3KEIA

Crystal structure of the glua4 ligand-binding domain l651v mutant in complex with glutamate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
257
structure length
257
Chain Sequence
TVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLAKQTEIAYGTVDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Glutamate receptor 4
publication title Enhanced efficacy without further cleft closure: reevaluating twist as a source of agonist efficacy in AMPA receptors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 81
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3keiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3keiA02
4OTEA 4F19A 3VLUA 4GWOA 4ESXA 1Y4TA 4OYVA 4F1YA 4ELOA 2CMOA 3OO9A 4EF2A 4F3SA 3B7DA 3RT8A 1FTKA 2F7AA 1EZPA 3K6WA 4POWA 5I56B 4OENA 3QAXA 3G7WA 2RC9A 1VE4A 5CMKA 2XXRA 3RT6B 5CMCA 3G3GA 2P1SA 1B5JA 2H99A 2GRVA 3Q28A 1Y4CA 2GHAA 1ATGA 3I3VA 5EHSA 4AB6A 1BP5A 3LSFB 4ZS9A 3RTFB 5ITPA 1Y3QA 3SKPA 5L9MA 1DTGA 2Y84A 2Z8EA 1GR2A 1P1NA 1B7UA 3LBSA 3T9UA 2NWJA 3U94A 3WAFA 3HO7A 3PMXA 3HCQA 3P7IA 3O66A 5FTIA 3LSXA 4U1ZA 2DSFA 4OQOA 2UVIA 3CG1A 1B6HA 1QULA 3C36A 2NUVA 4OZ9A 5KZTA 3C33A 1MM6A 3HSTA 3PV0E 1B52A 4HCYA 2AL5A 1I6AA 4U21A 4DCYA 1A99A 5L9OA 3FJ7A 4TLLB 3MVXA 4NF4B 3LSWA 1XT8A 4YZZA 3FVGA 3THIA 2HZLA 4C0RA 4FECA 1B46A 2B3FA 3ILTB 3CFZA 3FV2A 4FJPA 2F78A 3IO4A 1US5A 3VE1B 1SW1A 2E0SA 4GRKA 1OVTA 4R2BA 1QUIA 1NH8A 4I62A 1FQCA 3TPAA 3EHSA 4DCXA 3H4ZA 1ELJA 2XXIA 1SVXB 3CRBA 1B40A 3IR1A 3HHFA 5H8NA 4XTCQ 4F3GA 3PUYE 4F39A 5AA2A 1MXVA 4Z7EA 4HCWA 4YKJA 1FTOA 5BWJA 5DT6A 3CIJA 1SYIA 4ZDMA 4LZ7A 2UYEA 1OQGA 1FTJA 1SDXA 3OOAA 4H67A 1LAGE 4YB5A 3E9XA 3T9XB 2REGA 5FHOA 1SD3A 5HM4B 1RYXA 4IO3A 1SYHA 4OFLA 5H8FB 4F31B 3TCHA 4GF8A 3D4CA 4NF6B 4H8JA 3TTLA 4R72A 3LSLA 2HAVA 4PFUA 4LUBA 5DEXB 2R71A 4I9DA 1L5TA 1VR5A 5JTYB 1QKBA 2F35A 4LZ8A 3TCGA 3PPQA 3O97A 5CC2A 1LBCA 3TODA 1USYE 4GIZA 1XC1A 2OCUA 4BDRA 3O6HA 1SI0A 2DP8A 2GH9A 2Q9TA 2Y7PA 2O1LA 4TOZA 1SW5A 3M8UA 4FEDA 5DVIA 2V3TA 3MVZA 1B3FA 2H98A 5AE4A 1LCTA 1HSEA 4LQ5A 3EF7A 4NF5B 4G2ZA 5TP9A 1URGA 3AXFA 3N94A 5HPQA 2QRYA 1FQFA 3O6GA 1R1NA 5AA3A 1IEJA 3MW0A 1NKXA 1SI1A 1SW4A 1N76A 3VVDA 1F9BA 2XXQA 1ZIUA 3JV9A 2A5TB 2DWIA 3B6TA 1B0HA 4G77A 3UA8A 4JSOA 3O28A 2D3IA 1P1QA 3H6UA 1OLCA 4DZ1A 2H25A 3W9WA 4BDLA 3N5LA 4EDPA 1IXGA 5DTBA 2XD3A 1I6BA 3KGCA 5B7DA 1LB9A 3KOTA 4EF1A 1XS5A 1AIVA 1MY0A 3OSQA 1N3WA 1WVJA 1B05A 3VFJA 4Q30B 2UXAA 4KFQA 5I2NB 2HAUA 3Q26A 1MXZA 4ECFA 1UTBB 4KQPA 3GXAA 1JQFA 3VDFA 1PC3A 2QMXA 1M5CA 3TKDA 3RY3A 4JDFA 4XKNA 2RC8A 1MXWA 2ZNUA 1UQWA 1H76A 4OFJA 3A3CA 2GHBA 1O7TA 2XXTA 4KYEA 1TFAA 5KCJB 3RNNA 2I6EA 1TXFA 1VSOA 4IY5A 4XIGQ 1N3XA 4EQBA 3TQWA 3I6VA 3TQLA 3H06B 4FE8A 4NTLA 3PMWA 2CZLA 1MY1A 2YLNA 3G3HA 1RYOA 4RXLA 4LQ2A 2AYSA 2ALUA 4DE8A 2XX8A 3UGWA 3K2DA 4U4SA 2V25A 2Q88A 5CMBA 3JYRA 3L6HA 1B3LA 2XD2A 1D4NA 2V3QA 1ANFA 3QYTA 2ZXTA 2HEUA 1JNFA 3ONMA 4MFIA 4ZZEA 5TPAA 4LVQA 3VLWA 4O3AA 3DP4A 4RA1A 3K1PA 1N04A 3K4UA 4ZEDA 4U22A 2I49A 3UK4A 1N7WA 4G8HA 3S2VA 4QSCA 3IB1A 3UIFA 5I2KB 1CB6A 1B1HA 3K02A 3M3FA 4X48A 1JW5A 3C31A 3IORA 3A3UA 3BFTA 2DWHA 1Z7ME 3OSRA 4PP0A 1QUJA 1UTHA 4C1TA 2Q8JA 1IXCA 2AIXA 4KD5A 3FJMA 5I58B 5K2YA 1XVYA 3U93A 5JK4A 4MBPA 3T66A 4RYAA 4HS7A 3IL1B 4NF8A 1B3GA 1QUKA 1HSLA 5F7VA 4G4PA 1FTLA 1AOVA 3KOSA 4OEVA 3S4UA 4EQ9A 3O9PA 1YCJA 2ONRA 4DLDA 5DYHA 1WODA 2B3BA 4TQUQ 3JZJA 3R26A 4XXUA 4R9GA 4OMBA 5FTHA 4DXUA 1O64A 1R9QA 2ZMBA 1IXHA 3FVNA 1QW0A 3C9HA 3RN8A 2UVHA 3SEYA 4LA9A 2AL4A 1ZKBA 3FUZA 5H8HA 1AH5A 4I1DA 4QSEA 3MZ9A 1DTZA 3H6WA 4IO5A 3HV1A 3VVFA 3EHUA 2YJPA 1IXIA 1A7LA 1A8EA 1ZLQA 1NFTA 2XXYA 1FW0A 3TTKA 2PT1A 1WDNA 3PUXE 2F36A 3OEKA 5IKBA 2DE4A 4KYDA 1NNPA 4PFYA 4PFWA 5AA4A 2O7IA 2BJJX 2X7PA 1D9VA 4E0WA 4OEUA 1BTJA 2HQ0A 4MF3A 4FATA 4QFKA 4L17A 1IITA 5L8DA 4YKIA 1RKMA 2G93A 3CSGA 4UA8A 1P99A 4YB7A 2O7UA 3FJGA 4GLIA 4R2FA 3HPIA 1OVBA 2VP1A 1J1NA 4LATA 4P0IA 3K1MA 3TAJA 5KDTA 4R75A 3USDA 3EPEA 2O69A 3E3KA 5CMMA 4QFNA 2RC7A 1MY2A 4BLAA 3OD7A 3N6TA 1H44A 5H8NB 5B70A 2O84X 4IO6A 4OHNA 4IY6A 1VFEA 5AA2B 2DE2A 2F7CA 2Y7WA 2PBWA 3H6VA 1OMPA 4YKPA 3L6GA 4ELRA 1LFGA 2RF1A 3ODBA 3BKIB 1Z7NE 4N6PA 3FIRA 3UP9A 3IOTA 3ILUB 3PD9A 4JSDA 1MY4A 4FAJA 4E0XA 4DXCA 4LONB 2PYYA 3E13X 4N13A 1EZ9A 4YU0A 2OJTA 4ELPA 4BDNA 2E1SA 4KHZE 3CVGA 2XX9A 2OBGA 3PPOA 1GVCA 1A54A 2P0SA 3KEIA 3MJNA 4ND9A 4KYSA 1NL5A 1MG1A 2F5XA 1N84A 2VGQA 4R6HA 2M8CA 1I6QA 3TCFA 2IEEA 3KBRA 3PU5A 1B51A 5JTYA 3FVKA 3D4GA 4RPOA 3K1NA 1IQ7A 2H9BA 4AB5A 2ANJA 4GL8A 1MQGA 2FA7A 3HN0A 4OWDA 2F8DA 5H8SA 1B0LA 3U72A 3CSBA 1TFDA 3T22A 3VXBA 3MZ1A 4QF9A 1B9JA 4G68A 4ZZAA 3RPWA 3QUJA 3SDFA 1P1OA 4G8MA 4BDMA 4DXBA 2Z8FA 3RLFE 4F1VA 2R9JA 1LAHE 2I58A 4ISUA 5CBSA 4JBZA 2Q2CA 3LR1A 4H1XA 1URSA 1PDAA 4H65A 4GFRA 4H6DA 4G8NA 1NNKA 3C35A 1EU8A 3MPKA 5TP9B 3TUSA 2UYFA 2IA4A 3B6WA 4P0GA 3MQ9A 3Q29A 4OVJA 4OETA 4K3FA 3KSJA 3DLNA 3H6TA 3KJTA 4O3BA 3C4MA 3E4RA 1S7YA 4YICA 4LZ5A 3PD8A 2ONSA 1A40A 1MQJA 4YMAA 3PUWE 3GZGA 2HZKA 4HTGA 4JXIA 1IUDA 2F6PA 3TYHA 3FXQA 1B3HA 4QFPA 1D9YA 1DMBA 3M3LA 4PQJA 2I0BA 1M5DA 1UIVA 3IOVA 2DS9A 3U1OA 3MUQA 4GVOA 3TEPA 1B58A 3FV1A 2KLFA 3N26A 1ZU0A 4GXAA 1B1XA 1MXXA 2Q89A 4RNSA 2ZYOA 2OLBA 3V83A 1B7ZA 3BFUA 3V8XB 2W7YA 3MC2A 5J1DA 3LUYA 5AA2D 3OELA 1ZMGA 1FQBA 1T0KA 3PPPA 1DPPA 4NMYA 2QS1A 2XXXA 4H5FA 1B3EA 3MVWA 1USYH 2I0CA 3FATA 1NMUA 1CE2A 4GOTA 1QVSA 3OO6A 3F11A 1A55A 4XKQA 4G68C 1S9TA 1H3DA 1BKAA 5DVJA 1PB7A 3M3KA 2XXPA 2D5WA 3V89B 2ONKE 1EH3A 4FIMA 4RK2A 3S9LC 2Z22A 1DSNA 1LLSA 1PBQA 4U2RA 1SQYA 1B4HA 3GBAA 4M4GA 3SEUA 2I4CA 2F7BA 3UN6A 5TPAB 4BDQA 1M5EA 1Q35A 5I57A 1B7HA 4OESA 3OO7A 3R6UA 3K6UA 2QSXA 1PB9A 2OWTA 2OZZA 2QL3A 1MM7A 3G3FA 3ZKKA 1MDP1 2PX1A 3QUFA 2Y7IA 1MQHA 2UVJA 1YPNA 1M5BA 2HCAA 2QJEA 3T9VA 5I59A 3OEMA 3MP8A 1US4A 3IO6A 3S9NC 2THIA 3FASA 1UTHB 4R73A 5A5XA 5H8QA 4OFOA 4X9TA 1FCKA 5M2VA 3A09A 3EN3A 1N0TA 5F1QA 4ZECA 4GQOA 1SBPA 4F1UA 1LAFE 2VD2A 4F29A 4THIA 1JEUA 4NWDA 3SEVA 1H43A 4NF8B 3C34A 1P1UA 3OO8A 1JVYA 3I5OA 3KJ7A 4KCDA 4I8CA 1LAXA 4MLQA 4YB6A 4WKMA 1M5FA 4KCCA 3W9VA 3MPLA 5I56A 3VLVA 1B32A 2ZYMA 1POTA 4KI0E 2O68A 3G3IA 3V5AA 2QMWA 1IZ1A 3MZBA 3IOWA 2UVGA 5H8HB 2H5YA 1ZJLA 2P2AA 3PPRA 1MY3A 4IO2A 1I69A 4ZE9A 1LFIA 3KN3A 2WKYA 3CFLA 3IOUA 4U1OA 2RCBA 3T93B 2NXOA 3FD3A 4C1UA 3PUZE 4F3BA 1JW1A 1YAEA 3TTNA 1LSTA 4UACA 2QS4A 2V93A 3H3GA 5FHNA 3T96B 3EHTA 3K6XA 3KN8A 3IJXB 3RGYA 5ICQA 4LP2B 1JVXA 1LB8A 4PE5B 4RPNA 4FORA 1QJMA 5AA4B 2F97A 4QFLA 4OERA 1LGBC 1PBPA 3KZGA 3CFXA 1TT1A 3HHGA 3TFLA 4NF4A 1Y9UA 2Q2AA 3ZS6A 2DOJA 2F34A 3OENA 1FQEA 4BDOA 2NVUB 2DVZA 5I84A 3G3JA 1XOCA 4O3CA 4F3PA 3Q25A 4ZEFA 5KDTB 1PB8A 4R9FA 3WAEA 4POXA 1AMFA 1Y3NA 1LBBA 1IIWA 3U8QA 4JWYA 3TDJA 5K2XA 5CM6A 3SETA 5EHMA 2DYXA 3GLBA 3KFMA 3KG2A 1O63A 1FTMA 3K01A 1JW4A 3VV5A 3G3KA 4R6YA 3SESA 2PT2A 1VFDA 1TWYA 3K0VA 3EQ1A 1XVXA 3C32A 3UORA 4EQ7A 1LCFA 3Q27A 4QRZA 4YAHX 1MXUA 4ZE8A 2PMSA 3H7MA 3QK6A 3RQTA 4ELQA 1DOTA 3IAZA 4R6KA 2ZNTA 5H8FA 2ESNA 1PEBA 2VHAA 1OIBA 3IB2A 3MP6A 4FEBA 4NF6A 4TLMB 3ZSFA 4PFTA 4IB2A 3S9EA 2QS3A 1FQAA 2XXUA 2O1MA 4H8IA 5ICTA 2DQVA 2V3UA 4IGTA 5DEXA 4PETA 4NWCA 4KPTA 3R7XA 3FGSA 2DE3A 3K6VA 5ISUA 3FXUA 1AL3A 3VVEA 1MRPA 1FQDA 4YMBA 3MVYA 1GV8A 4ONYA 4R74A 1S50A 1OLAA 2R6GE 4WEPA 3KN7A 3FXRA 2VD3A 4YKKA 1JETA 2G29A 1Q1KA 3ECRA 3O2AA 1B5IA 1MPBA 5AA1A 1N7XA 1NH7A 4G68B 3PGFA 1MQIA 2ZYKA 3CG3A 3KSXA 4GD5A 3U92A 4RY1A 3TTRA 2VOZA 2Z23A 3DP6A 2LAOA 5L9SA 1KWHA 1NNFA 2I48A 5BUUA 1MPCA 2RCAA 4DIGA 4XKPA 4X1BA 1D3KA 1ZTYA 4JB7A 3H03A 3SEXA 4JWXA 4NF5A 3K00A 2QS2A 4IO7A 1H45A 3SERA 1B4ZA 4H5GA 3QXMA 2I3VA 3RTWB 1MH3A 5JEIA 5ITOA 4AQ4A 2FNCA 4F2OA 2O51A 2DWAA 5TU0A 3TTMA 1MS7A 2RINA 3CI8A 4ZEKA 2XHDA 2A5TA 4Q0CA 2HXWA 3OMBA 3O29A 2HFBA 3DELB 1SW2A 2XXWA 2XXVA 3QIMA 2OWSA 1YTVA 4P11A 3TMGA 4EXLA 2ZYNA 1Y1ZA 3B6QA 3MBPA 3FVOA 4HW8A 1BIYA 1Y20A 1NNTA 1A8FA 2X26A 5HBCA 4RJZA 1POY1 1Y1MA 4X1DA 5I2NA 2ABHA 2DXYA 1UTBA 1MH4A 4WXJA 4KR5A 4F22A 3FZVA 5FHMA 5ELVA 5DVFA 2Y7RA 2NOOA 3S9MC 4QSDA 3T9HB 4Q5TA 3BBRA 4Z0IA 1R9LA 5KCJA 5CRYA 4DDDA 4ESWA 1HSJA 1Y3PA 1EZOA 4NE4A 2I3WA 1MPDA 4Q8RA 2XXHA 4F18A 4RK9A 2REJA 4N07A 4IGRA 3N6UA 4MH5A 3DM0A 1URDA 3QSLA 4XKRA 1R6ZA 3O6IA 4H0WA 2V84A 3OXNA 1B5HA 1P1WA 3LC8A 4GL0A 3MP1A 2F6GA 2PVUA 2FYIA 3VXCA 1JEVA 2OK2A 3PPNA 5CI5A 4EXKA 1XHYA 1GGGA 3IX1A 1ZBMA 1DPEA 2B65A 5IAIA 1OQHA 1B2HA 2XX7A 3MAMA 5CBRA 3IK6B 3MWBA 2QPQA 2RKMA 3PMVA 2O6AA 4WEDA 5EYFA 2X7QA 2DXRA 2ZNSA 1UIUA 2Y7KA 4M1VA 2A5SA 3SEWA 2DWJA 5I57B 1QKAA 2D21A 3IB0A 3ZKLA 2I4BA 1II5A 2DVCA 5I2KA 4EUOA 4MLVA 3TZAA 4F2QA 3PUVE 4ZEBA 3W15C 3RUMA 4JWOA 4U4XA 4GXSB 2YPNA 1MQDA 3GBBA 2GFEA 3DP8A 5I59B 1BLFA 2H4IA 2Z8DA 1GTKA 3IJOB 4OXVA 4U23A 5A5XB 5H8QB 4QFOA 5I58A 1MXYA 4IO4A 3CR9A 4ZEIA 3TELA 4QHQA 4NEDA 1MDQA 5LOMA 1LFHA
