1Y20A

Crystal structure of the nr1 ligand-binding core in complex with acpc
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
287
structure length
287
Chain Sequence
RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords Glutamate [NMDA] receptor subunit zeta 1
publication title Mechanism of Partial Agonist Action at the NR1 Subunit of NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 84
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2004-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y20A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y20A02
4PFUA 5JTYB 5A5XB 2UXAA 1MPBA 2UVIA 3MUQA 1N7XA 5BWJA 1Y9UA 3TEPA 1P1NA 3SESA 2DVCA 1ZU0A 1N04A 3KBRA 4F29A 5DEXA 3U92A 3I3VA 3G3FA 2XXIA 1OLAA 1R9LA 5I56A 3PMWA 3O9PA 1LB9A 3FXUA 2RF1A 1XVYA 4OERA 3CVGA 4P11A 2BJJX 1EU8A 1SVXB 2I49A 2QSXA 2UYFA 1P99A 3PPQA 2F8DA 2UYEA 2VD2A 3K1NA 1ZJLA 2WKYA 1LB8A 1A8FA 4IO7A 4YB7A 3O28A 4NF6A 2VHAA 4IO3A 4ZE9A 1MG1A 5TPAA 2Y7WA 4ESWA 1S7YA 3KSJA 3PMXA 3RN8A 1VFDA 1Y4CA 4YKIA 1AL3A 4LQ2A 4OFJA 4JDFA 2XXHA 4MF3A 4BDNA 3RT6B 4G8MA 3MAMA 3K6UA 2HXWA 4DXUA 3CRBA 4U4XA 4YKPA 1D4NA 3N6TA 1JETA 1QKAA 5I2NB 3IO4A 4DIGA 2E0SA 4ZS9A 4EQBA 4IGRA 2P2AA 3FJMA 4R6YA 3DM0A 4Z7EA 5CRYA 2Y7PA 1NL5A 1YPNA 3EQ1A 1FQAA 1RYOA 3K01A 1Z7ME 1B51A 3K6WA 4F3BA 1MY4A 4HW8A 1H3DA 1UIUA 3PMVA 2DE2A 3MVZA 1WODA 3SDFA 1HSLA 3FVOA 1NNPA 1PDAA 2XXPA 1ZKBA 2B3BA 3BBRA 3K1PA 4OMBA 1US5A 3MQ9A 1POY1 1R6ZA 2R9JA 3PD8A 4FECA 4C1UA 2DXRA 1OMPA 4LATA 2F7AA 4ISUA 1OLCA 1LGBC 1IXCA 2THIA 2YLNA 4G68A 4YZZA 3VE1B 5I2KB 3VLVA 3H4ZA 4LZ8A 1MQDA 2XD3A 2QS2A 2UVJA 1B32A 1QUKA 1LFHA 4BDLA 3CG1A 1GVCA 3RTFB 4X9TA 2OWTA 3MC2A 3FASA 5DVJA 4H8JA 4DCYA 2XXWA 3PPRA 3E4RA 3N5LA 2RCAA 2I58A 5KDTA 2OK2A 2OCUA 3MBPA 4OXVA 4QF9A 4EXLA 4UA8A 1D3KA 2Z23A 2DWHA 4GD5A 3H3GA 4PETA 3LBSA 1MPDA 1AH5A 1B05A 1OVTA 3UP9A 3TQLA 2DE4A 3M8UA 2HFBA 4R73A 3K2DA 2H98A 4NF5A 2PBWA 1OQHA 4DXCA 3V83A 2NXOA 5K2YA 3RQTA 4X1DA 4MLQA 3QK6A 4U1ZA 1VFEA 3TTLA 3EPEA 5I58B 1A99A 4YKJA 1CE2A 5I57A 1LAFE 1YCJA 2W7YA 1D9YA 2Q2CA 4IO5A 4LUBA 5EYFA 5DVIA 3QYTA 4ZZEA 4LP2B 1LLSA 2FA7A 2GHBA 3A3CA 3V89B 4U1OA 1DTGA 1FTMA 2RC7A 3LUYA 2DWJA 2Q88A 3OO8A 3UA8A 3GXAA 3P7IA 4KPTA 2F35A 3OELA 3N26A 4ZEFA 2O7IA 4RPOA 4QFKA 1TWYA 3Q25A 4GL8A 2QJEA 5B70A 1S9TA 4AQ4A 3IK6B 2Y7RA 5TP9A 4G68C 5EHSA 5L8DA 1LBCA 3MZ1A 4Q5TA 4F39A 4KQPA 3FD3A 4XIGQ 3O6HA 5IAIA 3QXMA 1LCFA 4UACA 2DWAA 1XC1A 4GRKA 3CG3A 2Q2AA 4DCXA 1SW5A 3EHTA 4NF4A 4KR5A 1J1NA 4Q8RA 5CMCA 1A8EA 2PX1A 3PU5A 4GXSB 3IB0A 5KZTA 4RJZA 2B65A 3MZ9A 4R2BA 1MS7A 4GQOA 3KGCA 2XHDA 1SBPA 1I69A 3THIA 1B0LA 1JW5A 1FQDA 4P0IA 4U21A 1MDQA 1A54A 1JVYA 4R6KA 3QIMA 4N07A 4DLDA 4FAJA 1MY0A 4IO4A 3S9NC 3RT8A 3TYHA 3VVDA 3U8QA 4C0RA 4ND9A 4DE8A 4PQJA 4R9FA 1MQIA 3DP4A 3TCHA 3M3LA 1IEJA 1QVSA 4ONYA 1PEBA 1B52A 1B5JA 2DS9A 1NNKA 4BDMA 3C9HA 1Y1MA 4H8IA 4HCWA 1FTOA 4ZDMA 1IXHA 4F1VA 3Q27A 3IB1A 3IJXB 2X7PA 1RKMA 4HCYA 3T22A 2OWSA 1CB6A 4R6HA 1FQBA 2Z8FA 4RPNA 4QFNA 5HPQA 3O6GA 4O3CA 3U72A 1XT8A 2RC9A 2F36A 4H6DA 4GFRA 1OQGA 3G3HA 2GFEA 4NWDA 4Q0CA 1ANFA 3RNNA 1B7ZA 2H5YA 1FTJA 4QHQA 3HV1A 3OEKA 4GIZA 1Q1KA 1Y3QA 4C1TA 1LBBA 4EF2A 3C35A 3DLNA 3ONMA 3E13X 4Z0IA 5HM4B 1FCKA 3KZGA 1MXYA 3A09A 3G3GA 3VVFA 4ZEKA 3RUMA 4OZ9A 5H8FB 1OIBA 4G68B 4U22A 3SERA 2DE3A 1B6HA 5IKBA 2PT2A 5H8QA 2Q89A 3HHFA 1B1XA 5AA3A 1B7UA 1O63A 2RINA 3CSGA 3K4UA 4ZZAA 4LONB 3B6WA 1Z7NE 1ZIUA 1VE4A 4FATA 1LCTA 2YPNA 1PB8A 4OWDA 2XXXA 1XS5A 1JEVA 2PMSA 3VXCA 2I4CA 4R74A 1KWHA 3K1MA 4RY1A 4X48A 3O29A 3FVNA 4XKQA 3OO6A 4FIMA 4BDQA 4ZEDA 1UTHA 3BFUA 4F1UA 3KJTA 4ZEBA 3EHUA 1N3XA 1SW1A 3C33A 1II5A 3G3KA 2XD2A 4RA1A 4OFLA 4H1XA 4RXLA 3PGFA 1MM6A 3IO6A 3VDFA 4U4SA 3UIFA 3VLWA 1I6AA 3RY3A 3MVYA 1B5HA 4TLLB 1SQYA 4LVQA 1ATGA 3BFTA 3E3KA 4YB6A 2XXVA 3B7DA 2IA4A 3FXQA 3IORA 5ITPA 3O66A 4QSEA 2X26A 4MH5A 4THIA 4YAHX 1N3WA 1IITA 4BDOA 2DYXA 4F2OA 2F7BA 5H8NA 3FXRA 5AA1A 3UORA 5FHNA 5CM6A 1P1QA 4G8NA 5B7DA 2LAOA 1FQCA 4DDDA 3AXFA 3KG2A 2Z8EA 2I3WA 3VLUA 1MQHA 1BP5A 1MXZA 2A5SA 3PUXE 3R7XA 3FV1A 4JWYA 3W9WA 4FEBA 5JTYA 5A5XA 3VXBA 4ELPA 2AIXA 3PPOA 3Q29A 5L9SA 1EZ9A 4WEDA 3SEYA 1IUDA 3JZJA 2QMWA 3R6UA 1NNTA 1TFDA 5AA4B 3T9VA 5ICTA 2O1MA 2O1LA 5DTBA 2F5XA 1DPEA 2V3TA 1B5IA 1Y4TA 4WEPA 2D3IA 4H0WA 3LC8A 3TAJA 4TLMB 2I0BA 3GLBA 4F3GA 3R26A 4AB6A 4XKRA 4NE4A 2QS1A 5AA2B 2HEUA 1BLFA 2XXRA 2UVGA 2D21A 4M1VA 1QJMA 2Z8DA 5EHMA 4LQ5A 2REGA 4M4GA 1M5EA 4G77A 2DP8A 3UGWA 3FATA 2DSFA 3TODA 1NMUA 1AIVA 3LSLA 4NF8A 4IY6A 5H8HB 2O6AA 5ISUA 2HZKA 3T9XB 4XXUA 2QS3A 1MXUA 1Q35A 4N13A 3TCFA 1FTLA 1N84A 2RKMA 1NFTA 4JXIA 1NKXA 5I59B 2F97A 3H03A 3TMGA 1MXXA 2XXTA 3O2AA 4JB7A 3A3UA 3W15C 3RTWB 3O6IA 2CMOA 4JSOA 5I2NA 3ILUB 1B3GA 1JQFA 4OHNA 3OMBA 4ELRA 3MPKA 5LOMA 2PYYA 1YAEA 5FTIA 3LSFB 2AYSA 4XTCQ 4G4PA 3EN3A 1GV8A 3ILTB 1I6QA 3C34A 4EDPA 2NWJA 1P1OA 3LR1A 1JW4A 5DYHA 2XX8A 1HSEA 5I84A 2G29A 4O3AA 5DEXB 3MZBA 1B9JA 1P1UA 1DSNA 4IO6A 5I56B 3B6TA 3KOSA 2VGQA 4OEUA 3LSWA 2HZLA 1MY3A 1URGA 3V5AA 1B3HA 3SEUA 3SEVA 4QFLA 1P1WA 1ZBMA 3CFLA 3U93A 4OETA 1SI0A 3S9EA 1PC3A 3TUSA 4I62A 3MP1A 1TT1A 3KEIA 1R1NA 2QL3A 3L6GA 4OYVA 1QKBA 1A55A 1B2HA 2ONSA 4NMYA 4ECFA 1MRPA 4QSCA 3IB2A 4NF6B 4QFPA 2OZZA 1FW0A 4QSDA 4YB5A 5TPAB 2I48A 3SEXA 5J1DA 4IO2A 3CFXA 1TFAA 4OESA 4I1DA 5CC2A 3MP6A 3O97A 3FJ7A 4G8HA 1LSTA 1SW4A 2ZYKA 4YMAA 2DWIA 2OBGA 3M3KA 4KYEA 2QRYA 1NH8A 3H6WA 1SYHA 2V25A 4NTLA 3PV0E 4EXKA 1SDXA 3QAXA 4IB2A 5CMBA 4F31B 3G3IA 2I3VA 1BKAA 2D5WA 5I58A 3FV2A 4HTGA 2NUVA 3C4MA 4PFYA 1M5DA 3QUFA 2UVHA 4XKNA 4GWOA 4R72A 2QPQA 1I6BA 4QRZA 3SKPA 4WXJA 4F19A 1PB7A 3IOUA 1UTBA 4POWA 4PFTA 2XXQA 3UN6A 2ANJA 1HSJA 4ELQA 3EHSA 3IJOB 4U23A 2H99A 1EH3A 5CMKA 2P0SA 1PB9A 4POXA 4JSDA 1OVBA 2I6EA 3DELB 4NWCA 4OTEA 2G93A 3C36A 4YU0A 1B1HA 4F3SA 4ELOA 4EF1A 3KN3A 4EQ9A 5F1QA 3D4GA 1F9BA 1IXGA 3C32A 4L17A 4HS7A 1M5CA 3MW0A 2ZNSA 4KCCA 3ECRA 4GVOA 1Y20A 3ZKLA 1USYH 1N0TA 4FE8A 1NH7A 1URDA 3HPIA 1AOVA 3LSXA 1B40A 5KCJA 4R75A 3OOAA 1IIWA 5DT6A 4KHZE 2R71A 3H6VA 3OXNA 2H25A 2X7QA 2V3QA 4JWOA 5KDTB 2IEEA 3UK4A 1MM7A 2F34A 4GOTA 3F11A 3H6TA 2DXYA 3OD7A 1URSA 4G2ZA 2Y84A 1M5BA 2V93A 3RLFE 4ZECA 3IL1B 3I5OA 1RYXA 3E9XA 2I4BA 4KFQA 1IZ1A 1L5TA 1JVXA 4MFIA 2YJPA 4NF5B 4JWXA 3PPNA 3IX1A 2H9BA 4OQOA 3ZSFA 3K6XA 4ZE8A 4N6PA 3OENA 2O7UA 4NF8B 4O3BA 1VR5A 3V8XB 1ZMGA 3QUJA 3KN8A 4OVJA 5F7VA 5CBRA 3WAFA 5HBCA 1MQGA 4R2FA 3TTRA 2XXUA 1SI1A 3CFZA 5I57B 1T0KA 3S9MC 5ITOA 3HCQA 4F22A 4IY5A 1AMFA 2P1SA 1DPPA 3MVWA 1MY1A 2HAUA 3RGYA 2GHAA 2I0CA 2NOOA 2O84X 3N6UA 3HSTA 4U2RA 4RYAA 2DVZA 5FTHA 3CR9A 1FQEA 3KJ7A 3SEWA 1FTKA 4BLAA 3IOVA 4YMBA 3JV9A 3FVKA 2A5TA 1LFGA 2F7CA 2DQVA 3KFMA 3GBAA 2GRVA 5TP9B 2Y7KA 1M5FA 3HO7A 1Y3NA 3IR1A 3U1OA 1QUIA 1MH4A 1EZOA 5CI5A 3PUZE 2ZNTA 5M2VA 1DMBA 4TOZA 2FYIA 4E0WA 2O51A 4FORA 1BIYA 2AL4A 1SYIA 1MXWA 1B4ZA 3EF7A 3L6HA 4NF4B 3S4UA 1H45A 3H7MA 4YICA 3IOWA 5AE4A 3G3JA 3HHGA 1H43A 3CIJA 3OSRA 5H8FA 5DVFA 1MH3A 3Q28A 1D9VA 1LAGE 4ESXA 2Q8JA 1POTA 1N7WA 3USDA 1GTKA 2F6PA 3H6UA 3Q26A 4EQ7A 2H4IA 2ONRA 5TU0A 1IXIA 3TTMA 3FUZA 2OLBA 1H44A 3CI8A 3CSBA 4KCDA 2XX7A 4X1BA 1SW2A 3TZAA 1Y1ZA 2B3FA 4H5FA 1QW0A 4KD5A 1PBQA 1DOTA 2DOJA 2NVUB 5JEIA 3KN7A 1SD3A 5L9OA 1O7TA 2ZYOA 4I8CA 2REJA 3T96B 1A7LA 2ESNA 4I9DA 4E0XA 3S2VA 3TTNA 4IGTA 3TDJA 4F1YA 2ZMBA 4RK9A 5ICQA 1JW1A 1GR2A 3MJNA 3S9LC 2VP1A 2QMXA 4H65A 1ZTYA 2FNCA 3MP8A 4LA9A 1B7HA 1JEUA 3FIRA 3FJGA 1MQJA 3IAZA 4MBPA 3T93B 1MY2A 3DP8A 3M3FA 3U94A 4PE5B 3OEMA 3KOTA 1LFIA 3OO9A 1B3EA 4FEDA 4P0GA 3GBBA 3IOTA 4GLIA 2XXYA 3MWBA 5ELVA 4H67A 1B46A 3T9HB 2HAVA 1VSOA 3HN0A 5H8SA 2R6GE 1UQWA 3PUVE 3TELA 1GGGA 3PUYE 3G7WA 1DTZA 2ZXTA 2Q9TA 1UTBB 2HCAA 3DP6A 2KLFA 1NNFA 3PPPA 4BDRA 5L9MA 3FVGA 3N94A 5CBSA 4NEDA 2VD3A 4H5GA 5FHMA 3RPWA 4GXAA 4R9GA 4RK2A 2QS4A 1XHYA 1USYE 1WDNA 5H8QB 3TFLA 3WAEA 2XX9A 3H06B 4MLVA 1B58A 3FZVA 3VV5A 2CZLA 4LZ5A 4OENA 3BKIB 3C31A 3ODBA 2F78A 2AL5A 4FJPA 2E1SA 1XOCA 3K00A 2V3UA 4KYDA 4TQUQ 3OSQA 5KCJB 5I2KA 4ZEIA 1S50A 3GZGA 2ZNUA 2ZYNA 3I6VA 1B3FA 2VOZA 3TPAA 2ALUA 1QUJA 3TQWA 1US4A 4F18A 1O64A 5AA4A 4GL0A 1PBPA 5JK4A 2ONKE 2Z22A 3SETA 1XVXA 2PVUA 1MDP1 4JBZA 1WVJA 4F3PA 4XKPA 1LAXA 3TCGA 3QSLA 3VVEA 4KYSA 2F6GA 2GH9A 5FHOA 3K02A 1BTJA 1FQFA 1N76A 4OFOA 2PT1A 1R9QA 2M8CA 1UTHB 1MXVA 4WKMA 1Y3PA 2O69A 3K0VA 1B0HA 3TTKA 2HQ0A 5AA2A 1ELJA 3MPLA 4K3FA 3ZS6A 3VFJA 1EZPA 4EUOA 5CMMA 1JNFA 1UIVA 2OJTA 5BUUA 4GF8A 1LAHE 2Y7IA 3W9VA 2O68A 2ABHA 2RCBA 3T66A 3OO7A 4OEVA 4DXBA 1QULA 4KI0E 5H8HA 1A40A 5AA2D 3KSXA 2RC8A 3TKDA 3MVXA 1YTVA 4AB5A 5K2XA 3T9UA 4PP0A 4F2QA 4RNSA 3FGSA 4QFOA 5I59A 1H76A 4Q30B 3JYRA 3PUWE 3B6QA 1B3LA 3D4CA 5H8NB 2ZYMA 2A5TB 4YKKA 2V84A 1B4HA 1TXFA 3ZKKA 1ZLQA 1MPCA 4LZ7A 1IQ7A 4DZ1A 3PD9A 3K6VA 4PFWA
