4NQ8A

Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
300
structure length
300
Chain Sequence
TTLKMAYALSTSSHYGAGAEAFAKSIEGASGGKYKVQQFANSALGGEREVIEGLQIGTIDLAIVSTGATLNFVPETGVFDIPFLLRDLPHARAVLDSKIGQDMLAKFPDRGIIALAWGEQGFRHLTNNVRPVKTPADAKGLKIRTTENPIHITAFRQIGILPTPMAWPEVATALQQGTIDGQENPLSVITSAKLSQLQKYLSLTGHVYGPALVLMSANVYNGLSDAEKASFKAAGKDSAQAMRAYVDNIEQTGVEQLKKEGMEVSEVDRAAFAAAVEPAYAEYYKKFDKQLIQSIRDTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Putative periplasmic substrate-binding transport protein
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Bordetella bronchiseptica
total genus 105
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4nq8A00
4P56A 3B50A 4OANA 4MHFA 2WYPA 2HPGA 4N15A 4MCOA 2XXKA 4PF8A 4P1EA 4MNCA 5LTCA 4O94A 4P47A 4N8GA 5CM6A 4PAIA 4YICA 4N91A 2ZZWA 4OVSA 2XWVA 4OVPA 2PFYA 4NAPA 4MNPA 4MEVA 4PGPA 4X04A 4P1LA 4DI4B 4N6KA 4OA4A 4XEQA 4PFRA 4PDDA 2PFZA 4MX6A 5IZZA 4OVQA 4MMPA 4P9KA 2HZKA 4NQ8A 4N17A 4XF5A 2ZZXA 4MAGA 4LN5A 4DI3D 4NN3A 5IGAA 4NX1A 2ZZVA 4P3LA 4PETA 4PBHA 2VPNA 4PF6A 4N8YA 2CEXA 2WYKA 2XWKA 2XWOA 4PBQA 4P8BA 2HZLA 2WX9A 5I5PA 4PGNA 3U65A 4OVTA 3FXBA 4NGUA 2XWIA 4PAKA 5IM2A 4PDHA 4PCDA 4UABA 4N4UA 4PE3A 4PFIA 4X8RA 4PAFA 3GYYA 4NHBA 4O7MA 4PC9A 4O8MA 4OVRA 4XFEA 4MIJA 4PFBA 2V4CA 2XA5A 2CEYA 4N6DA 5I7IA 4YZZA 4NF0A 2VPOA 4MNIA 4NG7A
chains in the Genus database with same CATH superfamily
2Q2AA 3IOUA 1NV2A 4R6HA 1OIBA 4XIGQ 3FATA 5DVJA 4R9FA 1BLFA 4DZ1A 2UVJA 4OFJA 3TYHA 1FJ9A 1A7LA 2D3IA 1USYH 4ZEDA 3KZGA 2IA4A 3H3GA 3O6IA 4GWUA 4P1LA 1P1WA 1M5BA 3CFZA 3PPNA 5DYHA 2XXRA 2OWSA 4GD5A 5TPAA 3RT6B 5I2KA 3E13X 4QFPA 1R9QA 1VE4A 2DVZA 2UVHA 3FIRA 1GV8A 4I9DA 4OEVA 3TTLA 3DLNA 2Z23A 5I3SA 1MG1A 1LBYA 4F22A 3IJXB 1OQHA 4KI0E 3U1OA 4BDNA 1FBDA 1QJMA 2P0SA 1TT1A 4ZZAA 4DXBA 4JSOA 1N3XA 4ZEKA 3GXAA 3DP8A 4P8BA 1ZMGA 3E9XA 2WX9A 4DXUA 4G2ZA 3TKDA 4Z0IA 3AXFA 1EZ9A 3KGCA 4PDHA 3Q25A 4GXAA 2V3UA 1R9LA 5EQ7A 4I8CA 4IO4A 4H8JA 4ESWA 2VD3A 4JSDA 1LGBC 5EQAA 3PPPA 4LATA 2Y7IA 4LZ8A 1FPFA 5A5XA 2ZNTA 3IL1B 2ABHA 4GBVA 1MY1A 1OVTA 2HCAA 3W9WA 3JV9A 1ZIUA 5CMKA 1DCUA 1FBGA 2RC8A 1FPEA 1B0LA 1URGA 4U1OA 3VVEA 3MUQA 3C4MA 3IB2A 3K1PA 4X48A 5CM6A 1A54A 2YPNA 5CI5A 3MWBA 1B40A 4NF5A 4GQOA 1B0HA 3THIA 2UVGA 4TOZA 1XOCA 4OTEA 4DI4B 4RJZA 4N6KA 5I58B 3TEPA 3OO6A 1URSA 2UXAA 2XXWA 1LAXA 1N76A 3T0JA 4EQBA 3OELA 5FHNA 2F36A 4H5GA 4OXVA 2QVUA 5FBPA 2F7BA 3PGFA 4F3SA 2QS3A 2DQVA 1NV0A 1OVBA 2UVIA 4XKQA 4PF6A 4LP2B 1H45A 4IY5A 2HHMA 1RKMA 2XWOA 3MYUA 4YMAA 3U94A 2DE2A 3FXBA 2DDKA 1Z7NE 5AA4B 4NF8B 3E79A 2I4CA 3EKIA 2CZIA 1MXVA 2AL5A 3TCFA 1QUIA 3KN3A 5IKBA 5JTYA 4ONYA 2VGQA 4BDOA 2DYXA 2F7AA 1P1NA 1A99A 4IO7A 4O3CA 2XA5A 1DSNA 1VFEA 3FUZA 2OX3A 1AWBA 3R7XA 4BDRA 3BBRA 3USDA 2VPOA 4GWOA 4X1DA 1NUYA 5H8HB 5I59B 3G3HA 3IK6B 4MHFA 3JYRA 1QGXA 1PBQA 4OVJA 1EZOA 4MLVA 3CRBA 2ZYNA 2O1MA 4Q8RA 4NF4A 1Y3QA 3EHUA 3PMXA 3FXQA 3TDJA 1BTJA 4OVPA 1YCJA 4GBWA 4NAPA 3HHGA 1MDP1 4FEDA 4X04A 3K6WA 5F1QA 3OXNA 2VP1A 3VLUA 1UTBA 2QMXA 4GX3A 1MQJA 3D4CA 2HFBA 1EZPA 1MXZA 4NF6A 3V89B 4JWYA 4P11A 5DW8A 1LLSA 2CZHA 2Q2CA 4PETA 2P3NA 3MAMA 1DTZA 3SKPA 1SPIA 4N6PA 4NE4A 3IJOB 3CFLA 1XHYA 1LB8A 2F3DA 5EQ8A 3B7DA 5L8DA 3K0VA 4FORA 2O69A 1VR5A 4PAKA 2AL4A 1LBBA 4N4UA 3S2VA 3EHSA 2RCAA 3ROJA 1MQGA 5HBCA 1AL3A 4AB5A 1NUWA 4OMBA 1M5FA 3PMVA 4PE5B 4QRZA 3Q28A 4FJPA 3FJGA 4NF0A 4F2QA 1NV3A 1D9VA 3CG3A 2XXKA 3CR9A 1VSOA 4MNCA 5LTCA 3PUVE 4F3PA 3N5LA 1BKAA 5CC2A 3MZ9A 1POY1 1KZ8A 3ZS6A 3H4ZA 4GLIA 3VDFA 4GWWA 5I2NA 4F29A 2OWTA 3LBSA 4KHZE 5DTBA 3F11A 1FSAA 4LZ5A 2OK2A 1Y3PA 4HE0A 1FTMA 3S9EA 4N07A 3QYTA 1A40A 3RGYA 2ANJA 2F97A 5FTIA 4U1ZA 1IEJA 4NN3A 1MH3A 1US5A 2H5YA 4RPNA 5HPQA 2V3TA 1Y4CA 2QPQA 3EPEA 4JXIA 4KYDA 5DEXA 4WXJA 2CZLA 1LBCA 2PVUA 2M8CA 4G68B 1HSJA 3H6VA 1R6ZA 2V25A 4OQOA 3R6UA 4MF3A 2PYYA 2XXHA 3MZ1A 5EYHA 1F9BA 1NFTA 1UIVA 2FA7A 1B3FA 1GGGA 3T1BA 2ONSA 3N6UA 3UP9A 2KLFA 4EXLA 4ZDMA 3TTKA 3FVKA 4OEUA 4NMYA 1PB9A 4YZZA 5EYFA 2O6AA 2RC7A 4JBZA 5KCJA 1MXYA 2FVZA 1N7XA 3B50A 3VLWA 4QFKA 4G61A 4PFYA 1MXUA 4BDQA 5F7VA 4P47A 4P0GA 5T3JA 1MPDA 1QULA 4YICA 