1SI0A

Crystal structure of mannheimia haemolytica ferric iron-binding protein a in a closed conformation
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
316
structure length
316
Chain Sequence
ANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELSPADVLLTVDISRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDRVGKLPAGFDYLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKANLARKPQGGDRDQVKAIKEGICDYSIGNSYYYGKMLDDEKQKSWAEAAIINFPSGEHGTHKNISGVVIAKHSPNKANAVKLIEYLSGEKAQGLYAELNHEYPVKEGIEPSAIVKGWGTFKSDTIKLEDIAKNYEAALKLVDEVKFDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords iron binding protein FbpA
publication title Structural basis for iron binding and release by a novel class of periplasmic iron-binding proteins found in gram-negative pathogens.
pubmed doi rcsb
source organism Mannheimia haemolytica
total genus 126
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2004-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1si0A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1si0A02
2IA4A 2UVGA 3SETA 3IAZA 4C1TA 4H65A 4IO3A 2DWIA 4Q8RA 1DTGA 4XKQA 3QXMA 4JBZA 2RF1A 1SBPA 2OLBA 4I62A 3SEXA 1VSOA 1MQJA 1FQDA 3VXBA 4GOTA 4DDDA 3FASA 3KN3A 5AA1A 3VLVA 2GHAA 2QS2A 1N7XA 1UQWA 3MAMA 1Z7NE 3C34A 5TU0A 5JEIA 1YPNA 2ALUA 1JQFA 2V25A 2F7BA 1D3KA 1QJMA 2VP1A 3T9UA 3K6WA 2DSFA 1FTMA 1UTHB 2DP8A 4LZ5A 3ZSFA 4U4XA 2F78A 3QSLA 1LSTA 2M8CA 4OFJA 2D3IA 1FW0A 3USDA 3IB0A 4WKMA 1A55A 4Q5TA 3CR9A 4PFYA 4ZDMA 5ICQA 2OZZA 2D21A 3EQ1A 4IY6A 4EDPA 1MDQA 1Y1ZA 1AIVA 4JWXA 3CFXA 3G3IA 1MY4A 2RINA 2ANJA 1S50A 1RKMA 3BKIB 5H8QA 1QVSA 3K1NA 2E0SA 2P0SA 1IXIA 2DWHA 3KSJA 1B3FA 1B5JA 2PMSA 3VV5A 2XHDA 2YJPA 4R6YA 1B5IA 5B7DA 1ZMGA 3FVNA 3M3LA 4POXA 2OBGA 4GLIA 3MP8A 3R26A 3EHTA 2QS3A 4JSDA 4JWYA 2F7CA 2XD3A 4QFLA 5CC2A 1XOCA 1POTA 3ILUB 3TQWA 3K6XA 1B1HA 4JB7A 5DVJA 4QRZA 4GF8A 4DE8A 5A5XA 4R6HA 1SI1A 4HTGA 3FXQA 1ANFA 4ZZAA 1OVBA 3T96B 3MVXA 2B3BA 4WXJA 3E4RA 2Y7PA 2Y7IA 3H4ZA 4R6KA 5JTYB 1MQIA 1Y4CA 3AXFA 1M5FA 1US4A 2QS4A 1S9TA 2ZYOA 2NXOA 4OFLA 1R6ZA 1SYHA 1MM6A 3DP6A 3CG3A 1IXGA 3KJ7A 4OTEA 1IEJA 4LP2B 1QKAA 3RLFE 1I69A 3KFMA 1B2HA 4E0XA 2NOOA 4JSOA 1IXHA 2O1LA 3Q27A 1MH4A 2O68A 4FJPA 5CMMA 5A5XB 3O66A 3JZJA 5H8HA 2XXWA 1IQ7A 4OHNA 2HZLA 4OQOA 3OEMA 1FTKA 2LAOA 3UGWA 4NEDA 1LAXA 4L17A 1NNKA 4UA8A 3FJMA 1NMUA 4JXIA 3N26A 3S2VA 3FV2A 2VGQA 4GXAA 4O3CA 1P1OA 5BWJA 4R9FA 1IIWA 1JVXA 3RUMA 1NNPA 3U93A 4ELPA 3EHUA 3IL1B 3C32A 2X7PA 4GL8A 1URDA 4YAHX 2DVZA 4MBPA 1D4NA 3I6VA 4AQ4A 3TTKA 3SEYA 1P1QA 1WVJA 4OMBA 5H8HB 3H6WA 1ATGA 3H03A 2P2AA 3Q25A 2DOJA 4U1ZA 5AA2A 3LSLA 3LUYA 4PFWA 4RPOA 4TQUQ 1PB8A 2DYXA 2XXRA 2W7YA 4ZEIA 3KZGA 4ZZEA 3PPOA 3GBAA 3V5AA 4FECA 2XXPA 2DE3A 1QUJA 4F19A 4IO5A 1IITA 3M8UA 2UYEA 4NMYA 3UK4A 4FE8A 3K6VA 5H8FA 1B51A 3CFLA 4K3FA 1MXZA 2X7QA 1SW4A 4YICA 1PB7A 5DVIA 1A40A 1MY2A 4NWDA 4QHQA 3K6UA 3K02A 3D4CA 1F9BA 5I56B 3PUYE 3IB1A 2NWJA 4NF5A 1ZTYA 3RPWA 2A5SA 4WEDA 3PUVE 5TP9A 4G8HA 4LZ7A 3O6GA 3O2AA 4RYAA 2XXQA 2WKYA 1ELJA 1ZBMA 2CZLA 4F3PA 2OCUA 4F2QA 5CBRA 2XXVA 4KYSA 3K2DA 5H8FB 1QUIA 3FZVA 3B6WA 5FTHA 2UXAA 3N5LA 4E0WA 3EN3A 3ZKKA 4THIA 4FEBA 1QUKA 4ELQA 5ICTA 1M5BA 3PPNA 2PT1A 3I3VA 4QF9A 3ZS6A 1H45A 3OSRA 3U8QA 4YKIA 1H44A 4NF6A 4U21A 3TTLA 3O97A 3W15C 2GFEA 4TOZA 4JWOA 5TP9B 2Y7WA 1SYIA 4GXSB 2E1SA 2RKMA 3K1MA 4MLVA 1AMFA 1M5EA 4I8CA 1R1NA 5ITOA 3RN8A 1SD3A 4GRKA 5L9SA 3GLBA 1B3EA 2DXRA 2H98A 1O7TA 1LAHE 4GWOA 1TFDA 2G29A 2REJA 3C9HA 1FQCA 3O29A 4ZEBA 5FHMA 2ZXTA 2F97A 2H4IA 4H6DA 3MQ9A 4YZZA 3CFZA 2AL4A 3KG2A 3HN0A 4Q0CA 3MPKA 4EXLA 1M5CA 1ZLQA 5ITPA 1BKAA 4ZE8A 2ZNTA 3SEVA 3DLNA 2DE2A 3PUZE 2Q2CA 1MQDA 3FXUA 4LATA 2O7UA 4M4GA 3MP6A 3G3GA 2F6GA 2Y84A 3QUFA 1BP5A 4KCDA 1ZKBA 3TMGA 4EQ9A 3TEPA 1GGGA 4G8NA 4BDMA 2HAVA 3UA8A 5EHSA 3O6IA 5AA3A 3TPAA 1AH5A 4DXUA 4H1XA 4H5FA 4MH5A 1DPEA 3L6GA 2H9BA 3K0VA 3FVKA 5I2NB 3PPRA 1US5A 1MY0A 3OSQA 1Y4TA 4MFIA 1Y3NA 1FTJA 1Y20A 2DE4A 1URSA 3TCHA 1UIUA 2PBWA 3G3JA 1KWHA 1VFEA 2A5TB 1MQGA 3U94A 4DZ1A 3LSXA 3TODA 3IB2A 5DTBA 1J1NA 4NE4A 3K00A 4KYEA 1N04A 3W9WA 2XXYA 1CB6A 5CI5A 4TLMB 3FJGA 3FVOA 3FD3A 5HBCA 1B7UA 3MZ9A 4IY5A 2OK2A 1OLCA 5EHMA 1MPCA 3JYRA 2THIA 1SDXA 3KJTA 3OENA 4ESXA 4HCWA 1UTBA 3V83A 2O1MA 2OWSA 1B9JA 2PX1A 5I59A 4AB6A 2H5YA 5ELVA 4N6PA 5JTYA 4NWCA 5BUUA 4R75A 4QFPA 3N6UA 1NH7A 4IO7A 3LR1A 2Z22A 3D4GA 4H8JA 2Z8EA 4H5GA 4YMAA 4OWDA 1PEBA 3L6HA 4EUOA 2DWAA 3M3FA 1WODA 5ISUA 4ELOA 1P1UA 3DELB 3I5OA 4I1DA 5JK4A 1SW1A 4NF8A 1B6HA 4LA9A 4RPNA 1N76A 4F22A 1P1NA 4OEUA 3O9PA 1UTBB 4HW8A 3PPPA 1LB9A 2ONRA 3EHSA 5I59B 3CRBA 1OQHA 1YCJA 3BBRA 3MUQA 3Q26A 1EZ9A 1RYXA 3RQTA 4G8MA 2I3WA 4U4SA 4FORA 4DCYA 5L9MA 1MH3A 1SW5A 5AA2D 2VHAA 2Y7KA 3RTWB 4X1BA 5LOMA 1WDNA 3BFUA 1O63A 1NH8A 3FUZA 1OLAA 3CSGA 3P7IA 4NF8B 3IORA 5I58B 4F31B 3LBSA 4X9TA 4G77A 4UACA 4GD5A 1SQYA 2QJEA 4YKKA 2R6GE 4R2FA 3SEWA 1FQAA 3SEUA 5I57A 3S9MC 1ZJLA 1USYH 4LZ8A 3IJOB 4TLLB 1N84A 1LGBC 1MPDA 4U1OA 1URGA 2Z23A 4OVJA 3GBBA 4DXBA 3OO7A 3TTMA 1N3WA 1B4HA 3QYTA 5CBSA 3MWBA 2V3QA 3C4MA 3KEIA 3U92A 3OD7A 4QFOA 4BDLA 2I48A 1UIVA 1D9VA 1BTJA 3VXCA 1LFIA 4DCXA 3IO4A 5I56A 4X1DA 1B4ZA 2IEEA 1NL5A 5I57B 1LFGA 2R71A 1JW1A 3PMWA 3R6UA 3QAXA 2YLNA 4KHZE 1IUDA 1BIYA 5CMKA 1DPPA 3G3HA 1S7YA 1LBCA 1B0HA 4Z7EA 3G3FA 2BJJX 3MVYA 3OO9A 3HO7A 1OIBA 3IOTA 1DSNA 2AIXA 3DM0A 2ZMBA 3C35A 4G4PA 3VLWA 1MRPA 1FTLA 3TCFA 3ODBA 1Y3QA 2RC7A 4KPTA 1A8EA 1R9LA 2Q88A 4QSDA 2O51A 3UIFA 1HSEA 2KLFA 4EQ7A 4XKPA 4PFUA 3H7MA 2R9JA 1PB9A 3N6TA 1POY1 3Q29A 1MPBA 1D9YA 4XXUA 4ZEDA 4ND9A 1JVYA 2HEUA 1B7ZA 1HSLA 1B3HA 1IXCA 2GRVA 1B3GA 1LAGE 3FVGA 4YB6A 4H67A 3MVZA 4PQJA 1PBQA 2RC8A 4NF4B 4QFKA 4ZE9A 1B3LA 1I6AA 3IX1A 1GTKA 5H8SA 1FQEA 4P11A 1EU8A 2O69A 4OENA 1PC3A 2Q89A 1MDP1 1B7HA 3FIRA 3TQLA 2AYSA 1Y3PA 1JW4A 3RTFB 1MXXA 4DXCA 3UORA 5KCJB 2F35A 3HSTA 3PPQA 3RT6B 4RJZA 3KBRA 3Q28A 4YU0A 4N13A 3V89B 3RNNA 3FXRA 3PU5A 3SKPA 2XX9A 1BLFA 2FNCA 3O6HA 3OO6A 3MW0A 3TCGA 4R74A 5K2XA 3CG1A 3EPEA 3IO6A 2DVCA 3IJXB 1OVTA 3B7DA 3MBPA 1EH3A 4Q30B 2NUVA 1DMBA 2DXYA 4ELRA 1NKXA 4YB5A 1MY1A 1AL3A 2H25A 5I2NA 1XS5A 3PD8A 4C0RA 1I6BA 1LB8A 4HS7A 4U23A 2B65A 1MG1A 4U22A 4Z0IA 3TFLA 2H99A 2F34A 4F18A 2A5TA 3VVDA 4POWA 3IK6B 1AOVA 1B0LA 2F7AA 2CMOA 1TXFA 4G68A 4NTLA 4ZECA 3QUJA 1VR5A 1B40A 3HPIA 2V3TA 5FHOA 3F11A 2O7IA 4JDFA 3SERA 2QRYA 2Z8DA 1Y1MA 3PV0E 3G7WA 4P0GA 4PETA 1JEVA 2ONKE 2D5WA 5CRYA 1B05A 1MXVA 5DT6A 2ZYKA 3KOTA 5L8DA 1L5TA 1A8FA 3WAEA 4YMBA 5FHNA 2HFBA 2GH9A 3HV1A 2NVUB 3A09A 5K2YA 4R73A 2O84X 4M1VA 4F3SA 3SESA 4KD5A 5EYFA 1YAEA 3E9XA 2DWJA 3CSBA 5F7VA 2REGA 2RC9A 4ZS9A 4MF3A 4GFRA 4G68B 4G68C 1DOTA 1USYE 1PDAA 1CE2A 4F39A 2I4CA 5HPQA 1LLSA 1MY3A 1M5DA 1B58A 4RK9A 5DVFA 1P99A 1MS7A 1Q1KA 3TAJA 1VFDA 1B5HA 4F3BA 3RGYA 2F8DA 4N07A 4DLDA 3FGSA 2RCAA 4IO4A 3ZKLA 4KFQA 3DP8A 2XXUA 3FV1A 3MVWA 5M2VA 3W9VA 1YTVA 2QMXA 4R72A 5CMCA 1B1XA 1B46A 3TTNA 4QSCA 3T66A 2ESNA 4IO6A 3PMXA 4OESA 2XD2A 3A3UA 3H6UA 1XVXA 1RYOA 3S9NC 3H3GA 3MC2A 2I0BA 1XVYA 4OFOA 3QK6A 5IKBA 3H06B 4ZEFA 3UN6A 1SI0A 4XIGQ 1II5A 4X48A 4RY1A 1Q35A 3PUWE 5F1QA 3EF7A 3GXAA 5I58A 3CIJA 4PP0A 3T9VA 4C1UA 1LAFE 1Y9UA 4EF1A 5KDTA 1H76A 4ESWA 4BDRA 1LBBA 3LC8A 2HCAA 1N7WA 4KQPA 3TYHA 1FCKA 1A7LA 3OO8A 2ONSA 1FQBA 3SDFA 3ILTB 3LSWA 1DTZA 3TZAA 1SVXB 3VVEA 4LQ5A 3VE1B 5H8QB 4YKPA 2PT2A 4FATA 1JW5A 3PGFA 2Z8FA 3CI8A 1TWYA 4LUBA 3KGCA 2Q8JA 3QIMA 1ZIUA 3IR1A 2XXXA 3S9LC 4OYVA 3H6TA 2V84A 3S4UA 1EZOA 5KDTB 2QPQA 4O3AA 3V8XB 4F1YA 3C33A 3K1PA 2XXTA 3E3KA 4LONB 2HQ0A 3MZBA 3TKDA 1JNFA 4I9DA 2F6PA 4ISUA 4BDOA 4BDNA 3THIA 3HHGA 3N94A 3KN7A 4ECFA 3HCQA 5H8NA 4F29A 4RNSA 4U2RA 2ZYMA 3T9HB 2VD2A 1B52A 1QULA 4FAJA 2QSXA 4HCYA 1FTOA 2G93A 4PFTA 3OEKA 1LFHA 3R7XA 1Z7ME 5AE4A 1JETA 3VDFA 2XX8A 3OOAA 4OERA 4PE5B 3ONMA 4ZEKA 2Q9TA 3K01A 1LCTA 1P1WA 2PYYA 3GZGA 3MP1A 2VOZA 2B3FA 3VVFA 3T22A 2OWTA 2VD3A 1HSJA 4QSEA 4GQOA 3FJ7A 3A3CA 3K4UA 4BLAA 3OXNA 4GL0A 3OMBA 3KN8A 3TELA 4YKJA 5DEXA 2ZNSA 1MXYA 3TUSA 5H8NB 1XT8A 1GR2A 3B6QA 4F1UA 5J1DA 2Q2AA 3CVGA 2PVUA 4NF4A 1QKBA 2XX7A 1OMPA 4P0IA 1R9QA 3PD9A 1XC1A 3TDJA 1A54A 2FYIA 4F1VA 4ONYA 2ZNUA 4OXVA 1N3XA 3O28A 1T0KA 1LCFA 3DP4A 4O3BA 4OEVA 3LSFB 5IAIA 5TPAA 4GIZA 2X26A 4IO2A 2DS9A 5KCJA 4IGTA 3PUXE 3U72A 3HHFA 2ZYNA 1I6QA 3VLUA 1NFTA 3UP9A 2V3UA 1NNTA 5I2KA 1XHYA 3T93B 2HAUA 2I49A 5AA2B 2QMWA 5CM6A 5L9OA 1FQFA 4DIGA 3E13X 1B32A 4FIMA 2UVHA 4R2BA 4RXLA 5DEXB 4IB2A 2DQVA 1QW0A 3JV9A 2ABHA 4KR5A 3IOVA 3RY3A 4OZ9A 4QFNA 3IOUA 5FTIA 4GVOA 4RK2A 3PMVA 2OJTA 4G2ZA 2XXIA 1MQHA 3H6VA 4LVQA 4EF2A 3T9XB 2XXHA 2UYFA 4RA1A 1ZU0A 4KYDA 2O6AA 2F36A 2FA7A 4FEDA 1GVCA 1A99A 5AA4A 3MPLA 5TPAB 4OETA 3C36A 1IZ1A 4XKNA 1VE4A 1JEUA 4YB7A 4KCCA 5I2KB 5CMBA 3ECRA 1TT1A 1N0TA 4IGRA 4NF5B 2V93A 4F2OA 4H0WA 4XTCQ 1MXWA 5HM4B 2F5XA 1TFAA 1H43A 1SW2A 1GV8A 2UVIA 3RT8A 2P1SA 3B6TA 3TTRA 2GHBA 2RCBA 4AB5A 2I3VA 2AL5A 4F3GA 4LQ2A 2I58A 3OELA 1O64A 3FATA 5AA4B 3G3KA 1MXUA 2YPNA 3KOSA 3M3KA 1OQGA 2UVJA 3S9EA 5KZTA 3BFTA 1MM7A 3VFJA 2QS1A 5DYHA 2QL3A 5B70A 3MZ1A 5I84A 2HZKA 3U1OA 1EZPA 4WEPA 4R9GA 2Y7RA 4EQBA 4KI0E 1NNFA 3C31A 4NF6B 3IOWA 3KSXA 4H8IA 4BDQA 3WAFA 2I6EA 3MJNA 2I4BA 1PBPA 2HXWA 4EXKA 1UTHA 2I0CA 1H3DA 4MLQA 4XKRA
