3FJGA

Crystal structure of 3pg bound peb3
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
231
structure length
231
Chain Sequence
DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity of Campylobacter jejuni adhesin PEB3 for phosphates and structural differences among its ligand complexes.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
molecule keywords Major antigenic peptide PEB3
total genus 82
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fjgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fjgA02
2O7UA 3E9XA 3H3GA 3LSFB 4JWOA 3FUZA 3U8QA 1F9BA 3CFXA 4DE8A 2QJEA 1FTKA 1FTOA 3OEKA 3TTRA 3PPRA 3VLUA 3QUFA 3PUVE 4YKKA 2D5WA 3U72A 4Z7EA 1JNFA 1FW0A 1SW1A 1B1XA 1MPBA 3HHFA 1ELJA 3S9MC 3EQ1A 4G68B 2I0CA 4KCCA 4NF8A 2XHDA 4IGRA 1H43A 3K2DA 3TODA 4JSDA 4NF6B 1N7WA 1OQHA 1XS5A 2DXRA 4GOTA 3QUJA 3VXCA 5IKBA 4MLQA 4F18A 3B6WA 1S50A 4GIZA 4ZEIA 4HS7A 1OVTA 4X1BA 4DLDA 1Y3PA 1OIBA 4H6DA 4I9DA 1B52A 1B46A 4HW8A 2OJTA 1M5DA 4LVQA 5F7VA 2HAUA 2XX8A 5CMMA 2ZNSA 1A8FA 3PPPA 4PFWA 2Y7PA 1ANFA 5FHOA 2A5SA 4ESWA 4C1UA 1WODA 3FV1A 3C34A 4F39A 3D4GA 2O51A 2ZMBA 5FHNA 2I3WA 1EH3A 4JXIA 3I3VA 4OTEA 5ELVA 3KSJA 4NE4A 3USDA 2H9BA 1URGA 4NF5A 3QXMA 3VXBA 3K02A 1Y4CA 2Z8DA 4OERA 4U4SA 3VDFA 3CFZA 3ZS6A 1R9QA 2D3IA 3CSBA 4L17A 5DVFA 5EYFA 5H8FB 1EZPA 4HTGA 2DWIA 4WXJA 3TQLA 5L9OA 5BWJA 4O3AA 1LSTA 1MXXA 3THIA 4NF5B 2XXUA 1JEVA 2QS4A 4RY1A 3VVEA 5IAIA 3IR1A 1B9JA 4TQUQ 4R2FA 1USYH 1IXIA 1SI0A 1PBQA 3C35A 3U93A 2GHAA 2HFBA 4ESXA 3PPOA 4OFOA 5KCJA 2B3BA 2QL3A 5CMKA 2ZYKA 1LLSA 3DP6A 1JVXA 3UP9A 1JQFA 1B51A 1LAFE 1FQDA 1P1QA 1LFHA 3TEPA 4NWCA 3RT6B 3VV5A 3JYRA 3S2VA 1AMFA 4H65A 1B3FA 1MQJA 2OK2A 3PPQA 3DLNA 1MXUA 3GXAA 1RYXA 1EU8A 2ESNA 4N6PA 3K6WA 5DVIA 5DT6A 5CMBA 4BDMA 4BDOA 1A99A 3HO7A 3FVOA 2DE2A 2CMOA 4NTLA 3FGSA 3K1PA 3CG3A 4IB2A 2R6GE 3IOVA 1PBPA 2ZNTA 4GVOA 5CC2A 5J1DA 1KWHA 3PMWA 1OQGA 3LSLA 4RJZA 1MRPA 2XX7A 4IO3A 4ZDMA 1TXFA 3G7WA 3FV2A 4XKQA 1B3LA 3MVXA 4O3BA 2X7QA 3N26A 2D21A 3T9UA 4G8NA 3IOTA 2XXWA 1N3XA 2YJPA 1A7LA 3CR9A 3KN3A 3MAMA 4FECA 4GLIA 4LA9A 4WKMA 1UIVA 1YCJA 2B65A 4FORA 4Z0IA 1AOVA 1JW4A 1SVXB 4JB7A 3SEWA 3RT8A 3V89B 2OLBA 2VOZA 4PFYA 2REJA 4MLVA 1PB8A 2Y84A 3DELB 4ZEFA 4RNSA 5AA2D 1JW1A 1B7UA 3KEIA 4K3FA 1US4A 1SYHA 1XC1A 3BFTA 1B7ZA 3E13X 5EHMA 3MBPA 1HSEA 3H6VA 4U4XA 2GRVA 3LC8A 4BLAA 4JWYA 4OFJA 4RPNA 2DWHA 2P0SA 3HPIA 1BLFA 3W9WA 1DTGA 4EQ9A 1B1HA 3O66A 3UA8A 1II5A 2V25A 1LGBC 3IOUA 1IXHA 2F35A 1Y20A 4NF8B 2HZKA 3QK6A 5I56A 3ZKKA 1ZIUA 2I58A 3FZVA 3KOSA 3LSXA 1MDQA 4F2QA 1GV8A 4R72A 3FVKA 3FJGA 3KBRA 3O6HA 4GWOA 4OMBA 3N6UA 5CBSA 1IZ1A 3H06B 3CIJA 3TELA 3SDFA 4RYAA 4XXUA 3E4RA 2DWAA 4F1VA 4TLMB 4F31B 3FD3A 4GRKA 4QSCA 5DTBA 1GVCA 3C36A 3I6VA 3OMBA 5H8QB 1SBPA 2HXWA 4PQJA 4Q5TA 1XT8A 2F5XA 5KDTA 1B58A 2KLFA 4LZ7A 1LCFA 5I57B 5EHSA 1ZTYA 3IOWA 4H0WA 5I84A 4R6YA 5JTYA 2H25A 1Y9UA 2I6EA 4ZS9A 3H03A 3MJNA 3WAFA 3LBSA 2CZLA 3ILUB 1L5TA 5H8QA 4LZ8A 1P1NA 4LQ2A 2Y7WA 1ZLQA 5HM4B 1D9VA 2UVJA 3EPEA 5H8FA 4GQOA 3H7MA 3S9LC 3ONMA 2G29A 1XVYA 4OWDA 4U1ZA 4THIA 4GXAA 2QS2A 3O28A 4ZEBA 3E3KA 3IX1A 4E0WA 1DTZA 1MY2A 1POY1 2B3FA 2YLNA 3O6GA 4JDFA 1MY1A 3MVYA 5AA2B 1NL5A 2OWTA 4I1DA 4KFQA 4KQPA 3SETA 3OEMA 1AIVA 2OBGA 3CFLA 3RLFE 2O68A 3EHUA 1MH3A 2VD3A 1S9TA 5F1QA 2PMSA 4C0RA 3IJXB 2I48A 5K2XA 3N5LA 4HCYA 3G3JA 5KDTB 3PUYE 2HAVA 2DE3A 4R75A 2ONRA 3HV1A 1JW5A 1M5EA 2XXTA 3HN0A 3I5OA 3MZ1A 3KN7A 4IO2A 4U1OA 3RN8A 3SEVA 3UN6A 4U23A 1O7TA 2LAOA 3G3GA 1JEUA 4FJPA 2Y7RA 3S9EA 4F3BA 3DP4A 2AL4A 3HSTA 4P0IA 3C31A 1ZBMA 4DXUA 5CM6A 5H8SA 1YPNA 3U92A 3KFMA 1A40A 1QKBA 3MZBA 1LAHE 3C32A 1MS7A 2DE4A 4H5GA 3VVDA 2Y7KA 3TCGA 3HCQA 4G68C 4EF2A 3MP8A 4LP2B 1MPCA 1Z7NE 1LB9A 4IO5A 3IORA 1VSOA 2M8CA 3K6VA 3KOTA 1CE2A 3EN3A 2R71A 4H1XA 3F11A 4F3SA 2ABHA 1P1OA 3QSLA 4KYSA 2H99A 4JBZA 3VE1B 3EHSA 1FCKA 3FVNA 3PD8A 3OENA 4AQ4A 2XX9A 4BDLA 1MY3A 3O97A 5JEIA 4YMAA 4QFNA 5BUUA 1H44A 4GF8A 3OXNA 2IA4A 4LQ5A 4TOZA 1B0LA 4DIGA 3OD7A 1NFTA 2IEEA 4H8JA 4R9FA 4DZ1A 4IY5A 4QSEA 2WKYA 1MXYA 1MDP1 2NOOA 2O1MA 4IY6A 3IAZA 1QUKA 1VR5A 3K1MA 1IXCA 1I6QA 4FIMA 2A5TB 5DEXA 2RC8A 3RGYA 1FTLA 1B2HA 2QS1A 5H8HA 3QAXA 4QFPA 3VVFA 5I59B 4UACA 4G8MA 2RF1A 2Z22A 1TT1A 2P2AA 4POXA 4NF4B 1UTBA 4N07A 4ONYA 1QULA 2UYEA 4MH5A 2F97A 2V84A 4YU0A 3TYHA 3S9NC 1MH4A 2H5YA 4IO7A 4ND9A 4E0XA 1US5A 3RQTA 1R6ZA 1S7YA 4NF6A 5I56B 4IO4A 2AIXA 2XXQA 2THIA 3LUYA 3MWBA 2F7CA 2Y7IA 1BIYA 2RC7A 1SI1A 4G2ZA 4G4PA 4OEVA 2ZNUA 4N13A 4F22A 3DP8A 1PC3A 3PD9A 4R73A 1DSNA 1Z7ME 2H98A 2ZYNA 1B5JA 1PEBA 2Q8JA 4F19A 5I2NA 4ZZAA 4P11A 4EUOA 3AXFA 4RK2A 2DVZA 4EDPA 1IQ7A 1MM7A 3K6UA 4IO6A 3ZKLA 4JSOA 4KPTA 3OO7A 4H8IA 3CRBA 1UTHB 3G3FA 4QHQA 4ZE8A 1M5FA 5TPAA 3SERA 3TTLA 4BDQA 3T66A 5A5XB 2UVIA 4XKRA 3SEUA 1B5IA 1PDAA 1UTBB 5I2NB 4YKJA 1URSA 2PX1A 1MY0A 1DMBA 3FATA 3H6UA 4PE5B 4R6KA 3PUZE 2VHAA 1N84A 2O84X 2YPNA 3ODBA 3R26A 5TPAB 2NVUB 3W9VA 1NH7A 1ZMGA 2XXPA 3L6GA 1ZJLA 2DSFA 3MQ9A 4FEDA 1FQFA 4YZZA 3SEYA 2QS3A 3TZAA 3LSWA 1N7XA 3FXUA 4OHNA 1DPEA 4I62A 4AB5A 4BDNA 2GH9A 3CG1A 2UVHA 5AA4A 1CB6A 4PETA 3DM0A 3RTFB 3T9VA 4I8CA 3B7DA 3U1OA 4DXCA 2E0SA 1BP5A 1NNFA 3TFLA 3G3KA 1N04A 4GD5A 3VLWA 2Z8FA 4KYEA 1UTHA 3CSGA 3O9PA 4OQOA 1VFEA 4RK9A 4YB6A 5ITOA 2F34A 4QFLA 3TCHA 1IITA 2F6GA 2QSXA 4EQ7A 4ZECA 1QUIA 2Z8EA 1J1NA 1FQEA 1MQHA 5ITPA 3U94A 4Q8RA 4MBPA 5CMCA 1IIWA 1TFDA 1ZU0A 3T22A 1B3HA 2XD2A 2HZLA 1Y3QA 3MW0A 3TAJA 3UORA 1SW4A 5B7DA 1XVXA 1IEJA 1EZOA 1Y4TA 2I0BA 4PP0A 2QPQA 4EQBA 1NNTA 4G77A 3M3LA 5AA4B 1N76A 3C4MA 4RPOA 1SW5A 2FNCA 2OCUA 2Q2CA 3OO6A 2DOJA 4OXVA 1MXVA 1P99A 1XOCA 1R9LA 3EHTA 2HQ0A 4FATA 2X7PA 3JV9A 2XXVA 5K2YA 1O63A 2Q89A 1SW2A 4WEPA 3T9HB 2XXYA 4OESA 1PB7A 4OEUA 2NXOA 1I69A 1LB8A 4AB6A 1NMUA 1JETA 5AA1A 1FTJA 2VP1A 3D4CA 2V93A 1SYIA 4KD5A 4MFIA 3VLVA 1NNKA 1MQGA 3T93B 2RINA 4OVJA 1B32A 5KZTA 1NKXA 4LUBA 4DDDA 1OMPA 3KJTA 3LR1A 1TFAA 1FQAA 2AYSA 3R6UA 1IXGA 2A5TA 3KJ7A 4H67A 3IJOB 2OZZA 3IB1A 5DEXB 3S4UA 1D3KA 5TP9B 3PMXA 1FQCA 3IB2A 4XIGQ 3RUMA 2O6AA 4OFLA 4ELRA 3FVGA 3JZJA 1LCTA 2ZYMA 4YKPA 3V8XB 5H8NB 4R2BA 4U21A 3TTNA 3KG2A 2RC9A 5LOMA 3TPAA 3W15C 2REGA 4F3PA 4ELOA 3UK4A 1OVBA 1OLCA 1LAGE 2ALUA 2F6PA 1MXWA 4QSDA 4ZEDA 3M8UA 4X1DA 4M4GA 4OENA 1LBBA 1MQDA 1H45A 1VE4A 5I2KA 1A55A 4ZEKA 1GGGA 2XD3A 5DYHA 1H76A 3HHGA 4IGTA 2DQVA 4NWDA 4ZE9A 3A3UA 1B5HA 3IO6A 2ONSA 3MPLA 2RCBA 3BBRA 3K4UA 3N6TA 5TU0A 5KCJB 4QFOA 4NMYA 1B4ZA 3SKPA 4ELPA 4FAJA 2UYFA 1PB9A 3FXQA 1Q35A 1XHYA 3GLBA 5I2KB 2ZXTA 2NUVA 4LATA 4KI0E 3GBBA 4FE8A 4GL0A 4OETA 1P1UA 4Q0CA 2XXRA 3TQWA 1UIUA 3BFUA 3TTMA 4GL8A 3VFJA 5JK4A 4XKNA 2X26A 1BKAA 4RXLA 5JTYB 1YAEA 5AA3A 3K1NA 3B6QA 3V5AA 3FJMA 1GTKA 2F7BA 1A54A 3O6IA 1M5CA 2F78A 1R1NA 2FA7A 3CI8A 3FASA 4BDRA 1ZKBA 2QMXA 1N0TA 1LBCA 1SQYA 5AA2A 3QYTA 2PT2A 3MUQA 4F2OA 4UA8A 4KCDA 2F36A 3GBAA 3MC2A 3V83A 1QKAA 2I4CA 4F1YA 1M5BA 3GZGA 3IK6B 1FTMA 3K0VA 4R74A 3T96B 2F8DA 2UXAA 1MPDA 5CRYA 1URDA 5L9MA 2AL5A 2Q88A 3ZSFA 3C9HA 5ICQA 3MPKA 4DXBA 3M3KA 2G93A 3FJ7A 1FQBA 4R6HA 3RPWA 2FYIA 3Q25A 4X9TA 4QFKA 4U22A 1AH5A 2I49A 2I3VA 1DPPA 1B0HA 2RCAA 3PU5A 3B6TA 3PUXE 3H6WA 2VGQA 3MP1A 3MZ9A 4F3GA 5B70A 5H8NA 3M3FA 3G3HA 2DWJA 4EF1A 3H4ZA 1I6AA 5I58A 4ISUA 3IB0A 4OYVA 4RA1A 3FXRA 3P7IA 3OSRA 4Q30B 2BJJX 4EXKA 4DCYA 3ILTB 1TWYA 4M1VA 3RY3A 4KHZE 2O69A 5L8DA 3UGWA 4ELQA 4DCXA 3OOAA 1I6BA 1N3WA 1DOTA 3RTWB 1MG1A 1GR2A 3TTKA 3A09A 1HSJA 1USYE 2V3TA 4FEBA 5FTIA 1WDNA 1MQIA 1MY4A 4HCWA 5HBCA 5I59A 4XTCQ 2R9JA 2XXXA 1ATGA 4NF4A 5I57A 1MM6A 4XKPA 1D4NA 3G3IA 1B7HA 1OLAA 4POWA 2HCAA 3UIFA 1LFGA 5FHMA 2F7AA 1SD3A 2ONKE 2RKMA 3OSQA 2ZYOA 4F1UA 3TKDA 4QRZA 5CI5A 1B05A 4YKIA 1Y1MA 4OZ9A 2DP8A 5L9SA 4PFTA 4EXLA 3BKIB 3KN8A 2Q9TA 3EF7A 2GFEA 1D9YA 4LONB 4P0GA 4YMBA 4YAHX 1AL3A 1NH8A 2PT1A 5TP9A 3Q26A 1A8EA 3RNNA 2DYXA 3K6XA 2W7YA 2PBWA 3Q28A 1B40A 3QIMA 4WEDA 1B3EA 1O64A 1H3DA 4GFRA 4YB7A 2Q2AA 4GXSB 4F29A 2VD2A 4G68A 1Y3NA 5A5XA 4KR5A 1NNPA 4KYDA 3A3CA 4JWXA 1QUJA 3ECRA 5AE4A 3TUSA 3MVZA 3O2AA 3O29A 5M2VA 1LFIA 1SDXA 3IL1B 3R7XA 4R9GA 3MP6A 5I58B 2PYYA 4PFUA 4ZZEA 3TDJA 3SEXA 2XXIA 2Z23A 2DS9A 1RYOA 1P1WA 1QJMA 3KSXA 3PPNA 4ECFA 1QVSA 3TCFA 4X48A 4YB5A 3WAEA 1Y1ZA 2V3QA 2O7IA 1IUDA 1MXZA 1B3GA 3PV0E 3T9XB 3PGFA 5ICTA 4LZ5A 5DVJA 1WVJA 2XXHA 4NEDA 2DXYA 2QRYA 3K00A 3OO9A 5CBRA 2GHBA 4MF3A 5ISUA 3PMVA 1T0KA 2OWSA 3FIRA 2H4IA 1B6HA 3Q29A 3MVWA 2DVCA 1HSLA 2E1SA 1LAXA 1POTA 1QW0A 3H6TA 1EZ9A 3IO4A 3KGCA 2O1LA 3C33A 3L6HA 3KZGA 1B4HA 1YTVA 4H5FA 1Q1KA 4O3CA 4C1TA 4TLLB 4U2RA 5HPQA 2P1SA 2V3UA 2PVUA 1BTJA 1UQWA 2I4BA 4YICA 2UVGA 4QF9A 2ANJA 3CVGA 1JVYA 2NWJA 2HEUA 3TMGA 1RKMA 3K01A 3OELA 3OO8A 5H8HB 2QMWA 3N94A 3PUWE 4G8HA 3SESA 1VFDA 5FTHA 3Q27A