chains in the Genus database with same CATH superfamily
4PFUA 5JTYB 5A5XB 1SPIA 2UXAA 1MPBA 2UVIA 4N81A 1EYJA 4I40A 3MUQA 1N7XA 2OX3A 5BWJA 1Y9UA 3TEPA 1P1NA 4NX1A 4JVIA 3SESA 2DVCA 2PFYA 1N04A 1ZU0A 3KBRA 4N6DA 4F29A 5DEXA 3U92A 1FBFA 1RDYA 3I3VA 3G3FA 2XXIA 1OLAA 1R9LA 4N6KA 5I56A 3PMWA 2FIEA 3O9PA 1LB9A 3FXUA 2RF1A 1XVYA 4OERA 3CVGA 2QFLA 4P11A 3B50A 2BJJX 1EU8A 1SVXB 2I49A 2QSXA 2UYFA 1P99A 3PPQA 2F8DA 4I3EA 4GWYA 2UYEA 1LBXA 2VD2A 3K1NA 1ZJLA 2WKYA 1LB8A 1A8FA 3KBZA 4IO7A 4YB7A 3PTYA 3O28A 4NF6A 2VHAA 4IO3A 4ZE9A 1MG1A 5DW8A 5TPAA 2Y7WA 4PC9A 4ESWA 1S7YA 3KSJA 3PMXA 3RN8A 1VFDA 1Y4CA 4YKIA 1AL3A 1NV1A 4LQ2A 4OFJA 5EQ9A 4MEVA 4JDFA 2XXHA 1JP4A 4MF3A 4BDNA 3RT6B 2FVZA 4MHFA 4G8MA 4N17A 3MAMA 3K6UA 2HXWA 4DXUA 3CRBA 4U4XA 4X8RA 4YKPA 1D4NA 3N6TA 5IGAA 1JETA 1QKAA 4GBVA 5I2NB 2XWIA 3IO4A 4DIGA 2E0SA 4ZS9A 4EQBA 4NN3A 4IGRA 2P2AA 3FJMA 4R6YA 3DM0A 1NUYA 4Z7EA 2B4MA 5CRYA 2Y7PA 4P47A 1FPJA 1NL5A 3D1RA 1YPNA 3EQ1A 1FQAA 2BJIA 1RYOA 3K01A 1Z7ME 1B51A 3K6WA 1FJ6A 4F3BA 1MY4A 4HW8A 1H3DA 2XWOA 1UIUA 3PMVA 2DE2A 3MVZA 1WODA 3SDFA 1HSLA 4GX4A 3FVOA 1NNPA 2B4LA 1PDAA 2XXPA 5ET5A 1ZKBA 2B3BA 1IMFA 3BBRA 3K1PA 4OMBA 1US5A 5F24A 1K9ZA 3MQ9A 1POY1 1R6ZA 2R9JA 3PD8A 4FECA 4C1UA 2DXRA 1OMPA 4LATA 2F7AA 4ISUA 1OLCA 1LGBC 1IXCA 2THIA 2YLNA 4G68A 4PGPA 4YZZA 3VE1B 3ISPA 5I2KB 3VLVA 3H4ZA 4LZ8A 1MQDA 2XD3A 2QS2A 2UVJA 1B32A 1QUKA 1LFHA 4BDLA 4N8YA 4JVDA 3CG1A 1GVCA 4P1EA 3RTFB 4X9TA 3QMFA 2OWTA 3MC2A 2WYKA 3FASA 5DVJA 4H8JA 4DCYA 2XXWA 3PPRA 2PCRA 3E4RA 3N5LA 2RCAA 2I58A 5KDTA 2OK2A 1FPEA 2OCUA 3MBPA 4OXVA 4QF9A 4EXLA 4UA8A 1D3KA 2Z23A 4MAGA 2DWHA 4GD5A 3H3GA 4PETA 3LBSA 1G0HA 1MPDA 1AH5A 1B05A 1OVTA 3UP9A 4GWXA 3TQLA 1G0IA 2DE4A 2GQ1A 3M8UA 2HFBA 4R73A 4H45A 3K2DA 2H98A 4NF5A 2PBWA 1OQHA 2QVRA 4DXCA 4H46A 3V83A 2NXOA 5K2YA 3RQTA 4X1DA 4MLQA 3QK6A 4U1ZA 1VFEA 3TTLA 3EPEA 5I58B 1A99A 2HXRA 4YKJA 5EQ7A 1CE2A 5I57A 1FBCA 1LAFE 1YCJA 2W7YA 1D9YA 2L5VA 2Q2CA 4IO5A 4LUBA 5EYFA 5DVIA 3QYTA 4ZZEA 4PFBA 4LP2B 1LLSA 2FA7A 2GHBA 3A3CA 3V89B 4U1OA 4P1LA 4X04A 1DTGA 1FTMA 4GWSA 2RC7A 3LUYA 2DWJA 2Q88A 3OO8A 3UA8A 3GXAA 1FPFA 3P7IA 4KPTA 2F35A 3OELA 3N26A 4LN5A 1FRPA 4ZEFA 2O7IA 4RPOA 4QFKA 1TWYA 3Q25A 5ESYA 4GL8A 2QJEA 5B70A 2KR0A 1S9TA 4AQ4A 3IK6B 2Y7RA 1KA1A 5TP9A 4G68C 5EHSA 5L8DA 1LBCA 3MZ1A 4Q5TA 4F39A 4JVCA 4KQPA 4DI4B 3FD3A 4XIGQ 3O6HA 5IAIA 3QXMA 2WBDA 1LCFA 4UACA 2DWAA 1NV4A 4AS4A 1XC1A 4GRKA 3CG3A 3RPLA 2Q2AA 4DCXA 3IFCA 1SW5A 3EHTA 4NF4A 3BIHA 4KR5A 1J1NA 4OVPA 3FXBA 4Q8RA 5CMCA 1A8EA 2PX1A 3PU5A 4GXSB 3IB0A 5KZTA 4RJZA 5T3JA 2B65A 3MZ9A 4R2BA 1MS7A 2ZZXA 4PGNA 4GWUA 1D9QA 4GQOA 1FPDA 3KGCA 2XHDA 1SBPA 1I69A 3THIA 2WYPA 1B0LA 1JW5A 4MNIA 1FQDA 4P0IA 4PDHA 4U21A 1MDQA 1A54A 1JVYA 4R6KA 3QIMA 4N07A 4DLDA 4FAJA 1MY0A 4IO4A 3S9NC 3RT8A 3TYHA 4HXVA 3VVDA 3U8QA 4OVSA 1NV2A 4C0RA 4ND9A 1FPKA 4DE8A 4PQJA 4R9FA 1MQIA 3DP4A 3TCHA 3M3LA 1IEJA 1QVSA 4ONYA 2JJKA 1PEBA 1B52A 1B5JA 2DS9A 1NNKA 3SZPA 4BDMA 3C9HA 4OVRA 1Y1MA 2WX9A 4H8IA 4HCWA 4N15A 1FTOA 4ZDMA 1DK4A 1IXHA 4F1VA 3Q27A 3IB1A 2FHYA 3IJXB 2X7PA 1RKMA 4HCYA 3T22A 3MSTA 2OWSA 1CB6A 4R6HA 1FQBA 2Z8FA 4RPNA 4QFNA 5HPQA 3O6GA 1DBZA 4O3CA 3U72A 2FIXA 1XT8A 2RC9A 2F36A 4P9KA 4H6DA 4GFRA 1OQGA 3G3HA 2GFEA 4NWDA 4Q0CA 2Q8MA 1ANFA 5FBPA 3RNNA 1QGXA 1B7ZA 2H5YA 5IZ1A 1FTJA 1IMEA 4QHQA 3HV1A 3OEKA 4GIZA 1Q1KA 1K9YA 1Y3QA 4C1TA 1LBBA 4EF2A 3C35A 3DLNA 4NF0A 3ONMA 3E13X 4Z0IA 1FBHA 5HM4B 1FCKA 2KQZA 3KZGA 1MXYA 3A09A 3G3GA 3VVFA 4ZEKA 3RUMA 4OZ9A 2R8TA 5H8FB 1OIBA 4G68B 4U22A 4PFIA 2CZKA 3SERA 2DE3A 4KXPA 1B6HA 5IKBA 2PT2A 5H8QA 2WEFA 2Q89A 3HHFA 1B1XA 5AA3A 4NQ8A 1B7UA 1O63A 2RINA 2VT5A 3CSGA 3K4UA 4ZZAA 4LONB 3E79A 3B6WA 2V4CA 4PAFA 1Z7NE 1EYIA 1ZIUA 1VE4A 3NOHA 4FATA 1LCTA 2YPNA 1PB8A 4OWDA 2XXXA 1XS5A 3KC1A 1JEVA 2PMSA 3VXCA 2I4CA 4R74A 1KWHA 3K1MA 1NV7A 4RY1A 4X48A 3O29A 4FBPA 3FVNA 4XKQA 3OO6A 4FIMA 4BDQA 4ZEDA 1UTHA 3BFUA 4F1UA 3KJTA 4NHBA 4ZEBA 3EHUA 1N3XA 1SW1A 3C33A 1II5A 3G3KA 2XD2A 4RA1A 4OFLA 4H1XA 4RXLA 3PGFA 1MM6A 3T0JA 3IO6A 3VDFA 4U4SA 3UIFA 4GWWA 3VLWA 1I6AA 3RY3A 3HFUA 3MVYA 1B5HA 4TLLB 1SQYA 2CEYA 4LVQA 1ATGA 3BFTA 3E3KA 2ZZVA 4YB6A 4NAPA 2XXVA 3B7DA 2IA4A 3FXQA 3IORA 5EYHA 5ITPA 3O66A 4QSEA 2X26A 4MH5A 4HE1A 1IMCA 2DDKA 4THIA 4YAHX 1N3WA 1IITA 4BDOA 2DYXA 4F2OA 2F7BA 2F3DA 5H8NA 3FXRA 4PBQA 5AA1A 3UORA 5FHNA 5CM6A 4MX6A 1P1QA 4G8NA 5B7DA 2LAOA 1FQCA 4DDDA 3AXFA 3KG2A 2Z8EA 2I3WA 3VLUA 1MQHA 1BP5A 1MXZA 2A5SA 3PUXE 3R7XA 3FV1A 4JWYA 3W9WA 1FPIA 4FEBA 5JTYA 5A5XA 3VXBA 2Q74A 2XWKA 4ELPA 2AIXA 3PPOA 3Q29A 5L9SA 1EZ9A 4WEDA 3SEYA 1IUDA 3JZJA 2QMWA 3R6UA 1NNTA 1TFDA 5AA4B 3T9VA 5ICTA 2O1MA 4N91A 2O1LA 5DTBA 2F5XA 1DPEA 1EYKA 2V3TA 1B5IA 1Y4TA 4WEPA 1BK4A 2D3IA 4H0WA 3LC8A 3TAJA 4TLMB 2I0BA 3GLBA 4F3GA 2XWVA 1YXIA 3R26A 4AB6A 2WBBA 4XKRA 4NE4A 2QS1A 5AA2B 2HEUA 1BLFA 2XXRA 2UVGA 1NUZA 2D21A 1Q9DA 1NV6A 4M1VA 1QJMA 2Z8DA 3IFAA 5EHMA 4LQ5A 3FBPA 2REGA 4M4GA 1M5EA 1KA0A 4G77A 4OANA 2DP8A 2PFZA 3UGWA 3FATA 2DSFA 3TODA 1INPA 1NMUA 4MIJA 1AIVA 3LSLA 4NF8A 4IY6A 5H8HB 2O6AA 5ISUA 2HZKA 3T9XB 1RDXA 4XXUA 5IM2A 2QS3A 1MXUA 1Q35A 4N13A 3TCFA 1FTLA 1N84A 2RKMA 3E78A 1NFTA 4JXIA 1NKXA 5I59B 2F97A 4HE2A 3H03A 3TMGA 3B8BA 1MXXA 2XXTA 5IZ3A 1YZ0A 3O2AA 4JB7A 4O7MA 3A3UA 3W15C 3RTWB 3O6IA 2CMOA 4JSOA 5I2NA 4NGUA 3ILUB 1B3GA 1JQFA 4OHNA 3OMBA 4ELRA 3MPKA 5LOMA 2PYYA 1YAEA 2P3NA 5FTIA 3LSFB 2AYSA 1DCUA 4XTCQ 4G4PA 3EN3A 1GV8A 3ILTB 1I6QA 3C34A 4EDPA 2NWJA 1P1OA 4PCDA 3LR1A 1JW4A 5DYHA 2XX8A 1HSEA 5I84A 2G29A 4O3AA 5DEXB 4PDDA 3MZBA 1B9JA 1P1UA 1DSNA 4IO6A 5I56B 3B6TA 2ZZWA 3A29A 3KOSA 2VGQA 4OEUA 3LSWA 2HZLA 2P3VA 1MY3A 1URGA 3V5AA 1B3HA 3SEUA 3SEVA 4UABA 4QFLA 1P1WA 4PF8A 1ZBMA 3CFLA 4N8GA 1NV3A 3U93A 4OETA 1SI0A 3S9EA 1PC3A 3TUSA 4I62A 3MP1A 1TT1A 3KEIA 1R1NA 5IZZA 2QL3A 5LDZA 4AS5A 3L6GA 4OYVA 1QKBA 1A55A 1B2HA 2ONSA 4NMYA 4ECFA 1FPGA 1MRPA 4QSCA 3IB2A 4NF6B 4QFPA 4GBWA 2OZZA 1FW0A 4QSDA 4YB5A 5TPAB 2I48A 3SEXA 5J1DA 4IO2A 3CFXA 1TFAA 4OESA 4I1DA 5CC2A 4QXDA 3MP6A 3O97A 3FJ7A 4G8HA 1LSTA 1SW4A 2ZYKA 4OVTA 4YMAA 2DWIA 2OBGA 3M3KA 4KYEA 2QRYA 1NH8A 3H6WA 1SYHA 2V25A 1IMBA 4NTLA 3PV0E 3EKIA 1FBEA 4EXKA 1SDXA 3QAXA 4G61A 4IB2A 5CMBA 2XA5A 4F31B 1LBWA 3G3IA 2I3VA 4GWZA 1BKAA 5J16A 5EQ8A 2D5WA 4XEQA 5I58A 3FV2A 4HTGA 2NUVA 2XXKA 3C4MA 4PFYA 1M5DA 3QUFA 4MNCA 2UVHA 4XKNA 4GWOA 4R72A 2QPQA 1I6BA 4QRZA 3SKPA 4MJOA 4WXJA 4F19A 1PB7A 3IOUA 1UTBA 4POWA 5ET6A 4PFTA 2XXQA 3UN6A 2ANJA 1HSJA 4ELQA 3EHSA 3IJOB 4U23A 2H99A 1EH3A 5CMKA 2P0SA 1PB9A 4POXA 4JSDA 1OVBA 2I6EA 3DELB 4NWCA 4OTEA 2G93A 3C36A 2CEXA 4YU0A 1B1HA 4F3SA 4ELOA 4EF1A 3KN3A 4EQ9A 5F1QA 3D4GA 1F9BA 1IXGA 3C32A 4L17A 4HS7A 1NUXA 2QVVA 1M5CA 1FSAA 3MW0A 2ZNSA 4KCCA 1LBZA 3ECRA 4GVOA 1Y20A 3ZKLA 1N0TA 1USYH 4FE8A 1NH7A 1URDA 4MNPA 4PAIA 3HPIA 1AOVA 4PAKA 3LSXA 1B40A 5I7IA 5KCJA 4R75A 3OOAA 1IIWA 5DT6A 4KHZE 2R71A 3H6VA 3OXNA 2H25A 2X7QA 2V3QA 4JWOA 5KDTB 2IEEA 3RYDA 3UK4A 1MM7A 2F34A 4GOTA 3F11A 5ET8A 3H6TA 2DXYA 3OD7A 1URSA 1FTAA 4G2ZA 2Y84A 1M5BA 2V93A 3RLFE 4ZECA 3IL1B 3I5OA 1RYXA 3E9XA 2I4BA 2Y5LA 4KFQA 3T1BA 1IZ1A 1L5TA 1JVXA 4MFIA 2YJPA 4NF5B 4JWXA 3PPNA 3IX1A 2H9BA 4OQOA 3ZSFA 4XF5A 4PF6A 3K6XA 4ZE8A 4N6PA 3OENA 2O7UA 4NF8B 4O3BA 1VR5A 3V8XB 1ZMGA 3QUJA 3KN8A 4OVJA 5F7VA 4OA4A 5CBRA 3WAFA 4XFEA 5HBCA 1MQGA 4R2FA 3TTRA 2XXUA 1SI1A 3CFZA 5I57B 1FJ9A 1T0KA 4GX3A 3S9MC 4P8BA 4PE3A 5ITOA 3HCQA 2VPOA 4F22A 1CNQA 4IY5A 1AMFA 5IZ3B 2P1SA 1DPPA 3MVWA 1MY1A 1NUWA 2HAUA 3RGYA 2GHAA 2I0CA 2NOOA 2O84X 3N6UA 3HSTA 4U2RA 3ROJA 4RYAA 2DVZA 4O8MA 5FTHA 3MYUA 3CR9A 1FQEA 3KJ7A 3SEWA 1FTKA 4BLAA 3IOVA 4GX6A 4YMBA 3JV9A 3FVKA 2A5TA 3KC0A 1LFGA 2F7CA 2DQVA 1NI9A 3KFMA 3GBAA 2GRVA 5TP9B 2FBPA 2Y7KA 1NV0A 1M5FA 3HO7A 4OVQA 1Y3NA 2MKZA 3LUZA 3IR1A 3U1OA 1QUIA 1MH4A 1EZOA 5CI5A 3PUZE 2ZNTA 5M2VA 1DMBA 4TOZA 2FYIA 4E0WA 2Y5KA 2O51A 2OWZA 3RPLB 4FORA 1BIYA 2AL4A 1SYIA 1MXWA 2QVUA 1B4ZA 3EF7A 3L6HA 4NF4B 3S4UA 4HE0A 1H45A 3H7MA 4YICA 