4NQ8A

Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
300
structure length
300
Chain Sequence
TTLKMAYALSTSSHYGAGAEAFAKSIEGASGGKYKVQQFANSALGGEREVIEGLQIGTIDLAIVSTGATLNFVPETGVFDIPFLLRDLPHARAVLDSKIGQDMLAKFPDRGIIALAWGEQGFRHLTNNVRPVKTPADAKGLKIRTTENPIHITAFRQIGILPTPMAWPEVATALQQGTIDGQENPLSVITSAKLSQLQKYLSLTGHVYGPALVLMSANVYNGLSDAEKASFKAAGKDSAQAMRAYVDNIEQTGVEQLKKEGMEVSEVDRAAFAAAVEPAYAEYYKKFDKQLIQSIRDTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Protein transport
molecule keywords Putative periplasmic substrate-binding transport protein
total genus 105
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4nq8A00
4MIJA 4NGUA 4MAGA 4P47A 4P3LA 4N91A 2ZZVA 4PC9A 5I5PA 4MX6A 2XWKA 4OVQA 4NN3A 2XWIA 2VPNA 4PDDA 4PF6A 4YZZA 2XXKA 2ZZWA 3U65A 4PFBA 5IGAA 4N6KA 2PFZA 4OANA 4PF8A 5IZZA 4OVSA 4O8MA 4LN5A 4PFIA 4XEQA 2HZLA 2XWOA 5LTCA 4NAPA 4MNPA 2CEXA 4O94A 4YICA 4MCOA 4N15A 2HZKA 4PGNA 4X04A 4N4UA 4UABA 2PFYA 2VPOA 4N6DA 4PBQA 4P1LA 2V4CA 5I7IA 4NHBA 2HPGA 4O7MA 4NF0A 4PCDA 3GYYA 4DI4B 2XWVA 4N8YA 4NG7A 4X8RA 4PGPA 5IM2A 4MEVA 2ZZXA 4OVRA 4XFEA 4N17A 2WYPA 3FXBA 4NX1A 4PDHA 4P56A 4PETA 4MNCA 4PE3A 4XF5A 4OA4A 4MHFA 4MMPA 2XA5A 4OVTA 4DI3D 4P1EA 4P8BA 2WYKA 2CEYA 4PAFA 4OVPA 4PAIA 4PBHA 4PFRA 3B50A 5CM6A 4PAKA 4NQ8A 2WX9A 4MNIA 4N8GA 4P9KA
chains in the Genus database with same CATH superfamily
2FBPA 5I56A 2AL4A 2XHDA 4MAGA 1NV5A 1ATGA 1B40A 4OZ9A 2Q89A 2ZZVA 3FXRA 3N6UA 1DCUA 4JBZA 1P1NA 1MDP1 3RPWA 4G8HA 2F7BA 4F39A 1FBGA 1FW0A 3DP4A 1XS5A 3Q28A 2DVCA 3S2VA 1CNQA 2XXIA 1FPJA 1B7ZA 3TTNA 1R9QA 1B0HA 5DVIA 3VXCA 2ZYMA 1XHYA 1ZKBA 1EZ9A 1N7XA 3HCQA 1FBHA 2VPOA 3FVOA 3UK4A 2ZMBA 3ZKLA 5I7IA 4P0IA 3CRBA 1BLFA 2HHMA 5EYFA 1GR2A 3KBRA 4NF8A 1ELJA 4N6PA 1MDQA 1RKMA 2O7IA 4F3PA 2WKYA 2Z22A 3OO9A 1Q9DA 5I84A 4F1VA 3FJ7A 1JVXA 2OWZA 5IZ3B 5CRYA 5EQAA 1XOCA 3T9VA 4IR8A 3GZGA 4M4GA 4F29A 3LR1A 4POWA 1LAFE 1B4ZA 3W15C 5IKBA 4F22A 1MXYA 1AIVA 1ZTYA 1LBWA 2H5YA 3U8QA 2I3VA 2UVIA 1JNFA 2X7QA 4XTCQ 1FBFA 4IGTA 4I8CA 1IEJA 1FQFA 1WVJA 4GVOA 1UTHA 3BFTA 1YAEA 4YB5A 1VSOA 1XC1A 1XI6A 4QBAA 4IGRA 1IXIA 3T66A 3T96B 4R72A 4PDDA 3IJXB 2KQZA 3ZKKA 4OFOA 3FXUA 3MZBA 5TPAA 4ZEKA 1LB8A 1MPCA 3UN6A 2QPQA 4U4SA 3C34A 3IK6B 5I2NA 1EYKA 3A3CA 4GX6A 2DOJA 4EQ7A 5KDTB 1IXGA 4MH5A 2ALUA 2L5VA 2V3UA 1SYHA 4BLAA 1IUDA 1GGGA 1MY0A 1LFIA 3K1NA 2HPGA 4ZZAA 3UP9A 4NF0A 3GYYA 3D1RA 4U2RA 3PPQA 1EH3A 4WEPA 1BIYA 2ESNA 3T93B 4DCYA 4FJPA 5CMMA 2QS4A 5TPAB 1POTA 4HTGA 3TTMA 1LEVA 1R9LA 4DIGA 1MPDA 2XXUA 1YYZA 5M2VA 3R7XA 4ZEIA 1SW5A 3MP1A 4I3YA 4OVPA 4G68B 1MY4A 2ZYOA 1HSEA 4JWXA 1R1NA 3HPIA 4GBVA 2OCUA 3DP8A 3T22A 1NV6A 3H06B 2D3IA 2QVVA 4H6DA 3VFJA 1LBXA 2NUVA 1JQFA 2BJJX 2XXYA 2V3TA 2CZKA 3RUMA 2O84X 3FD3A 3MVZA 1QULA 2V3QA 1RDZA 4QXDA 1OLAA 4NF6A 1LBZA 2B3BA 4OANA 3TKDA 5DTBA 1EYJA 4O8MA 3ISPA 4ZS9A 4R6KA 3PUZE 1A54A 3EN3A 2CEXA 2MKZA 1M5BA 2F7CA 2B3FA 2DE4A 2XXRA 2Y7KA 4ONYA 2THIA 2ZNTA 1MG1A 1I6QA 4P1LA 1IMFA 1US5A 3RGYA 1IXHA 5H8SA 4OQOA 1JEVA 2OBGA 1LBBA 2DSFA 1LFHA 2DE2A 2UVJA 2P3VA 1USYH 5CMCA 4Q0CA 1MH3A 5I58A 4NF4B 4NWDA 1EU8A 4PFTA 4ESXA 3G3IA 3CIJA 2O69A 2QFLA 5KCJB 2XD2A 5I59B 4KYSA 1N3XA 4NE4A 1PB9A 3T1BA 3DP6A 3MZ1A 4GXAA 1ZJLA 2XWIA 2KR0A 4U4XA 5KCJA 1FPGA 5IZ1A 2PBWA 3L6GA 3HHGA 3I3VA 4KHZE 2OJTA 2GRVA 4I62A 2NXOA 4OWDA 2HXRA 1PBQA 2ONKE 4MCOA 3CR9A 3A09A 1NH8A 3PUXE 3B6WA 3IJOB 3OO8A 5CBRA 1OVBA 4H0WA 2HCAA 4O7MA 4F19A 2OX3A 4X48A 5B70A 3VXBA 2Y5LA 4HCWA 3O9PA 3OEMA 1Z7ME 4YKIA 3TFLA 3U92A 2GQ1A 1NNFA 2E1SA 1K9YA 4HW8A 1N04A 1S9TA 4GIZA 3USDA 2D21A 3EPEA 3FIRA 3FXBA 4U21A 1SI0A 1YPNA 2F35A 4KXPA 5I2KB 3ZSFA 2M8CA 3IOUA 4Z0IA 4P0GA 2RCAA 1NMUA 3PPPA 5B7DA 3RN8A 3V83A 3FJGA 3RPLA 4FECA 4PAKA 2HQ0A 3FGSA 3T9HB 3K0VA 3Q27A 3TODA 4ELQA 4JVDA 5EYGA 4XKRA 3HSTA 5CI5A 2F97A 5JK4A 5DEXA 1LBCA 4MJOA 4NN3A 2DE3A 1H3DA 4GD5A 1I69A 3Q26A 3UA8A 1LAGE 3IO6A 2ONSA 4FATA 1M5EA 4ELOA 3K4UA 3SEWA 2PFZA 3PPRA 2WEFA 1MY3A 2Q88A 5IZZA 4PTKA 4ZECA 2F3BA 1FBEA 3FBPA 3CG1A 1CB6A 4I3EA 4ZEFA 2XXVA 3I5OA 5FTIA 4YB7A 3UIFA 4ISUA 1FTOA 2CZIA 3ZS6A 1MXZA 3CSBA 4PBQA 1B51A 4LUBA 4UA8A 3BBRA 1TFAA 