2F7CA

Catm effector binding domain with its effector cis,cis-muconate
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
216
structure length
216
Chain Sequence
b'SQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKITDPAIRRIVLHKEQLKLAIHKHHHPNQFAATGVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVPSKLTEIREIQLALGLVAAGEGVCIVPASAMDIGVKNLLYIPILDDDAYSPISLAVRNMDHSNYIPKILACVQEVFATHHIRPLIES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator catM
publication title Distinct Effector-binding Sites Enable Synergistic Transcriptional Activation by BenM, a LysR-type Regulator.
pubmed doi rcsb
source organism Acinetobacter baylyi
molecule tags Gene regulation
total genus 61
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f7cA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f7cA02
4YZZA 3E4RA 4DXUA 1MXZA 4EF2A 1GTKA 4F3GA 2V3QA 3TELA 2OLBA 3K02A 4TOZA 4JWOA 1B7UA 3JYRA 4WKMA 4EQ7A 2RC7A 1DMBA 1ZU0A 4DXCA 3M3KA 4TLMB 3QIMA 1QVSA 2QS2A 2P1SA 3U72A 3EHUA 4QRZA 4PFYA 1LB9A 4ONYA 5ISUA 4GLIA 4G68B 2H25A 2O69A 4ZE8A 3ZKKA 3Q26A 3TQWA 4YMBA 4O3CA 2QS4A 3MQ9A 3C34A 4PE5B 3MP6A 5EHMA 3TDJA 5ITPA 3GXAA 3TEPA 1B3GA 4ZEBA 3VLVA 5IAIA 2F35A 1DSNA 3V83A 3IR1A 2ONSA 1VFDA 2XXXA 5KDTB 1LGBC 1N3WA 1TFAA 3CG3A 2I0CA 4X9TA 2H99A 1MXVA 1D9YA 3N26A 1UTHA 3QSLA 3S9NC 2V84A 3VVEA 2VP1A 1MY4A 4RY1A 3HV1A 3FVOA 1SDXA 5I2NA 1II5A 5H8NA 3KN7A 1B58A 1B3EA 4OESA 3IORA 1XOCA 1R1NA 3G3HA 2XX9A 1JEVA 5AA3A 1FTOA 2F8DA 3QUFA 5IKBA 2HQ0A 1RKMA 3K1PA 2PT2A 2RC8A 5CBRA 1EZOA 3TQLA 4ESWA 3LR1A 4O3AA 4NF6B 3Q25A 2X7PA 1NKXA 5EYFA 4XKRA 3HN0A 4THIA 3QXMA 2HAVA 3OO7A 2DWJA 5A5XB 3PU5A 5L9MA 5L8DA 3M3LA 3UGWA 1Q1KA 3IK6B 1IUDA 4PFTA 3MUQA 2HFBA 1LCTA 3EHTA 5DYHA 2XXQA 4OVJA 2DYXA 4FORA 2OCUA 4RK9A 1BKAA 1PEBA 2CMOA 3KFMA 4H5GA 4OEVA 1QJMA 3PMWA 5DVFA 1F9BA 2HXWA 3FATA 3P7IA 2ZNUA 5I2KB 5DT6A 1JVYA 