chains in the Genus database with same CATH superfamily
2IA4A 2UVGA 3SETA 1IMAA 3IAZA 2QVUA 4C1TA 4H65A 4IO3A 2DWIA 2CZIA 4Q8RA 1DTGA 4XKQA 3QXMA 4H46A 4JBZA 2RF1A 1SBPA 2OLBA 4I62A 3SEXA 1VSOA 3E78A 1MQJA 1FQDA 3VXBA 4GOTA 1FPBA 4DDDA 3FASA 3KN3A 5AA1A 2WBBA 3VLVA 2GHAA 2QS2A 1LBVA 1N7XA 1K9YA 1UQWA 3MAMA 1Z7NE 3C34A 2QFLA 5TU0A 5JEIA 1YPNA 2ALUA 5ESYA 1JQFA 2V25A 2F7BA 1D3KA 1QJMA 2VP1A 3T9UA 3K6WA 2DSFA 1FTMA 1UTHB 2DP8A 4LZ5A 4N15A 3ZSFA 4U4XA 2F78A 3QSLA 1LSTA 2CEXA 2M8CA 1INPA 4OFJA 2D3IA 1FW0A 3USDA 3IB0A 4WKMA 1VDWA 1A55A 2PCRA 4Q5TA 2L5VA 3CR9A 1LBZA 4N8YA 4PFYA 4ZDMA 2OZZA 5ICQA 2D21A 1EYIA 3EQ1A 4IY6A 4EDPA 1MDQA 1Y1ZA 1AIVA 4JWXA 3CFXA 3G3IA 2VPNA 3RYDA 1MY4A 2RINA 2ANJA 1S50A 1RKMA 3BKIB 5H8QA 2P3VA 1QVSA 3GYYA 3K1NA 2E0SA 4XF5A 2P0SA 1IXIA 5IZZA 2DWHA 3KSJA 1B3FA 1B5JA 2PMSA 3VV5A 2XHDA 2YJPA 4GWXA 4R6YA 1B5IA 5B7DA 1ZMGA 2WX9A 3FVNA 3M3LA 4POXA 2OBGA 4GLIA 3MP8A 3R26A 3EHTA 2QS3A 4JSDA 4JWYA 1K9ZA 2F7CA 2XD3A 4QFLA 5CC2A 1XOCA 1POTA 3ILUB 4N6KA 4P1EA 4PCDA 3TQWA 3K6XA 1B1HA 4JB7A 5DVJA 4QRZA 4GF8A 4DE8A 5A5XA 4R6HA 1SI1A 4HTGA 3FXQA 4GX3A 5EYGA 1ANFA 4ZZAA 1OVBA 3T96B 3E79A 4JVDA 3PTYA 3MVXA 2B3BA 4WXJA 3E4RA 2QVRA 2Y7PA 2Y7IA 1NV7A 3H4ZA 4R6KA 5JTYB 1MQIA 1Y4CA 3AXFA 1M5FA 1US4A 2QS4A 1S9TA 2ZYOA 2NXOA 4OFLA 4QXDA 4OVTA 2XWIA 1R6ZA 1FPKA 1SYHA 1MM6A 3DP6A 3CG3A 1IXGA 3KJ7A 2GQ1A 4OTEA 1IEJA 4LP2B 1QKAA 2Y5LA 1EYJA 3RLFE 4GBVA 1I69A 3KFMA 1B2HA 1NV4A 4E0XA 2NOOA 4JSOA 1IXHA 2O1LA 3Q27A 1MH4A 2O68A 4HXVA 4FJPA 5CMMA 5A5XB 3O66A 3JZJA 5H8HA 2XXWA 1IQ7A 4OHNA 2HZLA 4OQOA 3OEMA 1FTKA 2LAOA 3UGWA 4NEDA 1LAXA 4L17A 1NNKA 4UA8A 3FJMA 1NMUA 4JXIA 3N26A 2FIEA 3S2VA 3FV2A 2VGQA 4GXAA 4O3CA 1P1OA 5BWJA 4GWYA 4R9FA 1IIWA 1JVXA 3RUMA 1NNPA 3U93A 4ELPA 3EHUA 3IL1B 3C32A 2X7PA 4GL8A 5J16A 1URDA 4GWWA 4YAHX 2DVZA 4MBPA 1D4NA 3I6VA 4AQ4A 3TTKA 4NQ8A 4PFRA 3SEYA 1P1QA 1WVJA 4OMBA 5H8HB 3H6WA 3KC1A 1ATGA 3H03A 2P2AA 4O8MA 1XI6A 3Q25A 2DOJA 4U1ZA 5AA2A 3LSLA 3LUYA 1KA1A 4PFWA 1FPEA 4RPOA 4TQUQ 1PB8A 2DYXA 2XXRA 3MYUA 2XXKA 2W7YA 4ZEIA 3KZGA 4ZZEA 2HPGA 3PPOA 3GBAA 4JVCA 3V5AA 1BK4A 4FECA 4O7MA 2KR0A 2XXPA 2DE3A 1QUJA 4PBQA 4F19A 4IO5A 1IITA 1NUYA 4MIJA 4MNIA 3M8UA 2UYEA 4NMYA 3UK4A 4FE8A 3K6VA 5H8FA 1FJ6A 1B51A 3CFLA 5ET7A 2WEFA 4K3FA 1MXZA 2X7QA 2PFZA 1SW4A 4YICA 4NGUA 1PB7A 5DVIA 1A40A 2MKZA 1MY2A 4NWDA 4QHQA 3K6UA 3K02A 4P47A 3D4CA 1F9BA 5I56B 3PUYE 3IB1A 2NWJA 3T1BA 4NF5A 1ZTYA 3RPWA 2A5SA 4WEDA 3PUVE 5TP9A 4G8HA 4LZ7A 3O6GA 3O2AA 2XWVA 4RYAA 3FBPA 2F3BA 2XXQA 2WKYA 1ELJA 1ZBMA 2CZLA 4F3PA 2OCUA 4F2QA 5CBRA 2XXVA 4KYSA 3K2DA 5H8FB 1QUIA 3FZVA 3B6WA 5FTHA 2UXAA 4N81A 3N5LA 4E0WA 3EN3A 3ZKKA 4THIA 4FEBA 1QUKA 4GWZA 4ELQA 5ICTA 1M5BA 3PPNA 2PT1A 4PGPA 3I3VA 4QF9A 3ZS6A 2Q74A 1H45A 3OSRA 3U8QA 4YKIA 1H44A 4NF6A 4U21A 3TTLA 3O97A 3W15C 2GFEA 4TOZA 4JWOA 5I5PA 2Y7WA 5TP9B 1NV3A 1SYIA 4GXSB 2E1SA 2RKMA 1LBXA 3K1MA 4MLVA 1AMFA 1M5EA 4I8CA 1R1NA 5ITOA 3RN8A 1SD3A 5ET8A 4NG7A 5EQ9A 4DI4B 4GRKA 5L9SA 3GLBA 1B3EA 2DXRA 2H98A 1O7TA 1LAHE 4GWOA 1TFDA 2G29A 2REJA 3C9HA 1FQCA 3O29A 4ZEBA 5FHMA 2ZXTA 2F97A 2H4IA 4H6DA 3MQ9A 4YZZA 3CFZA 2AL4A 3KG2A 3HN0A 4Q0CA 3MPKA 4EXLA 2JJKA 1M5CA 1ZLQA 5ITPA 1BKAA 3B8BA 4ZE8A 2ZNTA 3SEVA 4MCOA 4AS4A 2PFYA 3DLNA 2DE2A 5FBPA 2Q8MA 1LBYA 3PUZE 2Q2CA 4PF8A 1MQDA 3FXUA 4LATA 2O7UA 1RDXA 4M4GA 3MP6A 1FPDA 3G3GA 2F6GA 2Y84A 5ET5A 3QUFA 1BP5A 4KCDA 5IZ3B 1ZKBA 3TMGA 4EQ9A 3TEPA 1LEVA 1GGGA 4G8NA 3KBZA 4BDMA 2HAVA 3UA8A 5EHSA 3O6IA 5AA3A 3TPAA 1AH5A 4DXUA 4H1XA 4H5FA 4MH5A 1DPEA 3L6GA 2H9BA 1LBWA 3FVKA 3K0VA 5I2NB 3PPRA 1US5A 1MY0A 3OSQA 1IMDA 1Y4TA 4MFIA 1Y3NA 3D1RA 1FTJA 1Y20A 2V4CA 2DE4A 1URSA 3TCHA 1UIUA 2PBWA 3G3JA 1KWHA 1IMEA 1VFEA 1MQGA 2A5TB 3U94A 4DZ1A 3LSXA 3TODA 3IB2A 5DTBA 1J1NA 4NE4A 3K00A 4KYEA 1N04A 3RPLB 3W9WA 4P1LA 2XXYA 1CB6A 5CI5A 4TLMB 3FJGA 3FVOA 3FD3A 5HBCA 1B7UA 3MZ9A 4IY5A 2OK2A 1OLCA 5EHMA 3T0JA 1MPCA 3JYRA 2THIA 1SDXA 3KJTA 3OENA 4ESXA 4HCWA 1UTBA 3V83A 2WBDA 2O1MA 2OWSA 1B9JA 2PX1A 5I59A 4AB6A 2HHMA 2H5YA 5ELVA 4N6PA 5JTYA 3HFUA 4NWCA 5BUUA 4R75A 4QFPA 3N6UA 1NH7A 4IO7A 3LR1A 2Z22A 3D4GA 4H8JA 2Z8EA 5LTCA 3LUZA 4H5GA 4YMAA 4OWDA 1PEBA 3L6HA 4EUOA 5ET6A 2DWAA 3M3FA 1WODA 5ISUA 2XWOA 4I3YA 4ELOA 1FTAA 1P1UA 3DELB 3I5OA 4I1DA 4MJOA 5JK4A 1NUWA 4HE1A 1SW1A 4NF8A 1B6HA 4LA9A 4RPNA 1N76A 4PC9A 4F22A 1P1NA 4OEUA 3O9PA 1UTBB 4N91A 4HW8A 3PPPA 1LB9A 2ONRA 3EHSA 5I59B 5IM2A 3CRBA 1OQHA 1YCJA 3BBRA 2KQZA 1QGXA 3IFAA 3MUQA 3Q26A 3MSTA 1EZ9A 1RYXA 2BJIA 3RQTA 4G8MA 2I3WA 4U4SA 4FORA 4OANA 2FHYA 4DCYA 5L9MA 1MH3A 1SW5A 5AA2D 2VHAA 2Y7KA 4MNCA 3RTWB 4X1BA 5LOMA 2Y5KA 1FSAA 1WDNA 1CNQA 1NV1A 3BFUA 1O63A 1NH8A 3FUZA 1OLAA 3CSGA 1IMCA 3P7IA 4NF8B 3IORA 5I58B 4F31B 3LBSA 4X9TA 4X04A 4G77A 4UACA 4GD5A 1SQYA 2QJEA 5I7IA 4YKKA 2R6GE 4R2FA 3SEWA 1FQAA 3SEUA 5I57A 3S9MC 4P3LA 1ZJLA 1USYH 4LZ8A 3IJOB 1FBDA 2CZHA 3KC0A 4TLLB 1N84A 1LGBC 1MPDA 3BIHA 4U1OA 1URGA 1YYZA 3FXBA 2Z23A 4OVJA 3GBBA 4DXBA 3OO7A 3TTMA 4HE2A 1N3WA 1B4HA 3QYTA 4NF0A 5CBSA 3MWBA 2V3QA 1G0IA 3C4MA 3KEIA 1FBGA 3U92A 3OD7A 4QFOA 4BDLA 2I48A 1UIVA 1D9VA 1BTJA 1AWBA 3VXCA 1LFIA 1FPFA 4DCXA 3IO4A 5I56A 4HE0A 4X1DA 1B4ZA 2IEEA 1NL5A 5I57B 1LFGA 2R71A 4PDDA 1JW1A 3PMWA 3R6UA 3QAXA 2YLNA 4KHZE 1IUDA 1BIYA 5CMKA 1DPPA 3G3HA 1S7YA 1LBCA 1JP4A 1B0HA 4Z7EA 3G3FA 2BJJX 3MVYA 3OO9A 3HO7A 4LN5A 1OIBA 3IOTA 1DSNA 2AIXA 3DM0A 2ZMBA 3C35A 4G4PA 3VLWA 1MRPA 1FTLA 3TCFA 3ODBA 1Y3QA 2RC7A 4KPTA 1A8EA 1R9LA 2Q88A 4QSDA 2O51A 3UIFA 1HSEA 5EQ8A 2KLFA 4EQ7A 4XKPA 4PFUA 3H7MA 4H45A 4I3EA 2R9JA 1PB9A 3N6TA 1POY1 3Q29A 1MPBA 1D9YA 4XXUA 4ZEDA 4ND9A 4PF6A 4GBWA 1JVYA 2HEUA 1B7ZA 1HSLA 1B3HA 1IXCA 4PE3A 2GRVA 1B3GA 1LAGE 3FVGA 4P56A 4YB6A 4H67A 2WYKA 3MVZA 4PQJA 1PBQA 2RC8A 4NF4B 2F3DA 4QFKA 4ZE9A 1FPJA 1B3LA 1I6AA 3IX1A 4O94A 1GTKA 5H8SA 1FQEA 4P11A 4QBAA 1EU8A 2O69A 4OENA 1PC3A 2Q89A 1MDP1 1B7HA 3FIRA 3TQLA 2AYSA 1Y3PA 1JW4A 3RTFB 1MXXA 4DXCA 3UORA 1EYKA 5KCJB 2F35A 3HSTA 3PPQA 3RT6B 5IGAA 4RJZA 3KBRA 2CZKA 4GX6A 3Q28A 4YU0A 4N13A 4GX4A 3V89B 4N6DA 3FXRA 3PU5A 3RNNA 3SKPA 2XX9A 1BLFA 2FNCA 3O6HA 3OO6A 5IZ3A 2FBPA 3MW0A 3TCGA 4R74A 5K2XA 3CG1A 3EPEA 3IO6A 2DVCA 3IJXB 5F24A 4I40A 1OVTA 3B7DA 1NV0A 3MBPA 4PAIA 1EH3A 4Q30B 2NUVA 1DMBA 2DXYA 4ELRA 1NKXA 3A29A 2ZZWA 4O7IA 4OVSA 4YB5A 1MY1A 1AL3A 2CEYA 2H25A 5I2NA 1XS5A 3PD8A 4C0RA 1I6BA 1LB8A 4HS7A 4U23A 2B65A 1MG1A 1KA0A 4U22A 4N4UA 4Z0IA 3ROJA 3TFLA 2H99A 2F34A 4F18A 1DBZA 2A5TA 3VVDA 4POWA 3IK6B 1AOVA 1B0LA 2F7AA 2CMOA 4DI3D 1TXFA 4G68A 4NTLA 4ZECA 3QUJA 1VR5A 3RPLA 1B40A 3HPIA 2V3TA 5FHOA 3F11A 2O7IA 4JDFA 1RDYA 3QMFA 3SERA 2QRYA 2Z8DA 1Y1MA 3PV0E 4P9KA 4OVPA 4JVIA 1FBCA 3G7WA 4PTKA 4P0GA 4PETA 1JEVA 2ONKE 2D5WA 5CRYA 1B05A 1MXVA 4OVQA 5DT6A 2ZYKA 3KOTA 5L8DA 1L5TA 1A8FA 3WAEA 4YMBA 5FHNA 2HFBA 1NV5A 2GH9A 3HV1A 2NVUB 3A09A 5K2YA 4R73A 1DK4A 2O84X 4PAKA 4M1VA 4F3SA 3SESA 4KD5A 5EYFA 3U65A 1YAEA 3E9XA 2VT5A 2DWJA 3CSBA 5F7VA 2REGA 1Q9DA 2RC9A 4ZS9A 4MF3A 4GFRA 3ISPA 4G68B 4G68C 1DOTA 1NUXA 1USYE 1PDAA 1CE2A 4F39A 2QVVA 2I4CA 5HPQA 1LLSA 1MY3A 1M5DA 1B58A 4RK9A 5DVFA 1P99A 1MS7A 1Q1KA 3TAJA 1VFDA 4AS5A 1B5HA 2VPOA 4F3BA 3RGYA 1FPGA 2F8DA 4X8RA 4N07A 4DLDA 3FGSA 2RCAA 5A5LA 4IO4A 4PDHA 4PFBA 3ZKLA 4KFQA 1KZ8A 3DP8A 2XXUA 3FV1A 3MVWA 5M2VA 3W9VA 1YTVA 2QMXA 4R72A 5CMCA 1FRPA 1B1XA 1YXIA 1B46A 3TTNA 4QSCA 3T66A 2ESNA 4IO6A 3PMXA 4OESA 2XD2A 3A3UA 3H6UA 2DDKA 1XVXA 1RYOA 4IR8A 3S9NC 3H3GA 3MC2A 2I0BA 4PBHA 1XVYA 4OFOA 2B4MA 3QK6A 5IKBA 3H06B 4UABA 4ZEFA 3UN6A 1SI0A 4XIGQ 1II5A 4X48A 4RY1A 1Q35A 3PUWE 5F1QA 3EF7A 3GXAA 5I58A 3CIJA 2XWKA 4PAFA 4PP0A 