chains in the Genus database with same CATH superfamily
4OTEA 4F19A 3VLUA 4GWOA 4ESXA 1Y4TA 4OYVA 4F1YA 4ELOA 2CMOA 3OO9A 4EF2A 4F3SA 3B7DA 3RT8A 1FTKA 2F7AA 1EZPA 3K6WA 4POWA 5I56B 4OENA 3QAXA 3G7WA 2RC9A 1VE4A 5CMKA 2XXRA 3RT6B 2FIXA 5CMCA 3G3GA 2P1SA 1B5JA 2H99A 2GRVA 3Q28A 4XF5A 1Y4CA 3IFCA 2GHAA 1ATGA 3I3VA 5EHSA 4AB6A 1BP5A 3LSFB 4ZS9A 2QVUA 3RTFB 5ITPA 1NUZA 1Y3QA 3SKPA 5IZ3A 5L9MA 1DTGA 2Y84A 2Z8EA 2XWIA 4PBHA 2HXRA 1GR2A 1P1NA 2CEXA 1B7UA 3LBSA 3T9UA 2NWJA 4MJOA 3U94A 3HO7A 3WAFA 3PMXA 3HCQA 3P7IA 3O66A 5FTIA 3LSXA 4U1ZA 2DSFA 4OQOA 2UVIA 3CG1A 3BIGA 1B6HA 1QULA 3C36A 2NUVA 4OZ9A 5KZTA 3C33A 1MM6A 3HSTA 4NG7A 3PV0E 1B52A 4HCYA 2AL5A 1I6AA 4U21A 3HFUA 4DCYA 1A99A 4I40A 5L9OA 3FJ7A 4TLLB 3MVXA 4NF4B 1D9QA 3U65A 3LSWA 1XT8A 4YZZA 3FVGA 3THIA 2HZLA 4C0RA 1K9YA 4N81A 4FECA 1B46A 2B3FA 3ILTB 3CFZA 3FV2A 4FJPA 2F78A 3IO4A 3LUZA 1US5A 3VE1B 1SW1A 2E0SA 4GRKA 1OVTA 4R2BA 1QUIA 1NH8A 4I62A 1FQCA 3TPAA 3EHSA 4DCXA 3H4ZA 2L5VA 2JJKA 1ELJA 2XXIA 1FBFA 1SVXB 3CRBA 1B40A 3IR1A 3HHFA 5H8NA 4XTCQ 4F3GA 4KXPA 3PUYE 4F39A 5AA2A 1MXVA 1NV1A 4Z7EA 4HCWA 4P47A 1FPFA 4YKJA 1FTOA 4MNCA 5BWJA 5DT6A 4NQ8A 3CIJA 1SYIA 4JVCA 4ZDMA 1BK4A 4LZ7A 2UYEA 1OQGA 1SDXA 1FTJA 1LEVA 3OOAA 4H67A 1LAGE 4YB5A 1K9ZA 3E9XA 3T9XB 1KZ8A 2REGA 5FHOA 1SD3A 5HM4B 1RYXA 4IO3A 4MMPA 1EYKA 1SYHA 4OFLA 5H8FB 4F31B 3TCHA 4GF8A 3D4CA 4OVTA 5ET5A 3IFAA 4NF6B 4H8JA 3TTLA 4R72A 3LSLA 2HAVA 4PFUA 4LUBA 5DEXB 4FBPA 4AS4A 4O94A 2R71A 4I9DA 1L5TA 1VR5A 5JTYB 4HXVA 1QKBA 2F35A 4LZ8A 3TCGA 3PPQA 3O97A 5CC2A 1LBCA 1RDZA 4GWUA 3TODA 1USYE 4GIZA 1XC1A 2OCUA 4BDRA 1FPGA 3O6HA 1SI0A 2DP8A 2GH9A 2Q9TA 2Y7PA 2O1LA 4TOZA 2FVZA 2HHMA 4PCDA 4PF8A 1SW5A 3M8UA 1LBZA 4FEDA 1NV0A 2P3VA 1FRPA 5DVIA 2V3TA 3MVZA 1B3FA 2H98A 4DI3D 5AE4A 4OVSA 1LCTA 1HSEA 4LQ5A 3EF7A 4NF5B 4G2ZA 5TP9A 1URGA 3AXFA 3N94A 5I5PA 5HPQA 2QRYA 3B8BA 1FQFA 3O6GA 1R1NA 5AA3A 1IEJA 3MW0A 1NKXA 1SI1A 1SW4A 1N76A 3BIHA 4N6KA 3VVDA 1F9BA 2XXQA 1ZIUA 3JV9A 2A5TB 2DWIA 4PFIA 3B6TA 4GWXA 1B0HA 4G77A 3UA8A 4JSOA 3O28A 2D3IA 1P1QA 4MIJA 4O7IA 3H6UA 1OLCA 4G61A 4DZ1A 1IMEA 2H25A 3W9WA 4BDLA 3N5LA 4EDPA 1IXGA 5DTBA 2XD3A 1I6BA 3KGCA 4OA4A 5B7DA 1LB9A 3KOTA 4EF1A 1JP4A 4PE3A 1XS5A 1AIVA 1MY0A 3OSQA 3T1BA 1N3WA 1WVJA 1B05A 3VFJA 4Q30B 4OVQA 2UXAA 4KFQA 5I2NB 2HAUA 3Q26A 4UABA 1IMDA 1MXZA 4ECFA 1UTBB 3T0JA 4KQPA 4P8BA 3GXAA 1JQFA 1LBWA 3VDFA 1PC3A 2QMXA 1M5CA 3TKDA 3RY3A 4JDFA 4XKNA 2RC8A 1MXWA 2ZNUA 1UQWA 1H76A 4OFJA 3A3CA 2GHBA 1O7TA 1Q9DA 2XXTA 4KYEA 1VDWA 1TFAA 1IMCA 5KCJB 5ET6A 3RNNA 2I6EA 1DCUA 1FBPA 1TXFA 1VSOA 4IY5A 4XIGQ 1N3XA 4EQBA 3TQWA 3I6VA 3TQLA 1NV4A 3H06B 4PFRA 4FE8A 4NTLA 3PMWA 2P3NA 5ET7A 2CZLA 1IMFA 1MY1A 2YLNA 3G3HA 1RYOA 5I7IA 4RXLA 4GBVA 4LQ2A 2AYSA 2ALUA 4P9KA 1YYZA 4DE8A 2XX8A 3UGWA 3K2DA 4U4SA 2V25A 2Q88A 4OVRA 5CMBA 3JYRA 3FBPA 3L6HA 1B3LA 4PGPA 2XD2A 1D4NA 2V3QA 1ANFA 3QYTA 2ZXTA 2HEUA 4NN3A 1JNFA 3ONMA 4MFIA 4ZZEA 5TPAA 4LVQA 3VLWA 4O3AA 3DP4A 4RA1A 3K1PA 5F24A 1N04A 3K4UA 4ZEDA 4U22A 2I49A 3UK4A 1N7WA 4G8HA 3S2VA 4QSCA 3IB1A 3UIFA 5I2KB 1CB6A 1B1HA 3K02A 3M3FA 4X48A 1JW5A 2PFYA 4GX6A 3C31A 4NX1A 3IORA 3A3UA 3BFTA 2DWHA 4P1EA 1Z7ME 3OSRA 4PP0A 1QUJA 1UTHA 4C1TA 2Q8JA 1IXCA 3KC1A 4P56A 2AIXA 4KD5A 4GWYA 3FJMA 5I58B 4I3EA 5K2YA 1XVYA 3U93A 5JK4A 4MBPA 3T66A 4RYAA 4HS7A 3IL1B 4NF8A 1B3GA 1QUKA 1HSLA 5F7VA 4G4PA 1FTLA 5LDZA 1AOVA 4OEVA 3KOSA 3S4UA 4EQ9A 3O9PA 4N91A 1YCJA 2ONRA 1NV2A 4DLDA 5DYHA 1WODA 2B3BA 4TQUQ 3JZJA 2WBBA 3R26A 4XXUA 4R9GA 4OMBA 5FTHA 4DXUA 1O64A 1R9QA 2CZKA 2ZMBA 1IXHA 3FVNA 1QW0A 3C9HA 3RN8A 3A29A 2UVHA 3SEYA 4LA9A 2AL4A 1ZKBA 3FUZA 1AH5A 4I1DA 5H8HA 4QSEA 3MZ9A 2GQ1A 1DTZA 2VPOA 4N8YA 3H6WA 4IO5A 3HV1A 3VVFA 5DW8A 3EHUA 5IZ3B 2YJPA 4PBQA 1IXIA 1A7LA 1A8EA 1FPDA 1ZLQA 1NFTA 2XXYA 1FW0A 3TTKA 2PT1A 1WDNA 3PUXE 4LN5A 2F36A 3OEKA 5IKBA 4QXDA 4XEQA 2DE4A 4KYDA 1NNPA 4PFYA 4PFWA 2Q74A 5AA4A 2O7IA 2BJJX 2X7PA 1D9VA 2ZZWA 4E0WA 4OEUA 1BTJA 5EQ7A 2HQ0A 4MF3A 4FATA 4O7MA 2DDKA 4QFKA 1FBCA 4L17A 1RDYA 1IITA 4MX6A 1NUXA 5L8DA 4YKIA 1RKMA 1EYJA 2G93A 3CSGA 4UA8A 1P99A 3E79A 2XXKA 4YB7A 2O7UA 3FJGA 4GLIA 4R2FA 3HPIA 2XWOA 1OVBA 2VP1A 1J1NA 4LATA 4P0IA 3K1MA 3TAJA 5KDTA 4QBAA 4R75A 3USDA 3EPEA 2O69A 3E3KA 2MKZA 5CMMA 4QFNA 2RC7A 1MY2A 4BLAA 1NV3A 3OD7A 3N6TA 1H44A 5H8NB 5B70A 2O84X 4IO6A 4OHNA 4IY6A 1VFEA 5AA2B 2DE2A 2F7CA 2Y7WA 2PBWA 3H6VA 1OMPA 4YKPA 3L6GA 2QFLA 4ELRA 4GX3A 1LFGA 2RF1A 4PC9A 3ODBA 3BKIB 1Z7NE 4N6PA 3FIRA 1FBHA 3UP9A 3IOTA 3ILUB 3PD9A 4JSDA 1MY4A 4FAJA 1G0IA 4E0XA 4DXCA 2V4CA 4LONB 2PYYA 3E13X 4N13A 1EZ9A 4YU0A 4PF6A 2OJTA 4ELPA 4BDNA 2E1SA 4KHZE 3CVGA 2XX9A 2CZHA 2OBGA 3PPOA 1GVCA 1A54A 2P0SA 3KEIA 3MJNA 4ND9A 4KYSA 1NL5A 1MG1A 2F5XA 1N84A 2VGQA 4R6HA 2M8CA 1I6QA 3TCFA 5IZZA 2IEEA 3KBRA 2FBPA 1NI9A 3PU5A 1B51A 5JTYA 3FVKA 3D4GA 4RPOA 3K1NA 5FBPA 1IQ7A 2H9BA 4AB5A 2ANJA 1RDXA 4GL8A 1MQGA 2FA7A 3HN0A 4OWDA 2F8DA 5H8SA 1B0LA 3U72A 3CSBA 4PGNA 1TFDA 3T22A 3VXBA 3MZ1A 4QF9A 5EYHA 4GX4A 1B9JA 3CHGA 4G68A 4ZZAA 3RPWA 3QUJA 3SDFA 1P1OA 4G8MA 4BDMA 4DXBA 2Z8FA 3RLFE 4F1VA 2R9JA 1LAHE 2I58A 4ISUA 5CBSA 4JBZA 2Q2CA 1FPJA 3LR1A 4H1XA 2WBDA 1URSA 4PAKA 2QVVA 1PDAA 4H65A 4GFRA 4H6DA 4G8NA 1LBXA 4IR8A 1NNKA 3C35A 1EU8A 3MPKA 5TP9B 3TUSA 2UYFA 2IA4A 3B6WA 2CEYA 4P0GA 4P3LA 3MQ9A 3Q29A 4O8MA 4OVJA 4OETA 4K3FA 3KSJA 3DLNA 4H45A 3H6TA 3KJTA 4O3BA 3C4MA 3E4RA 1S7YA 4YICA 4LZ5A 2QVRA 3PD8A 1FPBA 4N8GA 2ONSA 1A40A 1MQJA 4YMAA 3PUWE 3GZGA 2FIEA 2HZKA 4HTGA 4JXIA 1IUDA 2F6PA 3TYHA 3FXQA 1B3HA 3MYUA 5EQ9A 4QFPA 1D9YA 5EQAA 1DMBA 3M3LA 4PQJA 2I0BA 5I3SA 1M5DA 2ZZXA 1UIVA 3IOVA 2DS9A 3U1OA 3MUQA 4GVOA 3TEPA 1B58A 3FV1A 2KLFA 3N26A 1ZU0A 4GXAA 1B1XA 1MXXA 2Q89A 4RNSA 2ZYOA 2OLBA 2BJIA 3V83A 1B7ZA 3KBZA 3BFUA 3V8XB 1QGXA 2W7YA 3MC2A 5J1DA 3LUYA 2F3BA 5AA2D 3OELA 1ZMGA 1FQBA 1T0KA 4MNIA 3PPPA 1DPPA 4NMYA 2QS1A 5ET8A 2XXXA 4H5FA 1B3EA 3MVWA 1FBGA 1USYH 2I0CA 4PTKA 3FATA 1NMUA 2WX9A 1CE2A 4GOTA 1QVSA 3OO6A 3RPLA 3F11A 1A55A 4XKQA 4G68C 1S9TA 1H3DA 1BKAA 5DVJA 1PB7A 3M3KA 2XXPA 2D5WA 5ESYA 3D1RA 3V89B 4NHBA 2ONKE 1EH3A 4FIMA 4RK2A 3S9LC 2Z22A 1DSNA 1LLSA 1PBQA 4U2RA 1SQYA 1B4HA 3GBAA 4M4GA 3SEUA 2I4CA 2F7BA 3UN6A 5TPAB 4BDQA 1M5EA 1Q35A 5I57A 1B7HA 4OESA 3EKIA 3OO7A 3R6UA 3PTYA 1FTAA 3K6UA 2QSXA 5EQ8A 1PB9A 2OWTA 2OZZA 4GWWA 4X8RA 2QL3A 2VT5A 4XFEA 2CZIA 1MM7A 3G3FA 3ZKKA 1MDP1 2PX1A 3QUFA 5T3JA 2VPNA 2Y7IA 1MQHA 2R8TA 2UVJA 4AS5A 1YPNA 1M5BA 2HCAA 2QJEA 3T9VA 5I59A 3OEMA 3MP8A 1US4A 3IO6A 3S9NC 2THIA 3FASA 1UTHB 4R73A 5A5XA 5H8QA 4OFOA 4X9TA 1FCKA 5M2VA 3A09A 3EN3A 1CNQA 1N0TA 4NF0A 5F1QA 4ZECA 4GQOA 1FPKA 4PDHA 1SBPA 4F1UA 1LAFE 2VD2A 4F29A 4THIA 1JEUA 4NWDA 3SEVA 1H43A 4NF8B 3C34A 1P1UA 3OO8A 1JVYA 3I5OA 3KJ7A 4KCDA 4I8CA 1LAXA 4MLQA 4YB6A 4WKMA 1M5FA 4KCCA 3W9VA 1NUWA 3MPLA 5I56A 3VLVA 1B32A 3FXBA 2ZYMA 1POTA 4KI0E 2O68A 1FBEA 3G3IA 3V5AA 2QMWA 1IZ1A 3MZBA 3IOWA 2UVGA 5H8HB 2H5YA 1ZJLA 2P2AA 3PPRA 1MY3A 4IO2A 1I69A 4ZE9A 1LFIA 3KN3A 4JVIA 2WKYA 3CFLA 3IOUA 4U1OA 2RCBA 3T93B 2NXOA 3FD3A 4C1UA 3PUZE 3MSTA 4F3BA 1JW1A 1YAEA 3TTNA 2XWKA 2PFZA 1LSTA 2XWVA 4UACA 2QS4A 2V93A 3H3GA 5FHNA 3T96B 3EHTA 3K6XA 3KN8A 3IJXB 3RGYA 5ICQA 4LP2B 1JVXA 1LB8A 4PE5B 4RPNA 4FORA 1QJMA 5AA4B 2F97A 4QFLA 4OERA 1LGBC 1PBPA 4GWSA 3KZGA 3CFXA 1TT1A 3KC0A 3HHGA 1IMBA 3TFLA 4NF4A 1Y9UA 4HE1A 4P1LA 2Q2AA 2B4LA 5J16A 3ZS6A 2DOJA 2F34A 3OENA 1FQEA 3ISPA 4BDOA 1FSAA 2NVUB 2DVZA 2PCRA 5I84A 3G3JA 1XOCA 2Y5LA 4O3CA 2KQZA 1KA1A 4F3PA 3Q25A 4ZEFA 4MHFA 5KDTB 4NAPA 3LV0A 1PB8A 4HE2A 4MNPA 4R9FA 3WAEA 4POXA 1AMFA 1Y3NA 1LBBA 1IIWA 3U8QA 4JWYA 3TDJA 5K2XA 5CM6A 3SETA 5EHMA 2DYXA 5A5LA 3GLBA 3KFMA 3KG2A 1O63A 1FTMA 3K01A 1JW4A 3VV5A 3G3KA 4R6YA 3SESA 2PT2A 1AWBA 2WYKA 1VFDA 1TWYA 3K0VA 3EQ1A 1XVXA 3C32A 3UORA 4EQ7A 1FJ6A 1SPIA 1LCFA 3Q27A 4QRZA 4YAHX 1MXUA 4ZE8A 2PMSA 3H7MA 3QK6A 3RQTA 5IZ1A 4ELQA 1G0HA 1DOTA 3IAZA 4DI4B 4R6KA 2ZNTA 2WYPA 5H8FA 2ESNA 3QMFA 