2QPQA 4DIGA 1B5IA 3KG2A 1B3FA 1R9QA 2VD3A 3ZKLA 3N94A 3VV5A 5H8HA 2THIA 1MH3A 2VGQA 1B46A 4ZS9A 2XX8A 3TCHA 1OLCA 5JTYB 3QAXA 4FE8A 2KLFA 1YAEA 1UIUA 3O6GA 3ZS6A 4F18A 3QYTA 4IO2A 3O2AA 2PT1A 4IO6A 1WVJA 4NF8B 1FQCA 2Z8DA 5KCJA 1QUKA 3K2DA 1NMUA 3U93A 1AOVA 1PB7A 2I3WA 3N5LA 2I0BA 5TP9A 4C0RA 4C1UA 2R9JA 2XD3A 3T66A 1MQIA 4NF4A 4N13A 4L17A 3I3VA 1R6ZA 3IO4A 3KGCA 3PPRA 1LFHA 1JVXA 3MPLA 2DVCA 4KYSA 5FHMA 4I8CA 3TZAA 4JWYA 5ITOA 3B7DA 3PUZE 4KYEA 2F5XA 2ZYOA 1J1NA 4DXBA 2F7AA 3FASA 4ZEIA 2E1SA 4YB6A 3LSXA 2QMWA 3C9HA 4PQJA 4GF8A 2DVZA 3MW0A 3CVGA 5M2VA 5BWJA 5TPAB 4C1TA 5CM6A 3I5OA 4NWCA 4HW8A 4N6PA 3OO6A 2REGA 2Z22A 1ANFA 5BUUA 4R74A 4KCDA 3M8UA 4IY5A 3MVZA 1P1NA 2DOJA 3U94A 3IJXB 1US5A 5HM4B 1WDNA 1P99A 3PPOA 3IAZA 4AB6A 2UVGA 4UA8A 3ONMA 3EF7A 3V8XB 1B5JA 4F1VA 2DQVA 4F22A 1MG1A 3H6WA 4FEDA 1L5TA 2F36A 1B4ZA 2XHDA 4BDQA 2O7UA 1I69A 3N6TA 3DELB 3HHFA 3FJ7A 3KBRA 3GBBA 3RT6B 4JBZA 1B9JA 4NE4A 5I58A 2VHAA 3RT8A 4R6YA 3VXCA 3MZ1A 3FXRA 3T22A 3TUSA 2YLNA 4MLVA 3S9EA 1S50A 3FXQA 3RQTA 4X1DA 3MJNA 1HSEA 2X7QA 1XS5A 1US4A 1B6HA 1B3LA 1AH5A 3TTLA 3TPAA 2PVUA 1OMPA 3GZGA 3B6QA 4E0XA 3MVXA 3LUYA 3FVKA 3W9VA 2AL5A 3ILUB 1ZKBA 1N7WA 2QS1A 3CFXA 4EXKA 5K2XA 1IXCA 3ODBA 1QUIA 3H3GA 1A54A 3K6UA 4OXVA 3HHGA 1EH3A 4O3BA 3LSFB 1FW0A 4GIZA 2P2AA 2YJPA 4Z0IA 4EDPA 1I6QA 3DM0A 5H8QB 1ZBMA 4MFIA 3OXNA 4KHZE 4DE8A 4TQUQ 3VLUA 4GFRA 3OOAA 1I6AA 5AA1A 1DTZA 4I1DA 1DOTA 1TWYA 1URDA 4R9GA 4ELRA 1IXHA 2DE2A 2QS3A 3K4UA 1DPPA 3DP8A 5H8FB 5K2YA 4RYAA 2XXRA 2B3FA 2FNCA 3EQ1A 3IB1A 2LAOA 1PDAA 3C36A 2DS9A 2R71A 2O84X 2QMXA 3KZGA 5AA4B 1LB8A 4LZ8A 3PPNA 4GL0A 4R73A 1NH8A 1JEUA 4MF3A 2HAUA 4GL8A 3K1MA 4IY6A 2ABHA 3D4GA 3MVWA 3VLWA 4LUBA 1Y9UA 3MC2A 4QSDA 1H44A 2O1MA 2Q89A 3BFTA 3Q29A 1SD3A 1MRPA 2UVIA 2F34A 5TU0A 4ZE9A 2ANJA 3PUWE 4IGRA 3T93B 2D3IA 1VE4A 3KOSA 3IB2A 5DTBA 1EZPA 3V5AA 3MP8A 4ZECA 2FA7A 