2F7CA

Catm effector binding domain with its effector cis,cis-muconate
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
216
structure length
216
Chain Sequence
SQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKITDPAIRRIVLHKEQLKLAIHKHHHPNQFAATGVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVPSKLTEIREIQLALGLVAAGEGVCIVPASAMDIGVKNLLYIPILDDDAYSPISLAVRNMDHSNYIPKILACVQEVFATHHIRPLIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator catM
publication title Distinct Effector-binding Sites Enable Synergistic Transcriptional Activation by BenM, a LysR-type Regulator.
pubmed doi rcsb
source organism Acinetobacter baylyi
molecule tags Gene regulation
total genus 61
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f7cA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f7cA02
1S7YA 5JTYA 3SEVA 1UQWA 3FASA 4NF6B 5CMBA 1O64A 4DIGA 3KBRA 4GWOA 1Z7ME 4ELOA 4OFLA 5FTIA 2DWAA 1JEVA 1B3GA 3FV1A 5AA4B 2O1LA 1JW1A 4JWXA 1B46A 1RYOA 4NTLA 1PEBA 3LSWA 3C33A 5B7DA 1A55A 5I84A 4MBPA 2G29A 4KR5A 1FQAA 4RNSA 3S2VA 1ELJA 1MQIA 3E4RA 1A40A 2XXHA 2V3TA 4N07A 1JEUA 4R73A 1WODA 3C36A 3H7MA 4QF9A 4U22A 1VFDA 2HFBA 3O9PA 4H8IA 3THIA 2YJPA 2Y7WA 1EZ9A 1H43A 1R9LA 5H8FA 1S50A 4ELQA 2BJJX 1SW2A 3U94A 3OO8A 1H44A 3T9XB 1A99A 3K6XA 3T9HB 3FVNA 1IXGA 2V84A 2Z22A 3PD8A 4HCYA 4LATA 1B58A 1ZIUA 5CBSA 4QFLA 4FJPA 1QKAA 4OTEA 1VFEA 2GRVA 3IB1A 2Q88A 1MXVA 2NVUB 3JZJA 1B1HA 1UTHA 2I49A 2F78A 4KPTA 4F3SA 3KEIA 3OEMA 4OERA 3TZAA 4TLMB 3BFUA 2ANJA 2THIA 1US5A 3PPPA 4BDOA 3IB0A 3MWBA 1LAXA 5DVJA 2PMSA 1Y1MA 4G77A 1N7XA 1LFGA 2QL3A 3O6IA 5IAIA 3L6HA 1OQGA 2F8DA 4DLDA 4WEPA 4JSDA 1I6AA 4OYVA 3W9VA 4ZEKA 2A5TB 2G93A 3PUZE 5CM6A 3TTNA 1FQBA 1PBPA 2Q2AA 3CVGA 1SI1A 4Z0IA 4M1VA 3SEXA 3HHFA 1QJMA 3FUZA 2DS9A 3P7IA 4IO6A 2ZYKA 3GLBA 2XD2A 2OK2A 2I4CA 3KG2A 3IOUA 3H06B 4LZ8A 3R6UA 2R6GE 1DSNA 1NH8A 3PUVE 2AIXA 4X1DA 2RC9A 1NNTA 1ZKBA 3G3JA 2NWJA 3ZKKA 4HTGA 3TYHA 1SVXB 2UXAA 3MVWA 1N7WA 4NE4A 5KDTA 3HHGA 2I0BA 1NH7A 2PT2A 2UVHA 3RPWA 3RTFB 1LCTA 2NOOA 3T93B 3T22A 3TUSA 3HN0A 2ESNA 4G68B 4F2QA 1XS5A 2REGA 1MY0A 4YB5A 2HAUA 4UA8A 4HCWA 2ZXTA 5DEXA 4IGTA 1MY1A 3KFMA 4YKPA 1B9JA 3FXRA 5CBRA 4RPOA 3KZGA 3UIFA 1VSOA 5FHOA 4I1DA 4LA9A 2W7YA 1IIWA 1RKMA 1VR5A 3MVZA 4IO2A 4U21A 5JK4A 1B52A 3LSFB 3S4UA 1FTJA 1MPBA 3DP8A 2GHBA 4U4XA 4NF5A 3R26A 4POWA 1M5FA 4OENA 5I58A 2DSFA 2UYEA 1USYE 1I6QA 1GGGA 4TLLB 3WAEA 2VD3A 1OQHA 5AA1A 3MBPA 3MW0A 3MZBA 3Q27A 2M8CA 4P0GA 2F7AA 1A8EA 2Z23A 2XXTA 2RCBA 2YPNA 3TCGA 4ZE9A 1URSA 3TQWA 4NF4B 3C4MA 3C34A 1AIVA 2LAOA 4YKJA 1YAEA 2OWSA 4DE8A 1B5JA 1LAFE 4IO4A 1D4NA 1MY4A 1SYHA 1TT1A 3K2DA 2VOZA 3TKDA 3MUQA 3K6VA 4AB6A 2DWHA 3T9VA 4QHQA 2XXIA 2QPQA 3TPAA 1UIVA 2O84X 4YMAA 2PX1A 2O69A 3HO7A 4GIZA 3FVKA 3Q26A 3ZKLA 2QS4A 1B7ZA 5DVIA 1BTJA 1DPPA 3MVYA 2B65A 4DXCA 3UA8A 3DLNA 3PMWA 2PBWA 1IXHA 3LSLA 1JW4A 4R6HA 3OSQA 2AYSA 1TWYA 4I62A 4H0WA 5I56A 3Q25A 3C9HA 2Q8JA 1BKAA 4NF8A 3SEWA 3VLVA 2HAVA 4ZDMA 4BDLA 1MDP1 5A5XA 5JEIA 2Y7KA 3OEKA 2ALUA 1MM6A 2VD2A 1ZBMA 1Y1ZA 3IO4A 2RCAA 3IK6B 3K1NA 1B51A 4FORA 3TDJA 1YTVA 4OESA 4LONB 1M5CA 1LGBC 1MQDA 3FXQA 1Y3QA 3S9LC 1CB6A 2XXQA 4C1UA 5L9OA 1B40A 2ONKE 1B3EA 1FTLA 1ANFA 1NNPA 2DVZA 3CG3A 2O68A 3FATA 4BLAA 2OJTA 4ZZAA 3G3GA 3HCQA 3CIJA 3VVDA 3FVGA 1UTBB 1QUJA 3EN3A 4GL0A 1MQGA 1M5BA 3ONMA 4G4PA 1DMBA 3HPIA 4LVQA 3VXCA 3V89B 4MLVA 3K00A 4KD5A 1S9TA 3Q28A 5TPAB 3ILTB 2A5SA 3SKPA 3CR9A 5EHSA 2D21A 4G8HA 3O66A 3KOTA 3A09A 2F6PA 1MH3A 3B7DA 2QS3A 2Y7PA 3C31A 3PV0E 4ZEIA 2QRYA 1MXWA 3KOSA 2HZLA 2AL5A 4DXBA 5TU0A 4EF2A 5L9SA 4OZ9A 1B3HA 2R71A 4RY1A 5H8NA 1J1NA 1T0KA 5B70A 1IZ1A 2F35A 3IAZA 3K6UA 1I6BA 5HPQA 1D3KA 4RPNA 1LCFA 1XVYA 2Q2CA 3VXBA 1QVSA 3T9UA 3FVOA 3R7XA 2GHAA 4OETA 3CSBA 2B3BA 1MY3A 4U4SA 1IXCA 2DXYA 4THIA 1R9QA 1LAGE 2Y7IA 2ONRA 2OWTA 2Q89A 3BFTA 3I3VA 3PD9A 1D9VA 1NFTA 4IO3A 1P1UA 4OEUA 1ZU0A 3RUMA 3U8QA 4H67A 4ND9A 5AE4A 1YCJA 2NXOA 3CFXA 1N04A 1RYXA 1US4A 4BDQA 1DTZA 4OEVA 2DYXA 4QFPA 5DTBA 3VE1B 1FTMA 4I9DA 2XXUA 4JBZA 2PT1A 1FQEA 1AMFA 4DDDA 4IY5A 3RQTA 3FJGA 5L9MA 5CC2A 3K0VA 1TFAA 4H8JA 5I57B 3LUYA 4XKNA 4RA1A 2XX9A 3SDFA 3MAMA 4G2ZA 3CSGA 5I2NB 1OLCA 3IO6A 3MQ9A 1EH3A 5JTYB 4WKMA 3BBRA 4YICA 3VFJA 3PPNA 3TAJA 4GL8A 1XVXA 3KSXA 4XKRA 3MPLA 2F7BA 2GH9A 2H98A 3MP1A 1L5TA 2FNCA 3G3FA 3QYTA 3FGSA 2OBGA 4ONYA 1F9BA 5H8HA 2REJA 3IORA 3V83A 3H4ZA 3TFLA 2I6EA 1Z7NE 1H76A 3RTWB 2H25A 3EQ1A 5I2KA 1ZTYA 2RKMA 2F5XA 4XIGQ 4EQ9A 3E13X 1ZMGA 3B6TA 4Q8RA 2O7UA 1OIBA 1PC3A 5CI5A 2XXVA 4FAJA 5FTHA 4G8NA 5H8QA 1MQJA 2Z8DA 5I59A 4L17A 3VVEA 3LBSA 1IQ7A 2PVUA 4ZECA 2O7IA 3OO9A 5KCJB 3EHUA 3DP6A 2XHDA 1XC1A 4GRKA 4LP2B 4ESXA 4Q30B 5H8SA 3K6WA 2HEUA 4F19A 1P1WA 4O3AA 4WXJA 4Z7EA 3EHTA 3A3UA 3EPEA 2ZYOA 1M5DA 5ISUA 2I4BA 4PFTA 4Q0CA 4KCDA 4EUOA 3H6VA 4WEDA 3IB2A 1LFHA 1IXIA 4ECFA 5ELVA 3UK4A 4DZ1A 4QSDA 4R75A 4YB7A 1GR2A 3CFZA 5EYFA 4N13A 5TP9A 2E0SA 5BWJA 2DP8A 4KYEA 5CMKA 3HV1A 3CFLA 4ELPA 4EXKA 1NNKA 3CRBA 2YLNA 5AA2D 1URDA 3O6HA 4JB7A 3CG1A 1PB9A 1QUKA 2Y7RA 1R1NA 3E3KA 3WAFA 1Y3PA 3N5LA 4XKPA 1B1XA 3GBAA 3T96B 3V5AA 1B4HA 4IO7A 3IX1A 1PB8A 1BLFA 1FQFA 1FTOA 4QFOA 2XXRA 5CRYA 4EQBA 1SW4A 4EXLA 1SI0A 4C1TA 1SBPA 4N6PA 4MLQA 4F1UA 4FATA 1NKXA 5BUUA 1B0HA 2D5WA 4RK9A 4E0XA 3MZ9A 5AA2A 4AQ4A 3FIRA 2DE2A 4JWOA 1BP5A 3OO7A 3UORA 4NF6A 3TTLA 3EHSA 4GXSB 2I3WA 2V93A 3I5OA 2RC7A 2AL4A 3K01A 1FCKA 3GZGA 4KI0E 4RXLA 3DELB 1MS7A 1LSTA 5AA4A 5KDTB 5F7VA 3G3KA 1B5HA 4MF3A 1WDNA 1LBBA 1O63A 4LQ5A 3UN6A 4POXA 3D4GA 4DCXA 2ABHA 1NNFA 1XT8A 4PP0A 1OMPA 3S9MC 4O3BA 4F3PA 2ZYMA 4YB6A 4QFNA 1XHYA 4HW8A 3RLFE 3DP4A 3FZVA 1OVBA 4GFRA 1MPCA 4C0RA 3RGYA 2O6AA 5M2VA 2ZMBA 1YPNA 3H3GA 5DEXB 2I48A 4F3GA 1IITA 3KJ7A 3M3FA 2VP1A 2XXYA 3RNNA 1EU8A 2RINA 3OOAA 1EZOA 3U1OA 3ILUB 4PQJA 1A8FA 2ZNSA 4F29A 3C35A 3SETA 1FTKA 2CZLA 1MXYA 4Q5TA 2Q9TA 1OVTA 3KJTA 3ZS6A 2IA4A 3SERA 3TCFA 1LAHE 3VLUA 2X26A 2R9JA 4NF5B 4KQPA 5I58B 1B3FA 4EQ7A 4FEDA 1N0TA 4U23A 2UVIA 3FJMA 1SW5A 1H45A 1Y4CA 1N3XA 1KWHA 2Y84A 2X7QA 1OLAA 3MP6A 5ITPA 4PFYA 1IUDA 3A3CA 4FEBA 1FQDA 2FA7A 1MPDA 3MC2A 4KYDA 3IR1A 3G3IA 3PPQA 4HS7A 2ONSA 3JV9A 3O29A 5I2NA 3VDFA 4LZ7A 4H5GA 1MDQA 1SQYA 4XXUA 2XX8A 3MVXA 4RJZA 3OSRA 3TMGA 1FW0A 3PUXE 4P11A 4GQOA 4F22A 3ECRA 4BDNA 1B0LA 1UIUA 4F1VA 2P0SA 4ELRA 3L6GA 1A54A 3K1MA 3RT6B 1PBQA 4ZS9A 1MQHA 1R6ZA 3VLWA 1JVYA 4E0WA 3U92A 3O2AA 3N26A 1H3DA 1QW0A 4LZ5A 2A5TA 4X9TA 2UVGA 1USYH 4ZEBA 1Y20A 5I56B 2H99A 3N94A 1PDAA 3Q29A 4NF8B 1IEJA 1P1QA 2V3QA 3G3HA 3TTKA 4IB2A 3FD3A 5A5XB 2DE4A 2P1SA 4GOTA 2Z8EA 1JVXA 3PPRA 4R72A 2F97A 3MPKA 4JXIA 4JSOA 5DT6A 2QS2A 1B4ZA 1LB8A 4QSCA 5KCJA 3O28A 4M4GA 1SYIA 1FQCA 5EHMA 3IL1B 1MXUA 4IGRA 2P2AA 3M3KA 5ICQA 3O6GA 3MJNA 1MRPA 3E9XA 3QIMA 4KFQA 3M8UA 3TTMA 2NUVA 2DWJA 2DWIA 4RYAA 3IOWA 4I8CA 4F39A 1XOCA 4G68A 2QMXA 4IY6A 1B2HA 4OWDA 5FHNA 4PE5B 3K02A 4R9GA 1A7LA 4OFJA 1MH4A 2DVCA 2ZNUA 2QJEA 1JW5A 3M3LA 2I0CA 2H5YA 4F31B 1Y3NA 4IO5A 2H9BA 1M5EA 4YMBA 3S9EA 5IKBA 2XXWA 4OVJA 1O7TA 4PFUA 1II5A 4X48A 2F36A 1GV8A 3PMXA 1P99A 3FV2A 4H1XA 5J1DA 3IOVA 1P1OA 2GFEA 2RC8A 3KN3A 4FE8A 1POTA 4KHZE 5H8NB 3W9WA 4XTCQ 2O1MA 1B3LA 4NWCA 1GVCA 5K2YA 4H6DA 1LBCA 3T66A 4R6KA 4ISUA 3G7WA 5K2XA 1P1NA 3H6WA 2HQ0A 4OFOA 1HSLA 2XX7A 5H8FB 1JETA 2VHAA 4LQ2A 4NF4A 1POY1 5ICTA 5ITOA 3CI8A 3TQLA 3KSJA 2IEEA 4FECA 4GD5A 3OENA 1VE4A 3PMVA 1MG1A 4R2BA 4O3CA 1EZPA 3RT8A 1B6HA 2ZNTA 4FIMA 2V25A 3SEUA 4LUBA 4GF8A 4F2OA 5CMMA 5DVFA 1DOTA 4OXVA 4OHNA 4QFKA 2O51A 1UTHB 2Z8FA 1D9YA 3BKIB 3D4CA 1B5IA 3H6TA 3N6UA 1B7UA 3OXNA 1TXFA 4YU0A 3ZSFA 3MZ1A 1AL3A 1AH5A 4TOZA 2HXWA 2QS1A 4X1BA 2DE3A 5LOMA 4JDFA 3RY3A 3U93A 1N76A 4MH5A 1BIYA 1Q35A 1QULA 3UGWA 3EF7A 5H8HB 4BDRA 4U1ZA 5KZTA 3H6UA 1ATGA 3QXMA 2FYIA 4H5FA 3KN7A 3ODBA 3TODA 3W15C 3AXFA 1AOVA 2CMOA 1Y4TA 3QUJA 4MFIA 5I2KB 1Q1KA 5CMCA 3OO6A 3LR1A 4H65A 2UYFA 3U72A 5DYHA 2OCUA 4PETA 1WVJA 4PFWA 4R74A 1GTKA 1UTBA 4OQOA 1LFIA 5FHMA 1CE2A 3S9NC 4EDPA 4U2RA 5H8QB 4XKQA 2E1SA 3PU5A 5I59B 1SDXA 3MP8A 4OMBA 4TQUQ 4GXAA 1JNFA 3O97A 1B7HA 4ZEFA 5HBCA 3PPOA 4YKIA 3KN8A 4RK2A 3OELA 1NL5A 5TPAA 3H03A 4G68C 4P0IA 2F6GA 2X7PA 3IJXB 3PUWE 3SEYA 2UVJA 4ZEDA 3GXAA 3FXUA 4G8MA 3PGFA 4QSEA 4YAHX 4UACA 2HCAA 2RF1A 4NEDA 3VVFA 3TCHA 1PB7A 1MXZA 3QK6A 1B05A 1ZLQA 3F11A 2PYYA 1MXXA 1MY2A 2F7CA 3B6WA 2I3VA 1MM7A 3IOTA 3GBBA 4R9FA 3PUYE 1JQFA 1N84A 1ZJLA 1DTGA 2DQVA 2ZYNA 4R2FA 2B3FA 3TTRA 4GLIA 1QUIA 3TEPA 1QKBA 2QSXA 2F34A 1HSJA 3K4UA 2D3IA 2OZZA 3USDA 3QSLA 4BDMA 4NMYA 1TFDA 3QAXA 5TP9B 3SESA 2DXRA 4ZZEA 3JYRA 4YZZA 3I6VA 3TELA 2QMWA 5F1QA 4QRZA 2DOJA 2H4IA 4F3BA 3DM0A 2XD3A 3FJ7A 3OMBA 1HSEA 5L8DA 4KCCA 4JWYA 2VGQA 3OD7A 4R6YA 3HSTA 3LC8A 2WKYA 1SW1A 4K3FA 1DPEA 4ESWA 2KLFA 4ZE8A 2XXPA 4EF1A 2I58A 3B6QA 5HM4B 3C32A 3QUFA 3K1PA 5AA3A 3LSXA 1I69A 3IJOB 2OLBA 2V3UA 1N3WA 1NMUA 3UP9A 4F18A 3VV5A 3V8XB 4DXUA 4YKKA 1LLSA 3N6TA 4NWDA 1URGA 3RN8A 4DCYA 4KYSA 4GVOA 2XXXA 1B32A 2HZKA 5I57A 1Y9UA 1SD3A 1LB9A 4U1OA 5AA2B 3KGCA 4F1YA 4AB5A