1PEBA 2VHAA 4PDDA 1OIBA 3IB2A 3MP6A 4FEBA 4NF6A 4TLMB 3ZSFA 4PFTA 4IB2A 3S9EA 2QS3A 1FQAA 2XXUA 2O1MA 1LBYA 4H8IA 5ICTA 2DQVA 2V3UA 4IGTA 5DEXA 4PETA 4NWCA 4KPTA 1LBVA 3R7XA 3FGSA 2DE3A 3K6VA 5ISUA 3FXUA 1AL3A 3VVEA 1MRPA 1FQDA 4YMBA 3MVYA 1GV8A 4ONYA 4R74A 5IM2A 5EYGA 1S50A 1OLAA 2R6GE 4OVPA 4WEPA 1NV6A 3KN7A 3FXRA 2VD3A 4YKKA 3ROJA 1JETA 2G29A 1Q1KA 3ECRA 3O2AA 3B50A 1B5IA 1MPBA 5AA1A 1N7XA 1NH7A 4G68B 3PGFA 1MQIA 2ZYKA 1DBZA 3CG3A 3KSXA 4GD5A 3U92A 4N17A 4RY1A 3TTRA 2VOZA 2Z23A 3DP6A 2LAOA 5L9SA 1KWHA 1NNFA 4JVDA 2I48A 5BUUA 1MPCA 2RCAA 4DIGA 4XKPA 4X1BA 1D3KA 1ZTYA 4JB7A 3H03A 3SEXA 4JWXA 4NF5A 3K00A 2QS2A 4IO7A 1H45A 3SERA 1B4ZA 4H5GA 4OANA 4X04A 3QXMA 2I3VA 3RTWB 1MH3A 5JEIA 5ITOA 4AQ4A 2FNCA 4F2OA 1EYIA 2O51A 2DWAA 5TU0A 3TTMA 1MS7A 2RINA 3CI8A 4ZEKA 2XHDA 2A5TA 4MCOA 1FBDA 4Q0CA 2Q8MA 2HXWA 3OMBA 3O29A 2HFBA 3DELB 1NUYA 1SW2A 2XXWA 2XXVA 3QIMA 2OWSA 1YZ0A 1INPA 1YTVA 4N6DA 4P11A 3TMGA 4EXLA 2ZYNA 1IMAA 1Y1ZA 3B6QA 3MBPA 3FVOA 4HW8A 1BIYA 1Y20A 1NNTA 1A8FA 2X26A 5HBCA 4RJZA 1POY1 1Y1MA 2B4MA 4X1DA 5I2NA 2KR0A 2ABHA 2DXYA 2OX3A 1UTBA 1MH4A 4WXJA 4KR5A 1DK4A 4F22A 3FZVA 5FHMA 5ELVA 5DVFA 2Y7RA 1XI6A 2NOOA 3S9MC 4QSDA 3T9HB 4Q5TA 3BBRA 4Z0IA 3E78A 1R9LA 5KCJA 5CRYA 2FHYA 4DDDA 2Y5KA 4ESWA 1HSJA 1Y3PA 1EZOA 4NE4A 2I3WA 1MPDA 4Q8RA 2XXHA 4MAGA 3RYDA 4F18A 4RK9A 2REJA 4N07A 4IGRA 3N6UA 4NGUA 4MH5A 3DM0A 1URDA 3QSLA 5LTCA 2HPGA 4XKRA 1R6ZA 3O6IA 3SZPA 4H0WA 2V84A 3OXNA 1B5HA 2ZZVA 4N15A 1P1WA 4I3YA 3LC8A 4GL0A 3MP1A 2F6GA 1NV5A 2PVUA 2FYIA 3VXCA 1JEVA 3GYYA 3RPLB 2OK2A 1FPIA 3PPNA 1KA0A 5CI5A 4EXKA 1FPEA 1XHYA 1GGGA 3IX1A 2OWZA 1ZBMA 1DPEA 2B65A 5IAIA 1OQHA 1B2HA 2XX7A 3MAMA 4MEVA 5CBRA 2F3DA 3IK6B 3MWBA 2QPQA 2RKMA 2WEFA 2O6AA 3PMVA 4N4UA 2X7QA 4WEDA 5EYFA 1FJ9A 2DXRA 2ZNSA 1UIUA 2Y7KA 4M1VA 4PAFA 2A5SA 3SEWA 2DWJA 5I57B 1QKAA 2D21A 3IB0A 3ZKLA 2XA5A 1FPLA 2I4BA 1II5A 2DVCA 5I2KA 4HE0A 4EUOA 4MLVA 3TZAA 4F2QA 3PUVE 4ZEBA 4PFBA 3W15C 3RUMA 4JWOA 4U4XA 4GXSB 2YPNA 1MQDA 3GBBA 2GFEA 5IGAA 3DP8A 5I59B 1BLFA 2H4IA 2Z8DA 4PAIA 1GTKA 3IJOB 3NOHA 4OXVA 4U23A 5A5XB 5H8QB 4QFOA 5I58A 1MXYA 4IO4A 1NV7A 3CR9A 1YXIA 4ZEIA 3TELA 4QHQA 4NEDA 1MDQA 4GWZA 4H46A 5LOMA 1LFHA 4GBWA
chains in the Genus database with same CATH topology
4OTEA 4F19A 3VLUA 4GWOA 4ESXA 1Y4TA 4OYVA 4F1YA 4ELOA 2CMOA 3OO9A 4EF2A 4F3SA 3B7DA 3RT8A 1FTKA 2F7AA 1EZPA 3K6WA 4POWA 5I56B 4OENA 3QAXA 3G7WA 2RC9A 1VE4A 5CMKA 2XXRA 3RT6B 5CMCA 3G3GA 2P1SA 1B5JA 2H99A 2GRVA 3Q28A 1Y4CA 2GHAA 1ATGA 3I3VA 5EHSA 4AB6A 1BP5A 3LSFB 4ZS9A 3RTFB 5ITPA 1Y3QA 3SKPA 5L9MA 1DTGA 2Y84A 2Z8EA 1GR2A 1P1NA 1B7UA 3LBSA 3T9UA 2NWJA 3U94A 3WAFA 3HO7A 3PMXA 3HCQA 3P7IA 3O66A 5FTIA 3LSXA 4U1ZA 2DSFA 4OQOA 2UVIA 3CG1A 1B6HA 1QULA 3C36A 2NUVA 4OZ9A 5KZTA 3C33A 1MM6A 3HSTA 3PV0E 1B52A 4HCYA 2AL5A 1I6AA 4U21A 4DCYA 1A99A 5L9OA 3FJ7A 4TLLB 3MVXA 4NF4B 3LSWA 1XT8A 4YZZA 3FVGA 3THIA 2HZLA 4C0RA 4FECA 1B46A 2B3FA 3ILTB 3CFZA 3FV2A 4FJPA 2F78A 3IO4A 1US5A 3VE1B 1SW1A 2E0SA 4GRKA 1OVTA 4R2BA 1QUIA 1NH8A 4I62A 1FQCA 3TPAA 3EHSA 4DCXA 3H4ZA 1ELJA 2XXIA 1SVXB 3CRBA 1B40A 3IR1A 3HHFA 5H8NA 4XTCQ 4F3GA 3PUYE 4F39A 5AA2A 1MXVA 4Z7EA 4HCWA 4YKJA 1FTOA 5BWJA 5DT6A 3CIJA 1SYIA 4ZDMA 4LZ7A 2UYEA 1OQGA 1FTJA 1SDXA 3OOAA 4H67A 1LAGE 4YB5A 3E9XA 3T9XB 2REGA 5FHOA 1SD3A 5HM4B 1RYXA 4IO3A 1SYHA 4OFLA 5H8FB 4F31B 3TCHA 4GF8A 3D4CA 4NF6B 4H8JA 3TTLA 4R72A 3LSLA 2HAVA 4PFUA 4LUBA 5DEXB 2R71A 4I9DA 1L5TA 1VR5A 5JTYB 1QKBA 2F35A 4LZ8A 3TCGA 3PPQA 3O97A 5CC2A 1LBCA 3TODA 1USYE 4GIZA 1XC1A 2OCUA 4BDRA 3O6HA 1SI0A 2DP8A 2GH9A 2Q9TA 2Y7PA 2O1LA 4TOZA 1SW5A 3M8UA 4FEDA 5DVIA 2V3TA 3MVZA 1B3FA 2H98A 5AE4A 1LCTA 1HSEA 4LQ5A 3EF7A 4NF5B 4G2ZA 5TP9A 1URGA 3AXFA 3N94A 5HPQA 2QRYA 1FQFA 3O6GA 1R1NA 5AA3A 1IEJA 3MW0A 1NKXA 1SI1A 1SW4A 1N76A 3VVDA 1F9BA 2XXQA 1ZIUA 3JV9A 2A5TB 2DWIA 3B6TA 1B0HA 4G77A 3UA8A 4JSOA 3O28A 2D3IA 1P1QA 3H6UA 1OLCA 4DZ1A 2H25A 3W9WA 4BDLA 3N5LA 4EDPA 1IXGA 5DTBA 2XD3A 1I6BA 3KGCA 5B7DA 1LB9A 3KOTA 4EF1A 1XS5A 1AIVA 1MY0A 3OSQA 1N3WA 1WVJA 1B05A 3VFJA 4Q30B 2UXAA 4KFQA 5I2NB 2HAUA 3Q26A 1MXZA 4ECFA 1UTBB 4KQPA 3GXAA 1JQFA 3VDFA 1PC3A 2QMXA 1M5CA 3TKDA 3RY3A 4JDFA 4XKNA 2RC8A 1MXWA 2ZNUA 1UQWA 1H76A 4OFJA 3A3CA 2GHBA 1O7TA 2XXTA 4KYEA 1TFAA 5KCJB 3RNNA 2I6EA 1TXFA 1VSOA 4IY5A 4XIGQ 1N3XA 4EQBA 3TQWA 3I6VA 3TQLA 3H06B 4FE8A 4NTLA 3PMWA 2CZLA 1MY1A 2YLNA 3G3HA 1RYOA 4RXLA 4LQ2A 2AYSA 2ALUA 4DE8A 2XX8A 3UGWA 3K2DA 4U4SA 2V25A 2Q88A 5CMBA 3JYRA 3L6HA 1B3LA 2XD2A 1D4NA 2V3QA 1ANFA 3QYTA 2ZXTA 2HEUA 1JNFA 3ONMA 4MFIA 4ZZEA 5TPAA 4LVQA 3VLWA 4O3AA 3DP4A 4RA1A 3K1PA 1N04A 3K4UA 4ZEDA 4U22A 2I49A 3UK4A 1N7WA 4G8HA 3S2VA 4QSCA 3IB1A 3UIFA 5I2KB 1CB6A 1B1HA 3K02A 3M3FA 4X48A 1JW5A 3C31A 3IORA 3A3UA 3BFTA 2DWHA 1Z7ME 3OSRA 4PP0A 1QUJA 1UTHA 4C1TA 2Q8JA 1IXCA 2AIXA 4KD5A 3FJMA 5I58B 5K2YA 1XVYA 3U93A 5JK4A 4MBPA 3T66A 4RYAA 4HS7A 3IL1B 4NF8A 1B3GA 1QUKA 1HSLA 5F7VA 4G4PA 1FTLA 1AOVA 3KOSA 4OEVA 3S4UA 4EQ9A 3O9PA 1YCJA 2ONRA 4DLDA 5DYHA 1WODA 2B3BA 4TQUQ 3JZJA 3R26A 4XXUA 4R9GA 4OMBA 5FTHA 4DXUA 1O64A 1R9QA 2ZMBA 1IXHA 3FVNA 1QW0A 3C9HA 3RN8A 2UVHA 3SEYA 4LA9A 2AL4A 1ZKBA 3FUZA 5H8HA 1AH5A 4I1DA 4QSEA 3MZ9A 1DTZA 3H6WA 4IO5A 3HV1A 3VVFA 3EHUA 2YJPA 1IXIA 1A7LA 1A8EA 1ZLQA 1NFTA 2XXYA 1FW0A 3TTKA 2PT1A 1WDNA 3PUXE 2F36A 3OEKA 5IKBA 2DE4A 4KYDA 1NNPA 4PFYA 4PFWA 5AA4A 2O7IA 2BJJX 2X7PA 1D9VA 4E0WA 4OEUA 1BTJA 2HQ0A 4MF3A 4FATA 4QFKA 4L17A 1IITA 5L8DA 4YKIA 1RKMA 2G93A 3CSGA 4UA8A 1P99A 4YB7A 2O7UA 3FJGA 4GLIA 4R2FA 3HPIA 1OVBA 2VP1A 1J1NA 4LATA 4P0IA 3K1MA 3TAJA 5KDTA 4R75A 3USDA 3EPEA 2O69A 3E3KA 5CMMA 4QFNA 2RC7A 1MY2A 4BLAA 3OD7A 3N6TA 1H44A 5H8NB 5B70A 2O84X 4IO6A 4OHNA 4IY6A 1VFEA 5AA2B 2DE2A 2F7CA 2Y7WA 2PBWA 3H6VA 1OMPA 4YKPA 3L6GA 4ELRA 1LFGA 2RF1A 3ODBA 3BKIB 1Z7NE 4N6PA 3FIRA 3UP9A 3IOTA 3ILUB 3PD9A 4JSDA 1MY4A 4FAJA 4E0XA 4DXCA 4LONB 2PYYA 3E13X 4N13A 1EZ9A 4YU0A 2OJTA 4ELPA 4BDNA 2E1SA 4KHZE 3CVGA 2XX9A 2OBGA 3PPOA 1GVCA 1A54A 2P0SA 3KEIA 3MJNA 4ND9A 4KYSA 1NL5A 1MG1A 2F5XA 1N84A 2VGQA 4R6HA 2M8CA 1I6QA 3TCFA 2IEEA 3KBRA 3PU5A 1B51A 5JTYA 3FVKA 3D4GA 4RPOA 3K1NA 1IQ7A 2H9BA 4AB5A 2ANJA 4GL8A 1MQGA 2FA7A 3HN0A 4OWDA 2F8DA 5H8SA 1B0LA 3U72A 3CSBA 1TFDA 3T22A 3VXBA 3MZ1A 4QF9A 1B9JA 4G68A 4ZZAA 3RPWA 3QUJA 3SDFA 1P1OA 4G8MA 4BDMA 4DXBA 2Z8FA 3RLFE 4F1VA 2R9JA 1LAHE 2I58A 4ISUA 5CBSA 4JBZA 2Q2CA 3LR1A 4H1XA 1URSA 1PDAA 4H65A 4GFRA 4H6DA 4G8NA 1NNKA 3C35A 1EU8A 3MPKA 5TP9B 3TUSA 2UYFA 2IA4A 3B6WA 4P0GA 3MQ9A 3Q29A 4OVJA 4OETA 4K3FA 3KSJA 3DLNA 3H6TA 3KJTA 4O3BA 3C4MA 3E4RA 1S7YA 4YICA 4LZ5A 3PD8A 2ONSA 1A40A 1MQJA 4YMAA 3PUWE 3GZGA 2HZKA 4HTGA 4JXIA 1IUDA 2F6PA 3TYHA 3FXQA 1B3HA 4QFPA 1D9YA 1DMBA 3M3LA 4PQJA 2I0BA 1M5DA 1UIVA 3IOVA 2DS9A 3U1OA 3MUQA 4GVOA 3TEPA 1B58A 3FV1A 2KLFA 3N26A 1ZU0A 4GXAA 1B1XA 1MXXA 2Q89A 4RNSA 2ZYOA 2OLBA 3V83A 1B7ZA 3BFUA 3V8XB 2W7YA 3MC2A 5J1DA 3LUYA 5AA2D 3OELA 1ZMGA 1FQBA 1T0KA 3PPPA 1DPPA 4NMYA 2QS1A 2XXXA 4H5FA 1B3EA 3MVWA 1USYH 2I0CA 3FATA 1NMUA 1CE2A 4GOTA 1QVSA 3OO6A 3F11A 1A55A 4XKQA 4G68C 1S9TA 1H3DA 1BKAA 5DVJA 1PB7A 3M3KA 2XXPA 2D5WA 3V89B 2ONKE 1EH3A 4FIMA 4RK2A 3S9LC 2Z22A 1DSNA 1LLSA 1PBQA 4U2RA 1SQYA 1B4HA 3GBAA 4M4GA 3SEUA 2I4CA 2F7BA 3UN6A 5TPAB 4BDQA 1M5EA 1Q35A 5I57A 1B7HA 4OESA 3OO7A 3R6UA 3K6UA 2QSXA 1PB9A 2OWTA 2OZZA 2QL3A 1MM7A 3G3FA 3ZKKA 1MDP1 2PX1A 3QUFA 2Y7IA 1MQHA 2UVJA 1YPNA 1M5BA 2HCAA 2QJEA 3T9VA 5I59A 3OEMA 3MP8A 1US4A 3IO6A 3S9NC 2THIA 3FASA 1UTHB 4R73A 5A5XA 5H8QA 4OFOA 4X9TA 1FCKA 5M2VA 3A09A 3EN3A 1N0TA 5F1QA 4ZECA 4GQOA 1SBPA 4F1UA 1LAFE 2VD2A 4F29A 4THIA 1JEUA 4NWDA 3SEVA 1H43A 4NF8B 3C34A 1P1UA 3OO8A 1JVYA 3I5OA 3KJ7A 4KCDA 4I8CA 1LAXA 4MLQA 4YB6A 4WKMA 1M5FA 4KCCA 3W9VA 3MPLA 5I56A 3VLVA 1B32A 2ZYMA 1POTA 4KI0E 2O68A 3G3IA 3V5AA 2QMWA 1IZ1A 3MZBA 3IOWA 2UVGA 5H8HB 2H5YA 1ZJLA 2P2AA 3PPRA 1MY3A 4IO2A 1I69A 4ZE9A 1LFIA 3KN3A 2WKYA 3CFLA 3IOUA 4U1OA 2RCBA 3T93B 2NXOA 3FD3A 4C1UA 3PUZE 4F3BA 1JW1A 1YAEA 3TTNA 1LSTA 4UACA 2QS4A 2V93A 3H3GA 5FHNA 3T96B 3EHTA 3K6XA 3KN8A 3IJXB 3RGYA 5ICQA 4LP2B 1JVXA 1LB8A 4PE5B 4RPNA 4FORA 1QJMA 5AA4B 2F97A 4QFLA 4OERA 1LGBC 1PBPA 3KZGA 3CFXA 1TT1A 3HHGA 3TFLA 4NF4A 1Y9UA 2Q2AA 3ZS6A 2DOJA 2F34A 3OENA 1FQEA 4BDOA 2NVUB 2DVZA 5I84A 3G3JA 1XOCA 4O3CA 4F3PA 3Q25A 4ZEFA 5KDTB 1PB8A 4R9FA 3WAEA 4POXA 1AMFA 1Y3NA 1LBBA 1IIWA 3U8QA 4JWYA 3TDJA 5K2XA 5CM6A 