4KR5A 2UVHA 1HSLA 4JXIA 4QSEA 1B51A 4KFQA 3BKIB 4OFJA 2P0SA 5H8SA 1FTJA 3IOWA 3Q28A 3SEXA 1Z7ME 3OO9A 3S9MC 1B5HA 2VOZA 4Z7EA 1MQDA 1SVXB 4OYVA 1QKAA 1LSTA 3OENA 1A7LA 2I3VA 1SQYA 3GLBA 3OSRA 1IXIA 1SI0A 4NF5B 1LBCA 4M1VA 1MQJA 1PC3A 5CMKA 4ELQA 4PFUA 5LOMA 3PD8A 4ECFA 1B52A 3MVYA 4KI0E 3FUZA 5AA2B 1RYXA 2AL4A 4NF6A 4ELOA 5L9SA 4P11A 3VXBA 4I9DA 1Y20A 3IL1B 1SW2A 1H43A 1TXFA 4PP0A 5A5XA 3HPIA 3FD3A 2ZNTA 5ICTA 3OMBA 2Z8FA 4FAJA 1FQBA 4WXJA 4DCXA 1JW1A 1S9TA 3O97A 2I4BA 1ZTYA 1FCKA 4GOTA 4U1OA 1SI1A 3KOTA 1UTBA 2AIXA 4OETA 3LC8A 1YPNA 2RCBA 5I2KA 3ILTB 3S4UA 3A3CA 4QFPA 1WODA 2REJA 5H8NB 1P1QA 4GXSB 1B05A 4BDNA 4EUOA 4YKIA 1LAFE 4YKJA 3T9UA 5JTYA 3MZ9A 3HSTA 4F1UA 3MAMA 2H9BA 4OMBA 3BBRA 1MDQA 1XVYA 3CRBA 3PMVA 4KCCA 2IEEA 4KPTA 1ATGA 3B6TA 4QF9A 4U1ZA 2Z8EA 4NF8A 4BDRA 4HCYA 2ONRA 4HTGA 3FV1A 3KSJA 4KYDA 3TCGA 4RJZA 2BJJX 3K6WA 3FVGA 4YKPA 4MH5A 4OWDA 1M5DA 3E9XA 3CIJA 4AB5A 4F3BA 4R72A 3MWBA 2Y7WA 3TODA 1MXXA 2DE4A 1B4HA 1M5BA 2UVJA 1P1WA 3E13X 4POWA 1FQEA 2OWSA 3RUMA 3PUXE 1Q35A 1Y3NA 2ZXTA 4YICA 4R6KA 1LAGE 4F2QA 1NNKA 1MY3A 2AYSA 2XXHA 4OERA 2VD2A 3T9HB 5TPAA 4QFKA 5CMMA 4X1BA 1UIVA 1ZJLA 3KN8A 4WEPA 1SW1A 4AQ4A 1Z7NE 3OD7A 1TT1A 3S9LC 3Q27A 3OEKA 1S7YA 4N07A 2PMSA 1MPDA 3F11A 3PPQA 2RINA 4ZZEA 1N0TA 3U8QA 1LCFA 5KCJB 3KN3A 4IO4A 3TTMA 2CZLA 4G2ZA 1OVBA 1H45A 3CFZA 3K01A 2NXOA 3ZSFA 5I84A 2XXPA 4WEDA 3R7XA 4NF4B 2DP8A 2DWIA 4GXAA 1D4NA 1B2HA 2F6PA 1CE2A 4H67A 1EZ9A 3W15C 3DP4A 3PGFA 2ZNSA 4F2OA 4POXA 3C32A 1XHYA 1NNTA 1DPEA 1VR5A 1A55A 1IXGA 3A09A 3M3FA 1POTA 4QFOA 5HBCA 4LZ7A 2RC9A 3H6VA 1M5EA 1KWHA 2HZLA 3K6VA 3SESA 4H5FA 3SDFA 5DEXA 2XXWA 5J1DA 1MPCA 2A5TB 4GVOA 1D9VA 2ZYKA 3TAJA 3JV9A 4NEDA 4HS7A 1A40A 1FQFA 4GQOA 1FQAA 4XKNA 2Q88A 2B3BA 3PUYE 2HEUA 3FV2A 5HPQA 1D3KA 3PUVE 4JSOA 3CG1A 3K00A 2W7YA 4Q8RA 4BDOA 2PYYA 4KQPA 5B7DA 4R2FA 3G7WA 3OO8A 1PB8A 4LQ5A 2GHBA 