2O51A 4NHBA 5BWJA 2KLFA 3ROJA 3LBSA 4R9FA 5AA2D 4BDOA 3LUYA 3KOSA 3W9WA 2A5TB 1MM6A 3FZVA 3QAXA 1BK4A 2ZZXA 1B2HA 3O97A 2YPNA 3CVGA 3JV9A 4AB5A 2OLBA 4F2QA 2REGA 5BUUA 3TUSA 4G4PA 4GL8A 2D5WA 3TQLA 3OD7A 1IMDA 2XXWA 3HFUA 3B6QA 3FVNA 2I0CA 4RYAA 4QFLA 3PGFA 1XVYA 4P47A 5L9OA 1NNTA 4HE2A 2DXYA 4R2FA 4MX6A 2XWKA 1FQDA 2A5TA 1IITA 2ANJA 3HV1A 1FPDA 5ELVA 4E0WA 4X1BA 3EQ1A 4KPTA 5IGAA 3IOTA 1B1XA 5AA3A 3HHFA 4OFJA 3A29A 4OVSA 2R6GE 4ZDMA 2O7UA 4K3FA 3C35A 3VDFA 2Z8FA 1VFDA 2PT2A 4BDMA 4MNPA 4O94A 1KA1A 4GWXA 2Z23A 4LP2B 3G7WA 1P1OA 2DWAA 1JEUA 2VD3A 2P3NA 1B46A 4KI0E 3CFXA 2RF1A 2CZHA 4GWZA 1MY2A 3LC8A 1QGXA 3MYUA 5F1QA 4QF9A 5L9MA 4LZ7A 4DI4B 4TQUQ 4JWYA 4YAHX 4XKNA 2HAVA 2G93A 4ELPA 4X8RA 5KZTA 3N5LA 4EF2A 3VLUA 1OQGA 1FPLA 1K9ZA 1LBYA 4EXLA 1GTKA 4EUOA 1D9VA 1M5DA 1PB8A 3LSLA 4JDFA 4PE3A 5ESYA 4P11A 4EQ9A 4IO2A 1IQ7A 1US4A 5DVJA 2PT1A 1XVXA 3CSGA 3JZJA 3WAEA 3SEUA 1UQWA 1RDYA 4G61A 4EXKA 3LSXA 4F18A 4PAIA 2Y7IA 3OO7A 2PX1A 4X9TA 1FQBA 1KA0A 5FHMA 2Q8MA 2RC7A 4O3CA 1T0KA 2XXTA 3D4GA 1NUWA 3B8BA 3PD9A 4G2ZA 4GWUA 4IO6A 4PC9A 5CMKA 4H5GA 4PFYA 2QMWA 2F6PA 2BJIA 5LOMA 1P99A 3TAJA 2G29A 4NF4A 1FPFA 3H6UA 3QXMA 4PF8A 5A5XB 4OESA 1UIVA 1LAXA 4PP0A 3PUWE 4N15A 1S50A 1Q35A 1ZU0A 4UABA 1MQGA 4GX4A 4QFPA 1MXVA 3CG3A 3IAZA 2UVHA 1B3GA 1HSLA 1B52A 3K02A 3KN3A 4RJZA 3GBAA 4H8IA 3O28A 1DTGA 4MF3A 4H65A 3SZPA 2UYEA 3KC1A 4AB6A 4POXA 2QVRA 4KCDA 1JW5A 1N3WA 3KSXA 2DP8A 1FQCA 1FRPA 2ONRA 2Y84A 1H44A 4PETA 5H8FA 3TTRA 5HBCA 4AS5A 3IORA 1LLSA 2NVUB 3V89B 4KYDA 3ECRA 1BP5A 3NOHA 3B50A 1YCJA 2CMOA 3VV5A 3H6VA 3TZAA 1PB7A 1FTJA 3LUZA 4MLQA 3S9MC 1NNPA 4U1OA 1N76A 5HPQA 1I6BA 4NF5A 1SPIA 3G3JA 1PBPA 4OVQA 4OXVA 1VFEA 3G3FA 1B5IA 5FHOA 1MXWA 2ZZWA 4YKKA 1RDXA 2DXRA 3E13X 3OMBA 1Y9UA 2Z8DA 1G0IA 4MBPA 1LGBC 5I57B 2X7PA 2IA4A 4XEQA 4YB6A 1B1HA 1DMBA 3SEYA 2HEUA 1SQYA 2JJKA 2I49A 3GXAA 4TLMB 1FPIA 2DQVA 2QS1A 1IIWA 3BFUA 2DWIA 4TLLB 4U23A 4XIGQ 1VE4A 3FASA 3IB0A 3KN8A 3OSRA 3U94A 4DXBA 4LZ5A 4GRKA 4WEDA 4YKPA 2CZLA 3EHUA 2DWHA 2I0BA 4FORA 1OQHA 2P1SA 2FIXA 1IZ1A 4PE5B 3G3KA 4GWYA 1MH4A 3T9XB 5ICQA 2E0SA 5I57A 3SKPA 3SEXA 3MWBA 1NUZA 1OIBA 4QFNA 2H4IA 3KC0A 2CEYA 4QFKA 3V5AA 4IB2A 1TXFA 4RK2A 4F31B 4H5FA 4LA9A 3M3KA 5AA2A 4HXVA 4NGUA 2Y7RA 3TCHA 1NL5A 4GFRA 2F8DA 3OXNA 3H4ZA 4P3LA 2UYFA 2P2AA 2QS3A 5H8HB 1ANFA 3IOWA 2A5SA 2PYYA 4KD5A 3U65A 4PFBA 5FHNA 4EF1A 3B6TA 4GF8A 3LSWA 3OEKA 4YMAA 3FVGA 1A8FA 4I40A 4NF5B 3B7DA 5F7VA 1SDXA 3ILUB 3KZGA 5F24A 4WXJA 4BDRA 2OWTA 2REJA 1NV4A 1D9YA 3RT6B 2OZZA 1G0HA 3VVFA 1N7WA 4PFWA 2XD3A 3OENA 1ZBMA 4GBWA 3DLNA 4JVCA 3G3GA 4R75A 3MZ9A 1LBVA 5I56B 1FTKA 3IOVA 5H8FB 5FBPA 1B0LA 3PUYE 2YJPA 3TELA 1UIUA 3FJMA 1TFDA 2F5XA 4G77A 4OA4A 4MHFA 4MMPA 1NNKA 4QHQA 2Y5KA 5K2YA 3CI8A 4OENA 4OVTA 1FJ6A 3C9HA 4DCXA 2H9BA 2F7AA 4IO4A 5CM6A 3KJTA 2QRYA 4L17A 4MNIA 1B5HA 4N8GA 1FSAA 3MW0A 4FBPA 4U22A 4OEUA 3U1OA 1RYXA 1DPPA 3SEVA 1B32A 1NV3A 4N91A 3S9NC 4IO7A 3A3UA 1Z7NE 2VGQA 3LV0A 3RYDA 3FXQA 2WBDA 4N6KA 3SETA 3U72A 1AH5A 1B3FA 3DM0A 4EQBA 3MC2A 3R26A 3C36A 4PFIA 3O6HA 4H1XA 5K2XA 2O1MA 3MVWA 4YICA 2F78A 3OOAA 2H99A 4C0RA 3MSTA 1QUKA 3O66A 1SYIA 3R6UA 2NOOA 2I3WA 3TEPA 4QFOA 4EDPA 5ITPA 3MQ9A 3EHTA 3PPOA 4Q30B 4DLDA 1D4NA 3UORA 2O68A 2WYPA 2FA7A 2HFBA 4NMYA 3QIMA 3KSJA 5DW8A 3MPKA 1AWBA 3M3FA 4P1EA 1LAHE 4P8BA 4GWSA 4FEBA 4I9DA 5DYHA 4PFRA 1NV7A 4ESWA 2QL3A 5EQ8A 5ICTA 3KGCA 1YTVA 3K1PA 5IZ3A 3KBZA 1B3EA 2I48A 4R6HA 3FVKA 1PC3A 4FAJA 2DDKA 2ZNSA 3RTFB 3BKIB 1Y3QA 2FYIA 4FIMA 3OELA 4LONB 3RLFE 2QVUA 3RPLB 4DXCA 4OFLA 1II5A 3LSFB 4OERA 3PD8A 3QMFA 3H7MA 4F3SA 4F3GA 1AMFA 3MJNA 3IR1A 4LN5A 5I58B 1NKXA 1POY1 2HZLA 3QYTA 4NF6B 4H46A 4NTLA 2DWJA 4PFUA 4X04A 2I58A 2XX7A 1JW4A 1B9JA 1P1UA 3CFZA 1MQDA 3ILTB 3C4MA 2VOZA 4PCDA 3IB1A 3PTYA 4C1UA 5ET6A 4QRZA 4KYEA 4GOTA 1FQEA 1FPEA 3O6GA 5ET8A 4RNSA 5EHSA 4IY5A 5EYHA 5TP9A 1Y20A 2Y7PA 3TTLA 1WODA 4R73A 1J1NA 2XXXA 4M1VA 4JSDA 1SI1A 3P7IA 1JVYA 2AL5A 4AQ4A 2VD2A 4RY1A 4GX3A 1FCKA 3EKIA 4PAFA 1MQJA 5H8QA 2XXHA 3MAMA 1URGA 3TQWA 4E0XA 3IX1A 4H8JA 3E4RA 1QUJA 3IB2A 3FATA 3K6XA 3SERA 5AA1A 5J16A 3K6UA 4BDQA 