3SETA 5EHMA 2DYXA 3GLBA 3KFMA 3KG2A 1O63A 1FTMA 3K01A 1JW4A 3VV5A 3G3KA 4R6YA 3SESA 2PT2A 1VFDA 1TWYA 3K0VA 3EQ1A 1XVXA 3C32A 3UORA 4EQ7A 1LCFA 3Q27A 4QRZA 4YAHX 1MXUA 4ZE8A 2PMSA 3H7MA 3QK6A 3RQTA 4ELQA 1DOTA 3IAZA 4R6KA 2ZNTA 5H8FA 2ESNA 1PEBA 2VHAA 1OIBA 3IB2A 3MP6A 4FEBA 4NF6A 4TLMB 3ZSFA 4PFTA 4IB2A 3S9EA 2QS3A 1FQAA 2XXUA 2O1MA 4H8IA 5ICTA 2DQVA 2V3UA 4IGTA 5DEXA 4PETA 4NWCA 4KPTA 3R7XA 3FGSA 2DE3A 3K6VA 5ISUA 3FXUA 1AL3A 3VVEA 1MRPA 1FQDA 4YMBA 3MVYA 1GV8A 4ONYA 4R74A 1S50A 1OLAA 2R6GE 4WEPA 3KN7A 3FXRA 2VD3A 4YKKA 1JETA 2G29A 1Q1KA 3ECRA 3O2AA 1B5IA 1MPBA 5AA1A 1N7XA 1NH7A 4G68B 3PGFA 1MQIA 2ZYKA 3CG3A 3KSXA 4GD5A 3U92A 4RY1A 3TTRA 2VOZA 2Z23A 3DP6A 2LAOA 5L9SA 1KWHA 1NNFA 2I48A 5BUUA 1MPCA 2RCAA 4DIGA 4XKPA 4X1BA 1D3KA 1ZTYA 4JB7A 3H03A 3SEXA 4JWXA 4NF5A 3K00A 2QS2A 4IO7A 1H45A 3SERA 1B4ZA 4H5GA 3QXMA 2I3VA 3RTWB 1MH3A 5JEIA 5ITOA 4AQ4A 2FNCA 4F2OA 2O51A 2DWAA 5TU0A 3TTMA 1MS7A 2RINA 3CI8A 4ZEKA 2XHDA 2A5TA 4Q0CA 2HXWA 3OMBA 3O29A 2HFBA 3DELB 1SW2A 2XXWA 2XXVA 3QIMA 2OWSA 1YTVA 4P11A 3TMGA 4EXLA 2ZYNA 1Y1ZA 3B6QA 3MBPA 3FVOA 4HW8A 1BIYA 1Y20A 1NNTA 1A8FA 2X26A 5HBCA 4RJZA 1POY1 1Y1MA 4X1DA 5I2NA 2ABHA 2DXYA 1UTBA 1MH4A 4WXJA 4KR5A 4F22A 3FZVA 5FHMA 5ELVA 5DVFA 2Y7RA 2NOOA 3S9MC 4QSDA 3T9HB 4Q5TA 3BBRA 4Z0IA 1R9LA 5KCJA 5CRYA 4DDDA 4ESWA 1HSJA 1Y3PA 1EZOA 4NE4A 2I3WA 1MPDA 4Q8RA 2XXHA 4F18A 4RK9A 2REJA 4N07A 4IGRA 3N6UA 4MH5A 3DM0A 1URDA 3QSLA 4XKRA 1R6ZA 3O6IA 4H0WA 2V84A 3OXNA 1B5HA 1P1WA 3LC8A 4GL0A 3MP1A 2F6GA 2PVUA 2FYIA 3VXCA 1JEVA 2OK2A 3PPNA 5CI5A 4EXKA 1XHYA 1GGGA 3IX1A 1ZBMA 1DPEA 2B65A 5IAIA 1OQHA 1B2HA 2XX7A 3MAMA 5CBRA 3IK6B 3MWBA 2QPQA 2RKMA 3PMVA 2O6AA 4WEDA 5EYFA 2X7QA 2DXRA 2ZNSA 1UIUA 2Y7KA 4M1VA 2A5SA 3SEWA 2DWJA 5I57B 1QKAA 2D21A 3IB0A 3ZKLA 2I4BA 1II5A 2DVCA 5I2KA 4EUOA 4MLVA 3TZAA 4F2QA 3PUVE 4ZEBA 3W15C 3RUMA 4JWOA 4U4XA 4GXSB 2YPNA 1MQDA 3GBBA 2GFEA 3DP8A 5I59B 1BLFA 2H4IA 2Z8DA 1GTKA 3IJOB 4OXVA 4U23A 5A5XB 5H8QB 4QFOA 5I58A 1MXYA 4IO4A 3CR9A 4ZEIA 3TELA 4QHQA 4NEDA 1MDQA 5LOMA 1LFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OTE A;  4F19 A;  3VLU A;  4GWO A;  4ESX A;  1Y4T A;  4OYV A;  4F1Y A;  4ELO A;  2CMO A;  3OO9 A;  4EF2 A;  4F3S A;  3B7D A;  3RT8 A;  1FTK A;  2F7A A;  1EZP A;  3K6W A;  4POW A;  5I56 B;  4OEN A;  3QAX A;  3G7W A;  2RC9 A;  1VE4 A;  5CMK A;  2XXR A;  3RT6 B;  5CMC A;  3G3G A;  2P1S A;  1B5J A;  2H99 A;  2GRV A;  3Q28 A;  1Y4C A;  2GHA A;  1ATG A;  3I3V A;  5EHS A;  4AB6 A;  1BP5 A;  3LSF B;  4ZS9 A;  3RTF B;  5ITP A;  1Y3Q A;  3SKP A;  5L9M A;  1DTG A;  2Y84 A;  2Z8E A;  1GR2 A;  1P1N A;  1B7U A;  3LBS A;  3T9U A;  2NWJ A;  3U94 A;  3WAF A;  3HO7 A;  3PMX A;  3HCQ A;  3P7I A;  3O66 A;  5FTI A;  3LSX A;  4U1Z A;  2DSF A;  4OQO A;  2UVI A;  3CG1 A;  1B6H A;  1QUL A;  3C36 A;  2NUV A;  4OZ9 A;  5KZT A;  3C33 A;  1MM6 A;  3HST A;  3PV0 E;  1B52 A;  4HCY A;  2AL5 A;  1I6A A;  4U21 A;  4DCY A;  1A99 A;  5L9O A;  3FJ7 A;  4TLL B;  3MVX A;  4NF4 B;  3LSW A;  1XT8 A;  4YZZ A;  3FVG A;  3THI A;  2HZL A;  4C0R A;  4FEC A;  1B46 A;  2B3F A;  3ILT B;  3CFZ A;  3FV2 A;  4FJP A;  2F78 A;  3IO4 A;  1US5 A;  3VE1 B;  1SW1 A;  2E0S A;  4GRK A;  1OVT A;  4R2B A;  1QUI A;  1NH8 A;  4I62 A;  1FQC A;  3TPA A;  3EHS A;  4DCX A;  3H4Z A;  1ELJ A;  2XXI A;  1SVX B;  3CRB A;  1B40 A;  3IR1 A;  3HHF A;  5H8N A;  4XTC Q;  4F3G A;  3PUY E;  4F39 A;  5AA2 A;  1MXV A;  4Z7E A;  4HCW A;  4YKJ A;  1FTO A;  5BWJ A;  5DT6 A;  3CIJ A;  1SYI A;  4ZDM A;  4LZ7 A;  2UYE A;  1OQG A;  1FTJ A;  1SDX A;  3OOA A;  4H67 A;  1LAG E;  4YB5 A;  3E9X A;  3T9X B;  2REG A;  5FHO A;  1SD3 A;  5HM4 B;  1RYX A;  4IO3 A;  1SYH A;  4OFL A;  5H8F B;  4F31 B;  3TCH A;  4GF8 A;  3D4C A;  4NF6 B;  4H8J A;  3TTL A;  4R72 A;  3LSL A;  2HAV A;  4PFU A;  4LUB A;  5DEX B;  2R71 A;  4I9D A;  1L5T A;  1VR5 A;  5JTY B;  1QKB A;  2F35 A;  4LZ8 A;  3TCG A;  3PPQ A;  3O97 A;  5CC2 A;  1LBC A;  3TOD A;  1USY E;  4GIZ A;  1XC1 A;  2OCU A;  4BDR A;  3O6H A;  1SI0 A;  2DP8 A;  2GH9 A;  2Q9T A;  2Y7P A;  2O1L A;  4TOZ A;  1SW5 A;  3M8U A;  4FED A;  5DVI A;  2V3T A;  3MVZ A;  1B3F A;  2H98 A;  5AE4 A;  1LCT A;  1HSE A;  4LQ5 A;  3EF7 A;  4NF5 B;  4G2Z A;  5TP9 A;  1URG A;  3AXF A;  3N94 A;  5HPQ A;  2QRY A;  1FQF A;  3O6G A;  1R1N A;  5AA3 A;  1IEJ A;  3MW0 A;  1NKX A;  1SI1 A;  1SW4 A;  1N76 A;  3VVD A;  1F9B A;  2XXQ A;  1ZIU A;  3JV9 A;  2A5T B;  2DWI A;  3B6T A;  1B0H A;  4G77 A;  3UA8 A;  4JSO A;  3O28 A;  2D3I A;  1P1Q A;  3H6U A;  1OLC A;  4DZ1 A;  2H25 A;  3W9W A;  4BDL A;  3N5L A;  4EDP A;  1IXG A;  5DTB A;  2XD3 A;  1I6B A;  3KGC A;  5B7D A;  1LB9 A;  3KOT A;  4EF1 A;  1XS5 A;  1AIV A;  1MY0 A;  3OSQ A;  1N3W A;  1WVJ A;  1B05 A;  3VFJ A;  4Q30 B;  2UXA A;  4KFQ A;  5I2N B;  2HAU A;  3Q26 A;  1MXZ A;  4ECF A;  1UTB B;  4KQP A;  3GXA A;  1JQF A;  3VDF A;  1PC3 A;  2QMX A;  1M5C A;  3TKD A;  3RY3 A;  4JDF A;  4XKN A;  2RC8 A;  1MXW A;  2ZNU A;  1UQW A;  1H76 A;  4OFJ A;  3A3C A;  2GHB A;  1O7T A;  2XXT A;  4KYE A;  1TFA A;  5KCJ B;  3RNN A;  2I6E A;  1TXF A;  1VSO A;  4IY5 A;  4XIG Q;  1N3X A;  4EQB A;  3TQW A;  3I6V A;  3TQL A;  3H06 B;  4FE8 A;  4NTL A;  3PMW A;  2CZL A;  1MY1 A;  2YLN A;  3G3H A;  1RYO A;  4RXL A;  4LQ2 A;  2AYS A;  2ALU A;  4DE8 A;  2XX8 A;  3UGW A;  3K2D A;  4U4S A;  2V25 A;  2Q88 A;  5CMB A;  3JYR A;  3L6H A;  1B3L A;  2XD2 A;  1D4N A;  2V3Q A;  1ANF A;  3QYT A;  2ZXT A;  2HEU A;  1JNF A;  3ONM A;  4MFI A;  4ZZE A;  5TPA A;  4LVQ A;  3VLW A;  4O3A A;  3DP4 A;  4RA1 A;  3K1P A;  1N04 A;  3K4U A;  4ZED A;  4U22 A;  2I49 A;  3UK4 A;  1N7W A;  4G8H A;  3S2V A;  4QSC A;  3IB1 A;  3UIF A;  5I2K B;  1CB6 A;  1B1H A;  3K02 A;  3M3F A;  4X48 A;  1JW5 A;  3C31 A;  3IOR A;  3A3U A;  3BFT A;  2DWH A;  1Z7M E;  3OSR A;  4PP0 A;  1QUJ A;  1UTH A;  4C1T A;  2Q8J A;  1IXC A;  2AIX A;  4KD5 A;  3FJM A;  5I58 B;  5K2Y A;  1XVY A;  3U93 A;  5JK4 A;  4MBP A;  3T66 A;  4RYA A;  4HS7 A;  3IL1 B;  4NF8 A;  1B3G A;  1QUK A;  1HSL A;  5F7V A;  4G4P A;  1FTL A;  1AOV A;  3KOS A;  4OEV A;  3S4U A;  4EQ9 A;  3O9P A;  1YCJ A;  2ONR A;  4DLD A;  5DYH A;  1WOD A;  2B3B A;  4TQU Q;  3JZJ A;  3R26 A;  4XXU A;  4R9G A;  4OMB A;  5FTH A;  4DXU A;  1O64 A;  1R9Q A;  2ZMB A;  1IXH A;  3FVN A;  1QW0 A;  3C9H A;  3RN8 A;  2UVH A;  3SEY A;  4LA9 A;  2AL4 A;  1ZKB A;  3FUZ A;  5H8H A;  1AH5 A;  4I1D A;  4QSE A;  3MZ9 A;  1DTZ A;  3H6W A;  4IO5 A;  3HV1 A;  3VVF A;  3EHU A;  2YJP A;  1IXI A;  1A7L A;  1A8E A;  1ZLQ A;  1NFT A;  2XXY A;  1FW0 A;  3TTK A;  2PT1 A;  1WDN A;  3PUX E;  2F36 A;  3OEK A;  5IKB A;  2DE4 A;  4KYD A;  1NNP A;  4PFY A;  4PFW A;  5AA4 A;  2O7I A;  2BJJ X;  2X7P A;  1D9V A;  4E0W A;  4OEU A;  1BTJ A;  2HQ0 A;  4MF3 A;  4FAT A;  4QFK A;  4L17 A;  1IIT A;  5L8D A;  4YKI A;  1RKM A;  2G93 A;  3CSG A;  4UA8 A;  1P99 A;  4YB7 A;  2O7U A;  3FJG A;  4GLI A;  4R2F A;  3HPI A;  1OVB A;  2VP1 A;  1J1N A;  4LAT A;  4P0I A;  3K1M A;  3TAJ A;  5KDT A;  4R75 A;  3USD A;  3EPE A;  2O69 A;  3E3K A;  5CMM A;  4QFN A;  2RC7 A;  1MY2 A;  4BLA A;  3OD7 A;  3N6T A;  1H44 A;  5H8N B;  5B70 A;  2O84 X;  4IO6 A;  4OHN A;  4IY6 A;  1VFE A;  5AA2 B;  2DE2 A;  2F7C A;  2Y7W A;  2PBW A;  3H6V A;  1OMP A;  4YKP A;  3L6G A;  4ELR A;  1LFG A;  2RF1 A;  3ODB A;  3BKI B;  1Z7N E;  4N6P A;  3FIR A;  3UP9 A;  3IOT A;  3ILU B;  3PD9 A;  4JSD A;  1MY4 A;  4FAJ A;  4E0X A;  4DXC A;  4LON B;  2PYY A;  3E13 X;  4N13 A;  1EZ9 A;  4YU0 A;  2OJT A;  4ELP A;  4BDN A;  2E1S A;  4KHZ E;  3CVG A;  2XX9 A;  2OBG A;  3PPO A;  1GVC A;  1A54 A;  2P0S A;  3KEI A;  3MJN A;  4ND9 A;  4KYS A;  1NL5 A;  1MG1 A;  2F5X A;  1N84 A;  2VGQ A;  4R6H A;  2M8C A;  1I6Q A;  3TCF A;  2IEE A;  3KBR A;  3PU5 A;  1B51 A;  5JTY A;  3FVK A;  3D4G A;  4RPO A;  3K1N A;  1IQ7 A;  2H9B A;  4AB5 A;  2ANJ A;  4GL8 A;  1MQG A;  2FA7 A;  3HN0 A;  4OWD A;  2F8D A;  5H8S A;  1B0L A;  3U72 A;  3CSB A;  1TFD A;  3T22 A;  3VXB A;  3MZ1 A;  4QF9 A;  1B9J A;  4G68 A;  4ZZA A;  3RPW A;  3QUJ A;  3SDF A;  1P1O A;  4G8M A;  4BDM A;  4DXB A;  2Z8F A;  3RLF E;  4F1V A;  2R9J A;  1LAH E;  2I58 A;  4ISU A;  5CBS A;  4JBZ A;  2Q2C A;  3LR1 A;  4H1X A;  1URS A;  1PDA A;  4H65 A;  4GFR A;  4H6D A;  4G8N A;  1NNK A;  3C35 A;  1EU8 A;  3MPK A;  5TP9 B;  