chains in the Genus database with same CATH superfamily
3LSFB 1FTOA 3PPRA 3VLUA 1ELJA 2I0CA 4IGRA 3TODA 1N7WA 1OQHA 4GOTA 3VXCA 3QUJA 5IKBA 1Y3PA 1OIBA 4X04A 1B46A 4HW8A 2OJTA 4PFWA 4ESWA 1ANFA 4C1UA 1WODA 1FPEA 2O51A 5FHNA 1EH3A 4OTEA 4N4UA 3USDA 4NF5A 2WEFA 4P9KA 1Y4CA 4GWXA 3VDFA 5EYFA 4L17A 4WXJA 2KR0A 2XXUA 2QS4A 4R2FA 1SI0A 1EYIA 3U93A 5CMKA 1LFHA 1FQDA 4GX4A 3LV0A 3S2VA 4H65A 1B3FA 5DVIA 1EU8A 2ESNA 3HO7A 2DE2A 3K1PA 1PBPA 5J1DA 1KWHA 3PMWA 1OQGA 4ZDMA 1TXFA 3MVXA 2X7QA 2XXWA 2YJPA 3CR9A 2B65A 4FORA 1JW4A 5DW8A 2VOZA 4MLVA 1JW1A 2KQZA 1BLFA 4PFRA 5IZZA 1RDYA 3QK6A 5I56A 3KOSA 5ET7A 3FJGA 3KBRA 3O6HA 3N6UA 4O7MA 1LBWA 4RYAA 4XXUA 3E4RA 2DWAA 4GRKA 5DTBA 4PQJA 3D1RA 5I57B 3IOWA 3WAFA 4ZS9A 3H03A 2CZLA 3ILUB 1L5TA 4LZ8A 3EPEA 5H8FA 3H7MA 4OWDA 4THIA 4GXAA 4ZEBA 3E3KA 2YLNA 2B3FA 5AA2B 5B7DA 1NL5A 1AIVA 4KFQA 2OBGA 2CEYA 2PMSA 4C0RA 2DE3A 2ONRA 3HV1A 3SEVA 2Y5LA 2LAOA 1JEUA 2Y7RA 3DP4A 4P0IA 3A29A 1QKBA 1MS7A 3VVDA 3HCQA 1LB9A 4IO5A 2M8CA 1FPLA 2R71A 4JBZA 2XX9A 4BDLA 4JVIA 4GBVA 4N8GA 1NFTA 4DZ1A 4QSEA 4IY6A 1VR5A 5DEXA 1DBZA 3VVFA 4G61A 4QFPA 4UACA 4G8MA 1TT1A 4MH5A 3S9NC 1MH4A 4E0XA 4NF6A 2AIXA 4G2ZA 2Y7IA 5EYGA 5J16A 3RPLB 4OEVA 2ZNUA 2ZYNA 4P11A 4EDPA 3K6UA 4JSOA 3OO7A 4H8IA 1UTHB 3G3FA 4ZE8A 5TPAA 1M5FA 4BDQA 1URSA 1MY0A 3H6UA 4PE5B 3MQ9A 3L6GA 3T0JA 3LSWA 3FXUA 4PTKA 2UVHA 5AA4A 3T9VA 4DXCA 3U1OA 1FPDA 1NNFA 4GD5A 3VLWA 1FBFA 1UTHA 4OQOA 3O9PA 3TCHA 1IITA 2F6GA 2QSXA 1QUIA 4MHFA 1IIWA 3T22A 1B3HA 2XD2A 1IEJA 2I0BA 4MJOA 2DDKA 2OCUA 2DOJA 1KA1A 3EHTA 2X7PA 3JV9A 1O63A 5IZ3A 4GX6A 1I69A 1JETA 4I3EA 2B4LA 4I3YA 2RINA 4QXDA 5DEXB 3KJ7A 3IJOB 5TP9B 3RUMA 4OFLA 4ELRA 2ZYMA 2MKZA 5H8NB 4R2BA 4ELOA 4P47A 4MX6A 3M8UA 4X1DA 1MQDA 1VE4A 1GGGA 2WBBA 3IO6A 2RCBA 3BBRA 3SKPA 4ELPA 5I2KB 1Q35A 2ZXTA 4LATA 4MNCA 4KI0E 3GBBA 4OETA 1P1UA 1IMDA 4QBAA 3BFUA 3VFJA 4XKNA 2X26A 1BKAA 5AA3A 3K1NA 3V5AA 3FJMA 1A54A 3O6IA 2FA7A 3T1BA 2QMXA 1FPJA 2F36A 3MC2A 4F1YA 3GZGA 4R74A 3K0VA 3T96B 4O8MA 1MPDA 1URDA 3ZSFA 3C9HA 3MPKA 1DK4A 3M3KA 3PUXE 1RDZA 4F31B 3PU5A 3B6TA 3M3FA 3G3HA 4EF1A 3IB0A 4OYVA 2B4MA 3P7IA 1TWYA 4KHZE 4ELQA 3RTWB 3TTKA 1USYE 5I59A 4HCWA 1MQIA 1MY4A 2R9JA 4MCOA 1OLAA 4POWA 1SD3A 3OSQA 3BKIB 1D9YA 4YAHX 1NH8A 2W7YA 1B40A 4PGNA 4YB7A 1H3DA 4GXSB 4MAGA 5AE4A 3TUSA 3MVZA 5M2VA 1SDXA 3IL1B 2CZIA 4ZZEA 3TDJA 2DS9A 1RYOA 1QJMA 1QVSA 3TCFA 4X48A 2O7IA 5DVJA 1WVJA 2XXHA 2XWIA 2DXYA 3OO9A 1B6HA 3Q29A 1YXIA 1D9QA 4P1EA 3H6TA 3IO4A 1YTVA 5HPQA 2UVGA 3CVGA 3TMGA 5H8HB 4G8HA 3PUWE 2FYIA 3Q27A 2O7UA 1FTKA 4YKKA 4PE3A 4Z7EA 1JNFA 1SW1A 1B1XA 1MPBA 3HHFA 3K2DA 4NF6B 3RPLA 4HS7A 1OVTA 4PF8A 4I9DA 1M5DA 4LVQA 4GWSA 5CMMA 4F39A 3FV1A 3C34A 5ELVA 3I3VA 4NQ8A 4NE4A 3QXMA 3K02A 4U4SA 4MIJA 4HTGA 3BIGA 1MXXA 5IAIA 4TQUQ 1USYH 1IXIA 2GHAA 4H45A 4ESXA 2B3BA 2ZYKA 3DP6A 1JVXA 1B51A 1P1QA 4NWCA 2OK2A 3DLNA 5DT6A 5CMBA 4BDOA 4NTLA 3FGSA 1FBEA 3CG3A 4IB2A 3IOVA 2ZNTA 1MRPA 2XX7A 4IO3A 4XKQA 2D21A 1N3XA 3KN3A 3MAMA 4GLIA 1UIVA 1YCJA 1K9ZA 3V89B 3RT8A 4PFYA 2REJA 5AA2D 1XI6A 1B7UA 5F7VA 4K3FA 1XC1A 3BFTA 3MBPA 4NHBA 4MMPA 4U4XA 4JVDA 4BLAA 2DWHA 1G0IA 3O66A 4OVTA 2V25A 3IOUA 1IXHA 4PBHA 1IMFA 3LSXA 4R72A 3FVKA 1NV5A 2CEXA 1FSAA 3TELA 3FBPA 4P56A 3C36A 4FBPA 4JVCA 2HXWA 2KLFA 4LZ7A 1FPFA 1ZTYA 1Y9UA 1P1NA 2Y7WA 1ZLQA 2UVJA 3S9LC 2G29A 4U1ZA 4OVPA 3O28A 1MY2A 3O6GA 4I1DA 5I3SA 3OEMA 3CFLA 3EHUA 2VD3A 4AS5A 5K2XA 3N5LA 4HCYA 2HAVA 4R75A 4IO2A 1M5EA 2XXTA 4U1OA 4FJPA 4N6DA 2AL4A 5IGAA 5CM6A 5H8SA 1YPNA 3U92A 4H5GA 4G68C 1Z7NE 1VSOA 3KOTA 1CE2A 1P1OA 2H99A 1FCKA 3FVNA 2XXKA 1MY3A 1B0LA 3OD7A 4IY5A 1MDP1 3IAZA 1QUKA 3K1MA 1IXCA 1KZ8A 2A5TB 5H8HA 1B2HA 2Z22A 2P2AA 4HXVA 4ONYA 4N07A 2FVZA 4YU0A 3TYHA 2H5YA 4ND9A 1S7YA 5I56B 3LUYA 2THIA 1BIYA 4N13A 3DP8A 5F24A 4R73A 4F19A 1B5JA 2DVZA 3CRBA 5A5XB 2QVUA 4P1LA 1DMBA 1FBCA 2XXPA 2DSFA 3SEYA 1FQFA 4YZZA 1N7XA 4BDNA 4OHNA 1DPEA 2CZHA 4PETA 2E0SA 3TFLA 2Z8FA 5IM2A 5ITOA 1K9YA 2VT5A 1FQEA 1INPA 1ZU0A 1XVXA 3LUZA 4EQBA 3IFAA 1NNTA 4G77A 1N76A 1XOCA 4FATA 2HQ0A 5K2YA 1SW2A 4WEPA 1NUXA 4OEUA 1LB8A 1FTJA 1SYIA 1NNKA 1B32A 1NKXA 3LR1A 1TFAA 1FQAA 2AYSA 2WYPA 3R6UA 2A5TA 4H67A 2OZZA 3PMXA 4XIGQ 2O6AA 3JZJA 5EQ7A 4YKPA 3KG2A 5LOMA 5I7IA 4F3PA 2VPOA 3W15C 4ZEDA 4QSDA 3CHGA 4M4GA 1FJ6A 1A55A 1IMCA 2XD3A 5DYHA 1H76A 4ZE9A 5TU0A 5KCJB 4NMYA 2XXRA 3TTMA 5JK4A 4RXLA 3B6QA 2F7BA 2HPGA 1M5CA 4N91A 3CI8A 1R1NA 1N0TA 1SQYA 2PT2A 4F2OA 1QKAA 4P3LA 1FTMA 5BUUA 2AL5A 2G93A 2P3VA 3FJ7A 1FQBA 3RPWA 4U22A 1AH5A 1DPPA 3MZ9A 5ESYA 5LDZA 3OSRA 2BJJX 3ILTB 3RY3A 5IZ3B 5L8DA 3UGWA 1I6BA 3FXBA 3A09A 1HSJA 5HBCA 4FEBA 1LBXA 4XTCQ 2XXXA 4NF4A 1MM6A 4GBWA 4XEQA 1B7HA 4NX1A 5EQAA 2RKMA 4O7IA 2ZYOA 1B05A 4DI4B 1Y1MA 4PFTA 2GFEA 4LONB 4P0GA 4MEVA 1AL3A 2PT1A 1A8EA 2WBDA 3Q28A 4WEDA 1B3EA 1O64A 3A3CA 4JWXA 1QUJA 3ECRA 5ET8A 3O29A 3MP6A 2PYYA 1YYZA 3PPNA 3KSXA 4YB5A 1IUDA 3PV0E 5ICTA 4LZ5A 5ET6A 5ISUA 3FIRA 2DVCA 1EZ9A 3L6HA 4H5FA 1LBYA 1Q1KA 3EKIA 2P3NA 1BTJA 1UQWA 2V4CA 1RKMA 3N94A 4R9GA 5FTHA 3E9XA 3H3GA 4JWOA 3FUZA 3U8QA 4DE8A 3CFXA 2QJEA 3OEKA 3TTRA 4N8YA 2D5WA 3U72A 4GWZA 3E79A 4NF8A 5I57A 4JSDA 4GX3A 1S50A 4ZEIA 4I40A 1A8FA 3PPPA 2Y7PA 2A5SA 1LBZA 2I3WA 4UABA 2H9BA 2Z8DA 2PFZA 2HXRA 3CFZA 3ZS6A 1R9QA 3CSBA 5DVFA 3MSTA 4N6KA 5L9OA 5BWJA 1LSTA 3THIA 1FBDA 3VVEA 4RY1A 3IR1A 1B9JA 1PBQA 2HFBA 3PPOA 2VPNA 5KCJA 1LAFE 3B50A 3RT6B 3VV5A 3JYRA 1FBPA 1AMFA 1MQJA 1RYXA 1A99A 3FVOA 2R6GE 4NF0A 4GVOA 5CC2A 4RJZA 1FBHA 1A7LA 2JJKA 4LA9A 4WKMA 1SVXB 4ZEFA 3DELB 2Y84A 4RNSA 3KEIA 1US4A 1B7ZA 1HSEA 3H6VA 3LC8A 4JWYA 1DCUA 4OFJA 3HPIA 1DTGA 3MYUA 3UA8A 3PTYA 1LGBC 2F35A 4NF8B 3ZKKA 1ZIUA 2I58A 1MDQA 4GWOA 5CBSA 3H06B 3SDFA 4TLMB 2HHMA 4QSCA 3I6VA 1SBPA 1XT8A 2F5XA 1LCFA 5I84A 4R6YA 2H25A 2I6EA 3LBSA 4OANA 5H8QA 5HM4B 1D9VA 3ONMA 1XVYA 4E0WA 1POY1 3MVYA 4KQPA 3RLFE 1MH3A 3IJXB 2I48A 3PUYE 4EQ9A 1JW5A 3MZ1A 3UN6A 1O7TA 1FTAA 3S9EA 4P8BA 1ZBMA 4DI3D 3MZBA 1LAHE 3MP8A 4PDHA 1MPCA 3B8BA 3IORA 3K6VA 3F11A 2ABHA 3QSLA 2BJIA 3EHSA 3OENA 1FPIA 4O94A 4QFNA 4GF8A 4TOZA 2IA4A 4LQ5A 4N81A 2IEEA 1CNQA 1MXYA 2NOOA 1I6QA 2RC8A 3RGYA 1FTLA 5I59B 3QAXA 4POXA 4NF4B 1UTBA 1QULA 2UYEA 2F97A 4IO7A 3RQTA 1R6ZA 3MWBA 2F7CA 2RC7A 1SI1A 4G4PA 1PC3A 3PD9A 1PEBA 4ZZAA 4EUOA 4RK2A 3RYDA 3ZKLA 4NGUA 1QGXA 4QHQA 3TTLA 3SERA 1B5IA 1PDAA 1UTBB 5I2NB 4YKJA 3FATA 3PUZE 2YPNA 2O84X 3R26A 1NH7A 1ZMGA 4FEDA 1ZJLA 2QS3A 1NUZA 1NV0A 2GH9A 1CB6A 3RTFB 2XWKA 3B7DA 1BP5A 3G3KA 1N04A 2ZZXA 4KYEA 1VFEA 4RK9A 2F34A 4QFLA 4EQ7A 2Q8MA 2QVRA 1J1NA 4MBPA 5CMCA 2ZZVA 2HZLA 3TAJA 3UORA 1Y4TA 4PCDA 4PP0A 2QPQA 3M3LA 3C4MA 1SW5A 4OXVA 2FNCA 1MXVA 1RDXA 2XXYA 4OESA 2PCRA 1PB7A 2NXOA 1NMUA 5AA1A 3D4CA 2V93A 1FPKA 4MFIA 3VLVA 5EQ8A 1MQGA 4OVJA 1OMPA 3KJTA 2PFYA 4X8RA 3KC0A 1IXGA 3S4UA 4GWYA 1D3KA 4GWUA 1FQCA 1NUWA 4GWWA 3FVGA 1LCTA 3V8XB 3TTNA 1OLCA 1LAGE 2F6PA 1MXWA 4H46A 4OENA 1LBBA 4NN3A 5I2KA 4ZEKA 2DQVA 4NWDA 4PDDA 3HFUA 1B5HA 1NV2A 3BIHA 4QFOA 2UYFA 1PB9A 3FXQA 1XHYA 2NUVA 5ET5A 4GL8A 2F3DA 5JTYB 1NV3A 1FJ9A 2F78A 3KC1A 3FASA 1ZKBA 5AA2A 1VDWA 3GBAA 2I4CA 1M5BA 3IK6B 2F8DA 2UXAA 5ICQA 2Q88A 1AWBA 4R6HA 3Q25A 2I3VA 1B0HA 3H6WA 4F3GA 3H4ZA 1I6AA 1G0HA 4ISUA 4RA1A 4DCYA 2O69A 4DCXA 5FBPA 1DOTA 5FTIA 1ATGA 4XKPA 3ROJA 2HCAA 2GQ1A 3UIFA 5FHMA 4NG7A 3TKDA 1IMEA 4QRZA 4YKIA 5L9SA 4XF5A 4EXLA 4IR8A 2Q9TA 3EF7A 4YMBA 5TP9A 3Q26A 2DYXA 3QIMA 4KR5A 1FRPA 1YZ0A 3E78A 4LN5A 1LFIA 3R7XA 5I58B 4PFUA 2XWOA 2XXIA 1Y1ZA 2V3QA 4HE0A 3SZPA 1MXZA 1B3GA 2WX9A 1KA0A 3PGFA 4NEDA 3K00A 4MF3A 3PMVA 5I5PA 1T0KA 3MVWA 1POTA 1HSLA 1LAXA 2E1SA 1QW0A 4ZECA 3KGCA 2O1LA 4O3CA 4PAKA 3KZGA 1B4HA 4FAJA 4U2RA 2P1SA 2I4BA 4QF9A 4KXPA 2NWJA 3OELA 2QMWA 3SESA 1VFDA 4OVRA 1NV1A 1F9BA 3NOHA 3QUFA 3PUVE 1IMAA 4PBQA 1FW0A 3S9MC 3EQ1A 4G68B 4KCCA 2XHDA 1H43A 5IZ1A 1XS5A 2DXRA 2F3BA 4MLQA 4F18A 3B6WA 4GIZA 4X1BA 4DLDA 2CZKA 4H6DA 2XA5A 4MNPA 1B52A 2HAUA 2XX8A 2ZNSA 5FHOA 3D4GA 2ZMBA 4JXIA 3KSJA 3VXBA 1URGA 4OERA 2D3IA 5H8FB 1EZPA 2DWIA 3TQLA 