1OVTA 5CMBA 1S7YA 4ELRA 3Q25A 3E78A 1MS7A 2FHYA 4JSOA 2Q2AA 3C33A 5DVFA 3TCFA 1NV0A 1B7HA 3HN0A 4PGNA 4AS4A 1FTLA 3K1MA 2Y7WA 2ZYNA 3C31A 5A5LA 1LCTA 2GHBA 2Q8JA 5EQ7A 3S4UA 4R6YA 3MPLA 3L6HA 2XWVA 4N8YA 4ZEBA 4NG7A 5H8HA 2QJEA 1QKBA 5I2NB 1B58A 4OVRA 2Z8EA 4LQ2A 4RPOA 5ET5A 5CC2A 1TT1A 1PDAA 4XXUA 1A7LA 2QSXA 3KOTA 1MXXA 4THIA 1SW4A 1N84A 4P56A 3O2AA 3SDFA 1MXUA 1VDWA 3EHSA 5I3SA 3G3HA 5TP9B 2GFEA 3PV0E 1IMBA 2ZXTA 4GWOA 1RYOA 1AL3A 4DXUA 4O3BA 2B65A 1Y1ZA 4KFQA 2ZYKA 1WDNA 4N07A 3K01A 5I59A 1NFTA 4MIJA 5A5XA 4Z7EA 4OEVA 4NF8B 5DT6A 1BTJA 3T0JA 4DE8A 1FBDA 3MUQA 3RQTA 1TWYA 1H76A 3N26A 1MM7A 2H98A 2RC9A 1EYIA 1PEBA 1ZIUA 1DTZA 1MQIA 2Q2CA 1DSNA 1OLCA 2XX9A 4RK9A 1R6ZA 1LCFA 3MP8A 3MVXA 1JW1A 2V93A 4GWWA 1NV2A 2WBBA 1B05A 3TTKA 4RA1A 2NWJA 4LATA 4KR5A 2IEEA 2UVGA 2Q74A 1O7TA 3PMXA 4JXIA 4O3AA 4XKPA 4YMBA 2I4BA 3CHGA 4ZZEA 4I1DA 3QUFA 2V4CA 1NUXA 1Y4CA 3GLBA 3IO4A 1F9BA 2RC8A 1MRPA 3RNNA 1D9QA 3WAFA 4H45A 1EZPA 3Q29A 2PCRA 2QS2A 3TMGA 1URDA 3FUZA 3O29A 4QSEA 4RXLA 2QMXA 1SVXB 4DZ1A 5KDTA 4GXSB 3PMVA 3N6TA 4G68A 4XKQA 2GH9A 4MLVA 4F1YA 4XF5A 4RPNA 3FV1A 4ECFA 2WYKA 4FE8A 1BKAA 2X26A 4ND9A 1DK4A 3KFMA 3E9XA 4FEDA 2WX9A 3H3GA 3S9EA 1FTMA 1MY1A 3E79A 4OHNA 4KQPA 1SD3A 3K2DA 4YU0A 1P1QA 1FJ9A 2FNCA 2I4CA 1DPEA 1URSA 2AYSA 5AE4A 5I5PA 4QSDA 4Q5TA 5T3JA 3BIHA 3KJ7A 4HE0A 1LB9A 1YZ0A 2XXKA 3K6VA 1YXIA 2XXQA 1A8EA 1DBZA 4N81A 3E3KA 1A55A 2ABHA 4R9GA 5IAIA 2XXPA 3PUVE 3H6WA 5ET7A 5LTCA 1Y4TA 4JWOA 1Q1KA 1SW2A 2XX8A 3QUJA 4N4UA 2VHAA 2UXAA 1SBPA 4OVJA 1QW0A 3KEIA 4GQOA 1MPBA 4OTEA 2Q9TA 3U93A 1B4HA 1N0TA 2YLNA 1Y3PA 3H03A 3VLWA 2R8TA 2FIEA 3FV2A 4WKMA 5IM2A 4MEVA 3TDJA 4G68C 5L9SA 3K00A 4LQ5A 4N17A 1QKAA 2PMSA 4ZEDA 4N13A 4NX1A 4PDHA 1AOVA 3H6TA 4OETA 5H8QB 1KWHA 3KG2A 1EZOA 3MP6A 4R74A 1XT8A 4NEDA 3W9VA 4ZE9A 4DI3D 2FVZA 1IMCA 4F3BA 4PBHA 4G8MA 3RTWB 4HE1A 4C1TA 1M5FA 1Y1MA 2RCBA 1P1WA 1QVSA 4OYVA 1CE2A 3UGWA 1QJMA 3K6WA 2HAUA 3TCGA 1I6AA 3VLVA 1MQHA 4HS7A 1FTAA 4NWCA 5LDZA 4QSCA 4IO3A 4O7IA 3V8XB 3RY3A 1FBCA 2OWSA 5DEXB 4YZZA 2R9JA 5L8DA 5AA2B 3ODBA 3THIA 1B5JA 4LZ8A 2DVZA 2PVUA 1NH7A 1SW1A 5TU0A 1M5CA 4GLIA 5ITOA 1NV1A 4JVIA 5J1DA 1IMEA 5FTHA 4ZE8A 3VVDA 3BIGA 1LSTA 2RKMA 2HZKA 3TPAA 3MVYA 2V84A 1A99A 3DELB 2PFYA 1NI9A 1DOTA 3QK6A 3C32A 3GBBA 3M8UA 5I2KA 2VP1A 1UTBB 4F1UA 5HM4B 2H25A 4F2OA 2B4LA 4IO5A 1INPA 3OO6A 4TOZA 1UTBA 4XFEA 2F34A 3PU5A 2GHAA 4BDLA 4HCYA 1B6HA 1IXCA 4X1DA 5JTYA 1O63A 1UTHB 4MNCA 4DDDA 1O64A 3S9LC 5ISUA 2DS9A 2XA5A 1L5TA 5EQ9A 3KN7A 4IY6A 3OSQA 1H45A 1A40A 5EHMA 4LVQA 1LFGA 2VT5A 3PMWA 4H67A 4PQJA 1FPKA 2R71A 2V25A 2W7YA 3RT8A 1VR5A 5AA4B 3TYHA 3CFLA 1B3HA 1NUYA 4JB7A 2I6EA 2F6GA 1FQAA 2HXWA 1HSJA 2VPNA 3ONMA 4PF6A 3IFCA 3HO7A 1KZ8A 2LAOA 3AXFA 4GL0A 3EF7A 2F36A 3IL1B 5H8NA 2O1LA 3JYRA 2XWOA 4KCCA 3F11A 2AIXA 1QUIA 4NAPA 5JEIA 3VVEA 5H8NB 2F3DA 1Y3NA 3T9UA 4Q8RA 4N6DA 1GVCA 2RINA 1OMPA 4UACA 2P0SA 3VE1B 1FPBA 3QSLA 4OMBA 1USYE 3O6IA 3M3LA 1IMAA 1GV8A 5CBSA 1FBPA 3PPNA 2O6AA 2ZNUA 4PGPA 2DYXA 5AA4A 1JETA 1D3KA 1ZMGA 3D4CA 3MBPA 3IFAA 4R2BA 3SESA 3I6VA 4YKJA 1ZLQA 1B3LA 1JP4A 2B4MA 4U1ZA 4BDNA 4G8NA 4MFIA 5JTYB 1B7UA 2OK2A 1H43A 4NQ8A 3N94A 4P9KA
chains in the Genus database with same CATH topology
4HXVA 1IMDA 1FSAA 3E79A 4GBVA 4FBPA 2QFLA 2FBPA 4MIJA 5IZ3A 3HFUA 3LUZA 4NGUA 3KBZA 4MAGA 1NV5A 1NUWA 3B8BA 4JVDA 1NV6A 1NUYA 5EYGA 1FBDA 2QVVA 3T0JA 4PDDA 1FJ9A 4P47A 1LBXA 1NV3A 4HE2A 1FTAA 4GWUA 2DDKA 2ZZVA 4N91A 4P3LA 5JK4A 5LDZA 1XI6A 4PC9A 5I5PA 1SPIA 4QBAA 3T1BA 1DCUA 4MX6A 2XWKA 4MJOA 4O7IA 2CZKA 2DE3A 1EYIA 4NN3A 4OVQA 2BJIA 5T3JA 5J16A 2XWIA 2QVUA 3BIHA 1FBCA 2KR0A 2VPNA 3RPLB 1FPDA 4HE0A 1YZ0A 2XXKA 2V3QA 2ZZWA 1FPGA 3IFCA 3LV0A 1RDZA 1RDXA 5IZ1A 4QXDA 2KQZA 4PFBA 1YXIA 1KZ8A 1FPFA 2WBDA 4N6KA 5IGAA 2PFZA 1FBGA 1DBZA 3QMFA 1LBZA 2WEFA 4N81A 4OANA 4PF8A 3W9VA 4PTKA 5IZZA 1G0IA 4GWWA 1NV2A 2DVZA 2WBBA 3A29A 4OVSA 4YICA 1EYJA 2F3BA 2QPQA 4O8MA 3E78A 4LN5A 4PFIA 1FBEA 1CNQA 3ISPA 4XEQA 2FHYA 3FBPA 1NV1A 2HZLA 2XWOA 4JVIA 5ET7A 1IMEA 1FPJA 4I40A 1EYKA 5J1DA 1NV0A 4GX6A 4H46A 4I3EA 4NAPA 2HXRA 4MNPA 2CEXA 2MKZA 4O94A 2JJKA 