1NL5A 1LAXA 4PFYA 1SYHA 5TP9A 2XXYA 2RCBA 4PP0A 3PUZE 2REGA 1FQAA 1J1NA 4NE4A 2ONKE 2HAUA 4MBPA 3G3JA 3K6UA 4O3AA 2Z22A 4F29A 1JVYA 3IR1A 4QFLA 3OD7A 1D9VA 1NNTA 1I6BA 3IOWA 4FEBA 4LATA 4NWCA 3SEVA 3LC8A 1B3LA 3RT8A 1UIVA 3N26A 3OO7A 4E0WA 5AE4A 3SETA 2I4BA 4ELRA 1IXCA 3IB2A 3U72A 1D9YA 1JETA 2ABHA 2OBGA 4DLDA 4XKRA 4U21A 3MVYA 4KYDA 4L17A 4FATA 3TFLA 2HXWA 3RLFE 1IITA 3SKPA 1AL3A 4G68C 1PB7A 2VHAA 3VLUA 2XXXA 3K6XA 3RPWA 2AL4A 4QF9A 2HEUA 2HAVA 1P1OA 1TWYA 3OEMA 2XX7A 3A3CA 4H0WA 2P2AA 4R72A 1AIVA 1UQWA 3MP1A 4ONYA 4QFOA 2ZNTA 2O1MA 4H5FA 2ONSA 1GR2A 1B0HA 3C32A 5I58A 1Y4TA 2Y7PA 1ZBMA 4G8MA 1ELJA 1PBQA 3CG3A 4ZEBA 1ZIUA 1IZ1A 1IEJA 1B3FA 2DWIA 2X7QA 4RPOA 4XXUA 2V84A 2Y7KA 5AA4B 1XS5A 4ZEIA 1JW1A 3FVGA 5IAIA
chains in the Genus database with same CATH superfamily
1FBHA 2KR0A 2XXHA 2ALUA 5I57B 2PX1A 3G3FA 4QFNA 5IKBA 4O7MA 3CIJA 2PCRA 2DWJA 4OWDA 3VV5A 1EYIA 2Y7IA 3R7XA 3CR9A 4FAJA 4YKIA 1MM6A 3V89B 2XXWA 1IMCA 3CVGA 1Y3NA 5DEXB 3TQLA 3JV9A 3QXMA 3KOTA 4NTLA 3M3LA 5TPAB 4HCWA 1AMFA 1MH4A 4N6PA 4P9KA 3A3UA 2ZZWA 4HE1A 3K00A 4GLIA 5ITOA 5BUUA 1IMEA 3F11A 2QVUA 1S7YA 3ILUB 4EQ9A 5AA2B 1Y1ZA 1RYXA 2V93A 2XWKA 4ZE9A 1JEUA 3PUXE 4BDNA 3TODA 4I62A 3VFJA 4NF4B 1Y1MA 4E0XA 1LLSA 3QUFA 5BWJA 4OFJA 4OHNA 1B3HA 4YZZA 1NI9A 3OO8A 3CRBA 3CFLA 3RY3A 3T93B 1MQDA 1SDXA 4EDPA 1QUJA 2H5YA 1Z7ME 4MF3A 2VT5A 3QMFA 2GQ1A 1B52A 2QS4A 1LBCA 4LA9A 3RUMA 3KSJA 3RTFB 5DVFA 4KQPA 4MIJA 4FE8A 1B3EA 4NX1A 3PPRA 4PFIA 1SD3A 5AA4A 4X9TA 5H8NB 4OVTA 4Z7EA 1JVXA 1CE2A 1HSJA 4G2ZA 2XWIA 4IO5A 5I57A 5EQ7A 4KD5A 2V3QA 1NV1A 4DI3D 3MAMA 1L5TA 4XIGQ 5I7IA 3E3KA 1B58A 4H5GA 4FIMA 3U94A 1MH3A 2CZIA 5DEXA 3PUYE 3N94A 3T9HB 1XVYA 3K6WA 1N76A 1FPLA 4IY6A 5ISUA 3K6VA 4C1UA 3JYRA 5L9MA 1QVSA 5JTYB 4YMAA 3CSGA 4ESWA 4EXKA 3A29A 3MPLA 1FQEA 3C9HA 1N04A 1RDXA 2CZKA 3OO6A 1XC1A 5DW8A 5AA2A 3N6UA 4XFEA 2DDKA 1FQFA 4IB2A 3VVFA 3JZJA 2F7AA 4NMYA 1FBCA 2I0CA 2XA5A 2QMXA 3IJOB 2HQ0A 3G3IA 1IMDA 2AYSA 3HCQA 3LSLA 2HXRA 2OWTA 1K9ZA 3K1MA 5F24A 3O9PA 4WEPA 1NV4A 3O97A 4BDRA 1HSLA 2X26A 1EZOA 4HS7A 4GWWA 1PB8A 1LGBC 4H6DA 3LSFB 4PBHA 5H8HB 1A8EA 1PC3A 3C34A 3PUVE 1QUIA 5JK4A 4PF6A 4ZS9A 3IX1A 1LBVA 2P3NA 4HXVA 1A8FA 1B7ZA 1PB9A 2VPNA 1UIUA 3SERA 3HO7A 1A54A 5IM2A 5H8NA 5LOMA 3OSQA 5TU0A 3QIMA 2XWOA 1LAHE 4PBQA 1OMPA 1H76A 1B5IA 3KOSA 3FVOA 4PGNA 2B4LA 2V3UA 4P1LA 5DVIA 4AS5A 4H8IA 4OTEA 4N17A 2CEYA 4PGPA 4F1YA 1MQGA 4YB6A 3TYHA 4JDFA 4IO4A 3W9VA 4F2OA 2ZYKA 4IGRA 3SEYA 3CFZA 4GX3A 5AA3A 4GBWA 1FBFA 3LBSA 4OVRA 1VE4A 3USDA 4LVQA 4BDOA 1DK4A 5I84A 1FQBA 3N5LA 1B46A 2Q8MA 3TTMA 2DQVA 1MXZA 4FJPA 4NF6B 3Q28A 4WKMA 2JJKA 1FPBA 3B7DA 1SW2A 4H65A 2XXQA 4LP2B 5JTYA 5I2NB 2WBDA 3T96B 4I9DA 4RPNA 3S9EA 1EZPA 1B0LA 5EQ8A 4IO7A 3T0JA 1B9JA 2F34A 4IO2A 1B5HA 5CM6A 1H44A 1K9YA 1FJ6A 4F1UA 2PT2A 2V25A 2O84X 3O6GA 3LV0A 4G4PA 4MX6A 1BTJA 2DE3A 3VLWA 3KC1A 1Y20A 4NAPA 4RK2A 4Q5TA 1RYOA 4GWZA 4U23A 2Q2CA 3PD8A 1GGGA 4GFRA 3UIFA 3SEWA 4H46A 1I6QA 4ZZAA 1IIWA 1B4HA 3VDFA 3BFUA 3B6WA 3IO6A 2XXUA 2F78A 3IL1B 3L6HA 1QW0A 2Q89A 4ZDMA 3U8QA 1SPIA 4EF2A 3BFTA 1POY1 2DYXA 5AA1A 3FZVA 3UA8A 3IO4A 4PAFA 1MXWA 2O7UA 1USYE 2Y7WA 1YAEA 2XD2A 4P3LA 1QGXA 4MLQA 4MHFA 4JSOA 2UYEA 3H7MA 1D9QA 5L9SA 3TTLA 5FHMA 4GOTA 3HN0A 2O6AA 4OFOA 3TUSA 2QS3A 3HFUA 2KLFA 3FBPA 2I6EA 2OK2A 3IORA 3D1RA 1GTKA 2WYKA 5ET7A 2PMSA 4JBZA 2Z8EA 4PFRA 4LZ8A 4P0IA 2KQZA 3UK4A 3CG1A 4U1OA 4BDQA 4MNIA 2HZKA 3VLVA 5CBSA 4OANA 1LFGA 2RC7A 3SEXA 4OQOA 1JNFA 1NNKA 3FGSA 5ESYA 3HV1A 3TTKA 4PQJA 4NF6A 3W15C 5FHNA 3TZAA 4WEDA 3KN7A 5I2NA 1IQ7A 2V3TA 4X1DA 1NMUA 5EYHA 1MPDA 2UVJA 4PFWA 3QSLA 3IFAA 2NUVA 2I0BA 3MP8A 1BP5A 2G93A 1SBPA 4OVJA 3GBBA 4ZEDA 2H25A 4MH5A 2W7YA 3DELB 3S9NC 5CC2A 4JVDA 4XF5A 1WVJA 4LQ5A 4F3SA 4LZ5A 4OVQA 2FHYA 1SYIA 3GXAA 3TAJA 3B50A 4MNCA 3IAZA 4PAKA 4EQ7A 3KN3A 2R8TA 3M3FA 2OJTA 3MSTA 3V8XB 1NUXA 1BIYA 4YB5A 3QAXA 4NG7A 1FCKA 4ZE8A 2UVIA 3ZKKA 2XX8A 4JWXA 4QSEA 1ANFA 2Q74A 3PPOA 2FNCA 4EXLA 3H03A 2QVRA 4F31B 3R6UA 1NH7A 1ZU0A 4GXAA 5HPQA 1YYZA 3EN3A 3UORA 4YU0A 3TCHA 1XOCA 3ECRA 3K2DA 4GXSB 3ILTB 2FA7A 2PBWA 1RDZA 5IZ1A 4WXJA 5EHSA 4P0GA 3PPNA 4QHQA 5B70A 3FV1A 4GX4A 4RK9A 4ESXA 4KCDA 2VD3A 2XXKA 4PFTA 1DPPA 1CB6A 2MKZA 3LSWA 1VFDA 1BKAA 4F19A 4R2BA 4O7IA 1EZ9A 3T1BA 4QSDA 3H6TA 2GRVA 3Q27A 1YXIA 5ICQA 2QPQA 3V5AA 1WODA 3FV2A 3K02A 1Y3QA 3T9UA 1Z7NE 3IK6B 4PETA 1EYJA 2FIXA 3FJMA 2ZYOA 4F1VA 2RINA 4P8BA 1QUKA 4QFKA 3H06B 1MG1A 1OQHA 1MQJA 3K0VA 1URGA 1R9QA 3IB0A 4N6KA 3KJ7A 4M4GA 2F36A 3BIHA 3PV0E 4MEVA 2A5SA 3GYYA 2PVUA 1MM7A 1NV0A 3MZ1A 1FTJA 1O63A 3TEPA 1SI1A 2HZLA 1FTMA 1QJMA 4UABA 4RXLA 2RC9A 1MXVA 3G3KA 4F39A 4YKKA 3O6IA 3B8BA 1AWBA 2Z8FA 2BJIA 2UVHA 4JVCA 5IGAA 2NWJA 3NOHA 4PF8A 3FVNA 2D5WA 4BLAA 2UXAA 5HBCA 3I6VA 1M5FA 1FBDA 1OIBA 3M3KA 4OEVA 4QSCA 4TOZA 4G61A 4DDDA 4BDLA 3MZ9A 2B3BA 3D4CA 3I5OA 2Z8DA 3PPQA 1JP4A 1D3KA 1FSAA 3M8UA 5KCJB 1US4A 1LBWA 1LFHA 4KI0E 4R2FA 3T9VA 4M1VA 3S9LC 2OLBA 1OQGA 4YAHX 4NF8B 2F6GA 3TELA 2F5XA 3DP6A 4PTKA 2O7IA 1T0KA 4G77A 4ZEKA 4H1XA 3EHTA 2D21A 4ZEFA 5H8FB 2IEEA 4F3GA 3MVXA 1LBBA 5EHMA 1LAFE 3FD3A 3UP9A 5I56B 1NV7A 4X1BA 1H45A 5F1QA 2RF1A 4ND9A 2M8CA 2FVZA 3PMWA 1XVXA 4N13A 1YTVA 1FTOA 5CMBA 1DTGA 5TPAA 4LZ7A 4OZ9A 5HM4B 1B7UA 1SI0A 4OEUA 4XKNA 3IFCA 1Q9DA 1WDNA 4RY1A 4OERA 1IXIA 2YJPA 3HHFA 4EUOA 1NFTA 1BK4A 1FTKA 3OXNA 1S9TA 1KZ8A 2ZYMA 2E0SA 1NH8A 1PBPA 4JXIA 4NF4A 1ZMGA 2ANJA 1USYH 4R74A 5CMMA 1FQDA 3H6VA 2X7PA 4KR5A 3H3GA 5J1DA 1BLFA 1JW4A 3KC0A 2HFBA 3FXBA 2ONRA 2P0SA 3FATA 1B7HA 2F6PA 5ET8A 4GL8A 1FW0A 1GVCA 4PE5B 5EYGA 1MDQA 4O94A 2F3DA 3BKIB 4NF5B 2BJJX 2ZNSA 4POWA 1OVBA 4XTCQ 1B1HA 3PPPA 3E4RA 4NGUA 3C33A 1MS7A 3GZGA 4TQUQ 4ECFA 3RTWB 2NVUB 1IXHA 4ISUA 2Y5KA 5K2XA 4UA8A 3MP6A 1N0TA 4OVPA 2VPOA 1IXGA 2B65A 4RJZA 4DE8A 4KFQA 1UTHB 1XHYA 3TMGA 2Q88A 1OLCA 4C0RA 2B3FA 4BDMA 4YKJA 2R71A 4AB5A 4LUBA 3PGFA 1EH3A 2QVVA 3T9XB 4ZZEA 4IO6A 1DMBA 2WBBA 4R9FA 4OXVA 1FRPA 1LCFA 1Y9UA 1NKXA 1VFEA 3G7WA 1FQCA 5J16A 4HTGA 3VXCA 3S4UA 3KG2A 1M5CA 1VR5A 2DXRA 4FECA 1B40A 1MY0A 1SQYA 1NV3A 4XKQA 2WX9A 4KHZE 2XXIA 4KYEA 4OMBA 2AIXA 3B6QA 4YMBA 1RKMA 5K2YA 1DSNA 4R6YA 2QSXA 4N07A 1IMAA 1MY4A 3LR1A 1VSOA 4IO3A 2YLNA 3PMVA 4NWDA 5I59B 2VGQA 3QK6A 5L9OA 1I6AA 1MXXA 3RQTA 3MVZA 3IOTA 1HSEA 4DI4B 1MQHA 4GWUA 4LONB 1MY1A 5H8SA 2DE4A 5FTIA 1JQFA 4Q30B 3O6HA 1S50A 3TTRA 4IR8A 1NNFA 2F7BA 2ZXTA 3ZSFA 2PT1A 4EF1A 3PUWE 3BBRA 1N3XA 4NF5A 3I3VA 1N84A 2FBPA 2OZZA 3LUYA 2I48A 5H8HA 2QJEA 2I49A 4F22A 4DXUA 1R6ZA 1NUWA 1NUYA 3MJNA 4DXBA 3AXFA 3PMXA 4R6KA 4KCCA 4R6HA 1YCJA 3FXQA 2CZHA 1FPFA 2GHBA 3RNNA 3MQ9A 3CHGA 5ELVA 4YICA 5L8DA 1UTHA 3PU5A 1P1WA 2Q9TA 4QXDA 4U22A 4AS4A 3MC2A 5CRYA 3H6WA 2OCUA 3N6TA 1P1QA 3VE1B 3O28A 3KSXA 4YKPA 3RT6B 3TCGA 2XXRA 4N8YA 3EQ1A 1FBPA 5FTHA 1MDP1 2ZMBA 5A5LA 4I40A 3DP8A 4TLMB 3S2VA 3C35A 3KGCA 5CI5A 1LB9A 3VVDA 1B3GA 2RC8A 2FYIA 2Y84A 2O51A 4GQOA 2F3BA 1US5A 4N91A 2AL5A 1LEVA 2ZNUA 4POXA 3U92A 5KZTA 2QMWA 4GRKA 2OWZA 5CMCA 3U93A 4QBAA 1JEVA 3KFMA 1M5EA 2CEXA 4X48A 2I3WA 4ZECA 3UN6A 1ZJLA 3E13X 3TQWA 3MZBA 5ITPA 5I59A 1POTA 3EHSA 1MY3A 1Q35A 3IOVA 4FORA 2CZLA 2P1SA 4QFPA 2RCAA 3KBRA 4NF0A 4GVOA 1AH5A 4PE3A 2DS9A 3PD9A 2DVZA 4U2RA 3GBAA 3OMBA 3ROJA 1O64A 2D3IA 3LSXA 4PFUA 4OVSA 4DCYA 4MCOA 2Q8JA 2DXYA 2LAOA 4THIA 3FXRA 5AA2D 1KWHA 1N3WA 4DXCA 1ATGA 4PCDA 3THIA 5LTCA 3D4GA 3ISPA 