chains in the Genus database with same CATH superfamily
1S7YA 5JTYA 3SEVA 1UQWA 4O8MA 2CEYA 3FASA 4NF6B 5CMBA 1O64A 4DIGA 3KBRA 4GWOA 1Z7ME 1DCUA 4GBWA 4ELOA 4OFLA 5FTIA 2DWAA 4FBPA 1JEVA 4N6KA 1B3GA 3FV1A 5AA4B 2O1LA 1JW1A 3SZPA 4GWZA 4JWXA 1B46A 1RYOA 4NTLA 1PEBA 3LSWA 3U65A 4H45A 4OANA 3C33A 5B7DA 1A55A 5I84A 4MBPA 2G29A 4KR5A 1FQAA 3E78A 4RNSA 1FPEA 2XWVA 3S2VA 1ELJA 1MQIA 4PE3A 3E4RA 1A40A 2XXHA 2V3TA 4N07A 1JEUA 4R73A 1WODA 4MNCA 1AWBA 3C36A 3H7MA 4QF9A 4U22A 1VFDA 2HFBA 1NV5A 3O9PA 4H8IA 3THIA 2YJPA 1IMCA 5ESYA 2Y7WA 1EZ9A 1H43A 1R9LA 5H8FA 1S50A 4ELQA 2BJJX 1SW2A 5A5LA 3U94A 3OO8A 1H44A 3T9XB 1A99A 3K6XA 3T9HB 3FVNA 1IXGA 4PBHA 2V84A 2Z22A 3PD8A 4HCYA 4LATA 2MKZA 1B58A 1ZIUA 5CBSA 4QFLA 4FJPA 1QKAA 2Y5KA 4OTEA 3FXBA 1VFEA 2GRVA 3IB1A 2Q88A 1MXVA 1QGXA 2NVUB 3PTYA 5ET7A 3JZJA 1FBEA 4P8BA 4N8GA 1B1HA 1UTHA 4AS5A 5IZ3A 2I49A 2F78A 4KPTA 1IMDA 4F3SA 3KEIA 3OEMA 4O7MA 4OERA 3TZAA 4TLMB 3BFUA 2ANJA 4P1EA 2THIA 1US5A 3PPPA 3A29A 4BDOA 5I5PA 3IB0A 3MWBA 1LAXA 5DVJA 2PMSA 1YXIA 4PFRA 3KC0A 1Y1MA 4G77A 1N7XA 1LFGA 3T1BA 2QL3A 3O6IA 4JVIA 5IAIA 3L6HA 1OQGA 2F8DA 4DLDA 4WEPA 5LDZA 2FIXA 4JSDA 1I6AA 4OYVA 3W9VA 4ZEKA 2A5TB 5EQAA 1INPA 2G93A 1G0HA 3PUZE 5CM6A 3TTNA 1FQBA 1PBPA 2Q2AA 3CVGA 1BK4A 1SI1A 4Z0IA 4M1VA 3SEXA 3HHFA 1QJMA 3FUZA 2DS9A 3P7IA 4IO6A 2ZYKA 3GLBA 2XD2A 2OK2A 2I4CA 3BIGA 4PGPA 2ZZXA 3KG2A 3LUZA 3IOUA 3H06B 4LZ8A 3R6UA 4OVSA 2R6GE 1DSNA 1NH8A 3PUVE 4MCOA 1IMAA 2AIXA 4X1DA 2RC9A 1NNTA 1ZKBA 3G3JA 4I3YA 2NWJA 3ZKKA 4HTGA 3TYHA 1SVXB 2UXAA 3MVWA 2QVUA 4QBAA 1FPFA 1N7WA 4NE4A 5KDTA 3HHGA 2I0BA 1NH7A 2PT2A 2UVHA 3RPWA 3RTFB 4PBQA 1LCTA 2NOOA 3T93B 3T22A 3TUSA 2XXKA 3HN0A 2ESNA 4G68B 4F2QA 1XS5A 2REGA 1MY0A 4YB5A 1FBHA 2HAUA 4UA8A 4HCWA 2ZXTA 5DEXA 2R8TA 4IGTA 1MY1A 3KFMA 4YKPA 1B9JA 3FXRA 1D9QA 5CBRA 2WEFA 4RPOA 3KZGA 4NN3A 4I3EA 3UIFA 1VSOA 5FHOA 4I1DA 3NOHA 4LA9A 2W7YA 1IIWA 3T0JA 1RKMA 1VR5A 4GBVA 3MVZA 4IO2A 4U21A 5JK4A 1B52A 1FTAA 3LSFB 3S4UA 1FTJA 1MPBA 1FPIA 3DP8A 2GHBA 4GWYA 4U4XA 3MSTA 4NF5A 3R26A 4POWA 1M5FA 4OENA 5I58A 2DSFA 2UYEA 1USYE 1I6QA 1GGGA 4TLLB 3WAEA 2VD3A 1OQHA 5AA1A 3MBPA 3MW0A 3RYDA 3MZBA 3Q27A 2M8CA 4P0GA 5EQ7A 2F7AA 1A8EA 2Z23A 4GWXA 2XXTA 2RCBA 2YPNA 3TCGA 4ZE9A 1URSA 3TQWA 4NF4B 3C4MA 1YZ0A 3C34A 1AIVA 2LAOA 4YKJA 1YAEA 4NX1A 2OWSA 4DE8A 1B5JA 1LAFE 4IO4A 1D4NA 1MY4A 1SYHA 3D1RA 1TT1A 3K2DA 2VOZA 3TKDA 3MUQA 3K6VA 4AB6A 2DWHA 3T9VA 4QHQA 2XXIA 2QPQA 3TPAA 4P3LA 1UIVA 2O84X 4YMAA 4IR8A 2PX1A 2O69A 3HO7A 3IFAA 4GIZA 3FVKA 3Q26A 3ZKLA 2QS4A 1B7ZA 5DVIA 1BTJA 5F24A 1DPPA 2XWIA 3MVYA 2B65A 1IMEA 4DXCA 3UA8A 3DLNA 3PMWA 2PBWA 1IXHA 3LSLA 1JW4A 4R6HA 3EKIA 3OSQA 2AYSA 1TWYA 3ROJA 4I62A 4H0WA 5I56A 3Q25A 3C9HA 1FBDA 2Q8JA 1BKAA 4NF8A 3SEWA 3VLVA 1RDXA 2HAVA 4ZDMA 4BDLA 1MDP1 5A5XA 5JEIA 4PAFA 2Y7KA 3OEKA 2ALUA 1MM6A 2VD2A 1ZBMA 1Y1ZA 3IO4A 5EYHA 2RCAA 3IK6B 3K1NA 4PAKA 5EYGA 1B51A 4FORA 3TDJA 1YTVA 4XEQA 4OESA 4LONB 1M5CA 1LGBC 4P1LA 1MQDA 3FXQA 1Y3QA 3S9LC 1FBFA 1CB6A 2XXQA 4C1UA 5L9OA 1B40A 4XF5A 2ONKE 1B3EA 1FTLA 1ANFA 2PFZA 1NNPA 5LTCA 2DVZA 3CG3A 2O68A 3FATA 4BLAA 2WBDA 2OJTA 4ZZAA 3G3GA 3HCQA 3CIJA 1IMFA 3VVDA 1FPDA 3FVGA 1UTBB 1QUJA 3EN3A 1FPGA 4GL0A 1MQGA 1M5BA 3ONMA 4G4PA 4JVCA 1DMBA 3HPIA 1NUZA 4LVQA 4HE2A 3VXCA 3V89B 4MLVA 3K00A 2QVVA 4KD5A 1S9TA 3Q28A 5TPAB 3ILTB 2A5SA 3SKPA 4X04A 3CR9A 5EHSA 2B4LA 2D21A 4G8HA 3O66A 3KOTA 1XI6A 3A09A 2F6PA 1MH3A 3B7DA 2QS3A 2Y7PA 3C31A 3PV0E 4ZEIA 2QRYA 1MXWA 3KOSA 2HZLA 2AL5A 4DXBA 2CEXA 5I7IA 2VPNA 5TU0A 4EF2A 5L9SA 4OZ9A 1B3HA 2R71A 4RY1A 5H8NA 1J1NA 1T0KA 4N4UA 5B70A 1IZ1A 2F35A 3IAZA 1NV7A 1K9YA 3K6UA 1I6BA 5HPQA 1D3KA 2JJKA 4RPNA 1LCFA 1XVYA 4N17A 2Q2CA 3VXBA 1QVSA 3T9UA 4GX4A 3FVOA 3R7XA 2GHAA 2VT5A 4OETA 3CSBA 2B3BA 1MY3A 2Q74A 4U4SA 1IXCA 2DXYA 4THIA 1R9QA 1LAGE 2Y7IA 2ONRA 3RPLA 5IZ1A 4NGUA 2OWTA 4LN5A 2Q89A 4P56A 3BFTA 1FPJA 3I3VA 1KA0A 1LBXA 3PD9A 1D9VA 1NFTA 4IO3A 1P1UA 4OEUA 1ZU0A 3RUMA 3U8QA 4H67A 4ND9A 5AE4A 1YCJA 2NXOA 3CFXA 1N04A 4GWUA 1RYXA 1US4A 4BDQA 1DTZA 4OEVA 3IFCA 2DYXA 4QFPA 5DTBA 3VE1B 1FTMA 4I9DA 2XXUA 4JBZA 2PT1A 1FQEA 1AMFA 4DDDA 2CZHA 4IY5A 3RQTA 3FJGA 5L9MA 5CC2A 3K0VA 3CHGA 1TFAA 4OVRA 4H8JA 5I57B 3LUYA 4XKNA 4RA1A 2XX9A 3SDFA 3MAMA 4G2ZA 3CSGA 1FPKA 5I2NB 1OLCA 3IO6A 3MQ9A 1EH3A 1NI9A 5JTYB 4WKMA 3BBRA 4YICA 3VFJA 3PPNA 4JVDA 3TAJA 4GL8A 1XVXA 3KSXA 2B4MA 4XKRA 3MPLA 2F7BA 2GH9A 4MAGA 4N91A 2H98A 3MP1A 1L5TA 2FNCA 3G3FA 3QYTA 5T3JA 3FGSA 2OBGA 4ONYA 1F9BA 5H8HA 2REJA 3IORA 3V83A 4PFIA 4HE1A 3H4ZA 3TFLA 2I6EA 1Z7NE 4PDHA 1H76A 3RTWB 2H25A 3EQ1A 3ISPA 5I2KA 4G61A 1ZTYA 1FJ6A 2RKMA 2F5XA 4XIGQ 4EQ9A 1NV1A 3E13X 1ZMGA 3B6TA 4Q8RA 2O7UA 1OIBA 1PC3A 5CI5A 2XXVA 4FAJA 5FTHA 1EYKA 4G8NA 5H8QA 1MQJA 4OVQA 1NV4A 2Z8DA 5I59A 4L17A 3VVEA 3LBSA 1IQ7A 2PVUA 4ZECA 2O7IA 3OO9A 5KCJB 3EHUA 3DP6A 2XHDA 1XC1A 4GRKA 4LP2B 4ESXA 4Q30B 5H8SA 3K6WA 1IMBA 2HEUA 4F19A 2FIEA 1P1WA 4O3AA 4WXJA 1FRPA 4Z7EA 3EHTA 3A3UA 3EPEA 4PF8A 2Q8MA 2ZYOA 4O94A 1M5DA 5ISUA 2I4BA 4PFTA 2CZKA 4Q0CA 4KCDA 4EUOA 4PCDA 3H6VA 4WEDA 3IB2A 1LFHA 1IXIA 4NHBA 4ECFA 3KC1A 5ELVA 4MHFA 3UK4A 4DZ1A 5IZ3B 4PF6A 4QSDA 4R75A 4YB7A 1GR2A 3CFZA 5EYFA 4N13A 5TP9A 2E0SA 5BWJA 2DP8A 4KYEA 5CMKA 4N6DA 3HV1A 3CFLA 4ELPA 4EXKA 1NNKA 3CRBA 1VDWA 2YLNA 2FHYA 4OVTA 5AA2D 1URDA 3O6HA 1LBWA 1FJ9A 4JB7A 3CG1A 1PB9A 2VPOA 1QUKA 3FBPA 2Y7RA 1R1NA 4HXVA 3E3KA 3WAFA 1Y3PA 2XWKA 3N5LA 1LBZA 4XKPA 1B1XA 3GBAA 3T96B 3V5AA 4XFEA 1B4HA 4IO7A 3IX1A 1PB8A 4I40A 1BLFA 1FQFA 1FTOA 4QFOA 2HHMA 2XXRA 1RDYA 5CRYA 4EQBA 1SW4A 5ET6A 4EXLA 1SI0A 4NG7A 4C1TA 1SBPA 4N6PA 4MLQA 4N15A 4F1UA 4MX6A 4FATA 1NKXA 5BUUA 1B0HA 2D5WA 4RK9A 1FSAA 3MZ9A 4E0XA 5AA2A 4AQ4A 3FIRA 2DE2A 4JWOA 1BP5A 5I3SA 3OO7A 3UORA 4NF6A 3TTLA 3EHSA 4GXSB 2I3WA 2V93A 3I5OA 2Y5LA 5IGAA 2RC7A 2AL4A 3K01A 1FCKA 3GZGA 4KI0E 4RXLA 3DELB 1MS7A 1LSTA 5AA4A 5KDTB 5F7VA 3G3KA 3GYYA 1KZ8A 1B5HA 2OWZA 4MF3A 1EYJA 2ZZWA 1WDNA 1LBBA 1O63A 4LQ5A 3UN6A 4POXA 3D4GA 1JP4A 4DCXA 2ABHA 1FBPA 1NNFA 3B50A 1XT8A 4PP0A 1OMPA 3S9MC 4O3BA 4F3PA 2ZYMA 4YB6A 4QFNA 2ZZVA 1XHYA 4HW8A 3RLFE 3DP4A 3FZVA 1OVBA 4GFRA 2GQ1A 1MPCA 4C0RA 3RGYA 2O6AA 5M2VA 2ZMBA 1YPNA 3H3GA 5DEXB 2I48A 4F3GA 1IITA 3KJ7A 3M3FA 2VP1A 2XXYA 3RNNA 1EU8A 2RINA 3OOAA 1EZOA 3U1OA 3ILUB 4PQJA 1A8FA 2ZNSA 4F29A 3C35A 5DW8A 1FTKA 3SETA 4O7IA 4MIJA 2CZLA 1MXYA 4Q5TA 2Q9TA 1OVTA 3KJTA 3ZS6A 2IA4A 2PFYA 2WBBA 4P9KA 3SERA 3TCFA 1LAHE 3VLUA 2X26A 2R9JA 2P3VA 4NF5B 4KQPA 5I58B 1B3FA 4EQ7A 4FEDA 1N0TA 4U23A 2UVIA 3FJMA 1SW5A 1H45A 1Y4CA 1N3XA 1KWHA 2Y84A 2X7QA 1OLAA 3MP6A 5ITPA 4PGNA 4PFYA 1IUDA 3A3CA 4FEBA 1FQDA 4MEVA 2FA7A 1MPDA 3MC2A 4PTKA 2HPGA 4KYDA 3IR1A 3G3IA 3PPQA 4HS7A 2ONSA 3JV9A 2XWOA 3O29A 5I2NA 3VDFA 4LZ7A 4H5GA 1MDQA 1SQYA 4XXUA 2XX8A 3MVXA 4RJZA 3OSRA 1NUYA 3TMGA 4GX3A 5IZZA 1FW0A 3PUXE 1NV2A 4P11A 4GQOA 4F22A 3ECRA 4BDNA 1B0LA 1UIUA 2P0SA 4ELRA 4F1VA 3L6GA 4OA4A 1A54A 3K1MA 4GX6A 1PBQA 3RT6B 4ZS9A 1MQHA 1R6ZA 3VLWA 1JVYA 4E0WA 1FPBA 3U92A 3O2AA 3N26A 1H3DA 1QW0A 2HXRA 2A5TA 4LZ5A 4X9TA 2UVGA 1USYH 4ZEBA 1Y20A 2BJIA 4PFBA 5I56B 2H99A 3N94A 1YYZA 1PDAA 3Q29A 4NF8B 1IEJA 1P1QA 2V3QA 4MJOA 3G3HA 3TTKA 4IB2A 3FD3A 5A5XB 2DE4A 2P1SA 4GOTA 2Z8EA 1JVXA 3PPRA 4R72A 2F97A 3MPKA 4JXIA 3BIHA 4N8YA 1FPLA 4JSOA 5DT6A 2QS2A 1B4ZA 1LB8A 4QSCA 4NAPA 5KCJA 3O28A 4M4GA 1SYIA 1FQCA 5EHMA 3IL1B 4OVPA 1MXUA 4IGRA 2P2AA 3M3KA 5ICQA 3O6GA 3MJNA 1NUXA 1MRPA 5ET8A 3E9XA 2FVZA 3QIMA 4KFQA 3M8UA 3TTMA 2NUVA 2DWJA 2DWIA 4RYAA 3IOWA 4X8RA 4I8CA 4F39A 1XOCA 4G68A 2QMXA 4IY6A 1B2HA 4OWDA 5FHNA 4PE5B 3K02A 4R9GA 1A7LA 4OFJA 4QXDA 1MH4A 2DVCA 2ZNUA 2QJEA 1FBGA 2WX9A 1JW5A 1LBYA 3M3LA 2I0CA 2H5YA 4F31B 1Y3NA 4IO5A 2H9BA 1M5EA 4YMBA 4GWSA 4UABA 4GWWA 3S9EA 5IKBA 2XXWA 4OVJA 1O7TA 4PFUA 1II5A 4X48A 1Q9DA 2F36A 1GV8A 