2ZZWA 1IXGA 3QMFA 4RNSA 2RCBA 1AIVA 1FTLA 3IAZA 3TTNA 3SETA 1O64A 4F39A 4OVQA 3M3FA 4DE8A 1PB8A 1FRPA 4OENA 3LSWA 2I3VA 1MM7A 2X7QA 2R8TA 4DIGA 3S9LC 3OD7A 1NUXA 4XXUA 3Q29A 1PB7A 2I49A 2Y7PA 2VOZA 3MVXA 4R9GA 3V8XB 2WEFA 3FXRA 3K2DA 4JDFA 4GFRA 4GOTA 2RC9A 2Q8JA 3U92A 1SW1A 2QFLA 4X9TA 2H9BA 5ET7A 4OERA 1B7UA 4YU0A 2XXUA 2PT1A 4KD5A 3T22A 3CVGA 5LOMA 4G8NA 3KFMA 3N26A 3QXMA 1WVJA 4EUOA 4I40A 1MPBA 4RXLA 1OLCA 3GBAA 3DM0A 2B65A 2HPGA 5EHMA 2H99A 5B70A 4PF8A 4MJOA 1QUKA 3SZPA 3ODBA 4ESXA 5JEIA 1M5EA 4YKKA 4N8GA 2VT5A 3O66A 3T66A 1FPGA 2V93A 2FBPA 1EYKA 1N84A 4MNPA 5I57B 1FTJA 3RT8A 3KJ7A 4YKIA 1DOTA 1ZKBA 4EF1A 1FTAA 2D21A 3FVNA 2MKZA 3OEKA 4PQJA 4F31B 2FIEA 1FBFA 1KA1A 3CG1A 2I6EA 4KQPA 2V3QA 2O68A 1JQFA 3PUXE 2OBGA 4LONB 4MAGA 5FHMA 2X26A 2Q89A 1EYIA 2Y5KA 3G3GA 1RYXA 1UTHB 4N8YA 5L9MA 4GWSA 2WYKA 4HTGA 3U72A 4XTCQ 2Q74A 1M5DA 3TZAA 2XXXA 3LSFB 3T93B 4AB6A 4U2RA 3OO7A 2L5VA 5AA2B 3VVDA 3MP1A 1IMBA 1Y1MA 4OESA 3SEUA 1FPBA 2XD2A 5ICQA 1AMFA 4OVRA 1LCFA 1UQWA 1DK4A 3FGSA 1B1XA 3PV0E 2CEYA 4N13A 1FCKA 4THIA 3KEIA 1N3WA 3OO8A 1DTGA 4ISUA 1SW4A 1CE2A 5FTHA 4ZEFA 3RLFE 4JVCA 1TXFA 1A8FA 1YYZA 5ESYA 1D9QA 5IZ3B 2H25A 4POXA 3RPLB 3KC1A 1IXHA 4WEPA 1MY3A 4GIZA 5FHOA 1JETA 4H65A 4F1YA 3MBPA 3K4UA 4G8HA 3CI8A 3K6UA 1IITA 2HZKA 3G7WA 5ICTA 3MPKA 4H6DA 1SBPA 4QSCA 3UN6A 1MY0A 3PTYA 3H6WA 4U22A 4RYAA 2VHAA 2G93A 1VFDA 1YTVA 2E0SA 1B46A 2HZLA 4F18A 4P0IA 1B7HA 3PUWE 3VE1B 1MQHA 4IO3A 3FBPA 2ZXTA 5KZTA 4I3EA 5H8QB 1SI0A 3T9UA 3TELA 3A09A 2PX1A 1JNFA 1IXCA 4PC9A 1CB6A 3V83A 3BIHA 3VXBA 2V4CA 2XXVA 1DPEA 4FE8A 5TP9B 3D1RA 4U23A 1NNKA 4F3GA 3IB0A 1J1NA 2O7IA 1LAHE 2WYPA 3ILUB 3I5OA 5H8NB 2PT2A 1IQ7A 3H03A 5EHSA 2CMOA 3A29A 5B7DA 4OVSA 2WBDA 4XKRA 4NEDA 1B5HA 1B9JA 1Q9DA 3RN8A 1B52A 1H44A 4IO2A 3B8BA 2F34A 1MH4A 4MEVA 4PFWA 5HM4B 4RPOA 5H8HA 5I59A 1LBZA 2XXQA 3I6VA 4OYVA 1H3DA 2PBWA 1RDYA 5KDTB 4C1UA 2HAVA 4JVDA 3WAFA 4MX6A 4OETA 2F6GA 3CIJA 4QFNA 2I58A 3QIMA 2YJPA 4MMPA 3DP6A 4RA1A 2YLNA 1FW0A 4YAHX 2XD3A 1FPJA 2I4BA 4GWYA 2P2AA 2O84X 3PUYE 4ZZEA 3OEMA 3O29A 2XWKA 3KSJA 4G68C 2DVCA 1MQIA 2B3BA 1PC3A 2QVVA 3E78A 3TTRA 1S7YA 2AIXA 4NGUA 4EXKA 3QK6A 1FPKA 2XWIA 1NV4A 4ECFA 3FVGA 4KR5A 1L5TA 4LQ2A 5H8FB 2KR0A 4PAFA 1B3EA 4LUBA 1GVCA 3K6XA 2THIA 4PFUA 2Z22A 4MIJA 4NF6B 1B58A 4IGRA 1URDA 4IB2A 1MRPA 2ZYKA 3E4RA 4M1VA 1H76A 3MP8A 1XT8A 4RK2A 3DP4A 2ZYOA 3B6TA 2F6PA 4YMBA 1AOVA 2F8DA 3C9HA 3QUJA 4GWZA 2DWAA 3L6HA 4HCYA 2FIXA 3ZKLA 4HE2A 3Q26A 1B4HA 3IOVA 5J16A 2REGA 3IR1A 4LZ7A 3W9VA 4YB7A 2GQ1A 4IO6A 1QVSA 3B6WA 1ATGA 3KBRA 4XEQA 4GX4A 2NXOA 2QJEA 1FBCA 3OENA 4IR8A 3VFJA 2O1LA 1NKXA 2Q88A 1MXXA 3OO9A 2I48A 1SD3A 1YZ0A 3C31A 2QMWA 4RY1A 1NNPA 4IO5A 2G29A 3H7MA 4ZS9A 2CEXA 1S9TA 2E1SA 1ANFA 1B05A 1SDXA 1WDNA 4WEDA 3VLVA 1B3HA 3LR1A 1NV1A 2AYSA 3CFXA 4F1VA 1RDZA 4ELRA 1Y4TA 5IZ1A 1Y9UA 3PU5A 2Y5LA 2OJTA 1KWHA 2BJIA 1FBPA 4PE3A 2QL3A 4GXSB 1YXIA 3TUSA 4GF8A 4PFTA 4QHQA 3FJ7A 3PUZE 1LFIA 4EDPA 1JP4A 4AS4A 1MDQA 1BIYA 3A3UA 3FZVA 2DXYA 4N15A 3SEXA 1D4NA 3KBZA 1NH8A 2ZYMA 1FQDA 3IB1A 3MPLA 5DEXB 2Z8EA 1B5JA 2OZZA 1JW5A 5I56B 1HSEA 2Y84A 2NWJA 3SEYA 3A3CA 1Q1KA 4PTKA 2UYFA 4QSDA 2F35A 2RKMA 4XKPA 1FQAA 2FHYA 4FATA 2I0CA 1PDAA 1UIUA 3KJTA 2UYEA 1FPLA 3HFUA 5AA2D 3G3JA 5IZZA 2P3VA 5BWJA 3CHGA 1I69A 3V5AA 4Q30B 2XXIA 1DMBA 4EF2A 4LN5A 4YKJA 1N0TA 3TCHA 3GZGA 4GVOA 2BJJX 3H6TA 1G0HA 4H46A 5AE4A 3ISPA 4DLDA 5AA1A 2LAOA 1FQEA 5ITPA 4DDDA 3HSTA 1G0IA 2ZNSA 1BP5A 2Y7KA 1INPA 1AH5A 4I3YA 5L9OA 4PFIA 3SEWA 2NVUB 1MS7A 5LDZA 4ELPA 1TFDA 1SW2A 3H06B 1LB9A 2A5TB 4YKPA 1YAEA 4KCDA 3N94A 1S50A 3VVFA 2DWJA 3IX1A 4MNIA 1PBPA 1FPDA 4WKMA 3RNNA 3B6QA 3TMGA 2XHDA 4MCOA 4MBPA 4ZECA 3IOWA 3S9NC 4KCCA 2I3WA 4BDLA 1MPCA 3KOSA 3MVZA 3IFCA 5F24A 1MXWA 4H1XA 2F78A 1JVYA 3TQWA 4ZE9A 4C1TA 1B6HA 4Q5TA 1IMFA 4R74A 3FASA 4PDDA 5DVFA 3SEVA 3ZKKA 3MSTA 4BDMA 1FJ6A 1ZBMA 4I62A 4UA8A 4FIMA 1US4A 4NQ8A 3GBBA 4N17A 4XF5A 3C32A 1VDWA 3O6HA 1N7WA 3T96B 5I57A 3PD8A 3FD3A 2HAUA 3OSRA 3T9VA 4FBPA 2Q8MA 4H5FA 4PGNA 2REJA 4BLAA 1EYJA 2DE3A 4KPTA 4U4XA 2GFEA 4G4PA 3C34A 4HCWA 1FBHA 1B3LA 1UTHA 5J1DA 4O7IA 3C35A 1DPPA 