3MPKA 3VXBA 1B2HA 3QUJA 1NV2A 1B4ZA 1DBZA 1FPDA 3EHUA 1URDA 1QKAA 3IB1A 3KJTA 1B6HA 4KPTA 4GWOA 4P11A 5JEIA 5I3SA 2FIEA 2XXVA 2Y7RA 3EPEA 4G68B 2QRYA 4IY5A 2Z23A 2GFEA 3SESA 2XHDA 2RKMA 3B6TA 4NN3A 2YPNA 5DYHA 4P56A 1FPJA 4I1DA 2ESNA 3SZPA 4N15A 1LSTA 3FUZA 4OESA 4G8HA 4U4SA 2DP8A 4H8JA 3HSTA 2I4CA 2I58A 2NOOA 4U4XA 1I69A 2F7CA 1Y3PA 3L6GA 5I2KB 3ZKLA 3OELA 4DCXA 5M2VA 4G8NA 3K1NA 4JB7A 1XT8A 4MNPA 5IZZA 2VP1A 2QS1A 3SEUA 1LCTA 3EF7A 4I3YA 2THIA 4RA1A 4OFLA 1A7LA 1SW5A 3TCFA 1UTBB 1Y4CA 2WEFA 1MQIA 1B1XA 1OVTA 4R9GA 3HHGA 3RPLB 1D4NA 2PFZA 3C31A 3TTNA 4I8CA 4DIGA 2DE2A 2DVCA 5H8QB 5IZ3B 2O1LA 1MXYA 1SW4A 3RYDA 1FBEA 4FEDA 4MFIA 1MY2A 3G3HA 1A40A 3K1PA 5ET5A 4GL0A 1SVXB 4R73A 3KEIA 2V4CA 1A55A 4K3FA 3R26A 2REJA 1JW5A 3GLBA 3KN8A 3MWBA 1LBXA 2F8DA 2OX3A 4MJOA 3W9WA 4LN5A 4PC9A 3CFXA 4JVIA 1LBZA 1MPCA 4GX6A 4AQ4A 1N7WA 3Q29A 1QKBA 1GV8A 1TXFA 4JWYA 4OETA 3VVEA 4GWXA 4C1TA 2QFLA 2VOZA 1DPEA 2HCAA 2A5TB 3KBZA 1O7TA 5LDZA 4N4UA 3C4MA 3U1OA 4RYAA 2GH9A 5EQAA 2Q2AA 3O29A 5KDTB 4H67A 5DVJA 2XX9A 2F97A 4F18A 4G68A 4IGTA 1M5DA 3Q26A 3WAFA 2VD2A 2QL3A 4PFBA 3DM0A 1PEBA 3CSBA 3OENA 3ODBA 1P1UA 4ELQA 1MXUA 2NXOA 5ICTA 3O66A 4GWYA 2WKYA 1SW1A 1LB8A 1F9BA 3SDFA 2E1SA 2P3VA 4ELPA 1B5JA 1FPEA 4GD5A 3IOUA 2DOJA 5I2KA 1II5A 1N7XA 1QULA 4H45A 4U1ZA 1FPGA 4O3CA 2XWVA 4F3BA 4PDHA 2DSFA 2ZZXA 3FXUA 4F2QA 2L5VA 1LAGE 1M5BA 1PDAA 1DTZA 1P99A 1UTBA 2H9BA 5F7VA 4EQBA 5EYFA 2I3VA 3RPLA 1OLAA 5FBPA 3MYUA 1LFIA 2G29A 1H3DA 1P1NA 1NV6A 1B05A 3IJXB 5H8QA 5IZ3A 2PYYA 4Q0CA 5A5XB 5ET6A 3DLNA 2H99A 3K01A 5EQ9A 3OSRA 4Z0IA 1TFAA 2CMOA 1A99A 1MPBA 4KXPA 4JWOA 3O2AA 3H6UA 1DOTA 2ZYNA 3OOAA 4QRZA 4F3PA 1MRPA 2XXPA 3MW0A 3A09A 3OO9A 4OYVA 3UGWA 3MUQA 3G3GA 5B7DA 3U65A 3C36A 3FJGA 5TP9B 3KZGA 4N6DA 5KCJA 1YZ0A 2F35A 2UYFA 2O69A 3H4ZA 3S9MC 2B4MA 1FPIA 2A5TA 4PDDA 4PAIA 1Q1KA 4KYSA 4NF8A 1B32A 5CBRA 3TKDA 2UVGA 5KDTA 3ZS6A 4RNSA 3TDJA 3OEKA 5H8FA 3V83A 5CMKA 5I56A 1INPA 2H4IA 4P1EA 2O68A 2IA4A 4LQ2A 3FIRA 4MAGA 3TPAA 4ELOA 3E9XA 2QS2A 1AOVA 3RN8A 1TT1A 2GHAA 1KA1A 3RGYA 1B51A 3ONMA 2DWHA 2R6GE 4AB6A 1LBYA 3FASA 2XD3A 1IUDA 2R9JA 4YB7A 4N8GA 4UACA 2OWSA 5FHOA 3LUZA 3MVWA 4GIZA 1DCUA 5DT6A 1ZLQA 1URSA 3FJ7A 1H43A 4OA4A 4Q8RA 1NNPA 5DTBA 3WAEA 3DP4A 1R1NA 1YPNA 4TLLB 4X8RA 1KA0A 2DWAA 3T66A 3K4UA 4OENA 4GBVA 4HCYA 4DZ1A 3HPIA 2XXTA 5A5XA 1EU8A 2H98A 1ZKBA 1ZTYA 3CI8A 3Q25A 3FVKA 4JSDA 4NEDA 4GF8A 4N81A 4XKPA 1EYKA 3P7IA 3T22A 3MBPA 4R75A 4MLVA 1TFDA 1FTLA 4O3BA 4HW8A 3QYTA 1R9LA 5I58B 1NL5A 2Y5LA 1LAXA 2HPGA 4PFYA 1SYHA 1G0IA 5TP9A 1FPKA 2XXYA 2RCBA 4PP0A 5I5PA 4O8MA 3PUZE 2REGA 1FQAA 1J1NA 4NE4A 2ONKE 2HAUA 4MBPA 2WYPA 3G3JA 3K6UA 4O3AA 2Z22A 4F29A 1JVYA 3IR1A 4QFLA 3OD7A 1D9VA 1NNTA 1I6BA 1IMFA 3IOWA 4FEBA 3E78A 4LATA 4NWCA 3SEVA 3LC8A 1B3LA 3RT8A 1UIVA 2ZZVA 3N26A 1FTAA 3OO7A 1XI6A 4E0WA 1IMBA 5AE4A 3PTYA 3SETA 2I4BA 4ELRA 1IXCA 3IB2A 3U72A 1D9YA 1JETA 4FBPA 3BIGA 2ABHA 1FJ9A 2PFYA 4HE0A 4NQ8A 4NHBA 2OBGA 4DLDA 4XKRA 4U21A 1G0HA 3MVYA 4KYDA 4L17A 4FATA 3TFLA 2HXWA 3RLFE 1IITA 3SKPA 1VDWA 1AL3A 4G68C 1PB7A 2VHAA 4GWSA 1RDYA 3VLUA 2XXXA 3K6XA 3RPWA 3EKIA 2AL4A 4QF9A 2HEUA 2HAVA 1P1OA 1TWYA 3E79A 1NUZA 3OEMA 4P47A 2XX7A 1CNQA 4HE2A 3A3CA 4H0WA 5T3JA 2P2AA 4R72A 1AIVA 1UQWA 3MP1A 4I3EA 1NV5A 4ONYA 2HHMA 4QFOA 2ZNTA 2O1MA 4H5FA 2ONSA 1GR2A 1B0HA 3C32A 5I58A 1Y4TA 2Y7PA 1ZBMA 4X04A 4G8MA 4XEQA 4MMPA 1ELJA 1PBQA 3CG3A 4ZEBA 1ZIUA 1IZ1A 1IEJA 1B3FA 1FBGA 2DWIA 2X7QA 4RPOA 4XXUA 2V84A 2Y7KA 5AA4B 1XS5A 4ZEIA 1JW1A 3FVGA 5IAIA
chains in the Genus database with same CATH topology
2XXHA 2ALUA 5I57B 2PX1A 3G3FA 4QFNA 5IKBA 3CIJA 2DWJA 4OWDA 3VV5A 2Y7IA 3R7XA 3CR9A 4FAJA 4YKIA 1MM6A 3V89B 2XXWA 3CVGA 1Y3NA 5DEXB 3TQLA 3JV9A 3QXMA 3KOTA 4NTLA 3M3LA 5TPAB 4HCWA 1AMFA 1MH4A 4N6PA 3A3UA 3K00A 4GLIA 5ITOA 5BUUA 3F11A 1S7YA 3ILUB 4EQ9A 5AA2B 1Y1ZA 1RYXA 2V93A 4ZE9A 1JEUA 3PUXE 4BDNA 3TODA 4I62A 3VFJA 4NF4B 1Y1MA 4E0XA 1LLSA 3QUFA 5BWJA 4OFJA 4OHNA 1B3HA 4YZZA 3OO8A 3CRBA 3CFLA 3RY3A 3T93B 1MQDA 1SDXA 4EDPA 1QUJA 2H5YA 1Z7ME 4MF3A 1B52A 2QS4A 1LBCA 4LA9A 3RUMA 3KSJA 3RTFB 5DVFA 4KQPA 4FE8A 1B3EA 3PPRA 1SD3A 5AA4A 4X9TA 5H8NB 4Z7EA 1JVXA 1CE2A 1HSJA 4G2ZA 4IO5A 5I57A 4KD5A 2V3QA 3MAMA 1L5TA 4XIGQ 3E3KA 1B58A 4H5GA 4FIMA 3U94A 1MH3A 5DEXA 3PUYE 3N94A 3T9HB 1XVYA 3K6WA 1N76A 4IY6A 5ISUA 3K6VA 4C1UA 3JYRA 5L9MA 1QVSA 4YMAA 5JTYB 3CSGA 4ESWA 4EXKA 3MPLA 1FQEA 3C9HA 1N04A 3OO6A 1XC1A 5AA2A 3N6UA 1FQFA 4IB2A 3VVFA 3JZJA 2F7AA 4NMYA 2I0CA 2QMXA 3IJOB 2HQ0A 3G3IA 2AYSA 3HCQA 3LSLA 2OWTA 3K1MA 3O9PA 4WEPA 3O97A 4BDRA 1HSLA 2X26A 1EZOA 4HS7A 1PB8A 1LGBC 4H6DA 3LSFB 5H8HB 1A8EA 1PC3A 3C34A 3PUVE 1QUIA 5JK4A 4ZS9A 3IX1A 1A8FA 1B7ZA 1PB9A 1UIUA 3SERA 3HO7A 1A54A 5H8NA 5LOMA 3OSQA 5TU0A 3QIMA 1LAHE 1OMPA 1H76A 1B5IA 3KOSA 3FVOA 2V3UA 5DVIA 4H8IA 4OTEA 4F1YA 1MQGA 4YB6A 3TYHA 4JDFA 4IO4A 3W9VA 4F2OA 2ZYKA 4IGRA 3SEYA 3CFZA 5AA3A 3LBSA 1VE4A 3USDA 4LVQA 4BDOA 5I84A 1FQBA 3N5LA 1B46A 3TTMA 2DQVA 1MXZA 4FJPA 4NF6B 3Q28A 4WKMA 3B7DA 1SW2A 4H65A 2XXQA 4LP2B 5JTYA 5I2NB 3T96B 4I9DA 4RPNA 3S9EA 1EZPA 1B0LA 4IO7A 1B9JA 2F34A 4IO2A 1B5HA 5CM6A 1H44A 4F1UA 2PT2A 2V25A 2O84X 3O6GA 4G4PA 1BTJA 2DE3A 3VLWA 1Y20A 4RK2A 4Q5TA 1RYOA 4U23A 2Q2CA 3PD8A 1GGGA 4GFRA 3UIFA 3SEWA 1I6QA 4ZZAA 1IIWA 1B4HA 3VDFA 3BFUA 3B6WA 3IO6A 2XXUA 2F78A 3IL1B 3L6HA 1QW0A 2Q89A 4ZDMA 3U8QA 4EF2A 3BFTA 1POY1 2DYXA 5AA1A 3FZVA 3UA8A 3IO4A 1MXWA 2O7UA 1USYE 2Y7WA 1YAEA 2XD2A 4MLQA 4JSOA 2UYEA 3H7MA 5L9SA 3TTLA 5FHMA 4GOTA 3HN0A 2O6AA 4OFOA 3TUSA 2QS3A 2KLFA 2I6EA 2OK2A 3IORA 1GTKA 2PMSA 4JBZA 2Z8EA 4LZ8A 4P0IA 3UK4A 3CG1A 4U1OA 4BDQA 2HZKA 3VLVA 5CBSA 1LFGA 2RC7A 3SEXA 4OQOA 1JNFA 1NNKA 3FGSA 3TTKA 3HV1A 4PQJA 4NF6A 3W15C 5FHNA 3TZAA 4WEDA 3KN7A 5I2NA 1IQ7A 2V3TA 4X1DA 1NMUA 1MPDA 2UVJA 4PFWA 3QSLA 2NUVA 2I0BA 3MP8A 1BP5A 2G93A 1SBPA 4OVJA 3GBBA 4ZEDA 2H25A 4MH5A 2W7YA 3DELB 3S9NC 5CC2A 1WVJA 4LQ5A 4F3SA 4LZ5A 1SYIA 3GXAA 3TAJA 3IAZA 4EQ7A 3KN3A 3M3FA 2OJTA 3V8XB 1BIYA 4YB5A 3QAXA 1FCKA 4ZE8A 2UVIA 3ZKKA 2XX8A 4JWXA 4QSEA 1ANFA 3PPOA 2FNCA 4EXLA 3H03A 4F31B 3R6UA 1NH7A 1ZU0A 4GXAA 5HPQA 3EN3A 3UORA 4YU0A 3TCHA 1XOCA 3ECRA 3K2DA 4GXSB 3ILTB 2FA7A 2PBWA 4WXJA 5EHSA 4P0GA 3PPNA 4QHQA 5B70A 3FV1A 4RK9A 4ESXA 4KCDA 2VD3A 4PFTA 1DPPA 1CB6A 3LSWA 1VFDA 1BKAA 4F19A 4R2BA 1EZ9A 4QSDA 3H6TA 2GRVA 3Q27A 5ICQA 2QPQA 3V5AA 1WODA 3FV2A 3K02A 1Y3QA 3T9UA 1Z7NE 3IK6B 4PETA 3FJMA 2ZYOA 4F1VA 2RINA 1QUKA 4QFKA 3H06B 1MG1A 1OQHA 1MQJA 3K0VA 1URGA 1R9QA 3IB0A 3KJ7A 4M4GA 2F36A 3PV0E 2A5SA 2PVUA 1MM7A 3MZ1A 1FTJA 1O63A 3TEPA 1SI1A 2HZLA 1FTMA 1QJMA 4RXLA 2RC9A 1MXVA 3G3KA 4F39A 4YKKA 3O6IA 2Z8FA 2UVHA 2NWJA 3FVNA 2D5WA 4BLAA 2UXAA 5HBCA 3I6VA 1M5FA 1OIBA 3M3KA 4OEVA 4QSCA 4TOZA 4DDDA 4BDLA 3MZ9A 2B3BA 3D4CA 3I5OA 2Z8DA 3PPQA 1D3KA 3M8UA 5KCJB 1US4A 1LFHA 4KI0E 4R2FA 3T9VA 4M1VA 3S9LC 2OLBA 1OQGA 4YAHX 4NF8B 2F6GA 3TELA 2F5XA 3DP6A 2O7IA 1T0KA 4G77A 4ZEKA 3EHTA 4H1XA 2D21A 4ZEFA 5H8FB 2IEEA 4F3GA 3MVXA 1LBBA 5EHMA 1LAFE 3FD3A 3UP9A 5I56B 4X1BA 1H45A 5F1QA 2RF1A 4ND9A 2M8CA 3PMWA 1XVXA 4N13A 1YTVA 1FTOA 5CMBA 1DTGA 5TPAA 4LZ7A 4OZ9A 5HM4B 1B7UA 1SI0A 4OEUA 4XKNA 1WDNA 4RY1A 4OERA 1IXIA 2YJPA 3HHFA 4EUOA 1NFTA 1FTKA 3OXNA 1S9TA 2ZYMA 2E0SA 1NH8A 1PBPA 4JXIA 4NF4A 1ZMGA 2ANJA 1USYH 4R74A 5CMMA 1FQDA 3H6VA 2X7PA 4KR5A 3H3GA 5J1DA 1BLFA 1JW4A 2HFBA 2ONRA 2P0SA 