3BIGA 1KA1A 4GWXA 2Q74A 4MCOA 2L5VA 2HZKA 4N15A 4PGNA 4AS4A 1FPIA 4X04A 4N4UA 3RYDA 2CZIA 2F3DA 3CHGA 4UABA 5F24A 2DE4A 2PFYA 1NI9A 1FBHA 2VPOA 4GX4A 2P3NA 3MSTA 4N6DA 4PBQA 5A5LA 1NV4A 4P1LA 1IMFA 2Q9TA 4YZZA 2V4CA 1G0HA 4PF6A 5I7IA 2CZHA 4GWZA 1FPBA 1NUXA 2HPGA 4NHBA 4O7MA 1QGXA 2OX3A 5EQ7A 4DI3D 4NF0A 4F19A 4PCDA 4F1UA 2HHMA 3MYUA 3GYYA 1IMAA 1D9QA 2Y5LA 3D1RA 3PTYA 3ROJA 4H45A 3SZPA 4HCWA 2B4LA 2PCRA 1FBPA 4GBWA 5ET6A 3KC1A 2XWVA 2R8TA 1INPA 4N8YA 2FIEA 4JVCA 3W9WA 2QVRA 4NG7A 4X8RA 4DI4B 4PGPA 2GQ1A 1FPEA 1BK4A 2FIXA 1Q9DA 1K9YA 1LBVA 4MEVA 5ET8A 5IM2A 2ZZXA 4OVRA 2DE2A 5ET5A 4F1VA 5FBPA 4XFEA 5EYHA 2P3VA 1K9ZA 1LBYA 1FPLA 1FRPA 2OWZA 4N17A 4GWYA 5IZ3B 2WYPA 5EQAA 5LTCA 3FXBA 3IFAA 4HCYA 4NX1A 4PDHA 4P56A 4IR8A 4KXPA 1LEVA 4PETA 2F5XA 4M1VA 4MNCA 4PE3A 4XF5A 5ESYA 5DW8A 4OA4A 3U65A 4MHFA 4AS5A 1VDWA 4MMPA 1YYZA 2B4MA 1AWBA 1JP4A 1LBWA 1NUZA 2XA5A 2Y5KA 5I3SA 4GX3A 4OVTA 1FJ6A 5EQ9A 2FVZA 4P1EA 3KC0A 1RDYA 1IMCA 1IMBA 2WYKA 4G61A 4GWSA 4P8BA 4I3YA 2CEYA 3EKIA 4PAFA 4OVPA 4PAIA 4PBHA 4F18A 4HE1A 3RPLA 4PFRA 1DK4A 3NOHA 1NV7A 3B50A 4X9TA 5CM6A 5EQ8A 2VT5A 1KA0A 4PAKA 1FBFA 4NQ8A 2WX9A 2Q8MA 4MNIA 4N8GA 1FPKA 4P9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MIJ A;  4NGU A;  4MAG A;  4P47 A;  4P3L A;  4N91 A;  2ZZV A;  4PC9 A;  5I5P A;  4MX6 A;  2XWK A;  4OVQ A;  4NN3 A;  2XWI A;  2VPN A;  4PDD A;  4PF6 A;  4YZZ A;  2XXK A;  2ZZW A;  3U65 A;  4PFB A;  5IGA A;  4N6K A;  2PFZ A;  4OAN A;  4PF8 A;  5IZZ A;  4OVS A;  4O8M A;  4LN5 A;  4PFI A;  4XEQ A;  2HZL A;  2XWO A;  5LTC A;  4NAP A;  4MNP A;  2CEX A;  4O94 A;  4YIC A;  4MCO A;  4N15 A;  2HZK A;  4PGN A;  4X04 A;  4N4U A;  4UAB A;  2PFY A;  2VPO A;  4N6D A;  4PBQ A;  4P1L A;  2V4C A;  5I7I A;  4NHB A;  2HPG A;  4O7M A;  4NF0 A;  4PCD A;  3GYY A;  4DI4 B;  2XWV A;  4N8Y A;  4NG7 A;  4X8R A;  4PGP A;  5IM2 A;  4MEV A;  2ZZX A;  4OVR A;  4XFE A;  4N17 A;  2WYP A;  3FXB A;  4NX1 A;  4PDH A;  4P56 A;  4PET A;  4MNC A;  4PE3 A;  4XF5 A;  4OA4 A;  4MHF A;  4MMP A;  2XA5 A;  4OVT A;  4DI3 D;  4P1E A;  4P8B A;  2WYK A;  2CEY A;  4PAF A;  4OVP A;  4PAI A;  4PBH A;  4PFR A;  3B50 A;  5CM6 A;  4PAK A;  4NQ8 A;  2WX9 A;  4MNI A;  4N8G A;  4P9K A; 
#chains in the Genus database with same CATH topology
 2FBP A;  5I56 A;  2AL4 A;  2XHD A;  4MAG A;  1NV5 A;  1ATG A;  1B40 A;  4OZ9 A;  2Q89 A;  2ZZV A;  3FXR A;  3N6U A;  1DCU A;  4JBZ A;  1P1N A;  1MDP 1;  3RPW A;  4G8H A;  2F7B A;  4F39 A;  1FBG A;  1FW0 A;  3DP4 A;  1XS5 A;  3Q28 A;  2DVC A;  3S2V A;  1CNQ A;  2XXI A;  1FPJ A;  1B7Z A;  3TTN A;  1R9Q A;  1B0H A;  5DVI A;  3VXC A;  2ZYM A;  1XHY A;  1ZKB A;  1EZ9 A;  1N7X A;  3HCQ A;  1FBH A;  2VPO A;  3FVO A;  3UK4 A;  2ZMB A;  3ZKL A;  5I7I A;  4P0I A;  3CRB A;  1BLF A;  2HHM A;  5EYF A;  1GR2 A;  3KBR A;  4NF8 A;  1ELJ A;  4N6P A;  1MDQ A;  1RKM A;  2O7I A;  4F3P A;  2WKY A;  2Z22 A;  3OO9 A;  1Q9D A;  5I84 A;  4F1V A;  3FJ7 A;  1JVX A;  2OWZ A;  5IZ3 B;  5CRY A;  5EQA A;  1XOC A;  3T9V A;  4IR8 A;  3GZG A;  4M4G A;  4F29 A;  3LR1 A;  4POW A;  1LAF E;  1B4Z A;  3W15 C;  5IKB A;  4F22 A;  1MXY A;  1AIV A;  1ZTY A;  1LBW A;  2H5Y A;  3U8Q A;  2I3V A;  2UVI A;  1JNF A;  2X7Q A;  4XTC Q;  1FBF A;  4IGT A;  4I8C A;  1IEJ A;  1FQF A;  1WVJ A;  4GVO A;  1UTH A;  3BFT A;  1YAE A;  4YB5 A;  1VSO A;  1XC1 A;  1XI6 A;  4QBA A;  4IGR A;  1IXI A;  3T66 A;  3T96 B;  4R72 A;  4PDD A;  3IJX B;  2KQZ A;  3ZKK A;  4OFO A;  3FXU A;  3MZB A;  5TPA A;  4ZEK A;  1LB8 A;  1MPC A;  3UN6 A;  2QPQ A;  4U4S A;  3C34 A;  3IK6 B;  5I2N A;  1EYK A;  3A3C A;  4GX6 A;  2DOJ A;  4EQ7 A;  5KDT B;  1IXG A;  4MH5 A;  2ALU A;  2L5V A;  2V3U A;  1SYH A;  4BLA A;  1IUD A;  1GGG A;  1MY0 A;  1LFI A;  3K1N A;  2HPG A;  4ZZA A;  3UP9 A;  4NF0 A;  3GYY A;  3D1R A;  4U2R A;  3PPQ A;  1EH3 A;  4WEP A;  1BIY A;  2ESN A;  3T93 B;  4DCY A;  4FJP A;  5CMM A;  2QS4 A;  5TPA B;  1POT A;  4HTG A;  3TTM A;  1LEV A;  1R9L A;  4DIG A;  1MPD A;  2XXU A;  1YYZ A;  5M2V A;  3R7X A;  4ZEI A;  1SW5 A;  3MP1 A;  4I3Y A;  4OVP A;  4G68 B;  1MY4 A;  