1A55A 1JEVA 2JJKA 5I84A 3RY3A 4O3BA 3S4UA 5ET5A 2ALUA 4K3FA 4QSEA 3TAJA 3K1MA 5AA2A 3HCQA 5TPAB 5I2KB 4GWXA 2O51A 5CMBA 5DT6A 4X1BA 2DWIA 2GHAA 2GRVA 3QAXA 4FAJA 2XWVA 3BKIB 2PFYA 3TTMA 5H8SA 4E0XA 4FEBA 1ELJA 1XC1A 3M3LA 1Y1ZA 3L6GA 1FTOA 1NV5A 4G77A 3O97A 4ND9A 3UORA 3FVOA 4OFLA 2A5SA 1LEVA 4ZEBA 4R75A 2H98A 5IZ3A 3TFLA 3RPLA 4NX1A 1XS5A 2OLBA 3BFUA 2XXPA 2RF1A 3LSXA 3UA8A 1NMUA 3K02A 5A5XB 5DVIA 3T9HB 4H0WA 3P7IA 2Y7RA 4OVTA 1ZLQA 2Z8FA 3HPIA 3BFTA 4C0RA 3HN0A 3BIGA 3UIFA 4UABA 5M2VA 4KYEA 1JW1A 1SW5A 3R26A 3G3FA 3C36A 1NV7A 5CRYA 4R6YA 1NL5A 3EHTA 3K6VA 4YB6A 4LVQA 5I58A 4ZEIA 1NNFA 4NF5B 1FPIA 4ELOA 4N81A 4R6KA 3G3IA 1B32A 1T0KA 4Q0CA 4OANA 5H8QA 1P1QA 3OOAA 2XXTA 1CNQA 2HXRA 1Y3NA 2B4MA 1SYIA 1LFHA 1D3KA 4P1EA 2GH9A 2ESNA 4O94A 2FNCA 3K01A 3EN3A 3IO4A 2Z8DA 4NWDA 3RPWA 4PAIA 4R2BA 3Q27A 5TP9A 3LUZA 5AA4A 4KFQA 4NF8A 3QSLA 1SQYA 4R72A 4AS5A 1ZJLA 2B3FA 3PMWA 5H8NA 1Y20A 4DCYA 4PFRA 4H67A 3CSGA 2PFZA 4IGTA 3VV5A 1LFGA 2ZZXA 2D5WA 4GRKA 2DP8A 5JTYB 4E0WA 5IGAA 1NI9A 3RUMA 1D9YA 1I6BA 2OCUA 3TQLA 4H8IA 2ZMBA 5KDTA 5I5PA 4R73A 2DE4A 4HW8A 1KA0A 1JEUA 4QBAA 3LUYA 1FBEA 4PCDA 2PMSA 5K2XA 3TODA 3SERA 3PPOA 1LSTA 5EYGA 1MY2A 2HQ0A 3FV2A 4NHBA 1N04A 4O8MA 4QXDA 5JK4A 1FTKA 2QSXA 1MQDA 3LV0A 4NF4B 3GLBA 3WAEA 4TQUQ 4N6DA 1A8EA 1SVXB 2GHBA 4FECA 4NG7A 1ZU0A 1I6AA 2HXWA 1P1OA 5H8FA 2OWZA 3NOHA 1LBXA 1IMEA 1UTBB 1NNTA 4LQ5A 1O63A 3MC2A 3KN7A 3N6TA 2NUVA 2I0BA 4JWXA 2F5XA 4GL8A 1FQCA 3FV1A 1LCTA 3ILTB 2DOJA 4TLMB 1K9YA 1M5CA 2Y7WA 4JVIA 5ITOA 4M4GA 2DXRA 1PEBA 5EQ9A 2DSFA 2ONKE 2B4LA 2NOOA 4DCXA 3MZBA 4RK9A 1TWYA 1R1NA 3TCGA 2P1SA 2R9JA 4P9KA 1SYHA 3KOTA 3O2AA 3CSBA 2ZZVA 4PBHA 3PPRA 4XKNA 2VD2A 4Z7EA 1GR2A 1QKBA 4MLQA 1O7TA 5IAIA 1OQGA 2IEEA 3KG2A 3KN8A 3C33A 2XX9A 1Z7ME 1B51A 4R2FA 3SDFA 5ISUA 4GX6A 3GYYA 4O7MA 1RDXA 2X7PA 3K1NA 2V84A 1JVXA 4NTLA 1LBWA 4QFOA 1POTA 2R6GE 5I7IA 4F19A 5L9SA 5CMMA 4QF9A 1NV6A 2WBBA 4OHNA 4YB5A 1I6QA 5I2NB 3MQ9A 3S9MC 4HE1A 1QW0A 2DWHA 1TFAA 3M8UA 3ONMA 3RTWB 5AA3A 4H45A 3DELB 1XVYA 3MP6A 1LAFE 4N91A 1NUZA 3KSXA 3RTFB 1II5A 4PGPA 3KC0A 3HHFA 4KXPA 4G68A 1IMDA 3ZSFA 4KYSA 3JZJA 5ELVA 4HXVA 4O3AA 2CZKA 3PPQA 4NWCA 4F1UA 5ET6A 2W7YA 3HO7A 5I56A 2Q9TA 4G8MA 1B7ZA 2ZNUA 4POWA 3RQTA 1RYOA 1OMPA 5K2YA 1MM6A 1MY4A 1USYE 3SESA 3I3VA 5TU0A 4QFLA 1IZ1A 3FXUA 3MW0A 4MFIA 1LBVA 3G3KA 1NH7A 4PBQA 4MH5A 3ECRA 3MJNA 4OWDA 4I1DA 5ET8A 5KCJB 1OLAA 5CMCA 3H6UA 1QUJA 3IOTA 4EQ7A 2F3BA 2PCRA 1JW4A 1WODA 3UGWA 1P1UA 4XFEA 5CBSA 3FJMA 1XI6A 2KQZA 4F2OA 1BK4A 4IY6A 3K00A 3E3KA 1B3GA 1DBZA 4P56A 4UACA 4ELQA 3EQ1A 1EU8A 3VXCA 1K9ZA 1IMCA 3W15C 4U21A 2QS2A 3MVYA 4PP0A 3D4GA 2A5TA 1SI1A 3IORA 4AQ4A 4JB7A 4LA9A 1B2HA 3QUFA 2R71A 4TLLB 1B5IA 1B1HA 1IMAA 3U93A 1ZTYA 2DS9A 4OA4A 2F7CA 2XX7A 1YPNA 2WKYA 2HEUA 3T9XB 3IO6A 4OFOA 1FQBA 4U4SA 3RYDA 5A5LA 4DI3D 1HSLA 4P3LA 2VPNA 1GTKA 2QS1A 3M3KA 1EH3A 1H43A 4DXCA 1Q35A 3LSLA 1B4ZA 1XVXA 4GL0A 2RINA 3U65A 4ZE8A 3O28A 3O6GA 4L17A 3O9PA 5CBRA 3TPAA 3UK4A 1IUDA 3MVWA 5IM2A 4OZ9A 2QS4A 4X8RA 2QVRA 1P99A 3LC8A 2QRYA 2XXYA 2H4IA 1QKAA 4HS7A 1FQFA 2ONRA 3PD9A 2FYIA 1LAGE 5BUUA 4PFBA 3U8QA 2O7UA 4F3BA 3OMBA 4JWOA 3EF7A 4EQ9A 2XX8A 1IIWA 3IFAA 3HV1A 3OSQA 1IXIA
chains in the Genus database with same CATH topology
2FVZA 3B50A 4OANA 4M1VA 1NV2A 1CNQA 2HXRA 2B4MA 4G61A 4P1EA 4O94A 4GWZA 4P47A 5T3JA 1FJ9A 4HCYA 2FIXA 4PAIA 4YICA 2ZZWA 4HE2A 3LUZA 3QMFA 5J16A 3W9VA 2GQ1A 4AS5A 4GWUA 4P1LA 4XEQA 4GX4A 4PFRA 1FBCA 4IR8A 2PFZA 2DVZA 4OVQA 1YZ0A 5I3SA 2ZZXA 1FRPA 1LBYA 2R8TA 5IGAA 1NI9A 1NUXA 2CEXA 1FBDA 1NV1A 4P8BA 2WEFA 4F1VA 5I5PA 2WX9A 1RDZA 2DE4A 5IZ1A 1KA0A 2Y5LA 2QFLA 4QBAA 4X9TA 1FBEA 4PDHA 2BJIA 4PCDA 5ET7A 1FBPA 4PE3A 5EQ7A 5EYGA 1YXIA 4NHBA 4O8MA 4QXDA 5EQAA 5JK4A 3LV0A 1FPFA 1JP4A 4GBVA 4N6DA 3W9WA 4AS4A 4NG7A 4I40A 1DCUA 1FBGA 1FPEA 2HPGA 4N15A 2OWZA 3NOHA 1LBXA 4PF8A 4MJOA 3KBZA 1IMEA 3SZPA 2F5XA 4N8GA 5CM6A 2VT5A 1FPGA 2FBPA 4PTKA 1EYKA 4MNPA 1K9YA 4JVIA 4DI4B 2FHYA 4N6KA 1FTAA 5EQ9A 2MKZA 3T0JA 1FPLA 3HFUA 2B4LA 2FIEA 1FBFA 1KA1A 5IZZA 2P3VA 3CHGA 2V3QA 2QVUA 4P9KA 5FBPA 4MAGA 4LN5A 1NV0A 2ZZVA 4PF6A 