3FATA 1B7HA 2F6PA 4GL8A 1FW0A 1GVCA 4PE5B 1MDQA 3BKIB 4NF5B 2BJJX 2ZNSA 4POWA 1OVBA 4XTCQ 1B1HA 3PPPA 3E4RA 3C33A 1MS7A 3GZGA 4TQUQ 4ECFA 3RTWB 2NVUB 1IXHA 4ISUA 5K2XA 4UA8A 3MP6A 1N0TA 1IXGA 2B65A 4RJZA 4DE8A 4KFQA 1UTHB 1XHYA 3TMGA 2Q88A 1OLCA 4C0RA 4BDMA 2B3FA 4YKJA 2R71A 4AB5A 4LUBA 3PGFA 1EH3A 3T9XB 4ZZEA 4IO6A 1DMBA 4R9FA 4OXVA 1LCFA 1Y9UA 1NKXA 1VFEA 3G7WA 1FQCA 4HTGA 3VXCA 3S4UA 3KG2A 1M5CA 1VR5A 2DXRA 4FECA 1B40A 1MY0A 1SQYA 4XKQA 4KHZE 2XXIA 4KYEA 4OMBA 2AIXA 3B6QA 4YMBA 1RKMA 5K2YA 1DSNA 4R6YA 2QSXA 4N07A 1MY4A 3LR1A 1VSOA 4IO3A 2YLNA 3PMVA 4NWDA 5I59B 2VGQA 3QK6A 5L9OA 1I6AA 1MXXA 3RQTA 3MVZA 3IOTA 1HSEA 1MQHA 4LONB 1MY1A 5H8SA 2DE4A 5FTIA 1JQFA 4Q30B 3O6HA 1S50A 3TTRA 1NNFA 2F7BA 2ZXTA 3ZSFA 2PT1A 4EF1A 3PUWE 3BBRA 1N3XA 4NF5A 3I3VA 1N84A 2OZZA 3LUYA 2I48A 5H8HA 2QJEA 2I49A 4F22A 4DXUA 1R6ZA 3MJNA 4DXBA 3AXFA 3PMXA 4R6KA 4KCCA 4R6HA 1YCJA 3FXQA 2GHBA 3RNNA 3MQ9A 5ELVA 4YICA 5L8DA 1UTHA 3PU5A 1P1WA 2Q9TA 4U22A 3MC2A 5CRYA 3H6WA 2OCUA 3N6TA 1P1QA 3VE1B 3O28A 3KSXA 4YKPA 3RT6B 3TCGA 2XXRA 3EQ1A 5FTHA 1MDP1 2ZMBA 3DP8A 4TLMB 3S2VA 3C35A 3KGCA 5CI5A 1LB9A 3VVDA 1B3GA 2RC8A 2FYIA 2Y84A 2O51A 4GQOA 1US5A 2AL5A 2ZNUA 4POXA 3U92A 5KZTA 2QMWA 4GRKA 5CMCA 3U93A 1JEVA 3KFMA 1M5EA 4X48A 2I3WA 4ZECA 3UN6A 1ZJLA 3E13X 3TQWA 3MZBA 5ITPA 5I59A 1POTA 3EHSA 1MY3A 1Q35A 3IOVA 4FORA 2CZLA 2P1SA 4QFPA 2RCAA 3KBRA 4GVOA 1AH5A 2DS9A 3PD9A 2DVZA 4U2RA 3GBAA 3OMBA 1O64A 2D3IA 3LSXA 4PFUA 4DCYA 2Q8JA 2DXYA 2LAOA 4THIA 3FXRA 5AA2D 1KWHA 1N3WA 4DXCA 1ATGA 3THIA 3D4GA 3MPKA 3VXBA 1B2HA 3QUJA 1B4ZA 3EHUA 1URDA 1QKAA 3IB1A 3KJTA 1B6HA 4KPTA 4GWOA 4P11A 5JEIA 2XXVA 2Y7RA 3EPEA 4G68B 2QRYA 4IY5A 2Z23A 2GFEA 3SESA 2XHDA 2RKMA 3B6TA 2YPNA 5DYHA 4I1DA 2ESNA 1LSTA 3FUZA 4OESA 4G8HA 4U4SA 2DP8A 4H8JA 3HSTA 2I4CA 2I58A 2NOOA 4U4XA 1I69A 2F7CA 1Y3PA 3L6GA 5I2KB 3ZKLA 3OELA 4DCXA 5M2VA 4G8NA 3K1NA 4JB7A 1XT8A 2VP1A 2QS1A 3SEUA 1LCTA 3EF7A 2THIA 4RA1A 4OFLA 1A7LA 1SW5A 3TCFA 1UTBB 1Y4CA 1MQIA 1B1XA 1OVTA 4R9GA 3HHGA 1D4NA 3C31A 3TTNA 4I8CA 4DIGA 2DE2A 2DVCA 5H8QB 2O1LA 1MXYA 1SW4A 4FEDA 4MFIA 1MY2A 3G3HA 1A40A 3K1PA 4GL0A 1SVXB 4R73A 3KEIA 1A55A 4K3FA 3R26A 2REJA 1JW5A 3GLBA 3KN8A 3MWBA 2F8DA 3W9WA 3CFXA 1MPCA 4AQ4A 1N7WA 3Q29A 1QKBA 1GV8A 1TXFA 4JWYA 4OETA 3VVEA 4C1TA 2VOZA 1DPEA 2HCAA 2A5TB 1O7TA 3C4MA 3U1OA 4RYAA 2GH9A 2Q2AA 3O29A 5KDTB 4H67A 4F18A 2XX9A 2F97A 5DVJA 4G68A 4IGTA 1M5DA 3Q26A 3WAFA 2VD2A 2QL3A 3DM0A 1PEBA 3CSBA 3OENA 3ODBA 1P1UA 4ELQA 1MXUA 2NXOA 5ICTA 3O66A 2WKYA 1SW1A 1LB8A 1F9BA 3SDFA 2E1SA 4ELPA 1B5JA 4GD5A 3IOUA 2DOJA 5I2KA 1II5A 1N7XA 1QULA 4U1ZA 4O3CA 4F3BA 2DSFA 3FXUA 4F2QA 1LAGE 1M5BA 1PDAA 1DTZA 1P99A 1UTBA 2H9BA 5F7VA 4EQBA 5EYFA 2I3VA 1OLAA 1LFIA 2G29A 1H3DA 1P1NA 1B05A 3IJXB 5H8QA 2PYYA 4Q0CA 5A5XB 3DLNA 2H99A 3K01A 3OSRA 4Z0IA 1TFAA 2CMOA 1A99A 1MPBA 4JWOA 3O2AA 3H6UA 1DOTA 2ZYNA 3OOAA 4QRZA 4F3PA 1MRPA 2XXPA 3MW0A 3A09A 3OO9A 4OYVA 3UGWA 3MUQA 3G3GA 5B7DA 3C36A 3FJGA 5TP9B 3KZGA 5KCJA 2F35A 2UYFA 2O69A 3H4ZA 3S9MC 2A5TA 1Q1KA 4KYSA 4NF8A 1B32A 5CBRA 3TKDA 2UVGA 5KDTA 3ZS6A 4RNSA 3TDJA 3OEKA 5H8FA 3V83A 5CMKA 5I56A 2H4IA 2O68A 2IA4A 4LQ2A 3FIRA 3TPAA 4ELOA 3E9XA 2QS2A 1AOVA 3RN8A 1TT1A 2GHAA 3RGYA 1B51A 3ONMA 2DWHA 2R6GE 4AB6A 3FASA 2XD3A 1IUDA 2R9JA 4YB7A 4UACA 2OWSA 5FHOA 3MVWA 4GIZA 5DT6A 1ZLQA 1URSA 3FJ7A 1H43A 4Q8RA 1NNPA 5DTBA 3WAEA 3DP4A 1R1NA 1YPNA 4TLLB 2DWAA 3T66A 3K4UA 4OENA 4HCYA 4DZ1A 3HPIA 2XXTA 5A5XA 1EU8A 2H98A 1ZKBA 1ZTYA 3CI8A 3Q25A 3FVKA 4JSDA 4NEDA 4GF8A 4XKPA 3P7IA 3T22A 3MBPA 4R75A 4MLVA 1TFDA 1FTLA 4O3BA 4HW8A 3QYTA 1R9LA 5I58B 1NL5A 1LAXA 4PFYA 1SYHA 5TP9A 2XXYA 2RCBA 4PP0A 3PUZE 2REGA 1FQAA 1J1NA 4NE4A 2ONKE 2HAUA 4MBPA 3G3JA 3K6UA 4O3AA 2Z22A 4F29A 1JVYA 3IR1A 4QFLA 3OD7A 1D9VA 1NNTA 1I6BA 3IOWA 4FEBA 4LATA 4NWCA 3SEVA 3LC8A 1B3LA 3RT8A 1UIVA 3N26A 3OO7A 4E0WA 5AE4A 3SETA 2I4BA 4ELRA 1IXCA 3IB2A 3U72A 1D9YA 1JETA 2ABHA 2OBGA 4DLDA 4XKRA 4U21A 3MVYA 4KYDA 4L17A 4FATA 3TFLA 2HXWA 3RLFE 1IITA 3SKPA 1AL3A 4G68C 1PB7A 2VHAA 3VLUA 2XXXA 3K6XA 3RPWA 2AL4A 4QF9A 2HEUA 2HAVA 1P1OA 1TWYA 3OEMA 2XX7A 3A3CA 4H0WA 2P2AA 4R72A 1AIVA 1UQWA 3MP1A 4ONYA 4QFOA 2ZNTA 2O1MA 4H5FA 2ONSA 1GR2A 1B0HA 3C32A 5I58A 1Y4TA 2Y7PA 1ZBMA 4G8MA 1ELJA 1PBQA 3CG3A 4ZEBA 1ZIUA 1IZ1A 1IEJA 1B3FA 2DWIA 2X7QA 4RPOA 4XXUA 2V84A 2Y7KA 5AA4B 1XS5A 4ZEIA 1JW1A 3FVGA 5IAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXH A;  2ALU A;  5I57 B;  2PX1 A;  3G3F A;  4QFN A;  5IKB A;  3CIJ A;  2DWJ A;  4OWD A;  3VV5 A;  2Y7I A;  3R7X A;  3CR9 A;  4FAJ A;  4YKI A;  1MM6 A;  3V89 B;  2XXW A;  3CVG A;  1Y3N A;  5DEX B;  3TQL A;  3JV9 A;  3QXM A;  3KOT A;  4NTL A;  3M3L A;  5TPA B;  4HCW A;  1AMF A;  1MH4 A;  4N6P A;  3A3U A;  3K00 A;  4GLI A;  5ITO A;  5BUU A;  3F11 A;  1S7Y A;  3ILU B;  4EQ9 A;  5AA2 B;  1Y1Z A;  1RYX A;  2V93 A;  4ZE9 A;  1JEU A;  3PUX E;  4BDN A;  3TOD A;  4I62 A;  3VFJ A;  4NF4 B;  1Y1M A;  4E0X A;  1LLS A;  3QUF A;  5BWJ A;  4OFJ A;  4OHN A;  1B3H A;  4YZZ A;  3OO8 A;  3CRB A;  3CFL A;  3RY3 A;  3T93 B;  1MQD A;  1SDX A;  4EDP A;  1QUJ A;  2H5Y A;  1Z7M E;  4MF3 A;  1B52 A;  2QS4 A;  1LBC A;  4LA9 A;  3RUM A;  3KSJ A;  3RTF B;  5DVF A;  4KQP A;  4FE8 A;  1B3E A;  3PPR A;  1SD3 A;  5AA4 A;  4X9T A;  5H8N B;  4Z7E A;  1JVX A;  1CE2 A;  1HSJ A;  4G2Z A;  4IO5 A;  5I57 A;  4KD5 A;  2V3Q A;  3MAM A;  1L5T A;  4XIG Q;  3E3K A;  1B58 A;  4H5G A;  4FIM A;  3U94 A;  1MH3 A;  5DEX A;  3PUY E;  3N94 A;  3T9H B;  1XVY A;  3K6W A;  1N76 A;  4IY6 A;  5ISU A;  3K6V A;  4C1U A;  3JYR A;  5L9M A;  1QVS A;  4YMA A;  5JTY B;  3CSG A;  4ESW A;  4EXK A;  3MPL A;  1FQE A;  3C9H A;  1N04 A;  3OO6 A;  1XC1 A;  5AA2 A;  3N6U A;  1FQF A;  4IB2 A;  3VVF A;  3JZJ A;  2F7A A;  4NMY A;  2I0C A;  2QMX A;  3IJO B;  2HQ0 A;  3G3I A;  2AYS A;  3HCQ A;  3LSL A;  2OWT A;  3K1M A;  3O9P A;  4WEP A;  3O97 A;  4BDR A;  1HSL A;  2X26 A;  1EZO A;  4HS7 A;  1PB8 A;  1LGB C;  4H6D A;  3LSF B;  5H8H B;  1A8E A;  1PC3 A;  3C34 A;  3PUV E;  1QUI A;  5JK4 A;  4ZS9 A;  3IX1 A;  1A8F A;  1B7Z A;  1PB9 A;  1UIU A;  3SER A;  3HO7 A;  1A54 A;  5H8N A;  5LOM A;  3OSQ A;  5TU0 A;  3QIM A;  1LAH E;  1OMP A;  1H76 A;  1B5I A;  3KOS A;  3FVO A;  2V3U A;  5DVI A;  4H8I A;  4OTE A;  4F1Y A;  1MQG A;  4YB6 A;  3TYH A;  4JDF A;  4IO4 A;  3W9V A;  4F2O A;  2ZYK A;  4IGR A;  3SEY A;  3CFZ A;  5AA3 A;  3LBS A;  1VE4 A;  3USD A;  4LVQ A;  4BDO A;  5I84 A;  1FQB A;  3N5L A;  1B46 A;  3TTM A;  2DQV A;  1MXZ A;  4FJP A;  4NF6 B;  3Q28 A;  4WKM A;  3B7D A;  1SW2 A;  4H65 A;  2XXQ A;  4LP2 B;  5JTY A;  5I2N B;  3T96 B;  4I9D A;  4RPN A;  3S9E A;  1EZP A;  1B0L A;  4IO7 A;  1B9J A;  2F34 A;  4IO2 A;  1B5H A;  5CM6 A;  1H44 A;  4F1U A;  2PT2 A;  2V25 A;  2O84 X;  3O6G A;  4G4P A;  1BTJ A;  2DE3 A;  3VLW A;  1Y20 A;  4RK2 A;  4Q5T A;  1RYO A;  4U23 A;  2Q2C A;  3PD8 A;  1GGG A;  4GFR A;  3UIF A;  3SEW A;  1I6Q A;  4ZZA A;  1IIW A;  1B4H A;  3VDF A;  3BFU A;  3B6W A;  3IO6 A;  2XXU A;  2F78 A;  3IL1 B;  3L6H A;  1QW0 A;  2Q89 A;  4ZDM A;  3U8Q A;  4EF2 A;  3BFT A;  1POY 1;  2DYX A;  5AA1 A;  3FZV A;  3UA8 A;  3IO4 A;  1MXW A;  2O7U A;  1USY E;  2Y7W A;  1YAE A;  2XD2 A;  4MLQ A;  4JSO A;  2UYE A;  3H7M A;  5L9S A;  3TTL A;  5FHM A;  4GOT A;  3HN0 A;  2O6A A;  4OFO A;  3TUS A;  2QS3 A;  