2B65A 5H8QA 4ZEDA 4TLLB 3VVFA 3T9VA 5I57A 4DLDA 3R6UA 2D5WA 4ND9A 5CBSA 1Y3QA 2ALUA 4H8JA 2QRYA 3R26A 4P0GA 3PV0E 2DXRA 1B0HA 3G3FA 4LONB 4QFNA 3DP6A 1P1OA 4H65A 5H8FA 3FIRA 2OZZA 1ELJA 4HCWA 5ICQA 4XIGQ 1GV8A 1EU8A 4R75A 2NUVA 3QK6A 3UK4A 1AMFA 5AA4A 1IQ7A 4BDLA 1OQHA 1QULA 3V89B 3IOTA 5B70A 3HO7A 1IEJA 1NH7A 1MY1A 1SW5A 1Y4TA 4OENA 4YB7A 3IB0A 4OHNA 2DWHA 4LZ5A 3JZJA 4I62A 3H4ZA 3OSQA 1UQWA 2O1LA 1MXWA 4IO7A 2O51A 3C4MA 4G68A 3WAFA 4RPNA 1SW4A 5I59B 2NWJA 3H6TA 2V3UA 4U2RA 1GGGA 2Y84A 1PBQA 4R2BA 3H7MA 3S2VA 2Q8JA 4K3FA 1NNPA 3K6XA 4QFLA 1N7XA 5AA2D 4JSDA 2DE3A 1LAHE 5I56B 5KDTA 3DLNA 3K1NA 4LP2B 4ZEFA 4GD5A 1B3HA 3FZVA 2ZYMA 3EN3A 2F6GA 4JB7A 2RF1A 4DDDA 1URSA 4H8IA 4NF5A 4IO3A 2Q2AA 2ZYNA 4R9FA 1N76A 1USYH 3KJTA 3UIFA 1MDP1 2Q2CA 3IJOB 4G4PA 3CFLA 5AA2A 4IGTA 3MP1A 1N04A 4EQBA 3CI8A 3G3GA 5CMCA 5AE4A 4P0IA 1MXYA 3TFLA 2H98A 2F7BA 2V93A 4U4XA 4FATA 3RLFE 3PMXA 1JW4A 1M5CA 1VSOA 1N84A 1XT8A 2X26A 3L6HA 2O7IA 3VDFA 1LLSA 1LAXA 4EQ9A 4G8MA 3MZBA 1HSJA 1A8EA 3K0VA 1XC1A 3SEWA 2R6GE 4UACA 4LVQA 1PB9A 3KSXA 1H3DA 5CC2A 2NVUB 3D4CA 4JWXA 3RTWB 2HZKA 3RGYA 1SBPA 1H76A 3RPWA 4X48A 2I6EA 2I48A 4M4GA 1UTHB 4YKKA 2V3TA 1R9LA 3W9WA 1SYHA 2V25A 5DVIA 2WKYA 4QSCA 3O6IA 2GFEA 2Y7RA 1OQGA 4ZZAA 1RYOA 1N3XA 5I2NB 2ESNA 4U22A 2FYIA 3SEVA 4F3SA 2G29A 4YU0A 2Y7IA 4RNSA 3A3UA 1Y1MA 3TYHA 4QHQA 3RY3A 1GR2A 2Y7PA 1FTLA 1USYE 3BFUA 3SERA 1A99A 3O6HA 3O29A 3USDA 1XVXA 5KZTA 2M8CA 2OK2A 4KD5A 3CSBA 3TTKA 4XTCQ 4F39A 1URGA 4OQOA 4H6DA 3SETA 1JQFA 3TMGA 3IOVA 4NWDA 4RPOA 4JDFA 1OLAA 5JK4A 4DZ1A 1UTBB 4FECA 1MH4A 1Y3PA 2XX7A 5ELVA 4G8NA 5F7VA 3WAEA 3UN6A 4OFOA 1B7ZA 2ZMBA 1BIYA 3U92A 2HCAA 2OBGA 4GWOA 3RTFB 4F19A 4LA9A 4ZEKA 4OZ9A 1BP5A 4IB2A 1M5FA 1AL3A 2UXAA 1PBPA 4EF1A 1IZ1A 2QL3A 3T9XB 3TTNA 2F7CA 1ZMGA 1B32A 3G3KA 4Q5TA 5DVJA 3FJGA 4F31B 4ELPA 4DCYA 1SYIA 5H8HB 2NOOA 1I6BA 2Y7KA 1YTVA 2RCAA 