3IOWA 5AE4A 1FBPA 3G3JA 3HHGA 1H43A 3CIJA 3OSRA 1FBGA 5H8FA 5DVFA 1MH3A 1YYZA 3Q28A 1D9VA 1LAGE 4ESXA 2Q8JA 1AWBA 1POTA 1N7WA 1IMAA 3USDA 1GTKA 2F6PA 3H6UA 3Q26A 4EQ7A 2H4IA 2ONRA 5TU0A 1IXIA 3TTMA 3FUZA 2OLBA 1H44A 3CI8A 3CSBA 4KCDA 1IMDA 2XX7A 4X1BA 1SW2A 3TZAA 1Y1ZA 2B3FA 4H5FA 1QW0A 4KD5A 1PBQA 1DOTA 2DOJA 2NVUB 5JEIA 3KN7A 1SD3A 5L9OA 1O7TA 2ZYOA 4I8CA 2REJA 3T96B 4P56A 1A7LA 1FPLA 2ESNA 4I9DA 4E0XA 3S2VA 3TTNA 4IGTA 3TDJA 4F1YA 2ZMBA 4RK9A 5ICQA 1JW1A 1GR2A 4N4UA 3MJNA 3S9LC 3U65A 5EYGA 2VP1A 2QMXA 4H65A 1ZTYA 2FNCA 3MP8A 4LA9A 1B7HA 1JEUA 3FIRA 3FJGA 1MQJA 3IAZA 4MBPA 4PBHA 4PFRA 3T93B 1MY2A 4P3LA 3DP8A 3M3FA 3U94A 1FPBA 1LBYA 4PE5B 3OEMA 1RDZA 3KOTA 1LFIA 1LBVA 4O7IA 3OO9A 1B3EA 4FEDA 4P0GA 3GBBA 3IOTA 4GLIA 2XXYA 3MWBA 5ELVA 4H67A 1B46A 3T9HB 2HAVA 1VSOA 3HN0A 5H8SA 5A5LA 2R6GE 1UQWA 3PUVE 3TELA 1GGGA 3PUYE 3G7WA 1DTZA 2ZXTA 1KZ8A 2Q9TA 1UTBB 3CHGA 2CZIA 2HCAA 3DP6A 2KLFA 1NNFA 3PPPA 4BDRA 5L9MA 3FVGA 3N94A 5CBSA 4NEDA 2VD3A 4H5GA 5FHMA 3GYYA 3RPWA 4GXAA 1LEVA 5I3SA 4R9GA 4RK2A 2VPNA 2CZHA 2QS4A 1XHYA 1VDWA 2HPGA 1USYE 1WDNA 5H8QB 3TFLA 3WAEA 2XX9A 3H06B 4MLVA 1B58A 2F3BA 3FZVA 3VV5A 2CZLA 4LZ5A 4OENA 3BKIB 3C31A 3ODBA 2F78A 2AL5A 4FJPA 2E1SA 1XOCA 3K00A 2V3UA 4QBAA 1FBDA 4KYDA 4TQUQ 3OSQA 5KCJB 5I2KA 4ZEIA 1S50A 3GZGA 2ZNUA 2ZYNA 3I6VA 1B3FA 2VOZA 3TPAA 2ALUA 1QUJA 3TQWA 1US4A 4F18A 1O64A 5AA4A 4GL0A 1PBPA 5JK4A 2ONKE 2Z22A 3SETA 1XVXA 2PVUA 1MDP1 4JBZA 3BIGA 1WVJA 4F3PA 4XKPA 1LAXA 4DI3D 1NV5A 3TCGA 3QSLA 3VVEA 4KYSA 2F6GA 2GH9A 5FHOA 3K02A 1BTJA 1FQFA 1N76A 4I3YA 5EQAA 4OFOA 2PT1A 1R9QA 2M8CA 1UTHB 1XI6A 1MXVA 4WKMA 1Y3PA 2O69A 3K0VA 1B0HA 3TTKA 2HQ0A 5AA2A 1ELJA 4IR8A 3MPLA 4K3FA 3ZS6A 3VFJA 1EZPA 4EUOA 4PTKA 5CMMA 1JNFA 1UIVA 2OJTA 5BUUA 4GF8A 1LAHE 2Y7IA 3W9VA 2O68A 2ABHA 2RCBA 2HHMA 3T66A 4O94A 3OO7A 4OEVA 4DXBA 1QULA 4KI0E 5H8HA 1A40A 5AA2D 3KSXA 2RC8A 3TKDA 3MVXA 1YTVA 4AB5A 5K2XA 5LTCA 3T9UA 5ET7A 4PP0A 4F2QA 4RNSA 3FGSA 4QFOA 5I59A 1H76A 4Q30B 3JYRA 3PUWE 3B6QA 1B3LA 3D4CA 3LV0A 5H8NB 2ZYMA 2A5TB 4YKKA 2V84A 1B4HA 1TXFA 3ZKKA 1ZLQA 1MPCA 4LZ7A 1IQ7A 4NG7A 4MCOA 4DZ1A 3PD9A 5I5PA 3K6VA 4PFWA 4MMPA
chains in the Genus database with same CATH topology
4PFUA 5JTYB 5A5XB 2UXAA 1MPBA 2UVIA 3MUQA 1N7XA 5BWJA 1Y9UA 3TEPA 1P1NA 3SESA 2DVCA 1ZU0A 1N04A 3KBRA 4F29A 5DEXA 3U92A 3I3VA 3G3FA 2XXIA 1OLAA 1R9LA 5I56A 3PMWA 3O9PA 1LB9A 3FXUA 2RF1A 1XVYA 4OERA 3CVGA 4P11A 2BJJX 1EU8A 1SVXB 2I49A 2QSXA 2UYFA 1P99A 3PPQA 2F8DA 2UYEA 2VD2A 3K1NA 1ZJLA 2WKYA 1LB8A 1A8FA 4IO7A 4YB7A 3O28A 4NF6A 2VHAA 4IO3A 4ZE9A 1MG1A 5TPAA 2Y7WA 4ESWA 1S7YA 3KSJA 3PMXA 3RN8A 1VFDA 1Y4CA 4YKIA 1AL3A 4LQ2A 4OFJA 4JDFA 2XXHA 4MF3A 4BDNA 3RT6B 4G8MA 3MAMA 3K6UA 2HXWA 4DXUA 3CRBA 4U4XA 4YKPA 1D4NA 3N6TA 1JETA 1QKAA 5I2NB 3IO4A 4DIGA 2E0SA 4ZS9A 4EQBA 4IGRA 2P2AA 3FJMA 4R6YA 3DM0A 4Z7EA 5CRYA 2Y7PA 1NL5A 1YPNA 3EQ1A 1FQAA 1RYOA 3K01A 1Z7ME 1B51A 3K6WA 4F3BA 1MY4A 4HW8A 1H3DA 1UIUA 3PMVA 2DE2A 3MVZA 1WODA 3SDFA 1HSLA 3FVOA 1NNPA 1PDAA 2XXPA 1ZKBA 2B3BA 3BBRA 3K1PA 4OMBA 1US5A 3MQ9A 1POY1 1R6ZA 2R9JA 3PD8A 4FECA 4C1UA 2DXRA 1OMPA 4LATA 2F7AA 4ISUA 1OLCA 1LGBC 1IXCA 2THIA 2YLNA 4G68A 4YZZA 3VE1B 5I2KB 3VLVA 3H4ZA 4LZ8A 1MQDA 2XD3A 2QS2A 2UVJA 1B32A 1QUKA 1LFHA 4BDLA 3CG1A 1GVCA 3RTFB 4X9TA 2OWTA 3MC2A 3FASA 5DVJA 4H8JA 4DCYA 2XXWA 3PPRA 3E4RA 3N5LA 2RCAA 2I58A 5KDTA 2OK2A 2OCUA 3MBPA 4OXVA 4QF9A 4EXLA 4UA8A 1D3KA 2Z23A 2DWHA 4GD5A 3H3GA 4PETA 3LBSA 1MPDA 1AH5A 1B05A 1OVTA 3UP9A 3TQLA 2DE4A 3M8UA 2HFBA 4R73A 3K2DA 2H98A 4NF5A 2PBWA 1OQHA 4DXCA 3V83A 2NXOA 5K2YA 3RQTA 4X1DA 4MLQA 3QK6A 4U1ZA 1VFEA 3TTLA 3EPEA 5I58B 1A99A 4YKJA 1CE2A 5I57A 1LAFE 1YCJA 2W7YA 1D9YA 2Q2CA 4IO5A 4LUBA 5EYFA 5DVIA 3QYTA 4ZZEA 4LP2B 1LLSA 2FA7A 2GHBA 3A3CA 3V89B 4U1OA 1DTGA 1FTMA 2RC7A 3LUYA 2DWJA 2Q88A 3OO8A 3UA8A 3GXAA 3P7IA 4KPTA 2F35A 3OELA 3N26A 4ZEFA 2O7IA 4RPOA 4QFKA 1TWYA 3Q25A 4GL8A 2QJEA 5B70A 1S9TA 4AQ4A 3IK6B 2Y7RA 5TP9A 4G68C 5EHSA 5L8DA 1LBCA 3MZ1A 4Q5TA 4F39A 4KQPA 3FD3A 4XIGQ 3O6HA 5IAIA 3QXMA 1LCFA 4UACA 2DWAA 1XC1A 4GRKA 3CG3A 2Q2AA 4DCXA 1SW5A 3EHTA 4NF4A 4KR5A 1J1NA 4Q8RA 5CMCA 1A8EA 2PX1A 3PU5A 4GXSB 3IB0A 5KZTA 4RJZA 2B65A 3MZ9A 4R2BA 1MS7A 4GQOA 3KGCA 2XHDA 1SBPA 1I69A 3THIA 1B0LA 1JW5A 1FQDA 4P0IA 4U21A 1MDQA 1A54A 1JVYA 4R6KA 3QIMA 4N07A 4DLDA 4FAJA 1MY0A 4IO4A 3S9NC 3RT8A 3TYHA 3VVDA 3U8QA 4C0RA 4ND9A 4DE8A 4PQJA 4R9FA 1MQIA 3DP4A 3TCHA 3M3LA 1IEJA 1QVSA 4ONYA 1PEBA 1B52A 1B5JA 2DS9A 1NNKA 4BDMA 3C9HA 1Y1MA 4H8IA 4HCWA 1FTOA 4ZDMA 1IXHA 4F1VA 3Q27A 3IB1A 3IJXB 2X7PA 1RKMA 4HCYA 3T22A 2OWSA 1CB6A 4R6HA 1FQBA 2Z8FA 4RPNA 4QFNA 5HPQA 3O6GA 4O3CA 3U72A 1XT8A 2RC9A 2F36A 4H6DA 4GFRA 1OQGA 3G3HA 2GFEA 4NWDA 4Q0CA 1ANFA 3RNNA 1B7ZA 2H5YA 1FTJA 4QHQA 3HV1A 3OEKA 4GIZA 1Q1KA 1Y3QA 4C1TA 1LBBA 4EF2A 3C35A 3DLNA 3ONMA 3E13X 4Z0IA 5HM4B 1FCKA 3KZGA 1MXYA 3A09A 3G3GA 3VVFA 4ZEKA 3RUMA 4OZ9A 5H8FB 1OIBA 4G68B 4U22A 3SERA 2DE3A 1B6HA 5IKBA 2PT2A 5H8QA 2Q89A 3HHFA 1B1XA 5AA3A 1B7UA 1O63A 2RINA 3CSGA 3K4UA 4ZZAA 4LONB 3B6WA 1Z7NE 1ZIUA 1VE4A 4FATA 1LCTA 2YPNA 1PB8A 4OWDA 2XXXA 1XS5A 1JEVA 2PMSA 3VXCA 2I4CA 4R74A 1KWHA 3K1MA 4RY1A 4X48A 3O29A 3FVNA 4XKQA 3OO6A 4FIMA 4BDQA 4ZEDA 1UTHA 3BFUA 4F1UA 3KJTA 4ZEBA 3EHUA 1N3XA 1SW1A 3C33A 1II5A 3G3KA 2XD2A 4RA1A 4OFLA 4H1XA 4RXLA 3PGFA 1MM6A 3IO6A 3VDFA 4U4SA 3UIFA 3VLWA 1I6AA 3RY3A 3MVYA 1B5HA 4TLLB 1SQYA 4LVQA 1ATGA 3BFTA 3E3KA 4YB6A 2XXVA 3B7DA 2IA4A 3FXQA 3IORA 5ITPA 3O66A 4QSEA 2X26A 4MH5A 4THIA 4YAHX 1N3WA 1IITA 4BDOA 2DYXA 4F2OA 2F7BA 5H8NA 3FXRA 5AA1A 3UORA 5FHNA 5CM6A 1P1QA 4G8NA 5B7DA 2LAOA 1FQCA 4DDDA 3AXFA 3KG2A 2Z8EA 2I3WA 3VLUA 1MQHA 1BP5A 1MXZA 2A5SA 3PUXE 3R7XA 3FV1A 4JWYA 3W9WA 4FEBA 5JTYA 5A5XA 3VXBA 4ELPA 2AIXA 3PPOA 3Q29A 5L9SA 1EZ9A 4WEDA 3SEYA 1IUDA 3JZJA 2QMWA 3R6UA 1NNTA 1TFDA 5AA4B 3T9VA 5ICTA 2O1MA 2O1LA 5DTBA 2F5XA 1DPEA 2V3TA 1B5IA 1Y4TA 4WEPA 2D3IA 4H0WA 3LC8A 3TAJA 4TLMB 2I0BA 3GLBA 4F3GA 3R26A 4AB6A 4XKRA 4NE4A 2QS1A 5AA2B 2HEUA 1BLFA 2XXRA 2UVGA 2D21A 4M1VA 1QJMA 2Z8DA 5EHMA 4LQ5A 2REGA 4M4GA 1M5EA 4G77A 2DP8A 3UGWA 3FATA 2DSFA 3TODA 1NMUA 1AIVA 3LSLA 4NF8A 4IY6A 5H8HB 2O6AA 5ISUA 2HZKA 3T9XB 4XXUA 2QS3A 1MXUA 1Q35A 4N13A 3TCFA 1FTLA 1N84A 2RKMA 1NFTA 4JXIA 1NKXA 5I59B 2F97A 3H03A 3TMGA 1MXXA 2XXTA 3O2AA 4JB7A 3A3UA 3W15C 3RTWB 3O6IA 2CMOA 4JSOA 5I2NA 3ILUB 1B3GA 1JQFA 4OHNA 3OMBA 4ELRA 3MPKA 5LOMA 2PYYA 1YAEA 5FTIA 3LSFB 2AYSA 4XTCQ 4G4PA 3EN3A 1GV8A 3ILTB 1I6QA 3C34A 4EDPA 2NWJA 1P1OA 3LR1A 1JW4A 5DYHA 2XX8A 1HSEA 5I84A 2G29A 4O3AA 5DEXB 3MZBA 1B9JA 1P1UA 1DSNA 4IO6A 5I56B 3B6TA 3KOSA 2VGQA 4OEUA 3LSWA 2HZLA 1MY3A 1URGA 3V5AA 1B3HA 3SEUA 3SEVA 4QFLA 1P1WA 1ZBMA 3CFLA 3U93A 4OETA 1SI0A 3S9EA 1PC3A 3TUSA 4I62A 3MP1A 1TT1A 3KEIA 1R1NA 2QL3A 3L6GA 4OYVA 1QKBA 1A55A 1B2HA 2ONSA 4NMYA 4ECFA 1MRPA 4QSCA 3IB2A 4NF6B 4QFPA 2OZZA 1FW0A 4QSDA 4YB5A 5TPAB 2I48A 3SEXA 5J1DA 4IO2A 3CFXA 1TFAA 4OESA 4I1DA 5CC2A 3MP6A 3O97A 3FJ7A 4G8HA 1LSTA 1SW4A 2ZYKA 4YMAA 2DWIA 2OBGA 3M3KA 4KYEA 2QRYA 1NH8A 3H6WA 1SYHA 2V25A 4NTLA 3PV0E 4EXKA 1SDXA 3QAXA 4IB2A 5CMBA 4F31B 3G3IA 2I3VA 1BKAA 2D5WA 5I58A 3FV2A 4HTGA 2NUVA 3C4MA 4PFYA 1M5DA 3QUFA 2UVHA 4XKNA 4GWOA 4R72A 2QPQA 1I6BA 4QRZA 3SKPA 4WXJA 4F19A 1PB7A 3IOUA 1UTBA 4POWA 4PFTA 2XXQA 3UN6A 2ANJA 1HSJA 4ELQA 3EHSA 3IJOB 4U23A 2H99A 1EH3A 5CMKA 2P0SA 1PB9A 4POXA 4JSDA 1OVBA 2I6EA 3DELB 4NWCA 4OTEA 2G93A 3C36A 4YU0A 1B1HA 4F3SA 4ELOA 4EF1A 3KN3A 4EQ9A 5F1QA 3D4GA 1F9BA 1IXGA 3C32A 4L17A 4HS7A 1M5CA 3MW0A 2ZNSA 4KCCA 3ECRA 4GVOA 1Y20A 3ZKLA 1USYH 1N0TA 4FE8A 1NH7A 1URDA 3HPIA 1AOVA 3LSXA 1B40A 5KCJA 4R75A 3OOAA 1IIWA 5DT6A 4KHZE 2R71A 3H6VA 3OXNA 2H25A 2X7QA 2V3QA 4JWOA 5KDTB 2IEEA 3UK4A 1MM7A 2F34A 4GOTA 3F11A 3H6TA 2DXYA 3OD7A 1URSA 4G2ZA 2Y84A 1M5BA 2V93A 3RLFE 4ZECA 3IL1B 3I5OA 1RYXA 3E9XA 2I4BA 4KFQA 1IZ1A 1L5TA 1JVXA 4MFIA 2YJPA 4NF5B 4JWXA 3PPNA 3IX1A 2H9BA 4OQOA 3ZSFA 3K6XA 4ZE8A 4N6PA 3OENA 2O7UA 4NF8B 4O3BA 1VR5A 3V8XB 1ZMGA 3QUJA 3KN8A 4OVJA 5F7VA 5CBRA 3WAFA 5HBCA 1MQGA 4R2FA 3TTRA 2XXUA 1SI1A 3CFZA 5I57B 1T0KA 3S9MC 5ITOA 3HCQA 4F22A 4IY5A 1AMFA 2P1SA 1DPPA 3MVWA 1MY1A 2HAUA 3RGYA 2GHAA 2I0CA 2NOOA 2O84X 3N6UA 3HSTA 4U2RA 4RYAA 2DVZA 5FTHA 3CR9A 1FQEA 3KJ7A 3SEWA 1FTKA 4BLAA 3IOVA 4YMBA 3JV9A 3FVKA 2A5TA 1LFGA 2F7CA 2DQVA 3KFMA 3GBAA 2GRVA 5TP9B 2Y7KA 1M5FA 3HO7A 1Y3NA 3IR1A 