2KLF A;  2I6E A;  2OK2 A;  3IOR A;  1GTK A;  2PMS A;  4JBZ A;  2Z8E A;  4LZ8 A;  4P0I A;  3UK4 A;  3CG1 A;  4U1O A;  4BDQ A;  2HZK A;  3VLV A;  5CBS A;  1LFG A;  2RC7 A;  3SEX A;  4OQO A;  1JNF A;  1NNK A;  3FGS A;  3TTK A;  3HV1 A;  4PQJ A;  4NF6 A;  3W15 C;  5FHN A;  3TZA A;  4WED A;  3KN7 A;  5I2N A;  1IQ7 A;  2V3T A;  4X1D A;  1NMU A;  1MPD A;  2UVJ A;  4PFW A;  3QSL A;  2NUV A;  2I0B A;  3MP8 A;  1BP5 A;  2G93 A;  1SBP A;  4OVJ A;  3GBB A;  4ZED A;  2H25 A;  4MH5 A;  2W7Y A;  3DEL B;  3S9N C;  5CC2 A;  1WVJ A;  4LQ5 A;  4F3S A;  4LZ5 A;  1SYI A;  3GXA A;  3TAJ A;  3IAZ A;  4EQ7 A;  3KN3 A;  3M3F A;  2OJT A;  3V8X B;  1BIY A;  4YB5 A;  3QAX A;  1FCK A;  4ZE8 A;  2UVI A;  3ZKK A;  2XX8 A;  4JWX A;  4QSE A;  1ANF A;  3PPO A;  2FNC A;  4EXL A;  3H03 A;  4F31 B;  3R6U A;  1NH7 A;  1ZU0 A;  4GXA A;  5HPQ A;  3EN3 A;  3UOR A;  4YU0 A;  3TCH A;  1XOC A;  3ECR A;  3K2D A;  4GXS B;  3ILT B;  2FA7 A;  2PBW A;  4WXJ A;  5EHS A;  4P0G A;  3PPN A;  4QHQ A;  5B70 A;  3FV1 A;  4RK9 A;  4ESX A;  4KCD A;  2VD3 A;  4PFT A;  1DPP A;  1CB6 A;  3LSW A;  1VFD A;  1BKA A;  4F19 A;  4R2B A;  1EZ9 A;  4QSD A;  3H6T A;  2GRV A;  3Q27 A;  5ICQ A;  2QPQ A;  3V5A A;  1WOD A;  3FV2 A;  3K02 A;  1Y3Q A;  3T9U A;  1Z7N E;  3IK6 B;  4PET A;  3FJM A;  2ZYO A;  4F1V A;  2RIN A;  1QUK A;  4QFK A;  3H06 B;  1MG1 A;  1OQH A;  1MQJ A;  3K0V A;  1URG A;  1R9Q A;  3IB0 A;  3KJ7 A;  4M4G A;  2F36 A;  3PV0 E;  2A5S A;  2PVU A;  1MM7 A;  3MZ1 A;  1FTJ A;  1O63 A;  3TEP A;  1SI1 A;  2HZL A;  1FTM A;  1QJM A;  4RXL A;  2RC9 A;  1MXV A;  3G3K A;  4F39 A;  4YKK A;  3O6I A;  2Z8F A;  2UVH A;  2NWJ A;  3FVN A;  2D5W A;  4BLA A;  2UXA A;  5HBC A;  3I6V A;  1M5F A;  1OIB A;  3M3K A;  4OEV A;  4QSC A;  4TOZ A;  4DDD A;  4BDL A;  3MZ9 A;  2B3B A;  3D4C A;  3I5O A;  2Z8D A;  3PPQ A;  1D3K A;  3M8U A;  5KCJ B;  1US4 A;  1LFH A;  4KI0 E;  4R2F A;  3T9V A;  4M1V A;  3S9L C;  2OLB A;  1OQG A;  4YAH X;  4NF8 B;  2F6G A;  3TEL A;  2F5X A;  3DP6 A;  2O7I A;  1T0K A;  4G77 A;  4ZEK A;  3EHT A;  4H1X A;  2D21 A;  4ZEF A;  5H8F B;  2IEE A;  4F3G A;  3MVX A;  1LBB A;  5EHM A;  1LAF E;  3FD3 A;  3UP9 A;  5I56 B;  4X1B A;  1H45 A;  5F1Q A;  2RF1 A;  4ND9 A;  2M8C A;  3PMW A;  1XVX A;  4N13 A;  1YTV A;  1FTO A;  5CMB A;  1DTG A;  5TPA A;  4LZ7 A;  4OZ9 A;  5HM4 B;  1B7U A;  1SI0 A;  4OEU A;  4XKN A;  1WDN A;  4RY1 A;  4OER A;  1IXI A;  2YJP A;  3HHF A;  4EUO A;  1NFT A;  1FTK A;  3OXN A;  1S9T A;  2ZYM A;  2E0S A;  1NH8 A;  1PBP A;  4JXI A;  4NF4 A;  1ZMG A;  2ANJ A;  1USY H;  4R74 A;  5CMM A;  1FQD A;  3H6V A;  2X7P A;  4KR5 A;  3H3G A;  5J1D A;  1BLF A;  1JW4 A;  2HFB A;  2ONR A;  2P0S A;  3FAT A;  1B7H A;  2F6P A;  4GL8 A;  1FW0 A;  1GVC A;  4PE5 B;  1MDQ A;  3BKI B;  4NF5 B;  2BJJ X;  2ZNS A;  4POW A;  1OVB A;  4XTC Q;  1B1H A;  3PPP A;  3E4R A;  3C33 A;  1MS7 A;  3GZG A;  4TQU Q;  4ECF A;  3RTW B;  2NVU B;  1IXH A;  4ISU A;  5K2X A;  4UA8 A;  3MP6 A;  1N0T A;  1IXG A;  2B65 A;  4RJZ A;  4DE8 A;  4KFQ A;  1UTH B;  1XHY A;  3TMG A;  2Q88 A;  1OLC A;  4C0R A;  4BDM A;  2B3F A;  4YKJ A;  2R71 A;  4AB5 A;  4LUB A;  3PGF A;  1EH3 A;  3T9X B;  4ZZE A;  4IO6 A;  1DMB A;  4R9F A;  4OXV A;  1LCF A;  1Y9U A;  1NKX A;  1VFE A;  3G7W A;  1FQC A;  4HTG A;  3VXC A;  3S4U A;  3KG2 A;  1M5C A;  1VR5 A;  2DXR A;  4FEC A;  1B40 A;  1MY0 A;  1SQY A;  4XKQ A;  4KHZ E;  2XXI A;  4KYE A;  4OMB A;  2AIX A;  3B6Q A;  4YMB A;  1RKM A;  5K2Y A;  1DSN A;  4R6Y A;  2QSX A;  4N07 A;  1MY4 A;  3LR1 A;  1VSO A;  4IO3 A;  2YLN A;  3PMV A;  4NWD A;  5I59 B;  2VGQ A;  3QK6 A;  5L9O A;  1I6A A;  1MXX A;  3RQT A;  3MVZ A;  3IOT A;  1HSE A;  1MQH A;  4LON B;  1MY1 A;  5H8S A;  2DE4 A;  5FTI A;  1JQF A;  4Q30 B;  3O6H A;  1S50 A;  3TTR A;  1NNF A;  2F7B A;  2ZXT A;  3ZSF A;  2PT1 A;  4EF1 A;  3PUW E;  3BBR A;  1N3X A;  4NF5 A;  3I3V A;  1N84 A;  2OZZ A;  3LUY A;  2I48 A;  5H8H A;  2QJE A;  2I49 A;  4F22 A;  4DXU A;  1R6Z A;  3MJN A;  4DXB A;  3AXF A;  3PMX A;  4R6K A;  4KCC A;  4R6H A;  1YCJ A;  3FXQ A;  2GHB A;  3RNN A;  3MQ9 A;  5ELV A;  4YIC A;  5L8D A;  1UTH A;  3PU5 A;  1P1W A;  2Q9T A;  4U22 A;  3MC2 A;  5CRY A;  3H6W A;  2OCU A;  3N6T A;  1P1Q A;  3VE1 B;  3O28 A;  3KSX A;  4YKP A;  3RT6 B;  3TCG A;  2XXR A;  3EQ1 A;  5FTH A;  1MDP 1;  2ZMB A;  3DP8 A;  4TLM B;  3S2V A;  3C35 A;  3KGC A;  5CI5 A;  1LB9 A;  3VVD A;  1B3G A;  2RC8 A;  2FYI A;  2Y84 A;  2O51 A;  4GQO A;  1US5 A;  2AL5 A;  2ZNU A;  4POX A;  3U92 A;  5KZT A;  2QMW A;  4GRK A;  5CMC A;  3U93 A;  1JEV A;  3KFM A;  1M5E A;  4X48 A;  2I3W A;  4ZEC A;  3UN6 A;  1ZJL A;  3E13 X;  3TQW A;  3MZB A;  5ITP A;  5I59 A;  1POT A;  3EHS A;  1MY3 A;  1Q35 A;  3IOV A;  4FOR A;  2CZL A;  2P1S A;  4QFP A;  2RCA A;  3KBR A;  4GVO A;  1AH5 A;  2DS9 A;  3PD9 A;  2DVZ A;  4U2R A;  3GBA A;  3OMB A;  1O64 A;  2D3I A;  3LSX A;  4PFU A;  4DCY A;  2Q8J A;  2DXY A;  2LAO A;  4THI A;  3FXR A;  5AA2 D;  1KWH A;  1N3W A;  4DXC A;  1ATG A;  3THI A;  3D4G A;  3MPK A;  3VXB A;  1B2H A;  3QUJ A;  1B4Z A;  3EHU A;  1URD A;  1QKA A;  3IB1 A;  3KJT A;  1B6H A;  4KPT A;  4GWO A;  4P11 A;  5JEI A;  2XXV A;  2Y7R A;  3EPE A;  4G68 B;  2QRY A;  4IY5 A;  2Z23 A;  2GFE A;  3SES A;  2XHD A;  2RKM A;  3B6T A;  2YPN A;  5DYH A;  4I1D A;  2ESN A;  1LST A;  3FUZ A;  4OES A;  4G8H A;  4U4S A;  2DP8 A;  4H8J A;  3HST A;  2I4C A;  2I58 A;  2NOO A;  4U4X A;  1I69 A;  2F7C A;  1Y3P A;  3L6G A;  5I2K B;  3ZKL A;  3OEL A;  4DCX A;  5M2V A;  4G8N A;  3K1N A;  4JB7 A;  1XT8 A;  2VP1 A;  2QS1 A;  3SEU A;  1LCT A;  3EF7 A;  2THI A;  4RA1 A;  4OFL A;  1A7L A;  1SW5 A;  3TCF A;  1UTB B;  1Y4C A;  1MQI A;  1B1X A;  1OVT A;  4R9G A;  3HHG A;  1D4N A;  3C31 A;  3TTN A;  4I8C A;  4DIG A;  2DE2 A;  2DVC A;  5H8Q B;  2O1L A;  1MXY A;  1SW4 A;  4FED A;  4MFI A;  1MY2 A;  3G3H A;  1A40 A;  3K1P A;  4GL0 A;  1SVX B;  4R73 A;  3KEI A;  1A55 A;  4K3F A;  3R26 A;  2REJ A;  1JW5 A;  3GLB A;  3KN8 A;  3MWB A;  2F8D A;  3W9W A;  3CFX A;  1MPC A;  4AQ4 A;  1N7W A;  3Q29 A;  1QKB A;  1GV8 A;  1TXF A;  4JWY A;  4OET A;  3VVE A;  4C1T A;  2VOZ A;  1DPE A;  2HCA A;  2A5T B;  1O7T A;  3C4M A;  3U1O A;  4RYA A;  2GH9 A;  2Q2A A;  3O29 A;  5KDT B;  4H67 A;  4F18 A;  2XX9 A;  2F97 A;  5DVJ A;  4G68 A;  4IGT A;  1M5D A;  3Q26 A;  3WAF A;  2VD2 A;  2QL3 A;  3DM0 A;  1PEB A;  3CSB A;  3OEN A;  3ODB A;  1P1U A;  4ELQ A;  1MXU A;  2NXO A;  5ICT A;  3O66 A;  2WKY A;  1SW1 A;  1LB8 A;  1F9B A;  3SDF A;  2E1S A;  4ELP A;  1B5J A;  4GD5 A;  3IOU A;  2DOJ A;  5I2K A;  1II5 A;  1N7X A;  1QUL A;  4U1Z A;  4O3C A;  4F3B A;  2DSF A;  3FXU A;  4F2Q A;  1LAG E;  1M5B A;  1PDA A;  1DTZ A;  1P99 A;  1UTB A;  2H9B A;  5F7V A;  4EQB A;  5EYF A;  2I3V A;  1OLA A;  1LFI A;  2G29 A;  1H3D A;  1P1N A;  1B05 A;  3IJX B;  5H8Q A;  2PYY A;  4Q0C A;  5A5X B;  3DLN A;  2H99 A;  3K01 A;  3OSR A;  4Z0I A;  1TFA A;  2CMO A;  1A99 A;  1MPB A;  4JWO A;  3O2A A;  3H6U A;  1DOT A;  2ZYN A;  3OOA A;  4QRZ A;  4F3P A;  1MRP A;  2XXP A;  3MW0 A;  3A09 A;  3OO9 A;  4OYV A;  3UGW A;  3MUQ A;  3G3G A;  5B7D A;  3C36 A;  3FJG A;  5TP9 B;  3KZG A;  5KCJ A;  2F35 A;  2UYF A;  2O69 A;  3H4Z A;  3S9M C;  2A5T A;  1Q1K A;  4KYS A;  4NF8 A;  1B32 A;  5CBR A;  3TKD A;  2UVG A;  