2ZYO A;  1HSE A;  4JWX A;  1R1N A;  3HPI A;  4GBV A;  2OCU A;  3DP8 A;  3T22 A;  1NV6 A;  3H06 B;  2D3I A;  2QVV A;  4H6D A;  3VFJ A;  1LBX A;  2NUV A;  1JQF A;  2BJJ X;  2XXY A;  2V3T A;  2CZK A;  3RUM A;  2O84 X;  3FD3 A;  3MVZ A;  1QUL A;  2V3Q A;  1RDZ A;  4QXD A;  1OLA A;  4NF6 A;  1LBZ A;  2B3B A;  4OAN A;  3TKD A;  5DTB A;  1EYJ A;  4O8M A;  3ISP A;  4ZS9 A;  4R6K A;  3PUZ E;  1A54 A;  3EN3 A;  2CEX A;  2MKZ A;  1M5B A;  2F7C A;  2B3F A;  2DE4 A;  2XXR A;  2Y7K A;  4ONY A;  2THI A;  2ZNT A;  1MG1 A;  1I6Q A;  4P1L A;  1IMF A;  1US5 A;  3RGY A;  1IXH A;  5H8S A;  4OQO A;  1JEV A;  2OBG A;  1LBB A;  2DSF A;  1LFH A;  2DE2 A;  2UVJ A;  2P3V A;  1USY H;  5CMC A;  4Q0C A;  1MH3 A;  5I58 A;  4NF4 B;  4NWD A;  1EU8 A;  4PFT A;  4ESX A;  3G3I A;  3CIJ A;  2O69 A;  2QFL A;  5KCJ B;  2XD2 A;  5I59 B;  4KYS A;  1N3X A;  4NE4 A;  1PB9 A;  3T1B A;  3DP6 A;  3MZ1 A;  4GXA A;  1ZJL A;  2XWI A;  2KR0 A;  4U4X A;  5KCJ A;  1FPG A;  5IZ1 A;  2PBW A;  3L6G A;  3HHG A;  3I3V A;  4KHZ E;  2OJT A;  2GRV A;  4I62 A;  2NXO A;  4OWD A;  2HXR A;  1PBQ A;  2ONK E;  4MCO A;  3CR9 A;  3A09 A;  1NH8 A;  3PUX E;  3B6W A;  3IJO B;  3OO8 A;  5CBR A;  1OVB A;  4H0W A;  2HCA A;  4O7M A;  4F19 A;  2OX3 A;  4X48 A;  5B70 A;  3VXB A;  2Y5L A;  4HCW A;  3O9P A;  3OEM A;  1Z7M E;  4YKI A;  3TFL A;  3U92 A;  2GQ1 A;  1NNF A;  2E1S A;  1K9Y A;  4HW8 A;  1N04 A;  1S9T A;  4GIZ A;  3USD A;  2D21 A;  3EPE A;  3FIR A;  3FXB A;  4U21 A;  1SI0 A;  1YPN A;  2F35 A;  4KXP A;  5I2K B;  3ZSF A;  2M8C A;  3IOU A;  4Z0I A;  4P0G A;  2RCA A;  1NMU A;  3PPP A;  5B7D A;  3RN8 A;  3V83 A;  3FJG A;  3RPL A;  4FEC A;  4PAK A;  2HQ0 A;  3FGS A;  3T9H B;  3K0V A;  3Q27 A;  3TOD A;  4ELQ A;  4JVD A;  5EYG A;  4XKR A;  3HST A;  5CI5 A;  2F97 A;  5JK4 A;  5DEX A;  1LBC A;  4MJO A;  4NN3 A;  2DE3 A;  1H3D A;  4GD5 A;  1I69 A;  3Q26 A;  3UA8 A;  1LAG E;  3IO6 A;  2ONS A;  4FAT A;  1M5E A;  4ELO A;  3K4U A;  3SEW A;  2PFZ A;  3PPR A;  2WEF A;  1MY3 A;  2Q88 A;  5IZZ A;  4PTK A;  4ZEC A;  2F3B A;  1FBE A;  3FBP A;  3CG1 A;  1CB6 A;  4I3E A;  4ZEF A;  2XXV A;  3I5O A;  5FTI A;  4YB7 A;  3UIF A;  4ISU A;  1FTO A;  2CZI A;  3ZS6 A;  1MXZ A;  3CSB A;  4PBQ A;  1B51 A;  4LUB A;  4UA8 A;  3BBR A;  1TFA A;  2O51 A;  4NHB A;  5BWJ A;  2KLF A;  3ROJ A;  3LBS A;  4R9F A;  5AA2 D;  4BDO A;  3LUY A;  3KOS A;  3W9W A;  2A5T B;  1MM6 A;  3FZV A;  3QAX A;  1BK4 A;  2ZZX A;  1B2H A;  3O97 A;  2YPN A;  3CVG A;  3JV9 A;  4AB5 A;  2OLB A;  4F2Q A;  2REG A;  5BUU A;  3TUS A;  4G4P A;  4GL8 A;  2D5W A;  3TQL A;  3OD7 A;  1IMD A;  2XXW A;  3HFU A;  3B6Q A;  3FVN A;  2I0C A;  4RYA A;  4QFL A;  3PGF A;  1XVY A;  4P47 A;  5L9O A;  1NNT A;  4HE2 A;  2DXY A;  4R2F A;  4MX6 A;  2XWK A;  1FQD A;  2A5T A;  1IIT A;  2ANJ A;  3HV1 A;  1FPD A;  5ELV A;  4E0W A;  4X1B A;  3EQ1 A;  4KPT A;  5IGA A;  3IOT A;  1B1X A;  5AA3 A;  3HHF A;  4OFJ A;  3A29 A;  4OVS A;  2R6G E;  4ZDM A;  2O7U A;  4K3F A;  3C35 A;  3VDF A;  2Z8F A;  1VFD A;  2PT2 A;  4BDM A;  4MNP A;  4O94 A;  1KA1 A;  4GWX A;  2Z23 A;  4LP2 B;  3G7W A;  1P1O A;  2DWA A;  1JEU A;  2VD3 A;  2P3N A;  1B46 A;  4KI0 E;  3CFX A;  2RF1 A;  2CZH A;  4GWZ A;  1MY2 A;  3LC8 A;  1QGX A;  3MYU A;  5F1Q A;  4QF9 A;  5L9M A;  4LZ7 A;  4DI4 B;  4TQU Q;  4JWY A;  4YAH X;  4XKN A;  2HAV A;  2G93 A;  4ELP A;  4X8R A;  5KZT A;  3N5L A;  4EF2 A;  3VLU A;  1OQG A;  1FPL A;  1K9Z A;  1LBY A;  4EXL A;  1GTK A;  4EUO A;  1D9V A;  1M5D A;  1PB8 A;  3LSL A;  4JDF A;  4PE3 A;  5ESY A;  4P11 A;  4EQ9 A;  4IO2 A;  1IQ7 A;  1US4 A;  5DVJ A;  2PT1 A;  1XVX A;  3CSG A;  3JZJ A;  3WAE A;  3SEU A;  1UQW A;  1RDY A;  4G61 A;  4EXK A;  3LSX A;  4F18 A;  4PAI A;  2Y7I A;  3OO7 A;  2PX1 A;  4X9T A;  1FQB A;  1KA0 A;  5FHM A;  2Q8M A;  2RC7 A;  4O3C A;  1T0K A;  2XXT A;  3D4G A;  1NUW A;  3B8B A;  3PD9 A;  4G2Z A;  4GWU A;  4IO6 A;  4PC9 A;  5CMK A;  4H5G A;  4PFY A;  2QMW A;  2F6P A;  2BJI A;  5LOM A;  1P99 A;  3TAJ A;  2G29 A;  4NF4 A;  1FPF A;  3H6U A;  3QXM A;  4PF8 A;  5A5X B;  4OES A;  1UIV A;  1LAX