3PMXA 3E79A 1P99A 3FV2A 4H1XA 5J1DA 3IOVA 1P1OA 2GFEA 4DI3D 2RC8A 3KN3A 4FE8A 1NV6A 1POTA 4KHZE 2P3NA 5H8NB 3W9WA 4XTCQ 2O1MA 1B3LA 4NWCA 1GVCA 4MNPA 5K2YA 2F3DA 4H6DA 2OX3A 1LBCA 3T66A 1NV3A 4R6KA 4ISUA 3G7WA 5K2XA 1P1NA 5J16A 5ET5A 3H6WA 4PDDA 2HQ0A 4OFOA 2WYPA 1HSLA 1SPIA 3RPLB 2XX7A 5H8FB 1EYIA 1JETA 2VHAA 4LQ2A 4NF4A 1POY1 5ICTA 5ITOA 3CI8A 3TQLA 3KSJA 2IEEA 4FECA 4GD5A 3OENA 1VE4A 3LV0A 4PC9A 3PMVA 3QMFA 1MG1A 4R2BA 4O3CA 1EZPA 3RT8A 1B6HA 3KBZA 2ZNTA 4FIMA 2V25A 3SEUA 4LUBA 4GF8A 4F2OA 5CMMA 5DVFA 1DOTA 4OXVA 4OHNA 4QFKA 2O51A 1UTHB 2Z8FA 5EQ9A 1D9YA 4KXPA 2FBPA 4P47A 3BKIB 3D4CA 1B5IA 2WYKA 1DBZA 3H6TA 3N6UA 4H46A 1B7UA 3OXNA 1TXFA 4YU0A 3ZSFA 2DDKA 3MZ1A 1AL3A 2PCRA 4N81A 1AH5A 4TOZA 2HXWA 5FBPA 2XA5A 2F3BA 2QS1A 4X1BA 2DE3A 5LOMA 4JDFA 3RY3A 3U93A 1N76A 4MH5A 1BIYA 1Q35A 1QULA 3UGWA 2QVRA 3EF7A 5H8HB 4BDRA 1K9ZA 4U1ZA 5KZTA 3H6UA 1ATGA 1KA1A 3QXMA 4AS4A 1G0IA 5IM2A 2FYIA 4H5FA 3KN7A 3ODBA 3TODA 3W15C 3AXFA 1AOVA 2CMOA 1Y4TA 3QUJA 4MFIA 5I2KB 1Q1KA 5CMCA 3OO6A 3LR1A 4H65A 2UYFA 3U72A 5DYHA 2OCUA 4PETA 1WVJA 4PFWA 4MNIA 4R74A 1GTKA 1UTBA 4OQOA 1LFIA 5FHMA 1CE2A 3S9NC 4EDPA 4U2RA 5H8QB 4XKQA 2E1SA 3PU5A 5I59B 1SDXA 3MP8A 4OMBA 4TQUQ 4GXAA 1JNFA 3O97A 1B7HA 4ZEFA 5HBCA 3PPOA 4YKIA 3KN8A 4RK2A 3OELA 1NL5A 5TPAA 3H03A 4G68C 4P0IA 2F6GA 2X7PA 1DK4A 3IJXB 3PUWE 3SEYA 2UVJA 4ZEDA 3GXAA 3FXUA 4G8MA 3PGFA 4QSEA 4YAHX 1NUWA 5EQ8A 4UACA 1NV0A 2HCAA 2RF1A 4NEDA 3VVFA 3TCHA 1PB7A 1MXZA 3QK6A 1B05A 1ZLQA 3F11A 2PYYA 1MXXA 1MY2A 2F7CA 1LEVA 3B6WA 2I3VA 1MM7A 3IOTA 3HFUA 3GBBA 4R9FA 3PUYE 1CNQA 1JQFA 1N84A 1ZJLA 1DTGA 2DQVA 2ZYNA 4R2FA 2B3FA 3TTRA 4GLIA 1QUIA 3TEPA 1QKBA 2QSXA 2F34A 1HSJA 3K4UA 2D3IA 2OZZA 3USDA 3QSLA 1LBVA 4BDMA 4NMYA 1TFDA 3QAXA 5TP9B 3SESA 2DXRA 4ZZEA 3JYRA 3B8BA 2KR0A 4YZZA 3I6VA 3TELA 2QMWA 5F1QA 4QRZA 4NF0A 2DOJA 2H4IA 4F3BA 3DM0A 2QFLA 2XD3A 3FJ7A 1FBCA 3OMBA 4DI4B 1HSEA 5L8DA 1RDZA 4KCCA 4JWYA 2VGQA 3OD7A 2V4CA 4R6YA 3HSTA 3LC8A 3MYUA 2WKYA 2L5VA 4HE0A 1SW1A 4PAIA 2KQZA 4K3FA 1DPEA 4ESWA 2KLFA 4ZE8A 2XXPA 4EF1A 2CZIA 2I58A 3B6QA 5HM4B 3C32A 3QUFA 3K1PA 5AA3A 3LSXA 1I69A 3IJOB 4MMPA 2OLBA 2V3UA 1N3WA 1NMUA 3UP9A 4F18A 3VV5A 3V8XB 4DXUA 4YKKA 1LLSA 3N6TA 4NWDA 1URGA 3RN8A 4DCYA 4KYSA 4GVOA 2XXXA 1B32A 2HZKA 5I57A 1Y9UA 1SD3A 1LB9A 4U1OA 5AA2B 3KGCA 4F1YA 4NQ8A 4AB5A
chains in the Genus database with same CATH topology
1S7YA 5JTYA 3SEVA 1UQWA 3FASA 4NF6B 5CMBA 1O64A 4DIGA 3KBRA 4GWOA 1Z7ME 4ELOA 4OFLA 5FTIA 2DWAA 1JEVA 1B3GA 3FV1A 5AA4B 2O1LA 1JW1A 4JWXA 1B46A 1RYOA 4NTLA 1PEBA 3LSWA 3C33A 5B7DA 1A55A 5I84A 4MBPA 2G29A 4KR5A 1FQAA 4RNSA 3S2VA 1ELJA 1MQIA 3E4RA 1A40A 2XXHA 2V3TA 4N07A 1JEUA 4R73A 1WODA 3C36A 3H7MA 4QF9A 4U22A 1VFDA 2HFBA 3O9PA 4H8IA 3THIA 2YJPA 2Y7WA 1EZ9A 1H43A 1R9LA 5H8FA 1S50A 4ELQA 2BJJX 1SW2A 3U94A 3OO8A 1H44A 3T9XB 1A99A 3K6XA 3T9HB 3FVNA 1IXGA 2V84A 2Z22A 3PD8A 4HCYA 4LATA 1B58A 1ZIUA 5CBSA 4QFLA 4FJPA 1QKAA 4OTEA 1VFEA 2GRVA 3IB1A 2Q88A 1MXVA 2NVUB 3JZJA 1B1HA 1UTHA 2I49A 2F78A 4KPTA 4F3SA 3KEIA 3OEMA 4OERA 3TZAA 4TLMB 3BFUA 2ANJA 2THIA 1US5A 3PPPA 4BDOA 3IB0A 3MWBA 1LAXA 5DVJA 2PMSA 1Y1MA 4G77A 1N7XA 1LFGA 2QL3A 3O6IA 5IAIA 3L6HA 1OQGA 2F8DA 4DLDA 4WEPA 4JSDA 1I6AA 4OYVA 3W9VA 4ZEKA 2A5TB 2G93A 3PUZE 5CM6A 3TTNA 1FQBA 1PBPA 2Q2AA 3CVGA 1SI1A 4Z0IA 4M1VA 3SEXA 3HHFA 1QJMA 3FUZA 2DS9A 3P7IA 4IO6A 2ZYKA 3GLBA 2XD2A 2OK2A 2I4CA 3KG2A 3IOUA 3H06B 4LZ8A 3R6UA 2R6GE 1DSNA 1NH8A 3PUVE 2AIXA 4X1DA 2RC9A 1NNTA 1ZKBA 3G3JA 2NWJA 3ZKKA 4HTGA 3TYHA 1SVXB 2UXAA 3MVWA 1N7WA 4NE4A 5KDTA 3HHGA 2I0BA 1NH7A 2PT2A 2UVHA 3RPWA 3RTFB 1LCTA 2NOOA 3T93B 3T22A 3TUSA 3HN0A 2ESNA 4G68B 4F2QA 1XS5A 2REGA 1MY0A 4YB5A 2HAUA 4UA8A 4HCWA 2ZXTA 5DEXA 4IGTA 1MY1A 3KFMA 4YKPA 1B9JA 3FXRA 5CBRA 4RPOA 3KZGA 3UIFA 1VSOA 5FHOA 4I1DA 4LA9A 2W7YA 1IIWA 1RKMA 1VR5A 3MVZA 4IO2A 4U21A 5JK4A 1B52A 3LSFB 3S4UA 1FTJA 1MPBA 3DP8A 2GHBA 4U4XA 4NF5A 3R26A 4POWA 1M5FA 4OENA 5I58A 2DSFA 2UYEA 1USYE 1I6QA 1GGGA 4TLLB 3WAEA 2VD3A 1OQHA 5AA1A 3MBPA 3MW0A 3MZBA 3Q27A 2M8CA 4P0GA 2F7AA 1A8EA 2Z23A 2XXTA 2RCBA 2YPNA 3TCGA 4ZE9A 1URSA 3TQWA 4NF4B 3C4MA 3C34A 1AIVA 2LAOA 4YKJA 1YAEA 2OWSA 4DE8A 1B5JA 1LAFE 4IO4A 1D4NA 1MY4A 1SYHA 1TT1A 3K2DA 2VOZA 3TKDA 3MUQA 3K6VA 4AB6A 2DWHA 3T9VA 4QHQA 2XXIA 2QPQA 3TPAA 1UIVA 2O84X 4YMAA 2PX1A 2O69A 3HO7A 4GIZA 3FVKA 3Q26A 3ZKLA 2QS4A 1B7ZA 5DVIA 1BTJA 1DPPA 3MVYA 2B65A 4DXCA 3UA8A 3DLNA 3PMWA 2PBWA 1IXHA 3LSLA 1JW4A 4R6HA 3OSQA 2AYSA 1TWYA 4I62A 4H0WA 5I56A 3Q25A 3C9HA 2Q8JA 1BKAA 4NF8A 3SEWA 3VLVA 2HAVA 4ZDMA 4BDLA 1MDP1 5A5XA 5JEIA 2Y7KA 3OEKA 2ALUA 1MM6A 2VD2A 1ZBMA 1Y1ZA 3IO4A 2RCAA 3IK6B 3K1NA 1B51A 4FORA 3TDJA 1YTVA 4OESA 4LONB 1M5CA 1LGBC 1MQDA 3FXQA 1Y3QA 3S9LC 1CB6A 2XXQA 4C1UA 5L9OA 1B40A 2ONKE 1B3EA 1FTLA 1ANFA 1NNPA 2DVZA 3CG3A 2O68A 3FATA 4BLAA 2OJTA 4ZZAA 3G3GA 3HCQA 3CIJA 3VVDA 3FVGA 1UTBB 1QUJA 3EN3A 4GL0A 1MQGA 1M5BA 3ONMA 4G4PA 1DMBA 3HPIA 4LVQA 3VXCA 3V89B 4MLVA 3K00A 4KD5A 1S9TA 3Q28A 5TPAB 3ILTB 2A5SA 3SKPA 3CR9A 5EHSA 2D21A 4G8HA 3O66A 3KOTA 3A09A 2F6PA 1MH3A 3B7DA 2QS3A 2Y7PA 3C31A 3PV0E 4ZEIA 2QRYA 1MXWA 3KOSA 2HZLA 2AL5A 4DXBA 5TU0A 4EF2A 5L9SA 4OZ9A 1B3HA 2R71A 4RY1A 5H8NA 1J1NA 1T0KA 5B70A 1IZ1A 2F35A 3IAZA 3K6UA 1I6BA 5HPQA 1D3KA 4RPNA 1LCFA 1XVYA 2Q2CA 3VXBA 1QVSA 3T9UA 3FVOA 3R7XA 2GHAA 4OETA 3CSBA 2B3BA 1MY3A 4U4SA 1IXCA 2DXYA 4THIA 1R9QA 1LAGE 2Y7IA 2ONRA 2OWTA 2Q89A 3BFTA 3I3VA 3PD9A 1D9VA 1NFTA 4IO3A 1P1UA 4OEUA 1ZU0A 3RUMA 3U8QA 4H67A 4ND9A 5AE4A 1YCJA 2NXOA 3CFXA 1N04A 1RYXA 1US4A 4BDQA 1DTZA 4OEVA 2DYXA 4QFPA 5DTBA 3VE1B 1FTMA 4I9DA 2XXUA 4JBZA 2PT1A 1FQEA 1AMFA 4DDDA 4IY5A 3RQTA 3FJGA 5L9MA 5CC2A 3K0VA 1TFAA 4H8JA 5I57B 3LUYA 4XKNA 4RA1A 2XX9A 3SDFA 3MAMA 4G2ZA 3CSGA 5I2NB 1OLCA 3IO6A 3MQ9A 1EH3A 5JTYB 4WKMA 3BBRA 4YICA 3VFJA 3PPNA 3TAJA 4GL8A 1XVXA 3KSXA 4XKRA 3MPLA 2F7BA 2GH9A 2H98A 3MP1A 1L5TA 2FNCA 3G3FA 3QYTA 3FGSA 2OBGA 4ONYA 1F9BA 5H8HA 2REJA 3IORA 3V83A 3H4ZA 3TFLA 2I6EA 1Z7NE 1H76A 3RTWB 2H25A 3EQ1A 5I2KA 1ZTYA 2RKMA 2F5XA 4XIGQ 4EQ9A 3E13X 1ZMGA 3B6TA 4Q8RA 2O7UA 1OIBA 1PC3A 5CI5A 2XXVA 4FAJA 5FTHA 4G8NA 5H8QA 1MQJA 2Z8DA 5I59A 4L17A 3VVEA 3LBSA 1IQ7A 2PVUA 4ZECA 2O7IA 3OO9A 5KCJB 3EHUA 3DP6A 2XHDA 1XC1A 4GRKA 4LP2B 4ESXA 4Q30B 5H8SA 3K6WA 2HEUA 4F19A 1P1WA 4O3AA 4WXJA 4Z7EA 3EHTA 3A3UA 3EPEA 2ZYOA 1M5DA 5ISUA 2I4BA 4PFTA 4Q0CA 4KCDA 4EUOA 3H6VA 4WEDA 3IB2A 1LFHA 1IXIA 4ECFA 5ELVA 3UK4A 4DZ1A 4QSDA 4R75A 4YB7A 1GR2A 3CFZA 5EYFA 4N13A 5TP9A 2E0SA 5BWJA 2DP8A 4KYEA 5CMKA 3HV1A 3CFLA 4ELPA 4EXKA 1NNKA 3CRBA 2YLNA 5AA2D 1URDA 3O6HA 4JB7A 3CG1A 1PB9A 1QUKA 2Y7RA 1R1NA 3E3KA 3WAFA 1Y3PA 3N5LA 4XKPA 1B1XA 3GBAA 3T96B 3V5AA 1B4HA 4IO7A 3IX1A 1PB8A 1BLFA 1FQFA 1FTOA 4QFOA 2XXRA 5CRYA 4EQBA 1SW4A 4EXLA 1SI0A 4C1TA 1SBPA 4N6PA 4MLQA 4F1UA 4FATA 1NKXA 5BUUA 1B0HA 2D5WA 4RK9A 4E0XA 3MZ9A 5AA2A 4AQ4A 3FIRA 2DE2A 4JWOA 1BP5A 3OO7A 3UORA 4NF6A 3TTLA 3EHSA 4GXSB 2I3WA 2V93A 3I5OA 2RC7A 2AL4A 3K01A 1FCKA 3GZGA 4KI0E 4RXLA 3DELB 1MS7A 1LSTA 5AA4A 5KDTB 5F7VA 3G3KA 1B5HA 4MF3A 1WDNA 1LBBA 1O63A 4LQ5A 3UN6A 4POXA 3D4GA 4DCXA 2ABHA 1NNFA 1XT8A 4PP0A 1OMPA 3S9MC 4O3BA 4F3PA 2ZYMA 4YB6A 4QFNA 1XHYA 4HW8A 3RLFE 3DP4A 3FZVA 1OVBA 4GFRA 1MPCA 4C0RA 3RGYA 2O6AA 5M2VA 2ZMBA 1YPNA 3H3GA 5DEXB 2I48A 4F3GA 1IITA 3KJ7A 3M3FA 2VP1A 2XXYA 3RNNA 1EU8A 2RINA 3OOAA 1EZOA 3U1OA 3ILUB 4PQJA 1A8FA 2ZNSA 4F29A 3C35A 3SETA 1FTKA 2CZLA 1MXYA 4Q5TA 2Q9TA 1OVTA 3KJTA 3ZS6A 2IA4A 3SERA 3TCFA 1LAHE 3VLUA 2X26A 2R9JA 4NF5B 4KQPA 5I58B 1B3FA 4EQ7A 4FEDA 1N0TA 4U23A 2UVIA 3FJMA 1SW5A 1H45A 1Y4CA 1N3XA 1KWHA 2Y84A 2X7QA 1OLAA 3MP6A 5ITPA 4PFYA 1IUDA 3A3CA 4FEBA 1FQDA 2FA7A 1MPDA 3MC2A 4KYDA 3IR1A 3G3IA 3PPQA 4HS7A 2ONSA 3JV9A 3O29A 5I2NA 3VDFA 4LZ7A 4H5GA 1MDQA 1SQYA 4XXUA 2XX8A 3MVXA 4RJZA 3OSRA 3TMGA 1FW0A 3PUXE 4P11A 4GQOA 4F22A 3ECRA 4BDNA 1B0LA 1UIUA 4F1VA 2P0SA 4ELRA 3L6GA 1A54A 3K1MA 3RT6B 1PBQA 4ZS9A 1MQHA 1R6ZA 3VLWA 1JVYA 4E0WA 3U92A 3O2AA 3N26A 1H3DA 1QW0A 4LZ5A 2A5TA 4X9TA 2UVGA 1USYH 4ZEBA 1Y20A 5I56B 2H99A 3N94A 1PDAA 3Q29A 4NF8B 1IEJA 1P1QA 2V3QA 3G3HA 3TTKA 4IB2A 3FD3A 5A5XB 2DE4A 2P1SA 4GOTA 2Z8EA 1JVXA 3PPRA 4R72A 2F97A 3MPKA 4JXIA 4JSOA 5DT6A 2QS2A 1B4ZA 1LB8A 4QSCA 5KCJA 3O28A 4M4GA 1SYIA 1FQCA 5EHMA 3IL1B 1MXUA 4IGRA 2P2AA 3M3KA 5ICQA 3O6GA 3MJNA 1MRPA 3E9XA 3QIMA 4KFQA 3M8UA 3TTMA 2NUVA 2DWJA 2DWIA 4RYAA 3IOWA 4I8CA 4F39A 1XOCA 4G68A 