3T9VA 4C1UA 1LAFE 1Y9UA 4EF1A 5KDTA 1H76A 4ESWA 4BDRA 1LBBA 3LC8A 2HCAA 1N7WA 4KQPA 3TYHA 2WYPA 1FCKA 1A7LA 3OO8A 2ONSA 1FQBA 3SDFA 3ILTB 2HXRA 2B4LA 5EQAA 3LSWA 1DTZA 3TZAA 4KXPA 1SVXB 3VVEA 4LQ5A 3VE1B 5H8QB 4YKPA 1FBHA 2PT2A 4FATA 1JW5A 3PGFA 2P3NA 4MX6A 2Z8FA 2FIXA 3CI8A 1TWYA 4LUBA 3KGCA 2Q8JA 3QIMA 1ZIUA 3IR1A 2XXXA 3S9LC 4FBPA 4OVRA 4OYVA 3H6TA 2V84A 3S4UA 1EZOA 5KDTB 2QPQA 4MMPA 4O3AA 3V8XB 4GWSA 4F1YA 3C33A 3K1PA 2XXTA 2ZZVA 3E3KA 4MEVA 4LONB 2HQ0A 4GWUA 1NV2A 3MZBA 3TKDA 1JNFA 4I9DA 4P8BA 2F6PA 4ISUA 4BDOA 4BDNA 3THIA 1FPLA 3HHGA 3N94A 3KN7A 4ECFA 3HCQA 5H8NA 4F29A 4RNSA 4U2RA 2ZYMA 3T9HB 2VD2A 1B52A 1QULA 3BIGA 4FAJA 2QSXA 4XEQA 4HCYA 1FTOA 2G93A 4PFTA 3OEKA 1LFHA 3R7XA 1Z7ME 5AE4A 1JETA 5EYHA 3VDFA 4N8GA 2XX8A 3OOAA 4OERA 4PE5B 1NV6A 3ONMA 4ZEKA 2Q9TA 3K01A 1LCTA 1YZ0A 1P1WA 2PYYA 3GZGA 3B50A 3MP1A 2R8TA 2VOZA 2B3FA 3VVFA 3T22A 2OWTA 2VD3A 1HSJA 4QSEA 4GQOA 3FJ7A 5IZ1A 3A3CA 3K4UA 4BLAA 3OXNA 4GL0A 3OMBA 3KN8A 3TELA 4YKJA 5DEXA 3EKIA 2ZNSA 1MXYA 3TUSA 5H8NB 1XT8A 1GR2A 3B6QA 4F1UA 2FVZA 5J1DA 2Q2AA 3CVGA 2PVUA 1FBEA 4NF4A 1QKBA 2XX7A 1OMPA 4P0IA 1DCUA 1R9QA 3PD9A 1XC1A 3TDJA 1A54A 2FYIA 4F1VA 4ONYA 2ZNUA 4OXVA 1N3XA 4NAPA 1NUZA 3LV0A 2ZZXA 3O28A 1T0KA 1LCFA 3DP4A 4O3BA 4OEVA 3LSFB 5IAIA 5TPAA 4GIZA 2X26A 4IO2A 2DS9A 5KCJA 4IGTA 3PUXE 4NN3A 3U72A 3HHFA 2ZYNA 1I6QA 3VLUA 1NFTA 3UP9A 1RDZA 2V3UA 1NNTA 5I2KA 1XHYA 3T93B 2HAUA 2I49A 5AA2B 2QMWA 5CM6A 5L9OA 1FQFA 4DIGA 3E13X 1B32A 4FIMA 2UVHA 4R2BA 4RXLA 5DEXB 4MHFA 4IB2A 2DQVA 1QW0A 3JV9A 2ABHA 4KR5A 3IOVA 3RY3A 4OZ9A 4QFNA 3IOUA 5I3SA 5FTIA 4GVOA 4RK2A 3PMVA 2OJTA 4G2ZA 2XXIA 1MQHA 4PFIA 1FJ9A 3H6VA 4LVQA 4MNPA 4EF2A 3T9XB 2XXHA 3CHGA 2OWZA 2UYFA 4RA1A 1ZU0A 4KYDA 2O6AA 2F36A 2FA7A 4FEDA 1GVCA 4N17A 4G61A 1A99A 5AA4A 1FPIA 3MPLA 5TPAB 4OETA 3C36A 1IZ1A 4NX1A 4XKNA 1VE4A 1JEUA 3SZPA 1FBFA 4YB7A 4OA4A 4KCCA 2OX3A 5I2KB 5CMBA 3ECRA 1TT1A 1N0TA 4IGRA 4NF5B 2V93A 4F2OA 1G0HA 4H0WA 4XTCQ 1MXWA 5HM4B 2F5XA 1TFAA 2XA5A 4PGNA 1H43A 1SW2A 1GV8A 2UVIA 1SPIA 3RT8A 5DW8A 2P1SA 3B6TA 3IFCA 3TTRA 2GHBA 2RCBA 4AB5A 2I3VA 5EQ7A 2AL5A 1D9QA 4F3GA 4LQ2A 5LDZA 2I58A 3OELA 4XFEA 1O64A 3FATA 5AA4B 3G3KA 1MXUA 2YPNA 3KOSA 3M3KA 1OQGA 2UVJA 3S9EA 5KZTA 3BFTA 1MM7A 3VFJA 2QS1A 5DYHA 2QL3A 5B70A 3MZ1A 5I84A 2HZKA 3U1OA 5T3JA 1EZPA 1IMBA 4WEPA 4R9GA 2Y7RA 1IMFA 4EQBA 4KI0E 1NNFA 3C31A 4NF6B 3IOWA 3KSXA 4H8IA 4BDQA 1NI9A 3WAFA 2I6EA 4NHBA 3MJNA 2I4BA 1PBPA 1FBPA 2HXWA 4EXKA 1UTHA 2I0CA 4MAGA 3NOHA 1H3DA 4MLQA 4XKRA
chains in the Genus database with same CATH topology
2IA4A 2UVGA 3SETA 3IAZA 4C1TA 4H65A 4IO3A 2DWIA 4Q8RA 1DTGA 4XKQA 3QXMA 4JBZA 2RF1A 1SBPA 2OLBA 4I62A 3SEXA 1VSOA 1MQJA 1FQDA 3VXBA 4GOTA 4DDDA 3FASA 3KN3A 5AA1A 3VLVA 2GHAA 2QS2A 1N7XA 1UQWA 3MAMA 1Z7NE 3C34A 5TU0A 5JEIA 1YPNA 2ALUA 1JQFA 2V25A 2F7BA 1D3KA 1QJMA 2VP1A 3T9UA 3K6WA 2DSFA 1FTMA 1UTHB 2DP8A 4LZ5A 3ZSFA 4U4XA 2F78A 3QSLA 1LSTA 2M8CA 4OFJA 2D3IA 1FW0A 3USDA 3IB0A 4WKMA 1A55A 4Q5TA 3CR9A 4PFYA 4ZDMA 5ICQA 2OZZA 2D21A 3EQ1A 4IY6A 4EDPA 1MDQA 1Y1ZA 1AIVA 4JWXA 3CFXA 3G3IA 1MY4A 2RINA 2ANJA 1S50A 1RKMA 3BKIB 5H8QA 1QVSA 3K1NA 2E0SA 2P0SA 1IXIA 2DWHA 3KSJA 1B3FA 1B5JA 2PMSA 3VV5A 2XHDA 2YJPA 4R6YA 1B5IA 5B7DA 1ZMGA 3FVNA 3M3LA 4POXA 2OBGA 4GLIA 3MP8A 3R26A 3EHTA 2QS3A 4JSDA 4JWYA 2F7CA 2XD3A 4QFLA 5CC2A 1XOCA 1POTA 3ILUB 3TQWA 3K6XA 1B1HA 4JB7A 5DVJA 4QRZA 4GF8A 4DE8A 5A5XA 4R6HA 1SI1A 4HTGA 3FXQA 1ANFA 4ZZAA 1OVBA 3T96B 3MVXA 2B3BA 4WXJA 3E4RA 2Y7PA 2Y7IA 3H4ZA 4R6KA 5JTYB 1MQIA 1Y4CA 3AXFA 1M5FA 1US4A 2QS4A 1S9TA 2ZYOA 2NXOA 4OFLA 1R6ZA 1SYHA 1MM6A 3DP6A 3CG3A 1IXGA 3KJ7A 4OTEA 1IEJA 4LP2B 1QKAA 3RLFE 1I69A 3KFMA 1B2HA 4E0XA 2NOOA 4JSOA 1IXHA 2O1LA 3Q27A 1MH4A 2O68A 4FJPA 5CMMA 5A5XB 3O66A 3JZJA 5H8HA 2XXWA 1IQ7A 4OHNA 2HZLA 4OQOA 3OEMA 1FTKA 2LAOA 3UGWA 4NEDA 1LAXA 4L17A 1NNKA 4UA8A 3FJMA 1NMUA 4JXIA 3N26A 3S2VA 3FV2A 2VGQA 4GXAA 4O3CA 1P1OA 5BWJA 4R9FA 1IIWA 1JVXA 3RUMA 1NNPA 3U93A 4ELPA 3EHUA 3IL1B 3C32A 2X7PA 4GL8A 1URDA 4YAHX 2DVZA 4MBPA 1D4NA 3I6VA 4AQ4A 3TTKA 3SEYA 1P1QA 1WVJA 4OMBA 5H8HB 3H6WA 1ATGA 3H03A 2P2AA 3Q25A 2DOJA 4U1ZA 5AA2A 3LSLA 3LUYA 4PFWA 4RPOA 4TQUQ 1PB8A 2DYXA 2XXRA 2W7YA 4ZEIA 3KZGA 4ZZEA 3PPOA 3GBAA 3V5AA 4FECA 2XXPA 2DE3A 1QUJA 4F19A 4IO5A 1IITA 3M8UA 2UYEA 4NMYA 3UK4A 4FE8A 3K6VA 5H8FA 1B51A 3CFLA 4K3FA 1MXZA 2X7QA 1SW4A 4YICA 1PB7A 5DVIA 1A40A 1MY2A 4NWDA 4QHQA 3K6UA 3K02A 3D4CA 1F9BA 5I56B 3PUYE 3IB1A 2NWJA 4NF5A 1ZTYA 3RPWA 2A5SA 4WEDA 3PUVE 5TP9A 4G8HA 4LZ7A 3O6GA 3O2AA 4RYAA 2XXQA 2WKYA 1ELJA 1ZBMA 2CZLA 4F3PA 2OCUA 4F2QA 5CBRA 2XXVA 4KYSA 3K2DA 5H8FB 1QUIA 3FZVA 3B6WA 5FTHA 2UXAA 3N5LA 4E0WA 3EN3A 3ZKKA 4THIA 4FEBA 1QUKA 4ELQA 5ICTA 1M5BA 3PPNA 2PT1A 3I3VA 4QF9A 3ZS6A 1H45A 3OSRA 3U8QA 4YKIA 1H44A 4NF6A 4U21A 3TTLA 3O97A 3W15C 2GFEA 4TOZA 4JWOA 5TP9B 2Y7WA 1SYIA 4GXSB 2E1SA 2RKMA 3K1MA 4MLVA 1AMFA 1M5EA 4I8CA 1R1NA 5ITOA 3RN8A 1SD3A 4GRKA 5L9SA 3GLBA 1B3EA 2DXRA 2H98A 1O7TA 1LAHE 4GWOA 1TFDA 2G29A 2REJA 3C9HA 1FQCA 3O29A 4ZEBA 5FHMA 2ZXTA 2F97A 2H4IA 4H6DA 3MQ9A 4YZZA 3CFZA 2AL4A 3KG2A 3HN0A 4Q0CA 3MPKA 4EXLA 1M5CA 1ZLQA 5ITPA 1BKAA 4ZE8A 2ZNTA 3SEVA 3DLNA 2DE2A 3PUZE 2Q2CA 1MQDA 3FXUA 4LATA 2O7UA 4M4GA 3MP6A 3G3GA 2F6GA 2Y84A 3QUFA 1BP5A 4KCDA 1ZKBA 3TMGA 4EQ9A 3TEPA 1GGGA 4G8NA 4BDMA 2HAVA 3UA8A 5EHSA 3O6IA 5AA3A 3TPAA 1AH5A 4DXUA 4H1XA 4H5FA 4MH5A 1DPEA 3L6GA 2H9BA 3K0VA 3FVKA 5I2NB 3PPRA 1US5A 1MY0A 3OSQA 1Y4TA 4MFIA 1Y3NA 1FTJA 1Y20A 2DE4A 1URSA 3TCHA 1UIUA 2PBWA 3G3JA 1KWHA 1VFEA 2A5TB 1MQGA 3U94A 4DZ1A 3LSXA 3TODA 3IB2A 5DTBA 1J1NA 4NE4A 3K00A 4KYEA 1N04A 3W9WA 2XXYA 1CB6A 5CI5A 4TLMB 3FJGA 3FVOA 3FD3A 5HBCA 1B7UA 3MZ9A 4IY5A 2OK2A 1OLCA 5EHMA 1MPCA 3JYRA 2THIA 1SDXA 3KJTA 3OENA 4ESXA 4HCWA 1UTBA 3V83A 2O1MA 2OWSA 1B9JA 2PX1A 5I59A 4AB6A 2H5YA 5ELVA 4N6PA 5JTYA 4NWCA 5BUUA 4R75A 4QFPA 3N6UA 1NH7A 4IO7A 3LR1A 2Z22A 3D4GA 4H8JA 2Z8EA 4H5GA 4YMAA 4OWDA 1PEBA 3L6HA 4EUOA 2DWAA 3M3FA 1WODA 5ISUA 4ELOA 1P1UA 3DELB 3I5OA 4I1DA 5JK4A 1SW1A 4NF8A 1B6HA 4LA9A 4RPNA 1N76A 4F22A 1P1NA 4OEUA 3O9PA 1UTBB 4HW8A 3PPPA 1LB9A 2ONRA 3EHSA 5I59B 3CRBA 1OQHA 1YCJA 3BBRA 3MUQA 3Q26A 1EZ9A 1RYXA 3RQTA 4G8MA 2I3WA 4U4SA 4FORA 4DCYA 5L9MA 1MH3A 1SW5A 5AA2D 2VHAA 2Y7KA 3RTWB 4X1BA 5LOMA 1WDNA 3BFUA 1O63A 1NH8A 3FUZA 1OLAA 3CSGA 3P7IA 4NF8B 3IORA 5I58B 4F31B 3LBSA 4X9TA 4G77A 4UACA 4GD5A 1SQYA 2QJEA 4YKKA 2R6GE 4R2FA 3SEWA 1FQAA 3SEUA 5I57A 3S9MC 1ZJLA 1USYH 4LZ8A 3IJOB 4TLLB 1N84A 1LGBC 1MPDA 4U1OA 1URGA 2Z23A 4OVJA 3GBBA 4DXBA 3OO7A 3TTMA 1N3WA 1B4HA 3QYTA 5CBSA 3MWBA 2V3QA 3C4MA 3KEIA 3U92A 3OD7A 4QFOA 4BDLA 2I48A 1UIVA 1D9VA 1BTJA 3VXCA 1LFIA 4DCXA 3IO4A 5I56A 4X1DA 1B4ZA 2IEEA 1NL5A 5I57B 1LFGA 2R71A 1JW1A 3PMWA 3R6UA 3QAXA 2YLNA 4KHZE 1IUDA 1BIYA 5CMKA 1DPPA 3G3HA 1S7YA 1LBCA 1B0HA 4Z7EA 3G3FA 2BJJX 3MVYA 3OO9A 3HO7A 1OIBA 3IOTA 1DSNA 2AIXA 3DM0A 2ZMBA 3C35A 4G4PA 3VLWA 1MRPA 1FTLA 3TCFA 3ODBA 1Y3QA 2RC7A 4KPTA 1A8EA 1R9LA 2Q88A 4QSDA 2O51A 3UIFA 1HSEA 2KLFA 4EQ7A 4XKPA 4PFUA 3H7MA 2R9JA 1PB9A 3N6TA 1POY1 3Q29A 1MPBA 1D9YA 4XXUA 4ZEDA 4ND9A 1JVYA 2HEUA 1B7ZA 1HSLA 1B3HA 1IXCA 2GRVA 1B3GA 1LAGE 3FVGA 4YB6A 4H67A 3MVZA 4PQJA 1PBQA 2RC8A 4NF4B 4QFKA 4ZE9A 1B3LA 1I6AA 3IX1A 1GTKA 5H8SA 1FQEA 4P11A 1EU8A 2O69A 4OENA 1PC3A 2Q89A 1MDP1 1B7HA 3FIRA 3TQLA 2AYSA 1Y3PA 1JW4A 3RTFB 1MXXA 4DXCA 3UORA 5KCJB 2F35A 3HSTA 3PPQA 3RT6B 4RJZA 3KBRA 3Q28A 4YU0A 4N13A 3V89B 3RNNA 3FXRA 3PU5A 3SKPA 2XX9A 1BLFA 2FNCA 3O6HA 3OO6A 3MW0A 3TCGA 4R74A 5K2XA 3CG1A 3EPEA 3IO6A 2DVCA 3IJXB 1OVTA 3B7DA 3MBPA 1EH3A 4Q30B 2NUVA 1DMBA 2DXYA 4ELRA 1NKXA 4YB5A 1MY1A 1AL3A 2H25A 5I2NA 1XS5A 3PD8A 4C0RA 1I6BA 1LB8A 4HS7A 4U23A 2B65A 1MG1A 4U22A 4Z0IA 3TFLA 2H99A 2F34A 4F18A 2A5TA 3VVDA 4POWA 3IK6B 1AOVA 1B0LA 2F7AA 2CMOA 1TXFA 4G68A 4NTLA 4ZECA 3QUJA 1VR5A 1B40A 3HPIA 2V3TA 5FHOA 3F11A 2O7IA 4JDFA 3SERA 2QRYA 2Z8DA 1Y1MA 3PV0E 3G7WA 4P0GA 4PETA 1JEVA 2ONKE 2D5WA 5CRYA 1B05A 1MXVA 5DT6A 2ZYKA 3KOTA 5L8DA 1L5TA 1A8FA 3WAEA 4YMBA 5FHNA 2HFBA 2GH9A 3HV1A 2NVUB 3A09A 5K2YA 4R73A 2O84X 4M1VA 4F3SA 3SESA 4KD5A 5EYFA 1YAEA 3E9XA 2DWJA 3CSBA 5F7VA 2REGA 2RC9A 4ZS9A 4MF3A 4GFRA 4G68B 4G68C 1DOTA 1USYE 1PDAA 1CE2A 4F39A 2I4CA 5HPQA 1LLSA 1MY3A 1M5DA 1B58A 4RK9A 5DVFA 1P99A 1MS7A 1Q1KA 3TAJA 1VFDA 1B5HA 4F3BA 3RGYA 2F8DA 4N07A 4DLDA 3FGSA 2RCAA 4IO4A 3ZKLA 4KFQA 3DP8A 2XXUA 3FV1A 3MVWA 5M2VA 3W9VA 1YTVA 2QMXA 4R72A 5CMCA 1B1XA 