3U1OA 1QUIA 1MH4A 1EZOA 5CI5A 3PUZE 2ZNTA 5M2VA 1DMBA 4TOZA 2FYIA 4E0WA 2O51A 4FORA 1BIYA 2AL4A 1SYIA 1MXWA 1B4ZA 3EF7A 3L6HA 4NF4B 3S4UA 1H45A 3H7MA 4YICA 3IOWA 5AE4A 3G3JA 3HHGA 1H43A 3CIJA 3OSRA 5H8FA 5DVFA 1MH3A 3Q28A 1D9VA 1LAGE 4ESXA 2Q8JA 1POTA 1N7WA 3USDA 1GTKA 2F6PA 3H6UA 3Q26A 4EQ7A 2H4IA 2ONRA 5TU0A 1IXIA 3TTMA 3FUZA 2OLBA 1H44A 3CI8A 3CSBA 4KCDA 2XX7A 4X1BA 1SW2A 3TZAA 1Y1ZA 2B3FA 4H5FA 1QW0A 4KD5A 1PBQA 1DOTA 2DOJA 2NVUB 5JEIA 3KN7A 1SD3A 5L9OA 1O7TA 2ZYOA 4I8CA 2REJA 3T96B 1A7LA 2ESNA 4I9DA 4E0XA 3S2VA 3TTNA 4IGTA 3TDJA 4F1YA 2ZMBA 4RK9A 5ICQA 1JW1A 1GR2A 3MJNA 3S9LC 2VP1A 2QMXA 4H65A 1ZTYA 2FNCA 3MP8A 4LA9A 1B7HA 1JEUA 3FIRA 3FJGA 1MQJA 3IAZA 4MBPA 3T93B 1MY2A 3DP8A 3M3FA 3U94A 4PE5B 3OEMA 3KOTA 1LFIA 3OO9A 1B3EA 4FEDA 4P0GA 3GBBA 3IOTA 4GLIA 2XXYA 3MWBA 5ELVA 4H67A 1B46A 3T9HB 2HAVA 1VSOA 3HN0A 5H8SA 2R6GE 1UQWA 3PUVE 3TELA 1GGGA 3PUYE 3G7WA 1DTZA 2ZXTA 2Q9TA 1UTBB 2HCAA 3DP6A 2KLFA 1NNFA 3PPPA 4BDRA 5L9MA 3FVGA 3N94A 5CBSA 4NEDA 2VD3A 4H5GA 5FHMA 3RPWA 4GXAA 4R9GA 4RK2A 2QS4A 1XHYA 1USYE 1WDNA 5H8QB 3TFLA 3WAEA 2XX9A 3H06B 4MLVA 1B58A 3FZVA 3VV5A 2CZLA 4LZ5A 4OENA 3BKIB 3C31A 3ODBA 2F78A 2AL5A 4FJPA 2E1SA 1XOCA 3K00A 2V3UA 4KYDA 4TQUQ 3OSQA 5KCJB 5I2KA 4ZEIA 1S50A 3GZGA 2ZNUA 2ZYNA 3I6VA 1B3FA 2VOZA 3TPAA 2ALUA 1QUJA 3TQWA 1US4A 4F18A 1O64A 5AA4A 4GL0A 1PBPA 5JK4A 2ONKE 2Z22A 3SETA 1XVXA 2PVUA 1MDP1 4JBZA 1WVJA 4F3PA 4XKPA 1LAXA 3TCGA 3QSLA 3VVEA 4KYSA 2F6GA 2GH9A 5FHOA 3K02A 1BTJA 1FQFA 1N76A 4OFOA 2PT1A 1R9QA 2M8CA 1UTHB 1MXVA 4WKMA 1Y3PA 2O69A 3K0VA 1B0HA 3TTKA 2HQ0A 5AA2A 1ELJA 3MPLA 4K3FA 3ZS6A 3VFJA 1EZPA 4EUOA 5CMMA 1JNFA 1UIVA 2OJTA 5BUUA 4GF8A 1LAHE 2Y7IA 3W9VA 2O68A 2ABHA 2RCBA 3T66A 3OO7A 4OEVA 4DXBA 1QULA 4KI0E 5H8HA 1A40A 5AA2D 3KSXA 2RC8A 3TKDA 3MVXA 1YTVA 4AB5A 5K2XA 3T9UA 4PP0A 4F2QA 4RNSA 3FGSA 4QFOA 5I59A 1H76A 4Q30B 3JYRA 3PUWE 3B6QA 1B3LA 3D4CA 5H8NB 2ZYMA 2A5TB 4YKKA 2V84A 1B4HA 1TXFA 3ZKKA 1ZLQA 1MPCA 4LZ7A 1IQ7A 4DZ1A 3PD9A 3K6VA 4PFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PFU A;  5JTY B;  5A5X B;  2UXA A;  1MPB A;  2UVI A;  3MUQ A;  1N7X A;  5BWJ A;  1Y9U A;  3TEP A;  1P1N A;  3SES A;  2DVC A;  1ZU0 A;  1N04 A;  3KBR A;  4F29 A;  5DEX A;  3U92 A;  3I3V A;  3G3F A;  2XXI A;  1OLA A;  1R9L A;  5I56 A;  3PMW A;  3O9P A;  1LB9 A;  3FXU A;  2RF1 A;  1XVY A;  4OER A;  3CVG A;  4P11 A;  2BJJ X;  1EU8 A;  1SVX B;  2I49 A;  2QSX A;  2UYF A;  1P99 A;  3PPQ A;  2F8D A;  2UYE A;  2VD2 A;  3K1N A;  1ZJL A;  2WKY A;  1LB8 A;  1A8F A;  4IO7 A;  4YB7 A;  3O28 A;  4NF6 A;  2VHA A;  4IO3 A;  4ZE9 A;  1MG1 A;  5TPA A;  2Y7W A;  4ESW A;  1S7Y A;  3KSJ A;  3PMX A;  3RN8 A;  1VFD A;  1Y4C A;  4YKI A;  1AL3 A;  4LQ2 A;  4OFJ A;  4JDF A;  2XXH A;  4MF3 A;  4BDN A;  3RT6 B;  4G8M A;  3MAM A;  3K6U A;  2HXW A;  4DXU A;  3CRB A;  4U4X A;  4YKP A;  1D4N A;  3N6T A;  1JET A;  1QKA A;  5I2N B;  3IO4 A;  4DIG A;  2E0S A;  4ZS9 A;  4EQB A;  4IGR A;  2P2A A;  3FJM A;  4R6Y A;  3DM0 A;  4Z7E A;  5CRY A;  2Y7P A;  1NL5 A;  1YPN A;  3EQ1 A;  1FQA A;  1RYO A;  3K01 A;  1Z7M E;  1B51 A;  3K6W A;  4F3B A;  1MY4 A;  4HW8 A;  1H3D A;  1UIU A;  3PMV A;  2DE2 A;  3MVZ A;  1WOD A;  3SDF A;  1HSL A;  3FVO A;  1NNP A;  1PDA A;  2XXP A;  1ZKB A;  2B3B A;  3BBR A;  3K1P A;  4OMB A;  1US5 A;  3MQ9 A;  1POY 1;  1R6Z A;  2R9J A;  3PD8 A;  4FEC A;  4C1U A;  2DXR A;  1OMP A;  4LAT A;  2F7A A;  4ISU A;  1OLC A;  1LGB C;  1IXC A;  2THI A;  2YLN A;  4G68 A;  4YZZ A;  3VE1 B;  5I2K B;  3VLV A;  3H4Z A;  4LZ8 A;  1MQD A;  2XD3 A;  2QS2 A;  2UVJ A;  1B32 A;  1QUK A;  1LFH A;  4BDL A;  3CG1 A;  1GVC A;  3RTF B;  4X9T A;  2OWT A;  3MC2 A;  3FAS A;  5DVJ A;  4H8J A;  4DCY A;  2XXW A;  3PPR A;  3E4R A;  3N5L A;  2RCA A;  2I58 A;  5KDT A;  2OK2 A;  2OCU A;  3MBP A;  4OXV A;  4QF9 A;  4EXL A;  4UA8 A;  1D3K A;  2Z23 A;  2DWH A;  4GD5 A;  3H3G A;  4PET A;  3LBS A;  1MPD A;  1AH5 A;  1B05 A;  1OVT A;  3UP9 A;  3TQL A;  2DE4 A;  3M8U A;  2HFB A;  4R73 A;  3K2D A;  2H98 A;  4NF5 A;  2PBW A;  1OQH A;  4DXC A;  3V83 A;  2NXO A;  5K2Y A;  3RQT A;  4X1D A;  4MLQ A;  3QK6 A;  4U1Z A;  1VFE A;  3TTL A;  3EPE A;  5I58 B;  1A99 A;  4YKJ A;  1CE2 A;  5I57 A;  1LAF E;  1YCJ A;  2W7Y A;  1D9Y A;  2Q2C A;  4IO5 A;  4LUB A;  5EYF A;  5DVI A;  3QYT A;  4ZZE A;  4LP2 B;  1LLS A;  2FA7 A;  2GHB A;  3A3C A;  3V89 B;  4U1O A;  1DTG A;  1FTM A;  2RC7 A;  3LUY A;  2DWJ A;  2Q88 A;  3OO8 A;  3UA8 A;  3GXA A;  3P7I A;  4KPT A;  2F35 A;  3OEL A;  3N26 A;  4ZEF A;  2O7I A;  4RPO A;  4QFK A;  1TWY A;  3Q25 A;  4GL8 A;  2QJE A;  5B70 A;  1S9T A;  4AQ4 A;  3IK6 B;  2Y7R A;  5TP9 A;  4G68 C;  5EHS A;  5L8D A;  1LBC A;  3MZ1 A;  4Q5T A;  4F39 A;  4KQP A;  3FD3 A;  4XIG Q;  3O6H A;  5IAI A;  3QXM A;  1LCF A;  4UAC A;  2DWA A;  1XC1 A;  4GRK A;  3CG3 A;  2Q2A A;  4DCX A;  1SW5 A;  3EHT A;  4NF4 A;  4KR5 A;  1J1N A;  4Q8R A;  5CMC A;  1A8E A;  2PX1 A;  3PU5 A;  4GXS B;  3IB0 A;  5KZT A;  4RJZ A;  2B65 A;  3MZ9 A;  4R2B A;  1MS7 A;  4GQO A;  3KGC A;  2XHD A;  1SBP A;  1I69 A;  3THI A;  1B0L A;  1JW5 A;  1FQD A;  4P0I A;  4U21 A;  1MDQ A;  1A54 A;  1JVY A;  4R6K A;  3QIM A;  4N07 A;  4DLD A;  4FAJ A;  1MY0 A;  4IO4 A;  3S9N C;  3RT8 A;  3TYH A;  3VVD A;  3U8Q A;  4C0R A;  4ND9 A;  4DE8 A;  4PQJ A;  4R9F A;  1MQI A;  3DP4 A;  3TCH A;  3M3L A;  1IEJ A;  1QVS A;  4ONY A;  1PEB A;  1B52 A;  1B5J A;  2DS9 A;  1NNK A;  4BDM A;  3C9H A;  1Y1M A;  4H8I A;  4HCW A;  1FTO A;  4ZDM A;  1IXH A;  4F1V A;  3Q27 A;  3IB1 A;  3IJX B;  2X7P A;  1RKM A;  4HCY A;  3T22 A;  2OWS A;  1CB6 A;  4R6H A;  1FQB A;  2Z8F A;  4RPN A;  4QFN A;  5HPQ A;  3O6G A;  4O3C A;  3U72 A;  1XT8 A;  2RC9 A;  2F36 A;  4H6D A;  4GFR A;  1OQG A;  3G3H A;  2GFE A;  4NWD A;  4Q0C A;  1ANF A;  3RNN A;  1B7Z A;  2H5Y A;  1FTJ A;  4QHQ A;  3HV1 A;  3OEK A;  4GIZ A;  1Q1K A;  1Y3Q A;  4C1T A;  1LBB A;  4EF2 A;  3C35 A;  3DLN A;  3ONM A;  3E13 X;  4Z0I A;  5HM4 B;  1FCK A;  3KZG A;  1MXY A;  3A09 A;  3G3G A;  3VVF A;  4ZEK A;  3RUM A;  4OZ9 A;  5H8F B;  1OIB A;  4G68 B;  4U22 A;  3SER A;  2DE3 A;  1B6H A;  5IKB A;  2PT2 A;  5H8Q A;  2Q89 A;  3HHF A;  1B1X A;  5AA3 A;  1B7U A;  1O63 A;  2RIN A;  3CSG A;  3K4U A;  4ZZA A;  4LON B;  3B6W A;  1Z7N E;  1ZIU A;  1VE4 A;  4FAT A;  1LCT A;  2YPN A;  1PB8 A;  4OWD A;  2XXX A;  1XS5 A;  1JEV A;  2PMS A;  3VXC A;  2I4C A;  4R74 A;  1KWH A;  3K1M A;  4RY1 A;  4X48 A;  3O29 A;  3FVN A;  4XKQ A;  3OO6 A;  4FIM A;  4BDQ A;  4ZED A;  1UTH A;  3BFU A;  4F1U A;  3KJT A;  4ZEB A;  3EHU A;  1N3X A;  1SW1 A;  3C33 A;  1II5 A;  3G3K A;  2XD2 A;  4RA1 A;  4OFL A;  4H1X A;  4RXL A;  3PGF A;  1MM6 A;  3IO6 A;  3VDF A;  4U4S A;  3UIF A;  3VLW A;  1I6A A;  3RY3 A;  3MVY A;  1B5H A;  4TLL B;  1SQY A;  4LVQ A;  1ATG A;  3BFT A;  3E3K A;  4YB6 A;  2XXV A;  3B7D A;  2IA4 A;  3FXQ A;  3IOR A;  5ITP A;  3O66 A;  4QSE A;  2X26 A;  4MH5 A;  4THI A;  4YAH X;  1N3W A;  1IIT A;  4BDO A;  2DYX A;  4F2O A;  2F7B A;  5H8N A;  3FXR A;  5AA1 A;  3UOR A;  5FHN A;  5CM6 A;  1P1Q A;  4G8N A;  5B7D A;  2LAO A;  1FQC A;  4DDD A;  3AXF A;  3KG2 A;  2Z8E A;  2I3W A;  3VLU A;  1MQH A;  1BP5 A;  1MXZ A;  2A5S A;  3PUX E;  3R7X A;  3FV1 A;  4JWY A;  3W9W A;  4FEB A;  5JTY A;  5A5X A;  3VXB A;  4ELP A;  2AIX A;  3PPO A;  3Q29 A;  5L9S A;  1EZ9 A;  4WED A;  3SEY A;  1IUD A;  3JZJ A;  2QMW A;  3R6U A;  1NNT A;  1TFD A;  5AA4 B;  3T9V A;  5ICT A;  2O1M A;  2O1L A;  5DTB A;  2F5X A;  1DPE A;  2V3T A;  1B5I A;  1Y4T A;  4WEP A;  2D3I A;  4H0W A;  3LC8 A;  3TAJ A;  4TLM B;  2I0B A;  3GLB A;  4F3G A;  3R26 A;  4AB6 A;  4XKR A;  4NE4 A;  2QS1 A;  5AA2 B;  2HEU A;  1BLF A;  2XXR A;  2UVG A;  2D21 A;  4M1V A;  1QJM A;  2Z8D A;  5EHM A;  4LQ5 A;  2REG A;  4M4G A;  1M5E A;  4G77 A;  2DP8 A;  3UGW A;  3FAT A;  2DSF A;  3TOD A;  1NMU A;  1AIV A;  3LSL A;  4NF8 A;  4IY6 A;  5H8H B;  2O6A A;  5ISU A;  2HZK A;  3T9X B;  4XXU A;  2QS3 A;  1MXU A;  1Q35 A;  4N13 A;  3TCF A;  1FTL A;  1N84 A;  2RKM A;  1NFT A;  4JXI A;  1NKX A;  5I59 B;  2F97 A;  3H03 A;  3TMG A;  1MXX A;  2XXT A;  3O2A A;  4JB7 A;  3A3U A;  3W15 C;  3RTW B;  3O6I A;  2CMO A;  4JSO A;  5I2N A;  3ILU B;  1B3G A;  1JQF A;  4OHN A;  3OMB A;  4ELR A;  3MPK A;  5LOM A;  2PYY A;  1YAE A;  5FTI A;  3LSF