A;  4PP0 A;  3PUW E;  4N15 A;  1S50 A;  1Q35 A;  1ZU0 A;  4UAB A;  1MQG A;  4GX4 A;  4QFP A;  1MXV A;  3CG3 A;  3IAZ A;  2UVH A;  1B3G A;  1HSL A;  1B52 A;  3K02 A;  3KN3 A;  4RJZ A;  3GBA A;  4H8I A;  3O28 A;  1DTG A;  4MF3 A;  4H65 A;  3SZP A;  2UYE A;  3KC1 A;  4AB6 A;  4POX A;  2QVR A;  4KCD A;  1JW5 A;  1N3W A;  3KSX A;  2DP8 A;  1FQC A;  1FRP A;  2ONR A;  2Y84 A;  1H44 A;  4PET A;  5H8F A;  3TTR A;  5HBC A;  4AS5 A;  3IOR A;  1LLS A;  2NVU B;  3V89 B;  4KYD A;  3ECR A;  1BP5 A;  3NOH A;  3B50 A;  1YCJ A;  2CMO A;  3VV5 A;  3H6V A;  3TZA A;  1PB7 A;  1FTJ A;  3LUZ A;  4MLQ A;  3S9M C;  1NNP A;  4U1O A;  1N76 A;  5HPQ A;  1I6B A;  4NF5 A;  1SPI A;  3G3J A;  1PBP A;  4OVQ A;  4OXV A;  1VFE A;  3G3F A;  1B5I A;  5FHO A;  1MXW A;  2ZZW A;  4YKK A;  1RDX A;  2DXR A;  3E13 X;  3OMB A;  1Y9U A;  2Z8D A;  1G0I A;  4MBP A;  1LGB C;  5I57 B;  2X7P A;  2IA4 A;  4XEQ A;  4YB6 A;  1B1H A;  1DMB A;  3SEY A;  2HEU A;  1SQY A;  2JJK A;  2I49 A;  3GXA A;  4TLM B;  1FPI A;  2DQV A;  2QS1 A;  1IIW A;  3BFU A;  2DWI A;  4TLL B;  4U23 A;  4XIG Q;  1VE4 A;  3FAS A;  3IB0 A;  3KN8 A;  3OSR A;  3U94 A;  4DXB A;  4LZ5 A;  4GRK A;  4WED A;  4YKP A;  2CZL A;  3EHU A;  2DWH A;  2I0B A;  4FOR A;  1OQH A;  2P1S A;  2FIX A;  1IZ1 A;  4PE5 B;  3G3K A;  4GWY A;  1MH4 A;  3T9X B;  5ICQ A;  2E0S A;  5I57 A;  3SKP A;  3SEX A;  3MWB A;  1NUZ A;  1OIB A;  4QFN A;  2H4I A;  3KC0 A;  2CEY A;  4QFK A;  3V5A A;  4IB2 A;  1TXF A;  4RK2 A;  4F31 B;  4H5F A;  4LA9 A;  3M3K A;  5AA2 A;  4HXV A;  4NGU A;  2Y7R A;  3TCH A;  1NL5 A;  4GFR A;  2F8D A;  3OXN A;  3H4Z A;  4P3L A;  2UYF A;  2P2A A;  2QS3 A;  5H8H B;  1ANF A;  3IOW A;  2A5S A;  2PYY A;  4KD5 A;  3U65 A;  4PFB A;  5FHN A;  4EF1 A;  3B6T A;  4GF8 A;  3LSW A;  3OEK A;  4YMA A;  3FVG A;  1A8F A;  4I40 A;  4NF5 B;  3B7D A;  5F7V A;  1SDX A;  3ILU B;  3KZG A;  5F24 A;  4WXJ A;  4BDR A;  2OWT A;  2REJ A;  1NV4 A;  1D9Y A;  3RT6 B;  2OZZ A;  1G0H A;  3VVF A;  1N7W A;  4PFW A;  2XD3 A;  3OEN A;  1ZBM A;  4GBW A;  3DLN A;  4JVC A;  3G3G A;  4R75 A;  3MZ9 A;  1LBV A;  5I56 B;  1FTK A;  3IOV A;  5H8F B;  5FBP A;  1B0L A;  3PUY E;  2YJP A;  3TEL A;  1UIU A;  3FJM A;  1TFD A;  2F5X A;  4G77 A;  4OA4 A;  4MHF A;  4MMP A;  1NNK A;  4QHQ A;  2Y5K A;  5K2Y A;  3CI8 A;  4OEN A;  4OVT A;  1FJ6 A;  3C9H A;  4DCX A;  2H9B A;  2F7A A;  4IO4 A;  5CM6 A;  3KJT A;  2QRY A;  4L17 A;  4MNI A;  1B5H A;  4N8G A;  1FSA A;  3MW0 A;  4FBP A;  4U22 A;  4OEU A;  3U1O A;  1RYX A;  1DPP A;  3SEV A;  1B32 A;  1NV3 A;  4N91 A;  3S9N C;  4IO7 A;  3A3U A;  1Z7N E;  2VGQ A;  3LV0 A;  3RYD A;  3FXQ A;  2WBD A;  4N6K A;  3SET A;  3U72 A;  1AH5 A;  1B3F A;  3DM0 A;  4EQB A;  3MC2 A;  3R26 A;  3C36 A;  4PFI A;  3O6H A;  4H1X A;  5K2X A;  2O1M A;  3MVW A;  4YIC A;  2F78 A;  3OOA A;  2H99 A;  4C0R A;  3MST A;  1QUK A;  3O66 A;  1SYI A;  3R6U A;  2NOO A;  2I3W A;  3TEP A;  4QFO A;  4EDP A;  5ITP A;  3MQ9 A;  3EHT A;  3PPO A;  4Q30 B;  4DLD A;  1D4N A;  3UOR A;  2O68 A;  2WYP A;  2FA7 A;  2HFB A;  4NMY A;  3QIM A;  3KSJ A;  5DW8 A;  3MPK A;  1AWB A;  3M3F A;  4P1E A;  1LAH E;  4P8B A;  4GWS A;  4FEB A;  4I9D A;  5DYH A;  4PFR A;  1NV7 A;  4ESW A;  2QL3 A;  5EQ8 A;  5ICT A;  3KGC A;  1YTV A;  3K1P A;  5IZ3 A;  3KBZ A;  1B3E A;  2I48 A;  4R6H A;  3FVK A;  1PC3 A;  4FAJ A;  2DDK A;  2ZNS A;  3RTF B;  3BKI B;  1Y3Q A;  2FYI A;  4FIM A;  3OEL A;  4LON B;  3RLF E;  2QVU A;  3RPL B;  4DXC A;  4OFL A;  1II5 A;  3LSF B;  4OER A;  3PD8 A;  3QMF A;  3H7M A;  4F3S A;  4F3G A;  1AMF A;  3MJN A;  3IR1 A;  4LN5 A;  5I58 B;  1NKX A;  1POY 1;  2HZL A;  3QYT A;  4NF6 B;  4H46 A;  4NTL A;  2DWJ A;  4PFU A;  4X04 A;  2I58 A;  2XX7 A;  1JW4 A;  1B9J A;  1P1U A;  3CFZ A;  1MQD A;  3ILT B;  3C4M A;  2VOZ A;  4PCD A;  3IB1 A;  3PTY A;  4C1U A;  5ET6 A;  4QRZ A;  4KYE A;  4GOT A;  1FQE A;  1FPE A;  3O6G A;  5ET8 A;  4RNS A;  5EHS A;  4IY5 A;  5EYH A;  5TP9 A;  1Y20 A;  2Y7P A;  3TTL A;  1WOD A;  4R73 A;  1J1N A;  2XXX A;  4M1V A;  4JSD A;  1SI1 A;  3P7I A;  1JVY A;  2AL5 A;  4AQ4 A;  2VD2 