1B46A 3TTNA 4QSCA 3T66A 2ESNA 4IO6A 3PMXA 4OESA 2XD2A 3A3UA 3H6UA 1XVXA 1RYOA 3S9NC 3H3GA 3MC2A 2I0BA 1XVYA 4OFOA 3QK6A 5IKBA 3H06B 4ZEFA 3UN6A 1SI0A 4XIGQ 1II5A 4X48A 4RY1A 1Q35A 3PUWE 5F1QA 3EF7A 3GXAA 5I58A 3CIJA 4PP0A 3T9VA 4C1UA 1LAFE 1Y9UA 4EF1A 5KDTA 1H76A 4ESWA 4BDRA 1LBBA 3LC8A 2HCAA 1N7WA 4KQPA 3TYHA 1FCKA 1A7LA 3OO8A 2ONSA 1FQBA 3SDFA 3ILTB 3LSWA 1DTZA 3TZAA 1SVXB 3VVEA 4LQ5A 3VE1B 5H8QB 4YKPA 2PT2A 4FATA 1JW5A 3PGFA 2Z8FA 3CI8A 1TWYA 4LUBA 3KGCA 2Q8JA 3QIMA 1ZIUA 3IR1A 2XXXA 3S9LC 4OYVA 3H6TA 2V84A 3S4UA 1EZOA 5KDTB 2QPQA 4O3AA 3V8XB 4F1YA 3C33A 3K1PA 2XXTA 3E3KA 4LONB 2HQ0A 3MZBA 3TKDA 1JNFA 4I9DA 2F6PA 4ISUA 4BDOA 4BDNA 3THIA 3HHGA 3N94A 3KN7A 4ECFA 3HCQA 5H8NA 4F29A 4RNSA 4U2RA 2ZYMA 3T9HB 2VD2A 1B52A 1QULA 4FAJA 2QSXA 4HCYA 1FTOA 2G93A 4PFTA 3OEKA 1LFHA 3R7XA 1Z7ME 5AE4A 1JETA 3VDFA 2XX8A 3OOAA 4OERA 4PE5B 3ONMA 4ZEKA 2Q9TA 3K01A 1LCTA 1P1WA 2PYYA 3GZGA 3MP1A 2VOZA 2B3FA 3VVFA 3T22A 2OWTA 2VD3A 1HSJA 4QSEA 4GQOA 3FJ7A 3A3CA 3K4UA 4BLAA 3OXNA 4GL0A 3OMBA 3KN8A 3TELA 4YKJA 5DEXA 2ZNSA 1MXYA 3TUSA 5H8NB 1XT8A 1GR2A 3B6QA 4F1UA 5J1DA 2Q2AA 3CVGA 2PVUA 4NF4A 1QKBA 2XX7A 1OMPA 4P0IA 1R9QA 3PD9A 1XC1A 3TDJA 1A54A 2FYIA 4F1VA 4ONYA 2ZNUA 4OXVA 1N3XA 3O28A 1T0KA 1LCFA 3DP4A 4O3BA 4OEVA 3LSFB 5IAIA 5TPAA 4GIZA 2X26A 4IO2A 2DS9A 5KCJA 4IGTA 3PUXE 3U72A 3HHFA 2ZYNA 1I6QA 3VLUA 1NFTA 3UP9A 2V3UA 1NNTA 5I2KA 1XHYA 3T93B 2HAUA 2I49A 5AA2B 2QMWA 5CM6A 5L9OA 1FQFA 4DIGA 3E13X 1B32A 4FIMA 2UVHA 4R2BA 4RXLA 5DEXB 4IB2A 2DQVA 1QW0A 3JV9A 2ABHA 4KR5A 3IOVA 3RY3A 4OZ9A 4QFNA 3IOUA 5FTIA 4GVOA 4RK2A 3PMVA 2OJTA 4G2ZA 2XXIA 1MQHA 3H6VA 4LVQA 4EF2A 3T9XB 2XXHA 2UYFA 4RA1A 1ZU0A 4KYDA 2O6AA 2F36A 2FA7A 4FEDA 1GVCA 1A99A 5AA4A 3MPLA 5TPAB 4OETA 3C36A 1IZ1A 4XKNA 1VE4A 1JEUA 4YB7A 4KCCA 5I2KB 5CMBA 3ECRA 1TT1A 1N0TA 4IGRA 4NF5B 2V93A 4F2OA 4H0WA 4XTCQ 1MXWA 5HM4B 2F5XA 1TFAA 1H43A 1SW2A 1GV8A 2UVIA 3RT8A 2P1SA 3B6TA 3TTRA 2GHBA 2RCBA 4AB5A 2I3VA 2AL5A 4F3GA 4LQ2A 2I58A 3OELA 1O64A 3FATA 5AA4B 3G3KA 1MXUA 2YPNA 3KOSA 3M3KA 1OQGA 2UVJA 3S9EA 5KZTA 3BFTA 1MM7A 3VFJA 2QS1A 5DYHA 2QL3A 5B70A 3MZ1A 5I84A 2HZKA 3U1OA 1EZPA 4WEPA 4R9GA 2Y7RA 4EQBA 4KI0E 1NNFA 3C31A 4NF6B 3IOWA 3KSXA 4H8IA 4BDQA 3WAFA 2I6EA 3MJNA 2I4BA 1PBPA 2HXWA 4EXKA 1UTHA 2I0CA 1H3DA 4MLQA 4XKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IA4 A;  2UVG A;  3SET A;  3IAZ A;  4C1T A;  4H65 A;  4IO3 A;  2DWI A;  4Q8R A;  1DTG A;  4XKQ A;  3QXM A;  4JBZ A;  2RF1 A;  1SBP A;  2OLB A;  4I62 A;  3SEX A;  1VSO A;  1MQJ A;  1FQD A;  3VXB A;  4GOT A;  4DDD A;  3FAS A;  3KN3 A;  5AA1 A;  3VLV A;  2GHA A;  2QS2 A;  1N7X A;  1UQW A;  3MAM A;  1Z7N E;  3C34 A;  5TU0 A;  5JEI A;  1YPN A;  2ALU A;  1JQF A;  2V25 A;  2F7B A;  1D3K A;  1QJM A;  2VP1 A;  3T9U A;  3K6W A;  2DSF A;  1FTM A;  1UTH B;  2DP8 A;  4LZ5 A;  3ZSF A;  4U4X A;  2F78 A;  3QSL A;  1LST A;  2M8C A;  4OFJ A;  2D3I A;  1FW0 A;  3USD A;  3IB0 A;  4WKM A;  1A55 A;  4Q5T A;  3CR9 A;  4PFY A;  4ZDM A;  5ICQ A;  2OZZ A;  2D21 A;  3EQ1 A;  4IY6 A;  4EDP A;  1MDQ A;  1Y1Z A;  1AIV A;  4JWX A;  3CFX A;  3G3I A;  1MY4 A;  2RIN A;  2ANJ A;  1S50 A;  1RKM A;  3BKI B;  5H8Q A;  1QVS A;  3K1N A;  2E0S A;  2P0S A;  1IXI A;  2DWH A;  3KSJ A;  1B3F A;  1B5J A;  2PMS A;  3VV5 A;  2XHD A;  2YJP A;  4R6Y A;  1B5I A;  5B7D A;  1ZMG A;  3FVN A;  3M3L A;  4POX A;  2OBG A;  4GLI A;  3MP8 A;  3R26 A;  3EHT A;  2QS3 A;  4JSD A;  4JWY A;  2F7C A;  2XD3 A;  4QFL A;  5CC2 A;  1XOC A;  1POT A;  3ILU B;  3TQW A;  3K6X A;  1B1H A;  4JB7 A;  5DVJ A;  4QRZ A;  4GF8 A;  4DE8 A;  5A5X A;  4R6H A;  1SI1 A;  4HTG A;  3FXQ A;  1ANF A;  4ZZA A;  1OVB A;  3T96 B;  3MVX A;  2B3B A;  4WXJ A;  3E4R A;  2Y7P A;  2Y7I A;  3H4Z A;  4R6K A;  5JTY B;  1MQI A;  1Y4C A;  3AXF A;  1M5F A;  1US4 A;  2QS4 A;  1S9T A;  2ZYO A;  2NXO A;  4OFL A;  1R6Z A;  1SYH A;  1MM6 A;  3DP6 A;  3CG3 A;  1IXG A;  3KJ7 A;  4OTE A;  1IEJ A;  4LP2 B;  1QKA A;  3RLF E;  1I69 A;  3KFM A;  1B2H A;  4E0X A;  2NOO A;  4JSO A;  1IXH A;  2O1L A;  3Q27 A;  1MH4 A;  2O68 A;  4FJP A;  5CMM A;  5A5X B;  3O66 A;  3JZJ A;  5H8H A;  2XXW A;  1IQ7 A;  4OHN A;  2HZL A;  4OQO A;  3OEM A;  1FTK A;  2LAO A;  3UGW A;  4NED A;  1LAX A;  4L17 A;  1NNK A;  4UA8 A;  3FJM A;  1NMU A;  4JXI A;  3N26 A;  3S2V A;  3FV2 A;  2VGQ A;  4GXA A;  4O3C A;  1P1O A;  5BWJ A;  4R9F A;  1IIW A;  1JVX A;  3RUM A;  1NNP A;  3U93 A;  4ELP A;  3EHU A;  3IL1 B;  3C32 A;  2X7P A;  4GL8 A;  1URD A;  4YAH X;  2DVZ A;  4MBP A;  1D4N A;  3I6V A;  4AQ4 A;  3TTK A;  3SEY A;  1P1Q A;  1WVJ A;  4OMB A;  5H8H B;  3H6W A;  1ATG A;  3H03 A;  2P2A A;  3Q25 A;  2DOJ A;  4U1Z A;  5AA2 A;  3LSL A;  3LUY A;  4PFW A;  4RPO A;  4TQU Q;  1PB8 A;  2DYX A;  2XXR A;  2W7Y A;  4ZEI A;  3KZG A;  4ZZE A;  3PPO A;  3GBA A;  3V5A A;  4FEC A;  2XXP A;  2DE3 A;  1QUJ A;  4F19 A;  4IO5 A;  1IIT A;  3M8U A;  2UYE A;  4NMY A;  3UK4 A;  4FE8 A;  3K6V A;  5H8F A;  1B51 A;  3CFL A;  4K3F A;  1MXZ A;  2X7Q A;  1SW4 A;  4YIC A;  1PB7 A;  5DVI A;  1A40 A;  1MY2 A;  4NWD A;  4QHQ A;  3K6U A;  3K02 A;  3D4C A;  1F9B A;  5I56 B;  3PUY E;  3IB1 A;  2NWJ A;  4NF5 A;  1ZTY A;  3RPW A;  2A5S A;  4WED A;  3PUV E;  5TP9 A;  4G8H A;  4LZ7 A;  3O6G A;  3O2A A;  4RYA A;  2XXQ A;  2WKY A;  1ELJ A;  1ZBM A;  2CZL A;  4F3P A;  2OCU A;  4F2Q A;  5CBR A;  2XXV A;  4KYS A;  3K2D A;  5H8F B;  1QUI A;  3FZV A;  3B6W A;  5FTH A;  2UXA A;  3N5L A;  4E0W A;  3EN3 A;  3ZKK A;  4THI A;  4FEB A;  1QUK A;  4ELQ A;  5ICT A;  1M5B A;  3PPN A;  2PT1 A;  3I3V A;  4QF9 A;  3ZS6 A;  1H45 A;  3OSR A;  3U8Q A;  4YKI A;  1H44 A;  4NF6 A;  4U21 A;  3TTL A;  3O97 A;  3W15 C;  2GFE A;  4TOZ A;  4JWO A;  5TP9 B;  2Y7W A;  1SYI A;  4GXS B;  2E1S A;  2RKM A;  3K1M A;  4MLV A;  1AMF A;  1M5E A;  4I8C A;  1R1N A;  5ITO A;  3RN8 A;  1SD3 A;  4GRK A;  5L9S A;  3GLB A;  1B3E A;  2DXR A;  2H98 A;  1O7T A;  1LAH E;  4GWO A;  1TFD A;  2G29 A;  2REJ A;  3C9H A;  1FQC A;  3O29 A;  4ZEB A;  5FHM A;  2ZXT A;  2F97 A;  2H4I A;  4H6D A;  3MQ9 A;  4YZZ A;  3CFZ A;  2AL4 A;  3KG2 A;  3HN0 A;  4Q0C A;  3MPK A;  4EXL A;  1M5C A;  1ZLQ A;  5ITP A;  1BKA A;  4ZE8 A;  2ZNT A;  3SEV A;  3DLN A;  2DE2 A;  3PUZ E;  2Q2C A;  1MQD A;  3FXU A;  4LAT A;  2O7U A;  4M4G A;  3MP6 A;  3G3G A;  2F6G A;  2Y84 A;  3QUF A;  1BP5 A;  4KCD A;  1ZKB A;  3TMG A;  4EQ9 A;  3TEP A;  1GGG A;  4G8N A;  4BDM A;  2HAV A;  3UA8 A;  5EHS A;  3O6I A;  5AA3 A;  3TPA A;  1AH5 A;  4DXU A;  4H1X A;  4H5F A;  4MH5 A;  1DPE A;  3L6G A;  2H9B A;  3K0V A;  3FVK A;  5I2N B;  3PPR A;  1US5 A;  1MY0 A;  3OSQ A;  1Y4T A;  4MFI A;  1Y3N A;  1FTJ A;  1Y20 A;  2DE4 A;  1URS A;  3TCH A;  1UIU A;  2PBW A;  3G3J A;  1KWH A;  1VFE A;  2A5T B;  1MQG A;  3U94 A;  4DZ1 A;  3LSX A;  3TOD A;  3IB2 A;  5DTB A;  1J1N A;  4NE4 A;  3K00 A;  4KYE A;  1N04 A;  3W9W A;  2XXY A;  1CB6 A;  5CI5 A;  4TLM B;  3FJG A;  3FVO A;  3FD3 A;  5HBC A;  1B7U A;  3MZ9 A;  4IY5 A;  2OK2 A;  1OLC A;  5EHM A;  1MPC A;  3JYR A;  2THI A;  1SDX A;  3KJT A;  3OEN A;  4ESX A;  4HCW A;  1UTB A;  3V83 A;  2O1M A;  2OWS A;  1B9J A;  2PX1 A;  5I59 A;  4AB6 A;  2H5Y A;  5ELV A;  4N6P A;  5JTY A;  4NWC A;  5BUU A;  4R75 A;  4QFP A;  3N6U A;  1NH7 A;  4IO7 A;  3LR1 A;  2Z22 A;  3D4G A;  4H8J A;  2Z8E A;  4H5G A;  4YMA A;  4OWD A;  1PEB A;  3L6H A;  4EUO A;  2DWA A;  3M3F A;  1WOD A;  5ISU A;  4ELO A;  1P1U A;  3DEL B;  3I5O A;  4I1D A;  5JK4 A;  1SW1 A;  4NF8 A;  1B6H A;  4LA9 A;  4RPN A;  1N76 A;  4F22 A;  1P1N A;  4OEU A;  3O9P A;  1UTB B;  4HW8 A;  3PPP A;  1LB9 A;  2ONR A;  3EHS A;  5I59 B;  3CRB A;  1OQH A;  1YCJ A;  3BBR A;  3MUQ A;  3Q26 A;  1EZ9 A;  1RYX A;  3RQT A;  4G8M A;  2I3W A;  4U4S A;  4FOR A;  4DCY A;  5L9M A;  1MH3 A;  1SW5 A;  5AA2 D;  2VHA A;  2Y7K A;  3RTW B;  4X1B A;  5LOM A;  1WDN A;  3BFU A;  1O63 A;  1NH8 A;  3FUZ A;  1OLA A;  3CSG A;  3P7I A;  4NF8 B;  3IOR A;  5I58 B;  4F31 B;  3LBS A;  4X9T A;  4G77 A;  4UAC A;  4GD5 A;  1SQY A;  2QJE A;  4YKK A;  2R6G E;  4R2F A;  3SEW A;  1FQA A;  3SEU A;  5I57 A;  3S9M C;  1ZJL A;  1USY H;  4LZ8 A;  3IJO B;  4TLL B;  1N84 A;  1LGB C;  1MPD A;  4U1O A;  1URG A;  2Z23 A;  4OVJ A;  3GBB A;  4DXB A;  3OO7 A;  3TTM A;  1N3W A;  1B4H A;  3QYT A;  5CBS A;  3MWB A;  2V3Q A;  3C4M A;  3KEI A;  3U92 A;  3OD7 A;  4QFO A;  4BDL A;  2I48 A;  