1EYIA 2Y5KA 4PBHA 4N8YA 2HHMA 4GWSA 1G0HA 2WYKA 4H46A 3ISPA 2XWOA 3MYUA 2Q74A 1G0IA 2DE2A 3FXBA 2DDKA 3E79A 1INPA 3EKIA 2CZIA 4I3YA 2L5VA 4PFIA 4GX6A 1IMBA 3GYYA 4O7MA 1FPBA 4OVRA 1RDXA 5LDZA 1DK4A 1LBWA 2XA5A 2OX3A 2CEYA 1AWBA 5I7IA 4F19A 2VPOA 4MNIA 1FPDA 1NV6A 2WBBA 1NUYA 4MHFA 1QGXA 4MCOA 4HE1A 3IFCA 4JVCA 4H45A 5F24A 4N91A 1YYZA 5ESYA 1NUZA 4OVPA 1D9QA 4GBWA 5IZ3B 4NAPA 3RPLB 3KC1A 4PGPA 3KC0A 4X04A 4KXPA 1IMDA 4HXVA 1IMFA 2CZKA 4PDDA 4GX3A 3MSTA 4F1UA 5ET6A 1FJ6A 2Q9TA 2HZKA 4NQ8A 4N17A 4XF5A 1VDWA 5DW8A 2CZHA 3PTYA 4PETA 2P3NA 1LBVA 1SPIA 4FBPA 4PBQA 2Q8MA 2HZLA 4F18A 2F3DA 4PGNA 5EQ8A 1EYJA 2DE3A 5ET8A 3FBPA 4I3EA 4PAKA 2F3BA 2PCRA 4N4UA 4HCWA 1FBHA 3ROJA 4PC9A 1NUWA 5J1DA 4XFEA 4O7IA 3BIHA 2V4CA 1XI6A 2KQZA 1BK4A 2JJKA 3D1RA 4NF0A 5ET5A 1NV3A 1DBZA 4P56A 2WYPA 2XXKA 1K9ZA 4GWXA 1IMCA 4MNCA 5LTCA 3A29A 4OVSA 2WBDA 2XWVA 1KZ8A 1Q9DA 2PFYA 3B8BA 4MEVA 4GWWA 1LBZA 1IMAA 4OA4A 1RDYA 1FSAA 1NV5A 4JVDA 4MX6A 4HE0A 4MMPA 1LEVA 3RYDA 5IZ3A 5A5LA 1FPJA 3RPLA 4GWYA 4DI3D 4NN3A 4NX1A 4P3LA 2VPNA 2XWKA 2QPQA 3U65A 2QVVA 3E78A 4OVTA 4NGUA 1FPKA 2XWIA 1NV4A 5IM2A 3BIGA 4UABA 4X8RA 2QVRA 2KR0A 5EYHA 4PAFA 1NV7A 3T1BA 4MIJA 4PFBA 1FPIA 4YZZA 3IFAA 4N81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P56 A;  3B50 A;  4OAN A;  4MHF A;  2WYP A;  2HPG A;  4N15 A;  4MCO A;  2XXK A;  4PF8 A;  4P1E A;  4MNC A;  5LTC A;  4O94 A;  4P47 A;  4N8G A;  5CM6 A;  4PAI A;  4YIC A;  4N91 A;  2ZZW A;  4OVS A;  2XWV A;  4OVP A;  2PFY A;  4NAP A;  4MNP A;  4MEV A;  4PGP A;  4X04 A;  4P1L A;  4DI4 B;  4N6K A;  4OA4 A;  4XEQ A;  4PFR A;  4PDD A;  2PFZ A;  4MX6 A;  5IZZ A;  4OVQ A;  4MMP A;  4P9K A;  2HZK A;  4NQ8 A;  4N17 A;  4XF5 A;  2ZZX A;  4MAG A;  4LN5 A;  4DI3 D;  4NN3 A;  5IGA A;  4NX1 A;  2ZZV A;  4P3L A;  4PET A;  4PBH A;  2VPN A;  4PF6 A;  4N8Y A;  2CEX A;  2WYK A;  2XWK A;  2XWO A;  4PBQ A;  4P8B A;  2HZL A;  2WX9 A;  5I5P A;  4PGN A;  3U65 A;  4OVT A;  3FXB A;  4NGU A;  2XWI A;  4PAK A;  5IM2 A;  4PDH A;  4PCD A;  4UAB A;  4N4U A;  4PE3 A;  4PFI A;  4X8R A;  4PAF A;  3GYY A;  4NHB A;  4O7M A;  4PC9 A;  4O8M A;  4OVR A;  4XFE A;  4MIJ A;  4PFB A;  2V4C A;  2XA5 A;  2CEY A;  4N6D A;  5I7I A;  4YZZ A;  4NF0 A;  2VPO A;  4MNI A;  4NG7 A; 
#chains in the Genus database with same CATH topology
 2Q2A A;  3IOU A;  1NV2 A;  4R6H A;  1OIB A;  4XIG Q;  3FAT A;  5DVJ A;  4R9F A;  1BLF A;  4DZ1 A;  2UVJ A;  4OFJ A;  3TYH A;  1FJ9 A;  1A7L A;  2D3I A;  1USY H;  4ZED A;  3KZG A;  2IA4 A;  3H3G A;  3O6I A;  4GWU A;  4P1L A;  1P1W A;  1M5B A;  3CFZ A;  3PPN A;  5DYH A;  2XXR A;  2OWS A;  4GD5 A;  5TPA A;  3RT6 B;  5I2K A;  3E13 X;  4QFP A;  1R9Q A;  1VE4 A;  2DVZ A;  2UVH A;  3FIR A;  1GV8 A;  4I9D A;  4OEV A;  3TTL A;  3DLN A;  2Z23 A;  5I3S A;  1MG1 A;  1LBY A;  4F22 A;  3IJX B;  1OQH A;  4KI0 E;  3U1O A;  4BDN A;  1FBD A;  1QJM A;  2P0S A;  1TT1 A;  4ZZA A;  4DXB A;  4JSO A;  1N3X A;  4ZEK A;  3GXA A;  3DP8 A;  4P8B A;  1ZMG A;  3E9X A;  2WX9 A;  4DXU A;  4G2Z A;  3TKD A;  4Z0I A;  3AXF A;  1EZ9 A;  3KGC A;  4PDH A;  3Q25 A;  4GXA A;  2V3U A;  1R9L A;  5EQ7 A;  4I8C A;  4IO4 A;  4H8J A;  4ESW A;  2VD3 A;  4JSD A;  1LGB C;  5EQA A;  3PPP A;  4LAT A;  2Y7I A;  4LZ8 A;  1FPF A;  5A5X A;  2ZNT A;  3IL1 B;  2ABH A;  4GBV A;  1MY1 A;  1OVT A;  2HCA A;  3W9W A;  3JV9 A;  1ZIU A;  5CMK A;  1DCU A;  1FBG A;  2RC8 A;  1FPE A;  1B0L A;  1URG A;  4U1O A;  3VVE A;  3MUQ A;  3C4M A;  3IB2 A;  3K1P A;  4X48 A;  5CM6 A;  1A54 A;  2YPN A;  5CI5 A;  3MWB A;  1B40 A;  4NF5 A;  4GQO A;  1B0H A;  3THI A;  2UVG A;  4TOZ A;  1XOC A;  4OTE A;  4DI4 B;  4RJZ A;  4N6K A;  5I58 B;  3TEP A;  3OO6 A;  1URS A;  2UXA A;  2XXW A;  1LAX A;  1N76 A;  3T0J A;  4EQB A;  3OEL A;  5FHN A;  2F36 A;  4H5G A;  4OXV A;  2QVU A;  5FBP A;  2F7B A;  3PGF A;  4F3S A;  2QS3 A;  2DQV A;  1NV0 A;  1OVB A;  2UVI A;  4XKQ A;  4PF6 A;  4LP2 B;  1H45 A;  4IY5 A;  2HHM A;  1RKM A;  2XWO A;  3MYU A;  4YMA A;  3U94 A;  2DE2 A;  3FXB A;  2DDK A;  1Z7N E;  5AA4 B;  4NF8 B;  3E79 A;  2I4C A;  3EKI A;  2CZI A;  1MXV A;  2AL5 