5KDT A;  3ZS6 A;  4RNS A;  3TDJ A;  3OEK A;  5H8F A;  3V83 A;  5CMK A;  5I56 A;  2H4I A;  2O68 A;  2IA4 A;  4LQ2 A;  3FIR A;  3TPA A;  4ELO A;  3E9X A;  2QS2 A;  1AOV A;  3RN8 A;  1TT1 A;  2GHA A;  3RGY A;  1B51 A;  3ONM A;  2DWH A;  2R6G E;  4AB6 A;  3FAS A;  2XD3 A;  1IUD A;  2R9J A;  4YB7 A;  4UAC A;  2OWS A;  5FHO A;  3MVW A;  4GIZ A;  5DT6 A;  1ZLQ A;  1URS A;  3FJ7 A;  1H43 A;  4Q8R A;  1NNP A;  5DTB A;  3WAE A;  3DP4 A;  1R1N A;  1YPN A;  4TLL B;  2DWA A;  3T66 A;  3K4U A;  4OEN A;  4HCY A;  4DZ1 A;  3HPI A;  2XXT A;  5A5X A;  1EU8 A;  2H98 A;  1ZKB A;  1ZTY A;  3CI8 A;  3Q25 A;  3FVK A;  4JSD A;  4NED A;  4GF8 A;  4XKP A;  3P7I A;  3T22 A;  3MBP A;  4R75 A;  4MLV A;  1TFD A;  1FTL A;  4O3B A;  4HW8 A;  3QYT A;  1R9L A;  5I58 B;  1NL5 A;  1LAX A;  4PFY A;  1SYH A;  5TP9 A;  2XXY A;  2RCB A;  4PP0 A;  3PUZ E;  2REG A;  1FQA A;  1J1N A;  4NE4 A;  2ONK E;  2HAU A;  4MBP A;  3G3J A;  3K6U A;  4O3A A;  2Z22 A;  4F29 A;  1JVY A;  3IR1 A;  4QFL A;  3OD7 A;  1D9V A;  1NNT A;  1I6B A;  3IOW A;  4FEB A;  4LAT A;  4NWC A;  3SEV A;  3LC8 A;  1B3L A;  3RT8 A;  1UIV A;  3N26 A;  3OO7 A;  4E0W A;  5AE4 A;  3SET A;  2I4B A;  4ELR A;  1IXC A;  3IB2 A;  3U72 A;  1D9Y A;  1JET A;  2ABH A;  2OBG A;  4DLD A;  4XKR A;  4U21 A;  3MVY A;  4KYD A;  4L17 A;  4FAT A;  3TFL A;  2HXW A;  3RLF E;  1IIT A;  3SKP A;  1AL3 A;  4G68 C;  1PB7 A;  2VHA A;  3VLU A;  2XXX A;  3K6X A;  3RPW A;  2AL4 A;  4QF9 A;  2HEU A;  2HAV A;  1P1O A;  1TWY A;  3OEM A;  2XX7 A;  3A3C A;  4H0W A;  2P2A A;  4R72 A;  1AIV A;  1UQW A;  3MP1 A;  4ONY A;  4QFO A;  2ZNT A;  2O1M A;  4H5F A;  2ONS A;  1GR2 A;  1B0H A;  3C32 A;  5I58 A;  1Y4T A;  2Y7P A;  1ZBM A;  4G8M A;  1ELJ A;  1PBQ A;  3CG3 A;  4ZEB A;  1ZIU A;  1IZ1 A;  1IEJ A;  1B3F A;  2DWI A;  2X7Q A;  4RPO A;  4XXU A;  2V84 A;  2Y7K A;  5AA4 B;  1XS5 A;  4ZEI A;  1JW1 A;  3FVG A;  5IAI A; 
#chains in the Genus database with same CATH topology
 1FBH A;  2KR0 A;  2XXH A;  2ALU A;  5I57 B;  2PX1 A;  3G3F A;  4QFN A;  5IKB A;  4O7M A;  3CIJ A;  2PCR A;  2DWJ A;  4OWD A;  3VV5 A;  1EYI A;  2Y7I A;  3R7X A;  3CR9 A;  4FAJ A;  4YKI A;  1MM6 A;  3V89 B;  2XXW A;  1IMC A;  3CVG A;  1Y3N A;  5DEX B;  3TQL A;  3JV9 A;  3QXM A;  3KOT A;  4NTL A;  3M3L A;  5TPA B;  4HCW A;  1AMF A;  1MH4 A;  4N6P A;  4P9K A;  3A3U A;  2ZZW A;  4HE1 A;  3K00 A;  4GLI A;  5ITO A;  5BUU A;  1IME A;  3F11 A;  2QVU A;  1S7Y A;  3ILU B;  4EQ9 A;  5AA2 B;  1Y1Z A;  1RYX A;  2V93 A;  2XWK A;  4ZE9 A;  1JEU A;  3PUX E;  4BDN A;  3TOD A;  4I62 A;  3VFJ A;  4NF4 B;  1Y1M A;  4E0X A;  1LLS A;  3QUF A;  5BWJ A;  4OFJ A;  4OHN A;  1B3H A;  4YZZ A;  1NI9 A;  3OO8 A;  3CRB A;  3CFL A;  3RY3 A;  3T93 B;  1MQD A;  1SDX A;  4EDP A;  1QUJ A;  2H5Y A;  1Z7M E;  4MF3 A;  2VT5 A;  3QMF A;  2GQ1 A;  1B52 A;  2QS4 A;  1LBC A;  4LA9 A;  3RUM A;  3KSJ A;  3RTF B;  5DVF A;  4KQP A;  4MIJ A;  4FE8 A;  1B3E A;  4NX1 A;  3PPR A;  4PFI A;  1SD3 A;  5AA4 A;  4X9T A;  5H8N B;  4OVT A;  4Z7E A;  1JVX A;  1CE2 A;  1HSJ A;  4G2Z A;  2XWI A;  4IO5 A;  5I57 A;  5EQ7 A;  4KD5 A;  2V3Q A;  1NV1 A;  4DI3 D;  3MAM A;  1L5T A;  4XIG Q;  5I7I A;  3E3K A;  1B58 A;  4H5G A;  4FIM A;  3U94 A;  1MH3 A;  2CZI A;  5DEX A;  3PUY E;  3N94 A;  3T9H B;  1XVY A;  3K6W A;  1N76 A;  1FPL A;  4IY6 A;  5ISU A;  3K6V A;  4C1U A;  3JYR A;  5L9M A;  1QVS A;  5JTY B;  4YMA A;  3CSG A;  4ESW A;  4EXK A;  3A29 A;  3MPL A;  1FQE A;  3C9H A;  1N04 A;  1RDX A;  2CZK A;  3OO6 A;  1XC1 A;  5DW8 A;  5AA2 A;  3N6U A;  4XFE A;  2DDK A;  1FQF A;  4IB2 A;  3VVF A;  3JZJ A;  2F7A A;  4NMY A;  1FBC A;  2I0C A;  2XA5 A;  2QMX A;  3IJO B;  2HQ0 A;  3G3I A;  1IMD A;  2AYS A;  3HCQ A;  3LSL A;  2HXR A;  2OWT A;  1K9Z A;  3K1M A;  5F24 A;  3O9P A;  4WEP A;  1NV4 A;  3O97 A;  4BDR A;  1HSL A;  2X26 A;  1EZO A;  4HS7 A;  4GWW A;  1PB8 A;  1LGB C;  4H6D A;  3LSF B;  4PBH A;  5H8H B;  1A8E A;  1PC3 A;  3C34 A;  3PUV E;  1QUI A;  5JK4 A;  4PF6 A;  4ZS9 A;  3IX1 A;  1LBV A;  2P3N A;  4HXV A;  1A8F A;  1B7Z A;  1PB9 A;  2VPN A;  1UIU A;  3SER A;  3HO7 A;  1A54 A;  5IM2 A;  5H8N A;  5LOM A;  3OSQ A;  5TU0 A;  3QIM A;  2XWO A;  1LAH E;  4PBQ A;  1OMP A;  1H76 A;  1B5I A;  3KOS A;  3FVO A;  4PGN A;  2B4L A;  2V3U A;  4P1L A;  5DVI A;  4AS5 A;  4H8I A;  4OTE A;  4N17 A;  2CEY A;  4PGP A;  4F1Y A;  1MQG A;  4YB6 A;  3TYH A;  4JDF A;  4IO4 A;  3W9V A;  4F2O A;  2ZYK A;  4IGR A;  3SEY A;  3CFZ A;  4GX3 A;  5AA3 A;  4GBW A;  1FBF A;  3LBS A;  4OVR A;  1VE4 A;  3USD A;  4LVQ A;  4BDO A;  1DK4 A;  5I84 A;  1FQB A;  3N5L A;  1B46 A;  2Q8M A;  3TTM A;  2DQV A;  1MXZ A;  4FJP A;  4NF6 B;  3Q28 A;  4WKM A;  2JJK A;  1FPB A;  3B7D A;  1SW2 A;  4H65 A;  2XXQ A;  4LP2 B;  5JTY A;  5I2N B;  2WBD A;  3T96 B;  4I9D A;  4RPN A;  3S9E A;  1EZP A;  1B0L A;  5EQ8 A;  4IO7 A;  3T0J A;  1B9J A;  2F34 A;  4IO2 A;  1B5H A;  5CM6 A;  1H44 A;  1K9Y A;  1FJ6 A;  4F1U A;  2PT2 A;  2V25 A;  2O84 X;  3O6G A;  3LV0 A;  4G4P A;  4MX6 A;  1BTJ A;  2DE3 A;  3VLW A;  3KC1 A;  1Y20 A;  4NAP A;  4RK2 A;  4Q5T A;  1RYO A;  4GWZ A;  4U23 A;  2Q2C A;  3PD8 A;  1GGG A;  4GFR A;  3UIF A;  3SEW A;  4H46 A;  1I6Q A;  4ZZA A;  1IIW A;  1B4H A;  3VDF A;  3BFU A;  3B6W A;  3IO6 A;  2XXU A;  2F78 A;  3IL1 B;  3L6H A;  1QW0 A;  2Q89 A;  4ZDM A;  3U8Q A;  1SPI A;  4EF2 A;  3BFT A;  1POY 1;  2DYX A;  5AA1 A;  3FZV A;  3UA8 A;  3IO4 A;  4PAF A;  1MXW A;  2O7U A;  1USY E;  2Y7W A;  1YAE A;  2XD2 A;  4P3L A;  1QGX A;  4MLQ A;  4MHF A;  4JSO A;  2UYE A;  3H7M A;  1D9Q A;  5L9S A;  3TTL A;  5FHM A;  4GOT A;  3HN0 A;  2O6A A;  4OFO A;  3TUS A;  2QS3 A;  3HFU A;  2KLF A;  3FBP A;  2I6E A;  2OK2 A;  3IOR A;  3D1R A;  1GTK A;  2WYK A;  5ET7 A;  2PMS A;  4JBZ A;  2Z8E A;  4PFR A;  4LZ8 A;  4P0I A;  2KQZ A;  3UK4 A;  3CG1 A;  4U1O A;  4BDQ A;  4MNI A;  2HZK A;  3VLV A;  5CBS A;  4OAN A;  1LFG A;  2RC7 A;  3SEX A;  4OQO A;  1JNF A;  1NNK A;  3FGS A;  5ESY A;  3HV1 A;  3TTK A;  4PQJ A;  4NF6 A;  3W15 C;  5FHN A;  3TZA A;  4WED A;  3KN7 A;  5I2N A;  1IQ7 A;  2V3T A;  4X1D A;  1NMU A;  5EYH A;  1MPD A;  2UVJ A;  4PFW A;  3QSL A;  3IFA A;  2NUV A;  2I0B A;  3MP8 A;  1BP5 A;  2G93 A;  1SBP A;  4OVJ A;  3GBB A;  4ZED A;  2H25 A;  4MH5 A;  2W7Y A;  3DEL B;  3S9N C;  5CC2 A;  4JVD A;  4XF5 A;  1WVJ A;  4LQ5 A;  4F3S A;  4LZ5 A;  4OVQ A;  2FHY A;  1SYI A;  3GXA A;  3TAJ A;  3B50 A;  4MNC A;  3IAZ A;  4PAK A;  4EQ7 A;  3KN3 A;  2R8T A;  3M3F A;  2OJT A;  3MST A;  3V8X B;  1NUX A;  1BIY A;  4YB5 A;  3QAX A;  4NG7 A;  1FCK A;  4ZE8 A;  2UVI A;  3ZKK A;  2XX8 A;  4JWX A;  4QSE A;  1ANF A;  2Q74 A;  3PPO A;  2FNC A;  4EXL A;  3H03 A;  2QVR A;  4F31 B;  3R6U A;  1NH7 A;  1ZU0 A;  4GXA A;  5HPQ A;  1YYZ A;  3EN3 A;  3UOR A;  4YU0 A;  3TCH A;  1XOC A;  3ECR A;  3K2D A;  4GXS B;  3ILT B;  2FA7 A;  2PBW A;  1RDZ A;  5IZ1 A;  4WXJ A;  5EHS A;  4P0G A;  3PPN A;  4QHQ A;  5B70 A;  3FV1 A;  4GX4 A;  4RK9 A;  4ESX A;  4KCD A;  2VD3 A;  2XXK A;  4PFT A;  1DPP A;  1CB6 A;  2MKZ A;  3LSW A;  1VFD A;  1BKA A;  4F19 A;  4R2B A;  4O7I A;  1EZ9 A;  3T1B A;  4QSD A;  3H6T A;  2GRV A;  3Q27 A;  1YXI A;  5ICQ A;  2QPQ A;  3V5A A;  1WOD A;  3FV2 A;  3K02 A;  1Y3Q A;  3T9U A;  1Z7N E;  3IK6 B;  4PET A;  1EYJ A;  2FIX A;  3FJM A;  