3TUS A;  2UYF A;  2IA4 A;  3B6W A;  4P0G A;  3MQ9 A;  3Q29 A;  4OVJ A;  4OET A;  4K3F A;  3KSJ A;  3DLN A;  3H6T A;  3KJT A;  4O3B A;  3C4M A;  3E4R A;  1S7Y A;  4YIC A;  4LZ5 A;  3PD8 A;  2ONS A;  1A40 A;  1MQJ A;  4YMA A;  3PUW E;  3GZG A;  2HZK A;  4HTG A;  4JXI A;  1IUD A;  2F6P A;  3TYH A;  3FXQ A;  1B3H A;  4QFP A;  1D9Y A;  1DMB A;  3M3L A;  4PQJ A;  2I0B A;  1M5D A;  1UIV A;  3IOV A;  2DS9 A;  3U1O A;  3MUQ A;  4GVO A;  3TEP A;  1B58 A;  3FV1 A;  2KLF A;  3N26 A;  1ZU0 A;  4GXA A;  1B1X A;  1MXX A;  2Q89 A;  4RNS A;  2ZYO A;  2OLB A;  3V83 A;  1B7Z A;  3BFU A;  3V8X B;  2W7Y A;  3MC2 A;  5J1D A;  3LUY A;  5AA2 D;  3OEL A;  1ZMG A;  1FQB A;  1T0K A;  3PPP A;  1DPP A;  4NMY A;  2QS1 A;  2XXX A;  4H5F A;  1B3E A;  3MVW A;  1USY H;  2I0C A;  3FAT A;  1NMU A;  1CE2 A;  4GOT A;  1QVS A;  3OO6 A;  3F11 A;  1A55 A;  4XKQ A;  4G68 C;  1S9T A;  1H3D A;  1BKA A;  5DVJ A;  1PB7 A;  3M3K A;  2XXP A;  2D5W A;  3V89 B;  2ONK E;  1EH3 A;  4FIM A;  4RK2 A;  3S9L C;  2Z22 A;  1DSN A;  1LLS A;  1PBQ A;  4U2R A;  1SQY A;  1B4H A;  3GBA A;  4M4G A;  3SEU A;  2I4C A;  2F7B A;  3UN6 A;  5TPA B;  4BDQ A;  1M5E A;  1Q35 A;  5I57 A;  1B7H A;  4OES A;  3OO7 A;  3R6U A;  3K6U A;  2QSX A;  1PB9 A;  2OWT A;  2OZZ A;  2QL3 A;  1MM7 A;  3G3F A;  3ZKK A;  1MDP 1;  2PX1 A;  3QUF A;  2Y7I A;  1MQH A;  2UVJ A;  1YPN A;  1M5B A;  2HCA A;  2QJE A;  3T9V A;  5I59 A;  3OEM A;  3MP8 A;  1US4 A;  3IO6 A;  3S9N C;  2THI A;  3FAS A;  1UTH B;  4R73 A;  5A5X A;  5H8Q A;  4OFO A;  4X9T A;  1FCK A;  5M2V A;  3A09 A;  3EN3 A;  1N0T A;  5F1Q A;  4ZEC A;  4GQO A;  1SBP A;  4F1U A;  1LAF E;  2VD2 A;  4F29 A;  4THI A;  1JEU A;  4NWD A;  3SEV A;  1H43 A;  4NF8 B;  3C34 A;  1P1U A;  3OO8 A;  1JVY A;  3I5O A;  3KJ7 A;  4KCD A;  4I8C A;  1LAX A;  4MLQ A;  4YB6 A;  4WKM A;  1M5F A;  4KCC A;  3W9V A;  3MPL A;  5I56 A;  3VLV A;  1B32 A;  2ZYM A;  1POT A;  4KI0 E;  2O68 A;  3G3I A;  3V5A A;  2QMW A;  1IZ1 A;  3MZB A;  3IOW A;  2UVG A;  5H8H B;  2H5Y A;  1ZJL A;  2P2A A;  3PPR A;  1MY3 A;  4IO2 A;  1I69 A;  4ZE9 A;  1LFI A;  3KN3 A;  2WKY A;  3CFL A;  3IOU A;  4U1O A;  2RCB A;  3T93 B;  2NXO A;  3FD3 A;  4C1U A;  3PUZ E;  4F3B A;  1JW1 A;  1YAE A;  3TTN A;  1LST A;  4UAC A;  2QS4 A;  2V93 A;  3H3G A;  5FHN A;  3T96 B;  3EHT A;  3K6X A;  3KN8 A;  3IJX B;  3RGY A;  5ICQ A;  4LP2 B;  1JVX A;  1LB8 A;  4PE5 B;  4RPN A;  4FOR A;  1QJM A;  5AA4 B;  2F97 A;  4QFL A;  4OER A;  1LGB C;  1PBP A;  3KZG A;  3CFX A;  1TT1 A;  3HHG A;  3TFL A;  4NF4 A;  1Y9U A;  2Q2A A;  3ZS6 A;  2DOJ A;  2F34 A;  3OEN A;  1FQE A;  4BDO A;  2NVU B;  2DVZ A;  5I84 A;  3G3J A;  1XOC A;  4O3C A;  4F3P A;  3Q25 A;  4ZEF A;  5KDT B;  1PB8 A;  4R9F A;  3WAE A;  4POX A;  1AMF A;  1Y3N A;  1LBB A;  1IIW A;  3U8Q A;  4JWY A;  3TDJ A;  5K2X A;  5CM6 A;  3SET A;  5EHM A;  2DYX A;  3GLB A;  3KFM A;  3KG2 A;  1O63 A;  1FTM A;  3K01 A;  1JW4 A;  3VV5 A;  3G3K A;  4R6Y A;  3SES A;  2PT2 A;  1VFD A;  1TWY A;  3K0V A;  3EQ1 A;  1XVX A;  3C32 A;  3UOR A;  4EQ7 A;  1LCF A;  3Q27 A;  4QRZ A;  4YAH X;  1MXU A;  4ZE8 A;  2PMS A;  3H7M A;  3QK6 A;  3RQT A;  4ELQ A;  1DOT A;  3IAZ A;  4R6K A;  2ZNT A;  5H8F A;  2ESN A;  1PEB A;  2VHA A;  1OIB A;  3IB2 A;  3MP6 A;  4FEB A;  4NF6 A;  4TLM B;  3ZSF A;  4PFT A;  4IB2 A;  3S9E A;  2QS3 A;  1FQA A;  2XXU A;  2O1M A;  4H8I A;  5ICT A;  2DQV A;  2V3U A;  4IGT A;  5DEX A;  4PET A;  4NWC A;  4KPT A;  3R7X A;  3FGS A;  2DE3 A;  3K6V A;  5ISU A;  3FXU A;  1AL3 A;  3VVE A;  1MRP A;  1FQD A;  4YMB A;  3MVY A;  1GV8 A;  4ONY A;  4R74 A;  1S50 A;  1OLA A;  2R6G E;  4WEP A;  3KN7 A;  3FXR A;  2VD3 A;  4YKK A;  1JET A;  2G29 A;  1Q1K A;  3ECR A;  3O2A A;  1B5I A;  1MPB A;  5AA1 A;  1N7X A;  1NH7 A;  4G68 B;  3PGF A;  1MQI A;  2ZYK A;  3CG3 A;  3KSX A;  4GD5 A;  3U92 A;  4RY1 A;  3TTR A;  2VOZ A;  2Z23 A;  3DP6 A;  2LAO A;  5L9S A;  1KWH A;  1NNF A;  2I48 A;  5BUU A;  1MPC A;  2RCA A;  4DIG A;  4XKP A;  4X1B A;  1D3K A;  1ZTY A;  4JB7 A;  3H03 A;  3SEX A;  4JWX A;  4NF5 A;  3K00 A;  2QS2 A;  4IO7 A;  1H45 A;  3SER A;  1B4Z A;  4H5G A;  3QXM A;  2I3V A;  3RTW B;  1MH3 A;  5JEI A;  5ITO A;  4AQ4 A;  2FNC A;  4F2O A;  2O51 A;  2DWA A;  5TU0 A;  3TTM A;  1MS7 A;  2RIN A;  3CI8 A;  4ZEK A;  2XHD A;  2A5T A;  4Q0C A;  2HXW A;  3OMB A;  3O29 A;  2HFB A;  3DEL B;  1SW2 A;  2XXW A;  2XXV A;  3QIM A;  2OWS A;  1YTV A;  4P11 A;  3TMG A;  4EXL A;  2ZYN A;  1Y1Z A;  3B6Q A;  3MBP A;  3FVO A;  4HW8 A;  1BIY A;  1Y20 A;  1NNT A;  1A8F A;  2X26 A;  5HBC A;  4RJZ A;  1POY 1;  1Y1M A;  4X1D A;  5I2N A;  2ABH A;  2DXY A;  1UTB A;  1MH4 A;  4WXJ A;  4KR5 A;  4F22 A;  3FZV A;  5FHM A;  5ELV A;  5DVF A;  2Y7R A;  2NOO A;  3S9M C;  4QSD A;  3T9H B;  4Q5T A;  3BBR A;  4Z0I A;  1R9L A;  5KCJ A;  5CRY A;  4DDD A;  4ESW A;  1HSJ A;  1Y3P A;  1EZO A;  4NE4 A;  2I3W A;  1MPD A;  4Q8R A;  2XXH A;  4F18 A;  4RK9 A;  2REJ A;  4N07 A;  4IGR A;  3N6U A;  4MH5 A;  3DM0 A;  1URD A;  3QSL A;  4XKR A;  1R6Z A;  3O6I A;  4H0W A;  2V84 A;  3OXN A;  1B5H A;  1P1W A;  3LC8 A;  4GL0 A;  3MP1 A;  2F6G A;  2PVU A;  2FYI A;  3VXC A;  1JEV A;  2OK2 A;  3PPN A;  5CI5 A;  4EXK A;  1XHY A;  1GGG A;  3IX1 A;  1ZBM A;  1DPE A;  2B65 A;  5IAI A;  1OQH A;  1B2H A;  2XX7 A;  3MAM A;  5CBR A;  3IK6 B;  3MWB A;  2QPQ A;  2RKM A;  3PMV A;  2O6A A;  4WED A;  5EYF A;  2X7Q A;  2DXR A;  2ZNS A;  1UIU A;  2Y7K A;  4M1V A;  2A5S A;  3SEW A;  2DWJ A;  5I57 B;  1QKA A;  2D21 A;  3IB0 A;  3ZKL A;  2I4B A;  1II5 A;  2DVC A;  5I2K A;  4EUO A;  4MLV A;  3TZA A;  4F2Q A;  3PUV E;  4ZEB A;  3W15 C;  3RUM A;  4JWO A;  4U4X A;  4GXS B;  2YPN A;  1MQD A;  3GBB A;  2GFE A;  3DP8 A;  5I59 B;  1BLF A;  2H4I A;  2Z8D A;  1GTK A;  3IJO B;  4OXV A;  4U23 A;  5A5X B;  5H8Q B;  4QFO A;  5I58 A;  1MXY A;  4IO4 A;  3CR9 A;  4ZEI A;  3TEL A;  4QHQ A;  4NED A;  1MDQ A;  5LOM A;  1LFH A; 
#chains in the Genus database with same CATH topology
 4OTE A;  4F19 A;  3VLU A;  4GWO A;  4ESX A;  1Y4T A;  4OYV A;  4F1Y A;  4ELO A;  2CMO A;  3OO9 A;  4EF2 A;  4F3S A;  3B7D A;  3RT8 A;  1FTK A;  2F7A A;  1EZP A;  3K6W A;  4POW A;  5I56 B;  4OEN A;  3QAX A;  3G7W A;  2RC9 A;  1VE4 A;  5CMK A;  2XXR A;  3RT6 B;  2FIX A;  5CMC A;  3G3G A;  2P1S A;  1B5J A;  2H99 A;  2GRV A;  3Q28 A;  4XF5 A;  1Y4C A;  3IFC A;  2GHA A;  1ATG A;  3I3V A;  5EHS A;  4AB6 A;  1BP5 A;  3LSF B;  4ZS9 A;  2QVU A;  3RTF B;  5ITP A;  1NUZ A;  1Y3Q A;  3SKP A;  5IZ3 A;  5L9M A;  1DTG A;  2Y84 A;  2Z8E A;  2XWI A;  4PBH A;  2HXR A;  1GR2 A;  1P1N A;  2CEX A;  1B7U A;  3LBS A;  3T9U A;  2NWJ A;  4MJO A;  3U94 A;  3HO7 A;  3WAF A;  3PMX A;  3HCQ A;  3P7I A;  3O66 A;  5FTI A;  3LSX A;  4U1Z A;  2DSF A;  4OQO A;  2UVI A;  3CG1 A;  3BIG A;  1B6H A;  1QUL A;  3C36 A;  2NUV A;  4OZ9 A;  5KZT A;  3C33 A;  1MM6 A;  3HST A;  4NG7 A;  3PV0 E;  1B52 A;  4HCY A;  2AL5 A;  1I6A A;  4U21 A;  3HFU A;  4DCY A;  1A99 A;  4I40 A;  5L9O A;  3FJ7 A;  4TLL B;  3MVX A;  4NF4 B;  1D9Q A;  3U65 A;  3LSW A;  1XT8 A;  4YZZ A;  3FVG A;  3THI A;  2HZL A;  4C0R A;  1K9Y A;  4N81 A;  4FEC A;  1B46 A;  2B3F A;  3ILT B;  3CFZ A;  3FV2 A;  4FJP A;  2F78 A;  3IO4 A;  3LUZ A;  1US5 A;  3VE1 B;  1SW1 A;  2E0S A;  4GRK A;  1OVT A;  4R2B A;  1QUI A;  1NH8 A;  4I62 A;  1FQC A;  3TPA A;  3EHS A;  4DCX A;  3H4Z A;  2L5V A;  2JJK A;  1ELJ A;  2XXI A;  1FBF A;  1SVX B;  3CRB A;  1B40 A;  3IR1 A;  3HHF A;  5H8N A;  4XTC Q;  4F3G A;  4KXP A;  3PUY E;  4F39 A;  5AA2 A;  1MXV A;  1NV1 A;  4Z7E A;  4HCW A;  4P47 A;  1FPF A;  4YKJ A;  1FTO A;  4MNC A;  5BWJ A;  5DT6 A;  4NQ8 A;  3CIJ A;  1SYI A;  4JVC A;  4ZDM A;  1BK4 A;  4LZ7 A;  2UYE A;  1OQG A;  1SDX A;  1FTJ A;  1LEV A;  3OOA A;  4H67 A;  1LAG E;  4YB5 A;  1K9Z A;  3E9X A;  3T9X B;  1KZ8 A;  2REG A;  5FHO A;  1SD3 A;  5HM4 B;  1RYX A;  4IO3 A;  4MMP A;  1EYK A;  1SYH A;  4OFL A;  5H8F B;  4F31 B;  3TCH A;  4GF8 A;  3D4C A;  4OVT A;  5ET5 A;  3IFA A;  4NF6 B;  4H8J A;  3TTL A;  4R72 A;  3LSL A;  2HAV A;  4PFU A;  4LUB A;  5DEX B;  4FBP A;  4AS4 A;  4O94 A;  2R71 A;  4I9D A;  1L5T A;  1VR5 A;  5JTY B;  4HXV A;  1QKB A;  2F35 A;  4LZ8 A;  3TCG A;  3PPQ A;  3O97 A;  5CC2 A;  1LBC A;  1RDZ A;  4GWU A;  3TOD A;  1USY E;  4GIZ A;  1XC1 A;  2OCU A;  4BDR