A;  3TCF A;  1QUI A;  3KN3 A;  5IKB A;  5JTY A;  4ONY A;  2VGQ A;  4BDO A;  2DYX A;  2F7A A;  1P1N A;  1A99 A;  4IO7 A;  4O3C A;  2XA5 A;  1DSN A;  1VFE A;  3FUZ A;  2OX3 A;  1AWB A;  3R7X A;  4BDR A;  3BBR A;  3USD A;  2VPO A;  4GWO A;  4X1D A;  1NUY A;  5H8H B;  5I59 B;  3G3H A;  3IK6 B;  4MHF A;  3JYR A;  1QGX A;  1PBQ A;  4OVJ A;  1EZO A;  4MLV A;  3CRB A;  2ZYN A;  2O1M A;  4Q8R A;  4NF4 A;  1Y3Q A;  3EHU A;  3PMX A;  3FXQ A;  3TDJ A;  1BTJ A;  4OVP A;  1YCJ A;  4GBW A;  4NAP A;  3HHG A;  1MDP 1;  4FED A;  4X04 A;  3K6W A;  5F1Q A;  3OXN A;  2VP1 A;  3VLU A;  1UTB A;  2QMX A;  4GX3 A;  1MQJ A;  3D4C A;  2HFB A;  1EZP A;  1MXZ A;  4NF6 A;  3V89 B;  4JWY A;  4P11 A;  5DW8 A;  1LLS A;  2CZH A;  2Q2C A;  4PET A;  2P3N A;  3MAM A;  1DTZ A;  3SKP A;  1SPI A;  4N6P A;  4NE4 A;  3IJO B;  3CFL A;  1XHY A;  1LB8 A;  2F3D A;  5EQ8 A;  3B7D A;  5L8D A;  3K0V A;  4FOR A;  2O69 A;  1VR5 A;  4PAK A;  2AL4 A;  1LBB A;  4N4U A;  3S2V A;  3EHS A;  2RCA A;  3ROJ A;  1MQG A;  5HBC A;  1AL3 A;  4AB5 A;  1NUW A;  4OMB A;  1M5F A;  3PMV A;  4PE5 B;  4QRZ A;  3Q28 A;  4FJP A;  3FJG A;  4NF0 A;  4F2Q A;  1NV3 A;  1D9V A;  3CG3 A;  2XXK A;  3CR9 A;  1VSO A;  4MNC A;  5LTC A;  3PUV E;  4F3P A;  3N5L A;  1BKA A;  5CC2 A;  3MZ9 A;  1POY 1;  1KZ8 A;  3ZS6 A;  3H4Z A;  4GLI A;  3VDF A;  4GWW A;  5I2N A;  4F29 A;  2OWT A;  3LBS A;  4KHZ E;  5DTB A;  3F11 A;  1FSA A;  4LZ5 A;  2OK2 A;  1Y3P A;  4HE0 A;  1FTM A;  3S9E A;  4N07 A;  3QYT A;  1A40 A;  3RGY A;  2ANJ A;  2F97 A;  5FTI A;  4U1Z A;  1IEJ A;  4NN3 A;  1MH3 A;  1US5 A;  2H5Y A;  4RPN A;  5HPQ A;  2V3T A;  1Y4C A;  2QPQ A;  3EPE A;  4JXI A;  4KYD A;  5DEX A;  4WXJ A;  2CZL A;  1LBC A;  2PVU A;  2M8C A;  4G68 B;  1HSJ A;  3H6V A;  1R6Z A;  2V25 A;  4OQO A;  3R6U A;  4MF3 A;  2PYY A;  2XXH A;  3MZ1 A;  5EYH A;  1F9B A;  1NFT A;  1UIV A;  2FA7 A;  1B3F A;  1GGG A;  3T1B A;  2ONS A;  3N6U A;  3UP9 A;  2KLF A;  4EXL A;  4ZDM A;  3TTK A;  3FVK A;  4OEU A;  4NMY A;  1PB9 A;  4YZZ A;  5EYF A;  2O6A A;  2RC7 A;  4JBZ A;  5KCJ A;  1MXY A;  2FVZ A;  1N7X A;  3B50 A;  3VLW A;  4QFK A;  4G61 A;  4PFY A;  1MXU A;  4BDQ A;  5F7V A;  4P47 A;  4P0G A;  5T3J A;  1MPD A;  1QUL A;  4YIC A;  2ZZW A;  1IXG A;  3QMF A;  4RNS A;  2RCB A;  1AIV A;  1FTL A;  3IAZ A;  3TTN A;  3SET A;  1O64 A;  4F39 A;  4OVQ A;  3M3F A;  4DE8 A;  1PB8 A;  1FRP A;  4OEN A;  3LSW A;  2I3V A;  1MM7 A;  2X7Q A;  2R8T A;  4DIG A;  3S9L C;  3OD7 A;  1NUX A;  4XXU A;  3Q29 A;  1PB7 A;  2I49 A;  2Y7P A;  2VOZ A;  3MVX A;  4R9G A;  3V8X B;  2WEF A;  3FXR A;  3K2D A;  4JDF A;  4GFR A;  4GOT A;  2RC9 A;  2Q8J A;  3U92 A;  1SW1 A;  2QFL A;  4X9T A;  2H9B A;  5ET7 A;  4OER A;  1B7U A;  4YU0 A;  2XXU A;  2PT1 A;  4KD5 A;  3T22 A;  3CVG A;  5LOM A;  4G8N A;  3KFM A;  3N26 A;  3QXM A;  1WVJ A;  4EUO A;  4I40 A;  1MPB A;  4RXL A;  1OLC A;  3GBA A;  3DM0 A;  2B65 A;  2HPG A;  5EHM A;  2H99 A;  5B70 A;  4PF8 A;  4MJO A;  1QUK A;  3SZP A;  3ODB A;  4ESX A;  5JEI A;  1M5E A;  4YKK A;  4N8G A;  2VT5 A;  3O66 A;  3T66 A;  1FPG A;  2V93 A;  2FBP A;  1EYK A;  1N84 A;  4MNP A;  5I57 B;  1FTJ A;  3RT8 A;  3KJ7 A;  4YKI A;  1DOT A;  1ZKB A;  4EF1 A;  1FTA A;  2D21 A;  3FVN A;  2MKZ A;  3OEK A;  4PQJ A;  4F31 B;  2FIE A;  1FBF A;  1KA1 A;  3CG1 A;  2I6E A;  4KQP A;  2V3Q A;  2O68 A;  1JQF A;  3PUX E;  2OBG A;  4LON B;  4MAG A;  5FHM A;  2X26 A;  2Q89 A;  1EYI A;  2Y5K A;  3G3G A;  1RYX A;  1UTH B;  4N8Y A;  5L9M A;  4GWS A;  2WYK A;  4HTG A;  3U72 A;  4XTC Q;  2Q74 A;  1M5D A;  3TZA A;  2XXX A;  3LSF B;  3T93 B;  4AB6 A;  4U2R A;  3OO7 A;  2L5V A;  5AA2 B;  3VVD A;  3MP1 A;  1IMB A;  1Y1M A;  4OES A;  3SEU A;  1FPB A;  2XD2 A;  5ICQ A;  1AMF A;  4OVR A;  1LCF A;  1UQW A;  1DK4 A;  3FGS A;  1B1X A;  3PV0 E;  2CEY A;  4N13 A;  1FCK A;  4THI A;  3KEI A;  1N3W A;  3OO8 A;  1DTG A;  4ISU A;  1SW4 A;  1CE2 A;  5FTH A;  4ZEF A;  3RLF E;  4JVC A;  1TXF A;  1A8F A;  1YYZ A;  5ESY A;  1D9Q A;  5IZ3 B;  2H25 A;  4POX A;  3RPL B;  3KC1 A;  1IXH A;  4WEP A;  1MY3 A;  4GIZ A;  5FHO A;  1JET A;  