2QMXA 4IY6A 1B2HA 4OWDA 5FHNA 4PE5B 3K02A 4R9GA 1A7LA 4OFJA 1MH4A 2DVCA 2ZNUA 2QJEA 1JW5A 3M3LA 2I0CA 2H5YA 4F31B 1Y3NA 4IO5A 2H9BA 1M5EA 4YMBA 3S9EA 5IKBA 2XXWA 4OVJA 1O7TA 4PFUA 1II5A 4X48A 2F36A 1GV8A 3PMXA 1P99A 3FV2A 4H1XA 5J1DA 3IOVA 1P1OA 2GFEA 2RC8A 3KN3A 4FE8A 1POTA 4KHZE 5H8NB 3W9WA 4XTCQ 2O1MA 1B3LA 4NWCA 1GVCA 5K2YA 4H6DA 1LBCA 3T66A 4R6KA 4ISUA 3G7WA 5K2XA 1P1NA 3H6WA 2HQ0A 4OFOA 1HSLA 2XX7A 5H8FB 1JETA 2VHAA 4LQ2A 4NF4A 1POY1 5ICTA 5ITOA 3CI8A 3TQLA 3KSJA 2IEEA 4FECA 4GD5A 3OENA 1VE4A 3PMVA 1MG1A 4R2BA 4O3CA 1EZPA 3RT8A 1B6HA 2ZNTA 4FIMA 2V25A 3SEUA 4LUBA 4GF8A 4F2OA 5CMMA 5DVFA 1DOTA 4OXVA 4OHNA 4QFKA 2O51A 1UTHB 2Z8FA 1D9YA 3BKIB 3D4CA 1B5IA 3H6TA 3N6UA 1B7UA 3OXNA 1TXFA 4YU0A 3ZSFA 3MZ1A 1AL3A 1AH5A 4TOZA 2HXWA 2QS1A 4X1BA 2DE3A 5LOMA 4JDFA 3RY3A 3U93A 1N76A 4MH5A 1BIYA 1Q35A 1QULA 3UGWA 3EF7A 5H8HB 4BDRA 4U1ZA 5KZTA 3H6UA 1ATGA 3QXMA 2FYIA 4H5FA 3KN7A 3ODBA 3TODA 3W15C 3AXFA 1AOVA 2CMOA 1Y4TA 3QUJA 4MFIA 5I2KB 1Q1KA 5CMCA 3OO6A 3LR1A 4H65A 2UYFA 3U72A 5DYHA 2OCUA 4PETA 1WVJA 4PFWA 4R74A 1GTKA 1UTBA 4OQOA 1LFIA 5FHMA 1CE2A 3S9NC 4EDPA 4U2RA 5H8QB 4XKQA 2E1SA 3PU5A 5I59B 1SDXA 3MP8A 4OMBA 4TQUQ 4GXAA 1JNFA 3O97A 1B7HA 4ZEFA 5HBCA 3PPOA 4YKIA 3KN8A 4RK2A 3OELA 1NL5A 5TPAA 3H03A 4G68C 4P0IA 2F6GA 2X7PA 3IJXB 3PUWE 3SEYA 2UVJA 4ZEDA 3GXAA 3FXUA 4G8MA 3PGFA 4QSEA 4YAHX 4UACA 2HCAA 2RF1A 4NEDA 3VVFA 3TCHA 1PB7A 1MXZA 3QK6A 1B05A 1ZLQA 3F11A 2PYYA 1MXXA 1MY2A 2F7CA 3B6WA 2I3VA 1MM7A 3IOTA 3GBBA 4R9FA 3PUYE 1JQFA 1N84A 1ZJLA 1DTGA 2DQVA 2ZYNA 4R2FA 2B3FA 3TTRA 4GLIA 1QUIA 3TEPA 1QKBA 2QSXA 2F34A 1HSJA 3K4UA 2D3IA 2OZZA 3USDA 3QSLA 4BDMA 4NMYA 1TFDA 3QAXA 5TP9B 3SESA 2DXRA 4ZZEA 3JYRA 4YZZA 3I6VA 3TELA 2QMWA 5F1QA 4QRZA 2DOJA 2H4IA 4F3BA 3DM0A 2XD3A 3FJ7A 3OMBA 1HSEA 5L8DA 4KCCA 4JWYA 2VGQA 3OD7A 4R6YA 3HSTA 3LC8A 2WKYA 1SW1A 4K3FA 1DPEA 4ESWA 2KLFA 4ZE8A 2XXPA 4EF1A 2I58A 3B6QA 5HM4B 3C32A 3QUFA 3K1PA 5AA3A 3LSXA 1I69A 3IJOB 2OLBA 2V3UA 1N3WA 1NMUA 3UP9A 4F18A 3VV5A 3V8XB 4DXUA 4YKKA 1LLSA 3N6TA 4NWDA 1URGA 3RN8A 4DCYA 4KYSA 4GVOA 2XXXA 1B32A 2HZKA 5I57A 1Y9UA 1SD3A 1LB9A 4U1OA 5AA2B 3KGCA 4F1YA 4AB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7Y A;  5JTY A;  3SEV A;  1UQW A;  3FAS A;  4NF6 B;  5CMB A;  1O64 A;  4DIG A;  3KBR A;  4GWO A;  1Z7M E;  4ELO A;  4OFL A;  5FTI A;  2DWA A;  1JEV A;  1B3G A;  3FV1 A;  5AA4 B;  2O1L A;  1JW1 A;  4JWX A;  1B46 A;  1RYO A;  4NTL A;  1PEB A;  3LSW A;  3C33 A;  5B7D A;  1A55 A;  5I84 A;  4MBP A;  2G29 A;  4KR5 A;  1FQA A;  4RNS A;  3S2V A;  1ELJ A;  1MQI A;  3E4R A;  1A40 A;  2XXH A;  2V3T A;  4N07 A;  1JEU A;  4R73 A;  1WOD A;  3C36 A;  3H7M A;  4QF9 A;  4U22 A;  1VFD A;  2HFB A;  3O9P A;  4H8I A;  3THI A;  2YJP A;  2Y7W A;  1EZ9 A;  1H43 A;  1R9L A;  5H8F A;  1S50 A;  4ELQ A;  2BJJ X;  1SW2 A;  3U94 A;  3OO8 A;  1H44 A;  3T9X B;  1A99 A;  3K6X A;  3T9H B;  3FVN A;  1IXG A;  2V84 A;  2Z22 A;  3PD8 A;  4HCY A;  4LAT A;  1B58 A;  1ZIU A;  5CBS A;  4QFL A;  4FJP A;  1QKA A;  4OTE A;  1VFE A;  2GRV A;  3IB1 A;  2Q88 A;  1MXV A;  2NVU B;  3JZJ A;  1B1H A;  1UTH A;  2I49 A;  2F78 A;  4KPT A;  4F3S A;  3KEI A;  3OEM A;  4OER A;  3TZA A;  4TLM B;  3BFU A;  2ANJ A;  2THI A;  1US5 A;  3PPP A;  4BDO A;  3IB0 A;  3MWB A;  1LAX A;  5DVJ A;  2PMS A;  1Y1M A;  4G77 A;  1N7X A;  1LFG A;  2QL3 A;  3O6I A;  5IAI A;  3L6H A;  1OQG A;  2F8D A;  4DLD A;  4WEP A;  4JSD A;  1I6A A;  4OYV A;  3W9V A;  4ZEK A;  2A5T B;  2G93 A;  3PUZ E;  5CM6 A;  3TTN A;  1FQB A;  1PBP A;  2Q2A A;  3CVG A;  1SI1 A;  4Z0I A;  4M1V A;  3SEX A;  3HHF A;  1QJM A;  3FUZ A;  2DS9 A;  3P7I A;  4IO6 A;  2ZYK A;  3GLB A;  2XD2 A;  2OK2 A;  2I4C A;  3KG2 A;  3IOU A;  3H06 B;  4LZ8 A;  3R6U A;  2R6G E;  1DSN A;  1NH8 A;  3PUV E;  2AIX A;  4X1D A;  2RC9 A;  1NNT A;  1ZKB A;  3G3J A;  2NWJ A;  3ZKK A;  4HTG A;  3TYH A;  1SVX B;  2UXA A;  3MVW A;  1N7W A;  4NE4 A;  5KDT A;  3HHG A;  2I0B A;  1NH7 A;  2PT2 A;  2UVH A;  3RPW A;  3RTF B;  1LCT A;  2NOO A;  3T93 B;  3T22 A;  3TUS A;  3HN0 A;  2ESN A;  4G68 B;  4F2Q A;  1XS5 A;  2REG A;  1MY0 A;  4YB5 A;  2HAU A;  4UA8 A;  4HCW A;  2ZXT A;  5DEX A;  4IGT A;  1MY1 A;  3KFM A;  4YKP A;  1B9J A;  3FXR A;  5CBR A;  4RPO A;  3KZG A;  3UIF A;  1VSO A;  5FHO A;  4I1D A;  4LA9 A;  2W7Y A;  1IIW A;  1RKM A;  1VR5 A;  3MVZ A;  4IO2 A;  4U21 A;  5JK4 A;  1B52 A;  3LSF B;  3S4U A;  1FTJ A;  1MPB A;  3DP8 A;  2GHB A;  4U4X A;  4NF5 A;  3R26 A;  4POW A;  1M5F A;  4OEN A;  5I58 A;  2DSF A;  2UYE A;  1USY E;  1I6Q A;  1GGG A;  4TLL B;  3WAE A;  2VD3 A;  1OQH A;  5AA1 A;  3MBP A;  3MW0 A;  3MZB A;  3Q27 A;  2M8C A;  4P0G A;  2F7A A;  1A8E A;  2Z23 A;  2XXT A;  2RCB A;  2YPN A;  3TCG A;  4ZE9 A;  1URS A;  3TQW A;  4NF4 B;  3C4M A;  3C34 A;  1AIV A;  2LAO A;  4YKJ A;  1YAE A;  2OWS A;  4DE8 A;  1B5J A;  1LAF E;  4IO4 A;  1D4N A;  1MY4 A;  1SYH A;  1TT1 A;  3K2D A;  2VOZ A;  3TKD A;  3MUQ A;  3K6V A;  4AB6 A;  2DWH A;  3T9V A;  4QHQ A;  2XXI A;  2QPQ A;  3TPA A;  1UIV A;  2O84 X;  4YMA A;  2PX1 A;  2O69 A;  3HO7 A;  4GIZ A;  3FVK A;  3Q26 A;  3ZKL A;  2QS4 A;  1B7Z A;  5DVI A;  1BTJ A;  1DPP A;  3MVY A;  2B65 A;  4DXC A;  3UA8 A;  3DLN A;  3PMW A;  2PBW A;  1IXH A;  3LSL A;  1JW4 A;  4R6H A;  3OSQ A;  2AYS A;  1TWY A;  4I62 A;  4H0W A;  5I56 A;  3Q25 A;  3C9H A;  2Q8J A;  1BKA A;  4NF8 A;  3SEW A;  3VLV A;  2HAV A;  4ZDM A;  4BDL A;  1MDP 1;  5A5X A;  5JEI A;  2Y7K A;  3OEK A;  2ALU A;  1MM6 A;  2VD2 A;  1ZBM A;  1Y1Z A;  3IO4 A;  2RCA A;  3IK6 B;  3K1N A;  1B51 A;  4FOR A;  3TDJ A;  1YTV A;  4OES A;  4LON B;  1M5C A;  1LGB C;  1MQD A;  3FXQ A;  1Y3Q A;  3S9L C;  1CB6 A;  2XXQ A;  4C1U A;  5L9O A;  1B40 A;  2ONK E;  1B3E A;  1FTL A;  1ANF A;  1NNP A;  2DVZ A;  3CG3 A;  2O68 A;  3FAT A;  4BLA A;  2OJT A;  4ZZA A;  3G3G A;  3HCQ A;  3CIJ A;  3VVD A;  3FVG A;  1UTB B;  1QUJ A;  3EN3 A;  4GL0 A;  1MQG A;  1M5B A;  3ONM A;  4G4P A;  1DMB A;  3HPI A;  4LVQ A;  3VXC A;  3V89 B;  4MLV A;  3K00 A;  4KD5 A;  1S9T A;  3Q28 A;  5TPA B;  3ILT B;  2A5S A;  3SKP A;  3CR9 A;  5EHS A;  2D21 A;  4G8H A;  3O66 A;  3KOT A;  3A09 A;  2F6P A;  1MH3 A;  3B7D A;  2QS3 A;  2Y7P A;  3C31 A;  3PV0 E;  4ZEI A;  2QRY A;  1MXW A;  3KOS A;  2HZL A;  2AL5 A;  4DXB A;  5TU0 A;  4EF2 A;  5L9S A;  4OZ9 A;  1B3H A;  2R71 A;  4RY1 A;  5H8N A;  1J1N A;  1T0K A;  5B70 A;  1IZ1 A;  2F35 A;  3IAZ A;  3K6U A;  1I6B A;  5HPQ A;  1D3K A;  4RPN A;  1LCF A;  1XVY A;  2Q2C A;  3VXB A;  1QVS A;  3T9U A;  3FVO A;  3R7X A;  2GHA A;  4OET A;  3CSB A;  2B3B A;  1MY3 A;  4U4S A;  1IXC A;  2DXY A;  4THI A;  1R9Q A;  1LAG E;  2Y7I A;  2ONR A;  2OWT A;  2Q89 A;  3BFT A;  3I3V A;  3PD9 A;  1D9V A;  1NFT A;  4IO3 A;  1P1U A;  4OEU A;  1ZU0 A;  3RUM A;  3U8Q A;  4H67 A;  4ND9 A;  5AE4 A;  1YCJ A;  2NXO A;  3CFX A;  1N04 A;  1RYX A;  1US4 A;  4BDQ A;  1DTZ A;  4OEV A;  2DYX A;  4QFP A;  5DTB A;  3VE1 B;  1FTM A;  4I9D A;  2XXU A;  4JBZ A;  2PT1 A;  1FQE A;  1AMF A;  4DDD A;  4IY5 A;  3RQT A;  3FJG A;  5L9M A;  5CC2 A;  3K0V A;  1TFA A;  4H8J A;  5I57 B;  3LUY A;  4XKN A;  4RA1 A;  2XX9 A;  3SDF A;  3MAM A;  4G2Z A;  3CSG A;  5I2N B;  1OLC A;  3IO6 A;  3MQ9 A;  1EH3 A;  5JTY B;  4WKM A;  3BBR A;  4YIC A;  3VFJ A;  3PPN A;  3TAJ A;  4GL8 A;  1XVX A;  3KSX A;  4XKR A;  3MPL A;  2F7B A;  2GH9 A;  2H98 A;  3MP1 A;  1L5T A;  2FNC A;  3G3F A;  3QYT A;  3FGS A;  2OBG A;  4ONY A;  1F9B A;  5H8H A;  2REJ A;  3IOR A;  3V83 A;  3H4Z A;  3TFL A;  2I6E A;  1Z7N E;  1H76 A;  3RTW B;  2H25 A;  3EQ1 A;  5I2K A;  1ZTY A;  2RKM A;  2F5X A;  4XIG Q;  4EQ9 A;  3E13 X;  1ZMG A;  3B6T A;  4Q8R A;  2O7U A;  1OIB A;  1PC3 A;  5CI5 A;  2XXV A;  4FAJ A;  5FTH A;  4G8N A;  5H8Q A;  1MQJ A;  2Z8D A;  5I59 A;  4L17 A;  3VVE A;  3LBS A;  1IQ7 A;  2PVU A;  4ZEC A;  2O7I A;  3OO9 A;  5KCJ B;  3EHU A;  3DP6 A;  2XHD A;  1XC1 A;  4GRK A;  4LP2 B;  4ESX A;  4Q30 B;  5H8S A;  3K6W A;  2HEU A;  4F19 A;  1P1W A;  4O3A A;  4WXJ A;  4Z7E A;  3EHT A;  3A3U A;  3EPE A;  2ZYO A;  1M5D A;  5ISU A;  2I4B A;  4PFT A;  4Q0C A;  4KCD A;  4EUO A;  3H6V A;  4WED A;  3IB2 A;  1LFH A;  1IXI A;  4ECF A;  5ELV A;  3UK4 A;  4DZ1 A;  4QSD A;  4R75 A;  4YB7 A;  1GR2 A;  3CFZ A;  5EYF A;  4N13 A;  5TP9 A;  2E0S A;  5BWJ A;  2DP8 A;  4KYE A;  5CMK A;  3HV1 A;  