A;  1FPG A;  3O6H A;  1SI0 A;  2DP8 A;  2GH9 A;  2Q9T A;  2Y7P A;  2O1L A;  4TOZ A;  2FVZ A;  2HHM A;  4PCD A;  4PF8 A;  1SW5 A;  3M8U A;  1LBZ A;  4FED A;  1NV0 A;  2P3V A;  1FRP A;  5DVI A;  2V3T A;  3MVZ A;  1B3F A;  2H98 A;  4DI3 D;  5AE4 A;  4OVS A;  1LCT A;  1HSE A;  4LQ5 A;  3EF7 A;  4NF5 B;  4G2Z A;  5TP9 A;  1URG A;  3AXF A;  3N94 A;  5I5P A;  5HPQ A;  2QRY A;  3B8B A;  1FQF A;  3O6G A;  1R1N A;  5AA3 A;  1IEJ A;  3MW0 A;  1NKX A;  1SI1 A;  1SW4 A;  1N76 A;  3BIH A;  4N6K A;  3VVD A;  1F9B A;  2XXQ A;  1ZIU A;  3JV9 A;  2A5T B;  2DWI A;  4PFI A;  3B6T A;  4GWX A;  1B0H A;  4G77 A;  3UA8 A;  4JSO A;  3O28 A;  2D3I A;  1P1Q A;  4MIJ A;  4O7I A;  3H6U A;  1OLC A;  4G61 A;  4DZ1 A;  1IME A;  2H25 A;  3W9W A;  4BDL A;  3N5L A;  4EDP A;  1IXG A;  5DTB A;  2XD3 A;  1I6B A;  3KGC A;  4OA4 A;  5B7D A;  1LB9 A;  3KOT A;  4EF1 A;  1JP4 A;  4PE3 A;  1XS5 A;  1AIV A;  1MY0 A;  3OSQ A;  3T1B A;  1N3W A;  1WVJ A;  1B05 A;  3VFJ A;  4Q30 B;  4OVQ A;  2UXA A;  4KFQ A;  5I2N B;  2HAU A;  3Q26 A;  4UAB A;  1IMD A;  1MXZ A;  4ECF A;  1UTB B;  3T0J A;  4KQP A;  4P8B A;  3GXA A;  1JQF A;  1LBW A;  3VDF A;  1PC3 A;  2QMX A;  1M5C A;  3TKD A;  3RY3 A;  4JDF A;  4XKN A;  2RC8 A;  1MXW A;  2ZNU A;  1UQW A;  1H76 A;  4OFJ A;  3A3C A;  2GHB A;  1O7T A;  1Q9D A;  2XXT A;  4KYE A;  1VDW A;  1TFA A;  1IMC A;  5KCJ B;  5ET6 A;  3RNN A;  2I6E A;  1DCU A;  1FBP A;  1TXF A;  1VSO A;  4IY5 A;  4XIG Q;  1N3X A;  4EQB A;  3TQW A;  3I6V A;  3TQL A;  1NV4 A;  3H06 B;  4PFR A;  4FE8 A;  4NTL A;  3PMW A;  2P3N A;  5ET7 A;  2CZL A;  1IMF A;  1MY1 A;  2YLN A;  3G3H A;  1RYO A;  5I7I A;  4RXL A;  4GBV A;  4LQ2 A;  2AYS A;  2ALU A;  4P9K A;  1YYZ A;  4DE8 A;  2XX8 A;  3UGW A;  3K2D A;  4U4S A;  2V25 A;  2Q88 A;  4OVR A;  5CMB A;  3JYR A;  3FBP A;  3L6H A;  1B3L A;  4PGP A;  2XD2 A;  1D4N A;  2V3Q A;  1ANF A;  3QYT A;  2ZXT A;  2HEU A;  4NN3 A;  1JNF A;  3ONM A;  4MFI A;  4ZZE A;  5TPA A;  4LVQ A;  3VLW A;  4O3A A;  3DP4 A;  4RA1 A;  3K1P A;  5F24 A;  1N04 A;  3K4U A;  4ZED A;  4U22 A;  2I49 A;  3UK4 A;  1N7W A;  4G8H A;  3S2V A;  4QSC A;  3IB1 A;  3UIF A;  5I2K B;  1CB6 A;  1B1H A;  3K02 A;  3M3F A;  4X48 A;  1JW5 A;  2PFY A;  4GX6 A;  3C31 A;  4NX1 A;  3IOR A;  3A3U A;  3BFT A;  2DWH A;  4P1E A;  1Z7M E;  3OSR A;  4PP0 A;  1QUJ A;  1UTH A;  4C1T A;  2Q8J A;  1IXC A;  3KC1 A;  4P56 A;  2AIX A;  4KD5 A;  4GWY A;  3FJM A;  5I58 B;  4I3E A;  5K2Y A;  1XVY A;  3U93 A;  5JK4 A;  4MBP A;  3T66 A;  4RYA A;  4HS7 A;  3IL1 B;  4NF8 A;  1B3G A;  1QUK A;  1HSL A;  5F7V A;  4G4P A;  1FTL A;  5LDZ A;  1AOV A;  4OEV A;  3KOS A;  3S4U A;  4EQ9 A;  3O9P A;  4N91 A;  1YCJ A;  2ONR A;  1NV2 A;  4DLD A;  5DYH A;  1WOD A;  2B3B A;  4TQU Q;  3JZJ A;  2WBB A;  3R26 A;  4XXU A;  4R9G A;  4OMB A;  5FTH A;  4DXU A;  1O64 A;  1R9Q A;  2CZK A;  2ZMB A;  1IXH A;  3FVN A;  1QW0 A;  3C9H A;  3RN8 A;  3A29 A;  2UVH A;  3SEY A;  4LA9 A;  2AL4 A;  1ZKB A;  3FUZ A;  1AH5 A;  4I1D A;  5H8H A;  4QSE A;  3MZ9 A;  2GQ1 A;  1DTZ A;  2VPO A;  4N8Y A;  3H6W A;  4IO5 A;  3HV1 A;  3VVF A;  5DW8 A;  3EHU A;  5IZ3 B;  2YJP A;  4PBQ A;  1IXI A;  1A7L A;  1A8E A;  1FPD A;  1ZLQ A;  1NFT A;  2XXY A;  1FW0 A;  3TTK A;  2PT1 A;  1WDN A;  3PUX E;  4LN5 A;  2F36 A;  3OEK A;  5IKB A;  4QXD A;  4XEQ A;  2DE4 A;  4KYD A;  1NNP A;  4PFY A;  4PFW A;  2Q74 A;  5AA4 A;  2O7I A;  2BJJ X;  2X7P A;  1D9V A;  2ZZW A;  4E0W A;  4OEU A;  1BTJ A;  5EQ7 A;  2HQ0 A;  4MF3 A;  4FAT A;  4O7M A;  2DDK A;  4QFK A;  1FBC A;  4L17 A;  1RDY A;  1IIT A;  4MX6 A;  1NUX A;  5L8D A;  4YKI A;  1RKM A;  1EYJ A;  2G93 A;  3CSG A;  4UA8 A;  1P99 A;  3E79 A;  2XXK A;  4YB7 A;  2O7U A;  3FJG A;  4GLI A;  4R2F A;  3HPI A;  2XWO A;  1OVB A;  2VP1 A;  1J1N A;  4LAT A;  4P0I A;  3K1M A;  3TAJ A;  5KDT A;  4QBA A;  4R75 A;  3USD A;  3EPE A;  2O69 A;  3E3K A;  2MKZ A;  5CMM A;  4QFN A;  2RC7 A;  1MY2 A;  4BLA A;  1NV3 A;  3OD7 A;  3N6T A;  1H44 A;  5H8N B;  5B70 A;  2O84 X;  4IO6 A;  4OHN A;  4IY6 A;  1VFE A;  5AA2 B;  2DE2 A;  2F7C A;  2Y7W A;  2PBW A;  3H6V A;  1OMP A;  4YKP A;  3L6G A;  2QFL A;  4ELR A;  4GX3 A;  1LFG A;  2RF1 A;  4PC9 A;  3ODB A;  3BKI B;  1Z7N E;  4N6P A;  3FIR A;  1FBH A;  3UP9 A;  3IOT A;  3ILU B;  3PD9 A;  4JSD A;  1MY4 A;  4FAJ A;  1G0I A;  4E0X A;  4DXC A;  2V4C A;  4LON B;  2PYY A;  3E13 X;  4N13 A;  1EZ9 A;  4YU0 A;  4PF6 A;  2OJT A;  4ELP A;  4BDN A;  2E1S A;  4KHZ E;  3CVG A;  2XX9 A;  2CZH A;  2OBG A;  3PPO A;  1GVC A;  1A54 A;  2P0S A;  3KEI A;  3MJN A;  4ND9 A;  4KYS A;  1NL5 A;  1MG1 A;  2F5X A;  1N84 A;  2VGQ A;  4R6H A;  2M8C A;  1I6Q A;  3TCF A;  5IZZ A;  2IEE A;  3KBR A;  2FBP A;  1NI9 A;  3PU5 A;  1B51 A;  5JTY A;  3FVK A;  3D4G A;  4RPO A;  3K1N A;  5FBP A;  1IQ7 A;  2H9B A;  4AB5 A;  2ANJ A;  1RDX A;  4GL8 A;  1MQG A;  2FA7 A;  3HN0 A;  4OWD A;  2F8D A;  5H8S A;  1B0L A;  3U72 A;  3CSB A;  4PGN A;  1TFD A;  3T22 A;  3VXB A;  3MZ1 A;  4QF9 A;  5EYH A;  4GX4 A;  1B9J A;  3CHG A;  4G68 A;  4ZZA A;  3RPW A;  3QUJ A;  3SDF A;  1P1O A;  4G8M A;  4BDM A;  4DXB A;  2Z8F A;  3RLF E;  4F1V A;  2R9J A;  1LAH E;  2I58 A;  4ISU A;  5CBS A;  4JBZ A;  2Q2C A;  1FPJ A;  3LR1 A;  4H1X A;  2WBD A;  1URS A;  4PAK A;  2QVV A;  1PDA A;  4H65 A;  4GFR A;  4H6D A;  4G8N A;  1LBX A;  4IR8 A;  1NNK A;  3C35 A;  1EU8 A;  3MPK A;  5TP9 B;  3TUS A;  2UYF A;  2IA4 A;  3B6W A;  2CEY A;  4P0G A;  4P3L A;  3MQ9 A;  3Q29 A;  4O8M A;  4OVJ A;  4OET A;  4K3F A;  3KSJ A;  3DLN A;  4H45 A;  3H6T A;  3KJT A;  4O3B A;  3C4M A;  3E4R A;  1S7Y A;  4YIC A;  4LZ5 A;  2QVR A;  3PD8 A;  1FPB A;  4N8G A;  2ONS A;  1A40 A;  1MQJ A;  4YMA A;  3PUW E;  3GZG A;  2FIE A;  2HZK A;  4HTG A;  4JXI A;  1IUD A;  2F6P A;  3TYH A;  3FXQ A;  1B3H A;  3MYU A;  5EQ9 A;  4QFP A;  1D9Y A;  5EQA A;  1DMB A;  3M3L A;  4PQJ A;  2I0B A;  5I3S A;  1M5D A;  2ZZX A;  1UIV A;  3IOV A;  2DS9 A;  3U1O A;  3MUQ A;  4GVO A;  3TEP A;  1B58 A;  3FV1 A;  2KLF A;  3N26 A;  1ZU0 A;  4GXA A;  1B1X A;  1MXX A;  2Q89 A;  4RNS A;  2ZYO A;  2OLB A;  2BJI A;  3V83 A;  1B7Z A;  3KBZ A;  3BFU A;  3V8X B;  1QGX A;  2W7Y A;  3MC2 A;  5J1D A;  3LUY A;  2F3B A;  5AA2 D;  3OEL A;  1ZMG A;  1FQB A;  1T0K A;  4MNI A;  3PPP A;  1DPP A;  4NMY A;  2QS1 A;  5ET8 A;  2XXX A;  4H5F A;  1B3E A;  3MVW A;  1FBG A;  1USY H;  2I0C A;  4PTK A;  3FAT A;  1NMU A;  2WX9 A;  1CE2 A;  4GOT A;  1QVS A;  3OO6 A;  3RPL A;  3F11 A;  1A55 A;  4XKQ A;  4G68 C;  1S9T A;  1H3D A;  1BKA A;  5DVJ A;  1PB7 A;  3M3K A;  2XXP A;  2D5W A;  5ESY A;  3D1R A;  3V89 B;  4NHB A;  2ONK E;  1EH3 A;  4FIM A;  4RK2 A;  3S9L C;  2Z22 A;  1DSN A;  1LLS A;  1PBQ A;  4U2R A;  1SQY A;  1B4H A;  3GBA A;  4M4G A;  3SEU A;  2I4C A;  2F7B A;  3UN6 A;  5TPA B;  4BDQ A;  1M5E A;  1Q35 A;  5I57 A;  1B7H A;  4OES A;  3EKI A;  3OO7 A;  3R6U A;  3PTY A;  1FTA A;  3K6U A;  2QSX A;  5EQ8 A;  1PB9 A;  2OWT A;  2OZZ A;  4GWW A;  4X8R A;  2QL3 A;  2VT5 A;  4XFE A;  2CZI A;  1MM7 A;  3G3F A;  3ZKK A;  1MDP 1;  2PX1 A;  3QUF A;  5T3J A;  2VPN A;  2Y7I A;  1MQH A;  2R8T A;  2UVJ A;  4AS5 A;  1YPN A;  1M5B A;  2HCA A;  2QJE A;  3T9V A;  5I59 A;  3OEM A;  3MP8 A;  1US4 A;  3IO6 A;  3S9N C;  2THI A;  3FAS A;  1UTH B;  4R73 A;  5A5X A;  5H8Q A;  4OFO A;  4X9T A;  1FCK A;  5M2V A;  3A09 A;  3EN3 A;  1CNQ A;  1N0T A;  4NF0 A;  5F1Q A;  4ZEC A;  4GQO A;  1FPK A;  4PDH A;  1SBP A;  4F1U A;  1LAF E;  2VD2 A;  4F29 A;  4THI A;  1JEU A;  4NWD A;  3SEV A;  1H43 A;  4NF8 B;  3C34 A;  1P1U A;  3OO8 A;  1JVY A;  3I5O A;  3KJ7 A;  4KCD A;  4I8C A;  1LAX A;  4MLQ A;  4YB6 A;  4WKM A;  1M5F A;  4KCC A;  3W9V A;  1NUW A;  3MPL A;  5I56 A;  3VLV A;  1B32 A;  3FXB A;  2ZYM A;  1POT A;  4KI0 E;  2O68 A;  1FBE A;  3G3I A;  3V5A A;  2QMW A;  1IZ1 A;  3MZB A;  3IOW A;  2UVG A;  5H8H B;  2H5Y A;  1ZJL A;  2P2A A;  3PPR A;  1MY3 A;  4IO2 A;  1I69 A;  4ZE9 A;  1LFI A;  3KN3 A;  4JVI A;  2WKY A;  3CFL A;  3IOU A;  4U1O A;  2RCB A;  3T93 B;  2NXO A;  3FD3 A;  4C1U A;  3PUZ E;  3MST A;  4F3B A;  1JW1 A;  1YAE A;  3TTN A;  2XWK A;  2PFZ A;  1LST A;  2XWV A;  4UAC A;  2QS4 A;  2V93 A;  3H3G A;  5FHN A;  3T96 B;  3EHT A;  3K6X A;  3KN8 A;  3IJX B;  3RGY A;  5ICQ A;  4LP2 B;  1JVX A;  1LB8 A;  4PE5 B;  4RPN A;  4FOR A;  