4O3AA 4NF5B 1JEVA 3C35A 4OFOA 2QL3A 1LLSA 3UP9A 1JQFA 1NV4A 3TEPA 1NV7A 3PPQA 1MXUA 3GXAA 4N6PA 3K6WA 4BDMA 2CMOA 4PFIA 3GYYA 3LSLA 3G7WA 3FV2A 1B3LA 4O3BA 3N26A 3T9UA 4G8NA 3IOTA 4FECA 2Y5KA 4N15A 4Z0IA 1AOVA 4JB7A 3SEWA 2OLBA 1PB8A 1SYHA 3E13X 5EHMA 2GRVA 2P0SA 3W9WA 1B1HA 2ZZWA 4PF6A 1II5A 2FBPA 1Y20A 2HZKA 4F2QA 3FZVA 1GV8A 4OMBA 1IZ1A 3CIJA 4F1VA 3FD3A 1GVCA 5H8QB 3OMBA 4OA4A 4Q5TA 1Q9DA 5KDTA 1B58A 5EHSA 4H0WA 5JTYA 3MJNA 4LQ2A 4GQOA 2QS2A 3IX1A 1DTZA 4JDFA 1MY1A 2OWTA 3SETA 2O68A 5F1QA 1S9TA 1NV6A 5KDTB 3G3JA 5CRYA 3HN0A 3I5OA 4PGPA 3KN7A 3RN8A 4U23A 3G3GA 4F3BA 2XWVA 3HSTA 3C31A 4DXUA 3KFMA 1A40A 3C32A 5LTCA 2DE4A 2Y7KA 3TCGA 4EF2A 4LP2B 4NAPA 3EN3A 4H1XA 4F3SA 4KYSA 3VE1B 3PD8A 4AQ4A 5T3JA 3O97A 5JEIA 4YMAA 2OX3A 1H44A 3OXNA 4DIGA 4R9FA 4H8JA 2WKYA 2O1MA 4FIMA 4XFEA 2QS1A 4PFBA 2RF1A 1JP4A 2V84A 1US5A 4HE1A 4IO4A 2XXQA 4F22A 1DSNA 1Z7ME 2H98A 5I2NA 3AXFA 1IQ7A 1MM7A 4IO6A 4KPTA 3T66A 2UVIA 4XKRA 3SEUA 4MNIA 3QMFA 2PX1A 4R6KA 2VHAA 1N84A 3ODBA 5TPAB 2NVUB 3W9VA 3TZAA 4I62A 4AB5A 1EYKA 3CG1A 4PC9A 3DM0A 4I8CA 3CSGA 4YB6A 2Z8EA 5A5LA 1MQHA 5ITPA 1LBVA 3U94A 4Q8RA 1TFDA 1NUYA 1Y3QA 3MW0A 1SW4A 1EZOA 5AA4B 4RPOA 2WYKA 4AS4A 2Q2CA 3OO6A 1P99A 1R9LA 2XXVA 1EYJA 2Q89A 3T9HB 4AB6A 2VP1A 4KD5A 3T93B 1BK4A 4OVQA 4LUBA 4DDDA 5KZTA 1FBGA 3IB1A 3IB2A 4U21A 2RC9A 2L5VA 2Q74A 2REGA 3TPAA 3UK4A 1OVBA 2ALUA 2QFLA 3U65A 1H45A 3HHGA 4IGTA 3A3UA 3MPLA 2ONSA 1SPIA 3K4UA 3N6TA 1B4ZA 2FIEA 3GLBA 4RPNA 4FE8A 4GL0A 4Q0CA 3TQWA 1UIUA 1YAEA 4N17A 1GTKA 4BDRA 2QVVA 1LBCA 3QYTA 3MUQA 4UA8A 4KCDA 4PAIA 3V83A 5L9MA 4DXBA 2OWZA 4PAFA 4X9TA 4QFKA 4OVSA 2I49A 2RCAA 2VGQA 3MP1A 5B70A 5H8NA 2DWJA 4HE2A 5I58A 3FXRA 4Q30B 4EXKA 4M1VA 2FHYA 3OOAA 1N3WA 1MG1A 1GR2A 2V3TA 1WDNA 3KBZA 5EQ9A 1D4NA 3G3IA 1LFGA 2F7AA 2ONKE 4F1UA 5CI5A 4OZ9A 2DP8A 3KN8A 1NI9A 2R8TA 3RNNA 3K6XA 2PBWA 1LEVA 4GFRA 2Q2AA 4F29A 2VD2A 4G68A 1Y3NA 5A5XA 3ISPA 1NNPA 4KYDA 5EYHA 3O2AA 3SEXA 2Z23A 1IMBA 1P1WA 4ECFA 3WAEA 3T9XB 2QRYA 1FPGA 5CBRA 3IFCA 2GHBA 2OWSA 2H4IA 2Q8JA 3C33A 4C1TA 4TLLB 2V3UA 2FIXA 2PVUA 4YICA 2ANJA 1JVYA 2HEUA 3K01A 3OO8A 1FPBA
chains in the Genus database with same CATH topology
2O7UA 3E9XA 3H3GA 3LSFB 4JWOA 3FUZA 3U8QA 1F9BA 3CFXA 4DE8A 2QJEA 1FTKA 1FTOA 3OEKA 3TTRA 3PPRA 3VLUA 3QUFA 3PUVE 4YKKA 2D5WA 3U72A 4Z7EA 1JNFA 1FW0A 1SW1A 1B1XA 1MPBA 3HHFA 1ELJA 3S9MC 3EQ1A 4G68B 2I0CA 4KCCA 4NF8A 2XHDA 4IGRA 1H43A 3K2DA 3TODA 4JSDA 4NF6B 1N7WA 1OQHA 1XS5A 2DXRA 4GOTA 3QUJA 3VXCA 5IKBA 4MLQA 4F18A 3B6WA 1S50A 4GIZA 4ZEIA 4HS7A 1OVTA 4X1BA 4DLDA 1Y3PA 1OIBA 4H6DA 4I9DA 1B52A 1B46A 4HW8A 2OJTA 1M5DA 4LVQA 5F7VA 2HAUA 2XX8A 5CMMA 2ZNSA 1A8FA 3PPPA 4PFWA 2Y7PA 1ANFA 5FHOA 2A5SA 4ESWA 4C1UA 1WODA 3FV1A 3C34A 4F39A 3D4GA 2O51A 2ZMBA 5FHNA 2I3WA 1EH3A 4JXIA 3I3VA 4OTEA 5ELVA 3KSJA 4NE4A 3USDA 2H9BA 1URGA 4NF5A 3QXMA 3VXBA 3K02A 1Y4CA 2Z8DA 4OERA 4U4SA 3VDFA 3CFZA 3ZS6A 1R9QA 2D3IA 3CSBA 4L17A 5DVFA 5EYFA 5H8FB 1EZPA 4HTGA 2DWIA 4WXJA 3TQLA 5L9OA 5BWJA 4O3AA 1LSTA 1MXXA 3THIA 4NF5B 2XXUA 1JEVA 2QS4A 4RY1A 3VVEA 5IAIA 3IR1A 1B9JA 4TQUQ 4R2FA 1USYH 1IXIA 1SI0A 1PBQA 3C35A 3U93A 2GHAA 2HFBA 4ESXA 3PPOA 4OFOA 5KCJA 2B3BA 2QL3A 5CMKA 2ZYKA 1LLSA 3DP6A 1JVXA 3UP9A 1JQFA 1B51A 1LAFE 1FQDA 1P1QA 1LFHA 3TEPA 4NWCA 3RT6B 3VV5A 3JYRA 3S2VA 1AMFA 4H65A 1B3FA 1MQJA 2OK2A 3PPQA 3DLNA 1MXUA 3GXAA 1RYXA 1EU8A 2ESNA 4N6PA 3K6WA 5DVIA 5DT6A 5CMBA 4BDMA 4BDOA 1A99A 3HO7A 3FVOA 2DE2A 2CMOA 4NTLA 3FGSA 3K1PA 3CG3A 4IB2A 2R6GE 3IOVA 1PBPA 2ZNTA 4GVOA 5CC2A 5J1DA 1KWHA 3PMWA 1OQGA 3LSLA 4RJZA 1MRPA 2XX7A 4IO3A 4ZDMA 1TXFA 3G7WA 3FV2A 4XKQA 1B3LA 3MVXA 4O3BA 2X7QA 3N26A 2D21A 3T9UA 4G8NA 3IOTA 2XXWA 1N3XA 2YJPA 1A7LA 3CR9A 3KN3A 3MAMA 4FECA 4GLIA 4LA9A 4WKMA 1UIVA 1YCJA 2B65A 4FORA 4Z0IA 1AOVA 1JW4A 1SVXB 4JB7A 3SEWA 3RT8A 3V89B 2OLBA 2VOZA 4PFYA 2REJA 4MLVA 1PB8A 2Y84A 3DELB 4ZEFA 4RNSA 5AA2D 1JW1A 1B7UA 3KEIA 4K3FA 1US4A 1SYHA 1XC1A 3BFTA 1B7ZA 3E13X 5EHMA 3MBPA 1HSEA 3H6VA 4U4XA 2GRVA 3LC8A 4BLAA 4JWYA 4OFJA 4RPNA 2DWHA 2P0SA 3HPIA 1BLFA 3W9WA 1DTGA 4EQ9A 1B1HA 3O66A 3UA8A 1II5A 2V25A 1LGBC 3IOUA 1IXHA 2F35A 1Y20A 4NF8B 2HZKA 3QK6A 5I56A 3ZKKA 1ZIUA 2I58A 3FZVA 3KOSA 3LSXA 1MDQA 4F2QA 1GV8A 4R72A 3FVKA 3FJGA 3KBRA 3O6HA 4GWOA 4OMBA 3N6UA 5CBSA 1IZ1A 3H06B 3CIJA 3TELA 3SDFA 4RYAA 4XXUA 3E4RA 2DWAA 4F1VA 4TLMB 4F31B 3FD3A 4GRKA 4QSCA 5DTBA 1GVCA 3C36A 3I6VA 3OMBA 5H8QB 1SBPA 2HXWA 4PQJA 4Q5TA 1XT8A 2F5XA 5KDTA 1B58A 2KLFA 4LZ7A 1LCFA 5I57B 5EHSA 1ZTYA 3IOWA 4H0WA 5I84A 4R6YA 5JTYA 2H25A 1Y9UA 2I6EA 4ZS9A 3H03A 3MJNA 3WAFA 3LBSA 2CZLA 3ILUB 1L5TA 5H8QA 4LZ8A 1P1NA 4LQ2A 2Y7WA 1ZLQA 5HM4B 1D9VA 2UVJA 3EPEA 5H8FA 4GQOA 3H7MA 3S9LC 3ONMA 2G29A 1XVYA 4OWDA 4U1ZA 4THIA 4GXAA 2QS2A 3O28A 4ZEBA 3E3KA 3IX1A 4E0WA 1DTZA 1MY2A 1POY1 2B3FA 2YLNA 3O6GA 4JDFA 1MY1A 3MVYA 5AA2B 1NL5A 2OWTA 4I1DA 4KFQA 4KQPA 3SETA 3OEMA 1AIVA 2OBGA 3CFLA 3RLFE 2O68A 3EHUA 1MH3A 2VD3A 1S9TA 5F1QA 2PMSA 4C0RA 3IJXB 2I48A 5K2XA 3N5LA 4HCYA 3G3JA 5KDTB 3PUYE 2HAVA 2DE3A 4R75A 2ONRA 3HV1A 1JW5A 1M5EA 2XXTA 3HN0A 3I5OA 3MZ1A 3KN7A 4IO2A 4U1OA 3RN8A 3SEVA 3UN6A 4U23A 1O7TA 2LAOA 3G3GA 1JEUA 4FJPA 2Y7RA 3S9EA 4F3BA 3DP4A 2AL4A 3HSTA 4P0IA 3C31A 1ZBMA 4DXUA 5CM6A 5H8SA 1YPNA 3U92A 3KFMA 1A40A 1QKBA 3MZBA 1LAHE 3C32A 1MS7A 2DE4A 4H5GA 3VVDA 2Y7KA 3TCGA 3HCQA 4G68C 4EF2A 3MP8A 4LP2B 1MPCA 1Z7NE 1LB9A 4IO5A 3IORA 1VSOA 2M8CA 3K6VA 3KOTA 1CE2A 3EN3A 2R71A 4H1XA 3F11A 4F3SA 2ABHA 1P1OA 3QSLA 4KYSA 2H99A 4JBZA 3VE1B 3EHSA 1FCKA 3FVNA 3PD8A 3OENA 4AQ4A 2XX9A 4BDLA 1MY3A 3O97A 5JEIA 4YMAA 4QFNA 5BUUA 1H44A 4GF8A 3OXNA 2IA4A 4LQ5A 4TOZA 1B0LA 4DIGA 3OD7A 1NFTA 2IEEA 4H8JA 4R9FA 4DZ1A 4IY5A 4QSEA 2WKYA 1MXYA 1MDP1 2NOOA 2O1MA 4IY6A 3IAZA 1QUKA 1VR5A 3K1MA 1IXCA 1I6QA 4FIMA 2A5TB 5DEXA 2RC8A 3RGYA 1FTLA 1B2HA 2QS1A 5H8HA 3QAXA 4QFPA 3VVFA 5I59B 4UACA 4G8MA 2RF1A 2Z22A 1TT1A 2P2AA 4POXA 4NF4B 1UTBA 4N07A 4ONYA 1QULA 2UYEA 4MH5A 2F97A 2V84A 4YU0A 3TYHA 3S9NC 1MH4A 2H5YA 4IO7A 4ND9A 4E0XA 1US5A 3RQTA 1R6ZA 1S7YA 4NF6A 5I56B 4IO4A 2AIXA 2XXQA 2THIA 3LUYA 3MWBA 2F7CA 2Y7IA 1BIYA 2RC7A 1SI1A 4G2ZA 4G4PA 4OEVA 2ZNUA 4N13A 4F22A 3DP8A 1PC3A 3PD9A 4R73A 1DSNA 1Z7ME 2H98A 2ZYNA 1B5JA 1PEBA 2Q8JA 4F19A 5I2NA 4ZZAA 4P11A 4EUOA 3AXFA 4RK2A 2DVZA 4EDPA 1IQ7A 1MM7A 3K6UA 4IO6A 3ZKLA 4JSOA 4KPTA 3OO7A 4H8IA 3CRBA 1UTHB 3G3FA 4QHQA 4ZE8A 1M5FA 5TPAA 3SERA 3TTLA 4BDQA 3T66A 5A5XB 2UVIA 4XKRA 3SEUA 1B5IA 1PDAA 1UTBB 5I2NB 4YKJA 1URSA 2PX1A 1MY0A 1DMBA 3FATA 3H6UA 4PE5B 4R6KA 3PUZE 2VHAA 1N84A 2O84X 2YPNA 3ODBA 3R26A 5TPAB 2NVUB 3W9VA 1NH7A 1ZMGA 2XXPA 3L6GA 1ZJLA 2DSFA 3MQ9A 4FEDA 1FQFA 4YZZA 3SEYA 2QS3A 3TZAA 3LSWA 1N7XA 3FXUA 4OHNA 1DPEA 4I62A 4AB5A 4BDNA 2GH9A 3CG1A 2UVHA 5AA4A 1CB6A 4PETA 3DM0A 3RTFB 3T9VA 4I8CA 3B7DA 3U1OA 4DXCA 2E0SA 1BP5A 1NNFA 3TFLA 3G3KA 1N04A 4GD5A 3VLWA 2Z8FA 4KYEA 1UTHA 3CSGA 3O9PA 4OQOA 1VFEA 4RK9A 4YB6A 5ITOA 2F34A 4QFLA 3TCHA 1IITA 2F6GA 2QSXA 4EQ7A 4ZECA 1QUIA 2Z8EA 1J1NA 1FQEA 1MQHA 5ITPA 3U94A 4Q8RA 4MBPA 5CMCA 1IIWA 1TFDA 1ZU0A 3T22A 1B3HA 2XD2A 2HZLA 1Y3QA 3MW0A 3TAJA 3UORA 1SW4A 5B7DA 1XVXA 1IEJA 1EZOA 1Y4TA 2I0BA 4PP0A 2QPQA 4EQBA 1NNTA 4G77A 3M3LA 5AA4B 1N76A 3C4MA 4RPOA 1SW5A 2FNCA 2OCUA 2Q2CA 3OO6A 2DOJA 4OXVA 1MXVA 1P99A 1XOCA 1R9LA 3EHTA 2HQ0A 4FATA 2X7PA 3JV9A 2XXVA 5K2YA 1O63A 2Q89A 1SW2A 4WEPA 3T9HB 2XXYA 4OESA 1PB7A 4OEUA 2NXOA 1I69A 1LB8A 4AB6A 1NMUA 1JETA 5AA1A 1FTJA 2VP1A 3D4CA 2V93A 1SYIA 4KD5A 4MFIA 3VLVA 1NNKA 1MQGA 3T93B 2RINA 4OVJA 1B32A 5KZTA 1NKXA 4LUBA 4DDDA 1OMPA 3KJTA 3LR1A 1TFAA 1FQAA 2AYSA 3R6UA 1IXGA 2A5TA 3KJ7A 4H67A 3IJOB 2OZZA 3IB1A 5DEXB 3S4UA 1D3KA 5TP9B 3PMXA 1FQCA 3IB2A 4XIGQ 3RUMA 2O6AA 4OFLA 4ELRA 3FVGA 3JZJA 1LCTA 2ZYMA 4YKPA 3V8XB 5H8NB 4R2BA 4U21A 3TTNA 3KG2A 2RC9A 5LOMA 3TPAA 3W15C 2REGA 4F3PA 4ELOA 3UK4A 1OVBA 1OLCA 1LAGE 2ALUA 2F6PA 1MXWA 4QSDA 4ZEDA 3M8UA 4X1DA 4M4GA 4OENA 1LBBA 1MQDA 1H45A 1VE4A 5I2KA 1A55A 4ZEKA 1GGGA 2XD3A 5DYHA 1H76A 3HHGA 4IGTA 2DQVA 4NWDA 4ZE9A 3A3UA 1B5HA 3IO6A 2ONSA 3MPLA 2RCBA 3BBRA 3K4UA 3N6TA 5TU0A 5KCJB 4QFOA 4NMYA 1B4ZA 3SKPA 4ELPA 4FAJA 2UYFA 1PB9A 3FXQA 1Q35A 1XHYA 3GLBA 5I2KB 2ZXTA 2NUVA 4LATA 4KI0E 3GBBA 4FE8A 4GL0A 4OETA 1P1UA 4Q0CA 2XXRA 3TQWA 1UIUA 3BFUA 3TTMA 4GL8A 3VFJA 5JK4A 4XKNA 2X26A 1BKAA 4RXLA 5JTYB 1YAEA 5AA3A 3K1NA 3B6QA 3V5AA 3FJMA 1GTKA 2F7BA 1A54A 3O6IA 1M5CA 