3CFL A;  4ELP A;  4EXK A;  1NNK A;  3CRB A;  2YLN A;  5AA2 D;  1URD A;  3O6H A;  4JB7 A;  3CG1 A;  1PB9 A;  1QUK A;  2Y7R A;  1R1N A;  3E3K A;  3WAF A;  1Y3P A;  3N5L A;  4XKP A;  1B1X A;  3GBA A;  3T96 B;  3V5A A;  1B4H A;  4IO7 A;  3IX1 A;  1PB8 A;  1BLF A;  1FQF A;  1FTO A;  4QFO A;  2XXR A;  5CRY A;  4EQB A;  1SW4 A;  4EXL A;  1SI0 A;  4C1T A;  1SBP A;  4N6P A;  4MLQ A;  4F1U A;  4FAT A;  1NKX A;  5BUU A;  1B0H A;  2D5W A;  4RK9 A;  4E0X A;  3MZ9 A;  5AA2 A;  4AQ4 A;  3FIR A;  2DE2 A;  4JWO A;  1BP5 A;  3OO7 A;  3UOR A;  4NF6 A;  3TTL A;  3EHS A;  4GXS B;  2I3W A;  2V93 A;  3I5O A;  2RC7 A;  2AL4 A;  3K01 A;  1FCK A;  3GZG A;  4KI0 E;  4RXL A;  3DEL B;  1MS7 A;  1LST A;  5AA4 A;  5KDT B;  5F7V A;  3G3K A;  1B5H A;  4MF3 A;  1WDN A;  1LBB A;  1O63 A;  4LQ5 A;  3UN6 A;  4POX A;  3D4G A;  4DCX A;  2ABH A;  1NNF A;  1XT8 A;  4PP0 A;  1OMP A;  3S9M C;  4O3B A;  4F3P A;  2ZYM A;  4YB6 A;  4QFN A;  1XHY A;  4HW8 A;  3RLF E;  3DP4 A;  3FZV A;  1OVB A;  4GFR A;  1MPC A;  4C0R A;  3RGY A;  2O6A A;  5M2V A;  2ZMB A;  1YPN A;  3H3G A;  5DEX B;  2I48 A;  4F3G A;  1IIT A;  3KJ7 A;  3M3F A;  2VP1 A;  2XXY A;  3RNN A;  1EU8 A;  2RIN A;  3OOA A;  1EZO A;  3U1O A;  3ILU B;  4PQJ A;  1A8F A;  2ZNS A;  4F29 A;  3C35 A;  3SET A;  1FTK A;  2CZL A;  1MXY A;  4Q5T A;  2Q9T A;  1OVT A;  3KJT A;  3ZS6 A;  2IA4 A;  3SER A;  3TCF A;  1LAH E;  3VLU A;  2X26 A;  2R9J A;  4NF5 B;  4KQP A;  5I58 B;  1B3F A;  4EQ7 A;  4FED A;  1N0T A;  4U23 A;  2UVI A;  3FJM A;  1SW5 A;  1H45 A;  1Y4C A;  1N3X A;  1KWH A;  2Y84 A;  2X7Q A;  1OLA A;  3MP6 A;  5ITP A;  4PFY A;  1IUD A;  3A3C A;  4FEB A;  1FQD A;  2FA7 A;  1MPD A;  3MC2 A;  4KYD A;  3IR1 A;  3G3I A;  3PPQ A;  4HS7 A;  2ONS A;  3JV9 A;  3O29 A;  5I2N A;  3VDF A;  4LZ7 A;  4H5G A;  1MDQ A;  1SQY A;  4XXU A;  2XX8 A;  3MVX A;  4RJZ A;  3OSR A;  3TMG A;  1FW0 A;  3PUX E;  4P11 A;  4GQO A;  4F22 A;  3ECR A;  4BDN A;  1B0L A;  1UIU A;  4F1V A;  2P0S A;  4ELR A;  3L6G A;  1A54 A;  3K1M A;  3RT6 B;  1PBQ A;  4ZS9 A;  1MQH A;  1R6Z A;  3VLW A;  1JVY A;  4E0W A;  3U92 A;  3O2A A;  3N26 A;  1H3D A;  1QW0 A;  4LZ5 A;  2A5T A;  4X9T A;  2UVG A;  1USY H;  4ZEB A;  1Y20 A;  5I56 B;  2H99 A;  3N94 A;  1PDA A;  3Q29 A;  4NF8 B;  1IEJ A;  1P1Q A;  2V3Q A;  3G3H A;  3TTK A;  4IB2 A;  3FD3 A;  5A5X B;  2DE4 A;  2P1S A;  4GOT A;  2Z8E A;  1JVX A;  3PPR A;  4R72 A;  2F97 A;  3MPK A;  4JXI A;  4JSO A;  5DT6 A;  2QS2 A;  1B4Z A;  1LB8 A;  4QSC A;  5KCJ A;  3O28 A;  4M4G A;  1SYI A;  1FQC A;  5EHM A;  3IL1 B;  1MXU A;  4IGR A;  2P2A A;  3M3K A;  5ICQ A;  3O6G A;  3MJN A;  1MRP A;  3E9X A;  3QIM A;  4KFQ A;  3M8U A;  3TTM A;  2NUV A;  2DWJ A;  2DWI A;  4RYA A;  3IOW A;  4I8C A;  4F39 A;  1XOC A;  4G68 A;  2QMX A;  4IY6 A;  1B2H A;  4OWD A;  5FHN A;  4PE5 B;  3K02 A;  4R9G A;  1A7L A;  4OFJ A;  1MH4 A;  2DVC A;  2ZNU A;  2QJE A;  1JW5 A;  3M3L A;  2I0C A;  2H5Y A;  4F31 B;  1Y3N A;  4IO5 A;  2H9B A;  1M5E A;  4YMB A;  3S9E A;  5IKB A;  2XXW A;  4OVJ A;  1O7T A;  4PFU A;  1II5 A;  4X48 A;  2F36 A;  1GV8 A;  3PMX A;  1P99 A;  3FV2 A;  4H1X A;  5J1D A;  3IOV A;  1P1O A;  2GFE A;  2RC8 A;  3KN3 A;  4FE8 A;  1POT A;  4KHZ E;  5H8N B;  3W9W A;  4XTC Q;  2O1M A;  1B3L A;  4NWC A;  1GVC A;  5K2Y A;  4H6D A;  1LBC A;  3T66 A;  4R6K A;  4ISU A;  3G7W A;  5K2X A;  1P1N A;  3H6W A;  2HQ0 A;  4OFO A;  1HSL A;  2XX7 A;  5H8F B;  1JET A;  2VHA A;  4LQ2 A;  4NF4 A;  1POY 1;  5ICT A;  5ITO A;  3CI8 A;  3TQL A;  3KSJ A;  2IEE A;  4FEC A;  4GD5 A;  3OEN A;  1VE4 A;  3PMV A;  1MG1 A;  4R2B A;  4O3C A;  1EZP A;  3RT8 A;  1B6H A;  2ZNT A;  4FIM A;  2V25 A;  3SEU A;  4LUB A;  4GF8 A;  4F2O A;  5CMM A;  5DVF A;  1DOT A;  4OXV A;  4OHN A;  4QFK A;  2O51 A;  1UTH B;  2Z8F A;  1D9Y A;  3BKI B;  3D4C A;  1B5I A;  3H6T A;  3N6U A;  1B7U A;  3OXN A;  1TXF A;  4YU0 A;  3ZSF A;  3MZ1 A;  1AL3 A;  1AH5 A;  4TOZ A;  2HXW A;  2QS1 A;  4X1B A;  2DE3 A;  5LOM A;  4JDF A;  3RY3 A;  3U93 A;  1N76 A;  4MH5 A;  1BIY A;  1Q35 A;  1QUL A;  3UGW A;  3EF7 A;  5H8H B;  4BDR A;  4U1Z A;  5KZT A;  3H6U A;  1ATG A;  3QXM A;  2FYI A;  4H5F A;  3KN7 A;  3ODB A;  3TOD A;  3W15 C;  3AXF A;  1AOV A;  2CMO A;  1Y4T A;  3QUJ A;  4MFI A;  5I2K B;  1Q1K A;  5CMC A;  3OO6 A;  3LR1 A;  4H65 A;  2UYF A;  3U72 A;  5DYH A;  2OCU A;  4PET A;  1WVJ A;  4PFW A;  4R74 A;  1GTK A;  1UTB A;  4OQO A;  1LFI A;  5FHM A;  1CE2 A;  3S9N C;  4EDP A;  4U2R A;  5H8Q B;  4XKQ A;  2E1S A;  3PU5 A;  5I59 B;  1SDX A;  3MP8 A;  4OMB A;  4TQU Q;  4GXA A;  1JNF A;  3O97 A;  1B7H A;  4ZEF A;  5HBC A;  3PPO A;  4YKI A;  3KN8 A;  4RK2 A;  3OEL A;  1NL5 A;  5TPA A;  3H03 A;  4G68 C;  4P0I A;  2F6G A;  2X7P A;  3IJX B;  3PUW E;  3SEY A;  2UVJ A;  4ZED A;  3GXA A;  3FXU A;  4G8M A;  3PGF A;  4QSE A;  4YAH X;  4UAC A;  2HCA A;  2RF1 A;  4NED A;  3VVF A;  3TCH A;  1PB7 A;  1MXZ A;  3QK6 A;  1B05 A;  1ZLQ A;  3F11 A;  2PYY A;  1MXX A;  1MY2 A;  2F7C A;  3B6W A;  2I3V A;  1MM7 A;  3IOT A;  3GBB A;  4R9F A;  3PUY E;  1JQF A;  1N84 A;  1ZJL A;  1DTG A;  2DQV A;  2ZYN A;  4R2F A;  2B3F A;  3TTR A;  4GLI A;  1QUI A;  3TEP A;  1QKB A;  2QSX A;  2F34 A;  1HSJ A;  3K4U A;  2D3I A;  2OZZ A;  3USD A;  3QSL A;  4BDM A;  4NMY A;  1TFD A;  3QAX A;  5TP9 B;  3SES A;  2DXR A;  4ZZE A;  3JYR A;  4YZZ A;  3I6V A;  3TEL A;  2QMW A;  5F1Q A;  4QRZ A;  2DOJ A;  2H4I A;  4F3B A;  3DM0 A;  2XD3 A;  3FJ7 A;  3OMB A;  1HSE A;  5L8D A;  4KCC A;  4JWY A;  2VGQ A;  3OD7 A;  4R6Y A;  3HST A;  3LC8 A;  2WKY A;  1SW1 A;  4K3F A;  1DPE A;  4ESW A;  2KLF A;  4ZE8 A;  2XXP A;  4EF1 A;  2I58 A;  3B6Q A;  5HM4 B;  3C32 A;  3QUF A;  3K1P A;  5AA3 A;  3LSX A;  1I69 A;  3IJO B;  2OLB A;  2V3U A;  1N3W A;  1NMU A;  3UP9 A;  4F18 A;  3VV5 A;  3V8X B;  4DXU A;  4YKK A;  1LLS A;  3N6T A;  4NWD A;  1URG A;  3RN8 A;  4DCY A;  4KYS A;  4GVO A;  2XXX A;  1B32 A;  2HZK A;  5I57 A;  1Y9U A;  1SD3 A;  1LB9 A;  4U1O A;  5AA2 B;  3KGC A;  4F1Y A;  4AB5 A; 
#chains in the Genus database with same CATH topology
 1S7Y A;  5JTY A;  3SEV A;  1UQW A;  4O8M A;  2CEY A;  3FAS A;  4NF6 B;  5CMB A;  1O64 A;  4DIG A;  3KBR A;  4GWO A;  1Z7M E;  1DCU A;  4GBW A;  4ELO A;  4OFL A;  5FTI A;  2DWA A;  4FBP A;  1JEV A;  4N6K A;  1B3G A;  3FV1 A;  5AA4 B;  2O1L A;  1JW1 A;  3SZP A;  4GWZ A;  4JWX A;  1B46 A;  1RYO A;  4NTL A;  1PEB A;  3LSW A;  3U65 A;  4H45 A;  4OAN A;  3C33 A;  5B7D A;  1A55 A;  5I84 A;  4MBP A;  2G29 A;  4KR5 A;  1FQA A;  3E78 A;  4RNS A;  1FPE A;  2XWV A;  3S2V A;  1ELJ A;  1MQI A;  4PE3 A;  3E4R A;  1A40 A;  2XXH A;  2V3T A;  4N07 A;  1JEU A;  4R73 A;  1WOD A;  4MNC A;  1AWB A;  3C36 A;  3H7M A;  4QF9 A;  4U22 A;  1VFD A;  2HFB A;  1NV5 A;  3O9P A;  4H8I A;  3THI A;  2YJP A;  1IMC A;  5ESY A;  2Y7W A;  1EZ9 A;  1H43 A;  1R9L A;  5H8F A;  1S50 A;  4ELQ A;  2BJJ X;  1SW2 A;  5A5L A;  3U94 A;  3OO8 A;  1H44 A;  3T9X B;  1A99 A;  3K6X A;  3T9H B;  3FVN A;  1IXG A;  4PBH A;  2V84 A;  2Z22 A;  3PD8 A;  4HCY A;  4LAT A;  2MKZ A;  1B58 A;  1ZIU A;  5CBS A;  4QFL A;  4FJP A;  1QKA A;  2Y5K A;  4OTE A;  3FXB A;  1VFE A;  2GRV A;  3IB1 A;  2Q88 A;  1MXV A;  1QGX A;  2NVU B;  3PTY A;  5ET7 A;  3JZJ A;  1FBE A;  4P8B A;  4N8G A;  1B1H A;  1UTH A;  4AS5 A;  5IZ3 A;  2I49 A;  2F78 A;  4KPT A;  1IMD A;  4F3S A;  3KEI A;  3OEM A;  4O7M A;  4OER A;  3TZA A;  4TLM B;  3BFU A;  2ANJ A;  4P1E A;  2THI A;  1US5 A;  3PPP A;  3A29 A;  4BDO A;  5I5P A;  3IB0 A;  3MWB A;  1LAX A;  5DVJ A;  2PMS A;  1YXI A;  4PFR A;  3KC0 A;  1Y1M A;  4G77 A;  1N7X A;  1LFG A;  3T1B A;  2QL3 A;  3O6I A;  4JVI A;  5IAI A;  3L6H A;  1OQG A;  2F8D A;  4DLD A;  4WEP A;  5LDZ A;  2FIX A;  4JSD A;  1I6A A;  4OYV A;  3W9V A;  4ZEK A;  2A5T B;  5EQA A;  1INP A;  2G93 A;  1G0H A;  3PUZ E;  5CM6 A;  3TTN A;  1FQB A;  1PBP A;  2Q2A A;  3CVG A;  1BK4 A;  1SI1 A;  4Z0I A;  4M1V A;  3SEX A;  3HHF A;  1QJM A;  3FUZ A;  2DS9 A;  3P7I A;  4IO6 A;  2ZYK A;  3GLB A;  2XD2 A;  2OK2 A;  2I4C A;  3BIG A;  4PGP A;  2ZZX A;  3KG2 A;  3LUZ A;  3IOU A;  3H06 B;  4LZ8 A;  3R6U A;  4OVS A;  2R6G E;  1DSN A;  1NH8 A;  3PUV E;  4MCO A;  1IMA A;  2AIX A;  4X1D A;  2RC9 A;  1NNT A;  1ZKB A;  3G3J A;  4I3Y A;  2NWJ A;  3ZKK A;  4HTG A;  3TYH A;  1SVX B;  2UXA A;  3MVW A;  2QVU A;  4QBA A;  