3VVDA 2IA4A 1FTKA 3CSGA 4PFWA 4OFLA 1LFIA 3UORA 1FQDA 4R6HA 1T0KA 2O6AA 1AIVA 3ECRA 3E3KA 3H03A 1GVCA 1JNFA 3FGSA 1QKBA 1B7HA 2QSXA 3TKDA 1DTGA 1LBBA 5L9OA 3MPKA 2DWAA 1IIWA 2DXYA 2H4IA 2O68A 5TP9B 3N6UA 1Y4CA 1MQHA 5CI5A 4ZDMA 2XXTA 3RNNA 2PX1A 4H0WA 3MBPA 3TCFA 1NFTA 2F78A 3EHSA 3U1OA 2A5SA 4XKQA 2XXYA 2Q9TA 2QJEA 2G93A 4YB5A 2A5TA 2I4CA 3C35A 3OELA 5FTHA 2XXIA 3OEMA 4U23A 5FHOA 4PETA 3LSLA 4BDMA 4ISUA 4LQ2A 4XKPA 4RA1A 4F29A 4BLAA 2ONKE 3KJ7A 1B1XA 3TTRA 1JW5A 3VE1B 1O64A 3PD9A 1B40A 1MXUA 5FTIA 3FXUA 4EXLA 2UYFA 3FJMA 2UYEA 3O9PA 4YMAA 1NL5A 2E0SA 3EPEA 3I6VA 1MY2A 1QUJA 2D21A 2GHAA 4F3PA 3C33A 1MM7A 3IO6A 2XXUA 2PBWA 4E0WA 1B0LA 4LATA 3THIA 3LBSA 4FJPA 1IITA 4YAHX 3SEUA 4ESXA 1BTJA 1MM6A 4G8HA 3SKPA 2OWTA 2GH9A 2H5YA 2Z23A 5DEXB 3LSWA 1A8FA 2I49A 3O66A 1Y1ZA 1NNFA 5I58B 2DSFA 3QUJA 5JEIA 5FHNA 4RK2A 4H1XA 4IO5A 1MPBA 3FVNA 4OTEA 3O28A 4Q30B 2YPNA 3HCQA 4RXLA 3IOUA 4G77A 5EHSA 1ZIUA 4FEBA 3T96B 3H6UA 3G3JA 3C31A 3KEIA 1YCJA 2GRVA 1O63A 1LFGA 3B6WA 4Q0CA 1MS7A 1CB6A 4G68C 3L6GA 4U4SA 2OJTA 3VFJA 5I57B 5I59A 3H06B 1FTMA 4XXUA 3GBAA 1OIBA 1P1UA 4MBPA 3UA8A 3CR9A 4OEUA 2XD2A 3PPPA 4U21A 5CRYA 3G3IA 3AXFA 1MY0A 1JETA 4NTLA 1VFEA 4FIMA 5F1QA 1B1HA 2XXVA 3UP9A 1OVTA 1BLFA 1MQGA 4F1YA 2F97A 5I56A 4NMYA 1TFDA 1POY1 2I58A 4GRKA 3SEYA 3RN8A 4MLQA 3IX1A 1ZLQA 5CMBA 1O7TA 2RKMA 1QW0A
chains in the Genus database with same CATH superfamily
2QFLA 4YZZA 3E4RA 4DXUA 1MXZA 4EF2A 1GTKA 4F3GA 2V3QA 3TELA 2OLBA 3K02A 4TOZA 4JWOA 1B7UA 3JYRA 4WKMA 4EQ7A 2RC7A 1DMBA 1ZU0A 2Y5LA 4DXCA 3M3KA 4TLMB 3QIMA 1QVSA 2QS2A 2P1SA 3U72A 3EHUA 4QRZA 4PFYA 1LB9A 1FPDA 4ONYA 5ISUA 4GLIA 4G68B 2H25A 2O69A 5ET8A 4ZE8A 3ZKKA 3Q26A 3TQWA 4YMBA 4O3CA 2QS4A 3MQ9A 3C34A 4PE5B 3MP6A 5EHMA 3TDJA 5ITPA 3GXAA 3TEPA 1B3GA 4ZEBA 3VLVA 5IAIA 1FPFA 2F35A 1KA1A 1DSNA 3A29A 3V83A 3IR1A 2ONSA 1VFDA 2XXXA 5KDTB 1LGBC 1N3WA 