1UIV A;  1D9V A;  1BTJ A;  3VXC A;  1LFI A;  4DCX A;  3IO4 A;  5I56 A;  4X1D A;  1B4Z A;  2IEE A;  1NL5 A;  5I57 B;  1LFG A;  2R71 A;  1JW1 A;  3PMW A;  3R6U A;  3QAX A;  2YLN A;  4KHZ E;  1IUD A;  1BIY A;  5CMK A;  1DPP A;  3G3H A;  1S7Y A;  1LBC A;  1B0H A;  4Z7E A;  3G3F A;  2BJJ X;  3MVY A;  3OO9 A;  3HO7 A;  1OIB A;  3IOT A;  1DSN A;  2AIX A;  3DM0 A;  2ZMB A;  3C35 A;  4G4P A;  3VLW A;  1MRP A;  1FTL A;  3TCF A;  3ODB A;  1Y3Q A;  2RC7 A;  4KPT A;  1A8E A;  1R9L A;  2Q88 A;  4QSD A;  2O51 A;  3UIF A;  1HSE A;  2KLF A;  4EQ7 A;  4XKP A;  4PFU A;  3H7M A;  2R9J A;  1PB9 A;  3N6T A;  1POY 1;  3Q29 A;  1MPB A;  1D9Y A;  4XXU A;  4ZED A;  4ND9 A;  1JVY A;  2HEU A;  1B7Z A;  1HSL A;  1B3H A;  1IXC A;  2GRV A;  1B3G A;  1LAG E;  3FVG A;  4YB6 A;  4H67 A;  3MVZ A;  4PQJ A;  1PBQ A;  2RC8 A;  4NF4 B;  4QFK A;  4ZE9 A;  1B3L A;  1I6A A;  3IX1 A;  1GTK A;  5H8S A;  1FQE A;  4P11 A;  1EU8 A;  2O69 A;  4OEN A;  1PC3 A;  2Q89 A;  1MDP 1;  1B7H A;  3FIR A;  3TQL A;  2AYS A;  1Y3P A;  1JW4 A;  3RTF B;  1MXX A;  4DXC A;  3UOR A;  5KCJ B;  2F35 A;  3HST A;  3PPQ A;  3RT6 B;  4RJZ A;  3KBR A;  3Q28 A;  4YU0 A;  4N13 A;  3V89 B;  3RNN A;  3FXR A;  3PU5 A;  3SKP A;  2XX9 A;  1BLF A;  2FNC A;  3O6H A;  3OO6 A;  3MW0 A;  3TCG A;  4R74 A;  5K2X A;  3CG1 A;  3EPE A;  3IO6 A;  2DVC A;  3IJX B;  1OVT A;  3B7D A;  3MBP A;  1EH3 A;  4Q30 B;  2NUV A;  1DMB A;  2DXY A;  4ELR A;  1NKX A;  4YB5 A;  1MY1 A;  1AL3 A;  2H25 A;  5I2N A;  1XS5 A;  3PD8 A;  4C0R A;  1I6B A;  1LB8 A;  4HS7 A;  4U23 A;  2B65 A;  1MG1 A;  4U22 A;  4Z0I A;  3TFL A;  2H99 A;  2F34 A;  4F18 A;  2A5T A;  3VVD A;  4POW A;  3IK6 B;  1AOV A;  1B0L A;  2F7A A;  2CMO A;  1TXF A;  4G68 A;  4NTL A;  4ZEC A;  3QUJ A;  1VR5 A;  1B40 A;  3HPI A;  2V3T A;  5FHO A;  3F11 A;  2O7I A;  4JDF A;  3SER A;  2QRY A;  2Z8D A;  1Y1M A;  3PV0 E;  3G7W A;  4P0G A;  4PET A;  1JEV A;  2ONK E;  2D5W A;  5CRY A;  1B05 A;  1MXV A;  5DT6 A;  2ZYK A;  3KOT A;  5L8D A;  1L5T A;  1A8F A;  3WAE A;  4YMB A;  5FHN A;  2HFB A;  2GH9 A;  3HV1 A;  2NVU B;  3A09 A;  5K2Y A;  4R73 A;  2O84 X;  4M1V A;  4F3S A;  3SES A;  4KD5 A;  5EYF A;  1YAE A;  3E9X A;  2DWJ A;  3CSB A;  5F7V A;  2REG A;  2RC9 A;  4ZS9 A;  4MF3 A;  4GFR A;  4G68 B;  4G68 C;  1DOT A;  1USY E;  1PDA A;  1CE2 A;  4F39 A;  2I4C A;  5HPQ A;  1LLS A;  1MY3 A;  1M5D A;  1B58 A;  4RK9 A;  5DVF A;  1P99 A;  1MS7 A;  1Q1K A;  3TAJ A;  1VFD A;  1B5H A;  4F3B A;  3RGY A;  2F8D A;  4N07 A;  4DLD A;  3FGS A;  2RCA A;  4IO4 A;  3ZKL A;  4KFQ A;  3DP8 A;  2XXU A;  3FV1 A;  3MVW A;  5M2V A;  3W9V A;  1YTV A;  2QMX A;  4R72 A;  5CMC A;  1B1X A;  1B46 A;  3TTN A;  4QSC A;  3T66 A;  2ESN A;  4IO6 A;  3PMX A;  4OES A;  2XD2 A;  3A3U A;  3H6U A;  1XVX A;  1RYO A;  3S9N C;  3H3G A;  3MC2 A;  2I0B A;  1XVY A;  4OFO A;  3QK6 A;  5IKB A;  3H06 B;  4ZEF A;  3UN6 A;  1SI0 A;  4XIG Q;  1II5 A;  4X48 A;  4RY1 A;  1Q35 A;  3PUW E;  5F1Q A;  3EF7 A;  3GXA A;  5I58 A;  3CIJ A;  4PP0 A;  3T9V A;  4C1U A;  1LAF E;  1Y9U A;  4EF1 A;  5KDT A;  1H76 A;  4ESW A;  4BDR A;  1LBB A;  3LC8 A;  2HCA A;  1N7W A;  4KQP A;  3TYH A;  1FCK A;  1A7L A;  3OO8 A;  2ONS A;  1FQB A;  3SDF A;  3ILT B;  3LSW A;  1DTZ A;  3TZA A;  1SVX B;  3VVE A;  4LQ5 A;  3VE1 B;  5H8Q B;  4YKP A;  2PT2 A;  4FAT A;  1JW5 A;  3PGF A;  2Z8F A;  3CI8 A;  1TWY A;  4LUB A;  3KGC A;  2Q8J A;  3QIM A;  1ZIU A;  3IR1 A;  2XXX A;  3S9L C;  4OYV A;  3H6T A;  2V84 A;  3S4U A;  1EZO A;  5KDT B;  2QPQ A;  4O3A A;  3V8X B;  4F1Y A;  3C33 A;  3K1P A;  2XXT A;  3E3K A;  4LON B;  2HQ0 A;  3MZB A;  3TKD A;  1JNF A;  4I9D A;  2F6P A;  4ISU A;  4BDO A;  4BDN A;  3THI A;  3HHG A;  3N94 A;  3KN7 A;  4ECF A;  3HCQ A;  5H8N A;  4F29 A;  4RNS A;  4U2R A;  2ZYM A;  3T9H B;  2VD2 A;  1B52 A;  1QUL A;  4FAJ A;  2QSX A;  4HCY A;  1FTO A;  2G93 A;  4PFT A;  3OEK A;  1LFH A;  3R7X A;  1Z7M E;  5AE4 A;  1JET A;  3VDF A;  2XX8 A;  3OOA A;  4OER A;  4PE5 B;  3ONM A;  4ZEK A;  2Q9T A;  3K01 A;  1LCT A;  1P1W A;  2PYY A;  3GZG A;  3MP1 A;  2VOZ A;  2B3F A;  3VVF A;  3T22 A;  2OWT A;  2VD3 A;  1HSJ A;  4QSE A;  4GQO A;  3FJ7 A;  3A3C A;  3K4U A;  4BLA A;  3OXN A;  4GL0 A;  3OMB A;  3KN8 A;  3TEL A;  4YKJ A;  5DEX A;  2ZNS A;  1MXY A;  3TUS A;  5H8N B;  1XT8 A;  1GR2 A;  3B6Q A;  4F1U A;  5J1D A;  2Q2A A;  3CVG A;  2PVU A;  4NF4 A;  1QKB A;  2XX7 A;  1OMP A;  4P0I A;  1R9Q A;  3PD9 A;  1XC1 A;  3TDJ A;  1A54 A;  2FYI A;  4F1V A;  4ONY A;  2ZNU A;  4OXV A;  1N3X A;  3O28 A;  1T0K A;  1LCF A;  3DP4 A;  4O3B A;  4OEV A;  3LSF B;  5IAI A;  5TPA A;  4GIZ A;  2X26 A;  4IO2 A;  2DS9 A;  5KCJ A;  4IGT A;  3PUX E;  3U72 A;  3HHF A;  2ZYN A;  1I6Q A;  3VLU A;  1NFT A;  3UP9 A;  2V3U A;  1NNT A;  5I2K A;  1XHY A;  3T93 B;  2HAU A;  2I49 A;  5AA2 B;  2QMW A;  5CM6 A;  5L9O A;  1FQF A;  4DIG A;  3E13 X;  1B32 A;  4FIM A;  2UVH A;  4R2B A;  4RXL A;  5DEX B;  4IB2 A;  2DQV A;  1QW0 A;  3JV9 A;  2ABH A;  4KR5 A;  3IOV A;  3RY3 A;  4OZ9 A;  4QFN A;  3IOU A;  5FTI A;  4GVO A;  4RK2 A;  3PMV A;  2OJT A;  4G2Z A;  2XXI A;  1MQH A;  3H6V A;  4LVQ A;  4EF2 A;  3T9X B;  2XXH A;  2UYF A;  4RA1 A;  1ZU0 A;  4KYD A;  2O6A A;  2F36 A;  2FA7 A;  4FED A;  1GVC A;  1A99 A;  5AA4 A;  3MPL A;  5TPA B;  4OET A;  3C36 A;  1IZ1 A;  4XKN A;  1VE4 A;  1JEU A;  4YB7 A;  4KCC A;  5I2K B;  5CMB A;  3ECR A;  1TT1 A;  1N0T A;  4IGR A;  4NF5 B;  2V93 A;  4F2O A;  4H0W A;  4XTC Q;  1MXW A;  5HM4 B;  2F5X A;  1TFA A;  1H43 A;  1SW2 A;  1GV8 A;  2UVI A;  3RT8 A;  2P1S A;  3B6T A;  3TTR A;  2GHB A;  2RCB A;  4AB5 A;  2I3V A;  2AL5 A;  4F3G A;  4LQ2 A;  2I58 A;  3OEL A;  1O64 A;  3FAT A;  5AA4 B;  3G3K A;  1MXU A;  2YPN A;  3KOS A;  3M3K A;  1OQG A;  2UVJ A;  3S9E A;  5KZT A;  3BFT A;  1MM7 A;  3VFJ A;  2QS1 A;  5DYH A;  2QL3 A;  5B70 A;  3MZ1 A;  5I84 A;  2HZK A;  3U1O A;  1EZP A;  4WEP A;  4R9G A;  2Y7R A;  4EQB A;  4KI0 E;  1NNF A;  3C31 A;  4NF6 B;  3IOW A;  3KSX A;  4H8I A;  4BDQ A;  3WAF A;  2I6E A;  3MJN A;  2I4B A;  1PBP A;  2HXW A;  4EXK A;  1UTH A;  2I0C A;  1H3D A;  4MLQ A;  4XKR A; 
#chains in the Genus database with same CATH topology
 2IA4 A;  2UVG A;  3SET A;  1IMA A;  3IAZ A;  2QVU A;  4C1T A;  4H65 A;  4IO3 A;  2DWI A;  2CZI A;  4Q8R A;  1DTG A;  4XKQ A;  3QXM A;  4H46 A;  4JBZ A;  2RF1 A;  1SBP A;  2OLB A;  4I62 A;  3SEX A;  1VSO A;  3E78 A;  1MQJ A;  1FQD A;  3VXB A;  4GOT A;  1FPB A;  4DDD A;  3FAS A;  3KN3 A;  5AA1 A;  2WBB A;  3VLV A;  2GHA A;  2QS2 A;  1LBV A;  1N7X A;  1K9Y A;  1UQW A;  3MAM A;  1Z7N E;  3C34 A;  2QFL A;  5TU0 A;  5JEI A;  1YPN A;  2ALU A;  5ESY A;  1JQF A;  2V25 A;  2F7B A;  1D3K A;  1QJM A;  2VP1 A;  3T9U A;  3K6W A;  2DSF A;  1FTM A;  1UTH B;  2DP8 A;  4LZ5 A;  4N15 A;  3ZSF A;  4U4X A;  2F78 A;  3QSL A;  1LST A;  2CEX A;  2M8C A;  1INP A;  4OFJ A;  2D3I A;  1FW0 A;  3USD A;  3IB0 A;  4WKM A;  1VDW A;  1A55 A;  2PCR A;  4Q5T A;  2L5V A;  3CR9 A;  1LBZ A;  4N8Y A;  4PFY A;  4ZDM A;  2OZZ A;  5ICQ A;  2D21 A;  1EYI A;  3EQ1 A;  4IY6 A;  4EDP A;  1MDQ A;  1Y1Z A;  1AIV A;  4JWX A;  3CFX A;  3G3I A;  2VPN A;  3RYD A;  1MY4 A;  2RIN A;  2ANJ A;  1S50 A;  1RKM A;  3BKI B;  5H8Q A;  2P3V A;  1QVS A;  3GYY A;  3K1N A;  2E0S A;  4XF5 A;  2P0S A;  1IXI A;  5IZZ A;  2DWH A;  3KSJ A;  1B3F A;  1B5J A;  2PMS A;  3VV5 A;  2XHD A;  2YJP A;  4GWX A;  4R6Y A;  1B5I A;  5B7D A;  1ZMG A;  2WX9 A;  3FVN A;  3M3L A;  4POX A;  2OBG A;  4GLI A;  3MP8 A;  3R26 A;  3EHT A;  2QS3 A;  4JSD A;  4JWY A;  1K9Z A;  2F7C A;  2XD3 A;  4QFL A;  5CC2 A;  1XOC A;  1POT A;  3ILU B;  4N6K A;  4P1E A;  4PCD A;  3TQW A;  3K6X A;  1B1H A;  4JB7 A;  5DVJ A;  4QRZ A;  4GF8 A;  4DE8 A;  5A5X A;  4R6H A;  1SI1 A;  4HTG A;  3FXQ A;  4GX3 A;  5EYG A;  1ANF A;  4ZZA A;  1OVB A;  3T96 B;  3E79 A;  4JVD A;  3PTY A;  3MVX A;  2B3B A;  4WXJ A;  3E4R A;  2QVR A;  2Y7P A;  2Y7I A;  1NV7 A;  3H4Z A;  4R6K A;  5JTY B;  1MQI A;  1Y4C A;  3AXF A;  1M5F A;  1US4 A;  2QS4 A;  1S9T A;  2ZYO A;  2NXO A;  4OFL A;  4QXD A;  4OVT A;  2XWI A;  1R6Z A;  1FPK A;  1SYH A;  1MM6 A;  3DP6 A;  3CG3 A;  1IXG A;  3KJ7 A;  2GQ1 A;  4OTE A;  1IEJ A;  4LP2 B;  1QKA A;  2Y5L A;  1EYJ A;  3RLF E;  4GBV A;  1I69 A;  3KFM A;  1B2H A;  1NV4 A;  4E0X A;  2NOO A;  4JSO A;  1IXH A;  2O1L A;  3Q27 A;  1MH4 A;  2O68 