2F78A 1R1NA 2FA7A 3CI8A 3FASA 4BDRA 1ZKBA 2QMXA 1N0TA 1LBCA 1SQYA 5AA2A 3QYTA 2PT2A 3MUQA 4F2OA 4UA8A 4KCDA 2F36A 3GBAA 3MC2A 3V83A 1QKAA 2I4CA 4F1YA 1M5BA 3GZGA 3IK6B 1FTMA 3K0VA 4R74A 3T96B 2F8DA 2UXAA 1MPDA 5CRYA 1URDA 5L9MA 2AL5A 2Q88A 3ZSFA 3C9HA 5ICQA 3MPKA 4DXBA 3M3KA 2G93A 3FJ7A 1FQBA 4R6HA 3RPWA 2FYIA 3Q25A 4X9TA 4QFKA 4U22A 1AH5A 2I49A 2I3VA 1DPPA 1B0HA 2RCAA 3PU5A 3B6TA 3PUXE 3H6WA 2VGQA 3MP1A 3MZ9A 4F3GA 5B70A 5H8NA 3M3FA 3G3HA 2DWJA 4EF1A 3H4ZA 1I6AA 5I58A 4ISUA 3IB0A 4OYVA 4RA1A 3FXRA 3P7IA 3OSRA 4Q30B 2BJJX 4EXKA 4DCYA 3ILTB 1TWYA 4M1VA 3RY3A 4KHZE 2O69A 5L8DA 3UGWA 4ELQA 4DCXA 3OOAA 1I6BA 1N3WA 1DOTA 3RTWB 1MG1A 1GR2A 3TTKA 3A09A 1HSJA 1USYE 2V3TA 4FEBA 5FTIA 1WDNA 1MQIA 1MY4A 4HCWA 5HBCA 5I59A 4XTCQ 2R9JA 2XXXA 1ATGA 4NF4A 5I57A 1MM6A 4XKPA 1D4NA 3G3IA 1B7HA 1OLAA 4POWA 2HCAA 3UIFA 1LFGA 5FHMA 2F7AA 1SD3A 2ONKE 2RKMA 3OSQA 2ZYOA 4F1UA 3TKDA 4QRZA 5CI5A 1B05A 4YKIA 1Y1MA 4OZ9A 2DP8A 5L9SA 4PFTA 4EXLA 3BKIB 3KN8A 2Q9TA 3EF7A 2GFEA 1D9YA 4LONB 4P0GA 4YMBA 4YAHX 1AL3A 1NH8A 2PT1A 5TP9A 3Q26A 1A8EA 3RNNA 2DYXA 3K6XA 2W7YA 2PBWA 3Q28A 1B40A 3QIMA 4WEDA 1B3EA 1O64A 1H3DA 4GFRA 4YB7A 2Q2AA 4GXSB 4F29A 2VD2A 4G68A 1Y3NA 5A5XA 4KR5A 1NNPA 4KYDA 3A3CA 4JWXA 1QUJA 3ECRA 5AE4A 3TUSA 3MVZA 3O2AA 3O29A 5M2VA 1LFIA 1SDXA 3IL1B 3R7XA 4R9GA 3MP6A 5I58B 2PYYA 4PFUA 4ZZEA 3TDJA 3SEXA 2XXIA 2Z23A 2DS9A 1RYOA 1P1WA 1QJMA 3KSXA 3PPNA 4ECFA 1QVSA 3TCFA 4X48A 4YB5A 3WAEA 1Y1ZA 2V3QA 2O7IA 1IUDA 1MXZA 1B3GA 3PV0E 3T9XB 3PGFA 5ICTA 4LZ5A 5DVJA 1WVJA 2XXHA 4NEDA 2DXYA 2QRYA 3K00A 3OO9A 5CBRA 2GHBA 4MF3A 5ISUA 3PMVA 1T0KA 2OWSA 3FIRA 2H4IA 1B6HA 3Q29A 3MVWA 2DVCA 1HSLA 2E1SA 1LAXA 1POTA 1QW0A 3H6TA 1EZ9A 3IO4A 3KGCA 2O1LA 3C33A 3L6HA 3KZGA 1B4HA 1YTVA 4H5FA 1Q1KA 4O3CA 4C1TA 4TLLB 4U2RA 5HPQA 2P1SA 2V3UA 2PVUA 1BTJA 1UQWA 2I4BA 4YICA 2UVGA 4QF9A 2ANJA 3CVGA 1JVYA 2NWJA 2HEUA 3TMGA 1RKMA 3K01A 3OELA 3OO8A 5H8HB 2QMWA 3N94A 3PUWE 4G8HA 3SESA 1VFDA 5FTHA 3Q27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O7U A;  3E9X A;  3H3G A;  3LSF B;  4JWO A;  3FUZ A;  3U8Q A;  1F9B A;  3CFX A;  4DE8 A;  2QJE A;  1FTK A;  1FTO A;  3OEK A;  3TTR A;  3PPR A;  3VLU A;  3QUF A;  3PUV E;  4YKK A;  2D5W A;  3U72 A;  4Z7E A;  1JNF A;  1FW0 A;  1SW1 A;  1B1X A;  1MPB A;  3HHF A;  1ELJ A;  3S9M C;  3EQ1 A;  4G68 B;  2I0C A;  4KCC A;  4NF8 A;  2XHD A;  4IGR A;  1H43 A;  3K2D A;  3TOD A;  4JSD A;  4NF6 B;  1N7W A;  1OQH A;  1XS5 A;  2DXR A;  4GOT A;  3QUJ A;  3VXC A;  5IKB A;  4MLQ A;  4F18 A;  3B6W A;  1S50 A;  4GIZ A;  4ZEI A;  4HS7 A;  1OVT A;  4X1B A;  4DLD A;  1Y3P A;  1OIB A;  4H6D A;  4I9D A;  1B52 A;  1B46 A;  4HW8 A;  2OJT A;  1M5D A;  4LVQ A;  5F7V A;  2HAU A;  2XX8 A;  5CMM A;  2ZNS A;  1A8F A;  3PPP A;  4PFW A;  2Y7P A;  1ANF A;  5FHO A;  2A5S A;  4ESW A;  4C1U A;  1WOD A;  3FV1 A;  3C34 A;  4F39 A;  3D4G A;  2O51 A;  2ZMB A;  5FHN A;  2I3W A;  1EH3 A;  4JXI A;  3I3V A;  4OTE A;  5ELV A;  3KSJ A;  4NE4 A;  3USD A;  2H9B A;  1URG A;  4NF5 A;  3QXM A;  3VXB A;  3K02 A;  1Y4C A;  2Z8D A;  4OER A;  4U4S A;  3VDF A;  3CFZ A;  3ZS6 A;  1R9Q A;  2D3I A;  3CSB A;  4L17 A;  5DVF A;  5EYF A;  5H8F B;  1EZP A;  4HTG A;  2DWI A;  4WXJ A;  3TQL A;  5L9O A;  5BWJ A;  4O3A A;  1LST A;  1MXX A;  3THI A;  4NF5 B;  2XXU A;  1JEV A;  2QS4 A;  4RY1 A;  3VVE A;  5IAI A;  3IR1 A;  1B9J A;  4TQU Q;  4R2F A;  1USY H;  1IXI A;  1SI0 A;  1PBQ A;  3C35 A;  3U93 A;  2GHA A;  2HFB A;  4ESX A;  3PPO A;  4OFO A;  5KCJ A;  2B3B A;  2QL3 A;  5CMK A;  2ZYK A;  1LLS A;  3DP6 A;  1JVX A;  3UP9 A;  1JQF A;  1B51 A;  1LAF E;  1FQD A;  1P1Q A;  1LFH A;  3TEP A;  4NWC A;  3RT6 B;  3VV5 A;  3JYR A;  3S2V A;  1AMF A;  4H65 A;  1B3F A;  1MQJ A;  2OK2 A;  3PPQ A;  3DLN A;  1MXU A;  3GXA A;  1RYX A;  1EU8 A;  2ESN A;  4N6P A;  3K6W A;  5DVI A;  5DT6 A;  5CMB A;  4BDM A;  4BDO A;  1A99 A;  3HO7 A;  3FVO A;  2DE2 A;  2CMO A;  4NTL A;  3FGS A;  3K1P A;  3CG3 A;  4IB2 A;  2R6G E;  3IOV A;  1PBP A;  2ZNT A;  4GVO A;  5CC2 A;  5J1D A;  1KWH A;  3PMW A;  1OQG A;  3LSL A;  4RJZ A;  1MRP A;  2XX7 A;  4IO3 A;  4ZDM A;  1TXF A;  3G7W A;  3FV2 A;  4XKQ A;  1B3L A;  3MVX A;  4O3B A;  2X7Q A;  3N26 A;  2D21 A;  3T9U A;  4G8N A;  3IOT A;  2XXW A;  1N3X A;  2YJP A;  1A7L A;  3CR9 A;  3KN3 A;  3MAM A;  4FEC A;  4GLI A;  4LA9 A;  4WKM A;  1UIV A;  1YCJ A;  2B65 A;  4FOR A;  4Z0I A;  1AOV A;  1JW4 A;  1SVX B;  4JB7 A;  3SEW A;  3RT8 A;  3V89 B;  2OLB A;  2VOZ A;  4PFY A;  2REJ A;  4MLV A;  1PB8 A;  2Y84 A;  3DEL B;  4ZEF A;  4RNS A;  5AA2 D;  1JW1 A;  1B7U A;  3KEI A;  4K3F A;  1US4 A;  1SYH A;  1XC1 A;  3BFT A;  1B7Z A;  3E13 X;  5EHM A;  3MBP A;  1HSE A;  3H6V A;  4U4X A;  2GRV A;  3LC8 A;  4BLA A;  4JWY A;  4OFJ A;  4RPN A;  2DWH A;  2P0S A;  3HPI A;  1BLF A;  3W9W A;  1DTG A;  4EQ9 A;  1B1H A;  3O66 A;  3UA8 A;  1II5 A;  2V25 A;  1LGB C;  3IOU A;  1IXH A;  2F35 A;  1Y20 A;  4NF8 B;  2HZK A;  3QK6 A;  5I56 A;  3ZKK A;  1ZIU A;  2I58 A;  3FZV A;  3KOS A;  3LSX A;  1MDQ A;  4F2Q A;  1GV8 A;  4R72 A;  3FVK A;  3FJG A;  3KBR A;  3O6H A;  4GWO A;  4OMB A;  3N6U A;  5CBS A;  1IZ1 A;  3H06 B;  3CIJ A;  3TEL A;  3SDF A;  4RYA A;  4XXU A;  3E4R A;  2DWA A;  4F1V A;  4TLM B;  4F31 B;  3FD3 A;  4GRK A;  4QSC A;  5DTB A;  1GVC A;  3C36 A;  3I6V A;  3OMB A;  5H8Q B;  1SBP A;  2HXW A;  4PQJ A;  4Q5T A;  1XT8 A;  2F5X A;  5KDT A;  1B58 A;  2KLF A;  4LZ7 A;  1LCF A;  5I57 B;  5EHS A;  1ZTY A;  3IOW A;  4H0W A;  5I84 A;  4R6Y A;  5JTY A;  2H25 A;  1Y9U A;  2I6E A;  4ZS9 A;  3H03 A;  3MJN A;  3WAF A;  3LBS A;  2CZL A;  3ILU B;  1L5T A;  5H8Q A;  4LZ8 A;  1P1N A;  4LQ2 A;  2Y7W A;  1ZLQ A;  5HM4 B;  1D9V A;  2UVJ A;  3EPE A;  5H8F A;  4GQO A;  3H7M A;  3S9L C;  3ONM A;  2G29 A;  1XVY A;  4OWD A;  4U1Z A;  4THI A;  4GXA A;  2QS2 A;  3O28 A;  4ZEB A;  3E3K A;  3IX1 A;  4E0W A;  1DTZ A;  1MY2 A;  1POY 1;  2B3F A;  2YLN A;  3O6G A;  4JDF A;  1MY1 A;  3MVY A;  5AA2 B;  1NL5 A;  2OWT A;  4I1D A;  4KFQ A;  4KQP A;  3SET A;  3OEM A;  1AIV A;  2OBG A;  3CFL A;  3RLF E;  2O68 A;  3EHU A;  1MH3 A;  2VD3 A;  1S9T A;  5F1Q A;  2PMS A;  4C0R A;  3IJX B;  2I48 A;  5K2X A;  3N5L A;  4HCY A;  3G3J A;  5KDT B;  3PUY E;  2HAV A;  2DE3 A;  4R75 A;  2ONR A;  3HV1 A;  1JW5 A;  1M5E A;  2XXT A;  3HN0 A;  3I5O A;  3MZ1 A;  3KN7 A;  4IO2 A;  4U1O A;  3RN8 A;  3SEV A;  3UN6 A;  4U23 A;  1O7T A;  2LAO A;  3G3G A;  1JEU A;  4FJP A;  2Y7R A;  3S9E A;  4F3B A;  3DP4 A;  2AL4 A;  3HST A;  4P0I A;  3C31 A;  1ZBM A;  4DXU A;  5CM6 A;  5H8S A;  1YPN A;  3U92 A;  3KFM A;  1A40 A;  1QKB A;  3MZB A;  1LAH E;  3C32 A;  1MS7 A;  2DE4 A;  4H5G A;  3VVD A;  2Y7K A;  3TCG A;  3HCQ A;  4G68 C;  4EF2 A;  3MP8 A;  4LP2 B;  1MPC A;  1Z7N E;  1LB9 A;  4IO5 A;  3IOR A;  1VSO A;  2M8C A;  3K6V A;  3KOT A;  1CE2 A;  3EN3 A;  2R71 A;  4H1X A;  3F11 A;  4F3S A;  2ABH A;  1P1O A;  3QSL A;  4KYS A;  2H99 A;  4JBZ A;  3VE1 B;  3EHS A;  1FCK A;  3FVN A;  3PD8 A;  3OEN A;  4AQ4 A;  2XX9 A;  4BDL A;  1MY3 A;  3O97 A;  5JEI A;  4YMA A;  4QFN A;  5BUU A;  1H44 A;  4GF8 A;  3OXN A;  2IA4 A;  4LQ5 A;  4TOZ A;  1B0L A;  4DIG A;  3OD7 A;  1NFT A;  2IEE A;  4H8J A;  4R9F A;  4DZ1 A;  4IY5 A;  4QSE A;  2WKY A;  1MXY A;  1MDP 1;  2NOO A;  2O1M A;  4IY6 A;  3IAZ A;  1QUK A;  1VR5 A;  3K1M A;  1IXC A;  1I6Q A;  4FIM A;  2A5T B;  5DEX A;  2RC8 A;  3RGY A;  1FTL A;  1B2H A;  2QS1 A;  5H8H A;  3QAX A;  4QFP A;  3VVF A;  5I59 B;  4UAC A;  4G8M A;  2RF1 A;  2Z22 A;  1TT1 A;  2P2A A;  4POX A;  4NF4 B;  1UTB A;  4N07 A;  4ONY A;  1QUL A;  2UYE A;  4MH5 A;  2F97 A;  2V84 A;  4YU0 A;  3TYH A;  3S9N C;  1MH4 A;  2H5Y A;  4IO7 A;  4ND9 A;  4E0X A;  1US5 A;  3RQT A;  1R6Z A;  1S7Y A;  4NF6 A;  5I56 B;  4IO4 A;  2AIX A;  2XXQ A;  2THI A;  3LUY A;  3MWB A;  2F7C A;  2Y7I A;  1BIY A;  2RC7 A;  1SI1 A;  4G2Z A;  4G4P A;  4OEV A;  2ZNU A;  4N13 A;  4F22 A;  3DP8 A;  1PC3 A;  3PD9 A;  4R73 A;  1DSN A;  1Z7M E;  2H98 A;  2ZYN A;  1B5J A;  1PEB A;  2Q8J A;  4F19 A;  5I2N A;  4ZZA A;  4P11 A;  4EUO A;  3AXF A;  4RK2 A;  2DVZ A;  4EDP A;  1IQ7 A;  1MM7 A;  3K6U A;  4IO6 A;  3ZKL A;  4JSO A;  4KPT A;  3OO7 A;  4H8I A;  3CRB A;  1UTH B;  3G3F A;  4QHQ A;  4ZE8 A;  1M5F A;  5TPA A;  3SER A;  3TTL A;  4BDQ A;  3T66 A;  5A5X B;  