2ZYO A;  4F1V A;  2RIN A;  4P8B A;  1QUK A;  4QFK A;  3H06 B;  1MG1 A;  1OQH A;  1MQJ A;  3K0V A;  1URG A;  1R9Q A;  3IB0 A;  4N6K A;  3KJ7 A;  4M4G A;  2F36 A;  3BIH A;  3PV0 E;  4MEV A;  2A5S A;  3GYY A;  2PVU A;  1MM7 A;  1NV0 A;  3MZ1 A;  1FTJ A;  1O63 A;  3TEP A;  1SI1 A;  2HZL A;  1FTM A;  1QJM A;  4UAB A;  4RXL A;  2RC9 A;  1MXV A;  3G3K A;  4F39 A;  4YKK A;  3O6I A;  3B8B A;  1AWB A;  2Z8F A;  2BJI A;  2UVH A;  4JVC A;  5IGA A;  2NWJ A;  3NOH A;  4PF8 A;  3FVN A;  2D5W A;  4BLA A;  2UXA A;  5HBC A;  3I6V A;  1M5F A;  1FBD A;  1OIB A;  3M3K A;  4OEV A;  4QSC A;  4TOZ A;  4G61 A;  4DDD A;  4BDL A;  3MZ9 A;  2B3B A;  3D4C A;  3I5O A;  2Z8D A;  3PPQ A;  1JP4 A;  1D3K A;  1FSA A;  3M8U A;  5KCJ B;  1US4 A;  1LBW A;  1LFH A;  4KI0 E;  4R2F A;  3T9V A;  4M1V A;  3S9L C;  2OLB A;  1OQG A;  4YAH X;  4NF8 B;  2F6G A;  3TEL A;  2F5X A;  3DP6 A;  4PTK A;  2O7I A;  1T0K A;  4G77 A;  4ZEK A;  4H1X A;  3EHT A;  2D21 A;  4ZEF A;  5H8F B;  2IEE A;  4F3G A;  3MVX A;  1LBB A;  5EHM A;  1LAF E;  3FD3 A;  3UP9 A;  5I56 B;  1NV7 A;  4X1B A;  1H45 A;  5F1Q A;  2RF1 A;  4ND9 A;  2M8C A;  2FVZ A;  3PMW A;  1XVX A;  4N13 A;  1YTV A;  1FTO A;  5CMB A;  1DTG A;  5TPA A;  4LZ7 A;  4OZ9 A;  5HM4 B;  1B7U A;  1SI0 A;  4OEU A;  4XKN A;  3IFC A;  1Q9D A;  1WDN A;  4RY1 A;  4OER A;  1IXI A;  2YJP A;  3HHF A;  4EUO A;  1NFT A;  1BK4 A;  1FTK A;  3OXN A;  1S9T A;  1KZ8 A;  2ZYM A;  2E0S A;  1NH8 A;  1PBP A;  4JXI A;  4NF4 A;  1ZMG A;  2ANJ A;  1USY H;  4R74 A;  5CMM A;  1FQD A;  3H6V A;  2X7P A;  4KR5 A;  3H3G A;  5J1D A;  1BLF A;  1JW4 A;  3KC0 A;  2HFB A;  3FXB A;  2ONR A;  2P0S A;  3FAT A;  1B7H A;  2F6P A;  5ET8 A;  4GL8 A;  1FW0 A;  1GVC A;  4PE5 B;  5EYG A;  1MDQ A;  4O94 A;  2F3D A;  3BKI B;  4NF5 B;  2BJJ X;  2ZNS A;  4POW A;  1OVB A;  4XTC Q;  1B1H A;  3PPP A;  3E4R A;  4NGU A;  3C33 A;  1MS7 A;  3GZG A;  4TQU Q;  4ECF A;  3RTW B;  2NVU B;  1IXH A;  4ISU A;  2Y5K A;  5K2X A;  4UA8 A;  3MP6 A;  1N0T A;  4OVP A;  2VPO A;  1IXG A;  2B65 A;  4RJZ A;  4DE8 A;  4KFQ A;  1UTH B;  1XHY A;  3TMG A;  2Q88 A;  1OLC A;  4C0R A;  2B3F A;  4BDM A;  4YKJ A;  2R71 A;  4AB5 A;  4LUB A;  3PGF A;  1EH3 A;  2QVV A;  3T9X B;  4ZZE A;  4IO6 A;  1DMB A;  2WBB A;  4R9F A;  4OXV A;  1FRP A;  1LCF A;  1Y9U A;  1NKX A;  1VFE A;  3G7W A;  1FQC A;  5J16 A;  4HTG A;  3VXC A;  3S4U A;  3KG2 A;  1M5C A;  1VR5 A;  2DXR A;  4FEC A;  1B40 A;  1MY0 A;  1SQY A;  1NV3 A;  4XKQ A;  2WX9 A;  4KHZ E;  2XXI A;  4KYE A;  4OMB A;  2AIX A;  3B6Q A;  4YMB A;  1RKM A;  5K2Y A;  1DSN A;  4R6Y A;  2QSX A;  4N07 A;  1IMA A;  1MY4 A;  3LR1 A;  1VSO A;  4IO3 A;  2YLN A;  3PMV A;  4NWD A;  5I59 B;  2VGQ A;  3QK6 A;  5L9O A;  1I6A A;  1MXX A;  3RQT A;  3MVZ A;  3IOT A;  1HSE A;  4DI4 B;  1MQH A;  4GWU A;  4LON B;  1MY1 A;  5H8S A;  2DE4 A;  5FTI A;  1JQF A;  4Q30 B;  3O6H A;  1S50 A;  3TTR A;  4IR8 A;  1NNF A;  2F7B A;  2ZXT A;  3ZSF A;  2PT1 A;  4EF1 A;  3PUW E;  3BBR A;  1N3X A;  4NF5 A;  3I3V A;  1N84 A;  2FBP A;  2OZZ A;  3LUY A;  2I48 A;  5H8H A;  2QJE A;  2I49 A;  4F22 A;  4DXU A;  1R6Z A;  1NUW A;  1NUY A;  3MJN A;  4DXB A;  3AXF A;  3PMX A;  4R6K A;  4KCC A;  4R6H A;  1YCJ A;  3FXQ A;  2CZH A;  1FPF A;  2GHB A;  3RNN A;  3MQ9 A;  3CHG A;  5ELV A;  4YIC A;  5L8D A;  1UTH A;  3PU5 A;  1P1W A;  2Q9T A;  4QXD A;  4U22 A;  4AS4 A;  3MC2 A;  5CRY A;  3H6W A;  2OCU A;  3N6T A;  1P1Q A;  3VE1 B;  3O28 A;  3KSX A;  4YKP A;  3RT6 B;  3TCG A;  2XXR A;  4N8Y A;  3EQ1 A;  1FBP A;  5FTH A;  1MDP 1;  2ZMB A;  5A5L A;  4I40 A;  3DP8 A;  4TLM B;  3S2V A;  3C35 A;  3KGC A;  5CI5 A;  1LB9 A;  3VVD A;  1B3G A;  2RC8 A;  2FYI A;  2Y84 A;  2O51 A;  4GQO A;  2F3B A;  1US5 A;  4N91 A;  2AL5 A;  1LEV A;  2ZNU A;  4POX A;  3U92 A;  5KZT A;  2QMW A;  4GRK A;  2OWZ A;  5CMC A;  3U93 A;  4QBA A;  1JEV A;  3KFM A;  1M5E A;  2CEX A;  4X48 A;  2I3W A;  4ZEC A;  3UN6 A;  1ZJL A;  3E13 X;  3TQW A;  3MZB A;  5ITP A;  5I59 A;  1POT A;  3EHS A;  1MY3 A;  1Q35 A;  3IOV A;  4FOR A;  2CZL A;  2P1S A;  4QFP A;  2RCA A;  3KBR A;  4NF0 A;  4GVO A;  1AH5 A;  4PE3 A;  2DS9 A;  3PD9 A;  2DVZ A;  4U2R A;  3GBA A;  3OMB A;  3ROJ A;  1O64 A;  2D3I A;  3LSX A;  4PFU A;  4OVS A;  4DCY A;  4MCO A;  2Q8J A;  2DXY A;  2LAO A;  4THI A;  3FXR A;  5AA2 D;  1KWH A;  1N3W A;  4DXC A;  1ATG A;  4PCD A;  3THI A;  5LTC A;  3D4G A;  3ISP A;  3MPK A;  3VXB A;  1B2H A;  3QUJ A;  1NV2 A;  1B4Z A;  1DBZ A;  1FPD A;  3EHU A;  1URD A;  1QKA A;  3IB1 A;  3KJT A;  1B6H A;  4KPT A;  4GWO A;  4P11 A;  5JEI A;  5I3S A;  2FIE A;  2XXV A;  2Y7R A;  3EPE A;  4G68 B;  2QRY A;  4IY5 A;  2Z23 A;  2GFE A;  3SES A;  2XHD A;  2RKM A;  3B6T A;  4NN3 A;  2YPN A;  5DYH A;  4P56 A;  1FPJ A;  4I1D A;  2ESN A;  3SZP A;  4N15 A;  1LST A;  3FUZ A;  4OES A;  4G8H A;  4U4S A;  2DP8 A;  4H8J A;  3HST A;  2I4C A;  2I58 A;  2NOO A;  4U4X A;  1I69 A;  2F7C A;  1Y3P A;  3L6G A;  5I2K B;  3ZKL A;  3OEL A;  4DCX A;  5M2V A;  4G8N A;  3K1N A;  4JB7 A;  1XT8 A;  4MNP A;  5IZZ A;  2VP1 A;  2QS1 A;  3SEU A;  1LCT A;  3EF7 A;  4I3Y A;  2THI A;  4RA1 A;  4OFL A;  1A7L A;  1SW5 A;  3TCF A;  1UTB B;  1Y4C A;  2WEF A;  1MQI A;  1B1X A;  1OVT A;  4R9G A;  3HHG A;  3RPL B;  1D4N A;  2PFZ A;  3C31 A;  3TTN A;  4I8C A;  4DIG A;  2DE2 A;  2DVC A;  5H8Q B;  5IZ3 B;  2O1L A;  1MXY A;  1SW4 A;  3RYD A;  1FBE A;  4FED A;  4MFI A;  1MY2 A;  3G3H A;  1A40 A;  3K1P A;  5ET5 A;  4GL0 A;  1SVX B;  4R73 A;  3KEI A;  2V4C A;  1A55 A;  4K3F A;  3R26 A;  2REJ A;  1JW5 A;  3GLB A;  3KN8 A;  3MWB A;  1LBX A;  2F8D A;  2OX3 A;  4MJO A;  3W9W A;  4LN5 A;  4PC9 A;  3CFX A;  4JVI A;  1LBZ A;  1MPC A;  4GX6 A;  4AQ4 A;  1N7W A;  3Q29 A;  1QKB A;  1GV8 A;  1TXF A;  4JWY A;  4OET A;  3VVE A;  4GWX A;  4C1T A;  2QFL A;  2VOZ A;  1DPE A;  2HCA A;  2A5T B;  3KBZ A;  1O7T A;  5LDZ A;  4N4U A;  3C4M A;  3U1O A;  4RYA A;  2GH9 A;  5EQA A;  2Q2A A;  3O29 A;  5KDT B;  4H67 A;  5DVJ A;  2XX9 A;  2F97 A;  4F18 A;  4G68 A;  4IGT A;  1M5D A;  3Q26 A;  3WAF A;  2VD2 A;  2QL3 A;  4PFB A;  3DM0 A;  1PEB A;  3CSB A;  3OEN A;  3ODB A;  1P1U A;  4ELQ A;  1MXU A;  2NXO A;  5ICT A;  3O66 A;  4GWY A;  2WKY A;  1SW1 A;  1LB8 A;  1F9B A;  3SDF A;  2E1S A;  2P3V A;  4ELP A;  1B5J A;  1FPE A;  4GD5 A;  3IOU A;  2DOJ A;  5I2K A;  1II5 A;  1N7X A;  1QUL A;  4H45 A;  4U1Z A;  1FPG A;  4O3C A;  2XWV A;  4F3B A;  4PDH A;  2DSF A;  2ZZX A;  3FXU A;  4F2Q A;  2L5V A;  1LAG E;  1M5B A;  1PDA A;  1DTZ A;  1P99 A;  1UTB A;  2H9B A;  5F7V A;  4EQB A;  5EYF A;  2I3V A;  3RPL A;  1OLA A;  5FBP A;  3MYU A;  1LFI A;  2G29 A;  1H3D A;  1P1N A;  1NV6 A;  1B05 A;  3IJX B;  5H8Q A;  5IZ3 A;  2PYY A;  4Q0C A;  5A5X B;  5ET6 A;  3DLN A;  2H99 A;  3K01 A;  5EQ9 A;  3OSR A;  4Z0I A;  1TFA A;  2CMO A;  1A99 A;  1MPB A;  4KXP A;  4JWO A;  3O2A A;  3H6U A;  1DOT A;  2ZYN A;  3OOA A;  4QRZ A;  4F3P A;  1MRP A;  2XXP A;  3MW0 A;  3A09 A;  3OO9 A;  4OYV A;  3UGW A;  3MUQ A;  3G3G A;  5B7D A;  3U65 A;  3C36 A;  3FJG A;  5TP9 B;  3KZG A;  4N6D A;  5KCJ A;  1YZ0 A;  2F35 A;  2UYF A;  2O69 A;  3H4Z A;  3S9M C;  2B4M A;  1FPI A;  2A5T A;  4PDD A;  4PAI A;  1Q1K A;  4KYS A;  4NF8 A;  1B32 A;  5CBR A;  3TKD A;  2UVG A;  5KDT A;  3ZS6 A;  4RNS A;  3TDJ A;  3OEK A;  5H8F