A;  4HXV A;  4FJP A;  5CMM A;  5A5X B;  3O66 A;  3JZJ A;  5H8H A;  2XXW A;  1IQ7 A;  4OHN A;  2HZL A;  4OQO A;  3OEM A;  1FTK A;  2LAO A;  3UGW A;  4NED A;  1LAX A;  4L17 A;  1NNK A;  4UA8 A;  3FJM A;  1NMU A;  4JXI A;  3N26 A;  2FIE A;  3S2V A;  3FV2 A;  2VGQ A;  4GXA A;  4O3C A;  1P1O A;  5BWJ A;  4GWY A;  4R9F A;  1IIW A;  1JVX A;  3RUM A;  1NNP A;  3U93 A;  4ELP A;  3EHU A;  3IL1 B;  3C32 A;  2X7P A;  4GL8 A;  5J16 A;  1URD A;  4GWW A;  4YAH X;  2DVZ A;  4MBP A;  1D4N A;  3I6V A;  4AQ4 A;  3TTK A;  4NQ8 A;  4PFR A;  3SEY A;  1P1Q A;  1WVJ A;  4OMB A;  5H8H B;  3H6W A;  3KC1 A;  1ATG A;  3H03 A;  2P2A A;  4O8M A;  1XI6 A;  3Q25 A;  2DOJ A;  4U1Z A;  5AA2 A;  3LSL A;  3LUY A;  1KA1 A;  4PFW A;  1FPE A;  4RPO A;  4TQU Q;  1PB8 A;  2DYX A;  2XXR A;  3MYU A;  2XXK A;  2W7Y A;  4ZEI A;  3KZG A;  4ZZE A;  2HPG A;  3PPO A;  3GBA A;  4JVC A;  3V5A A;  1BK4 A;  4FEC A;  4O7M A;  2KR0 A;  2XXP A;  2DE3 A;  1QUJ A;  4PBQ A;  4F19 A;  4IO5 A;  1IIT A;  1NUY A;  4MIJ A;  4MNI A;  3M8U A;  2UYE A;  4NMY A;  3UK4 A;  4FE8 A;  3K6V A;  5H8F A;  1FJ6 A;  1B51 A;  3CFL A;  5ET7 A;  2WEF A;  4K3F A;  1MXZ A;  2X7Q A;  2PFZ A;  1SW4 A;  4YIC A;  4NGU A;  1PB7 A;  5DVI A;  1A40 A;  2MKZ A;  1MY2 A;  4NWD A;  4QHQ A;  3K6U A;  3K02 A;  4P47 A;  3D4C A;  1F9B A;  5I56 B;  3PUY E;  3IB1 A;  2NWJ A;  3T1B A;  4NF5 A;  1ZTY A;  3RPW A;  2A5S A;  4WED A;  3PUV E;  5TP9 A;  4G8H A;  4LZ7 A;  3O6G A;  3O2A A;  2XWV A;  4RYA A;  3FBP A;  2F3B A;  2XXQ A;  2WKY A;  1ELJ A;  1ZBM A;  2CZL A;  4F3P A;  2OCU A;  4F2Q A;  5CBR A;  2XXV A;  4KYS A;  3K2D A;  5H8F B;  1QUI A;  3FZV A;  3B6W A;  5FTH A;  2UXA A;  4N81 A;  3N5L A;  4E0W A;  3EN3 A;  3ZKK A;  4THI A;  4FEB A;  1QUK A;  4GWZ A;  4ELQ A;  5ICT A;  1M5B A;  3PPN A;  2PT1 A;  4PGP A;  3I3V A;  4QF9 A;  3ZS6 A;  2Q74 A;  1H45 A;  3OSR A;  3U8Q A;  4YKI A;  1H44 A;  4NF6 A;  4U21 A;  3TTL A;  3O97 A;  3W15 C;  2GFE A;  4TOZ A;  4JWO A;  5I5P A;  2Y7W A;  5TP9 B;  1NV3 A;  1SYI A;  4GXS B;  2E1S A;  2RKM A;  1LBX A;  3K1M A;  4MLV A;  1AMF A;  1M5E A;  4I8C A;  1R1N A;  5ITO A;  3RN8 A;  1SD3 A;  5ET8 A;  4NG7 A;  5EQ9 A;  4DI4 B;  4GRK A;  5L9S A;  3GLB A;  1B3E A;  2DXR A;  2H98 A;  1O7T A;  1LAH E;  4GWO A;  1TFD A;  2G29 A;  2REJ A;  3C9H A;  1FQC A;  3O29 A;  4ZEB A;  5FHM A;  2ZXT A;  2F97 A;  2H4I A;  4H6D A;  3MQ9 A;  4YZZ A;  3CFZ A;  2AL4 A;  3KG2 A;  3HN0 A;  4Q0C A;  3MPK A;  4EXL A;  2JJK A;  1M5C A;  1ZLQ A;  5ITP A;  1BKA A;  3B8B A;  4ZE8 A;  2ZNT A;  3SEV A;  4MCO A;  4AS4 A;  2PFY A;  3DLN A;  2DE2 A;  5FBP A;  2Q8M A;  1LBY A;  3PUZ E;  2Q2C A;  4PF8 A;  1MQD A;  3FXU A;  4LAT A;  2O7U A;  1RDX A;  4M4G A;  3MP6 A;  1FPD A;  3G3G A;  2F6G A;  2Y84 A;  5ET5 A;  3QUF A;  1BP5 A;  4KCD A;  5IZ3 B;  1ZKB A;  3TMG A;  4EQ9 A;  3TEP A;  1LEV A;  1GGG A;  4G8N A;  3KBZ A;  4BDM A;  2HAV A;  3UA8 A;  5EHS A;  3O6I A;  5AA3 A;  3TPA A;  1AH5 A;  4DXU A;  4H1X A;  4H5F A;  4MH5 A;  1DPE A;  3L6G A;  2H9B A;  1LBW A;  3FVK A;  3K0V A;  5I2N B;  3PPR A;  1US5 A;  1MY0 A;  3OSQ A;  1IMD A;  1Y4T A;  4MFI A;  1Y3N A;  3D1R A;  1FTJ A;  1Y20 A;  2V4C A;  2DE4 A;  1URS A;  3TCH A;  1UIU A;  2PBW A;  3G3J A;  1KWH A;  1IME A;  1VFE A;  1MQG A;  2A5T B;  3U94 A;  4DZ1 A;  3LSX A;  3TOD A;  3IB2 A;  5DTB A;  1J1N A;  4NE4 A;  3K00 A;  4KYE A;  1N04 A;  3RPL B;  3W9W A;  4P1L A;  2XXY A;  1CB6 A;  5CI5 A;  4TLM B;  3FJG A;  3FVO A;  3FD3 A;  5HBC A;  1B7U A;  3MZ9 A;  4IY5 A;  2OK2 A;  1OLC A;  5EHM A;  3T0J A;  1MPC A;  3JYR A;  2THI A;  1SDX A;  3KJT A;  3OEN A;  4ESX A;  4HCW A;  1UTB A;  3V83 A;  2WBD A;  2O1M A;  2OWS A;  1B9J A;  2PX1 A;  5I59 A;  4AB6 A;  2HHM A;  2H5Y A;  5ELV A;  4N6P A;  5JTY A;  3HFU A;  4NWC A;  5BUU A;  4R75 A;  4QFP A;  3N6U A;  1NH7 A;  4IO7 A;  3LR1 A;  2Z22 A;  3D4G A;  4H8J A;  2Z8E A;  5LTC A;  3LUZ A;  4H5G A;  4YMA A;  4OWD A;  1PEB A;  3L6H A;  4EUO A;  5ET6 A;  2DWA A;  3M3F A;  1WOD A;  5ISU A;  2XWO A;  4I3Y A;  4ELO A;  1FTA A;  1P1U A;  3DEL B;  3I5O A;  4I1D A;  4MJO A;  5JK4 A;  1NUW A;  4HE1 A;  1SW1 A;  4NF8 A;  1B6H A;  4LA9 A;  4RPN A;  1N76 A;  4PC9 A;  4F22 A;  1P1N A;  4OEU A;  3O9P A;  1UTB B;  4N91 A;  4HW8 A;  3PPP A;  1LB9 A;  2ONR A;  3EHS A;  5I59 B;  5IM2 A;  3CRB A;  1OQH A;  1YCJ A;  3BBR A;  2KQZ A;  1QGX A;  3IFA A;  3MUQ A;  3Q26 A;  3MST A;  1EZ9 A;  1RYX A;  2BJI A;  3RQT A;  4G8M A;  2I3W A;  4U4S A;  4FOR A;  4OAN A;  2FHY A;  4DCY A;  5L9M A;  1MH3 A;  1SW5 A;  5AA2 D;  2VHA A;  2Y7K A;  4MNC A;  3RTW B;  4X1B A;  5LOM A;  2Y5K A;  1FSA A;  1WDN A;  1CNQ A;  1NV1 A;  3BFU A;  1O63 A;  1NH8 A;  3FUZ A;  1OLA A;  3CSG A;  1IMC A;  3P7I A;  4NF8 B;  3IOR A;  5I58 B;  4F31 B;  3LBS A;  4X9T A;  4X04 A;  4G77 A;  4UAC A;  4GD5 A;  1SQY A;  2QJE A;  5I7I A;  4YKK A;  2R6G E;  4R2F A;  3SEW A;  1FQA A;  3SEU A;  5I57 A;  3S9M C;  4P3L A;  1ZJL A;  1USY H;  4LZ8 A;  3IJO B;  1FBD A;  2CZH A;  3KC0 A;  4TLL B;  1N84 A;  1LGB C;  1MPD A;  3BIH A;  4U1O A;  1URG A;  1YYZ A;  3FXB A;  2Z23 A;  4OVJ A;  3GBB A;  4DXB A;  3OO7 A;  3TTM A;  4HE2 A;  1N3W A;  1B4H A;  3QYT A;  4NF0 A;  5CBS A;  3MWB A;  2V3Q A;  1G0I A;  3C4M A;  3KEI A;  1FBG A;  3U92 A;  3OD7 A;  4QFO A;  4BDL A;  2I48 A;  1UIV A;  1D9V A;  1BTJ A;  1AWB A;  3VXC A;  1LFI A;  1FPF A;  4DCX A;  3IO4 A;  5I56 A;  4HE0 A;  4X1D A;  1B4Z A;  2IEE A;  1NL5 A;  5I57 B;  1LFG A;  2R71 A;  4PDD A;  1JW1 A;  3PMW A;  3R6U A;  3QAX A;  2YLN A;  4KHZ E;  1IUD A;  1BIY A;  5CMK A;  1DPP A;  3G3H A;  1S7Y A;  1LBC A;  1JP4 A;  1B0H A;  4Z7E A;  3G3F A;  2BJJ X;  3MVY A;  3OO9 A;  3HO7 A;  4LN5 A;  1OIB A;  3IOT A;  1DSN A;  2AIX A;  3DM0 A;  2ZMB A;  3C35 A;  4G4P A;  3VLW A;  1MRP A;  1FTL A;  3TCF A;  3ODB A;  1Y3Q A;  2RC7 A;  4KPT A;  1A8E A;  1R9L A;  2Q88 A;  4QSD A;  2O51 A;  3UIF A;  1HSE A;  5EQ8 A;  2KLF A;  4EQ7 A;  4XKP A;  4PFU A;  3H7M A;  4H45 A;  4I3E A;  2R9J A;  1PB9 A;  3N6T A;  1POY 1;  3Q29 A;  1MPB A;  1D9Y A;  4XXU A;  4ZED A;  4ND9 A;  4PF6 A;  4GBW A;  1JVY A;  2HEU A;  1B7Z A;  1HSL A;  1B3H A;  1IXC A;  4PE3 A;  2GRV A;  1B3G A;  1LAG E;  3FVG A;  4P56 A;  4YB6 A;  4H67 A;  2WYK A;  3MVZ A;  4PQJ A;  1PBQ A;  2RC8 A;  4NF4 B;  2F3D A;  4QFK A;  4ZE9 A;  1FPJ A;  1B3L A;  1I6A A;  3IX1 A;  4O94 A;  1GTK A;  5H8S A;  1FQE A;  4P11 A;  4QBA A;  1EU8 A;  2O69 A;  4OEN A;  1PC3 A;  2Q89 A;  1MDP 1;  1B7H A;  3FIR A;  3TQL A;  2AYS A;  1Y3P A;  1JW4 A;  3RTF B;  1MXX A;  4DXC A;  3UOR A;  1EYK A;  5KCJ B;  2F35 A;  3HST A;  3PPQ A;  3RT6 B;  5IGA A;  4RJZ A;  3KBR A;  2CZK A;  4GX6 A;  3Q28 A;  4YU0 A;  4N13 A;  4GX4 A;  3V89 B;  4N6D A;  3FXR A;  3PU5 A;  3RNN A;  3SKP A;  2XX9 A;  1BLF A;  2FNC A;  3O6H A;  3OO6 A;  5IZ3 A;  2FBP A;  3MW0 A;  3TCG A;  4R74 A;  5K2X A;  3CG1 A;  3EPE A;  3IO6 A;  2DVC A;  3IJX B;  5F24 A;  4I40 A;  1OVT A;  3B7D A;  1NV0 A;  3MBP A;  4PAI A;  1EH3 A;  4Q30 B;  2NUV A;  1DMB A;  2DXY A;  4ELR A;  1NKX A;  3A29 A;  2ZZW A;  4O7I A;  4OVS A;  4YB5 A;  1MY1 A;  1AL3 A;  2CEY A;  2H25 A;  5I2N A;  1XS5 A;  3PD8 A;  4C0R A;  1I6B A;  1LB8 A;  4HS7 A;  4U23 A;  2B65 A;  1MG1 A;  1KA0 A;  4U22 A;  4N4U A;  4Z0I A;  3ROJ A;  3TFL A;  2H99 A;  2F34 A;  4F18 A;  1DBZ A;  2A5T A;  3VVD A;  4POW A;  3IK6 B;  1AOV A;  1B0L A;  2F7A A;  2CMO A;  4DI3 D;  1TXF A;  4G68 A;  4NTL A;  4ZEC A;  3QUJ A;  1VR5 A;  3RPL A;  1B40 A;  3HPI A;  2V3T A;  5FHO A;  3F11 A;  2O7I A;  4JDF A;  1RDY A;  3QMF A;  3SER A;  2QRY A;  2Z8D A;  1Y1M A;  3PV0 E;  4P9K A;  4OVP A;  4JVI A;  1FBC A;  3G7W A;  4PTK A;  4P0G A;  4PET A;  1JEV A;  2ONK E;  2D5W A;  5CRY A;  1B05 A;  1MXV A;  4OVQ A;  5DT6 A;  2ZYK A;  3KOT A;  5L8D A;  1L5T A;  1A8F A;  3WAE A;  4YMB A;  5FHN A;  2HFB A;  1NV5 A;  2GH9 A;  3HV1 A;  2NVU B;  3A09 A;  5K2Y A;  4R73 A;  1DK4 A;  2O84 X;  4PAK A;  4M1V A;  4F3S A;  3SES A;  4KD5 A;  5EYF A;  3U65 A;  1YAE A;  3E9X A;  2VT5 A;  2DWJ A;  3CSB A;  5F7V A;  2REG A;  1Q9D A;  2RC9 A;  4ZS9 A;  4MF3 A;  4GFR A;  3ISP A;  4G68 B;  4G68 C;  1DOT A;  1NUX A;  1USY E;  1PDA A;  1CE2 A;  4F39 A;  2QVV A;  2I4C A;  5HPQ A;  1LLS A;  1MY3 A;  1M5D A;  1B58 A;  4RK9 A;  5DVF A;  1P99 A;  1MS7 A;  1Q1K A;  3TAJ A;  1VFD A;  4AS5 A;  1B5H