4H65 A;  4F1Y A;  3MBP A;  3K4U A;  4G8H A;  3CI8 A;  3K6U A;  1IIT A;  2HZK A;  3G7W A;  5ICT A;  3MPK A;  4H6D A;  1SBP A;  4QSC A;  3UN6 A;  1MY0 A;  3PTY A;  3H6W A;  4U22 A;  4RYA A;  2VHA A;  2G93 A;  1VFD A;  1YTV A;  2E0S A;  1B46 A;  2HZL A;  4F18 A;  4P0I A;  1B7H A;  3PUW E;  3VE1 B;  1MQH A;  4IO3 A;  3FBP A;  2ZXT A;  5KZT A;  4I3E A;  5H8Q B;  1SI0 A;  3T9U A;  3TEL A;  3A09 A;  2PX1 A;  1JNF A;  1IXC A;  4PC9 A;  1CB6 A;  3V83 A;  3BIH A;  3VXB A;  2V4C A;  2XXV A;  1DPE A;  4FE8 A;  5TP9 B;  3D1R A;  4U23 A;  1NNK A;  4F3G A;  3IB0 A;  1J1N A;  2O7I A;  1LAH E;  2WYP A;  3ILU B;  3I5O A;  5H8N B;  2PT2 A;  1IQ7 A;  3H03 A;  5EHS A;  2CMO A;  3A29 A;  5B7D A;  4OVS A;  2WBD A;  4XKR A;  4NED A;  1B5H A;  1B9J A;  1Q9D A;  3RN8 A;  1B52 A;  1H44 A;  4IO2 A;  3B8B A;  2F34 A;  1MH4 A;  4MEV A;  4PFW A;  5HM4 B;  4RPO A;  5H8H A;  5I59 A;  1LBZ A;  2XXQ A;  3I6V A;  4OYV A;  1H3D A;  2PBW A;  1RDY A;  5KDT B;  4C1U A;  2HAV A;  4JVD A;  3WAF A;  4MX6 A;  4OET A;  2F6G A;  3CIJ A;  4QFN A;  2I58 A;  3QIM A;  2YJP A;  4MMP A;  3DP6 A;  4RA1 A;  2YLN A;  1FW0 A;  4YAH X;  2XD3 A;  1FPJ A;  2I4B A;  4GWY A;  2P2A A;  2O84 X;  3PUY E;  4ZZE A;  3OEM A;  3O29 A;  2XWK A;  3KSJ A;  4G68 C;  2DVC A;  1MQI A;  2B3B A;  1PC3 A;  2QVV A;  3E78 A;  3TTR A;  1S7Y A;  2AIX A;  4NGU A;  4EXK A;  3QK6 A;  1FPK A;  2XWI A;  1NV4 A;  4ECF A;  3FVG A;  4KR5 A;  1L5T A;  4LQ2 A;  5H8F B;  2KR0 A;  4PAF A;  1B3E A;  4LUB A;  1GVC A;  3K6X A;  2THI A;  4PFU A;  2Z22 A;  4MIJ A;  4NF6 B;  1B58 A;  4IGR A;  1URD A;  4IB2 A;  1MRP A;  2ZYK A;  3E4R A;  4M1V A;  1H76 A;  3MP8 A;  1XT8 A;  4RK2 A;  3DP4 A;  2ZYO A;  3B6T A;  2F6P A;  4YMB A;  1AOV A;  2F8D A;  3C9H A;  3QUJ A;  4GWZ A;  2DWA A;  3L6H A;  4HCY A;  2FIX A;  3ZKL A;  4HE2 A;  3Q26 A;  1B4H A;  3IOV A;  5J16 A;  2REG A;  3IR1 A;  4LZ7 A;  3W9V A;  4YB7 A;  2GQ1 A;  4IO6 A;  1QVS A;  3B6W A;  1ATG A;  3KBR A;  4XEQ A;  4GX4 A;  2NXO A;  2QJE A;  1FBC A;  3OEN A;  4IR8 A;  3VFJ A;  2O1L A;  1NKX A;  2Q88 A;  1MXX A;  3OO9 A;  2I48 A;  1SD3 A;  1YZ0 A;  3C31 A;  2QMW A;  4RY1 A;  1NNP A;  4IO5 A;  2G29 A;  3H7M A;  4ZS9 A;  2CEX A;  1S9T A;  2E1S A;  1ANF A;  1B05 A;  1SDX A;  1WDN A;  4WED A;  3VLV A;  1B3H A;  3LR1 A;  1NV1 A;  2AYS A;  3CFX A;  4F1V A;  1RDZ A;  4ELR A;  1Y4T A;  5IZ1 A;  1Y9U A;  3PU5 A;  2Y5L A;  2OJT A;  1KWH A;  2BJI A;  1FBP A;  4PE3 A;  2QL3 A;  4GXS B;  1YXI A;  3TUS A;  4GF8 A;  4PFT A;  4QHQ A;  3FJ7 A;  3PUZ E;  1LFI A;  4EDP A;  1JP4 A;  4AS4 A;  1MDQ A;  1BIY A;  3A3U A;  3FZV A;  2DXY A;  4N15 A;  3SEX A;  1D4N A;  3KBZ A;  1NH8 A;  2ZYM A;  1FQD A;  3IB1 A;  3MPL A;  5DEX B;  2Z8E A;  1B5J A;  2OZZ A;  1JW5 A;  5I56 B;  1HSE A;  2Y84 A;  2NWJ A;  3SEY A;  3A3C A;  1Q1K A;  4PTK A;  2UYF A;  4QSD A;  2F35 A;  2RKM A;  4XKP A;  1FQA A;  2FHY A;  4FAT A;  2I0C A;  1PDA A;  1UIU A;  3KJT A;  2UYE A;  1FPL A;  3HFU A;  5AA2 D;  3G3J A;  5IZZ A;  2P3V A;  5BWJ A;  3CHG A;  1I69 A;  3V5A A;  4Q30 B;  2XXI A;  1DMB A;  4EF2 A;  4LN5 A;  4YKJ A;  1N0T A;  3TCH A;  3GZG A;  4GVO A;  2BJJ X;  3H6T A;  1G0H A;  4H46 A;  5AE4 A;  3ISP A;  4DLD A;  5AA1 A;  2LAO A;  1FQE A;  5ITP A;  4DDD A;  3HST A;  1G0I A;  2ZNS A;  1BP5 A;  2Y7K A;  1INP A;  1AH5 A;  4I3Y A;  5L9O A;  4PFI A;  3SEW A;  2NVU B;  1MS7 A;  5LDZ A;  4ELP A;  1TFD A;  1SW2 A;  3H06 B;  1LB9 A;  2A5T B;  4YKP A;  1YAE A;  4KCD A;  3N94 A;  1S50 A;  3VVF A;  2DWJ A;  3IX1 A;  4MNI A;  1PBP A;  1FPD A;  4WKM A;  3RNN A;  3B6Q A;  3TMG A;  2XHD A;  4MCO A;  4MBP A;  4ZEC A;  3IOW A;  3S9N C;  4KCC A;  2I3W A;  4BDL A;  1MPC A;  3KOS A;  3MVZ A;  3IFC A;  5F24 A;  1MXW A;  4H1X A;  2F78 A;  1JVY A;  3TQW A;  4ZE9 A;  4C1T A;  1B6H A;  4Q5T A;  1IMF A;  4R74 A;  3FAS A;  4PDD A;  5DVF A;  3SEV A;  3ZKK A;  3MST A;  4BDM A;  1FJ6 A;  1ZBM A;  4I62 A;  4UA8 A;  4FIM A;  1US4 A;  4NQ8 A;  3GBB A;  4N17 A;  4XF5 A;  3C32 A;  1VDW A;  3O6H A;  1N7W A;  3T96 B;  5I57 A;  3PD8 A;  3FD3 A;  2HAU A;  3OSR A;  3T9V A;  