B;  2AYS A;  4XTC Q;  4G4P A;  3EN3 A;  1GV8 A;  3ILT B;  1I6Q A;  3C34 A;  4EDP A;  2NWJ A;  1P1O A;  3LR1 A;  1JW4 A;  5DYH A;  2XX8 A;  1HSE A;  5I84 A;  2G29 A;  4O3A A;  5DEX B;  3MZB A;  1B9J A;  1P1U A;  1DSN A;  4IO6 A;  5I56 B;  3B6T A;  3KOS A;  2VGQ A;  4OEU A;  3LSW A;  2HZL A;  1MY3 A;  1URG A;  3V5A A;  1B3H A;  3SEU A;  3SEV A;  4QFL A;  1P1W A;  1ZBM A;  3CFL A;  3U93 A;  4OET A;  1SI0 A;  3S9E A;  1PC3 A;  3TUS A;  4I62 A;  3MP1 A;  1TT1 A;  3KEI A;  1R1N A;  2QL3 A;  3L6G A;  4OYV A;  1QKB A;  1A55 A;  1B2H A;  2ONS A;  4NMY A;  4ECF A;  1MRP A;  4QSC A;  3IB2 A;  4NF6 B;  4QFP A;  2OZZ A;  1FW0 A;  4QSD A;  4YB5 A;  5TPA B;  2I48 A;  3SEX A;  5J1D A;  4IO2 A;  3CFX A;  1TFA A;  4OES A;  4I1D A;  5CC2 A;  3MP6 A;  3O97 A;  3FJ7 A;  4G8H A;  1LST A;  1SW4 A;  2ZYK A;  4YMA A;  2DWI A;  2OBG A;  3M3K A;  4KYE A;  2QRY A;  1NH8 A;  3H6W A;  1SYH A;  2V25 A;  4NTL A;  3PV0 E;  4EXK A;  1SDX A;  3QAX A;  4IB2 A;  5CMB A;  4F31 B;  3G3I A;  2I3V A;  1BKA A;  2D5W A;  5I58 A;  3FV2 A;  4HTG A;  2NUV A;  3C4M A;  4PFY A;  1M5D A;  3QUF A;  2UVH A;  4XKN A;  4GWO A;  4R72 A;  2QPQ A;  1I6B A;  4QRZ A;  3SKP A;  4WXJ A;  4F19 A;  1PB7 A;  3IOU A;  1UTB A;  4POW A;  4PFT A;  2XXQ A;  3UN6 A;  2ANJ A;  1HSJ A;  4ELQ A;  3EHS A;  3IJO B;  4U23 A;  2H99 A;  1EH3 A;  5CMK A;  2P0S A;  1PB9 A;  4POX A;  4JSD A;  1OVB A;  2I6E A;  3DEL B;  4NWC A;  4OTE A;  2G93 A;  3C36 A;  4YU0 A;  1B1H A;  4F3S A;  4ELO A;  4EF1 A;  3KN3 A;  4EQ9 A;  5F1Q A;  3D4G A;  1F9B A;  1IXG A;  3C32 A;  4L17 A;  4HS7 A;  1M5C A;  3MW0 A;  2ZNS A;  4KCC A;  3ECR A;  4GVO A;  1Y20 A;  3ZKL A;  1USY H;  1N0T A;  4FE8 A;  1NH7 A;  1URD A;  3HPI A;  1AOV A;  3LSX A;  1B40 A;  5KCJ A;  4R75 A;  3OOA A;  1IIW A;  5DT6 A;  4KHZ E;  2R71 A;  3H6V A;  3OXN A;  2H25 A;  2X7Q A;  2V3Q A;  4JWO A;  5KDT B;  2IEE A;  3UK4 A;  1MM7 A;  2F34 A;  4GOT A;  3F11 A;  3H6T A;  2DXY A;  3OD7 A;  1URS A;  4G2Z A;  2Y84 A;  1M5B A;  2V93 A;  3RLF E;  4ZEC A;  3IL1 B;  3I5O A;  1RYX A;  3E9X A;  2I4B A;  4KFQ A;  1IZ1 A;  1L5T A;  1JVX A;  4MFI A;  2YJP A;  4NF5 B;  4JWX A;  3PPN A;  3IX1 A;  2H9B A;  4OQO A;  3ZSF A;  3K6X A;  4ZE8 A;  4N6P A;  3OEN A;  2O7U A;  4NF8 B;  4O3B A;  1VR5 A;  3V8X B;  1ZMG A;  3QUJ A;  3KN8 A;  4OVJ A;  5F7V A;  5CBR A;  3WAF A;  5HBC A;  1MQG A;  4R2F A;  3TTR A;  2XXU A;  1SI1 A;  3CFZ A;  5I57 B;  1T0K A;  3S9M C;  5ITO A;  3HCQ A;  4F22 A;  4IY5 A;  1AMF A;  2P1S A;  1DPP A;  3MVW A;  1MY1 A;  2HAU A;  3RGY A;  2GHA A;  2I0C A;  2NOO A;  2O84 X;  3N6U A;  3HST A;  4U2R A;  4RYA A;  2DVZ A;  5FTH A;  3CR9 A;  1FQE A;  3KJ7 A;  3SEW A;  1FTK A;  4BLA A;  3IOV A;  4YMB A;  3JV9 A;  3FVK A;  2A5T A;  1LFG A;  2F7C A;  2DQV A;  3KFM A;  3GBA A;  2GRV A;  5TP9 B;  2Y7K A;  1M5F A;  3HO7 A;  1Y3N A;  3IR1 A;  3U1O A;  1QUI A;  1MH4 A;  1EZO A;  5CI5 A;  3PUZ E;  2ZNT A;  5M2V A;  1DMB A;  4TOZ A;  2FYI A;  4E0W A;  2O51 A;  4FOR A;  1BIY A;  2AL4 A;  1SYI A;  1MXW A;  1B4Z A;  3EF7 A;  3L6H A;  4NF4 B;  3S4U A;  1H45 A;  3H7M A;  4YIC A;  3IOW A;  5AE4 A;  3G3J A;  3HHG A;  1H43 A;  3CIJ A;  3OSR A;  5H8F A;  5DVF A;  1MH3 A;  3Q28 A;  1D9V A;  1LAG E;  4ESX A;  2Q8J A;  1POT A;  1N7W A;  3USD A;  1GTK A;  2F6P A;  3H6U A;  3Q26 A;  4EQ7 A;  2H4I A;  2ONR A;  5TU0 A;  1IXI A;  3TTM A;  3FUZ A;  2OLB A;  1H44 A;  3CI8 A;  3CSB A;  4KCD A;  2XX7 A;  4X1B A;  1SW2 A;  3TZA A;  1Y1Z A;  2B3F A;  4H5F A;  1QW0 A;  4KD5 A;  1PBQ A;  1DOT A;  2DOJ A;  2NVU B;  5JEI A;  3KN7 A;  1SD3 A;  5L9O A;  1O7T A;  2ZYO A;  4I8C A;  2REJ A;  3T96 B;  1A7L A;  2ESN A;  4I9D A;  4E0X A;  3S2V A;  3TTN A;  4IGT A;  3TDJ A;  4F1Y A;  2ZMB A;  4RK9 A;  5ICQ A;  1JW1 A;  1GR2 A;  3MJN A;  3S9L C;  2VP1 A;  2QMX A;  4H65 A;  1ZTY A;  2FNC A;  3MP8 A;  4LA9 A;  1B7H A;  1JEU A;  3FIR A;  3FJG A;  1MQJ A;  3IAZ A;  4MBP A;  3T93 B;  1MY2 A;  3DP8 A;  3M3F A;  3U94 A;  4PE5 B;  3OEM A;  3KOT A;  1LFI A;  3OO9 A;  1B3E A;  4FED A;  4P0G A;  3GBB A;  3IOT A;  4GLI A;  2XXY A;  3MWB A;  5ELV A;  4H67 A;  1B46 A;  3T9H B;  2HAV A;  1VSO A;  3HN0 A;  5H8S A;  2R6G E;  1UQW A;  3PUV E;  3TEL A;  1GGG A;  3PUY E;  3G7W A;  1DTZ A;  2ZXT A;  2Q9T A;  1UTB B;  2HCA A;  3DP6 A;  2KLF A;  1NNF A;  3PPP A;  4BDR A;  5L9M A;  3FVG A;  3N94 A;  5CBS A;  4NED A;  2VD3 A;  4H5G A;  5FHM A;  3RPW A;  4GXA A;  4R9G A;  4RK2 A;  2QS4 A;  1XHY A;  1USY E;  1WDN A;  5H8Q B;  3TFL A;  3WAE A;  2XX9 A;  3H06 B;  4MLV A;  1B58 A;  3FZV A;  3VV5 A;  2CZL A;  4LZ5 A;  4OEN A;  3BKI B;  3C31 A;  3ODB A;  2F78 A;  2AL5 A;  4FJP A;  2E1S A;  1XOC A;  3K00 A;  2V3U A;  4KYD A;  4TQU Q;  3OSQ A;  5KCJ B;  5I2K A;  4ZEI A;  1S50 A;  3GZG A;  2ZNU A;  2ZYN A;  3I6V A;  1B3F A;  2VOZ A;  3TPA A;  2ALU A;  1QUJ A;  3TQW A;  1US4 A;  4F18 A;  1O64 A;  5AA4 A;  4GL0 A;  1PBP A;  5JK4 A;  2ONK E;  2Z22 A;  3SET A;  1XVX A;  2PVU A;  1MDP 1;  4JBZ A;  1WVJ A;  4F3P A;  4XKP A;  1LAX A;  3TCG A;  3QSL A;  3VVE A;  4KYS A;  2F6G A;  2GH9 A;  5FHO A;  3K02 A;  1BTJ A;  1FQF A;  1N76 A;  4OFO A;  2PT1 A;  1R9Q A;  2M8C A;  1UTH B;  1MXV A;  4WKM A;  1Y3P A;  2O69 A;  3K0V A;  1B0H A;  3TTK A;  2HQ0 A;  5AA2 A;  1ELJ A;  3MPL A;  4K3F A;  3ZS6 A;  3VFJ A;  1EZP A;  4EUO A;  5CMM A;  1JNF A;  1UIV A;  2OJT A;  5BUU A;  4GF8 A;  1LAH E;  2Y7I A;  3W9V A;  2O68 A;  2ABH A;  2RCB A;  3T66 A;  3OO7 A;  4OEV A;  4DXB A;  1QUL A;  4KI0 E;  5H8H A;  1A40 A;  5AA2 D;  3KSX A;  2RC8 A;  3TKD A;  3MVX A;  1YTV A;  4AB5 A;  5K2X A;  3T9U A;  4PP0 A;  4F2Q A;  4RNS A;  3FGS A;  4QFO A;  5I59 A;  1H76 A;  4Q30 B;  3JYR A;  3PUW E;  3B6Q A;  1B3L A;  3D4C A;  5H8N B;  2ZYM A;  2A5T B;  4YKK A;  2V84 A;  1B4H A;  1TXF A;  3ZKK A;  1ZLQ A;  1MPC A;  4LZ7 A;  1IQ7 A;  4DZ1 A;  3PD9 A;  3K6V A;  4PFW A; 
#chains in the Genus database with same CATH topology
 4PFU A;  5JTY B;  5A5X B;  1SPI A;  2UXA A;  1MPB A;  2UVI A;  4N81 A;  1EYJ A;  4I40 A;  3MUQ A;  1N7X A;  2OX3 A;  5BWJ A;  1Y9U A;  3TEP A;  1P1N A;  4NX1 A;  4JVI A;  3SES A;  2DVC A;  2PFY A;  1N04 A;  1ZU0 A;  3KBR A;  4N6D A;  4F29 A;  5DEX A;  3U92 A;  1FBF A;  1RDY A;  3I3V A;  3G3F A;  2XXI A;  1OLA A;  1R9L A;  4N6K A;  5I56 A;  3PMW A;  2FIE A;  3O9P A;  1LB9 A;  3FXU A;  2RF1 A;  1XVY A;  4OER A;  3CVG A;  2QFL A;  4P11 A;  3B50 A;  2BJJ X;  1EU8 A;  1SVX B;  2I49 A;  2QSX A;  2UYF A;  1P99 A;  3PPQ A;  2F8D A;  4I3E A;  4GWY A;  2UYE A;  1LBX A;  2VD2 A;  3K1N A;  1ZJL A;  2WKY A;  1LB8 A;  1A8F A;  3KBZ A;  4IO7 A;  4YB7 A;  3PTY A;  3O28 A;  4NF6 A;  2VHA A;  4IO3 A;  4ZE9 A;  1MG1 A;  5DW8 A;  5TPA A;  2Y7W A;  4PC9 A;  4ESW A;  1S7Y A;  3KSJ A;  3PMX A;  3RN8 A;  1VFD A;  1Y4C A;  4YKI A;  1AL3 A;  1NV1 A;  4LQ2 A;  4OFJ A;  5EQ9 A;  4MEV A;  4JDF A;  2XXH A;  1JP4 A;  4MF3 A;  4BDN A;  3RT6 B;  2FVZ A;  4MHF A;  4G8M A;  4N17 A;  3MAM A;  3K6U A;  2HXW A;  4DXU A;  3CRB A;  4U4X A;  4X8R A;  4YKP A;  1D4N A;  3N6T A;  5IGA A;  1JET A;  1QKA A;  4GBV A;  5I2N B;  2XWI A;  3IO4 A;  4DIG A;  2E0S A;  4ZS9 A;  4EQB A;  4NN3 A;  4IGR A;  2P2A A;  3FJM A;  4R6Y A;  3DM0 A;  1NUY A;  4Z7E A;  2B4M A;  5CRY A;  2Y7P A;  4P47 A;  1FPJ A;  1NL5 A;  3D1R A;  1YPN A;  3EQ1 A;  1FQA A;  2BJI A;  1RYO A;  3K01 A;  1Z7M E;  1B51 A;  3K6W A;  1FJ6 A;  4F3B A;  1MY4 A;  4HW8 A;  1H3D A;  2XWO A;  1UIU A;  3PMV A;  2DE2 A;  3MVZ A;  1WOD A;  3SDF A;  1HSL A;  4GX4 A;  3FVO A;  1NNP A;  2B4L A;  1PDA A;  2XXP A;  5ET5 A;  1ZKB A;  2B3B A;  1IMF A;  3BBR A;  3K1P A;  4OMB A;  1US5 A;  5F24 A;  1K9Z A;  3MQ9 A;  1POY 1;  1R6Z A;  2R9J A;  3PD8 A;  4FEC A;  4C1U A;  2DXR A;  1OMP A;  4LAT A;  2F7A A;  4ISU A;  1OLC A;  1LGB C;  1IXC A;  2THI A;  2YLN A;  4G68 A;  4PGP A;  4YZZ A;  3VE1 B;  3ISP A;  5I2K B;  3VLV A;  3H4Z A;  4LZ8 A;  1MQD A;  2XD3 A;  2QS2 A;  2UVJ A;  1B32 A;  1QUK A;  1LFH A;  4BDL A;  4N8Y A;  4JVD A;  3CG1 A;  1GVC A;  4P1E A;  3RTF B;  4X9T A;  3QMF A;  2OWT A;  3MC2 A;  2WYK A;  3FAS A;  5DVJ A;  4H8J A;  4DCY A;  2XXW A;  3PPR A;  2PCR A;  3E4R A;  3N5L A;  2RCA A;  2I58 A;  5KDT A;  2OK2 A;  1FPE A;  2OCU A;  3MBP A;  4OXV A;  4QF9 A;  4EXL A;  4UA8 A;  1D3K A;  2Z23 A;  