1FPF A;  1N7W A;  4NE4 A;  5KDT A;  3HHG A;  2I0B A;  1NH7 A;  2PT2 A;  2UVH A;  3RPW A;  3RTF B;  4PBQ A;  1LCT A;  2NOO A;  3T93 B;  3T22 A;  3TUS A;  2XXK A;  3HN0 A;  2ESN A;  4G68 B;  4F2Q A;  1XS5 A;  2REG A;  1MY0 A;  4YB5 A;  1FBH A;  2HAU A;  4UA8 A;  4HCW A;  2ZXT A;  5DEX A;  2R8T A;  4IGT A;  1MY1 A;  3KFM A;  4YKP A;  1B9J A;  3FXR A;  1D9Q A;  5CBR A;  2WEF A;  4RPO A;  3KZG A;  4NN3 A;  4I3E A;  3UIF A;  1VSO A;  5FHO A;  4I1D A;  3NOH A;  4LA9 A;  2W7Y A;  1IIW A;  3T0J A;  1RKM A;  1VR5 A;  4GBV A;  3MVZ A;  4IO2 A;  4U21 A;  5JK4 A;  1B52 A;  1FTA A;  3LSF B;  3S4U A;  1FTJ A;  1MPB A;  1FPI A;  3DP8 A;  2GHB A;  4GWY A;  4U4X A;  3MST A;  4NF5 A;  3R26 A;  4POW A;  1M5F A;  4OEN A;  5I58 A;  2DSF A;  2UYE A;  1USY E;  1I6Q A;  1GGG A;  4TLL B;  3WAE A;  2VD3 A;  1OQH A;  5AA1 A;  3MBP A;  3MW0 A;  3RYD A;  3MZB A;  3Q27 A;  2M8C A;  4P0G A;  5EQ7 A;  2F7A A;  1A8E A;  2Z23 A;  4GWX A;  2XXT A;  2RCB A;  2YPN A;  3TCG A;  4ZE9 A;  1URS A;  3TQW A;  4NF4 B;  3C4M A;  1YZ0 A;  3C34 A;  1AIV A;  2LAO A;  4YKJ A;  1YAE A;  4NX1 A;  2OWS A;  4DE8 A;  1B5J A;  1LAF E;  4IO4 A;  1D4N A;  1MY4 A;  1SYH A;  3D1R A;  1TT1 A;  3K2D A;  2VOZ A;  3TKD A;  3MUQ A;  3K6V A;  4AB6 A;  2DWH A;  3T9V A;  4QHQ A;  2XXI A;  2QPQ A;  3TPA A;  4P3L A;  1UIV A;  2O84 X;  4YMA A;  4IR8 A;  2PX1 A;  2O69 A;  3HO7 A;  3IFA A;  4GIZ A;  3FVK A;  3Q26 A;  3ZKL A;  2QS4 A;  1B7Z A;  5DVI A;  1BTJ A;  5F24 A;  1DPP A;  2XWI A;  3MVY A;  2B65 A;  1IME A;  4DXC A;  3UA8 A;  3DLN A;  3PMW A;  2PBW A;  1IXH A;  3LSL A;  1JW4 A;  4R6H A;  3EKI A;  3OSQ A;  2AYS A;  1TWY A;  3ROJ A;  4I62 A;  4H0W A;  5I56 A;  3Q25 A;  3C9H A;  1FBD A;  2Q8J A;  1BKA A;  4NF8 A;  3SEW A;  3VLV A;  1RDX A;  2HAV A;  4ZDM A;  4BDL A;  1MDP 1;  5A5X A;  5JEI A;  4PAF A;  2Y7K A;  3OEK A;  2ALU A;  1MM6 A;  2VD2 A;  1ZBM A;  1Y1Z A;  3IO4 A;  5EYH A;  2RCA A;  3IK6 B;  3K1N A;  4PAK A;  5EYG A;  1B51 A;  4FOR A;  3TDJ A;  1YTV A;  4XEQ A;  4OES A;  4LON B;  1M5C A;  1LGB C;  4P1L A;  1MQD A;  3FXQ A;  1Y3Q A;  3S9L C;  1FBF A;  1CB6 A;  2XXQ A;  4C1U A;  5L9O A;  1B40 A;  4XF5 A;  2ONK E;  1B3E A;  1FTL A;  1ANF A;  2PFZ A;  1NNP A;  5LTC A;  2DVZ A;  3CG3 A;  2O68 A;  3FAT A;  4BLA A;  2WBD A;  2OJT A;  4ZZA A;  3G3G A;  3HCQ A;  3CIJ A;  1IMF A;  3VVD A;  1FPD A;  3FVG A;  1UTB B;  1QUJ A;  3EN3 A;  1FPG A;  4GL0 A;  1MQG A;  1M5B A;  3ONM A;  4G4P A;  4JVC A;  1DMB A;  3HPI A;  1NUZ A;  4LVQ A;  4HE2 A;  3VXC A;  3V89 B;  4MLV A;  3K00 A;  2QVV A;  4KD5 A;  1S9T A;  3Q28 A;  5TPA B;  3ILT B;  2A5S A;  3SKP A;  4X04 A;  3CR9 A;  5EHS A;  2B4L A;  2D21 A;  4G8H A;  3O66 A;  3KOT A;  1XI6 A;  3A09 A;  2F6P A;  1MH3 A;  3B7D A;  2QS3 A;  2Y7P A;  3C31 A;  3PV0 E;  4ZEI A;  2QRY A;  1MXW A;  3KOS A;  2HZL A;  2AL5 A;  4DXB A;  2CEX A;  5I7I A;  2VPN A;  5TU0 A;  4EF2 A;  5L9S A;  4OZ9 A;  1B3H A;  2R71 A;  4RY1 A;  5H8N A;  1J1N A;  1T0K A;  4N4U A;  5B70 A;  1IZ1 A;  2F35 A;  3IAZ A;  1NV7 A;  1K9Y A;  3K6U A;  1I6B A;  5HPQ A;  1D3K A;  2JJK A;  4RPN A;  1LCF A;  1XVY A;  4N17 A;  2Q2C A;  3VXB A;  1QVS A;  3T9U A;  4GX4 A;  3FVO A;  3R7X A;  2GHA A;  2VT5 A;  4OET A;  3CSB A;  2B3B A;  1MY3 A;  2Q74 A;  4U4S A;  1IXC A;  2DXY A;  4THI A;  1R9Q A;  1LAG E;  2Y7I A;  2ONR A;  3RPL A;  5IZ1 A;  4NGU A;  2OWT A;  4LN5 A;  2Q89 A;  4P56 A;  3BFT A;  1FPJ A;  3I3V A;  1KA0 A;  1LBX A;  3PD9 A;  1D9V A;  1NFT A;  4IO3 A;  1P1U A;  4OEU A;  1ZU0 A;  3RUM A;  3U8Q A;  4H67 A;  4ND9 A;  5AE4 A;  1YCJ A;  2NXO A;  3CFX A;  1N04 A;  4GWU A;  1RYX A;  1US4 A;  4BDQ A;  1DTZ A;  4OEV A;  3IFC A;  2DYX A;  4QFP A;  5DTB A;  3VE1 B;  1FTM A;  4I9D A;  2XXU A;  4JBZ A;  2PT1 A;  1FQE A;  1AMF A;  4DDD A;  2CZH A;  4IY5 A;  3RQT A;  3FJG A;  5L9M A;  5CC2 A;  3K0V A;  3CHG A;  1TFA A;  4OVR A;  4H8J A;  5I57 B;  3LUY A;  4XKN A;  4RA1 A;  2XX9 A;  3SDF A;  3MAM A;  4G2Z A;  3CSG A;  1FPK A;  5I2N B;  1OLC A;  3IO6 A;  3MQ9 A;  1EH3 A;  1NI9 A;  5JTY B;  4WKM A;  3BBR A;  4YIC A;  3VFJ A;  3PPN A;  4JVD A;  3TAJ A;  4GL8 A;  1XVX A;  3KSX A;  2B4M A;  4XKR A;  3MPL A;  2F7B A;  2GH9 A;  4MAG A;  4N91 A;  2H98 A;  3MP1 A;  1L5T A;  2FNC A;  3G3F A;  3QYT A;  5T3J A;  3FGS A;  2OBG A;  4ONY A;  1F9B A;  5H8H A;  2REJ A;  3IOR A;  3V83 A;  4PFI A;  4HE1 A;  3H4Z A;  3TFL A;  2I6E A;  1Z7N E;  4PDH A;  1H76 A;  3RTW B;  2H25 A;  3EQ1 A;  3ISP A;  5I2K A;  4G61 A;  1ZTY A;  1FJ6 A;  2RKM A;  2F5X A;  4XIG Q;  4EQ9 A;  1NV1 A;  3E13 X;  1ZMG A;  3B6T A;  4Q8R A;  2O7U A;  1OIB A;  1PC3 A;  5CI5 A;  2XXV A;  4FAJ A;  5FTH A;  1EYK A;  4G8N A;  5H8Q A;  1MQJ A;  4OVQ A;  1NV4 A;  2Z8D A;  5I59 A;  4L17 A;  3VVE A;  3LBS A;  1IQ7 A;  2PVU A;  4ZEC A;  2O7I A;  3OO9 A;  5KCJ B;  3EHU A;  3DP6 A;  2XHD A;  1XC1 A;  4GRK A;  4LP2 B;  4ESX A;  4Q30 B;  5H8S A;  3K6W A;  1IMB A;  2HEU A;  4F19 A;  2FIE A;  1P1W A;  4O3A A;  4WXJ A;  1FRP A;  4Z7E A;  3EHT A;  3A3U A;  3EPE A;  4PF8 A;  2Q8M A;  2ZYO A;  4O94 A;  1M5D A;  5ISU A;  2I4B A;  4PFT A;  2CZK A;  4Q0C A;  4KCD A;  4EUO A;  4PCD A;  3H6V A;  4WED A;  3IB2 A;  1LFH A;  1IXI A;  4NHB A;  4ECF A;  3KC1 A;  5ELV A;  4MHF A;  3UK4 A;  4DZ1 A;  5IZ3 B;  4PF6 A;  4QSD A;  4R75 A;  4YB7 A;  1GR2 A;  3CFZ A;  5EYF A;  4N13 A;  5TP9 A;  2E0S A;  5BWJ A;  2DP8 A;  4KYE A;  5CMK A;  4N6D A;  3HV1 A;  3CFL A;  4ELP A;  4EXK A;  1NNK A;  3CRB A;  1VDW A;  2YLN A;  2FHY A;  4OVT A;  5AA2 D;  1URD A;  3O6H A;  1LBW A;  1FJ9 A;  4JB7 A;  3CG1 A;  1PB9 A;  2VPO A;  1QUK A;  3FBP A;  2Y7R A;  1R1N A;  4HXV A;  3E3K A;  3WAF A;  1Y3P A;  2XWK A;  3N5L A;  1LBZ A;  4XKP A;  1B1X A;  3GBA A;  3T96 B;  3V5A A;  4XFE A;  1B4H A;  4IO7 A;  3IX1 A;  1PB8 A;  4I40 A;  1BLF A;  1FQF A;  1FTO A;  4QFO A;  2HHM A;  2XXR A;  1RDY A;  5CRY A;  4EQB A;  1SW4 A;  5ET6 A;  4EXL A;  1SI0 A;  4NG7 A;  4C1T A;  1SBP A;  4N6P A;  4MLQ A;  4N15 A;  4F1U A;  4MX6 A;  4FAT A;  1NKX A;  5BUU A;  1B0H A;  2D5W A;  4RK9 A;  1FSA A;  3MZ9 A;  4E0X A;  5AA2 A;  4AQ4 A;  3FIR A;  2DE2 A;  4JWO A;  1BP5 A;  5I3S A;  3OO7 A;  3UOR A;  4NF6 A;  3TTL A;  3EHS A;  4GXS B;  2I3W A;  2V93 A;  3I5O A;  2Y5L A;  5IGA A;  2RC7 A;  2AL4 A;  3K01 A;  1FCK A;  3GZG A;  4KI0 E;  4RXL A;  3DEL B;  1MS7 A;  1LST A;  5AA4 A;  5KDT B;  5F7V A;  3G3K A;  3GYY A;  1KZ8 A;  1B5H A;  2OWZ A;  4MF3 A;  1EYJ A;  2ZZW A;  1WDN A;  1LBB A;  1O63 A;  4LQ5 A;  3UN6 A;  4POX A;  3D4G A;  1JP4 A;  4DCX A;  2ABH A;  1FBP A;  1NNF A;  3B50 A;  1XT8 A;  4PP0 A;  1OMP A;  3S9M C;  4O3B A;  4F3P A;  2ZYM A;  4YB6 A;  4QFN A;  2ZZV A;  1XHY A;  4HW8 A;  3RLF E;  3DP4 A;  3FZV A;  1OVB A;  4GFR A;  2GQ1 A;  1MPC A;  4C0R A;  3RGY A;  2O6A A;  5M2V A;  2ZMB A;  1YPN A;  3H3G A;  5DEX B;  2I48 A;  4F3G A;  1IIT A;  3KJ7 A;  3M3F A;  2VP1 A;  2XXY A;  3RNN A;  1EU8 A;  2RIN A;  3OOA A;  1EZO A;  3U1O A;  3ILU B;  4PQJ A;  1A8F A;  2ZNS A;  4F29 A;  3C35 A;  5DW8 A;  1FTK A;  3SET A;  4O7I A;  4MIJ A;  2CZL A;  1MXY A;  4Q5T A;  2Q9T A;  1OVT A;  3KJT A;  3ZS6 A;  2IA4 A;  2PFY A;  2WBB A;  4P9K A;  3SER A;  3TCF A;  1LAH E;  3VLU A;  2X26 A;  2R9J A;  2P3V A;  4NF5 B;  4KQP A;  5I58 B;  1B3F A;  4EQ7 A;  4FED A;  1N0T A;  4U23 A;  2UVI A;  3FJM A;  1SW5 A;  1H45 A;  1Y4C A;  1N3X A;  1KWH A;  2Y84 A;  2X7Q A;  1OLA A;  3MP6 A;  5ITP A;  4PGN A;  4PFY A;  1IUD A;  3A3C A;  4FEB A;  1FQD A;  4MEV A;  2FA7 A;  1MPD A;  3MC2 A;  4PTK A;  2HPG A;  4KYD A;  3IR1 A;  3G3I A;  3PPQ A;  4HS7 A;  2ONS A;  3JV9 A;  2XWO A;  3O29 A;  5I2N A;  3VDF A;  4LZ7 A;  4H5G A;  1MDQ A;  1SQY A;  4XXU A;  2XX8 A;  3MVX A;  4RJZ A;  3OSR A;  1NUY A;  3TMG A;  4GX3 A;  5IZZ A;  1FW0 A;  3PUX E;  1NV2 A;  4P11 A;  4GQO A;  4F22 A;  3ECR A;  4BDN A;  1B0L A;  1UIU A;  2P0S A;  4ELR A;  4F1V A;  3L6G A;  4OA4 A;  1A54 A;  3K1M A;  4GX6 A;  1PBQ A;  3RT6 B;  4ZS9 A;  1MQH A;  1R6Z A;  3VLW A;  1JVY A;  4E0W A;  1FPB A;  3U92 A;  3O2A A;  3N26 A;  1H3D A;  1QW0 A;  2HXR A;  2A5T A;  4LZ5 A;  4X9T A;  2UVG A;  1USY H;  4ZEB A;  1Y20 A;  2BJI A;  4PFB A;  5I56 B;  2H99 A;  3N94 A;  1YYZ A;  1PDA A;  3Q29 A;  4NF8 B;  1IEJ A;  1P1Q A;  2V3Q A;  4MJO A;  3G3H A;  3TTK A;  4IB2 A;  3FD3 A;  5A5X B;  