4FBP A;  2Q8M A;  4H5F A;  4PGN A;  2REJ A;  4BLA A;  1EYJ A;  2DE3 A;  4KPT A;  4U4X A;  2GFE A;  4G4P A;  3C34 A;  4HCW A;  1FBH A;  1B3L A;  1UTH A;  5J1D A;  4O7I A;  3C35 A;  1DPP A;  1A55 A;  1JEV A;  2JJK A;  5I84 A;  3RY3 A;  4O3B A;  3S4U A;  5ET5 A;  2ALU A;  4K3F A;  4QSE A;  3TAJ A;  3K1M A;  5AA2 A;  3HCQ A;  5TPA B;  5I2K B;  4GWX A;  2O51 A;  5CMB A;  5DT6 A;  4X1B A;  2DWI A;  2GHA A;  2GRV A;  3QAX A;  4FAJ A;  2XWV A;  3BKI B;  2PFY A;  3TTM A;  5H8S A;  4E0X A;  4FEB A;  1ELJ A;  1XC1 A;  3M3L A;  1Y1Z A;  3L6G A;  1FTO A;  1NV5 A;  4G77 A;  3O97 A;  4ND9 A;  3UOR A;  3FVO A;  4OFL A;  2A5S A;  1LEV A;  4ZEB A;  4R75 A;  2H98 A;  5IZ3 A;  3TFL A;  3RPL A;  4NX1 A;  1XS5 A;  2OLB A;  3BFU A;  2XXP A;  2RF1 A;  3LSX A;  3UA8 A;  1NMU A;  3K02 A;  5A5X B;  5DVI A;  3T9H B;  4H0W A;  3P7I A;  2Y7R A;  4OVT A;  1ZLQ A;  2Z8F A;  3HPI A;  3BFT A;  4C0R A;  3HN0 A;  3BIG A;  3UIF A;  4UAB A;  5M2V A;  4KYE A;  1JW1 A;  1SW5 A;  3R26 A;  3G3F A;  3C36 A;  1NV7 A;  5CRY A;  4R6Y A;  1NL5 A;  3EHT A;  3K6V A;  4YB6 A;  4LVQ A;  5I58 A;  4ZEI A;  1NNF A;  4NF5 B;  1FPI A;  4ELO A;  4N81 A;  4R6K A;  3G3I A;  1B32 A;  1T0K A;  4Q0C A;  4OAN A;  5H8Q A;  1P1Q A;  3OOA A;  2XXT A;  1CNQ A;  2HXR A;  1Y3N A;  2B4M A;  1SYI A;  1LFH A;  1D3K A;  4P1E A;  2GH9 A;  2ESN A;  4O94 A;  2FNC A;  3K01 A;  3EN3 A;  3IO4 A;  2Z8D A;  4NWD A;  3RPW A;  4PAI A;  4R2B A;  3Q27 A;  5TP9 A;  3LUZ A;  5AA4 A;  4KFQ A;  4NF8 A;  3QSL A;  1SQY A;  4R72 A;  4AS5 A;  1ZJL A;  2B3F A;  3PMW A;  5H8N A;  1Y20 A;  4DCY A;  4PFR A;  4H67 A;  3CSG A;  2PFZ A;  4IGT A;  3VV5 A;  1LFG A;  2ZZX A;  2D5W A;  4GRK A;  2DP8 A;  5JTY B;  4E0W A;  5IGA A;  1NI9 A;  3RUM A;  1D9Y A;  1I6B A;  2OCU A;  3TQL A;  4H8I A;  2ZMB A;  5KDT A;  5I5P A;  4R73 A;  2DE4 A;  4HW8 A;  1KA0 A;  1JEU A;  4QBA A;  3LUY A;  1FBE A;  4PCD A;  2PMS A;  5K2X A;  3TOD A;  3SER A;  3PPO A;  1LST A;  5EYG A;  1MY2 A;  2HQ0 A;  3FV2 A;  4NHB A;  1N04 A;  4O8M A;  4QXD A;  5JK4 A;  1FTK A;  2QSX A;  1MQD A;  3LV0 A;  4NF4 B;  3GLB A;  3WAE A;  4TQU Q;  4N6D A;  1A8E A;  1SVX B;  2GHB A;  4FEC A;  4NG7 A;  1ZU0 A;  1I6A A;  2HXW A;  1P1O A;  5H8F A;  2OWZ A;  3NOH A;  1LBX A;  1IME A;  1UTB B;  1NNT A;  4LQ5 A;  1O63 A;  3MC2 A;  3KN7 A;  3N6T A;  2NUV A;  2I0B A;  4JWX A;  2F5X A;  4GL8 A;  1FQC A;  3FV1 A;  1LCT A;  3ILT B;  2DOJ A;  4TLM B;  1K9Y A;  1M5C A;  2Y7W A;  4JVI A;  5ITO A;  4M4G A;  2DXR A;  1PEB A;  5EQ9 A;  2DSF A;  2ONK E;  2B4L A;  2NOO A;  4DCX A;  3MZB A;  4RK9 A;  1TWY A;  1R1N A;  3TCG A;  2P1S A;  2R9J A;  4P9K A;  1SYH A;  3KOT A;  3O2A A;  3CSB A;  2ZZV A;  4PBH A;  3PPR A;  4XKN A;  2VD2 A;  4Z7E A;  1GR2 A;  1QKB A;  4MLQ A;  1O7T A;  5IAI A;  1OQG A;  2IEE A;  3KG2 A;  3KN8 A;  3C33 A;  2XX9 A;  1Z7M E;  1B51 A;  4R2F A;  3SDF A;  5ISU A;  4GX6 A;  3GYY A;  4O7M A;  1RDX A;  2X7P A;  3K1N A;  2V84 A;  1JVX A;  4NTL A;  1LBW A;  4QFO A;  1POT A;  2R6G E;  5I7I A;  4F19 A;  5L9S A;  5CMM A;  4QF9 A;  1NV6 A;  2WBB A;  4OHN A;  4YB5 A;  1I6Q A;  5I2N B;  3MQ9 A;  3S9M C;  4HE1 A;  1QW0 A;  2DWH A;  1TFA A;  3M8U A;  3ONM A;  3RTW B;  5AA3 A;  4H45 A;  3DEL B;  1XVY A;  3MP6 A;  1LAF E;  4N91 A;  1NUZ A;  3KSX A;  3RTF B;  1II5 A;  4PGP A;  3KC0 A;  3HHF A;  4KXP A;  4G68 A;  1IMD A;  3ZSF A;  4KYS A;  3JZJ A;  5ELV A;  4HXV A;  4O3A A;  2CZK A;  3PPQ A;  4NWC A;  4F1U A;  5ET6 A;  2W7Y A;  3HO7 A;  5I56 A;  2Q9T A;  4G8M A;  1B7Z A;  2ZNU A;  4POW A;  3RQT A;  1RYO A;  1OMP A;  5K2Y A;  1MM6 A;  1MY4 A;  1USY E;  3SES A;  3I3V A;  5TU0 A;  4QFL A;  1IZ1 A;  3FXU A;  3MW0 A;  4MFI A;  1LBV A;  3G3K A;  1NH7 A;  4PBQ A;  4MH5 A;  3ECR A;  3MJN A;  4OWD A;  4I1D A;  5ET8 A;  5KCJ B;  1OLA A;  5CMC A;  3H6U A;  1QUJ A;  3IOT A;  4EQ7 A;  2F3B A;  2PCR A;  1JW4 A;  1WOD A;  3UGW A;  1P1U A;  4XFE A;  5CBS A;  3FJM A;  1XI6 A;  2KQZ A;  4F2O A;  1BK4 A;  4IY6 A;  3K00 A;  3E3K A;  1B3G A;  1DBZ A;  4P56 A;  4UAC A;  4ELQ A;  3EQ1 A;  1EU8 A;  3VXC A;  1K9Z A;  1IMC A;  3W15 