4MAG A;  2DWH A;  4GD5 A;  3H3G A;  4PET A;  3LBS A;  1G0H A;  1MPD A;  1AH5 A;  1B05 A;  1OVT A;  3UP9 A;  4GWX A;  3TQL A;  1G0I A;  2DE4 A;  2GQ1 A;  3M8U A;  2HFB A;  4R73 A;  4H45 A;  3K2D A;  2H98 A;  4NF5 A;  2PBW A;  1OQH A;  2QVR A;  4DXC A;  4H46 A;  3V83 A;  2NXO A;  5K2Y A;  3RQT A;  4X1D A;  4MLQ A;  3QK6 A;  4U1Z A;  1VFE A;  3TTL A;  3EPE A;  5I58 B;  1A99 A;  2HXR A;  4YKJ A;  5EQ7 A;  1CE2 A;  5I57 A;  1FBC A;  1LAF E;  1YCJ A;  2W7Y A;  1D9Y A;  2L5V A;  2Q2C A;  4IO5 A;  4LUB A;  5EYF A;  5DVI A;  3QYT A;  4ZZE A;  4PFB A;  4LP2 B;  1LLS A;  2FA7 A;  2GHB A;  3A3C A;  3V89 B;  4U1O A;  4P1L A;  4X04 A;  1DTG A;  1FTM A;  4GWS A;  2RC7 A;  3LUY A;  2DWJ A;  2Q88 A;  3OO8 A;  3UA8 A;  3GXA A;  1FPF A;  3P7I A;  4KPT A;  2F35 A;  3OEL A;  3N26 A;  4LN5 A;  1FRP A;  4ZEF A;  2O7I A;  4RPO A;  4QFK A;  1TWY A;  3Q25 A;  5ESY A;  4GL8 A;  2QJE A;  5B70 A;  2KR0 A;  1S9T A;  4AQ4 A;  3IK6 B;  2Y7R A;  1KA1 A;  5TP9 A;  4G68 C;  5EHS A;  5L8D A;  1LBC A;  3MZ1 A;  4Q5T A;  4F39 A;  4JVC A;  4KQP A;  4DI4 B;  3FD3 A;  4XIG Q;  3O6H A;  5IAI A;  3QXM A;  2WBD A;  1LCF A;  4UAC A;  2DWA A;  1NV4 A;  4AS4 A;  1XC1 A;  4GRK A;  3CG3 A;  3RPL A;  2Q2A A;  4DCX A;  3IFC A;  1SW5 A;  3EHT A;  4NF4 A;  3BIH A;  4KR5 A;  1J1N A;  4OVP A;  3FXB A;  4Q8R A;  5CMC A;  1A8E A;  2PX1 A;  3PU5 A;  4GXS B;  3IB0 A;  5KZT A;  4RJZ A;  5T3J A;  2B65 A;  3MZ9 A;  4R2B A;  1MS7 A;  2ZZX A;  4PGN A;  4GWU A;  1D9Q A;  4GQO A;  1FPD A;  3KGC A;  2XHD A;  1SBP A;  1I69 A;  3THI A;  2WYP A;  1B0L A;  1JW5 A;  4MNI A;  1FQD A;  4P0I A;  4PDH A;  4U21 A;  1MDQ A;  1A54 A;  1JVY A;  4R6K A;  3QIM A;  4N07 A;  4DLD A;  4FAJ A;  1MY0 A;  4IO4 A;  3S9N C;  3RT8 A;  3TYH A;  4HXV A;  3VVD A;  3U8Q A;  4OVS A;  1NV2 A;  4C0R A;  4ND9 A;  1FPK A;  4DE8 A;  4PQJ A;  4R9F A;  1MQI A;  3DP4 A;  3TCH A;  3M3L A;  1IEJ A;  1QVS A;  4ONY A;  2JJK A;  1PEB A;  1B52 A;  1B5J A;  2DS9 A;  1NNK A;  3SZP A;  4BDM A;  3C9H A;  4OVR A;  1Y1M A;  2WX9 A;  4H8I A;  4HCW A;  4N15 A;  1FTO A;  4ZDM A;  1DK4 A;  1IXH A;  4F1V A;  3Q27 A;  3IB1 A;  2FHY A;  3IJX B;  2X7P A;  1RKM A;  4HCY A;  3T22 A;  3MST A;  2OWS A;  1CB6 A;  4R6H A;  1FQB A;  2Z8F A;  4RPN A;  4QFN A;  5HPQ A;  3O6G A;  1DBZ A;  4O3C A;  3U72 A;  2FIX A;  1XT8 A;  2RC9 A;  2F36 A;  4P9K A;  4H6D A;  4GFR A;  1OQG A;  3G3H A;  2GFE A;  4NWD A;  4Q0C A;  2Q8M A;  1ANF A;  5FBP A;  3RNN A;  1QGX A;  1B7Z A;  2H5Y A;  5IZ1 A;  1FTJ A;  1IME A;  4QHQ A;  3HV1 A;  3OEK A;  4GIZ A;  1Q1K A;  1K9Y A;  1Y3Q A;  4C1T A;  1LBB A;  4EF2 A;  3C35 A;  3DLN A;  4NF0 A;  3ONM A;  3E13 X;  4Z0I A;  1FBH A;  5HM4 B;  1FCK A;  2KQZ A;  3KZG A;  1MXY A;  3A09 A;  3G3G A;  3VVF A;  4ZEK A;  3RUM A;  4OZ9 A;  2R8T A;  5H8F B;  1OIB A;  4G68 B;  4U22 A;  4PFI A;  2CZK A;  3SER A;  2DE3 A;  4KXP A;  1B6H A;  5IKB A;  2PT2 A;  5H8Q A;  2WEF A;  2Q89 A;  3HHF A;  1B1X A;  5AA3 A;  4NQ8 A;  1B7U A;  1O63 A;  2RIN A;  2VT5 A;  3CSG A;  3K4U A;  4ZZA A;  4LON B;  3E79 A;  3B6W A;  2V4C A;  4PAF A;  1Z7N E;  1EYI A;  1ZIU A;  1VE4 A;  3NOH A;  4FAT A;  1LCT A;  2YPN A;  1PB8 A;  4OWD A;  2XXX A;  1XS5 A;  3KC1 A;  1JEV A;  2PMS A;  3VXC A;  2I4C A;  4R74 A;  1KWH A;  3K1M A;  1NV7 A;  4RY1 A;  4X48 A;  3O29 A;  4FBP A;  3FVN A;  4XKQ A;  3OO6 A;  4FIM A;  4BDQ A;  4ZED A;  1UTH A;  3BFU A;  4F1U A;  3KJT A;  4NHB A;  4ZEB A;  3EHU A;  1N3X A;  1SW1 A;  3C33 A;  1II5 A;  3G3K A;  2XD2 A;  4RA1 A;  4OFL A;  4H1X A;  4RXL A;  3PGF A;  1MM6 A;  3T0J A;  3IO6 A;  3VDF A;  4U4S A;  3UIF A;  4GWW A;  3VLW A;  1I6A A;  3RY3 A;  3HFU A;  3MVY A;  1B5H A;  4TLL B;  1SQY A;  2CEY A;  4LVQ A;  1ATG A;  3BFT A;  3E3K A;  2ZZV A;  4YB6 A;  4NAP A;  2XXV A;  3B7D A;  2IA4 A;  3FXQ A;  3IOR A;  5EYH A;  5ITP A;  3O66 A;  4QSE A;  2X26 A;  4MH5 A;  4HE1 A;  1IMC A;  2DDK A;  4THI A;  4YAH X;  1N3W A;  1IIT A;  4BDO A;  2DYX A;  4F2O A;  2F7B A;  2F3D A;  5H8N A;  3FXR A;  4PBQ A;  5AA1 A;  3UOR A;  5FHN A;  5CM6 A;  4MX6 A;  1P1Q A;  4G8N A;  5B7D A;  2LAO A;  1FQC A;  4DDD A;  3AXF A;  3KG2 A;  2Z8E A;  2I3W A;  3VLU A;  1MQH A;  1BP5 A;  1MXZ A;  2A5S A;  3PUX E;  3R7X A;  3FV1 A;  4JWY A;  3W9W A;  1FPI A;  4FEB A;  5JTY A;  5A5X A;  3VXB A;  2Q74 A;  2XWK A;  4ELP A;  2AIX A;  3PPO A;  3Q29 A;  5L9S A;  1EZ9 A;  4WED A;  3SEY A;  1IUD A;  3JZJ A;  2QMW A;  3R6U A;  1NNT A;  1TFD A;  5AA4 B;  3T9V A;  5ICT A;  2O1M A;  4N91 A;  2O1L A;  5DTB A;  2F5X A;  1DPE A;  1EYK A;  2V3T A;  1B5I A;  1Y4T A;  4WEP A;  1BK4 A;  2D3I A;  4H0W A;  3LC8 A;  3TAJ A;  4TLM B;  2I0B A;  3GLB A;  4F3G A;  2XWV A;  1YXI A;  3R26 A;  4AB6 A;  2WBB A;  4XKR A;  4NE4 A;  2QS1 A;  5AA2 B;  2HEU A;  1BLF A;  2XXR A;  2UVG A;  1NUZ A;  2D21 A;  1Q9D A;  1NV6 A;  4M1V A;  1QJM A;  2Z8D A;  3IFA A;  5EHM A;  4LQ5 A;  3FBP A;  2REG A;  4M4G A;  1M5E A;  1KA0 A;  4G77 A;  4OAN A;  2DP8 A;  2PFZ A;  3UGW A;  3FAT A;  2DSF A;  3TOD A;  1INP A;  1NMU A;  4MIJ A;  1AIV A;  3LSL A;  4NF8 A;  4IY6 A;  5H8H B;  2O6A A;  5ISU A;  2HZK A;  3T9X B;  1RDX A;  4XXU A;  5IM2 A;  2QS3 A;  1MXU A;  1Q35 A;  4N13 A;  3TCF A;  1FTL A;  1N84 A;  2RKM A;  3E78 A;  1NFT A;  4JXI A;  1NKX A;  5I59 B;  2F97 A;  4HE2 A;  3H03 A;  3TMG A;  3B8B A;  1MXX A;  2XXT A;  5IZ3 A;  1YZ0 A;  3O2A A;  4JB7 A;  4O7M A;  3A3U A;  3W15 C;  3RTW B;  3O6I A;  2CMO A;  4JSO A;  5I2N A;  4NGU A;  3ILU B;  1B3G A;  1JQF A;  4OHN A;  3OMB A;  4ELR A;  3MPK A;  5LOM A;  2PYY A;  1YAE A;  2P3N A;  5FTI A;  3LSF B;  2AYS A;  1DCU A;  4XTC Q;  4G4P A;  3EN3 A;  1GV8 A;  3ILT B;  1I6Q A;  3C34 A;  4EDP A;  2NWJ A;  1P1O A;  4PCD A;  3LR1 A;  1JW4 A;  5DYH A;  2XX8 A;  1HSE A;  5I84 A;  2G29 A;  4O3A A;  5DEX B;  4PDD A;  3MZB A;  1B9J A;  1P1U A;  1DSN A;  4IO6 A;  5I56 B;  3B6T A;  2ZZW A;  3A29 A;  3KOS A;  2VGQ A;  4OEU A;  3LSW A;  2HZL A;  2P3V A;  1MY3 A;  1URG A;  3V5A A;  1B3H A;  3SEU A;  3SEV A;  4UAB A;  4QFL A;  1P1W A;  4PF8 A;  1ZBM A;  3CFL A;  4N8G A;  1NV3 A;  3U93 A;  4OET A;  1SI0 A;  3S9E A;  1PC3 A;  3TUS A;  4I62 A;  3MP1 A;  1TT1 A;  3KEI A;  1R1N A;  5IZZ A;  2QL3 A;  5LDZ A;  4AS5 A;  3L6G A;  4OYV A;  1QKB A;  1A55 A;  1B2H A;  2ONS A;  4NMY A;  4ECF A;  1FPG A;  1MRP A;  4QSC A;  3IB2 A;  4NF6 B;  4QFP A;  4GBW A;  2OZZ A;  1FW0 A;  4QSD A;  4YB5 A;  5TPA B;  2I48 A;  3SEX A;  5J1D A;  4IO2 A;  3CFX A;  1TFA A;  4OES A;  4I1D A;  5CC2 A;  4QXD A;  3MP6 A;  3O97 A;  3FJ7 A;  4G8H A;  1LST A;  1SW4 A;  2ZYK A;  4OVT A;  4YMA A;  2DWI A;  2OBG A;  3M3K A;  4KYE A;  2QRY A;  1NH8 A;  3H6W A;  1SYH A;  2V25 A;  1IMB A;  4NTL A;  3PV0 E;  3EKI A;  1FBE A;  4EXK A;  1SDX A;  3QAX A;  4G61 A;  4IB2 A;  5CMB A;  2XA5 A;  4F31 B;  1LBW A;  3G3I A;  2I3V A;  4GWZ A;  1BKA A;  5J16 A;  5EQ8 A;  2D5W A;  4XEQ A;  5I58 A;  3FV2 A;  4HTG A;  2NUV A;  2XXK A;  3C4M A;  4PFY A;  1M5D A;  3QUF A;  4MNC A;  2UVH A;  4XKN A;  4GWO A;  4R72 A;  2QPQ A;  1I6B A;  4QRZ A;  3SKP A;  4MJO A;  4WXJ A;  4F19 A;  1PB7 A;  3IOU A;  1UTB A;  4POW A;  5ET6 A;  4PFT A;  2XXQ A;  3UN6 A;  2ANJ A;  1HSJ A;  4ELQ A;  3EHS A;  3IJO B;  4U23 A;  2H99 A;  1EH3 A;  5CMK A;  2P0S A;  1PB9 A;  4POX A;  4JSD A;  1OVB A;  2I6E A;  3DEL B;  4NWC A;  4OTE A;  2G93 A;  3C36 A;  2CEX A;  4YU0 A;  1B1H A;  4F3S A;  4ELO A;  4EF1 A;  3KN3 A;  4EQ9 A;  5F1Q A;  3D4G A;  1F9B A;  1IXG A;  3C32 A;  4L17 A;  4HS7 A;  1NUX A;  2QVV A;  1M5C A;  1FSA A;  3MW0 A;  2ZNS A;  4KCC A;  1LBZ A;  3ECR A;  4GVO A;  1Y20 A;  3ZKL A;  1N0T A;  1USY H;  4FE8 A;  1NH7 A;  1URD A;  4MNP A;  4PAI A;  3HPI A;  1AOV A;  4PAK A;  3LSX A;  1B40 A;  5I7I A;  5KCJ A;  4R75 A;  3OOA A;  1IIW A;  5DT6 A;  4KHZ E;  2R71 A;  3H6V A;  3OXN A;  2H25 A;  2X7Q A;  2V3Q A;  4JWO A;  5KDT B;  2IEE A;  3RYD A;  3UK4 A;  1MM7 A;  2F34 A;  4GOT A;  3F11 A;  5ET8 A;  3H6T A;  2DXY A;  3OD7 A;  1URS A;  1FTA A;  4G2Z A;  2Y84 A;  1M5B A;  2V93 A;  3RLF E;  4ZEC A;  3IL1 B;  3I5O A;  1RYX A;  3E9X A;  2I4B A;  2Y5L A;  4KFQ A;  3T1B A;  1IZ1 A;  1L5T A;  1JVX A;  4MFI A;  2YJP A;  4NF5 B;  4JWX A;  3PPN A;  3IX1 A;  2H9B A;  4OQO A;  3ZSF A;  4XF5 A;  4PF6 A;  3K6X A;  4ZE8 A;  4N6P A;  3OEN A;  