A;  4RY1 A;  4GX3 A;  1FCK A;  3EKI A;  4PAF A;  1MQJ A;  5H8Q A;  2XXH A;  3MAM A;  1URG A;  3TQW A;  4E0X A;  3IX1 A;  4H8J A;  3E4R A;  1QUJ A;  3IB2 A;  3FAT A;  3K6X A;  3SER A;  5AA1 A;  5J16 A;  3K6U A;  4BDQ A;  1OVT A;  5CMB A;  1S7Y A;  4ELR A;  3Q25 A;  3E78 A;  1MS7 A;  2FHY A;  4JSO A;  2Q2A A;  3C33 A;  5DVF A;  3TCF A;  1NV0 A;  1B7H A;  3HN0 A;  4PGN A;  4AS4 A;  1FTL A;  3K1M A;  2Y7W A;  2ZYN A;  3C31 A;  5A5L A;  1LCT A;  2GHB A;  2Q8J A;  5EQ7 A;  3S4U A;  4R6Y A;  3MPL A;  3L6H A;  2XWV A;  4N8Y A;  4ZEB A;  4NG7 A;  5H8H A;  2QJE A;  1QKB A;  5I2N B;  1B58 A;  4OVR A;  2Z8E A;  4LQ2 A;  4RPO A;  5ET5 A;  5CC2 A;  1TT1 A;  1PDA A;  4XXU A;  1A7L A;  2QSX A;  3KOT A;  1MXX A;  4THI A;  1SW4 A;  1N84 A;  4P56 A;  3O2A A;  3SDF A;  1MXU A;  1VDW A;  3EHS A;  5I3S A;  3G3H A;  5TP9 B;  2GFE A;  3PV0 E;  1IMB A;  2ZXT A;  4GWO A;  1RYO A;  1AL3 A;  4DXU A;  4O3B A;  2B65 A;  1Y1Z A;  4KFQ A;  2ZYK A;  1WDN A;  4N07 A;  3K01 A;  5I59 A;  1NFT A;  4MIJ A;  5A5X A;  4Z7E A;  4OEV A;  4NF8 B;  5DT6 A;  1BTJ A;  3T0J A;  4DE8 A;  1FBD A;  3MUQ A;  3RQT A;  1TWY A;  1H76 A;  3N26 A;  1MM7 A;  2H98 A;  2RC9 A;  1EYI A;  1PEB A;  1ZIU A;  1DTZ A;  1MQI A;  2Q2C A;  1DSN A;  1OLC A;  2XX9 A;  4RK9 A;  1R6Z A;  1LCF A;  3MP8 A;  3MVX A;  1JW1 A;  2V93 A;  4GWW A;  1NV2 A;  2WBB A;  1B05 A;  3TTK A;  4RA1 A;  2NWJ A;  4LAT A;  4KR5 A;  2IEE A;  2UVG A;  2Q74 A;  1O7T A;  3PMX A;  4JXI A;  4O3A A;  4XKP A;  4YMB A;  2I4B A;  3CHG A;  4ZZE A;  4I1D A;  3QUF A;  2V4C A;  1NUX A;  1Y4C A;  3GLB A;  3IO4 A;  1F9B A;  2RC8 A;  1MRP A;  3RNN A;  1D9Q A;  3WAF A;  4H45 A;  1EZP A;  3Q29 A;  2PCR A;  2QS2 A;  3TMG A;  1URD A;  3FUZ A;  3O29 A;  4QSE A;  4RXL A;  2QMX A;  1SVX B;  4DZ1 A;  5KDT A;  4GXS B;  3PMV A;  3N6T A;  4G68 A;  4XKQ A;  2GH9 A;  4MLV A;  4F1Y A;  4XF5 A;  4RPN A;  3FV1 A;  4ECF A;  2WYK A;  4FE8 A;  1BKA A;  2X26 A;  4ND9 A;  1DK4 A;  3KFM A;  3E9X A;  4FED A;  2WX9 A;  3H3G A;  3S9E A;  1FTM A;  1MY1 A;  3E79 A;  4OHN A;  4KQP A;  1SD3 A;  3K2D A;  4YU0 A;  1P1Q A;  1FJ9 A;  2FNC A;  2I4C A;  1DPE A;  1URS A;  2AYS A;  5AE4 A;  5I5P A;  4QSD A;  4Q5T A;  5T3J A;  3BIH A;  3KJ7 A;  4HE0 A;  1LB9 A;  1YZ0 A;  2XXK A;  3K6V A;  1YXI A;  2XXQ A;  1A8E A;  1DBZ A;  4N81 A;  3E3K A;  1A55 A;  2ABH A;  4R9G A;  5IAI A;  2XXP A;  3PUV E;  3H6W A;  5ET7 A;  5LTC A;  1Y4T A;  4JWO A;  1Q1K A;  1SW2 A;  2XX8 A;  3QUJ A;  4N4U A;  2VHA A;  2UXA A;  1SBP A;  4OVJ A;  1QW0 A;  3KEI A;  4GQO A;  1MPB A;  4OTE A;  2Q9T A;  3U93 A;  1B4H A;  1N0T A;  2YLN A;  1Y3P A;  3H03 A;  3VLW A;  2R8T A;  2FIE A;  3FV2 A;  4WKM A;  5IM2 A;  4MEV A;  3TDJ A;  4G68 C;  5L9S A;  3K00 A;  4LQ5 A;  4N17 A;  1QKA A;  2PMS A;  4ZED A;  4N13 A;  4NX1 A;  4PDH A;  1AOV A;  3H6T A;  4OET A;  5H8Q B;  1KWH A;  3KG2 A;  1EZO A;  3MP6 A;  4R74 A;  1XT8 A;  4NED A;  3W9V A;  4ZE9 A;  4DI3 D;  2FVZ A;  1IMC A;  4F3B A;  4PBH A;  4G8M A;  3RTW B;  4HE1 A;  4C1T A;  1M5F A;  1Y1M A;  2RCB A;  1P1W A;  1QVS A;  4OYV A;  1CE2 A;  3UGW A;  1QJM A;  3K6W A;  2HAU A;  3TCG A;  1I6A A;  3VLV A;  1MQH A;  4HS7 A;  1FTA A;  4NWC A;  5LDZ A;  4QSC A;  4IO3 A;  4O7I A;  3V8X B;  3RY3 A;  1FBC A;  2OWS A;  5DEX B;  4YZZ A;  2R9J A;  5L8D A;  5AA2 B;  3ODB A;  3THI A;  1B5J A;  4LZ8 A;  2DVZ A;  2PVU A;  1NH7 A;  1SW1 A;  5TU0 A;  1M5C A;  4GLI A;  5ITO A;  1NV1 A;  4JVI A;  5J1D A;  1IME A;  5FTH A;  4ZE8 A;  3VVD A;  3BIG A;  1LST A;  2RKM A;  2HZK A;  3TPA A;  3MVY A;  2V84 A;  1A99 A;  3DEL B;  2PFY A;  1NI9 A;  1DOT A;  3QK6 A;  3C32 A;  3GBB A;  3M8U A;  5I2K A;  2VP1 A;  1UTB B;  4F1U A;  5HM4 B;  2H25 A;  4F2O A;  2B4L A;  4IO5 A;  1INP A;  3OO6 A;  4TOZ A;  1UTB A;  4XFE A;  2F34 A;  3PU5 A;  2GHA A;  4BDL A;  4HCY A;  1B6H A;  1IXC A;  4X1D A;  5JTY A;  1O63 A;  1UTH B;  4MNC A;  4DDD A;  1O64 A;  3S9L C;  5ISU A;  2DS9 A;  2XA5 A;  1L5T A;  5EQ9 A;  3KN7 A;  4IY6 A;  3OSQ A;  1H45 A;  1A40 A;  5EHM A;  4LVQ A;  1LFG A;  2VT5 A;  3PMW A;  4H67 A;  4PQJ A;  