A;  2VPO A;  4F3B A;  3RGY A;  1FPG A;  2F8D A;  4X8R A;  4N07 A;  4DLD A;  3FGS A;  2RCA A;  5A5L A;  4IO4 A;  4PDH A;  4PFB A;  3ZKL A;  4KFQ A;  1KZ8 A;  3DP8 A;  2XXU A;  3FV1 A;  3MVW A;  5M2V A;  3W9V A;  1YTV A;  2QMX A;  4R72 A;  5CMC A;  1FRP A;  1B1X A;  1YXI A;  1B46 A;  3TTN A;  4QSC A;  3T66 A;  2ESN A;  4IO6 A;  3PMX A;  4OES A;  2XD2 A;  3A3U A;  3H6U A;  2DDK A;  1XVX A;  1RYO A;  4IR8 A;  3S9N C;  3H3G A;  3MC2 A;  2I0B A;  4PBH A;  1XVY A;  4OFO A;  2B4M A;  3QK6 A;  5IKB A;  3H06 B;  4UAB A;  4ZEF A;  3UN6 A;  1SI0 A;  4XIG Q;  1II5 A;  4X48 A;  4RY1 A;  1Q35 A;  3PUW E;  5F1Q A;  3EF7 A;  3GXA A;  5I58 A;  3CIJ A;  2XWK A;  4PAF A;  4PP0 A;  3T9V A;  4C1U A;  1LAF E;  1Y9U A;  4EF1 A;  5KDT A;  1H76 A;  4ESW A;  4BDR A;  1LBB A;  3LC8 A;  2HCA A;  1N7W A;  4KQP A;  3TYH A;  2WYP A;  1FCK A;  1A7L A;  3OO8 A;  2ONS A;  1FQB A;  3SDF A;  3ILT B;  2HXR A;  2B4L A;  5EQA A;  3LSW A;  1DTZ A;  3TZA A;  4KXP A;  1SVX B;  3VVE A;  4LQ5 A;  3VE1 B;  5H8Q B;  4YKP A;  1FBH A;  2PT2 A;  4FAT A;  1JW5 A;  3PGF A;  2P3N A;  4MX6 A;  2Z8F A;  2FIX A;  3CI8 A;  1TWY A;  4LUB A;  3KGC A;  2Q8J A;  3QIM A;  1ZIU A;  3IR1 A;  2XXX A;  3S9L C;  4FBP A;  4OVR A;  4OYV A;  3H6T A;  2V84 A;  3S4U A;  1EZO A;  5KDT B;  2QPQ A;  4MMP A;  4O3A A;  3V8X B;  4GWS A;  4F1Y A;  3C33 A;  3K1P A;  2XXT A;  2ZZV A;  3E3K A;  4MEV A;  4LON B;  2HQ0 A;  4GWU A;  1NV2 A;  3MZB A;  3TKD A;  1JNF A;  4I9D A;  4P8B A;  2F6P A;  4ISU A;  4BDO A;  4BDN A;  3THI A;  1FPL A;  3HHG A;  3N94 A;  3KN7 A;  4ECF A;  3HCQ A;  5H8N A;  4F29 A;  4RNS A;  4U2R A;  2ZYM A;  3T9H B;  2VD2 A;  1B52 A;  1QUL A;  3BIG A;  4FAJ A;  2QSX A;  4XEQ A;  4HCY A;  1FTO A;  2G93 A;  4PFT A;  3OEK A;  1LFH A;  3R7X A;  1Z7M E;  5AE4 A;  1JET A;  5EYH A;  3VDF A;  4N8G A;  2XX8 A;  3OOA A;  4OER A;  4PE5 B;  1NV6 A;  3ONM A;  4ZEK A;  2Q9T A;  3K01 A;  1LCT A;  1YZ0 A;  1P1W A;  2PYY A;  3GZG A;  3B50 A;  3MP1 A;  2R8T A;  2VOZ A;  2B3F A;  3VVF A;  3T22 A;  2OWT A;  2VD3 A;  1HSJ A;  4QSE A;  4GQO A;  3FJ7 A;  5IZ1 A;  3A3C A;  3K4U A;  4BLA A;  3OXN A;  4GL0 A;  3OMB A;  3KN8 A;  3TEL A;  4YKJ A;  5DEX A;  3EKI A;  2ZNS A;  1MXY A;  3TUS A;  5H8N B;  1XT8 A;  1GR2 A;  3B6Q A;  4F1U A;  2FVZ A;  5J1D A;  2Q2A A;  3CVG A;  2PVU A;  1FBE A;  4NF4 A;  1QKB A;  2XX7 A;  1OMP A;  4P0I A;  1DCU A;  1R9Q A;  3PD9 A;  1XC1 A;  3TDJ A;  1A54 A;  2FYI A;  4F1V A;  4ONY A;  2ZNU A;  4OXV A;  1N3X A;  4NAP A;  1NUZ A;  3LV0 A;  2ZZX A;  3O28 A;  1T0K A;  1LCF A;  3DP4 A;  4O3B A;  4OEV A;  3LSF B;  5IAI A;  5TPA A;  4GIZ A;  2X26 A;  4IO2 A;  2DS9 A;  5KCJ A;  4IGT A;  3PUX E;  4NN3 A;  3U72 A;  3HHF A;  2ZYN A;  1I6Q A;  3VLU A;  1NFT A;  3UP9 A;  1RDZ A;  2V3U A;  1NNT A;  5I2K A;  1XHY A;  3T93 B;  2HAU A;  2I49 A;  5AA2 B;  2QMW A;  5CM6 A;  5L9O A;  1FQF A;  4DIG A;  3E13 X;  1B32 A;  4FIM A;  2UVH A;  4R2B A;  4RXL A;  5DEX B;  4MHF A;  4IB2 A;  2DQV A;  1QW0 A;  3JV9 A;  2ABH A;  4KR5 A;  3IOV A;  3RY3 A;  4OZ9 A;  4QFN A;  3IOU A;  5I3S A;  5FTI A;  4GVO A;  4RK2 A;  3PMV A;  2OJT A;  4G2Z A;  2XXI A;  1MQH A;  4PFI A;  1FJ9 A;  3H6V A;  4LVQ A;  4MNP A;  4EF2 A;  3T9X B;  2XXH A;  3CHG A;  2OWZ A;  2UYF A;  4RA1 A;  1ZU0 A;  4KYD A;  2O6A A;  2F36 A;  2FA7 A;  4FED A;  1GVC A;  4N17 A;  4G61 A;  1A99 A;  5AA4 A;  1FPI A;  3MPL A;  5TPA B;  4OET A;  3C36 A;  1IZ1 A;  4NX1 A;  4XKN A;  1VE4 A;  1JEU A;  3SZP A;  1FBF A;  4YB7 A;  4OA4 A;  4KCC A;  2OX3 A;  5I2K B;  5CMB A;  3ECR A;  1TT1 A;  1N0T A;  4IGR A;  4NF5 B;  2V93 A;  4F2O A;  1G0H A;  4H0W A;  4XTC Q;  1MXW A;  5HM4 B;  2F5X A;  1TFA A;  2XA5 A;  4PGN A;  1H43 A;  1SW2 A;  1GV8 A;  2UVI A;  1SPI A;  3RT8 A;  5DW8 A;  2P1S A;  3B6T A;  3IFC A;  3TTR A;  2GHB A;  2RCB A;  4AB5 A;  2I3V A;  5EQ7 A;  2AL5 A;  1D9Q A;  4F3G A;  4LQ2 A;  5LDZ A;  2I58 A;  3OEL A;  4XFE A;  1O64 A;  3FAT A;  5AA4 B;  3G3K A;  1MXU A;  2YPN A;  3KOS A;  3M3K A;  1OQG A;  2UVJ A;  3S9E A;  5KZT A;  3BFT A;  1MM7 A;  3VFJ A;  2QS1 A;  5DYH A;  2QL3 A;  5B70 A;  3MZ1 A;  5I84 A;  2HZK A;  3U1O A;  5T3J A;  1EZP A;  1IMB A;  4WEP A;  4R9G A;  2Y7R A;  1IMF A;  4EQB A;  4KI0 E;  1NNF A;  3C31 A;  4NF6 B;  3IOW A;  3KSX A;  4H8I A;  4BDQ A;  1NI9 A;  3WAF A;  2I6E A;  4NHB A;  3MJN A;  2I4B A;  1PBP A;  1FBP A;  2HXW A;  4EXK A;  1UTH A;  2I0C A;  4MAG A;  3NOH A;  1H3D A;  4MLQ A;  4XKR A; 
#chains in the Genus database with same CATH homology
 2IA4 A;  2UVG A;  3SET A;  3IAZ A;  4C1T A;  4H65 A;  4IO3 A;  2DWI A;  4Q8R A;  1DTG A;  4XKQ A;  3QXM A;  4JBZ A;  2RF1 A;  1SBP A;  2OLB A;  4I62 A;  3SEX A;  1VSO A;  1MQJ A;  1FQD A;  3VXB A;  4GOT A;  4DDD A;  3FAS A;  3KN3 A;  5AA1 A;  3VLV A;  2GHA A;  2QS2 A;  1N7X A;  1UQW A;  3MAM A;  1Z7N E;  3C34 A;  5TU0 A;  5JEI A;  1YPN A;  2ALU A;  1JQF A;  2V25 A;  2F7B A;  1D3K A;  1QJM A;  2VP1 A;  3T9U A;  3K6W A;  2DSF A;  1FTM A;  1UTH B;  2DP8 A;  4LZ5 A;  3ZSF A;  4U4X A;  2F78 A;  3QSL A;  1LST A;  2M8C A;  4OFJ A;  2D3I A;  1FW0 A;  3USD A;  3IB0 A;  4WKM A;  1A55 A;  4Q5T A;  3CR9 A;  4PFY A;  4ZDM A;  5ICQ A;  2OZZ A;  2D21 A;  3EQ1 A;  4IY6 A;  4EDP A;  1MDQ A;  1Y1Z A;  1AIV A;  4JWX A;  3CFX A;  3G3I A;  1MY4 A;  2RIN A;  2ANJ A;  1S50 A;  1RKM A;  3BKI B;  5H8Q A;  1QVS A;  3K1N A;  2E0S A;  2P0S A;  1IXI A;  2DWH A;  3KSJ A;  1B3F A;  1B5J A;  2PMS A;  3VV5 A;  2XHD A;  2YJP A;  4R6Y A;  1B5I A;  5B7D A;  1ZMG A;  3FVN A;  3M3L A;  4POX A;  2OBG A;  4GLI A;  3MP8 A;  3R26 A;  3EHT A;  2QS3 A;  4JSD A;  4JWY A;  2F7C A;  2XD3 A;  4QFL A;  5CC2 A;  1XOC A;  1POT A;  3ILU B;  3TQW A;  3K6X A;  1B1H A;  4JB7 A;  5DVJ A;  4QRZ A;  4GF8 A;  4DE8 A;  5A5X A;  4R6H A;  1SI1 A;  4HTG A;  3FXQ A;  1ANF A;  4ZZA A;  1OVB A;  3T96 B;  3MVX A;  2B3B A;  4WXJ A;  3E4R A;  2Y7P A;  2Y7I A;  3H4Z A;  4R6K A;  5JTY B;  1MQI A;  1Y4C A;  3AXF A;  1M5F A;  1US4 A;  2QS4 A;  1S9T A;  2ZYO A;  2NXO A;  4OFL A;  1R6Z A;  1SYH A;  1MM6 A;  3DP6 A;  3CG3 A;  1IXG A;  3KJ7 A;  4OTE A;  1IEJ A;  4LP2 B;  1QKA A;  3RLF E;  1I69 A;  3KFM A;  1B2H A;  4E0X A;  2NOO A;  4JSO A;  1IXH A;  2O1L A;  3Q27 A;  1MH4 A;  2O68 A;  4FJP A;  5CMM A;  5A5X B;  3O66 A;  3JZJ A;  5H8H A;  2XXW A;  1IQ7 A;  4OHN A;  2HZL A;  4OQO A;  3OEM A;  1FTK A;  2LAO A;  3UGW A;  4NED A;  1LAX A;  4L17 A;  1NNK A;  4UA8 A;  3FJM A;  1NMU A;  4JXI A;  3N26 A;  3S2V A;  3FV2 A;  2VGQ A;  4GXA A;  4O3C A;  1P1O A;  5BWJ A;  4R9F A;  1IIW A;  1JVX A;  3RUM A;  1NNP A;  3U93 A;  4ELP A;  3EHU A;  3IL1 B;  3C32 A;  2X7P A;  4GL8 A;  1URD A;  4YAH X;  2DVZ A;  4MBP A;  1D4N A;  3I6V A;  4AQ4 A;  3TTK A;  3SEY A;  1P1Q A;  1WVJ A;  4OMB A;  5H8H B;  3H6W A;  1ATG A;  3H03 A;  2P2A A;  3Q25 A;  2DOJ A;  4U1Z A;  5AA2 A;  3LSL A;  3LUY A;  4PFW A;  4RPO A;  4TQU Q;  1PB8 A;  2DYX A;  2XXR A;  2W7Y A;  4ZEI A;  3KZG A;  4ZZE A;  3PPO A;  3GBA A;  3V5A A;  4FEC A;  2XXP A;  2DE3 A;  1QUJ A;  4F19 A;  4IO5 A;  1IIT A;  3M8U A;  2UYE A;  4NMY A;  3UK4 A;  4FE8 A;  3K6V A;  5H8F A;  1B51 A;  3CFL A;  4K3F A;  1MXZ A;  2X7Q A;  1SW4 A;  4YIC A;  1PB7 A;  5DVI A;  1A40 A;  1MY2 A;  4NWD A;  4QHQ A;  3K6U A;  3K02 A;  3D4C A;  1F9B A;  5I56 B;  3PUY E;  3IB1 A;  2NWJ A;  4NF5 A;  1ZTY A;  3RPW A;  2A5S A;  4WED A;  3PUV E;  5TP9 A;  4G8H A;  4LZ7 A;  3O6G A;  3O2A A;  4RYA A;  2XXQ A;  2WKY A;  1ELJ A;  1ZBM A;  2CZL A;  4F3P A;  2OCU A;  4F2Q A;  5CBR A;  2XXV A;  4KYS A;  3K2D A;  5H8F B;  1QUI A;  3FZV A;  3B6W A;  5FTH A;  2UXA A;  3N5L A;  4E0W A;  3EN3 A;  3ZKK A;  4THI A;  4FEB A;  1QUK A;  4ELQ A;  5ICT A;  1M5B A;  3PPN A;  2PT1 A;  3I3V A;  4QF9 A;  3ZS6 A;  1H45 A;  3OSR A;  3U8Q A;  4YKI A;  1H44 A;  4NF6 A;  4U21 A;  3TTL A;  3O97 A;  3W15 C;  2GFE A;  4TOZ A;  4JWO A;  5TP9 B;  2Y7W A;  1SYI A;  4GXS B;  2E1S A;  2RKM A;  3K1M A;  4MLV A;  1AMF A;  1M5E A;  4I8C A;  1R1N A;  5ITO A;  3RN8 A;  1SD3 A;  4GRK A;  5L9S A;  3GLB A;  1B3E A;  2DXR A;  2H98 A;  1O7T A;  1LAH E;  4GWO A;  1TFD A;  2G29 A;  2REJ A;  3C9H A;  1FQC A;  3O29 A;  4ZEB A;  5FHM A;  2ZXT A;  2F97 A;  2H4I A;  4H6D A;  3MQ9 A;  4YZZ A;  3CFZ A;  2AL4 A;  3KG2 A;  3HN0 A;  4Q0C A;  3MPK A;  4EXL A;  1M5C A;  1ZLQ A;  5ITP A;  1BKA A;  4ZE8 A;  2ZNT