2O7U A;  4NF8 B;  4O3B A;  1VR5 A;  3V8X B;  1ZMG A;  3QUJ A;  3KN8 A;  4OVJ A;  5F7V A;  4OA4 A;  5CBR A;  3WAF A;  4XFE A;  5HBC A;  1MQG A;  4R2F A;  3TTR A;  2XXU A;  1SI1 A;  3CFZ A;  5I57 B;  1FJ9 A;  1T0K A;  4GX3 A;  3S9M C;  4P8B A;  4PE3 A;  5ITO A;  3HCQ A;  2VPO A;  4F22 A;  1CNQ A;  4IY5 A;  1AMF A;  5IZ3 B;  2P1S A;  1DPP A;  3MVW A;  1MY1 A;  1NUW A;  2HAU A;  3RGY A;  2GHA A;  2I0C A;  2NOO A;  2O84 X;  3N6U A;  3HST A;  4U2R A;  3ROJ A;  4RYA A;  2DVZ A;  4O8M A;  5FTH A;  3MYU A;  3CR9 A;  1FQE A;  3KJ7 A;  3SEW A;  1FTK A;  4BLA A;  3IOV A;  4GX6 A;  4YMB A;  3JV9 A;  3FVK A;  2A5T A;  3KC0 A;  1LFG A;  2F7C A;  2DQV A;  1NI9 A;  3KFM A;  3GBA A;  2GRV A;  5TP9 B;  2FBP A;  2Y7K A;  1NV0 A;  1M5F A;  3HO7 A;  4OVQ A;  1Y3N A;  2MKZ A;  3LUZ A;  3IR1 A;  3U1O A;  1QUI A;  1MH4 A;  1EZO A;  5CI5 A;  3PUZ E;  2ZNT A;  5M2V A;  1DMB A;  4TOZ A;  2FYI A;  4E0W A;  2Y5K A;  2O51 A;  2OWZ A;  3RPL B;  4FOR A;  1BIY A;  2AL4 A;  1SYI A;  1MXW A;  2QVU A;  1B4Z A;  3EF7 A;  3L6H A;  4NF4 B;  3S4U A;  4HE0 A;  1H45 A;  3H7M A;  4YIC A;  3IOW A;  5AE4 A;  1FBP A;  3G3J A;  3HHG A;  1H43 A;  3CIJ A;  3OSR A;  1FBG A;  5H8F A;  5DVF A;  1MH3 A;  1YYZ A;  3Q28 A;  1D9V A;  1LAG E;  4ESX A;  2Q8J A;  1AWB A;  1POT A;  1N7W A;  1IMA A;  3USD A;  1GTK A;  2F6P A;  3H6U A;  3Q26 A;  4EQ7 A;  2H4I A;  2ONR A;  5TU0 A;  1IXI A;  3TTM A;  3FUZ A;  2OLB A;  1H44 A;  3CI8 A;  3CSB A;  4KCD A;  1IMD A;  2XX7 A;  4X1B A;  1SW2 A;  3TZA A;  1Y1Z A;  2B3F A;  4H5F A;  1QW0 A;  4KD5 A;  1PBQ A;  1DOT A;  2DOJ A;  2NVU B;  5JEI A;  3KN7 A;  1SD3 A;  5L9O A;  1O7T A;  2ZYO A;  4I8C A;  2REJ A;  3T96 B;  4P56 A;  1A7L A;  1FPL A;  2ESN A;  4I9D A;  4E0X A;  3S2V A;  3TTN A;  4IGT A;  3TDJ A;  4F1Y A;  2ZMB A;  4RK9 A;  5ICQ A;  1JW1 A;  1GR2 A;  4N4U A;  3MJN A;  3S9L C;  3U65 A;  5EYG A;  2VP1 A;  2QMX A;  4H65 A;  1ZTY A;  2FNC A;  3MP8 A;  4LA9 A;  1B7H A;  1JEU A;  3FIR A;  3FJG A;  1MQJ A;  3IAZ A;  4MBP A;  4PBH A;  4PFR A;  3T93 B;  1MY2 A;  4P3L A;  3DP8 A;  3M3F A;  3U94 A;  1FPB A;  1LBY A;  4PE5 B;  3OEM A;  1RDZ A;  3KOT A;  1LFI A;  1LBV A;  4O7I A;  3OO9 A;  1B3E A;  4FED A;  4P0G A;  3GBB A;  3IOT A;  4GLI A;  2XXY A;  3MWB A;  5ELV A;  4H67 A;  1B46 A;  3T9H B;  2HAV A;  1VSO A;  3HN0 A;  5H8S A;  5A5L A;  2R6G E;  1UQW A;  3PUV E;  3TEL A;  1GGG A;  3PUY E;  3G7W A;  1DTZ A;  2ZXT A;  1KZ8 A;  2Q9T A;  1UTB B;  3CHG A;  2CZI A;  2HCA A;  3DP6 A;  2KLF A;  1NNF A;  3PPP A;  4BDR A;  5L9M A;  3FVG A;  3N94 A;  5CBS A;  4NED A;  2VD3 A;  4H5G A;  5FHM A;  3GYY A;  3RPW A;  4GXA A;  1LEV A;  5I3S A;  4R9G A;  4RK2 A;  2VPN A;  2CZH A;  2QS4 A;  1XHY A;  1VDW A;  2HPG A;  1USY E;  1WDN A;  5H8Q B;  3TFL A;  3WAE A;  2XX9 A;  3H06 B;  4MLV A;  1B58 A;  2F3B A;  3FZV A;  3VV5 A;  2CZL A;  4LZ5 A;  4OEN A;  3BKI B;  3C31 A;  3ODB A;  2F78 A;  2AL5 A;  4FJP A;  2E1S A;  1XOC A;  3K00 A;  2V3U A;  4QBA A;  1FBD A;  4KYD A;  4TQU Q;  3OSQ A;  5KCJ B;  5I2K A;  4ZEI A;  1S50 A;  3GZG A;  2ZNU A;  2ZYN A;  3I6V A;  1B3F A;  2VOZ A;  3TPA A;  2ALU A;  1QUJ A;  3TQW A;  1US4 A;  4F18 A;  1O64 A;  5AA4 A;  4GL0 A;  1PBP A;  5JK4 A;  2ONK E;  2Z22 A;  3SET A;  1XVX A;  2PVU A;  1MDP 1;  4JBZ A;  3BIG A;  1WVJ A;  4F3P A;  4XKP A;  1LAX A;  4DI3 D;  1NV5 A;  3TCG A;  3QSL A;  3VVE A;  4KYS A;  2F6G A;  2GH9 A;  5FHO A;  3K02 A;  1BTJ A;  1FQF A;  1N76 A;  4I3Y A;  5EQA A;  4OFO A;  2PT1 A;  1R9Q A;  2M8C A;  1UTH B;  1XI6 A;  1MXV A;  4WKM A;  1Y3P A;  2O69 A;  3K0V A;  1B0H A;  3TTK A;  2HQ0 A;  5AA2 A;  1ELJ A;  4IR8 A;  3MPL A;  4K3F A;  3ZS6 A;  3VFJ A;  1EZP A;  4EUO A;  4PTK A;  5CMM A;  1JNF A;  1UIV A;  2OJT A;  5BUU A;  4GF8 A;  1LAH E;  2Y7I A;  3W9V A;  2O68 A;  2ABH A;  2RCB A;  2HHM A;  3T66 A;  4O94 A;  3OO7 A;  4OEV A;  4DXB A;  1QUL A;  4KI0 E;  5H8H A;  1A40 A;  5AA2 D;  3KSX A;  2RC8 A;  3TKD A;  3MVX A;  1YTV A;  4AB5 A;  5K2X A;  5LTC A;  3T9U A;  5ET7 A;  4PP0 A;  4F2Q A;  4RNS A;  3FGS A;  4QFO A;  5I59 A;  1H76 A;  4Q30 B;  3JYR A;  3PUW E;  3B6Q A;  1B3L A;  3D4C A;  3LV0 A;  5H8N B;  2ZYM A;  2A5T B;  4YKK A;  2V84 A;  1B4H A;  1TXF A;  3ZKK A;  1ZLQ A;  1MPC A;  4LZ7 A;  1IQ7 A;  4NG7 A;  4MCO A;  4DZ1 A;  3PD9 A;  5I5P A;  3K6V A;  4PFW A;  4MMP A; 
#chains in the Genus database with same CATH homology
 4PFU A;  5JTY B;  5A5X B;  2UXA A;  1MPB A;  2UVI A;  3MUQ A;  1N7X A;  5BWJ A;  1Y9U A;  3TEP A;  1P1N A;  3SES A;  2DVC A;  1ZU0 A;  1N04 A;  3KBR A;  4F29 A;  5DEX A;  3U92 A;  3I3V A;  3G3F A;  2XXI A;  1OLA A;  1R9L A;  5I56 A;  3PMW A;  3O9P A;  1LB9 A;  3FXU A;  2RF1 A;  1XVY A;  4OER A;  3CVG A;  4P11 A;  2BJJ X;  1EU8 A;  1SVX B;  2I49 A;  2QSX A;  2UYF A;  1P99 A;  3PPQ A;  2F8D A;  2UYE A;  2VD2 A;  3K1N A;  1ZJL A;  2WKY A;  1LB8 A;  1A8F A;  4IO7 A;  4YB7 A;  3O28 A;  4NF6 A;  2VHA A;  4IO3 A;  4ZE9 A;  1MG1 A;  5TPA A;  2Y7W A;  4ESW A;  1S7Y A;  3KSJ A;  3PMX A;  3RN8 A;  1VFD A;  1Y4C A;  4YKI A;  1AL3 A;  4LQ2 A;  4OFJ A;  4JDF A;  2XXH A;  4MF3 A;  4BDN A;  3RT6 B;  4G8M A;  3MAM A;  3K6U A;  2HXW A;  4DXU A;  3CRB A;  4U4X A;  4YKP A;  1D4N A;  3N6T A;  1JET A;  1QKA A;  5I2N B;  3IO4 A;  4DIG A;  2E0S A;  4ZS9 A;  4EQB A;  4IGR A;  2P2A A;  3FJM A;  4R6Y A;  3DM0 A;  4Z7E A;  5CRY A;  2Y7P A;  1NL5 A;  1YPN A;  3EQ1 A;  1FQA A;  1RYO A;  3K01 A;  1Z7M E;  1B51 A;  3K6W A;  4F3B A;  1MY4 A;  4HW8 A;  1H3D A;  1UIU A;  3PMV A;  2DE2 A;  3MVZ A;  1WOD A;  3SDF A;  1HSL A;  3FVO A;  1NNP A;  1PDA A;  2XXP A;  1ZKB A;  2B3B A;  3BBR A;  3K1P A;  4OMB A;  1US5 A;  3MQ9 A;  1POY 1;  1R6Z A;  2R9J A;  3PD8 A;  4FEC A;  4C1U A;  2DXR A;  1OMP A;  4LAT A;  2F7A A;  4ISU A;  1OLC A;  1LGB C;  1IXC A;  2THI A;  2YLN A;  4G68 A;  4YZZ A;  3VE1 B;  5I2K B;  3VLV A;  3H4Z A;  4LZ8 A;  1MQD A;  2XD3 A;  2QS2 A;  2UVJ A;  1B32 A;  1QUK A;  1LFH A;  4BDL A;  3CG1 A;  1GVC A;  3RTF B;  4X9T A;  2OWT A;  3MC2 A;  3FAS A;  5DVJ A;  4H8J A;  4DCY A;  2XXW A;  3PPR A;  3E4R A;  3N5L A;  2RCA A;  2I58 A;  5KDT A;  2OK2 A;  2OCU A;  3MBP A;  4OXV A;  4QF9 A;  4EXL A;  4UA8 A;  1D3K A;  2Z23 A;  2DWH A;  4GD5 A;  3H3G A;  4PET A;  3LBS A;  1MPD A;  1AH5 A;  1B05 A;  1OVT A;  3UP9 A;  3TQL A;  2DE4 A;  3M8U A;  2HFB A;  4R73 A;  3K2D A;  2H98 A;  4NF5 A;  2PBW A;  1OQH A;  4DXC A;  3V83 A;  2NXO A;  5K2Y A;  3RQT A;  4X1D A;  4MLQ A;  3QK6 A;  4U1Z A;  1VFE A;  3TTL A;  3EPE A;  5I58 B;  1A99 A;  4YKJ A;  1CE2 A;  5I57 A;  1LAF E;  1YCJ A;  2W7Y A;  1D9Y A;  2Q2C A;  4IO5 A;  4LUB A;  5EYF A;  5DVI A;  3QYT A;  4ZZE A;  4LP2 B;  1LLS A;  2FA7 A;  2GHB A;  3A3C A;  3V89 B;  4U1O A;  1DTG A;  1FTM A;  2RC7 A;  3LUY A;  2DWJ A;  2Q88 A;  3OO8 A;  3UA8 A;  3GXA A;  3P7I A;  4KPT A;  2F35 A;  3OEL A;  3N26 A;  4ZEF A;  2O7I A;  4RPO A;  4QFK A;  1TWY A;  3Q25 A;  4GL8 A;  2QJE A;  5B70 A;  1S9T A;  4AQ4 A;  3IK6 B;  2Y7R A;  5TP9 A;  4G68 C;  5EHS A;  5L8D A;  1LBC A;  3MZ1 A;  4Q5T A;  4F39 A;  4KQP A;  3FD3 A;  4XIG Q;  3O6H A;  5IAI A;  3QXM A;  1LCF A;  4UAC A;  2DWA A;  1XC1 A;  4GRK A;  3CG3 A;  2Q2A A;  4DCX A;  1SW5 A;  3EHT A;  4NF4 A;  4KR5 A;  1J1N A;  4Q8R A;  5CMC A;  1A8E A;  2PX1 A;  3PU5 A;  4GXS B;  3IB0 A;  5KZT A;  4RJZ A;  2B65 A;  3MZ9 A;  4R2B A;  1MS7 A;  4GQO A;  3KGC A;  2XHD A;  1SBP A;  1I69 A;  3THI A;  1B0L A;  1JW5 A;  1FQD A;  4P0I A;  4U21 A;  1MDQ A;  1A54 A;  1JVY A;  4R6K A;  3QIM A;  4N07 A;  4DLD A;  4FAJ A;  1MY0 A;  4IO4 A;  3S9N C;  3RT8 A;  3TYH A;  3VVD A;  3U8Q A;  4C0R A;  4ND9 A;  4DE8 A;  4PQJ A;  4R9F A;  1MQI A;  3DP4 A;  3TCH A;  3M3L A;  1IEJ A;  1QVS A;  4ONY A;  1PEB A;  1B52 A;  1B5J A;  2DS9 A;  1NNK A;  4BDM A;  3C9H A;  1Y1M A;  4H8I A;  4HCW A;  1FTO A;  4ZDM A;  1IXH A;  4F1V A;  3Q27 A;  3IB1 A;  3IJX B;  2X7P A;  1RKM A;  4HCY A;  3T22 A;  2OWS A;  1CB6 A;  4R6H A;  1FQB A;  2Z8F A;  4RPN A;  4QFN A;  5HPQ A;  3O6G A;  4O3C A;  3U72 A;  1XT8 A;  2RC9 A;  2F36 A;  4H6D A;  4GFR A;  1OQG A;  3G3H A;  2GFE A;  4NWD A;  4Q0C A;  1ANF A;  3RNN A;  1B7Z A;  2H5Y A;  1FTJ A;  4QHQ A;  3HV1 A;  3OEK A;  4GIZ A;  1Q1K A;  1Y3Q A;  4C1T A;  1LBB A;  4EF2 A;  3C35 A;  3DLN A;  3ONM A;  3E13 