2UVI A;  4XKR A;  3SEU A;  1B5I A;  1PDA A;  1UTB B;  5I2N B;  4YKJ A;  1URS A;  2PX1 A;  1MY0 A;  1DMB A;  3FAT A;  3H6U A;  4PE5 B;  4R6K A;  3PUZ E;  2VHA A;  1N84 A;  2O84 X;  2YPN A;  3ODB A;  3R26 A;  5TPA B;  2NVU B;  3W9V A;  1NH7 A;  1ZMG A;  2XXP A;  3L6G A;  1ZJL A;  2DSF A;  3MQ9 A;  4FED A;  1FQF A;  4YZZ A;  3SEY A;  2QS3 A;  3TZA A;  3LSW A;  1N7X A;  3FXU A;  4OHN A;  1DPE A;  4I62 A;  4AB5 A;  4BDN A;  2GH9 A;  3CG1 A;  2UVH A;  5AA4 A;  1CB6 A;  4PET A;  3DM0 A;  3RTF B;  3T9V A;  4I8C A;  3B7D A;  3U1O A;  4DXC A;  2E0S A;  1BP5 A;  1NNF A;  3TFL A;  3G3K A;  1N04 A;  4GD5 A;  3VLW A;  2Z8F A;  4KYE A;  1UTH A;  3CSG A;  3O9P A;  4OQO A;  1VFE A;  4RK9 A;  4YB6 A;  5ITO A;  2F34 A;  4QFL A;  3TCH A;  1IIT A;  2F6G A;  2QSX A;  4EQ7 A;  4ZEC A;  1QUI A;  2Z8E A;  1J1N A;  1FQE A;  1MQH A;  5ITP A;  3U94 A;  4Q8R A;  4MBP A;  5CMC A;  1IIW A;  1TFD A;  1ZU0 A;  3T22 A;  1B3H A;  2XD2 A;  2HZL A;  1Y3Q A;  3MW0 A;  3TAJ A;  3UOR A;  1SW4 A;  5B7D A;  1XVX A;  1IEJ A;  1EZO A;  1Y4T A;  2I0B A;  4PP0 A;  2QPQ A;  4EQB A;  1NNT A;  4G77 A;  3M3L A;  5AA4 B;  1N76 A;  3C4M A;  4RPO A;  1SW5 A;  2FNC A;  2OCU A;  2Q2C A;  3OO6 A;  2DOJ A;  4OXV A;  1MXV A;  1P99 A;  1XOC A;  1R9L A;  3EHT A;  2HQ0 A;  4FAT A;  2X7P A;  3JV9 A;  2XXV A;  5K2Y A;  1O63 A;  2Q89 A;  1SW2 A;  4WEP A;  3T9H B;  2XXY A;  4OES A;  1PB7 A;  4OEU A;  2NXO A;  1I69 A;  1LB8 A;  4AB6 A;  1NMU A;  1JET A;  5AA1 A;  1FTJ A;  2VP1 A;  3D4C A;  2V93 A;  1SYI A;  4KD5 A;  4MFI A;  3VLV A;  1NNK A;  1MQG A;  3T93 B;  2RIN A;  4OVJ A;  1B32 A;  5KZT A;  1NKX A;  4LUB A;  4DDD A;  1OMP A;  3KJT A;  3LR1 A;  1TFA A;  1FQA A;  2AYS A;  3R6U A;  1IXG A;  2A5T A;  3KJ7 A;  4H67 A;  3IJO B;  2OZZ A;  3IB1 A;  5DEX B;  3S4U A;  1D3K A;  5TP9 B;  3PMX A;  1FQC A;  3IB2 A;  4XIG Q;  3RUM A;  2O6A A;  4OFL A;  4ELR A;  3FVG A;  3JZJ A;  1LCT A;  2ZYM A;  4YKP A;  3V8X B;  5H8N B;  4R2B A;  4U21 A;  3TTN A;  3KG2 A;  2RC9 A;  5LOM A;  3TPA A;  3W15 C;  2REG A;  4F3P A;  4ELO A;  3UK4 A;  1OVB A;  1OLC A;  1LAG E;  2ALU A;  2F6P A;  1MXW A;  4QSD A;  4ZED A;  3M8U A;  4X1D A;  4M4G A;  4OEN A;  1LBB A;  1MQD A;  1H45 A;  1VE4 A;  5I2K A;  1A55 A;  4ZEK A;  1GGG A;  2XD3 A;  5DYH A;  1H76 A;  3HHG A;  4IGT A;  2DQV A;  4NWD A;  4ZE9 A;  3A3U A;  1B5H A;  3IO6 A;  2ONS A;  3MPL A;  2RCB A;  3BBR A;  3K4U A;  3N6T A;  5TU0 A;  5KCJ B;  4QFO A;  4NMY A;  1B4Z A;  3SKP A;  4ELP A;  4FAJ A;  2UYF A;  1PB9 A;  3FXQ A;  1Q35 A;  1XHY A;  3GLB A;  5I2K B;  2ZXT A;  2NUV A;  4LAT A;  4KI0 E;  3GBB A;  4FE8 A;  4GL0 A;  4OET A;  1P1U A;  4Q0C A;  2XXR A;  3TQW A;  1UIU A;  3BFU A;  3TTM A;  4GL8 A;  3VFJ A;  5JK4 A;  4XKN A;  2X26 A;  1BKA A;  4RXL A;  5JTY B;  1YAE A;  5AA3 A;  3K1N A;  3B6Q A;  3V5A A;  3FJM A;  1GTK A;  2F7B A;  1A54 A;  3O6I A;  1M5C A;  2F78 A;  1R1N A;  2FA7 A;  3CI8 A;  3FAS A;  4BDR A;  1ZKB A;  2QMX A;  1N0T A;  1LBC A;  1SQY A;  5AA2 A;  3QYT A;  2PT2 A;  3MUQ A;  4F2O A;  4UA8 A;  4KCD A;  2F36 A;  3GBA A;  3MC2 A;  3V83 A;  1QKA A;  2I4C A;  4F1Y A;  1M5B A;  3GZG A;  3IK6 B;  1FTM A;  3K0V A;  4R74 A;  3T96 B;  2F8D A;  2UXA A;  1MPD A;  5CRY A;  1URD A;  5L9M A;  2AL5 A;  2Q88 A;  3ZSF A;  3C9H A;  5ICQ A;  3MPK A;  4DXB A;  3M3K A;  2G93 A;  3FJ7 A;  1FQB A;  4R6H A;  3RPW A;  2FYI A;  3Q25 A;  4X9T A;  4QFK A;  4U22 A;  1AH5 A;  2I49 A;  2I3V A;  1DPP A;  1B0H A;  2RCA A;  3PU5 A;  3B6T A;  3PUX E;  3H6W A;  2VGQ A;  3MP1 A;  3MZ9 A;  4F3G A;  5B70 A;  5H8N A;  3M3F A;  3G3H A;  2DWJ A;  4EF1 A;  3H4Z A;  1I6A A;  5I58 A;  4ISU A;  3IB0 A;  4OYV A;  4RA1 A;  3FXR A;  3P7I A;  3OSR A;  4Q30 B;  2BJJ X;  4EXK A;  4DCY A;  3ILT B;  1TWY A;  4M1V A;  3RY3 A;  4KHZ E;  2O69 A;  5L8D A;  3UGW A;  4ELQ A;  4DCX A;  3OOA A;  1I6B A;  1N3W A;  1DOT A;  3RTW B;  1MG1 A;  1GR2 A;  3TTK A;  3A09 A;  1HSJ A;  1USY E;  2V3T A;  4FEB A;  5FTI A;  1WDN A;  1MQI A;  1MY4 A;  4HCW A;  5HBC A;  5I59 A;  4XTC Q;  2R9J A;  2XXX A;  1ATG A;  4NF4 A;  5I57 A;  1MM6 A;  4XKP A;  1D4N A;  3G3I A;  1B7H A;  1OLA A;  4POW A;  2HCA A;  3UIF A;  1LFG A;  5FHM A;  2F7A A;  1SD3 A;  2ONK E;  2RKM A;  3OSQ A;  2ZYO A;  4F1U A;  3TKD A;  4QRZ A;  5CI5 A;  1B05 A;  4YKI A;  1Y1M A;  4OZ9 A;  2DP8 A;  5L9S A;  4PFT A;  4EXL A;  3BKI B;  3KN8 A;  2Q9T A;  3EF7 A;  2GFE A;  1D9Y A;  4LON B;  4P0G A;  4YMB A;  4YAH X;  1AL3 A;  1NH8 A;  2PT1 A;  5TP9 A;  3Q26 A;  1A8E A;  3RNN A;  2DYX A;  3K6X A;  2W7Y A;  2PBW A;  3Q28 A;  1B40 A;  3QIM A;  4WED A;  1B3E A;  1O64 A;  1H3D A;  4GFR A;  4YB7 A;  2Q2A A;  4GXS B;  4F29 A;  2VD2 A;  4G68 A;  1Y3N A;  5A5X A;  4KR5 A;  1NNP A;  4KYD A;  3A3C A;  4JWX A;  1QUJ A;  3ECR A;  5AE4 A;  3TUS A;  3MVZ A;  3O2A A;  3O29 A;  5M2V A;  1LFI A;  1SDX A;  3IL1 B;  3R7X A;  4R9G A;  3MP6 A;  5I58 B;  2PYY A;  4PFU A;  4ZZE A;  3TDJ A;  3SEX A;  2XXI A;  2Z23 A;  2DS9 A;  1RYO A;  1P1W A;  1QJM A;  3KSX A;  3PPN A;  4ECF A;  1QVS A;  3TCF A;  4X48 A;  4YB5 A;  3WAE A;  1Y1Z A;  2V3Q A;  2O7I A;  1IUD A;  1MXZ A;  1B3G A;  3PV0 E;  3T9X B;  3PGF A;  5ICT A;  4LZ5 A;  5DVJ A;  1WVJ A;  2XXH A;  4NED A;  2DXY A;  2QRY A;  3K00 A;  3OO9 A;  5CBR A;  2GHB A;  4MF3 A;  5ISU A;  3PMV A;  1T0K A;  2OWS A;  3FIR A;  2H4I A;  1B6H A;  3Q29 A;  3MVW A;  2DVC A;  1HSL A;  2E1S A;  1LAX A;  1POT A;  1QW0 A;  3H6T A;  1EZ9 A;  3IO4 A;  3KGC A;  2O1L A;  3C33 A;  3L6H A;  3KZG A;  1B4H A;  1YTV A;  4H5F A;  1Q1K A;  4O3C A;  4C1T A;  4TLL B;  4U2R A;  5HPQ A;  2P1S A;  2V3U A;  2PVU A;  1BTJ A;  1UQW A;  2I4B A;  4YIC A;  2UVG A;  4QF9 A;  2ANJ A;  3CVG A;  1JVY A;  2NWJ A;  2HEU A;  3TMG A;  1RKM A;  3K01 A;  3OEL A;  3OO8 A;  5H8H B;  2QMW A;  3N94 A;  3PUW E;  4G8H A;  3SES A;  1VFD A;  5FTH A;  3Q27 A; 
#chains in the Genus database with same CATH topology
 3LSF B;  1FTO A;  3PPR A;  3VLU A;  1ELJ A;  2I0C A;  4IGR A;  3TOD A;  1N7W A;  1OQH A;  4GOT A;  3VXC A;  3QUJ A;  5IKB A;  1Y3P A;  1OIB A;  4X04 A;  1B46 A;  4HW8 A;  2OJT A;  4PFW A;  4ESW A;  1ANF A;  4C1U A;  1WOD A;  1FPE A;  2O51 A;  5FHN A;  1EH3 A;  4OTE A;  4N4U A;  3USD A;  4NF5 A;  2WEF A;  4P9K A;  1Y4C A;  4GWX A;  3VDF A;  5EYF A;  4L17 A;  4WXJ A;  2KR0 A;  2XXU A;  2QS4 A;  4R2F A;  1SI0 A;  1EYI A;  3U93 A;  5CMK A;  1LFH A;  1FQD A;  4GX4 A;  3LV0 A;  3S2V A;  4H65 A;  1B3F A;  5DVI A;  1EU8 A;  2ESN A;  3HO7 A;  2DE2 A;  3K1P A;  1PBP A;  5J1D A;  1KWH A;  3PMW A;  1OQG A;  4ZDM A;  1TXF A;  3MVX A;  2X7Q A;  2XXW A;  2YJP A;  3CR9 A;  2B65 A;  4FOR A;  1JW4 A;  5DW8 A;  2VOZ A;  4MLV A;  1JW1 A;  2KQZ A;  1BLF A;  4PFR A;  5IZZ A;  1RDY A;  3QK6 A;  5I56 A;  3KOS A;  5ET7 A;  3FJG A;  3KBR A;  3O6H A;  3N6U A;  4O7M A;  1LBW A;  4RYA A;  4XXU A;  3E4R A;  2DWA A;  4GRK A;  5DTB A;  4PQJ A;  3D1R A;  5I57 B;  3IOW A;  3WAF A;  4ZS9 A;  3H03 A;  2CZL A;  3ILU B;  1L5T A;  4LZ8 A;  3EPE A;  5H8F A;  3H7M A;  4OWD A;  4THI A;  4GXA A;  4ZEB A;  3E3K A;  2YLN A;  2B3F A;  5AA2 B;  5B7D A;  1NL5 A;  1AIV A;  4KFQ A;  2OBG A;  2CEY A;  2PMS A;  4C0R A;  2DE3 A;  2ONR A;  3HV1 A;  3SEV A;  2Y5L A;  2LAO A;  1JEU A;  2Y7R A;  3DP4 A;  4P0I A;  3A29 A;  1QKB A;  1MS7 A;  3VVD A;  3HCQ A;  1LB9 A;  4IO5 A;  2M8C A;  1FPL A;  2R71 A;  4JBZ A;  2XX9 A;  4BDL A;  4JVI A;  4GBV A;  4N8G A;  1NFT A;  4DZ1 A;  4QSE A;  4IY6 A;  1VR5 A;  5DEX A;  1DBZ A;  3VVF A;  4G61 A;  4QFP A;  4UAC A;  4G8M A;  1TT1 A;  4MH5 A;  3S9N C;  1MH4 A;  4E0X A;  4NF6 A;  2AIX A;  4G2Z A;  2Y7I A;  5EYG A;  5J16 A;  3RPL B;  4OEV A;  2ZNU A;  2ZYN A;  4P11 A;  4EDP A;  3K6U A;  4JSO A;  3OO7 A;  4H8I A;  1UTH B;  3G3F A;  4ZE8 A;  5TPA A;  1M5F A;  4BDQ A;  1URS A;  1MY0 A;  3H6U A;  4PE5 B;  3MQ9 A;  3L6G A;  3T0J A;  3LSW A;  3FXU A;  4PTK A;  2UVH A;  5AA4 A;  3T9V A;  4DXC A;  3U1O A;  1FPD A;  1NNF A;  4GD5 A;  3VLW A;  1FBF A;  1UTH A;  4OQO A;  3O9P A;  3TCH A;  1IIT A;  2F6G A;  2QSX A;  1QUI A;  4MHF A;  1IIW A;  3T22 A;  1B3H A;  2XD2 A;  1IEJ A;  2I0B A;  4MJO A;  2DDK A;  2OCU A;  2DOJ A;  1KA1 A;  3EHT A;  2X7P A;  3JV9 A;  1O63 A;  5IZ3 A;  4GX6 A;  1I69 A;  1JET A;  4I3E A;  2B4L A;  4I3Y A;  2RIN A;  4QXD A;  