1QJM A;  5AA4 B;  2F97 A;  4QFL A;  4OER A;  1LGB C;  1PBP A;  4GWS A;  3KZG A;  3CFX A;  1TT1 A;  3KC0 A;  3HHG A;  1IMB A;  3TFL A;  4NF4 A;  1Y9U A;  4HE1 A;  4P1L A;  2Q2A A;  2B4L A;  5J16 A;  3ZS6 A;  2DOJ A;  2F34 A;  3OEN A;  1FQE A;  3ISP A;  4BDO A;  1FSA A;  2NVU B;  2DVZ A;  2PCR A;  5I84 A;  3G3J A;  1XOC A;  2Y5L A;  4O3C A;  2KQZ A;  1KA1 A;  4F3P A;  3Q25 A;  4ZEF A;  4MHF A;  5KDT B;  4NAP A;  3LV0 A;  1PB8 A;  4HE2 A;  4MNP A;  4R9F A;  3WAE A;  4POX A;  1AMF A;  1Y3N A;  1LBB A;  1IIW A;  3U8Q A;  4JWY A;  3TDJ A;  5K2X A;  5CM6 A;  3SET A;  5EHM A;  2DYX A;  5A5L A;  3GLB A;  3KFM A;  3KG2 A;  1O63 A;  1FTM A;  3K01 A;  1JW4 A;  3VV5 A;  3G3K A;  4R6Y A;  3SES A;  2PT2 A;  1AWB A;  2WYK A;  1VFD A;  1TWY A;  3K0V A;  3EQ1 A;  1XVX A;  3C32 A;  3UOR A;  4EQ7 A;  1FJ6 A;  1SPI A;  1LCF A;  3Q27 A;  4QRZ A;  4YAH X;  1MXU A;  4ZE8 A;  2PMS A;  3H7M A;  3QK6 A;  3RQT A;  5IZ1 A;  4ELQ A;  1G0H A;  1DOT A;  3IAZ A;  4DI4 B;  4R6K A;  2ZNT A;  2WYP A;  5H8F A;  2ESN A;  3QMF A;  1PEB A;  2VHA A;  4PDD A;  1OIB A;  3IB2 A;  3MP6 A;  4FEB A;  4NF6 A;  4TLM B;  3ZSF A;  4PFT A;  4IB2 A;  3S9E A;  2QS3 A;  1FQA A;  2XXU A;  2O1M A;  1LBY A;  4H8I A;  5ICT A;  2DQV A;  2V3U A;  4IGT A;  5DEX A;  4PET A;  4NWC A;  4KPT A;  1LBV A;  3R7X A;  3FGS A;  2DE3 A;  3K6V A;  5ISU A;  3FXU A;  1AL3 A;  3VVE A;  1MRP A;  1FQD A;  4YMB A;  3MVY A;  1GV8 A;  4ONY A;  4R74 A;  5IM2 A;  5EYG A;  1S50 A;  1OLA A;  2R6G E;  4OVP A;  4WEP A;  1NV6 A;  3KN7 A;  3FXR A;  2VD3 A;  4YKK A;  3ROJ A;  1JET A;  2G29 A;  1Q1K A;  3ECR A;  3O2A A;  3B50 A;  1B5I A;  1MPB A;  5AA1 A;  1N7X A;  1NH7 A;  4G68 B;  3PGF A;  1MQI A;  2ZYK A;  1DBZ A;  3CG3 A;  3KSX A;  4GD5 A;  3U92 A;  4N17 A;  4RY1 A;  3TTR A;  2VOZ A;  2Z23 A;  3DP6 A;  2LAO A;  5L9S A;  1KWH A;  1NNF A;  4JVD A;  2I48 A;  5BUU A;  1MPC A;  2RCA A;  4DIG A;  4XKP A;  4X1B A;  1D3K A;  1ZTY A;  4JB7 A;  3H03 A;  3SEX A;  4JWX A;  4NF5 A;  3K00 A;  2QS2 A;  4IO7 A;  1H45 A;  3SER A;  1B4Z A;  4H5G A;  4OAN A;  4X04 A;  3QXM A;  2I3V A;  3RTW B;  1MH3 A;  5JEI A;  5ITO A;  4AQ4 A;  2FNC A;  4F2O A;  1EYI A;  2O51 A;  2DWA A;  5TU0 A;  3TTM A;  1MS7 A;  2RIN A;  3CI8 A;  4ZEK A;  2XHD A;  2A5T A;  4MCO A;  1FBD A;  4Q0C A;  2Q8M A;  2HXW A;  3OMB A;  3O29 A;  2HFB A;  3DEL B;  1NUY A;  1SW2 A;  2XXW A;  2XXV A;  3QIM A;  2OWS A;  1YZ0 A;  1INP A;  1YTV A;  4N6D A;  4P11 A;  3TMG A;  4EXL A;  2ZYN A;  1IMA A;  1Y1Z A;  3B6Q A;  3MBP A;  3FVO A;  4HW8 A;  1BIY A;  1Y20 A;  1NNT A;  1A8F A;  2X26 A;  5HBC A;  4RJZ A;  1POY 1;  1Y1M A;  2B4M A;  4X1D A;  5I2N A;  2KR0 A;  2ABH A;  2DXY A;  2OX3 A;  1UTB A;  1MH4 A;  4WXJ A;  4KR5 A;  1DK4 A;  4F22 A;  3FZV A;  5FHM A;  5ELV A;  5DVF A;  2Y7R A;  1XI6 A;  2NOO A;  3S9M C;  4QSD A;  3T9H B;  4Q5T A;  3BBR A;  4Z0I A;  3E78 A;  1R9L A;  5KCJ A;  5CRY A;  2FHY A;  4DDD A;  2Y5K A;  4ESW A;  1HSJ A;  1Y3P A;  1EZO A;  4NE4 A;  2I3W A;  1MPD A;  4Q8R A;  2XXH A;  4MAG A;  3RYD A;  4F18 A;  4RK9 A;  2REJ A;  4N07 A;  4IGR A;  3N6U A;  4NGU A;  4MH5 A;  3DM0 A;  1URD A;  3QSL A;  5LTC A;  2HPG A;  4XKR A;  1R6Z A;  3O6I A;  3SZP A;  4H0W A;  2V84 A;  3OXN A;  1B5H A;  2ZZV A;  4N15 A;  1P1W A;  4I3Y A;  3LC8 A;  4GL0 A;  3MP1 A;  2F6G A;  1NV5 A;  2PVU A;  2FYI A;  3VXC A;  1JEV A;  3GYY A;  3RPL B;  2OK2 A;  1FPI A;  3PPN A;  1KA0 A;  5CI5 A;  4EXK A;  1FPE A;  1XHY A;  1GGG A;  3IX1 A;  2OWZ A;  1ZBM A;  1DPE A;  2B65 A;  5IAI A;  1OQH A;  1B2H A;  2XX7 A;  3MAM A;  4MEV A;  5CBR A;  2F3D A;  3IK6 B;  3MWB A;  2QPQ A;  2RKM A;  2WEF A;  2O6A A;  3PMV A;  4N4U A;  2X7Q A;  4WED A;  5EYF A;  1FJ9 A;  2DXR A;  2ZNS A;  1UIU A;  2Y7K A;  4M1V A;  4PAF A;  2A5S A;  3SEW A;  2DWJ A;  5I57 B;  1QKA A;  2D21 A;  3IB0 A;  3ZKL A;  2XA5 A;  1FPL A;  2I4B A;  1II5 A;  2DVC A;  5I2K A;  4HE0 A;  4EUO A;  4MLV A;  3TZA A;  4F2Q A;  3PUV E;  4ZEB A;  4PFB A;  3W15 C;  3RUM A;  4JWO A;  4U4X A;  4GXS B;  2YPN A;  1MQD A;  3GBB A;  2GFE A;  5IGA A;  3DP8 A;  5I59 B;  1BLF A;  2H4I A;  2Z8D A;  4PAI A;  1GTK A;  3IJO B;  3NOH A;  4OXV A;  4U23 A;  5A5X B;  5H8Q B;  4QFO A;  5I58 A;  1MXY A;  4IO4 A;  1NV7 A;  3CR9 A;  1YXI A;  4ZEI A;  3TEL A;  4QHQ A;  4NED A;  1MDQ A;  4GWZ A;  4H46 A;  5LOM A;  1LFH A;  4GBW A; 
#chains in the Genus database with same CATH homology
 4OTE A;  4F19 A;  3VLU A;  4GWO A;  4ESX A;  1Y4T A;  4OYV A;  4F1Y A;  4ELO A;  2CMO A;  3OO9 A;  4EF2 A;  4F3S A;  3B7D A;  3RT8 A;  1FTK A;  2F7A A;  1EZP A;  3K6W A;  4POW A;  5I56 B;  4OEN A;  3QAX A;  3G7W A;  2RC9 A;  1VE4 A;  5CMK A;  2XXR A;  3RT6 B;  5CMC A;  3G3G A;  2P1S A;  1B5J A;  2H99 A;  2GRV A;  3Q28 A;  1Y4C A;  2GHA A;  1ATG A;  3I3V A;  5EHS A;  4AB6 A;  1BP5 A;  3LSF B;  4ZS9 A;  3RTF B;  5ITP A;  1Y3Q A;  3SKP A;  5L9M A;  1DTG A;  2Y84 A;  2Z8E A;  1GR2 A;  1P1N A;  1B7U A;  3LBS A;  3T9U A;  2NWJ A;  3U94 A;  3WAF A;  3HO7 A;  3PMX A;  3HCQ A;  3P7I A;  3O66 A;  5FTI A;  3LSX A;  4U1Z A;  2DSF A;  4OQO A;  2UVI A;  3CG1 A;  1B6H A;  1QUL A;  3C36 A;  2NUV A;  4OZ9 A;  5KZT A;  3C33 A;  1MM6 A;  3HST A;  3PV0 E;  1B52 A;  4HCY A;  2AL5 A;  1I6A A;  4U21 A;  4DCY A;  1A99 A;  5L9O A;  3FJ7 A;  4TLL B;  3MVX A;  4NF4 B;  3LSW A;  1XT8 A;  4YZZ A;  3FVG A;  3THI A;  2HZL A;  4C0R A;  4FEC A;  1B46 A;  2B3F A;  3ILT B;  3CFZ A;  3FV2 A;  4FJP A;  2F78 A;  3IO4 A;  1US5 A;  3VE1 B;  1SW1 A;  2E0S A;  4GRK A;  1OVT A;  4R2B A;  1QUI A;  1NH8 A;  4I62 A;  1FQC A;  3TPA A;  3EHS A;  4DCX A;  3H4Z A;  1ELJ A;  2XXI A;  1SVX B;  3CRB A;  1B40 A;  3IR1 A;  3HHF A;  5H8N A;  4XTC Q;  4F3G A;  3PUY E;  4F39 A;  5AA2 A;  1MXV A;  4Z7E A;  4HCW A;  4YKJ A;  1FTO A;  5BWJ A;  5DT6 A;  3CIJ A;  1SYI A;  4ZDM A;  4LZ7 A;  2UYE A;  1OQG A;  1FTJ A;  1SDX A;  3OOA A;  4H67 A;  1LAG E;  4YB5 A;  3E9X A;  3T9X B;  2REG A;  5FHO A;  1SD3 A;  5HM4 B;  1RYX A;  4IO3 A;  1SYH A;  4OFL A;  5H8F B;  4F31 B;  3TCH A;  4GF8 A;  3D4C A;  4NF6 B;  4H8J A;  3TTL A;  4R72 A;  3LSL A;  2HAV A;  4PFU A;  4LUB A;  5DEX B;  2R71 A;  4I9D A;  1L5T A;  1VR5 A;  5JTY B;  1QKB A;  2F35 A;  4LZ8 A;  3TCG A;  3PPQ A;  3O97 A;  5CC2 A;  1LBC A;  3TOD A;  1USY E;  4GIZ A;  1XC1 A;  2OCU A;  4BDR A;  3O6H A;  1SI0 A;  2DP8 A;  2GH9 A;  2Q9T A;  2Y7P A;  2O1L A;  4TOZ A;  1SW5 A;  3M8U A;  4FED A;  5DVI A;  2V3T A;  3MVZ A;  1B3F A;  2H98 A;  5AE4 A;  1LCT A;  1HSE A;  4LQ5 A;  3EF7 A;  4NF5 B;  4G2Z A;  5TP9 A;  1URG A;  3AXF A;  3N94 A;  5HPQ A;  2QRY A;  1FQF A;  3O6G A;  1R1N A;  5AA3 A;  1IEJ A;  3MW0 A;  1NKX A;  1SI1 A;  1SW4 A;  1N76 A;  3VVD A;  1F9B A;  2XXQ A;  1ZIU A;  3JV9 A;  2A5T B;  2DWI A;  3B6T A;  1B0H A;  4G77 A;  3UA8 A;  4JSO A;  3O28 A;  2D3I A;  1P1Q A;  3H6U A;  1OLC A;  4DZ1 A;  2H25 A;  3W9W A;  4BDL A;  3N5L A;  4EDP A;  1IXG A;  5DTB A;  2XD3 A;  1I6B A;  3KGC A;  5B7D A;  1LB9 A;  3KOT A;  4EF1 A;  1XS5 A;  1AIV A;  1MY0 A;  3OSQ A;  1N3W A;  1WVJ A;  1B05 A;  3VFJ A;  4Q30 B;  2UXA A;  4KFQ A;  5I2N B;  2HAU A;  3Q26 A;  1MXZ A;  4ECF A;  1UTB B;  4KQP A;  3GXA A;  1JQF A;  3VDF A;  1PC3 A;  2QMX A;  1M5C A;  3TKD A;  3RY3 A;  4JDF A;  4XKN A;  2RC8 A;  1MXW A;  2ZNU A;  1UQW A;  1H76 A;  4OFJ A;  3A3C A;  2GHB A;  1O7T A;  2XXT A;  4KYE A;  1TFA A;  5KCJ B;  3RNN A;  2I6E A;  1TXF A;  1VSO A;  4IY5 A;  4XIG Q;  1N3X A;  4EQB A;  3TQW A;  3I6V A;  3TQL A;  3H06 B;  4FE8 A;  4NTL A;  3PMW A;  2CZL A;  1MY1 A;  2YLN A;  3G3H A;  1RYO A;  4RXL A;  4LQ2 A;  2AYS A;  2ALU A;  4DE8 A;  2XX8 A;  3UGW A;  3K2D A;  4U4S A;  2V25 A;  2Q88 A;  5CMB A;  3JYR A;  3L6H A;  1B3L A;  2XD2 A;  1D4N A;  2V3Q A;  1ANF A;  3QYT A;  2ZXT A;  2HEU A;  1JNF A;  3ONM A;  4MFI A;  4ZZE A;  5TPA A;  4LVQ A;  3VLW A;  4O3A A;  3DP4 A;  4RA1 A;  3K1P A;  1N04 A;  3K4U A;  4ZED A;  4U22 A;  2I49 A;  3UK4 A;  1N7W A;  4G8H A;  3S2V A;  4QSC A;  3IB1 A;  3UIF A;  5I2K B;  1CB6 A;  1B1H A;  3K02 A;  3M3F A;  4X48 A;  1JW5 A;  3C31 A;  3IOR A;  3A3U A;  3BFT A;  2DWH A;  1Z7M E;  3OSR A;  4PP0 A;  1QUJ A;  1UTH A;  4C1T A;  2Q8J A;  1IXC A;  2AIX A;  4KD5 A;  3FJM A;  5I58 B;  5K2Y A;  1XVY A;  3U93 A;  5JK4 A;  4MBP A;  3T66 A;  4RYA A;  4HS7 A;  