X;  4Z0I A;  5HM4 B;  1FCK A;  3KZG A;  1MXY A;  3A09 A;  3G3G A;  3VVF A;  4ZEK A;  3RUM A;  4OZ9 A;  5H8F B;  1OIB A;  4G68 B;  4U22 A;  3SER A;  2DE3 A;  1B6H A;  5IKB A;  2PT2 A;  5H8Q A;  2Q89 A;  3HHF A;  1B1X A;  5AA3 A;  1B7U A;  1O63 A;  2RIN A;  3CSG A;  3K4U A;  4ZZA A;  4LON B;  3B6W A;  1Z7N E;  1ZIU A;  1VE4 A;  4FAT A;  1LCT A;  2YPN A;  1PB8 A;  4OWD A;  2XXX A;  1XS5 A;  1JEV A;  2PMS A;  3VXC A;  2I4C A;  4R74 A;  1KWH A;  3K1M A;  4RY1 A;  4X48 A;  3O29 A;  3FVN A;  4XKQ A;  3OO6 A;  4FIM A;  4BDQ A;  4ZED A;  1UTH A;  3BFU A;  4F1U A;  3KJT A;  4ZEB A;  3EHU A;  1N3X A;  1SW1 A;  3C33 A;  1II5 A;  3G3K A;  2XD2 A;  4RA1 A;  4OFL A;  4H1X A;  4RXL A;  3PGF A;  1MM6 A;  3IO6 A;  3VDF A;  4U4S A;  3UIF A;  3VLW A;  1I6A A;  3RY3 A;  3MVY A;  1B5H A;  4TLL B;  1SQY A;  4LVQ A;  1ATG A;  3BFT A;  3E3K A;  4YB6 A;  2XXV A;  3B7D A;  2IA4 A;  3FXQ A;  3IOR A;  5ITP A;  3O66 A;  4QSE A;  2X26 A;  4MH5 A;  4THI A;  4YAH X;  1N3W A;  1IIT A;  4BDO A;  2DYX A;  4F2O A;  2F7B A;  5H8N A;  3FXR A;  5AA1 A;  3UOR A;  5FHN A;  5CM6 A;  1P1Q A;  4G8N A;  5B7D A;  2LAO A;  1FQC A;  4DDD A;  3AXF A;  3KG2 A;  2Z8E A;  2I3W A;  3VLU A;  1MQH A;  1BP5 A;  1MXZ A;  2A5S A;  3PUX E;  3R7X A;  3FV1 A;  4JWY A;  3W9W A;  4FEB A;  5JTY A;  5A5X A;  3VXB A;  4ELP A;  2AIX A;  3PPO A;  3Q29 A;  5L9S A;  1EZ9 A;  4WED A;  3SEY A;  1IUD A;  3JZJ A;  2QMW A;  3R6U A;  1NNT A;  1TFD A;  5AA4 B;  3T9V A;  5ICT A;  2O1M A;  2O1L A;  5DTB A;  2F5X A;  1DPE A;  2V3T A;  1B5I A;  1Y4T A;  4WEP A;  2D3I A;  4H0W A;  3LC8 A;  3TAJ A;  4TLM B;  2I0B A;  3GLB A;  4F3G A;  3R26 A;  4AB6 A;  4XKR A;  4NE4 A;  2QS1 A;  5AA2 B;  2HEU A;  1BLF A;  2XXR A;  2UVG A;  2D21 A;  4M1V A;  1QJM A;  2Z8D A;  5EHM A;  4LQ5 A;  2REG A;  4M4G A;  1M5E A;  4G77 A;  2DP8 A;  3UGW A;  3FAT A;  2DSF A;  3TOD A;  1NMU A;  1AIV A;  3LSL A;  4NF8 A;  4IY6 A;  5H8H B;  2O6A A;  5ISU A;  2HZK A;  3T9X B;  4XXU A;  2QS3 A;  1MXU A;  1Q35 A;  4N13 A;  3TCF A;  1FTL A;  1N84 A;  2RKM A;  1NFT A;  4JXI A;  1NKX A;  5I59 B;  2F97 A;  3H03 A;  3TMG A;  1MXX A;  2XXT A;  3O2A A;  4JB7 A;  3A3U A;  3W15 C;  3RTW B;  3O6I A;  2CMO A;  4JSO A;  5I2N A;  3ILU B;  1B3G A;  1JQF A;  4OHN A;  3OMB A;  4ELR A;  3MPK A;  5LOM A;  2PYY A;  1YAE A;  5FTI A;  3LSF B;  2AYS A;  4XTC Q;  4G4P A;  3EN3 A;  1GV8 A;  3ILT B;  1I6Q A;  3C34 A;  4EDP A;  2NWJ A;  1P1O A;  3LR1 A;  1JW4 A;  5DYH A;  2XX8 A;  1HSE A;  5I84 A;  2G29 A;  4O3A A;  5DEX B;  3MZB A;  1B9J A;  1P1U A;  1DSN A;  4IO6 A;  5I56 B;  3B6T A;  3KOS A;  2VGQ A;  4OEU A;  3LSW A;  2HZL A;  1MY3 A;  1URG A;  3V5A A;  1B3H A;  3SEU A;  3SEV A;  4QFL A;  1P1W A;  1ZBM A;  3CFL A;  3U93 A;  4OET A;  1SI0 A;  3S9E A;  1PC3 A;  3TUS A;  4I62 A;  3MP1 A;  1TT1 A;  3KEI A;  1R1N A;  2QL3 A;  3L6G A;  4OYV A;  1QKB A;  1A55 A;  1B2H A;  2ONS A;  4NMY A;  4ECF A;  1MRP A;  4QSC A;  3IB2 A;  4NF6 B;  4QFP A;  2OZZ A;  1FW0 A;  4QSD A;  4YB5 A;  5TPA B;  2I48 A;  3SEX A;  5J1D A;  4IO2 A;  3CFX A;  1TFA A;  4OES A;  4I1D A;  5CC2 A;  3MP6 A;  3O97 A;  3FJ7 A;  4G8H A;  1LST A;  1SW4 A;  2ZYK A;  4YMA A;  2DWI A;  2OBG A;  3M3K A;  4KYE A;  2QRY A;  1NH8 A;  3H6W A;  1SYH A;  2V25 A;  4NTL A;  3PV0 E;  4EXK A;  1SDX A;  3QAX A;  4IB2 A;  5CMB A;  4F31 B;  3G3I A;  2I3V A;  1BKA A;  2D5W A;  5I58 A;  3FV2 A;  4HTG A;  2NUV A;  3C4M A;  4PFY A;  1M5D A;  3QUF A;  2UVH A;  4XKN A;  4GWO A;  4R72 A;  2QPQ A;  1I6B A;  4QRZ A;  3SKP A;  4WXJ A;  4F19 A;  1PB7 A;  3IOU A;  1UTB A;  4POW A;  4PFT A;  2XXQ A;  3UN6 A;  2ANJ A;  1HSJ A;  4ELQ A;  3EHS A;  3IJO B;  4U23 A;  2H99 A;  1EH3 A;  5CMK A;  2P0S A;  1PB9 A;  4POX A;  4JSD A;  1OVB A;  2I6E A;  3DEL B;  4NWC A;  4OTE A;  2G93 A;  3C36 A;  4YU0 A;  1B1H A;  4F3S A;  4ELO A;  4EF1 A;  3KN3 A;  4EQ9 A;  5F1Q A;  3D4G A;  1F9B A;  1IXG A;  3C32 A;  4L17 A;  4HS7 A;  1M5C A;  3MW0 A;  2ZNS A;  4KCC A;  3ECR A;  4GVO A;  1Y20 A;  3ZKL A;  1USY H;  1N0T A;  4FE8 A;  1NH7 A;  1URD A;  3HPI A;  1AOV A;  3LSX A;  1B40 A;  5KCJ A;  4R75 A;  3OOA A;  1IIW A;  5DT6 A;  4KHZ E;  2R71 A;  3H6V A;  3OXN A;  2H25 A;  2X7Q A;  2V3Q A;  4JWO A;  5KDT B;  2IEE A;  3UK4 A;  1MM7 A;  2F34 A;  4GOT A;  3F11 A;  3H6T A;  2DXY A;  3OD7 A;  1URS A;  4G2Z A;  2Y84 A;  1M5B A;  2V93 A;  3RLF E;  4ZEC A;  3IL1 B;  3I5O A;  1RYX A;  3E9X A;  2I4B A;  4KFQ A;  1IZ1 A;  1L5T A;  1JVX A;  4MFI A;  2YJP A;  4NF5 B;  4JWX A;  3PPN A;  3IX1 A;  2H9B A;  4OQO A;  3ZSF A;  3K6X A;  4ZE8 A;  4N6P A;  3OEN A;  2O7U A;  4NF8 B;  4O3B A;  1VR5 A;  3V8X B;  1ZMG A;  3QUJ A;  3KN8 A;  4OVJ A;  5F7V A;  5CBR A;  3WAF A;  5HBC A;  1MQG A;  4R2F A;  3TTR A;  2XXU A;  1SI1 A;  3CFZ A;  5I57 B;  1T0K A;  3S9M C;  5ITO A;  3HCQ A;  4F22 A;  4IY5 A;  1AMF A;  2P1S A;  1DPP A;  3MVW A;  1MY1 A;  2HAU A;  3RGY A;  2GHA A;  2I0C A;  2NOO A;  2O84 X;  3N6U A;  3HST A;  4U2R A;  4RYA A;  2DVZ A;  5FTH A;  3CR9 A;  1FQE A;  3KJ7 A;  3SEW A;  1FTK A;  4BLA A;  3IOV A;  4YMB A;  3JV9 A;  3FVK A;  2A5T A;  1LFG A;  2F7C A;  2DQV A;  3KFM A;  3GBA A;  2GRV A;  5TP9 B;  2Y7K A;  1M5F A;  3HO7 A;  1Y3N A;  3IR1 A;  3U1O A;  1QUI A;  1MH4 A;  1EZO A;  5CI5 A;  3PUZ E;  2ZNT A;  5M2V A;  1DMB A;  4TOZ A;  2FYI A;  4E0W A;  2O51 A;  4FOR A;  1BIY A;  2AL4 A;  1SYI A;  1MXW A;  1B4Z A;  3EF7 A;  3L6H A;  4NF4 B;  3S4U A;  1H45 A;  3H7M A;  4YIC A;  3IOW A;  5AE4 A;  3G3J A;  3HHG A;  1H43 A;  3CIJ A;  3OSR A;  5H8F A;  5DVF A;  1MH3 A;  3Q28 A;  1D9V A;  1LAG E;  4ESX A;  2Q8J A;  1POT A;  1N7W A;  3USD A;  1GTK A;  2F6P A;  3H6U A;  3Q26 A;  4EQ7 A;  2H4I A;  2ONR A;  5TU0 A;  1IXI A;  3TTM A;  3FUZ A;  2OLB A;  1H44 A;  3CI8 A;  3CSB A;  4KCD A;  2XX7 A;  4X1B A;  1SW2 A;  3TZA A;  1Y1Z A;  2B3F A;  4H5F A;  1QW0 A;  4KD5 A;  1PBQ A;  1DOT A;  2DOJ A;  2NVU B;  5JEI A;  3KN7 A;  1SD3 A;  5L9O A;  1O7T A;  2ZYO A;  4I8C A;  2REJ A;  3T96 B;  1A7L A;  2ESN A;  4I9D A;  4E0X A;  3S2V A;  3TTN A;  4IGT A;  3TDJ A;  4F1Y A;  2ZMB A;  4RK9 A;  5ICQ A;  1JW1 A;  1GR2 A;  3MJN A;  3S9L C;  2VP1 A;  2QMX A;  4H65 A;  1ZTY A;  2FNC A;  3MP8 A;  4LA9 A;  1B7H A;  1JEU A;  3FIR A;  3FJG A;  1MQJ A;  3IAZ A;  4MBP A;  3T93 B;  1MY2 A;  3DP8 A;  3M3F A;  3U94 A;  4PE5 B;  3OEM A;  3KOT A;  1LFI A;  3OO9 A;  1B3E A;  4FED A;  4P0G A;  3GBB A;  3IOT A;  4GLI A;  2XXY A;  3MWB A;  5ELV A;  4H67 A;  1B46 A;  3T9H B;  2HAV A;  1VSO A;  3HN0 A;  5H8S A;  2R6G E;  1UQW A;  3PUV E;  3TEL A;  1GGG A;  3PUY E;  3G7W A;  1DTZ A;  2ZXT A;  2Q9T A;  1UTB B;  2HCA A;  3DP6 A;  2KLF A;  1NNF A;  3PPP A;  4BDR A;  5L9M A;  3FVG A;  3N94 A;  5CBS A;  4NED A;  2VD3 A;  4H5G A;  5FHM A;  3RPW A;  4GXA A;  4R9G A;  4RK2 A;  2QS4 A;  1XHY A;  1USY E;  1WDN A;  5H8Q B;  3TFL A;  3WAE A;  2XX9 A;  3H06 B;  4MLV A;  1B58 A;  3FZV A;  3VV5 A;  2CZL A;  4LZ5 A;  4OEN A;  3BKI B;  3C31 A;  3ODB A;  2F78 A;  2AL5 A;  4FJP A;  2E1S A;  1XOC A;  3K00 A;  2V3U A;  4KYD A;  4TQU Q;  3OSQ A;  5KCJ B;  5I2K A;  4ZEI A;  1S50 A;  3GZG A;  2ZNU A;  2ZYN A;  3I6V A;  1B3F A;  2VOZ A;  3TPA A;  2ALU A;  1QUJ A;  3TQW A;  1US4 A;  4F18 A;  1O64 A;  5AA4 A;  4GL0 A;  1PBP A;  5JK4 A;  2ONK E;  2Z22 A;  3SET A;  1XVX A;  2PVU A;  1MDP 1;  4JBZ A;  1WVJ A;  4F3P A;  4XKP A;  1LAX A;  3TCG A;  3QSL A;  3VVE A;  4KYS A;  2F6G A;  2GH9 A;  5FHO A;  3K02 A;  1BTJ A;  1FQF A;  1N76 A;  4OFO A;  2PT1 A;  1R9Q A;  2M8C A;  1UTH B;  1MXV A;  4WKM A;  1Y3P A;  2O69 A;  3K0V A;  1B0H A;  3TTK A;  2HQ0 A;  5AA2 A;  1ELJ A;  3MPL A;  4K3F A;  3ZS6 A;  3VFJ A;  1EZP A;  4EUO A;  5CMM A;  1JNF A;  1UIV A;  2OJT A;  5BUU A;  4GF8 A;  1LAH E;  2Y7I A;  3W9V A;  2O68 A;  2ABH A;  2RCB A;  3T66 A;  3OO7 A;  4OEV A;  4DXB A;  1QUL A;  4KI0 E;  5H8H A;  1A40 A;  5AA2 D;  3KSX A;  2RC8 A;  3TKD A;  3MVX A;  1YTV A;  4AB5 A;  5K2X A;  3T9U A;  4PP0 A;  4F2Q A;  4RNS A;  3FGS A;  4QFO A;  5I59 A;  1H76 A;  4Q30 B;  3JYR A;  3PUW E;  3B6Q A;  1B3L A;  3D4C A;  5H8N B;  2ZYM A;  2A5T B;  4YKK A;  2V84 A;  1B4H A;  1TXF A;  3ZKK A;  1ZLQ A;  1MPC A;  4LZ7 A;  1IQ7 A;  4DZ1 A;  3PD9 A;  3K6V A;  4PFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...