A;  3V83 A;  5CMK A;  5I56 A;  1INP A;  2H4I A;  4P1E A;  2O68 A;  2IA4 A;  4LQ2 A;  3FIR A;  4MAG A;  3TPA A;  4ELO A;  3E9X A;  2QS2 A;  1AOV A;  3RN8 A;  1TT1 A;  2GHA A;  1KA1 A;  3RGY A;  1B51 A;  3ONM A;  2DWH A;  2R6G E;  4AB6 A;  1LBY A;  3FAS A;  2XD3 A;  1IUD A;  2R9J A;  4YB7 A;  4N8G A;  4UAC A;  2OWS A;  5FHO A;  3LUZ A;  3MVW A;  4GIZ A;  1DCU A;  5DT6 A;  1ZLQ A;  1URS A;  3FJ7 A;  1H43 A;  4OA4 A;  4Q8R A;  1NNP A;  5DTB A;  3WAE A;  3DP4 A;  1R1N A;  1YPN A;  4TLL B;  4X8R A;  1KA0 A;  2DWA A;  3T66 A;  3K4U A;  4OEN A;  4GBV A;  4HCY A;  4DZ1 A;  3HPI A;  2XXT A;  5A5X A;  1EU8 A;  2H98 A;  1ZKB A;  1ZTY A;  3CI8 A;  3Q25 A;  3FVK A;  4JSD A;  4NED A;  4GF8 A;  4N81 A;  4XKP A;  1EYK A;  3P7I A;  3T22 A;  3MBP A;  4R75 A;  4MLV A;  1TFD A;  1FTL A;  4O3B A;  4HW8 A;  3QYT A;  1R9L A;  5I58 B;  1NL5 A;  2Y5L A;  1LAX A;  2HPG A;  4PFY A;  1SYH A;  1G0I A;  5TP9 A;  1FPK A;  2XXY A;  2RCB A;  4PP0 A;  5I5P A;  4O8M A;  3PUZ E;  2REG A;  1FQA A;  1J1N A;  4NE4 A;  2ONK E;  2HAU A;  4MBP A;  2WYP A;  3G3J A;  3K6U A;  4O3A A;  2Z22 A;  4F29 A;  1JVY A;  3IR1 A;  4QFL A;  3OD7 A;  1D9V A;  1NNT A;  1I6B A;  1IMF A;  3IOW A;  4FEB A;  3E78 A;  4LAT A;  4NWC A;  3SEV A;  3LC8 A;  1B3L A;  3RT8 A;  1UIV A;  2ZZV A;  3N26 A;  1FTA A;  3OO7 A;  1XI6 A;  4E0W A;  1IMB A;  5AE4 A;  3PTY A;  3SET A;  2I4B A;  4ELR A;  1IXC A;  3IB2 A;  3U72 A;  1D9Y A;  1JET A;  4FBP A;  3BIG A;  2ABH A;  1FJ9 A;  2PFY A;  4HE0 A;  4NQ8 A;  4NHB A;  2OBG A;  4DLD A;  4XKR A;  4U21 A;  1G0H A;  3MVY A;  4KYD A;  4L17 A;  4FAT A;  3TFL A;  2HXW A;  3RLF E;  1IIT A;  3SKP A;  1VDW A;  1AL3 A;  4G68 C;  1PB7 A;  2VHA A;  4GWS A;  1RDY A;  3VLU A;  2XXX A;  3K6X A;  3RPW A;  3EKI A;  2AL4 A;  4QF9 A;  2HEU A;  2HAV A;  1P1O A;  1TWY A;  3E79 A;  1NUZ A;  3OEM A;  4P47 A;  2XX7 A;  1CNQ A;  4HE2 A;  3A3C A;  4H0W A;  5T3J A;  2P2A A;  4R72 A;  1AIV A;  1UQW A;  3MP1 A;  4I3E A;  1NV5 A;  4ONY A;  2HHM A;  4QFO A;  2ZNT A;  2O1M A;  4H5F A;  2ONS A;  1GR2 A;  1B0H A;  3C32 A;  5I58 A;  1Y4T A;  2Y7P A;  1ZBM A;  4X04 A;  4G8M A;  4XEQ A;  4MMP A;  1ELJ A;  1PBQ A;  3CG3 A;  4ZEB A;  1ZIU A;  1IZ1 A;  1IEJ A;  1B3F A;  1FBG A;  2DWI A;  2X7Q A;  4RPO A;  4XXU A;  2V84 A;  2Y7K A;  5AA4 B;  1XS5 A;  4ZEI A;  1JW1 A;  3FVG A;  5IAI A; 
#chains in the Genus database with same CATH homology
 2XXH A;  2ALU A;  5I57 B;  2PX1 A;  3G3F A;  4QFN A;  5IKB A;  3CIJ A;  2DWJ A;  4OWD A;  3VV5 A;  2Y7I A;  3R7X A;  3CR9 A;  4FAJ A;  4YKI A;  1MM6 A;  3V89 B;  2XXW A;  3CVG A;  1Y3N A;  5DEX B;  3TQL A;  3JV9 A;  3QXM A;  3KOT A;  4NTL A;  3M3L A;  5TPA B;  4HCW A;  1AMF A;  1MH4 A;  4N6P A;  3A3U A;  3K00 A;  4GLI A;  5ITO A;  5BUU A;  3F11 A;  1S7Y A;  3ILU B;  4EQ9 A;  5AA2 B;  1Y1Z A;  1RYX A;  2V93 A;  4ZE9 A;  1JEU A;  3PUX E;  4BDN A;  3TOD A;  4I62 A;  3VFJ A;  4NF4 B;  1Y1M A;  4E0X A;  1LLS A;  3QUF A;  5BWJ A;  4OFJ A;  4OHN A;  1B3H A;  4YZZ A;  3OO8 A;  3CRB A;  3CFL A;  3RY3 A;  3T93 B;  1MQD A;  1SDX A;  4EDP A;  1QUJ A;  2H5Y A;  1Z7M E;  4MF3 A;  1B52 A;  2QS4 A;  1LBC A;  4LA9 A;  3RUM A;  3KSJ A;  3RTF B;  5DVF A;  4KQP A;  4FE8 A;  1B3E A;  3PPR A;  1SD3 A;  5AA4 A;  4X9T A;  5H8N B;  4Z7E A;  1JVX A;  1CE2 A;  1HSJ A;  4G2Z A;  4IO5 A;  5I57 A;  4KD5 A;  2V3Q A;  3MAM A;  1L5T A;  4XIG Q;  3E3K A;  1B58 A;  4H5G A;  4FIM A;  3U94 A;  1MH3 A;  5DEX A;  3PUY E;  3N94 A;  3T9H B;  1XVY A;  3K6W A;  1N76 A;  4IY6 A;  5ISU A;  3K6V A;  4C1U A;  3JYR A;  5L9M A;  1QVS A;  4YMA A;  5JTY B;  3CSG A;  4ESW A;  4EXK A;  3MPL A;  1FQE A;  3C9H A;  1N04 A;  3OO6 A;  1XC1 A;  5AA2 A;  3N6U A;  1FQF A;  4IB2 A;  3VVF A;  3JZJ A;  2F7A A;  4NMY A;  2I0C A;  2QMX A;  3IJO B;  2HQ0 A;  3G3I A;  2AYS A;  3HCQ A;  3LSL A;  2OWT A;  3K1M A;  3O9P A;  4WEP A;  3O97 A;  4BDR A;  1HSL A;  2X26 A;  1EZO A;  4HS7 A;  1PB8 A;  1LGB C;  4H6D A;  3LSF B;  5H8H B;  1A8E A;  1PC3 A;  3C34 A;  3PUV E;  1QUI A;  5JK4 A;  4ZS9 A;  3IX1 A;  1A8F A;  1B7Z A;  1PB9 A;  1UIU A;  3SER A;  3HO7 A;  1A54 A;  5H8N A;  5LOM A;  3OSQ A;  5TU0 A;  3QIM A;  1LAH E;  1OMP A;  1H76 A;  1B5I A;  3KOS A;  3FVO A;  2V3U A;  5DVI A;  4H8I A;  4OTE A;  4F1Y A;  1MQG A;  4YB6 A;  3TYH A;  4JDF A;  4IO4 A;  3W9V A;  4F2O A;  2ZYK A;  4IGR A;  3SEY A;  3CFZ A;  5AA3 A;  3LBS A;  1VE4 A;  3USD A;  4LVQ A;  4BDO A;  5I84 A;  1FQB A;  3N5L A;  1B46 A;  3TTM A;  2DQV A;  1MXZ A;  4FJP A;  4NF6 B;  3Q28 A;  4WKM A;  3B7D A;  1SW2 A;  4H65 A;  2XXQ A;  4LP2 B;  5JTY A;  5I2N B;  3T96 B;  4I9D A;  4RPN A;  3S9E A;  1EZP A;  1B0L A;  4IO7 A;  1B9J A;  2F34 A;  4IO2 A;  1B5H A;  5CM6 A;  1H44 A;  4F1U A;  2PT2 A;  2V25 A;  2O84 X;  3O6G A;  4G4P A;  1BTJ A;  2DE3 A;  3VLW A;  1Y20 A;  4RK2 A;  4Q5T A;  1RYO A;  4U23 A;  2Q2C A;  3PD8 A;  1GGG A;  4GFR A;  3UIF A;  3SEW A;  1I6Q A;  4ZZA A;  1IIW A;  1B4H A;  3VDF A;  3BFU A;  3B6W A;  3IO6 A;  2XXU A;  2F78 A;  3IL1 B;  3L6H A;  1QW0 A;  2Q89 A;  4ZDM A;  3U8Q A;  4EF2 A;  3BFT A;  1POY 1;  2DYX A;  5AA1 A;  3FZV A;  3UA8 A;  3IO4 A;  1MXW A;  2O7U A;  1USY E;  2Y7W A;  1YAE A;  2XD2 A;  4MLQ A;  4JSO A;  2UYE A;  3H7M A;  5L9S A;  3TTL A;  5FHM A;  4GOT A;  3HN0 A;  2O6A A;  4OFO A;  3TUS A;  2QS3 A;  2KLF A;  2I6E A;  2OK2 A;  3IOR A;  1GTK A;  2PMS A;  4JBZ A;  2Z8E A;  4LZ8 A;  4P0I A;  3UK4 A;  3CG1 A;  4U1O A;  4BDQ A;  2HZK A;  3VLV A;  5CBS A;  1LFG A;  2RC7 A;  3SEX A;  4OQO A;  1JNF A;  1NNK A;  3FGS A;  3TTK A;  3HV1 A;  4PQJ A;  4NF6 A;  3W15 C;  5FHN A;  3TZA A;  4WED A;  3KN7 A;  5I2N A;  1IQ7 A;  2V3T A;  4X1D A;  1NMU A;  1MPD A;  2UVJ A;  4PFW A;  3QSL A;  2NUV A;  2I0B A;  3MP8 A;  1BP5 A;  2G93 A;  1SBP A;  4OVJ A;  3GBB A;  4ZED A;  2H25 A;  4MH5 A;  2W7Y A;  3DEL B;  3S9N C;  5CC2 A;  1WVJ A;  4LQ5 A;  4F3S A;  4LZ5 A;  1SYI A;  3GXA A;  3TAJ A;  3IAZ A;  4EQ7 A;  3KN3 A;  3M3F A;  2OJT A;  3V8X B;  1BIY A;  4YB5 A;  3QAX A;  1FCK A;  4ZE8 A;  2UVI A;  3ZKK A;  2XX8 A;  4JWX A;  4QSE A;  1ANF A;  3PPO A;  2FNC A;  4EXL A;  3H03 A;  4F31 B;  3R6U A;  1NH7 A;  1ZU0 A;  4GXA A;  5HPQ A;  3EN3 A;  3UOR A;  4YU0 A;  3TCH A;  1XOC A;  3ECR A;  3K2D A;  4GXS B;  3ILT B;  2FA7 A;  2PBW A;  4WXJ A;  5EHS A;  4P0G A;  3PPN A;  4QHQ A;  5B70 A;  3FV1 A;  4RK9 A;  4ESX A;  4KCD A;  2VD3 A;  4PFT A;  1DPP A;  1CB6 A;  3LSW A;  1VFD A;  1BKA A;  4F19 A;  4R2B A;  1EZ9 A;  4QSD A;  3H6T A;  2GRV A;  3Q27 A;  5ICQ A;  2QPQ A;  3V5A A;  1WOD A;  3FV2 A;  3K02 A;  1Y3Q A;  3T9U A;  1Z7N E;  3IK6 B;  4PET A;  3FJM A;  2ZYO A;  4F1V A;  2RIN A;  1QUK A;  4QFK A;  3H06 B;  1MG1 A;  1OQH A;  1MQJ A;  3K0V A;  1URG A;  1R9Q A;  3IB0 A;  3KJ7 A;  4M4G A;  2F36 A;  3PV0 E;  2A5S A;  2PVU A;  1MM7 A;  3MZ1 A;  1FTJ A;  1O63 A;  3TEP A;  1SI1 A;  2HZL A;  1FTM A;  1QJM A;  4RXL A;  2RC9 A;  1MXV A;  3G3K A;  4F39 A;  4YKK A;  3O6I A;  2Z8F A;  2UVH A;  2NWJ A;  3FVN A;  2D5W A;  4BLA A;  2UXA A;  5HBC A;  3I6V A;  1M5F A;  1OIB A;  3M3K A;  4OEV A;  4QSC A;  4TOZ A;  4DDD A;  4BDL A;  3MZ9 A;  2B3B A;  3D4C A;  3I5O A;  2Z8D A;  3PPQ A;  1D3K A;  3M8U A;  5KCJ B;  1US4 A;  1LFH A;  4KI0 E;  4R2F A;  3T9V A;  4M1V A;  3S9L C;  2OLB A;  1OQG A;  4YAH