5DEX B;  3KJ7 A;  3IJO B;  5TP9 B;  3RUM A;  4OFL A;  4ELR A;  2ZYM A;  2MKZ A;  5H8N B;  4R2B A;  4ELO A;  4P47 A;  4MX6 A;  3M8U A;  4X1D A;  1MQD A;  1VE4 A;  1GGG A;  2WBB A;  3IO6 A;  2RCB A;  3BBR A;  3SKP A;  4ELP A;  5I2K B;  1Q35 A;  2ZXT A;  4LAT A;  4MNC A;  4KI0 E;  3GBB A;  4OET A;  1P1U A;  1IMD A;  4QBA A;  3BFU A;  3VFJ A;  4XKN A;  2X26 A;  1BKA A;  5AA3 A;  3K1N A;  3V5A A;  3FJM A;  1A54 A;  3O6I A;  2FA7 A;  3T1B A;  2QMX A;  1FPJ A;  2F36 A;  3MC2 A;  4F1Y A;  3GZG A;  4R74 A;  3K0V A;  3T96 B;  4O8M A;  1MPD A;  1URD A;  3ZSF A;  3C9H A;  3MPK A;  1DK4 A;  3M3K A;  3PUX E;  1RDZ A;  4F31 B;  3PU5 A;  3B6T A;  3M3F A;  3G3H A;  4EF1 A;  3IB0 A;  4OYV A;  2B4M A;  3P7I A;  1TWY A;  4KHZ E;  4ELQ A;  3RTW B;  3TTK A;  1USY E;  5I59 A;  4HCW A;  1MQI A;  1MY4 A;  2R9J A;  4MCO A;  1OLA A;  4POW A;  1SD3 A;  3OSQ A;  3BKI B;  1D9Y A;  4YAH X;  1NH8 A;  2W7Y A;  1B40 A;  4PGN A;  4YB7 A;  1H3D A;  4GXS B;  4MAG A;  5AE4 A;  3TUS A;  3MVZ A;  5M2V A;  1SDX A;  3IL1 B;  2CZI A;  4ZZE A;  3TDJ A;  2DS9 A;  1RYO A;  1QJM A;  1QVS A;  3TCF A;  4X48 A;  2O7I A;  5DVJ A;  1WVJ A;  2XXH A;  2XWI A;  2DXY A;  3OO9 A;  1B6H A;  3Q29 A;  1YXI A;  1D9Q A;  4P1E A;  3H6T A;  3IO4 A;  1YTV A;  5HPQ A;  2UVG A;  3CVG A;  3TMG A;  5H8H B;  4G8H A;  3PUW E;  2FYI A;  3Q27 A;  2O7U A;  1FTK A;  4YKK A;  4PE3 A;  4Z7E A;  1JNF A;  1SW1 A;  1B1X A;  1MPB A;  3HHF A;  3K2D A;  4NF6 B;  3RPL A;  4HS7 A;  1OVT A;  4PF8 A;  4I9D A;  1M5D A;  4LVQ A;  4GWS A;  5CMM A;  4F39 A;  3FV1 A;  3C34 A;  5ELV A;  3I3V A;  4NQ8 A;  4NE4 A;  3QXM A;  3K02 A;  4U4S A;  4MIJ A;  4HTG A;  3BIG A;  1MXX A;  5IAI A;  4TQU Q;  1USY H;  1IXI A;  2GHA A;  4H45 A;  4ESX A;  2B3B A;  2ZYK A;  3DP6 A;  1JVX A;  1B51 A;  1P1Q A;  4NWC A;  2OK2 A;  3DLN A;  5DT6 A;  5CMB A;  4BDO A;  4NTL A;  3FGS A;  1FBE A;  3CG3 A;  4IB2 A;  3IOV A;  2ZNT A;  1MRP A;  2XX7 A;  4IO3 A;  4XKQ A;  2D21 A;  1N3X A;  3KN3 A;  3MAM A;  4GLI A;  1UIV A;  1YCJ A;  1K9Z A;  3V89 B;  3RT8 A;  4PFY A;  2REJ A;  5AA2 D;  1XI6 A;  1B7U A;  5F7V A;  4K3F A;  1XC1 A;  3BFT A;  3MBP A;  4NHB A;  4MMP A;  4U4X A;  4JVD A;  4BLA A;  2DWH A;  1G0I A;  3O66 A;  4OVT A;  2V25 A;  3IOU A;  1IXH A;  4PBH A;  1IMF A;  3LSX A;  4R72 A;  3FVK A;  1NV5 A;  2CEX A;  1FSA A;  3TEL A;  3FBP A;  4P56 A;  3C36 A;  4FBP A;  4JVC A;  2HXW A;  2KLF A;  4LZ7 A;  1FPF A;  1ZTY A;  1Y9U A;  1P1N A;  2Y7W A;  1ZLQ A;  2UVJ A;  3S9L C;  2G29 A;  4U1Z A;  4OVP A;  3O28 A;  1MY2 A;  3O6G A;  4I1D A;  5I3S A;  3OEM A;  3CFL A;  3EHU A;  2VD3 A;  4AS5 A;  5K2X A;  3N5L A;  4HCY A;  2HAV A;  4R75 A;  4IO2 A;  1M5E A;  2XXT A;  4U1O A;  4FJP A;  4N6D A;  2AL4 A;  5IGA A;  5CM6 A;  5H8S A;  1YPN A;  3U92 A;  4H5G A;  4G68 C;  1Z7N E;  1VSO A;  3KOT A;  1CE2 A;  1P1O A;  2H99 A;  1FCK A;  3FVN A;  2XXK A;  1MY3 A;  1B0L A;  3OD7 A;  4IY5 A;  1MDP 1;  3IAZ A;  1QUK A;  3K1M A;  1IXC A;  1KZ8 A;  2A5T B;  5H8H A;  1B2H A;  2Z22 A;  2P2A A;  4HXV A;  4ONY A;  4N07 A;  2FVZ A;  4YU0 A;  3TYH A;  2H5Y A;  4ND9 A;  1S7Y A;  5I56 B;  3LUY A;  2THI A;  1BIY A;  4N13 A;  3DP8 A;  5F24 A;  4R73 A;  4F19 A;  1B5J A;  2DVZ A;  3CRB A;  5A5X B;  2QVU A;  4P1L A;  1DMB A;  1FBC A;  2XXP A;  2DSF A;  3SEY A;  1FQF A;  4YZZ A;  1N7X A;  4BDN A;  4OHN A;  1DPE A;  2CZH A;  4PET A;  2E0S A;  3TFL A;  2Z8F A;  5IM2 A;  5ITO A;  1K9Y A;  2VT5 A;  1FQE A;  1INP A;  1ZU0 A;  1XVX A;  3LUZ A;  4EQB A;  3IFA A;  1NNT A;  4G77 A;  1N76 A;  1XOC A;  4FAT A;  2HQ0 A;  5K2Y A;  1SW2 A;  4WEP A;  1NUX A;  4OEU A;  1LB8 A;  1FTJ A;  1SYI A;  1NNK A;  1B32 A;  1NKX A;  3LR1 A;  1TFA A;  1FQA A;  2AYS A;  2WYP A;  3R6U A;  2A5T A;  4H67 A;  2OZZ A;  3PMX A;  4XIG Q;  2O6A A;  3JZJ A;  5EQ7 A;  4YKP A;  3KG2 A;  5LOM A;  5I7I A;  4F3P A;  2VPO A;  3W15 C;  4ZED A;  4QSD A;  3CHG A;  4M4G A;  1FJ6 A;  1A55 A;  1IMC A;  2XD3 A;  5DYH A;  1H76 A;  4ZE9 A;  5TU0 A;  5KCJ B;  4NMY A;  2XXR A;  3TTM A;  5JK4 A;  4RXL A;  3B6Q A;  2F7B A;  2HPG A;  1M5C A;  4N91 A;  3CI8 A;  1R1N A;  1N0T A;  1SQY A;  2PT2 A;  4F2O A;  1QKA A;  4P3L A;  1FTM A;  5BUU A;  2AL5 A;  2G93 A;  2P3V A;  3FJ7 A;  1FQB A;  3RPW A;  4U22 A;  1AH5 A;  1DPP A;  3MZ9 A;  5ESY A;  5LDZ A;  3OSR A;  2BJJ X;  3ILT B;  3RY3 A;  5IZ3 B;  5L8D A;  3UGW A;  1I6B A;  3FXB A;  3A09 A;  1HSJ A;  5HBC A;  4FEB A;  1LBX A;  4XTC Q;  2XXX A;  4NF4 A;  1MM6 A;  4GBW A;  4XEQ A;  1B7H A;  4NX1 A;  5EQA A;  2RKM A;  4O7I A;  2ZYO A;  1B05 A;  4DI4 B;  1Y1M A;  4PFT A;  2GFE A;  4LON B;  4P0G A;  4MEV A;  1AL3 A;  2PT1 A;  1A8E A;  2WBD A;  3Q28 A;  4WED A;  1B3E A;  1O64 A;  3A3C A;  4JWX A;  1QUJ A;  3ECR A;  5ET8 A;  3O29 A;  3MP6 A;  2PYY A;  1YYZ A;  3PPN A;  3KSX A;  4YB5 A;  1IUD A;  3PV0 E;  5ICT A;  4LZ5 A;  5ET6 A;  5ISU A;  3FIR A;  2DVC A;  1EZ9 A;  3L6H A;  4H5F A;  1LBY A;  1Q1K A;  3EKI A;  2P3N A;  1BTJ A;  1UQW A;  2V4C A;  1RKM A;  3N94 A;  4R9G A;  5FTH A;  3E9X A;  3H3G A;  4JWO A;  3FUZ A;  3U8Q A;  4DE8 A;  3CFX A;  2QJE A;  3OEK A;  3TTR A;  4N8Y A;  2D5W A;  3U72 A;  4GWZ A;  3E79 A;  4NF8 A;  5I57 A;  4JSD A;  4GX3 A;  1S50 A;  4ZEI A;  4I40 A;  1A8F A;  3PPP A;  2Y7P A;  2A5S A;  1LBZ A;  2I3W A;  4UAB A;  2H9B A;  2Z8D A;  2PFZ A;  2HXR A;  3CFZ A;  3ZS6 A;  1R9Q A;  3CSB A;  5DVF A;  3MST A;  4N6K A;  5L9O A;  5BWJ A;  1LST A;  3THI A;  1FBD A;  3VVE A;  4RY1 A;  3IR1 A;  1B9J A;  1PBQ A;  2HFB A;  3PPO A;  2VPN A;  5KCJ A;  1LAF E;  3B50 A;  3RT6 B;  3VV5 A;  3JYR A;  1FBP A;  1AMF A;  1MQJ A;  1RYX A;  1A99 A;  3FVO A;  2R6G E;  4NF0 A;  4GVO A;  5CC2 A;  4RJZ A;  1FBH A;  1A7L A;  2JJK A;  4LA9 A;  4WKM A;  1SVX B;  4ZEF A;  3DEL B;  2Y84 A;  4RNS A;  3KEI A;  1US4 A;  1B7Z A;  1HSE A;  3H6V A;  3LC8 A;  4JWY A;  1DCU A;  4OFJ A;  3HPI A;  1DTG A;  3MYU A;  3UA8 A;  3PTY A;  1LGB C;  2F35 A;  4NF8 B;  3ZKK A;  1ZIU A;  2I58 A;  1MDQ A;  4GWO A;  5CBS A;  3H06 B;  3SDF A;  4TLM B;  2HHM A;  4QSC A;  3I6V A;  1SBP A;  1XT8 A;  2F5X A;  1LCF A;  5I84 A;  4R6Y A;  2H25 A;  2I6E A;  3LBS A;  4OAN A;  5H8Q A;  5HM4 B;  1D9V A;  3ONM A;  1XVY A;  4E0W A;  1POY 1;  3MVY A;  4KQP A;  3RLF E;  1MH3 A;  3IJX B;  2I48 A;  3PUY E;  4EQ9 A;  1JW5 A;  3MZ1 A;  3UN6 A;  1O7T A;  1FTA A;  3S9E A;  4P8B A;  1ZBM A;  4DI3 D;  3MZB A;  1LAH E;  3MP8 A;  4PDH A;  1MPC A;  3B8B A;  3IOR A;  3K6V A;  3F11 A;  2ABH A;  3QSL A;  2BJI A;  3EHS A;  3OEN A;  1FPI A;  4O94 A;  4QFN A;  4GF8 A;  4TOZ A;  2IA4 A;  4LQ5 A;  4N81 A;  2IEE A;  1CNQ A;  1MXY A;  2NOO A;  1I6Q A;  2RC8 A;  3RGY A;  1FTL A;  5I59 B;  3QAX A;  4POX A;  4NF4 B;  1UTB A;  1QUL A;  2UYE A;  2F97 A;  4IO7 A;  3RQT A;  1R6Z A;  3MWB A;  2F7C A;  2RC7 A;  1SI1 A;  4G4P A;  1PC3 A;  3PD9 A;  1PEB A;  4ZZA A;  4EUO A;  4RK2 A;  3RYD A;  3ZKL A;  4NGU A;  1QGX A;  4QHQ A;  3TTL A;  3SER A;  1B5I A;  1PDA A;  1UTB B;  5I2N B;  4YKJ A;  3FAT A;  3PUZ E;  2YPN A;  2O84 X;  3R26 A;  1NH7 A;  1ZMG A;  4FED A;  1ZJL A;  2QS3 A;  1NUZ A;  1NV0 A;  2GH9 A;  1CB6 A;  3RTF B;  2XWK A;  3B7D A;  1BP5 A;  3G3K A;  1N04 A;  2ZZX A;  4KYE A;  1VFE A;  4RK9 A;  2F34 A;  4QFL A;  4EQ7 A;  2Q8M A;  2QVR A;  1J1N A;  4MBP A;  5CMC A;  2ZZV A;  2HZL A;  3TAJ A;  3UOR A;  1Y4T A;  4PCD A;  4PP0 A;  2QPQ A;  3M3L A;  3C4M A;  1SW5 A;  4OXV A;  2FNC A;  1MXV A;  1RDX A;  2XXY A;  4OES A;  2PCR A;  1PB7 A;  2NXO A;  1NMU A;  5AA1 A;  3D4C A;  2V93 A;  1FPK A;  4MFI A;  3VLV A;  5EQ8 A;  1MQG A;  4OVJ A;  1OMP A;  3KJT A;  2PFY A;  4X8R A;  3KC0 A;  1IXG A;  3S4U A;  4GWY A;  1D3K A;  4GWU A;  1FQC A;  1NUW A;  4GWW A;  3FVG A;  1LCT A;  3V8X B;  3TTN A;  1OLC A;  1LAG E;  2F6P A;  1MXW A;  4H46 A;  4OEN A;  1LBB A;  4NN3 A;  5I2K A;  4ZEK A;  2DQV A;  4NWD A;  4PDD A;  3HFU A;  1B5H A;  1NV2 A;  3BIH A;  4QFO A;  2UYF A;  1PB9 A;  3FXQ A;  1XHY A;  2NUV A;  5ET5 A;  4GL8 A;  2F3D A;  5JTY B;  1NV3 A;  1FJ9 A;  2F78 A;  3KC1 A;  3FAS A;  1ZKB A;  5AA2 A;  1VDW A;  3GBA A;  2I4C A;  1M5B A;  3IK6 B;  2F8D A;  2UXA A;  5ICQ A;  2Q88 A;  1AWB A;  4R6H A;  3Q25 A;  2I3V A;  1B0H A;  3H6W A;  4F3G A;  3H4Z A;  1I6A A;  1G0H A;  4ISU A;  4RA1 A;  4DCY A;  2O69 A;  4DCX A;  5FBP