1FPK A;  2R71 A;  2V25 A;  2W7Y A;  3RT8 A;  1VR5 A;  5AA4 B;  3TYH A;  3CFL A;  1B3H A;  1NUY A;  4JB7 A;  2I6E A;  2F6G A;  1FQA A;  2HXW A;  1HSJ A;  2VPN A;  3ONM A;  4PF6 A;  3IFC A;  3HO7 A;  1KZ8 A;  2LAO A;  3AXF A;  4GL0 A;  3EF7 A;  2F36 A;  3IL1 B;  5H8N A;  2O1L A;  3JYR A;  2XWO A;  4KCC A;  3F11 A;  2AIX A;  1QUI A;  4NAP A;  5JEI A;  3VVE A;  5H8N B;  2F3D A;  1Y3N A;  3T9U A;  4Q8R A;  4N6D A;  1GVC A;  2RIN A;  1OMP A;  4UAC A;  2P0S A;  3VE1 B;  1FPB A;  3QSL A;  4OMB A;  1USY E;  3O6I A;  3M3L A;  1IMA A;  1GV8 A;  5CBS A;  1FBP A;  3PPN A;  2O6A A;  2ZNU A;  4PGP A;  2DYX A;  5AA4 A;  1JET A;  1D3K A;  1ZMG A;  3D4C A;  3MBP A;  3IFA A;  4R2B A;  3SES A;  3I6V A;  4YKJ A;  1ZLQ A;  1B3L A;  1JP4 A;  2B4M A;  4U1Z A;  4BDN A;  4G8N A;  4MFI A;  5JTY B;  1B7U A;  2OK2 A;  1H43 A;  4NQ8 A;  3N94 A;  4P9K A; 
#chains in the Genus database with same CATH homology
 4HXV A;  1IMD A;  1FSA A;  3E79 A;  4GBV A;  4FBP A;  2QFL A;  2FBP A;  4MIJ A;  5IZ3 A;  3HFU A;  3LUZ A;  4NGU A;  3KBZ A;  4MAG A;  1NV5 A;  1NUW A;  3B8B A;  4JVD A;  1NV6 A;  1NUY A;  5EYG A;  1FBD A;  2QVV A;  3T0J A;  4PDD A;  1FJ9 A;  4P47 A;  1LBX A;  1NV3 A;  4HE2 A;  1FTA A;  4GWU A;  2DDK A;  2ZZV A;  4N91 A;  4P3L A;  5JK4 A;  5LDZ A;  1XI6 A;  4PC9 A;  5I5P A;  1SPI A;  4QBA A;  3T1B A;  1DCU A;  4MX6 A;  2XWK A;  4MJO A;  4O7I A;  2CZK A;  2DE3 A;  1EYI A;  4NN3 A;  4OVQ A;  2BJI A;  5T3J A;  5J16 A;  2XWI A;  2QVU A;  3BIH A;  1FBC A;  2KR0 A;  2VPN A;  3RPL B;  1FPD A;  4HE0 A;  1YZ0 A;  2XXK A;  2V3Q A;  2ZZW A;  1FPG A;  3IFC A;  3LV0 A;  1RDZ A;  1RDX A;  5IZ1 A;  4QXD A;  2KQZ A;  4PFB A;  1YXI A;  1KZ8 A;  1FPF A;  2WBD A;  4N6K A;  5IGA A;  2PFZ A;  1FBG A;  1DBZ A;  3QMF A;  1LBZ A;  2WEF A;  4N81 A;  4OAN A;  4PF8 A;  3W9V A;  4PTK A;  5IZZ A;  1G0I A;  4GWW A;  1NV2 A;  2DVZ A;  2WBB A;  3A29 A;  4OVS A;  4YIC A;  1EYJ A;  2F3B A;  2QPQ A;  4O8M A;  3E78 A;  4LN5 A;  4PFI A;  1FBE A;  1CNQ A;  3ISP A;  4XEQ A;  2FHY A;  3FBP A;  1NV1 A;  2HZL A;  2XWO A;  4JVI A;  5ET7 A;  1IME A;  1FPJ A;  4I40 A;  1EYK A;  5J1D A;  1NV0 A;  4GX6 A;  4H46 A;  4I3E A;  4NAP A;  2HXR A;  4MNP A;  2CEX A;  2MKZ A;  4O94 A;  2JJK A;  3BIG A;  1KA1 A;  4GWX A;  2Q74 A;  4MCO A;  2L5V A;  2HZK A;  4N15 A;  4PGN A;  4AS4 A;  1FPI A;  4X04 A;  4N4U A;  3RYD A;  2CZI A;  2F3D A;  3CHG A;  4UAB A;  5F24 A;  2DE4 A;  2PFY A;  1NI9 A;  1FBH A;  2VPO A;  4GX4 A;  2P3N A;  3MST A;  4N6D A;  4PBQ A;  5A5L A;  1NV4 A;  4P1L A;  1IMF A;  2Q9T A;  4YZZ A;  2V4C A;  1G0H A;  4PF6 A;  5I7I A;  2CZH A;  4GWZ A;  1FPB A;  1NUX A;  2HPG A;  4NHB A;  4O7M A;  1QGX A;  2OX3 A;  5EQ7 A;  4DI3 D;  4NF0 A;  4F19 A;  4PCD A;  4F1U A;  2HHM A;  3MYU A;  3GYY A;  1IMA A;  1D9Q A;  2Y5L A;  3D1R A;  3PTY A;  3ROJ A;  4H45 A;  3SZP A;  4HCW A;  2B4L A;  2PCR A;  1FBP A;  4GBW A;  5ET6 A;  3KC1 A;  2XWV A;  2R8T A;  1INP A;  4N8Y A;  2FIE A;  4JVC A;  3W9W A;  2QVR A;  4NG7 A;  4X8R A;  4DI4 B;  4PGP A;  2GQ1 A;  1FPE A;  1BK4 A;  2FIX A;  1Q9D A;  1K9Y A;  1LBV A;  4MEV A;  5ET8 A;  5IM2 A;  2ZZX A;  4OVR A;  2DE2 A;  5ET5 A;  4F1V A;  5FBP A;  4XFE A;  5EYH A;  2P3V A;  1K9Z A;  1LBY A;  1FPL A;  1FRP A;  2OWZ A;  4N17 A;  4GWY A;  5IZ3 B;  2WYP A;  5EQA A;  5LTC A;  3FXB A;  3IFA A;  4HCY A;  4NX1 A;  4PDH A;  4P56 A;  4IR8 A;  4KXP A;  1LEV A;  4PET A;  2F5X A;  4M1V A;  4MNC A;  4PE3 A;  4XF5 A;  5ESY A;  5DW8 A;  4OA4 A;  3U65 A;  4MHF A;  4AS5 A;  1VDW A;  4MMP A;  1YYZ A;  2B4M A;  1AWB A;  1JP4 A;  1LBW A;  1NUZ A;  2XA5 A;  2Y5K A;  5I3S A;  4GX3 A;  4OVT A;  1FJ6 A;  5EQ9 A;  2FVZ A;  4P1E A;  3KC0 A;  1RDY A;  1IMC A;  1IMB A;  2WYK A;  4G61 A;  4GWS A;  4P8B A;  4I3Y A;  2CEY A;  3EKI A;  4PAF A;  4OVP A;  4PAI A;  4PBH A;  4F18 A;  4HE1 A;  3RPL A;  4PFR A;  1DK4 A;  3NOH A;  1NV7 A;  3B50 A;  4X9T A;  5CM6 A;  5EQ8 A;  2VT5 A;  1KA0 A;  4PAK A;  1FBF A;  4NQ8 A;  2WX9 A;  2Q8M A;  4MNI A;  4N8G A;  1FPK A;  4P9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...