2DE4 A;  2P1S A;  4GOT A;  2Z8E A;  1JVX A;  3PPR A;  4R72 A;  2F97 A;  3MPK A;  4JXI A;  3BIH A;  4N8Y A;  1FPL A;  4JSO A;  5DT6 A;  2QS2 A;  1B4Z A;  1LB8 A;  4QSC A;  4NAP A;  5KCJ A;  3O28 A;  4M4G A;  1SYI A;  1FQC A;  5EHM A;  3IL1 B;  4OVP A;  1MXU A;  4IGR A;  2P2A A;  3M3K A;  5ICQ A;  3O6G A;  3MJN A;  1NUX A;  1MRP A;  5ET8 A;  3E9X A;  2FVZ A;  3QIM A;  4KFQ A;  3M8U A;  3TTM A;  2NUV A;  2DWJ A;  2DWI A;  4RYA A;  3IOW A;  4X8R A;  4I8C A;  4F39 A;  1XOC A;  4G68 A;  2QMX A;  4IY6 A;  1B2H A;  4OWD A;  5FHN A;  4PE5 B;  3K02 A;  4R9G A;  1A7L A;  4OFJ A;  4QXD A;  1MH4 A;  2DVC A;  2ZNU A;  2QJE A;  1FBG A;  2WX9 A;  1JW5 A;  1LBY A;  3M3L A;  2I0C A;  2H5Y A;  4F31 B;  1Y3N A;  4IO5 A;  2H9B A;  1M5E A;  4YMB A;  4GWS A;  4UAB A;  4GWW A;  3S9E A;  5IKB A;  2XXW A;  4OVJ A;  1O7T A;  4PFU A;  1II5 A;  4X48 A;  1Q9D A;  2F36 A;  1GV8 A;  3PMX A;  3E79 A;  1P99 A;  3FV2 A;  4H1X A;  5J1D A;  3IOV A;  1P1O A;  2GFE A;  4DI3 D;  2RC8 A;  3KN3 A;  4FE8 A;  1NV6 A;  1POT A;  4KHZ E;  2P3N A;  5H8N B;  3W9W A;  4XTC Q;  2O1M A;  1B3L A;  4NWC A;  1GVC A;  4MNP A;  5K2Y A;  2F3D A;  4H6D A;  2OX3 A;  1LBC A;  3T66 A;  1NV3 A;  4R6K A;  4ISU A;  3G7W A;  5K2X A;  1P1N A;  5J16 A;  5ET5 A;  3H6W A;  4PDD A;  2HQ0 A;  4OFO A;  2WYP A;  1HSL A;  1SPI A;  3RPL B;  2XX7 A;  5H8F B;  1EYI A;  1JET A;  2VHA A;  4LQ2 A;  4NF4 A;  1POY 1;  5ICT A;  5ITO A;  3CI8 A;  3TQL A;  3KSJ A;  2IEE A;  4FEC A;  4GD5 A;  3OEN A;  1VE4 A;  3LV0 A;  4PC9 A;  3PMV A;  3QMF A;  1MG1 A;  4R2B A;  4O3C A;  1EZP A;  3RT8 A;  1B6H A;  3KBZ A;  2ZNT A;  4FIM A;  2V25 A;  3SEU A;  4LUB A;  4GF8 A;  4F2O A;  5CMM A;  5DVF A;  1DOT A;  4OXV A;  4OHN A;  4QFK A;  2O51 A;  1UTH B;  2Z8F A;  5EQ9 A;  1D9Y A;  4KXP A;  2FBP A;  4P47 A;  3BKI B;  3D4C A;  1B5I A;  2WYK A;  1DBZ A;  3H6T A;  3N6U A;  4H46 A;  1B7U A;  3OXN A;  1TXF A;  4YU0 A;  3ZSF A;  2DDK A;  3MZ1 A;  1AL3 A;  2PCR A;  4N81 A;  1AH5 A;  4TOZ A;  2HXW A;  5FBP A;  2XA5 A;  2F3B A;  2QS1 A;  4X1B A;  2DE3 A;  5LOM A;  4JDF A;  3RY3 A;  3U93 A;  1N76 A;  4MH5 A;  1BIY A;  1Q35 A;  1QUL A;  3UGW A;  2QVR A;  3EF7 A;  5H8H B;  4BDR A;  1K9Z A;  4U1Z A;  5KZT A;  3H6U A;  1ATG A;  1KA1 A;  3QXM A;  4AS4 A;  1G0I A;  5IM2 A;  2FYI A;  4H5F A;  3KN7 A;  3ODB A;  3TOD A;  3W15 C;  3AXF A;  1AOV A;  2CMO A;  1Y4T A;  3QUJ A;  4MFI A;  5I2K B;  1Q1K A;  5CMC A;  3OO6 A;  3LR1 A;  4H65 A;  2UYF A;  3U72 A;  5DYH A;  2OCU A;  4PET A;  1WVJ A;  4PFW A;  4MNI A;  4R74 A;  1GTK A;  1UTB A;  4OQO A;  1LFI A;  5FHM A;  1CE2 A;  3S9N C;  4EDP A;  4U2R A;  5H8Q B;  4XKQ A;  2E1S A;  3PU5 A;  5I59 B;  1SDX A;  3MP8 A;  4OMB A;  4TQU Q;  4GXA A;  1JNF A;  3O97 A;  1B7H A;  4ZEF A;  5HBC A;  3PPO A;  4YKI A;  3KN8 A;  4RK2 A;  3OEL A;  1NL5 A;  5TPA A;  3H03 A;  4G68 C;  4P0I A;  2F6G A;  2X7P A;  1DK4 A;  3IJX B;  3PUW E;  3SEY A;  2UVJ A;  4ZED A;  3GXA A;  3FXU A;  4G8M A;  3PGF A;  4QSE A;  4YAH X;  1NUW A;  5EQ8 A;  4UAC A;  1NV0 A;  2HCA A;  2RF1 A;  4NED A;  3VVF A;  3TCH A;  1PB7 A;  1MXZ A;  3QK6 A;  1B05 A;  1ZLQ A;  3F11 A;  2PYY A;  1MXX A;  1MY2 A;  2F7C A;  1LEV A;  3B6W A;  2I3V A;  1MM7 A;  3IOT A;  3HFU A;  3GBB A;  4R9F A;  3PUY E;  1CNQ A;  1JQF A;  1N84 A;  1ZJL A;  1DTG A;  2DQV A;  2ZYN A;  4R2F A;  2B3F A;  3TTR A;  4GLI A;  1QUI A;  3TEP A;  1QKB A;  2QSX A;  2F34 A;  1HSJ A;  3K4U A;  2D3I A;  2OZZ A;  3USD A;  3QSL A;  1LBV A;  4BDM A;  4NMY A;  1TFD A;  3QAX A;  5TP9 B;  3SES A;  2DXR A;  4ZZE A;  3JYR A;  3B8B A;  2KR0 A;  4YZZ A;  3I6V A;  3TEL A;  2QMW A;  5F1Q A;  4QRZ A;  4NF0 A;  2DOJ A;  2H4I A;  4F3B A;  3DM0 A;  2QFL A;  2XD3 A;  3FJ7 A;  1FBC A;  3OMB A;  4DI4 B;  1HSE A;  5L8D A;  1RDZ A;  4KCC A;  4JWY A;  2VGQ A;  3OD7 A;  2V4C A;  4R6Y A;  3HST A;  3LC8 A;  3MYU A;  2WKY A;  2L5V A;  4HE0 A;  1SW1 A;  4PAI A;  2KQZ A;  4K3F A;  1DPE A;  4ESW A;  2KLF A;  4ZE8 A;  2XXP A;  4EF1 A;  2CZI A;  2I58 A;  3B6Q A;  5HM4 B;  3C32 A;  3QUF A;  3K1P A;  5AA3 A;  3LSX A;  1I69 A;  3IJO B;  4MMP A;  2OLB A;  2V3U A;  1N3W A;  1NMU A;  3UP9 A;  4F18 A;  3VV5 A;  3V8X B;  4DXU A;  4YKK A;  1LLS A;  3N6T A;  4NWD A;  1URG A;  3RN8 A;  4DCY A;  4KYS A;  4GVO A;  2XXX A;  1B32 A;  2HZK A;  5I57 A;  1Y9U A;  1SD3 A;  1LB9 A;  4U1O A;  5AA2 B;  3KGC A;  4F1Y A;  4NQ8 A;  4AB5 A; 
#chains in the Genus database with same CATH homology
 1S7Y A;  5JTY A;  3SEV A;  1UQW A;  3FAS A;  4NF6 B;  5CMB A;  1O64 A;  4DIG A;  3KBR A;  4GWO A;  1Z7M E;  4ELO A;  4OFL A;  5FTI A;  2DWA A;  1JEV A;  1B3G A;  3FV1 A;  5AA4 B;  2O1L A;  1JW1 A;  4JWX A;  1B46 A;  1RYO A;  4NTL A;  1PEB A;  3LSW A;  3C33 A;  5B7D A;  1A55 A;  5I84 A;  4MBP A;  2G29 A;  4KR5 A;  1FQA A;  4RNS A;  3S2V A;  1ELJ A;  1MQI A;  3E4R A;  1A40 A;  2XXH A;  2V3T A;  4N07 A;  1JEU A;  4R73 A;  1WOD A;  3C36 A;  3H7M A;  4QF9 A;  4U22 A;  1VFD A;  2HFB A;  3O9P A;  4H8I A;  3THI A;  2YJP A;  2Y7W A;  1EZ9 A;  1H43 A;  1R9L A;  5H8F A;  1S50 A;  4ELQ A;  2BJJ X;  1SW2 A;  3U94 A;  3OO8 A;  1H44 A;  3T9X B;  1A99 A;  3K6X A;  3T9H B;  3FVN A;  1IXG A;  2V84 A;  2Z22 A;  3PD8 A;  4HCY A;  4LAT A;  1B58 A;  1ZIU A;  5CBS A;  4QFL A;  4FJP A;  1QKA A;  4OTE A;  1VFE A;  2GRV A;  3IB1 A;  2Q88 A;  1MXV A;  2NVU B;  3JZJ A;  1B1H A;  1UTH A;  2I49 A;  2F78 A;  4KPT A;  4F3S A;  3KEI A;  3OEM A;  4OER A;  3TZA A;  4TLM B;  3BFU A;  2ANJ A;  2THI A;  1US5 A;  3PPP A;  4BDO A;  3IB0 A;  3MWB A;  1LAX A;  5DVJ A;  2PMS A;  1Y1M A;  4G77 A;  1N7X A;  1LFG A;  2QL3 A;  3O6I A;  5IAI A;  3L6H A;  1OQG A;  2F8D A;  4DLD A;  4WEP A;  4JSD A;  1I6A A;  4OYV A;  3W9V A;  4ZEK A;  2A5T B;  2G93 A;  3PUZ E;  5CM6 A;  3TTN A;  1FQB A;  1PBP A;  2Q2A A;  3CVG A;  1SI1 A;  4Z0I A;  4M1V A;  3SEX A;  3HHF A;  1QJM A;  3FUZ A;  2DS9 A;  3P7I A;  4IO6 A;  2ZYK A;  3GLB A;  2XD2 A;  2OK2 A;  2I4C A;  3KG2 A;  3IOU A;  3H06 B;  4LZ8 A;  3R6U A;  2R6G E;  1DSN A;  1NH8 A;  3PUV E;  2AIX A;  4X1D A;  2RC9 A;  1NNT A;  1ZKB A;  3G3J A;  2NWJ A;  3ZKK A;  4HTG A;  3TYH A;  1SVX B;  2UXA A;  3MVW A;  1N7W A;  4NE4 A;  5KDT A;  3HHG A;  2I0B A;  1NH7 A;  2PT2 A;  2UVH A;  3RPW A;  3RTF B;  1LCT A;  2NOO A;  3T93 B;  3T22 A;  3TUS A;  3HN0 A;  2ESN A;  4G68 B;  4F2Q A;  1XS5 A;  2REG A;  1MY0 A;  4YB5 A;  2HAU A;  4UA8 A;  4HCW A;  2ZXT A;  5DEX A;  4IGT A;  1MY1 A;  3KFM A;  4YKP A;  1B9J A;  3FXR A;  5CBR A;  4RPO A;  3KZG A;  3UIF A;  1VSO A;  5FHO A;  4I1D A;  4LA9 A;  2W7Y A;  1IIW A;  1RKM A;  1VR5 A;  3MVZ A;  4IO2 A;  4U21 A;  5JK4 A;  1B52 A;  3LSF B;  3S4U A;  1FTJ A;  1MPB A;  3DP8 A;  2GHB A;  4U4X A;  4NF5 A;  3R26 A;  4POW A;  1M5F A;  4OEN A;  5I58 A;  2DSF A;  2UYE A;  1USY E;  1I6Q A;  1GGG A;  4TLL B;  3WAE A;  2VD3 A;  1OQH A;  5AA1 A;  3MBP A;  3MW0 A;  3MZB A;  3Q27 A;  2M8C A;  4P0G A;  2F7A A;  1A8E A;  2Z23 A;  2XXT A;  2RCB A;  2YPN A;  3TCG A;  4ZE9 A;  1URS A;  3TQW A;  4NF4 B;  3C4M A;  3C34 A;  1AIV A;  2LAO A;  4YKJ A;  1YAE A;  2OWS A;  4DE8 A;  1B5J A;  1LAF E;  4IO4 A;  1D4N A;  1MY4 A;  1SYH A;  1TT1 A;  3K2D A;  2VOZ A;  3TKD A;  3MUQ A;  3K6V A;  4AB6 A;  2DWH A;  3T9V A;  4QHQ A;  2XXI A;  2QPQ A;  3TPA A;  1UIV A;  2O84 X;  4YMA A;  2PX1 A;  2O69 A;  3HO7 A;  4GIZ A;  3FVK A;  3Q26 A;  3ZKL A;  2QS4 A;  1B7Z A;  5DVI A;  1BTJ A;  1DPP A;  3MVY A;  2B65 A;  4DXC A;  3UA8 A;  3DLN A;  3PMW A;  2PBW A;  1IXH A;  3LSL A;  1JW4 A;  4R6H A;  3OSQ A;  2AYS A;  1TWY A;  4I62 A;  4H0W A;  5I56 A;  3Q25 A;  3C9H A;  2Q8J A;  1BKA A;  4NF8 A;  3SEW A;  3VLV A;  2HAV A;  4ZDM A;  4BDL A;  1MDP 1;  5A5X A;  5JEI A;  2Y7K A;  3OEK A;  2ALU A;  1MM6 A;  2VD2 A;  1ZBM A;  1Y1Z A;  3IO4 A;  2RCA A;  3IK6 B;  3K1N A;  1B51 A;  4FOR A;  3TDJ A;  1YTV A;  4OES A;  4LON B;  1M5C A;  1LGB C;  1MQD A;  3FXQ A;  1Y3Q A;  3S9L C;  1CB6 A;  2XXQ A;  4C1U A;  5L9O A;  1B40 A;  2ONK E;  1B3E A;  1FTL A;  1ANF A;  1NNP A;  2DVZ A;  3CG3 A;  2O68 A;  3FAT A;  4BLA A;  2OJT A;  4ZZA A;  3G3G A;  3HCQ A;  3CIJ A;  3VVD A;  3FVG A;  1UTB B;  1QUJ A;  3EN3 A;  4GL0 A;  1MQG A;  1M5B A;  3ONM A;  4G4P A;  1DMB A;  3HPI A;  4LVQ A;  3VXC A;  3V89 B;  4MLV A;  3K00 A;  4KD5 A;  1S9T A;  3Q28 A;  5TPA B;  3ILT