A;  3SEV A;  3DLN A;  2DE2 A;  3PUZ E;  2Q2C A;  1MQD A;  3FXU A;  4LAT A;  2O7U A;  4M4G A;  3MP6 A;  3G3G A;  2F6G A;  2Y84 A;  3QUF A;  1BP5 A;  4KCD A;  1ZKB A;  3TMG A;  4EQ9 A;  3TEP A;  1GGG A;  4G8N A;  4BDM A;  2HAV A;  3UA8 A;  5EHS A;  3O6I A;  5AA3 A;  3TPA A;  1AH5 A;  4DXU A;  4H1X A;  4H5F A;  4MH5 A;  1DPE A;  3L6G A;  2H9B A;  3K0V A;  3FVK A;  5I2N B;  3PPR A;  1US5 A;  1MY0 A;  3OSQ A;  1Y4T A;  4MFI A;  1Y3N A;  1FTJ A;  1Y20 A;  2DE4 A;  1URS A;  3TCH A;  1UIU A;  2PBW A;  3G3J A;  1KWH A;  1VFE A;  2A5T B;  1MQG A;  3U94 A;  4DZ1 A;  3LSX A;  3TOD A;  3IB2 A;  5DTB A;  1J1N A;  4NE4 A;  3K00 A;  4KYE A;  1N04 A;  3W9W A;  2XXY A;  1CB6 A;  5CI5 A;  4TLM B;  3FJG A;  3FVO A;  3FD3 A;  5HBC A;  1B7U A;  3MZ9 A;  4IY5 A;  2OK2 A;  1OLC A;  5EHM A;  1MPC A;  3JYR A;  2THI A;  1SDX A;  3KJT A;  3OEN A;  4ESX A;  4HCW A;  1UTB A;  3V83 A;  2O1M A;  2OWS A;  1B9J A;  2PX1 A;  5I59 A;  4AB6 A;  2H5Y A;  5ELV A;  4N6P A;  5JTY A;  4NWC A;  5BUU A;  4R75 A;  4QFP A;  3N6U A;  1NH7 A;  4IO7 A;  3LR1 A;  2Z22 A;  3D4G A;  4H8J A;  2Z8E A;  4H5G A;  4YMA A;  4OWD A;  1PEB A;  3L6H A;  4EUO A;  2DWA A;  3M3F A;  1WOD A;  5ISU A;  4ELO A;  1P1U A;  3DEL B;  3I5O A;  4I1D A;  5JK4 A;  1SW1 A;  4NF8 A;  1B6H A;  4LA9 A;  4RPN A;  1N76 A;  4F22 A;  1P1N A;  4OEU A;  3O9P A;  1UTB B;  4HW8 A;  3PPP A;  1LB9 A;  2ONR A;  3EHS A;  5I59 B;  3CRB A;  1OQH A;  1YCJ A;  3BBR A;  3MUQ A;  3Q26 A;  1EZ9 A;  1RYX A;  3RQT A;  4G8M A;  2I3W A;  4U4S A;  4FOR A;  4DCY A;  5L9M A;  1MH3 A;  1SW5 A;  5AA2 D;  2VHA A;  2Y7K A;  3RTW B;  4X1B A;  5LOM A;  1WDN A;  3BFU A;  1O63 A;  1NH8 A;  3FUZ A;  1OLA A;  3CSG A;  3P7I A;  4NF8 B;  3IOR A;  5I58 B;  4F31 B;  3LBS A;  4X9T A;  4G77 A;  4UAC A;  4GD5 A;  1SQY A;  2QJE A;  4YKK A;  2R6G E;  4R2F A;  3SEW A;  1FQA A;  3SEU A;  5I57 A;  3S9M C;  1ZJL A;  1USY H;  4LZ8 A;  3IJO B;  4TLL B;  1N84 A;  1LGB C;  1MPD A;  4U1O A;  1URG A;  2Z23 A;  4OVJ A;  3GBB A;  4DXB A;  3OO7 A;  3TTM A;  1N3W A;  1B4H A;  3QYT A;  5CBS A;  3MWB A;  2V3Q A;  3C4M A;  3KEI A;  3U92 A;  3OD7 A;  4QFO A;  4BDL A;  2I48 A;  1UIV A;  1D9V A;  1BTJ A;  3VXC A;  1LFI A;  4DCX A;  3IO4 A;  5I56 A;  4X1D A;  1B4Z A;  2IEE A;  1NL5 A;  5I57 B;  1LFG A;  2R71 A;  1JW1 A;  3PMW A;  3R6U A;  3QAX A;  2YLN A;  4KHZ E;  1IUD A;  1BIY A;  5CMK A;  1DPP A;  3G3H A;  1S7Y A;  1LBC A;  1B0H A;  4Z7E A;  3G3F A;  2BJJ X;  3MVY A;  3OO9 A;  3HO7 A;  1OIB A;  3IOT A;  1DSN A;  2AIX A;  3DM0 A;  2ZMB A;  3C35 A;  4G4P A;  3VLW A;  1MRP A;  1FTL A;  3TCF A;  3ODB A;  1Y3Q A;  2RC7 A;  4KPT A;  1A8E A;  1R9L A;  2Q88 A;  4QSD A;  2O51 A;  3UIF A;  1HSE A;  2KLF A;  4EQ7 A;  4XKP A;  4PFU A;  3H7M A;  2R9J A;  1PB9 A;  3N6T A;  1POY 1;  3Q29 A;  1MPB A;  1D9Y A;  4XXU A;  4ZED A;  4ND9 A;  1JVY A;  2HEU A;  1B7Z A;  1HSL A;  1B3H A;  1IXC A;  2GRV A;  1B3G A;  1LAG E;  3FVG A;  4YB6 A;  4H67 A;  3MVZ A;  4PQJ A;  1PBQ A;  2RC8 A;  4NF4 B;  4QFK A;  4ZE9 A;  1B3L A;  1I6A A;  3IX1 A;  1GTK A;  5H8S A;  1FQE A;  4P11 A;  1EU8 A;  2O69 A;  4OEN A;  1PC3 A;  2Q89 A;  1MDP 1;  1B7H A;  3FIR A;  3TQL A;  2AYS A;  1Y3P A;  1JW4 A;  3RTF B;  1MXX A;  4DXC A;  3UOR A;  5KCJ B;  2F35 A;  3HST A;  3PPQ A;  3RT6 B;  4RJZ A;  3KBR A;  3Q28 A;  4YU0 A;  4N13 A;  3V89 B;  3RNN A;  3FXR A;  3PU5 A;  3SKP A;  2XX9 A;  1BLF A;  2FNC A;  3O6H A;  3OO6 A;  3MW0 A;  3TCG A;  4R74 A;  5K2X A;  3CG1 A;  3EPE A;  3IO6 A;  2DVC A;  3IJX B;  1OVT A;  3B7D A;  3MBP A;  1EH3 A;  4Q30 B;  2NUV A;  1DMB A;  2DXY A;  4ELR A;  1NKX A;  4YB5 A;  1MY1 A;  1AL3 A;  2H25 A;  5I2N A;  1XS5 A;  3PD8 A;  4C0R A;  1I6B A;  1LB8 A;  4HS7 A;  4U23 A;  2B65 A;  1MG1 A;  4U22 A;  4Z0I A;  3TFL A;  2H99 A;  2F34 A;  4F18 A;  2A5T A;  3VVD A;  4POW A;  3IK6 B;  1AOV A;  1B0L A;  2F7A A;  2CMO A;  1TXF A;  4G68 A;  4NTL A;  4ZEC A;  3QUJ A;  1VR5 A;  1B40 A;  3HPI A;  2V3T A;  5FHO A;  3F11 A;  2O7I A;  4JDF A;  3SER A;  2QRY A;  2Z8D A;  1Y1M A;  3PV0 E;  3G7W A;  4P0G A;  4PET A;  1JEV A;  2ONK E;  2D5W A;  5CRY A;  1B05 A;  1MXV A;  5DT6 A;  2ZYK A;  3KOT A;  5L8D A;  1L5T A;  1A8F A;  3WAE A;  4YMB A;  5FHN A;  2HFB A;  2GH9 A;  3HV1 A;  2NVU B;  3A09 A;  5K2Y A;  4R73 A;  2O84 X;  4M1V A;  4F3S A;  3SES A;  4KD5 A;  5EYF A;  1YAE A;  3E9X A;  2DWJ A;  3CSB A;  5F7V A;  2REG A;  2RC9 A;  4ZS9 A;  4MF3 A;  4GFR A;  4G68 B;  4G68 C;  1DOT A;  1USY E;  1PDA A;  1CE2 A;  4F39 A;  2I4C A;  5HPQ A;  1LLS A;  1MY3 A;  1M5D A;  1B58 A;  4RK9 A;  5DVF A;  1P99 A;  1MS7 A;  1Q1K A;  3TAJ A;  1VFD A;  1B5H A;  4F3B A;  3RGY A;  2F8D A;  4N07 A;  4DLD A;  3FGS A;  2RCA A;  4IO4 A;  3ZKL A;  4KFQ A;  3DP8 A;  2XXU A;  3FV1 A;  3MVW A;  5M2V A;  3W9V A;  1YTV A;  2QMX A;  4R72 A;  5CMC A;  1B1X A;  1B46 A;  3TTN A;  4QSC A;  3T66 A;  2ESN A;  4IO6 A;  3PMX A;  4OES A;  2XD2 A;  3A3U A;  3H6U A;  1XVX A;  1RYO A;  3S9N C;  3H3G A;  3MC2 A;  2I0B A;  1XVY A;  4OFO A;  3QK6 A;  5IKB A;  3H06 B;  4ZEF A;  3UN6 A;  1SI0 A;  4XIG Q;  1II5 A;  4X48 A;  4RY1 A;  1Q35 A;  3PUW E;  5F1Q A;  3EF7 A;  3GXA A;  5I58 A;  3CIJ A;  4PP0 A;  3T9V A;  4C1U A;  1LAF E;  1Y9U A;  4EF1 A;  5KDT A;  1H76 A;  4ESW A;  4BDR A;  1LBB A;  3LC8 A;  2HCA A;  1N7W A;  4KQP A;  3TYH A;  1FCK A;  1A7L A;  3OO8 A;  2ONS A;  1FQB A;  3SDF A;  3ILT B;  3LSW A;  1DTZ A;  3TZA A;  1SVX B;  3VVE A;  4LQ5 A;  3VE1 B;  5H8Q B;  4YKP A;  2PT2 A;  4FAT A;  1JW5 A;  3PGF A;  2Z8F A;  3CI8 A;  1TWY A;  4LUB A;  3KGC A;  2Q8J A;  3QIM A;  1ZIU A;  3IR1 A;  2XXX A;  3S9L C;  4OYV A;  3H6T A;  2V84 A;  3S4U A;  1EZO A;  5KDT B;  2QPQ A;  4O3A A;  3V8X B;  4F1Y A;  3C33 A;  3K1P A;  2XXT A;  3E3K A;  4LON B;  2HQ0 A;  3MZB A;  3TKD A;  1JNF A;  4I9D A;  2F6P A;  4ISU A;  4BDO A;  4BDN A;  3THI A;  3HHG A;  3N94 A;  3KN7 A;  4ECF A;  3HCQ A;  5H8N A;  4F29 A;  4RNS A;  4U2R A;  2ZYM A;  3T9H B;  2VD2 A;  1B52 A;  1QUL A;  4FAJ A;  2QSX A;  4HCY A;  1FTO A;  2G93 A;  4PFT A;  3OEK A;  1LFH A;  3R7X A;  1Z7M E;  5AE4 A;  1JET A;  3VDF A;  2XX8 A;  3OOA A;  4OER A;  4PE5 B;  3ONM A;  4ZEK A;  2Q9T A;  3K01 A;  1LCT A;  1P1W A;  2PYY A;  3GZG A;  3MP1 A;  2VOZ A;  2B3F A;  3VVF A;  3T22 A;  2OWT A;  2VD3 A;  1HSJ A;  4QSE A;  4GQO A;  3FJ7 A;  3A3C A;  3K4U A;  4BLA A;  3OXN A;  4GL0 A;  3OMB A;  3KN8 A;  3TEL A;  4YKJ A;  5DEX A;  2ZNS A;  1MXY A;  3TUS A;  5H8N B;  1XT8 A;  1GR2 A;  3B6Q A;  4F1U A;  5J1D A;  2Q2A A;  3CVG A;  2PVU A;  4NF4 A;  1QKB A;  2XX7 A;  1OMP A;  4P0I A;  1R9Q A;  3PD9 A;  1XC1 A;  3TDJ A;  1A54 A;  2FYI A;  4F1V A;  4ONY A;  2ZNU A;  4OXV A;  1N3X A;  3O28 A;  1T0K A;  1LCF A;  3DP4 A;  4O3B A;  4OEV A;  3LSF B;  5IAI A;  5TPA A;  4GIZ A;  2X26 A;  4IO2 A;  2DS9 A;  5KCJ A;  4IGT A;  3PUX E;  3U72 A;  3HHF A;  2ZYN A;  1I6Q A;  3VLU A;  1NFT A;  3UP9 A;  2V3U A;  1NNT A;  5I2K A;  1XHY A;  3T93 B;  2HAU A;  2I49 A;  5AA2 B;  2QMW A;  5CM6 A;  5L9O A;  1FQF A;  4DIG A;  3E13 X;  1B32 A;  4FIM A;  2UVH A;  4R2B A;  4RXL A;  5DEX B;  4IB2 A;  2DQV A;  1QW0 A;  3JV9 A;  2ABH A;  4KR5 A;  3IOV A;  3RY3 A;  4OZ9 A;  4QFN A;  3IOU A;  5FTI A;  4GVO A;  4RK2 A;  3PMV A;  2OJT A;  4G2Z A;  2XXI A;  1MQH A;  3H6V A;  4LVQ A;  4EF2 A;  3T9X B;  2XXH A;  2UYF A;  4RA1 A;  1ZU0 A;  4KYD A;  2O6A A;  2F36 A;  2FA7 A;  4FED A;  1GVC A;  1A99 A;  5AA4 A;  3MPL A;  5TPA B;  4OET A;  3C36 A;  1IZ1 A;  4XKN A;  1VE4 A;  1JEU A;  4YB7 A;  4KCC A;  5I2K B;  5CMB A;  3ECR A;  1TT1 A;  1N0T A;  4IGR A;  4NF5 B;  2V93 A;  4F2O A;  4H0W A;  4XTC Q;  1MXW A;  5HM4 B;  2F5X A;  1TFA A;  1H43 A;  1SW2 A;  1GV8 A;  2UVI A;  3RT8 A;  2P1S A;  3B6T A;  3TTR A;  2GHB A;  2RCB A;  4AB5 A;  2I3V A;  2AL5 A;  4F3G A;  4LQ2 A;  2I58 A;  3OEL A;  1O64 A;  3FAT A;  5AA4 B;  3G3K A;  1MXU A;  2YPN A;  3KOS A;  3M3K A;  1OQG A;  2UVJ A;  3S9E A;  5KZT A;  3BFT A;  1MM7 A;  3VFJ A;  2QS1 A;  5DYH A;  2QL3 A;  5B70 A;  3MZ1 A;  5I84 A;  2HZK A;  3U1O A;  1EZP A;  4WEP A;  4R9G A;  2Y7R A;  4EQB A;  4KI0 E;  1NNF A;  3C31 A;  4NF6 B;  3IOW A;  3KSX A;  4H8I A;  4BDQ A;  3WAF A;  2I6E A;  3MJN A;  2I4B A;  1PBP A;  2HXW A;  4EXK A;  1UTH A;  2I0C A;  1H3D A;  4MLQ A;  4XKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...