3IL1 B;  4NF8 A;  1B3G A;  1QUK A;  1HSL A;  5F7V A;  4G4P A;  1FTL A;  1AOV A;  3KOS A;  4OEV A;  3S4U A;  4EQ9 A;  3O9P A;  1YCJ A;  2ONR A;  4DLD A;  5DYH A;  1WOD A;  2B3B A;  4TQU Q;  3JZJ A;  3R26 A;  4XXU A;  4R9G A;  4OMB A;  5FTH A;  4DXU A;  1O64 A;  1R9Q A;  2ZMB A;  1IXH A;  3FVN A;  1QW0 A;  3C9H A;  3RN8 A;  2UVH A;  3SEY A;  4LA9 A;  2AL4 A;  1ZKB A;  3FUZ A;  5H8H A;  1AH5 A;  4I1D A;  4QSE A;  3MZ9 A;  1DTZ A;  3H6W A;  4IO5 A;  3HV1 A;  3VVF A;  3EHU A;  2YJP A;  1IXI A;  1A7L A;  1A8E A;  1ZLQ A;  1NFT A;  2XXY A;  1FW0 A;  3TTK A;  2PT1 A;  1WDN A;  3PUX E;  2F36 A;  3OEK A;  5IKB A;  2DE4 A;  4KYD A;  1NNP A;  4PFY A;  4PFW A;  5AA4 A;  2O7I A;  2BJJ X;  2X7P A;  1D9V A;  4E0W A;  4OEU A;  1BTJ A;  2HQ0 A;  4MF3 A;  4FAT A;  4QFK A;  4L17 A;  1IIT A;  5L8D A;  4YKI A;  1RKM A;  2G93 A;  3CSG A;  4UA8 A;  1P99 A;  4YB7 A;  2O7U A;  3FJG A;  4GLI A;  4R2F A;  3HPI A;  1OVB A;  2VP1 A;  1J1N A;  4LAT A;  4P0I A;  3K1M A;  3TAJ A;  5KDT A;  4R75 A;  3USD A;  3EPE A;  2O69 A;  3E3K A;  5CMM A;  4QFN A;  2RC7 A;  1MY2 A;  4BLA A;  3OD7 A;  3N6T A;  1H44 A;  5H8N B;  5B70 A;  2O84 X;  4IO6 A;  4OHN A;  4IY6 A;  1VFE A;  5AA2 B;  2DE2 A;  2F7C A;  2Y7W A;  2PBW A;  3H6V A;  1OMP A;  4YKP A;  3L6G A;  4ELR A;  1LFG A;  2RF1 A;  3ODB A;  3BKI B;  1Z7N E;  4N6P A;  3FIR A;  3UP9 A;  3IOT A;  3ILU B;  3PD9 A;  4JSD A;  1MY4 A;  4FAJ A;  4E0X A;  4DXC A;  4LON B;  2PYY A;  3E13 X;  4N13 A;  1EZ9 A;  4YU0 A;  2OJT A;  4ELP A;  4BDN A;  2E1S A;  4KHZ E;  3CVG A;  2XX9 A;  2OBG A;  3PPO A;  1GVC A;  1A54 A;  2P0S A;  3KEI A;  3MJN A;  4ND9 A;  4KYS A;  1NL5 A;  1MG1 A;  2F5X A;  1N84 A;  2VGQ A;  4R6H A;  2M8C A;  1I6Q A;  3TCF A;  2IEE A;  3KBR A;  3PU5 A;  1B51 A;  5JTY A;  3FVK A;  3D4G A;  4RPO A;  3K1N A;  1IQ7 A;  2H9B A;  4AB5 A;  2ANJ A;  4GL8 A;  1MQG A;  2FA7 A;  3HN0 A;  4OWD A;  2F8D A;  5H8S A;  1B0L A;  3U72 A;  3CSB A;  1TFD A;  3T22 A;  3VXB A;  3MZ1 A;  4QF9 A;  1B9J A;  4G68 A;  4ZZA A;  3RPW A;  3QUJ A;  3SDF A;  1P1O A;  4G8M A;  4BDM A;  4DXB A;  2Z8F A;  3RLF E;  4F1V A;  2R9J A;  1LAH E;  2I58 A;  4ISU A;  5CBS A;  4JBZ A;  2Q2C A;  3LR1 A;  4H1X A;  1URS A;  1PDA A;  4H65 A;  4GFR A;  4H6D A;  4G8N A;  1NNK A;  3C35 A;  1EU8 A;  3MPK A;  5TP9 B;  3TUS A;  2UYF A;  2IA4 A;  3B6W A;  4P0G A;  3MQ9 A;  3Q29 A;  4OVJ A;  4OET A;  4K3F A;  3KSJ A;  3DLN A;  3H6T A;  3KJT A;  4O3B A;  3C4M A;  3E4R A;  1S7Y A;  4YIC A;  4LZ5 A;  3PD8 A;  2ONS A;  1A40 A;  1MQJ A;  4YMA A;  3PUW E;  3GZG A;  2HZK A;  4HTG A;  4JXI A;  1IUD A;  2F6P A;  3TYH A;  3FXQ A;  1B3H A;  4QFP A;  1D9Y A;  1DMB A;  3M3L A;  4PQJ A;  2I0B A;  1M5D A;  1UIV A;  3IOV A;  2DS9 A;  3U1O A;  3MUQ A;  4GVO A;  3TEP A;  1B58 A;  3FV1 A;  2KLF A;  3N26 A;  1ZU0 A;  4GXA A;  1B1X A;  1MXX A;  2Q89 A;  4RNS A;  2ZYO A;  2OLB A;  3V83 A;  1B7Z A;  3BFU A;  3V8X B;  2W7Y A;  3MC2 A;  5J1D A;  3LUY A;  5AA2 D;  3OEL A;  1ZMG A;  1FQB A;  1T0K A;  3PPP A;  1DPP A;  4NMY A;  2QS1 A;  2XXX A;  4H5F A;  1B3E A;  3MVW A;  1USY H;  2I0C A;  3FAT A;  1NMU A;  1CE2 A;  4GOT A;  1QVS A;  3OO6 A;  3F11 A;  1A55 A;  4XKQ A;  4G68 C;  1S9T A;  1H3D A;  1BKA A;  5DVJ A;  1PB7 A;  3M3K A;  2XXP A;  2D5W A;  3V89 B;  2ONK E;  1EH3 A;  4FIM A;  4RK2 A;  3S9L C;  2Z22 A;  1DSN A;  1LLS A;  1PBQ A;  4U2R A;  1SQY A;  1B4H A;  3GBA A;  4M4G A;  3SEU A;  2I4C A;  2F7B A;  3UN6 A;  5TPA B;  4BDQ A;  1M5E A;  1Q35 A;  5I57 A;  1B7H A;  4OES A;  3OO7 A;  3R6U A;  3K6U A;  2QSX A;  1PB9 A;  2OWT A;  2OZZ A;  2QL3 A;  1MM7 A;  3G3F A;  3ZKK A;  1MDP 1;  2PX1 A;  3QUF A;  2Y7I A;  1MQH A;  2UVJ A;  1YPN A;  1M5B A;  2HCA A;  2QJE A;  3T9V A;  5I59 A;  3OEM A;  3MP8 A;  1US4 A;  3IO6 A;  3S9N C;  2THI A;  3FAS A;  1UTH B;  4R73 A;  5A5X A;  5H8Q A;  4OFO A;  4X9T A;  1FCK A;  5M2V A;  3A09 A;  3EN3 A;  1N0T A;  5F1Q A;  4ZEC A;  4GQO A;  1SBP A;  4F1U A;  1LAF E;  2VD2 A;  4F29 A;  4THI A;  1JEU A;  4NWD A;  3SEV A;  1H43 A;  4NF8 B;  3C34 A;  1P1U A;  3OO8 A;  1JVY A;  3I5O A;  3KJ7 A;  4KCD A;  4I8C A;  1LAX A;  4MLQ A;  4YB6 A;  4WKM A;  1M5F A;  4KCC A;  3W9V A;  3MPL A;  5I56 A;  3VLV A;  1B32 A;  2ZYM A;  1POT A;  4KI0 E;  2O68 A;  3G3I A;  3V5A A;  2QMW A;  1IZ1 A;  3MZB A;  3IOW A;  2UVG A;  5H8H B;  2H5Y A;  1ZJL A;  2P2A A;  3PPR A;  1MY3 A;  4IO2 A;  1I69 A;  4ZE9 A;  1LFI A;  3KN3 A;  2WKY A;  3CFL A;  3IOU A;  4U1O A;  2RCB A;  3T93 B;  2NXO A;  3FD3 A;  4C1U A;  3PUZ E;  4F3B A;  1JW1 A;  1YAE A;  3TTN A;  1LST A;  4UAC A;  2QS4 A;  2V93 A;  3H3G A;  5FHN A;  3T96 B;  3EHT A;  3K6X A;  3KN8 A;  3IJX B;  3RGY A;  5ICQ A;  4LP2 B;  1JVX A;  1LB8 A;  4PE5 B;  4RPN A;  4FOR A;  1QJM A;  5AA4 B;  2F97 A;  4QFL A;  4OER A;  1LGB C;  1PBP A;  3KZG A;  3CFX A;  1TT1 A;  3HHG A;  3TFL A;  4NF4 A;  1Y9U A;  2Q2A A;  3ZS6 A;  2DOJ A;  2F34 A;  3OEN A;  1FQE A;  4BDO A;  2NVU B;  2DVZ A;  5I84 A;  3G3J A;  1XOC A;  4O3C A;  4F3P A;  3Q25 A;  4ZEF A;  5KDT B;  1PB8 A;  4R9F A;  3WAE A;  4POX A;  1AMF A;  1Y3N A;  1LBB A;  1IIW A;  3U8Q A;  4JWY A;  3TDJ A;  5K2X A;  5CM6 A;  3SET A;  5EHM A;  2DYX A;  3GLB A;  3KFM A;  3KG2 A;  1O63 A;  1FTM A;  3K01 A;  1JW4 A;  3VV5 A;  3G3K A;  4R6Y A;  3SES A;  2PT2 A;  1VFD A;  1TWY A;  3K0V A;  3EQ1 A;  1XVX A;  3C32 A;  3UOR A;  4EQ7 A;  1LCF A;  3Q27 A;  4QRZ A;  4YAH X;  1MXU A;  4ZE8 A;  2PMS A;  3H7M A;  3QK6 A;  3RQT A;  4ELQ A;  1DOT A;  3IAZ A;  4R6K A;  2ZNT A;  5H8F A;  2ESN A;  1PEB A;  2VHA A;  1OIB A;  3IB2 A;  3MP6 A;  4FEB A;  4NF6 A;  4TLM B;  3ZSF A;  4PFT A;  4IB2 A;  3S9E A;  2QS3 A;  1FQA A;  2XXU A;  2O1M A;  4H8I A;  5ICT A;  2DQV A;  2V3U A;  4IGT A;  5DEX A;  4PET A;  4NWC A;  4KPT A;  3R7X A;  3FGS A;  2DE3 A;  3K6V A;  5ISU A;  3FXU A;  1AL3 A;  3VVE A;  1MRP A;  1FQD A;  4YMB A;  3MVY A;  1GV8 A;  4ONY A;  4R74 A;  1S50 A;  1OLA A;  2R6G E;  4WEP A;  3KN7 A;  3FXR A;  2VD3 A;  4YKK A;  1JET A;  2G29 A;  1Q1K A;  3ECR A;  3O2A A;  1B5I A;  1MPB A;  5AA1 A;  1N7X A;  1NH7 A;  4G68 B;  3PGF A;  1MQI A;  2ZYK A;  3CG3 A;  3KSX A;  4GD5 A;  3U92 A;  4RY1 A;  3TTR A;  2VOZ A;  2Z23 A;  3DP6 A;  2LAO A;  5L9S A;  1KWH A;  1NNF A;  2I48 A;  5BUU A;  1MPC A;  2RCA A;  4DIG A;  4XKP A;  4X1B A;  1D3K A;  1ZTY A;  4JB7 A;  3H03 A;  3SEX A;  4JWX A;  4NF5 A;  3K00 A;  2QS2 A;  4IO7 A;  1H45 A;  3SER A;  1B4Z A;  4H5G A;  3QXM A;  2I3V A;  3RTW B;  1MH3 A;  5JEI A;  5ITO A;  4AQ4 A;  2FNC A;  4F2O A;  2O51 A;  2DWA A;  5TU0 A;  3TTM A;  1MS7 A;  2RIN A;  3CI8 A;  4ZEK A;  2XHD A;  2A5T A;  4Q0C A;  2HXW A;  3OMB A;  3O29 A;  2HFB A;  3DEL B;  1SW2 A;  2XXW A;  2XXV A;  3QIM A;  2OWS A;  1YTV A;  4P11 A;  3TMG A;  4EXL A;  2ZYN A;  1Y1Z A;  3B6Q A;  3MBP A;  3FVO A;  4HW8 A;  1BIY A;  1Y20 A;  1NNT A;  1A8F A;  2X26 A;  5HBC A;  4RJZ A;  1POY 1;  1Y1M A;  4X1D A;  5I2N A;  2ABH A;  2DXY A;  1UTB A;  1MH4 A;  4WXJ A;  4KR5 A;  4F22 A;  3FZV A;  5FHM A;  5ELV A;  5DVF A;  2Y7R A;  2NOO A;  3S9M C;  4QSD A;  3T9H B;  4Q5T A;  3BBR A;  4Z0I A;  1R9L A;  5KCJ A;  5CRY A;  4DDD A;  4ESW A;  1HSJ A;  1Y3P A;  1EZO A;  4NE4 A;  2I3W A;  1MPD A;  4Q8R A;  2XXH A;  4F18 A;  4RK9 A;  2REJ A;  4N07 A;  4IGR A;  3N6U A;  4MH5 A;  3DM0 A;  1URD A;  3QSL A;  4XKR A;  1R6Z A;  3O6I A;  4H0W A;  2V84 A;  3OXN A;  1B5H A;  1P1W A;  3LC8 A;  4GL0 A;  3MP1 A;  2F6G A;  2PVU A;  2FYI A;  3VXC A;  1JEV A;  2OK2 A;  3PPN A;  5CI5 A;  4EXK A;  1XHY A;  1GGG A;  3IX1 A;  1ZBM A;  1DPE A;  2B65 A;  5IAI A;  1OQH A;  1B2H A;  2XX7 A;  3MAM A;  5CBR A;  3IK6 B;  3MWB A;  2QPQ A;  2RKM A;  3PMV A;  2O6A A;  4WED A;  5EYF A;  2X7Q A;  2DXR A;  2ZNS A;  1UIU A;  2Y7K A;  4M1V A;  2A5S A;  3SEW A;  2DWJ A;  5I57 B;  1QKA A;  2D21 A;  3IB0 A;  3ZKL A;  2I4B A;  1II5 A;  2DVC A;  5I2K A;  4EUO A;  4MLV A;  3TZA A;  4F2Q A;  3PUV E;  4ZEB A;  3W15 C;  3RUM A;  4JWO A;  4U4X A;  4GXS B;  2YPN A;  1MQD A;  3GBB A;  2GFE A;  3DP8 A;  5I59 B;  1BLF A;  2H4I A;  2Z8D A;  1GTK A;  3IJO B;  4OXV A;  4U23 A;  5A5X B;  5H8Q B;  4QFO A;  5I58 A;  1MXY A;  4IO4 A;  3CR9 A;  4ZEI A;  3TEL A;  4QHQ A;  4NED A;  1MDQ A;  5LOM A;  1LFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...