X;  4NF8 B;  2F6G A;  3TEL A;  2F5X A;  3DP6 A;  2O7I A;  1T0K A;  4G77 A;  4ZEK A;  3EHT A;  4H1X A;  2D21 A;  4ZEF A;  5H8F B;  2IEE A;  4F3G A;  3MVX A;  1LBB A;  5EHM A;  1LAF E;  3FD3 A;  3UP9 A;  5I56 B;  4X1B A;  1H45 A;  5F1Q A;  2RF1 A;  4ND9 A;  2M8C A;  3PMW A;  1XVX A;  4N13 A;  1YTV A;  1FTO A;  5CMB A;  1DTG A;  5TPA A;  4LZ7 A;  4OZ9 A;  5HM4 B;  1B7U A;  1SI0 A;  4OEU A;  4XKN A;  1WDN A;  4RY1 A;  4OER A;  1IXI A;  2YJP A;  3HHF A;  4EUO A;  1NFT A;  1FTK A;  3OXN A;  1S9T A;  2ZYM A;  2E0S A;  1NH8 A;  1PBP A;  4JXI A;  4NF4 A;  1ZMG A;  2ANJ A;  1USY H;  4R74 A;  5CMM A;  1FQD A;  3H6V A;  2X7P A;  4KR5 A;  3H3G A;  5J1D A;  1BLF A;  1JW4 A;  2HFB A;  2ONR A;  2P0S A;  3FAT A;  1B7H A;  2F6P A;  4GL8 A;  1FW0 A;  1GVC A;  4PE5 B;  1MDQ A;  3BKI B;  4NF5 B;  2BJJ X;  2ZNS A;  4POW A;  1OVB A;  4XTC Q;  1B1H A;  3PPP A;  3E4R A;  3C33 A;  1MS7 A;  3GZG A;  4TQU Q;  4ECF A;  3RTW B;  2NVU B;  1IXH A;  4ISU A;  5K2X A;  4UA8 A;  3MP6 A;  1N0T A;  1IXG A;  2B65 A;  4RJZ A;  4DE8 A;  4KFQ A;  1UTH B;  1XHY A;  3TMG A;  2Q88 A;  1OLC A;  4C0R A;  4BDM A;  2B3F A;  4YKJ A;  2R71 A;  4AB5 A;  4LUB A;  3PGF A;  1EH3 A;  3T9X B;  4ZZE A;  4IO6 A;  1DMB A;  4R9F A;  4OXV A;  1LCF A;  1Y9U A;  1NKX A;  1VFE A;  3G7W A;  1FQC A;  4HTG A;  3VXC A;  3S4U A;  3KG2 A;  1M5C A;  1VR5 A;  2DXR A;  4FEC A;  1B40 A;  1MY0 A;  1SQY A;  4XKQ A;  4KHZ E;  2XXI A;  4KYE A;  4OMB A;  2AIX A;  3B6Q A;  4YMB A;  1RKM A;  5K2Y A;  1DSN A;  4R6Y A;  2QSX A;  4N07 A;  1MY4 A;  3LR1 A;  1VSO A;  4IO3 A;  2YLN A;  3PMV A;  4NWD A;  5I59 B;  2VGQ A;  3QK6 A;  5L9O A;  1I6A A;  1MXX A;  3RQT A;  3MVZ A;  3IOT A;  1HSE A;  1MQH A;  4LON B;  1MY1 A;  5H8S A;  2DE4 A;  5FTI A;  1JQF A;  4Q30 B;  3O6H A;  1S50 A;  3TTR A;  1NNF A;  2F7B A;  2ZXT A;  3ZSF A;  2PT1 A;  4EF1 A;  3PUW E;  3BBR A;  1N3X A;  4NF5 A;  3I3V A;  1N84 A;  2OZZ A;  3LUY A;  2I48 A;  5H8H A;  2QJE A;  2I49 A;  4F22 A;  4DXU A;  1R6Z A;  3MJN A;  4DXB A;  3AXF A;  3PMX A;  4R6K A;  4KCC A;  4R6H A;  1YCJ A;  3FXQ A;  2GHB A;  3RNN A;  3MQ9 A;  5ELV A;  4YIC A;  5L8D A;  1UTH A;  3PU5 A;  1P1W A;  2Q9T A;  4U22 A;  3MC2 A;  5CRY A;  3H6W A;  2OCU A;  3N6T A;  1P1Q A;  3VE1 B;  3O28 A;  3KSX A;  4YKP A;  3RT6 B;  3TCG A;  2XXR A;  3EQ1 A;  5FTH A;  1MDP 1;  2ZMB A;  3DP8 A;  4TLM B;  3S2V A;  3C35 A;  3KGC A;  5CI5 A;  1LB9 A;  3VVD A;  1B3G A;  2RC8 A;  2FYI A;  2Y84 A;  2O51 A;  4GQO A;  1US5 A;  2AL5 A;  2ZNU A;  4POX A;  3U92 A;  5KZT A;  2QMW A;  4GRK A;  5CMC A;  3U93 A;  1JEV A;  3KFM A;  1M5E A;  4X48 A;  2I3W A;  4ZEC A;  3UN6 A;  1ZJL A;  3E13 X;  3TQW A;  3MZB A;  5ITP A;  5I59 A;  1POT A;  3EHS A;  1MY3 A;  1Q35 A;  3IOV A;  4FOR A;  2CZL A;  2P1S A;  4QFP A;  2RCA A;  3KBR A;  4GVO A;  1AH5 A;  2DS9 A;  3PD9 A;  2DVZ A;  4U2R A;  3GBA A;  3OMB A;  1O64 A;  2D3I A;  3LSX A;  4PFU A;  4DCY A;  2Q8J A;  2DXY A;  2LAO A;  4THI A;  3FXR A;  5AA2 D;  1KWH A;  1N3W A;  4DXC A;  1ATG A;  3THI A;  3D4G A;  3MPK A;  3VXB A;  1B2H A;  3QUJ A;  1B4Z A;  3EHU A;  1URD A;  1QKA A;  3IB1 A;  3KJT A;  1B6H A;  4KPT A;  4GWO A;  4P11 A;  5JEI A;  2XXV A;  2Y7R A;  3EPE A;  4G68 B;  2QRY A;  4IY5 A;  2Z23 A;  2GFE A;  3SES A;  2XHD A;  2RKM A;  3B6T A;  2YPN A;  5DYH A;  4I1D A;  2ESN A;  1LST A;  3FUZ A;  4OES A;  4G8H A;  4U4S A;  2DP8 A;  4H8J A;  3HST A;  2I4C A;  2I58 A;  2NOO A;  4U4X A;  1I69 A;  2F7C A;  1Y3P A;  3L6G A;  5I2K B;  3ZKL A;  3OEL A;  4DCX A;  5M2V A;  4G8N A;  3K1N A;  4JB7 A;  1XT8 A;  2VP1 A;  2QS1 A;  3SEU A;  1LCT A;  3EF7 A;  2THI A;  4RA1 A;  4OFL A;  1A7L A;  1SW5 A;  3TCF A;  1UTB B;  1Y4C A;  1MQI A;  1B1X A;  1OVT A;  4R9G A;  3HHG A;  1D4N A;  3C31 A;  3TTN A;  4I8C A;  4DIG A;  2DE2 A;  2DVC A;  5H8Q B;  2O1L A;  1MXY A;  1SW4 A;  4FED A;  4MFI A;  1MY2 A;  3G3H A;  1A40 A;  3K1P A;  4GL0 A;  1SVX B;  4R73 A;  3KEI A;  1A55 A;  4K3F A;  3R26 A;  2REJ A;  1JW5 A;  3GLB A;  3KN8 A;  3MWB A;  2F8D A;  3W9W A;  3CFX A;  1MPC A;  4AQ4 A;  1N7W A;  3Q29 A;  1QKB A;  1GV8 A;  1TXF A;  4JWY A;  4OET A;  3VVE A;  4C1T A;  2VOZ A;  1DPE A;  2HCA A;  2A5T B;  1O7T A;  3C4M A;  3U1O A;  4RYA A;  2GH9 A;  2Q2A A;  3O29 A;  5KDT B;  4H67 A;  4F18 A;  2XX9 A;  2F97 A;  5DVJ A;  4G68 A;  4IGT A;  1M5D A;  3Q26 A;  3WAF A;  2VD2 A;  2QL3 A;  3DM0 A;  1PEB A;  3CSB A;  3OEN A;  3ODB A;  1P1U A;  4ELQ A;  1MXU A;  2NXO A;  5ICT A;  3O66 A;  2WKY A;  1SW1 A;  1LB8 A;  1F9B A;  3SDF A;  2E1S A;  4ELP A;  1B5J A;  4GD5 A;  3IOU A;  2DOJ A;  5I2K A;  1II5 A;  1N7X A;  1QUL A;  4U1Z A;  4O3C A;  4F3B A;  2DSF A;  3FXU A;  4F2Q A;  1LAG E;  1M5B A;  1PDA A;  1DTZ A;  1P99 A;  1UTB A;  2H9B A;  5F7V A;  4EQB A;  5EYF A;  2I3V A;  1OLA A;  1LFI A;  2G29 A;  1H3D A;  1P1N A;  1B05 A;  3IJX B;  5H8Q A;  2PYY A;  4Q0C A;  5A5X B;  3DLN A;  2H99 A;  3K01 A;  3OSR A;  4Z0I A;  1TFA A;  2CMO A;  1A99 A;  1MPB A;  4JWO A;  3O2A A;  3H6U A;  1DOT A;  2ZYN A;  3OOA A;  4QRZ A;  4F3P A;  1MRP A;  2XXP A;  3MW0 A;  3A09 A;  3OO9 A;  4OYV A;  3UGW A;  3MUQ A;  3G3G A;  5B7D A;  3C36 A;  3FJG A;  5TP9 B;  3KZG A;  5KCJ A;  2F35 A;  2UYF A;  2O69 A;  3H4Z A;  3S9M C;  2A5T A;  1Q1K A;  4KYS A;  4NF8 A;  1B32 A;  5CBR A;  3TKD A;  2UVG A;  5KDT A;  3ZS6 A;  4RNS A;  3TDJ A;  3OEK A;  5H8F A;  3V83 A;  5CMK A;  5I56 A;  2H4I A;  2O68 A;  2IA4 A;  4LQ2 A;  3FIR A;  3TPA A;  4ELO A;  3E9X A;  2QS2 A;  1AOV A;  3RN8 A;  1TT1 A;  2GHA A;  3RGY A;  1B51 A;  3ONM A;  2DWH A;  2R6G E;  4AB6 A;  3FAS A;  2XD3 A;  1IUD A;  2R9J A;  4YB7 A;  4UAC A;  2OWS A;  5FHO A;  3MVW A;  4GIZ A;  5DT6 A;  1ZLQ A;  1URS A;  3FJ7 A;  1H43 A;  4Q8R A;  1NNP A;  5DTB A;  3WAE A;  3DP4 A;  1R1N A;  1YPN A;  4TLL B;  2DWA A;  3T66 A;  3K4U A;  4OEN A;  4HCY A;  4DZ1 A;  3HPI A;  2XXT A;  5A5X A;  1EU8 A;  2H98 A;  1ZKB A;  1ZTY A;  3CI8 A;  3Q25 A;  3FVK A;  4JSD A;  4NED A;  4GF8 A;  4XKP A;  3P7I A;  3T22 A;  3MBP A;  4R75 A;  4MLV A;  1TFD A;  1FTL A;  4O3B A;  4HW8 A;  3QYT A;  1R9L A;  5I58 B;  1NL5 A;  1LAX A;  4PFY A;  1SYH A;  5TP9 A;  2XXY A;  2RCB A;  4PP0 A;  3PUZ E;  2REG A;  1FQA A;  1J1N A;  4NE4 A;  2ONK E;  2HAU A;  4MBP A;  3G3J A;  3K6U A;  4O3A A;  2Z22 A;  4F29 A;  1JVY A;  3IR1 A;  4QFL A;  3OD7 A;  1D9V A;  1NNT A;  1I6B A;  3IOW A;  4FEB A;  4LAT A;  4NWC A;  3SEV A;  3LC8 A;  1B3L A;  3RT8 A;  1UIV A;  3N26 A;  3OO7 A;  4E0W A;  5AE4 A;  3SET A;  2I4B A;  4ELR A;  1IXC A;  3IB2 A;  3U72 A;  1D9Y A;  1JET A;  2ABH A;  2OBG A;  4DLD A;  4XKR A;  4U21 A;  3MVY A;  4KYD A;  4L17 A;  4FAT A;  3TFL A;  2HXW A;  3RLF E;  1IIT A;  3SKP A;  1AL3 A;  4G68 C;  1PB7 A;  2VHA A;  3VLU A;  2XXX A;  3K6X A;  3RPW A;  2AL4 A;  4QF9 A;  2HEU A;  2HAV A;  1P1O A;  1TWY A;  3OEM A;  2XX7 A;  3A3C A;  4H0W A;  2P2A A;  4R72 A;  1AIV A;  1UQW A;  3MP1 A;  4ONY A;  4QFO A;  2ZNT A;  2O1M A;  4H5F A;  2ONS A;  1GR2 A;  1B0H A;  3C32 A;  5I58 A;  1Y4T A;  2Y7P A;  1ZBM A;  4G8M A;  1ELJ A;  1PBQ A;  3CG3 A;  4ZEB A;  1ZIU A;  1IZ1 A;  1IEJ A;  1B3F A;  2DWI A;  2X7Q A;  4RPO A;  4XXU A;  2V84 A;  2Y7K A;  5AA4 B;  1XS5 A;  4ZEI A;  1JW1 A;  3FVG A;  5IAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...