A;  1DOT A;  5FTI A;  1ATG A;  4XKP A;  3ROJ A;  2HCA A;  2GQ1 A;  3UIF A;  5FHM A;  4NG7 A;  3TKD A;  1IME A;  4QRZ A;  4YKI A;  5L9S A;  4XF5 A;  4EXL A;  4IR8 A;  2Q9T A;  3EF7 A;  4YMB A;  5TP9 A;  3Q26 A;  2DYX A;  3QIM A;  4KR5 A;  1FRP A;  1YZ0 A;  3E78 A;  4LN5 A;  1LFI A;  3R7X A;  5I58 B;  4PFU A;  2XWO A;  2XXI A;  1Y1Z A;  2V3Q A;  4HE0 A;  3SZP A;  1MXZ A;  1B3G A;  2WX9 A;  1KA0 A;  3PGF A;  4NED A;  3K00 A;  4MF3 A;  3PMV A;  5I5P A;  1T0K A;  3MVW A;  1POT A;  1HSL A;  1LAX A;  2E1S A;  1QW0 A;  4ZEC A;  3KGC A;  2O1L A;  4O3C A;  4PAK A;  3KZG A;  1B4H A;  4FAJ A;  4U2R A;  2P1S A;  2I4B A;  4QF9 A;  4KXP A;  2NWJ A;  3OEL A;  2QMW A;  3SES A;  1VFD A;  4OVR A;  1NV1 A;  1F9B A;  3NOH A;  3QUF A;  3PUV E;  1IMA A;  4PBQ A;  1FW0 A;  3S9M C;  3EQ1 A;  4G68 B;  4KCC A;  2XHD A;  1H43 A;  5IZ1 A;  1XS5 A;  2DXR A;  2F3B A;  4MLQ A;  4F18 A;  3B6W A;  4GIZ A;  4X1B A;  4DLD A;  2CZK A;  4H6D A;  2XA5 A;  4MNP A;  1B52 A;  2HAU A;  2XX8 A;  2ZNS A;  5FHO A;  3D4G A;  2ZMB A;  4JXI A;  3KSJ A;  3VXB A;  1URG A;  4OER A;  2D3I A;  5H8F B;  1EZP A;  2DWI A;  3TQL A;  4O3A A;  4NF5 B;  1JEV A;  3C35 A;  4OFO A;  2QL3 A;  1LLS A;  3UP9 A;  1JQF A;  1NV4 A;  3TEP A;  1NV7 A;  3PPQ A;  1MXU A;  3GXA A;  4N6P A;  3K6W A;  4BDM A;  2CMO A;  4PFI A;  3GYY A;  3LSL A;  3G7W A;  3FV2 A;  1B3L A;  4O3B A;  3N26 A;  3T9U A;  4G8N A;  3IOT A;  4FEC A;  2Y5K A;  4N15 A;  4Z0I A;  1AOV A;  4JB7 A;  3SEW A;  2OLB A;  1PB8 A;  1SYH A;  3E13 X;  5EHM A;  2GRV A;  2P0S A;  3W9W A;  1B1H A;  2ZZW A;  4PF6 A;  1II5 A;  2FBP A;  1Y20 A;  2HZK A;  4F2Q A;  3FZV A;  1GV8 A;  4OMB A;  1IZ1 A;  3CIJ A;  4F1V A;  3FD3 A;  1GVC A;  5H8Q B;  3OMB A;  4OA4 A;  4Q5T A;  1Q9D A;  5KDT A;  1B58 A;  5EHS A;  4H0W A;  5JTY A;  3MJN A;  4LQ2 A;  4GQO A;  2QS2 A;  3IX1 A;  1DTZ A;  4JDF A;  1MY1 A;  2OWT A;  3SET A;  2O68 A;  5F1Q A;  1S9T A;  1NV6 A;  5KDT B;  3G3J A;  5CRY A;  3HN0 A;  3I5O A;  4PGP A;  3KN7 A;  3RN8 A;  4U23 A;  3G3G A;  4F3B A;  2XWV A;  3HST A;  3C31 A;  4DXU A;  3KFM A;  1A40 A;  3C32 A;  5LTC A;  2DE4 A;  2Y7K A;  3TCG A;  4EF2 A;  4LP2 B;  4NAP A;  3EN3 A;  4H1X A;  4F3S A;  4KYS A;  3VE1 B;  3PD8 A;  4AQ4 A;  5T3J A;  3O97 A;  5JEI A;  4YMA A;  2OX3 A;  1H44 A;  3OXN A;  4DIG A;  4R9F A;  4H8J A;  2WKY A;  2O1M A;  4FIM A;  4XFE A;  2QS1 A;  4PFB A;  2RF1 A;  1JP4 A;  2V84 A;  1US5 A;  4HE1 A;  4IO4 A;  2XXQ A;  4F22 A;  1DSN A;  1Z7M E;  2H98 A;  5I2N A;  3AXF A;  1IQ7 A;  1MM7 A;  4IO6 A;  4KPT A;  3T66 A;  2UVI A;  4XKR A;  3SEU A;  4MNI A;  3QMF A;  2PX1 A;  4R6K A;  2VHA A;  1N84 A;  3ODB A;  5TPA B;  2NVU B;  3W9V A;  3TZA A;  4I62 A;  4AB5 A;  1EYK A;  3CG1 A;  4PC9 A;  3DM0 A;  4I8C A;  3CSG A;  4YB6 A;  2Z8E A;  5A5L A;  1MQH A;  5ITP A;  1LBV A;  3U94 A;  4Q8R A;  1TFD A;  1NUY A;  1Y3Q A;  3MW0 A;  1SW4 A;  1EZO A;  5AA4 B;  4RPO A;  2WYK A;  4AS4 A;  2Q2C A;  3OO6 A;  1P99 A;  1R9L A;  2XXV A;  1EYJ A;  2Q89 A;  3T9H B;  4AB6 A;  2VP1 A;  4KD5 A;  3T93 B;  1BK4 A;  4OVQ A;  4LUB A;  4DDD A;  5KZT A;  1FBG A;  3IB1 A;  3IB2 A;  4U21 A;  2RC9 A;  2L5V A;  2Q74 A;  2REG A;  3TPA A;  3UK4 A;  1OVB A;  2ALU A;  2QFL A;  3U65 A;  1H45 A;  3HHG A;  4IGT A;  3A3U A;  3MPL A;  2ONS A;  1SPI A;  3K4U A;  3N6T A;  1B4Z A;  2FIE A;  3GLB A;  4RPN A;  4FE8 A;  4GL0 A;  4Q0C A;  3TQW A;  1UIU A;  1YAE A;  4N17 A;  1GTK A;  4BDR A;  2QVV A;  1LBC A;  3QYT A;  3MUQ A;  4UA8 A;  4KCD A;  4PAI A;  3V83 A;  5L9M A;  4DXB A;  2OWZ A;  4PAF A;  4X9T A;  4QFK A;  4OVS A;  2I49 A;  2RCA A;  2VGQ A;  3MP1 A;  5B70 A;  5H8N A;  2DWJ A;  4HE2 A;  5I58 A;  3FXR A;  4Q30 B;  4EXK A;  4M1V A;  2FHY A;  3OOA A;  1N3W A;  1MG1 A;  1GR2 A;  2V3T A;  1WDN A;  3KBZ A;  5EQ9 A;  1D4N A;  3G3I A;  1LFG A;  2F7A A;  2ONK E;  4F1U A;  5CI5 A;  4OZ9 A;  2DP8 A;  3KN8 A;  1NI9 A;  2R8T A;  3RNN A;  3K6X A;  2PBW A;  1LEV A;  4GFR A;  2Q2A A;  4F29 A;  2VD2 A;  4G68 A;  1Y3N A;  5A5X A;  3ISP A;  1NNP A;  4KYD A;  5EYH A;  3O2A A;  3SEX A;  2Z23 A;  1IMB A;  1P1W A;  4ECF A;  3WAE A;  3T9X B;  2QRY A;  1FPG A;  5CBR A;  3IFC A;  2GHB A;  2OWS A;  2H4I A;  2Q8J A;  3C33 A;  4C1T A;  4TLL B;  2V3U A;  2FIX A;  2PVU A;  4YIC A;  2ANJ A;  1JVY A;  2HEU A;  3K01 A;  3OO8 A;  1FPB A; 
#chains in the Genus database with same CATH homology
 2O7U A;  3E9X A;  3H3G A;  3LSF B;  4JWO A;  3FUZ A;  3U8Q A;  1F9B A;  3CFX A;  4DE8 A;  2QJE A;  1FTK A;  1FTO A;  3OEK A;  3TTR A;  3PPR A;  3VLU A;  3QUF A;  3PUV E;  4YKK A;  2D5W A;  3U72 A;  4Z7E A;  1JNF A;  1FW0 A;  1SW1 A;  1B1X A;  1MPB A;  3HHF A;  1ELJ A;  3S9M C;  3EQ1 A;  4G68 B;  2I0C A;  4KCC A;  4NF8 A;  2XHD A;  4IGR A;  1H43 A;  3K2D A;  3TOD A;  4JSD A;  4NF6 B;  1N7W A;  1OQH A;  1XS5 A;  2DXR A;  4GOT A;  3QUJ A;  3VXC A;  5IKB A;  4MLQ A;  4F18 A;  3B6W A;  1S50 A;  4GIZ A;  4ZEI A;  4HS7 A;  1OVT A;  4X1B A;  4DLD A;  1Y3P A;  1OIB A;  4H6D A;  4I9D A;  1B52 A;  1B46 A;  4HW8 A;  2OJT A;  1M5D A;  4LVQ A;  5F7V A;  2HAU A;  2XX8 A;  5CMM A;  2ZNS A;  1A8F A;  3PPP A;  4PFW A;  2Y7P A;  1ANF A;  5FHO A;  2A5S A;  4ESW A;  4C1U A;  1WOD A;  3FV1 A;  3C34 A;  4F39 A;  3D4G A;  2O51 A;  2ZMB A;  5FHN A;  2I3W A;  1EH3 A;  4JXI A;  3I3V A;  4OTE A;  5ELV A;  3KSJ A;  4NE4 A;  3USD A;  2H9B A;  1URG A;  4NF5 A;  3QXM A;  3VXB A;  3K02 A;  1Y4C A;  2Z8D A;  4OER A;  4U4S A;  3VDF A;  3CFZ A;  3ZS6 A;  1R9Q A;  2D3I A;  3CSB A;  4L17 A;  5DVF A;  5EYF A;  5H8F B;  1EZP A;  4HTG A;  2DWI A;  4WXJ A;  3TQL A;  5L9O A;  5BWJ A;  4O3A A;  1LST A;  1MXX A;  3THI A;  4NF5 B;  2XXU A;  1JEV A;  2QS4 A;  4RY1 A;  3VVE A;  5IAI A;  3IR1 A;  1B9J A;  4TQU Q;  4R2F A;  1USY H;  1IXI A;  1SI0 A;  1PBQ A;  3C35 A;  3U93 A;  2GHA A;  2HFB A;  4ESX A;  3PPO A;  4OFO A;  5KCJ A;  2B3B A;  2QL3 A;  5CMK A;  2ZYK A;  1LLS A;  3DP6 A;  1JVX A;  3UP9 A;  1JQF A;  1B51 A;  1LAF E;  1FQD A;  1P1Q A;  1LFH A;  3TEP A;  4NWC A;  3RT6 B;  3VV5 A;  3JYR A;  3S2V A;  1AMF A;  4H65 A;  1B3F A;  1MQJ A;  2OK2 A;  3PPQ A;  3DLN A;  1MXU A;  3GXA A;  1RYX A;  1EU8 A;  2ESN A;  4N6P A;  3K6W A;  5DVI A;  5DT6 A;  5CMB A;  4BDM A;  4BDO A;  1A99 A;  3HO7 A;  3FVO A;  2DE2 A;  2CMO A;  4NTL A;  3FGS A;  3K1P A;  3CG3 A;  4IB2 A;  2R6G E;  3IOV A;  1PBP A;  2ZNT A;  4GVO A;  5CC2 A;  5J1D A;  1KWH A;  3PMW A;  1OQG A;  3LSL A;  4RJZ A;  1MRP A;  2XX7 A;  4IO3 A;  4ZDM A;  1TXF A;  3G7W A;  3FV2 A;  4XKQ A;  1B3L A;  3MVX A;  4O3B A;  2X7Q A;  3N26 A;  2D21 A;  3T9U A;  4G8N A;  3IOT A;  2XXW A;  1N3X A;  2YJP A;  1A7L A;  3CR9 A;  3KN3 A;  3MAM A;  4FEC A;  4GLI A;  4LA9 A;  4WKM A;  1UIV A;  1YCJ A;  2B65 A;  4FOR A;  4Z0I A;  1AOV A;  1JW4 A;  1SVX B;  4JB7 A;  3SEW A;  3RT8 A;  3V89 B;  2OLB A;  2VOZ A;  4PFY A;  2REJ A;  4MLV A;  1PB8 A;  2Y84 A;  3DEL B;  4ZEF A;  4RNS A;  5AA2 D;  1JW1 A;  1B7U A;  3KEI A;  4K3F A;  1US4 A;  1SYH A;  1XC1 A;  3BFT A;  1B7Z A;  3E13 X;  5EHM A;  3MBP A;  1HSE A;  3H6V A;  4U4X A;  2GRV A;  3LC8 A;  4BLA A;  4JWY A;  4OFJ A;  4RPN A;  2DWH A;  2P0S A;  3HPI A;  1BLF A;  3W9W A;  1DTG A;  4EQ9 A;  1B1H A;  3O66 A;  3UA8 A;  1II5 A;  2V25 A;  1LGB C;  3IOU A;  1IXH A;  2F35 A;  1Y20 A;  4NF8 B;  2HZK A;  3QK6 A;  5I56 A;  3ZKK A;  1ZIU A;  2I58 A;  3FZV A;  3KOS A;  3LSX A;  1MDQ A;  4F2Q A;  1GV8 A;  4R72 A;  3FVK A;  3FJG A;  3KBR A;  3O6H A;  4GWO A;  4OMB A;  3N6U A;  5CBS A;  1IZ1 A;  3H06 B;  3CIJ A;  3TEL A;  3SDF A;  4RYA A;  4XXU A;  3E4R A;  2DWA A;  4F1V A;  4TLM B;  4F31 B;  3FD3 A;  4GRK A;  4QSC A;  5DTB A;  1GVC A;  3C36 A;  3I6V A;  3OMB A;  5H8Q B;  1SBP A;  2HXW A;  4PQJ A;  4Q5T A;  1XT8 A;  2F5X A;  5KDT A;  1B58 A;  2KLF A;  4LZ7 A;  1LCF A;  5I57 B;  5EHS A;  1ZTY A;  3IOW A;  4H0W A;  5I84 A;  4R6Y A;  5JTY A;  2H25 A;  1Y9U A;  2I6E A;  4ZS9 A;  3H03 A;  3MJN A;  3WAF A;  3LBS A;  2CZL A;  3ILU B;  1L5T A;  5H8Q A;  4LZ8 A;  1P1N A;  4LQ2 A;  2Y7W A;  1ZLQ A;  5HM4 B;  1D9V A;  2UVJ A;  3EPE A;  5H8F A;  4GQO A;  3H7M A;  3S9L C;  3ONM A;  2G29 A;  1XVY A;  4OWD A;  4U1Z A;  4THI A;  4GXA A;  2QS2 A;  3O28 A;  4ZEB A;  3E3K A;  3IX1 A;  4E0W A;  1DTZ A;  1MY2 A;  1POY 1;  2B3F A;  2YLN A;  3O6G