C;  4U21 A;  2QS2 A;  3MVY A;  4PP0 A;  3D4G A;  2A5T A;  1SI1 A;  3IOR A;  4AQ4 A;  4JB7 A;  4LA9 A;  1B2H A;  3QUF A;  2R71 A;  4TLL B;  1B5I A;  1B1H A;  1IMA A;  3U93 A;  1ZTY A;  2DS9 A;  4OA4 A;  2F7C A;  2XX7 A;  1YPN A;  2WKY A;  2HEU A;  3T9X B;  3IO6 A;  4OFO A;  1FQB A;  4U4S A;  3RYD A;  5A5L A;  4DI3 D;  1HSL A;  4P3L A;  2VPN A;  1GTK A;  2QS1 A;  3M3K A;  1EH3 A;  1H43 A;  4DXC A;  1Q35 A;  3LSL A;  1B4Z A;  1XVX A;  4GL0 A;  2RIN A;  3U65 A;  4ZE8 A;  3O28 A;  3O6G A;  4L17 A;  3O9P A;  5CBR A;  3TPA A;  3UK4 A;  1IUD A;  3MVW A;  5IM2 A;  4OZ9 A;  2QS4 A;  4X8R A;  2QVR A;  1P99 A;  3LC8 A;  2QRY A;  2XXY A;  2H4I A;  1QKA A;  4HS7 A;  1FQF A;  2ONR A;  3PD9 A;  2FYI A;  1LAG E;  5BUU A;  4PFB A;  3U8Q A;  2O7U A;  4F3B A;  3OMB A;  4JWO A;  3EF7 A;  4EQ9 A;  2XX8 A;  1IIW A;  3IFA A;  3HV1 A;  3OSQ A;  1IXI A; 
#chains in the Genus database with same CATH homology
 2FVZ A;  3B50 A;  4OAN A;  4M1V A;  1NV2 A;  1CNQ A;  2HXR A;  2B4M A;  4G61 A;  4P1E A;  4O94 A;  4GWZ A;  4P47 A;  5T3J A;  1FJ9 A;  4HCY A;  2FIX A;  4PAI A;  4YIC A;  2ZZW A;  4HE2 A;  3LUZ A;  3QMF A;  5J16 A;  3W9V A;  2GQ1 A;  4AS5 A;  4GWU A;  4P1L A;  4XEQ A;  4GX4 A;  4PFR A;  1FBC A;  4IR8 A;  2PFZ A;  2DVZ A;  4OVQ A;  1YZ0 A;  5I3S A;  2ZZX A;  1FRP A;  1LBY A;  2R8T A;  5IGA A;  1NI9 A;  1NUX A;  2CEX A;  1FBD A;  1NV1 A;  4P8B A;  2WEF A;  4F1V A;  5I5P A;  2WX9 A;  1RDZ A;  2DE4 A;  5IZ1 A;  1KA0 A;  2Y5L A;  2QFL A;  4QBA A;  4X9T A;  1FBE A;  4PDH A;  2BJI A;  4PCD A;  5ET7 A;  1FBP A;  4PE3 A;  5EQ7 A;  5EYG A;  1YXI A;  4NHB A;  4O8M A;  4QXD A;  5EQA A;  5JK4 A;  3LV0 A;  1FPF A;  1JP4 A;  4GBV A;  4N6D A;  3W9W A;  4AS4 A;  4NG7 A;  4I40 A;  1DCU A;  1FBG A;  1FPE A;  2HPG A;  4N15 A;  2OWZ A;  3NOH A;  1LBX A;  4PF8 A;  4MJO A;  3KBZ A;  1IME A;  3SZP A;  2F5X A;  4N8G A;  5CM6 A;  2VT5 A;  1FPG A;  2FBP A;  4PTK A;  1EYK A;  4MNP A;  1K9Y A;  4JVI A;  4DI4 B;  2FHY A;  4N6K A;  1FTA A;  5EQ9 A;  2MKZ A;  3T0J A;  1FPL A;  3HFU A;  2B4L A;  2FIE A;  1FBF A;  1KA1 A;  5IZZ A;  2P3V A;  3CHG A;  2V3Q A;  2QVU A;  4P9K A;  5FBP A;  4MAG A;  4LN5 A;  1NV0 A;  2ZZV A;  4PF6 A;  1EYI A;  2Y5K A;  4PBH A;  4N8Y A;  2HHM A;  4GWS A;  1G0H A;  2WYK A;  4H46 A;  3ISP A;  2XWO A;  3MYU A;  2Q74 A;  1G0I A;  2DE2 A;  3FXB A;  2DDK A;  3E79 A;  1INP A;  3EKI A;  2CZI A;  4I3Y A;  2L5V A;  4PFI A;  4GX6 A;  1IMB A;  3GYY A;  4O7M A;  1FPB A;  4OVR A;  1RDX A;  5LDZ A;  1DK4 A;  1LBW A;  2XA5 A;  2OX3 A;  2CEY A;  1AWB A;  5I7I A;  4F19 A;  2VPO A;  4MNI A;  1FPD A;  1NV6 A;  2WBB A;  1NUY A;  4MHF A;  1QGX A;  4MCO A;  4HE1 A;  3IFC A;  4JVC A;  4H45 A;  5F24 A;  4N91 A;  1YYZ A;  5ESY A;  1NUZ A;  4OVP A;  1D9Q A;  4GBW A;  5IZ3 B;  4NAP A;  3RPL B;  3KC1 A;  4PGP A;  3KC0 A;  4X04 A;  4KXP A;  1IMD A;  4HXV A;  1IMF A;  2CZK A;  4PDD A;  4GX3 A;  3MST A;  4F1U A;  5ET6 A;  1FJ6 A;  2Q9T A;  2HZK A;  4NQ8 A;  4N17 A;  4XF5 A;  1VDW A;  5DW8 A;  2CZH A;  3PTY A;  4PET A;  2P3N A;  1LBV A;  1SPI A;  4FBP A;  4PBQ A;  2Q8M A;  2HZL A;  4F18 A;  2F3D A;  4PGN A;  5EQ8 A;  1EYJ A;  2DE3 A;  5ET8 A;  3FBP A;  4I3E A;  4PAK A;  2F3B A;  2PCR A;  4N4U A;  4HCW A;  1FBH A;  3ROJ A;  4PC9 A;  1NUW A;  5J1D A;  4XFE A;  4O7I A;  3BIH A;  2V4C A;  1XI6 A;  2KQZ A;  1BK4 A;  2JJK A;  3D1R A;  4NF0 A;  5ET5 A;  1NV3 A;  1DBZ A;  4P56 A;  2WYP A;  2XXK A;  1K9Z A;  4GWX A;  1IMC A;  4MNC A;  5LTC A;  3A29 A;  4OVS A;  2WBD A;  2XWV A;  1KZ8 A;  1Q9D A;  2PFY A;  3B8B A;  4MEV A;  4GWW A;  1LBZ A;  1IMA A;  4OA4 A;  1RDY A;  1FSA A;  1NV5 A;  4JVD A;  4MX6 A;  4HE0 A;  4MMP A;  1LEV A;  3RYD A;  5IZ3 A;  5A5L A;  1FPJ A;  3RPL A;  4GWY A;  4DI3 D;  4NN3 A;  4NX1 A;  4P3L A;  2VPN A;  2XWK A;  2QPQ A;  3U65 A;  2QVV A;  3E78 A;  4OVT A;  4NGU A;  1FPK A;  2XWI A;  1NV4 A;  5IM2 A;  3BIG A;  4UAB A;  4X8R A;  2QVR A;  2KR0 A;  5EYH A;  4PAF A;  1NV7 A;  3T1B A;  4MIJ A;  4PFB A;  1FPI A;  4YZZ A;  3IFA A;  4N81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...