B;  2A5S A;  3SKP A;  3CR9 A;  5EHS A;  2D21 A;  4G8H A;  3O66 A;  3KOT A;  3A09 A;  2F6P A;  1MH3 A;  3B7D A;  2QS3 A;  2Y7P A;  3C31 A;  3PV0 E;  4ZEI A;  2QRY A;  1MXW A;  3KOS A;  2HZL A;  2AL5 A;  4DXB A;  5TU0 A;  4EF2 A;  5L9S A;  4OZ9 A;  1B3H A;  2R71 A;  4RY1 A;  5H8N A;  1J1N A;  1T0K A;  5B70 A;  1IZ1 A;  2F35 A;  3IAZ A;  3K6U A;  1I6B A;  5HPQ A;  1D3K A;  4RPN A;  1LCF A;  1XVY A;  2Q2C A;  3VXB A;  1QVS A;  3T9U A;  3FVO A;  3R7X A;  2GHA A;  4OET A;  3CSB A;  2B3B A;  1MY3 A;  4U4S A;  1IXC A;  2DXY A;  4THI A;  1R9Q A;  1LAG E;  2Y7I A;  2ONR A;  2OWT A;  2Q89 A;  3BFT A;  3I3V A;  3PD9 A;  1D9V A;  1NFT A;  4IO3 A;  1P1U A;  4OEU A;  1ZU0 A;  3RUM A;  3U8Q A;  4H67 A;  4ND9 A;  5AE4 A;  1YCJ A;  2NXO A;  3CFX A;  1N04 A;  1RYX A;  1US4 A;  4BDQ A;  1DTZ A;  4OEV A;  2DYX A;  4QFP A;  5DTB A;  3VE1 B;  1FTM A;  4I9D A;  2XXU A;  4JBZ A;  2PT1 A;  1FQE A;  1AMF A;  4DDD A;  4IY5 A;  3RQT A;  3FJG A;  5L9M A;  5CC2 A;  3K0V A;  1TFA A;  4H8J A;  5I57 B;  3LUY A;  4XKN A;  4RA1 A;  2XX9 A;  3SDF A;  3MAM A;  4G2Z A;  3CSG A;  5I2N B;  1OLC A;  3IO6 A;  3MQ9 A;  1EH3 A;  5JTY B;  4WKM A;  3BBR A;  4YIC A;  3VFJ A;  3PPN A;  3TAJ A;  4GL8 A;  1XVX A;  3KSX A;  4XKR A;  3MPL A;  2F7B A;  2GH9 A;  2H98 A;  3MP1 A;  1L5T A;  2FNC A;  3G3F A;  3QYT A;  3FGS A;  2OBG A;  4ONY A;  1F9B A;  5H8H A;  2REJ A;  3IOR A;  3V83 A;  3H4Z A;  3TFL A;  2I6E A;  1Z7N E;  1H76 A;  3RTW B;  2H25 A;  3EQ1 A;  5I2K A;  1ZTY A;  2RKM A;  2F5X A;  4XIG Q;  4EQ9 A;  3E13 X;  1ZMG A;  3B6T A;  4Q8R A;  2O7U A;  1OIB A;  1PC3 A;  5CI5 A;  2XXV A;  4FAJ A;  5FTH A;  4G8N A;  5H8Q A;  1MQJ A;  2Z8D A;  5I59 A;  4L17 A;  3VVE A;  3LBS A;  1IQ7 A;  2PVU A;  4ZEC A;  2O7I A;  3OO9 A;  5KCJ B;  3EHU A;  3DP6 A;  2XHD A;  1XC1 A;  4GRK A;  4LP2 B;  4ESX A;  4Q30 B;  5H8S A;  3K6W A;  2HEU A;  4F19 A;  1P1W A;  4O3A A;  4WXJ A;  4Z7E A;  3EHT A;  3A3U A;  3EPE A;  2ZYO A;  1M5D A;  5ISU A;  2I4B A;  4PFT A;  4Q0C A;  4KCD A;  4EUO A;  3H6V A;  4WED A;  3IB2 A;  1LFH A;  1IXI A;  4ECF A;  5ELV A;  3UK4 A;  4DZ1 A;  4QSD A;  4R75 A;  4YB7 A;  1GR2 A;  3CFZ A;  5EYF A;  4N13 A;  5TP9 A;  2E0S A;  5BWJ A;  2DP8 A;  4KYE A;  5CMK A;  3HV1 A;  3CFL A;  4ELP A;  4EXK A;  1NNK A;  3CRB A;  2YLN A;  5AA2 D;  1URD A;  3O6H A;  4JB7 A;  3CG1 A;  1PB9 A;  1QUK A;  2Y7R A;  1R1N A;  3E3K A;  3WAF A;  1Y3P A;  3N5L A;  4XKP A;  1B1X A;  3GBA A;  3T96 B;  3V5A A;  1B4H A;  4IO7 A;  3IX1 A;  1PB8 A;  1BLF A;  1FQF A;  1FTO A;  4QFO A;  2XXR A;  5CRY A;  4EQB A;  1SW4 A;  4EXL A;  1SI0 A;  4C1T A;  1SBP A;  4N6P A;  4MLQ A;  4F1U A;  4FAT A;  1NKX A;  5BUU A;  1B0H A;  2D5W A;  4RK9 A;  4E0X A;  3MZ9 A;  5AA2 A;  4AQ4 A;  3FIR A;  2DE2 A;  4JWO A;  1BP5 A;  3OO7 A;  3UOR A;  4NF6 A;  3TTL A;  3EHS A;  4GXS B;  2I3W A;  2V93 A;  3I5O A;  2RC7 A;  2AL4 A;  3K01 A;  1FCK A;  3GZG A;  4KI0 E;  4RXL A;  3DEL B;  1MS7 A;  1LST A;  5AA4 A;  5KDT B;  5F7V A;  3G3K A;  1B5H A;  4MF3 A;  1WDN A;  1LBB A;  1O63 A;  4LQ5 A;  3UN6 A;  4POX A;  3D4G A;  4DCX A;  2ABH A;  1NNF A;  1XT8 A;  4PP0 A;  1OMP A;  3S9M C;  4O3B A;  4F3P A;  2ZYM A;  4YB6 A;  4QFN A;  1XHY A;  4HW8 A;  3RLF E;  3DP4 A;  3FZV A;  1OVB A;  4GFR A;  1MPC A;  4C0R A;  3RGY A;  2O6A A;  5M2V A;  2ZMB A;  1YPN A;  3H3G A;  5DEX B;  2I48 A;  4F3G A;  1IIT A;  3KJ7 A;  3M3F A;  2VP1 A;  2XXY A;  3RNN A;  1EU8 A;  2RIN A;  3OOA A;  1EZO A;  3U1O A;  3ILU B;  4PQJ A;  1A8F A;  2ZNS A;  4F29 A;  3C35 A;  3SET A;  1FTK A;  2CZL A;  1MXY A;  4Q5T A;  2Q9T A;  1OVT A;  3KJT A;  3ZS6 A;  2IA4 A;  3SER A;  3TCF A;  1LAH E;  3VLU A;  2X26 A;  2R9J A;  4NF5 B;  4KQP A;  5I58 B;  1B3F A;  4EQ7 A;  4FED A;  1N0T A;  4U23 A;  2UVI A;  3FJM A;  1SW5 A;  1H45 A;  1Y4C A;  1N3X A;  1KWH A;  2Y84 A;  2X7Q A;  1OLA A;  3MP6 A;  5ITP A;  4PFY A;  1IUD A;  3A3C A;  4FEB A;  1FQD A;  2FA7 A;  1MPD A;  3MC2 A;  4KYD A;  3IR1 A;  3G3I A;  3PPQ A;  4HS7 A;  2ONS A;  3JV9 A;  3O29 A;  5I2N A;  3VDF A;  4LZ7 A;  4H5G A;  1MDQ A;  1SQY A;  4XXU A;  2XX8 A;  3MVX A;  4RJZ A;  3OSR A;  3TMG A;  1FW0 A;  3PUX E;  4P11 A;  4GQO A;  4F22 A;  3ECR A;  4BDN A;  1B0L A;  1UIU A;  4F1V A;  2P0S A;  4ELR A;  3L6G A;  1A54 A;  3K1M A;  3RT6 B;  1PBQ A;  4ZS9 A;  1MQH A;  1R6Z A;  3VLW A;  1JVY A;  4E0W A;  3U92 A;  3O2A A;  3N26 A;  1H3D A;  1QW0 A;  4LZ5 A;  2A5T A;  4X9T A;  2UVG A;  1USY H;  4ZEB A;  1Y20 A;  5I56 B;  2H99 A;  3N94 A;  1PDA A;  3Q29 A;  4NF8 B;  1IEJ A;  1P1Q A;  2V3Q A;  3G3H A;  3TTK A;  4IB2 A;  3FD3 A;  5A5X B;  2DE4 A;  2P1S A;  4GOT A;  2Z8E A;  1JVX A;  3PPR A;  4R72 A;  2F97 A;  3MPK A;  4JXI A;  4JSO A;  5DT6 A;  2QS2 A;  1B4Z A;  1LB8 A;  4QSC A;  5KCJ A;  3O28 A;  4M4G A;  1SYI A;  1FQC A;  5EHM A;  3IL1 B;  1MXU A;  4IGR A;  2P2A A;  3M3K A;  5ICQ A;  3O6G A;  3MJN A;  1MRP A;  3E9X A;  3QIM A;  4KFQ A;  3M8U A;  3TTM A;  2NUV A;  2DWJ A;  2DWI A;  4RYA A;  3IOW A;  4I8C A;  4F39 A;  1XOC A;  4G68 A;  2QMX A;  4IY6 A;  1B2H A;  4OWD A;  5FHN A;  4PE5 B;  3K02 A;  4R9G A;  1A7L A;  4OFJ A;  1MH4 A;  2DVC A;  2ZNU A;  2QJE A;  1JW5 A;  3M3L A;  2I0C A;  2H5Y A;  4F31 B;  1Y3N A;  4IO5 A;  2H9B A;  1M5E A;  4YMB A;  3S9E A;  5IKB A;  2XXW A;  4OVJ A;  1O7T A;  4PFU A;  1II5 A;  4X48 A;  2F36 A;  1GV8 A;  3PMX A;  1P99 A;  3FV2 A;  4H1X A;  5J1D A;  3IOV A;  1P1O A;  2GFE A;  2RC8 A;  3KN3 A;  4FE8 A;  1POT A;  4KHZ E;  5H8N B;  3W9W A;  4XTC Q;  2O1M A;  1B3L A;  4NWC A;  1GVC A;  5K2Y A;  4H6D A;  1LBC A;  3T66 A;  4R6K A;  4ISU A;  3G7W A;  5K2X A;  1P1N A;  3H6W A;  2HQ0 A;  4OFO A;  1HSL A;  2XX7 A;  5H8F B;  1JET A;  2VHA A;  4LQ2 A;  4NF4 A;  1POY 1;  5ICT A;  5ITO A;  3CI8 A;  3TQL A;  3KSJ A;  2IEE A;  4FEC A;  4GD5 A;  3OEN A;  1VE4 A;  3PMV A;  1MG1 A;  4R2B A;  4O3C A;  1EZP A;  3RT8 A;  1B6H A;  2ZNT A;  4FIM A;  2V25 A;  3SEU A;  4LUB A;  4GF8 A;  4F2O A;  5CMM A;  5DVF A;  1DOT A;  4OXV A;  4OHN A;  4QFK A;  2O51 A;  1UTH B;  2Z8F A;  1D9Y A;  3BKI B;  3D4C A;  1B5I A;  3H6T A;  3N6U A;  1B7U A;  3OXN A;  1TXF A;  4YU0 A;  3ZSF A;  3MZ1 A;  1AL3 A;  1AH5 A;  4TOZ A;  2HXW A;  2QS1 A;  4X1B A;  2DE3 A;  5LOM A;  4JDF A;  3RY3 A;  3U93 A;  1N76 A;  4MH5 A;  1BIY A;  1Q35 A;  1QUL A;  3UGW A;  3EF7 A;  5H8H B;  4BDR A;  4U1Z A;  5KZT A;  3H6U A;  1ATG A;  3QXM A;  2FYI A;  4H5F A;  3KN7 A;  3ODB A;  3TOD A;  3W15 C;  3AXF A;  1AOV A;  2CMO A;  1Y4T A;  3QUJ A;  4MFI A;  5I2K B;  1Q1K A;  5CMC A;  3OO6 A;  3LR1 A;  4H65 A;  2UYF A;  3U72 A;  5DYH A;  2OCU A;  4PET A;  1WVJ A;  4PFW A;  4R74 A;  1GTK A;  1UTB A;  4OQO A;  1LFI A;  5FHM A;  1CE2 A;  3S9N C;  4EDP A;  4U2R A;  5H8Q B;  4XKQ A;  2E1S A;  3PU5 A;  5I59 B;  1SDX A;  3MP8 A;  4OMB A;  4TQU Q;  4GXA A;  1JNF A;  3O97 A;  1B7H A;  4ZEF A;  5HBC A;  3PPO A;  4YKI A;  3KN8 A;  4RK2 A;  3OEL A;  1NL5 A;  5TPA A;  3H03 A;  4G68 C;  4P0I A;  2F6G A;  2X7P A;  3IJX B;  3PUW E;  3SEY A;  2UVJ A;  4ZED A;  3GXA A;  3FXU A;  4G8M A;  3PGF A;  4QSE A;  4YAH X;  4UAC A;  2HCA A;  2RF1 A;  4NED A;  3VVF A;  3TCH A;  1PB7 A;  1MXZ A;  3QK6 A;  1B05 A;  1ZLQ A;  3F11 A;  2PYY A;  1MXX A;  1MY2 A;  2F7C A;  3B6W A;  2I3V A;  1MM7 A;  3IOT A;  3GBB A;  4R9F A;  3PUY E;  1JQF A;  1N84 A;  1ZJL A;  1DTG A;  2DQV A;  2ZYN A;  4R2F A;  2B3F A;  3TTR A;  4GLI A;  1QUI A;  3TEP A;  1QKB A;  2QSX A;  2F34 A;  1HSJ A;  3K4U A;  2D3I A;  2OZZ A;  3USD A;  3QSL A;  4BDM A;  4NMY A;  1TFD A;  3QAX A;  5TP9 B;  3SES A;  2DXR A;  4ZZE A;  3JYR A;  4YZZ A;  3I6V A;  3TEL A;  2QMW A;  5F1Q A;  4QRZ A;  2DOJ A;  2H4I A;  4F3B A;  3DM0 A;  2XD3 A;  3FJ7 A;  3OMB A;  1HSE A;  5L8D A;  4KCC A;  4JWY A;  2VGQ A;  3OD7 A;  4R6Y A;  3HST A;  3LC8 A;  2WKY A;  1SW1 A;  4K3F A;  1DPE A;  4ESW A;  2KLF A;  4ZE8 A;  2XXP A;  4EF1 A;  2I58 A;  3B6Q A;  5HM4 B;  3C32 A;  3QUF A;  3K1P A;  5AA3 A;  3LSX A;  1I69 A;  3IJO B;  2OLB A;  2V3U A;  1N3W A;  1NMU A;  3UP9 A;  4F18 A;  3VV5 A;  3V8X B;  4DXU A;  4YKK A;  1LLS A;  3N6T A;  4NWD A;  1URG A;  3RN8 A;  4DCY A;  4KYS A;  4GVO A;  2XXX A;  1B32 A;  2HZK A;  5I57 A;  1Y9U A;  1SD3 A;  1LB9 A;  4U1O A;  5AA2 B;  3KGC A;  4F1Y A;  4AB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...