A;  4JDF A;  1MY1 A;  3MVY A;  5AA2 B;  1NL5 A;  2OWT A;  4I1D A;  4KFQ A;  4KQP A;  3SET A;  3OEM A;  1AIV A;  2OBG A;  3CFL A;  3RLF E;  2O68 A;  3EHU A;  1MH3 A;  2VD3 A;  1S9T A;  5F1Q A;  2PMS A;  4C0R A;  3IJX B;  2I48 A;  5K2X A;  3N5L A;  4HCY A;  3G3J A;  5KDT B;  3PUY E;  2HAV A;  2DE3 A;  4R75 A;  2ONR A;  3HV1 A;  1JW5 A;  1M5E A;  2XXT A;  3HN0 A;  3I5O A;  3MZ1 A;  3KN7 A;  4IO2 A;  4U1O A;  3RN8 A;  3SEV A;  3UN6 A;  4U23 A;  1O7T A;  2LAO A;  3G3G A;  1JEU A;  4FJP A;  2Y7R A;  3S9E A;  4F3B A;  3DP4 A;  2AL4 A;  3HST A;  4P0I A;  3C31 A;  1ZBM A;  4DXU A;  5CM6 A;  5H8S A;  1YPN A;  3U92 A;  3KFM A;  1A40 A;  1QKB A;  3MZB A;  1LAH E;  3C32 A;  1MS7 A;  2DE4 A;  4H5G A;  3VVD A;  2Y7K A;  3TCG A;  3HCQ A;  4G68 C;  4EF2 A;  3MP8 A;  4LP2 B;  1MPC A;  1Z7N E;  1LB9 A;  4IO5 A;  3IOR A;  1VSO A;  2M8C A;  3K6V A;  3KOT A;  1CE2 A;  3EN3 A;  2R71 A;  4H1X A;  3F11 A;  4F3S A;  2ABH A;  1P1O A;  3QSL A;  4KYS A;  2H99 A;  4JBZ A;  3VE1 B;  3EHS A;  1FCK A;  3FVN A;  3PD8 A;  3OEN A;  4AQ4 A;  2XX9 A;  4BDL A;  1MY3 A;  3O97 A;  5JEI A;  4YMA A;  4QFN A;  5BUU A;  1H44 A;  4GF8 A;  3OXN A;  2IA4 A;  4LQ5 A;  4TOZ A;  1B0L A;  4DIG A;  3OD7 A;  1NFT A;  2IEE A;  4H8J A;  4R9F A;  4DZ1 A;  4IY5 A;  4QSE A;  2WKY A;  1MXY A;  1MDP 1;  2NOO A;  2O1M A;  4IY6 A;  3IAZ A;  1QUK A;  1VR5 A;  3K1M A;  1IXC A;  1I6Q A;  4FIM A;  2A5T B;  5DEX A;  2RC8 A;  3RGY A;  1FTL A;  1B2H A;  2QS1 A;  5H8H A;  3QAX A;  4QFP A;  3VVF A;  5I59 B;  4UAC A;  4G8M A;  2RF1 A;  2Z22 A;  1TT1 A;  2P2A A;  4POX A;  4NF4 B;  1UTB A;  4N07 A;  4ONY A;  1QUL A;  2UYE A;  4MH5 A;  2F97 A;  2V84 A;  4YU0 A;  3TYH A;  3S9N C;  1MH4 A;  2H5Y A;  4IO7 A;  4ND9 A;  4E0X A;  1US5 A;  3RQT A;  1R6Z A;  1S7Y A;  4NF6 A;  5I56 B;  4IO4 A;  2AIX A;  2XXQ A;  2THI A;  3LUY A;  3MWB A;  2F7C A;  2Y7I A;  1BIY A;  2RC7 A;  1SI1 A;  4G2Z A;  4G4P A;  4OEV A;  2ZNU A;  4N13 A;  4F22 A;  3DP8 A;  1PC3 A;  3PD9 A;  4R73 A;  1DSN A;  1Z7M E;  2H98 A;  2ZYN A;  1B5J A;  1PEB A;  2Q8J A;  4F19 A;  5I2N A;  4ZZA A;  4P11 A;  4EUO A;  3AXF A;  4RK2 A;  2DVZ A;  4EDP A;  1IQ7 A;  1MM7 A;  3K6U A;  4IO6 A;  3ZKL A;  4JSO A;  4KPT A;  3OO7 A;  4H8I A;  3CRB A;  1UTH B;  3G3F A;  4QHQ A;  4ZE8 A;  1M5F A;  5TPA A;  3SER A;  3TTL A;  4BDQ A;  3T66 A;  5A5X B;  2UVI A;  4XKR A;  3SEU A;  1B5I A;  1PDA A;  1UTB B;  5I2N B;  4YKJ A;  1URS A;  2PX1 A;  1MY0 A;  1DMB A;  3FAT A;  3H6U A;  4PE5 B;  4R6K A;  3PUZ E;  2VHA A;  1N84 A;  2O84 X;  2YPN A;  3ODB A;  3R26 A;  5TPA B;  2NVU B;  3W9V A;  1NH7 A;  1ZMG A;  2XXP A;  3L6G A;  1ZJL A;  2DSF A;  3MQ9 A;  4FED A;  1FQF A;  4YZZ A;  3SEY A;  2QS3 A;  3TZA A;  3LSW A;  1N7X A;  3FXU A;  4OHN A;  1DPE A;  4I62 A;  4AB5 A;  4BDN A;  2GH9 A;  3CG1 A;  2UVH A;  5AA4 A;  1CB6 A;  4PET A;  3DM0 A;  3RTF B;  3T9V A;  4I8C A;  3B7D A;  3U1O A;  4DXC A;  2E0S A;  1BP5 A;  1NNF A;  3TFL A;  3G3K A;  1N04 A;  4GD5 A;  3VLW A;  2Z8F A;  4KYE A;  1UTH A;  3CSG A;  3O9P A;  4OQO A;  1VFE A;  4RK9 A;  4YB6 A;  5ITO A;  2F34 A;  4QFL A;  3TCH A;  1IIT A;  2F6G A;  2QSX A;  4EQ7 A;  4ZEC A;  1QUI A;  2Z8E A;  1J1N A;  1FQE A;  1MQH A;  5ITP A;  3U94 A;  4Q8R A;  4MBP A;  5CMC A;  1IIW A;  1TFD A;  1ZU0 A;  3T22 A;  1B3H A;  2XD2 A;  2HZL A;  1Y3Q A;  3MW0 A;  3TAJ A;  3UOR A;  1SW4 A;  5B7D A;  1XVX A;  1IEJ A;  1EZO A;  1Y4T A;  2I0B A;  4PP0 A;  2QPQ A;  4EQB A;  1NNT A;  4G77 A;  3M3L A;  5AA4 B;  1N76 A;  3C4M A;  4RPO A;  1SW5 A;  2FNC A;  2OCU A;  2Q2C A;  3OO6 A;  2DOJ A;  4OXV A;  1MXV A;  1P99 A;  1XOC A;  1R9L A;  3EHT A;  2HQ0 A;  4FAT A;  2X7P A;  3JV9 A;  2XXV A;  5K2Y A;  1O63 A;  2Q89 A;  1SW2 A;  4WEP A;  3T9H B;  2XXY A;  4OES A;  1PB7 A;  4OEU A;  2NXO A;  1I69 A;  1LB8 A;  4AB6 A;  1NMU A;  1JET A;  5AA1 A;  1FTJ A;  2VP1 A;  3D4C A;  2V93 A;  1SYI A;  4KD5 A;  4MFI A;  3VLV A;  1NNK A;  1MQG A;  3T93 B;  2RIN A;  4OVJ A;  1B32 A;  5KZT A;  1NKX A;  4LUB A;  4DDD A;  1OMP A;  3KJT A;  3LR1 A;  1TFA A;  1FQA A;  2AYS A;  3R6U A;  1IXG A;  2A5T A;  3KJ7 A;  4H67 A;  3IJO B;  2OZZ A;  3IB1 A;  5DEX B;  3S4U A;  1D3K A;  5TP9 B;  3PMX A;  1FQC A;  3IB2 A;  4XIG Q;  3RUM A;  2O6A A;  4OFL A;  4ELR A;  3FVG A;  3JZJ A;  1LCT A;  2ZYM A;  4YKP A;  3V8X B;  5H8N B;  4R2B A;  4U21 A;  3TTN A;  3KG2 A;  2RC9 A;  5LOM A;  3TPA A;  3W15 C;  2REG A;  4F3P A;  4ELO A;  3UK4 A;  1OVB A;  1OLC A;  1LAG E;  2ALU A;  2F6P A;  1MXW A;  4QSD A;  4ZED A;  3M8U A;  4X1D A;  4M4G A;  4OEN A;  1LBB A;  1MQD A;  1H45 A;  1VE4 A;  5I2K A;  1A55 A;  4ZEK A;  1GGG A;  2XD3 A;  5DYH A;  1H76 A;  3HHG A;  4IGT A;  2DQV A;  4NWD A;  4ZE9 A;  3A3U A;  1B5H A;  3IO6 A;  2ONS A;  3MPL A;  2RCB A;  3BBR A;  3K4U A;  3N6T A;  5TU0 A;  5KCJ B;  4QFO A;  4NMY A;  1B4Z A;  3SKP A;  4ELP A;  4FAJ A;  2UYF A;  1PB9 A;  3FXQ A;  1Q35 A;  1XHY A;  3GLB A;  5I2K B;  2ZXT A;  2NUV A;  4LAT A;  4KI0 E;  3GBB A;  4FE8 A;  4GL0 A;  4OET A;  1P1U A;  4Q0C A;  2XXR A;  3TQW A;  1UIU A;  3BFU A;  3TTM A;  4GL8 A;  3VFJ A;  5JK4 A;  4XKN A;  2X26 A;  1BKA A;  4RXL A;  5JTY B;  1YAE A;  5AA3 A;  3K1N A;  3B6Q A;  3V5A A;  3FJM A;  1GTK A;  2F7B A;  1A54 A;  3O6I A;  1M5C A;  2F78 A;  1R1N A;  2FA7 A;  3CI8 A;  3FAS A;  4BDR A;  1ZKB A;  2QMX A;  1N0T A;  1LBC A;  1SQY A;  5AA2 A;  3QYT A;  2PT2 A;  3MUQ A;  4F2O A;  4UA8 A;  4KCD A;  2F36 A;  3GBA A;  3MC2 A;  3V83 A;  1QKA A;  2I4C A;  4F1Y A;  1M5B A;  3GZG A;  3IK6 B;  1FTM A;  3K0V A;  4R74 A;  3T96 B;  2F8D A;  2UXA A;  1MPD A;  5CRY A;  1URD A;  5L9M A;  2AL5 A;  2Q88 A;  3ZSF A;  3C9H A;  5ICQ A;  3MPK A;  4DXB A;  3M3K A;  2G93 A;  3FJ7 A;  1FQB A;  4R6H A;  3RPW A;  2FYI A;  3Q25 A;  4X9T A;  4QFK A;  4U22 A;  1AH5 A;  2I49 A;  2I3V A;  1DPP A;  1B0H A;  2RCA A;  3PU5 A;  3B6T A;  3PUX E;  3H6W A;  2VGQ A;  3MP1 A;  3MZ9 A;  4F3G A;  5B70 A;  5H8N A;  3M3F A;  3G3H A;  2DWJ A;  4EF1 A;  3H4Z A;  1I6A A;  5I58 A;  4ISU A;  3IB0 A;  4OYV A;  4RA1 A;  3FXR A;  3P7I A;  3OSR A;  4Q30 B;  2BJJ X;  4EXK A;  4DCY A;  3ILT B;  1TWY A;  4M1V A;  3RY3 A;  4KHZ E;  2O69 A;  5L8D A;  3UGW A;  4ELQ A;  4DCX A;  3OOA A;  1I6B A;  1N3W A;  1DOT A;  3RTW B;  1MG1 A;  1GR2 A;  3TTK A;  3A09 A;  1HSJ A;  1USY E;  2V3T A;  4FEB A;  5FTI A;  1WDN A;  1MQI A;  1MY4 A;  4HCW A;  5HBC A;  5I59 A;  4XTC Q;  2R9J A;  2XXX A;  1ATG A;  4NF4 A;  5I57 A;  1MM6 A;  4XKP A;  1D4N A;  3G3I A;  1B7H A;  1OLA A;  4POW A;  2HCA A;  3UIF A;  1LFG A;  5FHM A;  2F7A A;  1SD3 A;  2ONK E;  2RKM A;  3OSQ A;  2ZYO A;  4F1U A;  3TKD A;  4QRZ A;  5CI5 A;  1B05 A;  4YKI A;  1Y1M A;  4OZ9 A;  2DP8 A;  5L9S A;  4PFT A;  4EXL A;  3BKI B;  3KN8 A;  2Q9T A;  3EF7 A;  2GFE A;  1D9Y A;  4LON B;  4P0G A;  4YMB A;  4YAH X;  1AL3 A;  1NH8 A;  2PT1 A;  5TP9 A;  3Q26 A;  1A8E A;  3RNN A;  2DYX A;  3K6X A;  2W7Y A;  2PBW A;  3Q28 A;  1B40 A;  3QIM A;  4WED A;  1B3E A;  1O64 A;  1H3D A;  4GFR A;  4YB7 A;  2Q2A A;  4GXS B;  4F29 A;  2VD2 A;  4G68 A;  1Y3N A;  5A5X A;  4KR5 A;  1NNP A;  4KYD A;  3A3C A;  4JWX A;  1QUJ A;  3ECR A;  5AE4 A;  3TUS A;  3MVZ A;  3O2A A;  3O29 A;  5M2V A;  1LFI A;  1SDX A;  3IL1 B;  3R7X A;  4R9G A;  3MP6 A;  5I58 B;  2PYY A;  4PFU A;  4ZZE A;  3TDJ A;  3SEX A;  2XXI A;  2Z23 A;  2DS9 A;  1RYO A;  1P1W A;  1QJM A;  3KSX A;  3PPN A;  4ECF A;  1QVS A;  3TCF A;  4X48 A;  4YB5 A;  3WAE A;  1Y1Z A;  2V3Q A;  2O7I A;  1IUD A;  1MXZ A;  1B3G A;  3PV0 E;  3T9X B;  3PGF A;  5ICT A;  4LZ5 A;  5DVJ A;  1WVJ A;  2XXH A;  4NED A;  2DXY A;  2QRY A;  3K00 A;  3OO9 A;  5CBR A;  2GHB A;  4MF3 A;  5ISU A;  3PMV A;  1T0K A;  2OWS A;  3FIR A;  2H4I A;  1B6H A;  3Q29 A;  3MVW A;  2DVC A;  1HSL A;  2E1S A;  1LAX A;  1POT A;  1QW0 A;  3H6T A;  1EZ9 A;  3IO4 A;  3KGC A;  2O1L A;  3C33 A;  3L6H A;  3KZG A;  1B4H A;  1YTV A;  4H5F A;  1Q1K A;  4O3C A;  4C1T A;  4TLL B;  4U2R A;  5HPQ A;  2P1S A;  2V3U A;  2PVU A;  1BTJ A;  1UQW A;  2I4B A;  4YIC A;  2UVG A;  4QF9 A;  2ANJ A;  3CVG A;  1JVY A;  2NWJ A;  2HEU A;  3TMG A;  1RKM A;  3K01 A;  3OEL A;  3OO8 A;  5H8H B;  2QMW A;  3N94 A;  3PUW E;  4G8H A;  3SES A;  1VFD A;  5FTH A;  3Q27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...