1TFAA 3CG3A 2FVZA 2I0CA 4X9TA 2H99A 3RYDA 1MXVA 1D9YA 3N26A 1UTHA 3HFUA 3QSLA 3S9NC 2V84A 3VVEA 2VP1A 1MY4A 4RY1A 3HV1A 3FVOA 3QMFA 1IMBA 1SDXA 5I2NA 1II5A 2Q8MA 5H8NA 3KN7A 1B58A 4P8BA 1B3EA 4OESA 3IORA 1XOCA 1R1NA 3G3HA 2XX9A 1JEVA 2CEXA 1RDYA 5AA3A 1FTOA 2F8DA 3QUFA 5IKBA 2HQ0A 2VT5A 3ROJA 1RKMA 3K1PA 4XF5A 2PT2A 2RC8A 5CBRA 1EZOA 3TQLA 4ESWA 3LR1A 1D9QA 4O3AA 4NF6B 3Q25A 2X7PA 1NKXA 5EYFA 1G0HA 1YZ0A 5IZ1A 4XKRA 3HN0A 4THIA 3QXMA 2HAVA 3OO7A 2DWJA 5A5XB 3PU5A 5L9MA 5L8DA 3M3LA 1Q1KA 3UGWA 3IK6B 4PDDA 1IUDA 4PFTA 3MUQA 2HFBA 2FIXA 1LCTA 5IGAA 4P1EA 3EHTA 5DYHA 2XXQA 4OVJA 2DYXA 4FORA 2OCUA 4RK9A 1BKAA 1PEBA 2CMOA 1BK4A 3KFMA 4H5GA 4OEVA 1QJMA 4PF8A 3PMWA 5DVFA 1F9BA 2HXWA 3FATA 3P7IA 2ZNUA 5I2KB 5DT6A 1JVYA 2QPQA 4DIGA 1B5IA 3KG2A 2F3DA 1B3FA 1R9QA 3LUZA 2VD3A 3ZKLA 3N94A 1IMDA 3VV5A 5H8HA 1EYIA 2THIA 1MH3A 2VGQA 4PGNA 1B46A 4ZS9A 2XX8A 1DCUA 3TCHA 1OLCA 5JTYB 3QAXA 4FE8A 2KLFA 1YAEA 1UIUA 3O6GA 3MSTA 3ZS6A 4F18A 3QYTA 4IO2A 4MHFA 3O2AA 2PT1A 4IO6A 1WVJA 4NF8B 1FQCA 4NAPA 2Z8DA 5KCJA 3BIGA 1QUKA 3K2DA 1NMUA 3U93A 1AOVA 1PB7A 2I3WA 3N5LA 2I0BA 5TP9A 4C0RA 4C1UA 2R9JA 2XD3A 3T66A 1MQIA 4MMPA 4NF4A 2OWZA 4N13A 4L17A 3I3VA 2PFZA 1R6ZA 3IO4A 3KGCA 3PPRA 1LFHA 1JVXA 4N17A 3MPLA 2DVCA 1XI6A 4KYSA 5FHMA 4I8CA 3TZAA 4JWYA 5ITOA 3B7DA 3PUZE 5LTCA 4KYEA 2F5XA 2ZYOA 1J1NA 4DXBA 2F7AA 4GBWA 3FASA 4ZEIA 2E1SA 4YB6A 3LSXA 2QMWA 3C9HA 4N15A 4PQJA 4GF8A 2DVZA 3MW0A 3CVGA 5M2VA 5BWJA 5TPAB 4C1TA 5CM6A 3I5OA 4PE3A 4NWCA 4GWZA 4O7MA 4HW8A 4N6PA 3OO6A 2REGA 2Z22A 1ANFA 1NV5A 5BUUA 4R74A 4KCDA 3M8UA 4IY5A 3MVZA 1P1NA 2DOJA 3U94A 5I7IA 3IJXB 1US5A 5HM4B 4HE1A 1WDNA 1P99A 3PPOA 3IAZA 4AB6A 2UVGA 4UA8A 3ONMA 4P3LA 3EF7A 3V8XB 4GWSA 1IMEA 1B5JA 4F1VA 2DQVA 4OVTA 4F22A 1MG1A 3H6WA 4FEDA 4MEVA 1L5TA 2F36A 4N8YA 4JVIA 2WYPA 1B4ZA 2XHDA 4BDQA 2O7UA 4X8RA 1I69A 1NV2A 3N6TA 3DELB 3HHFA 3FJ7A 4OA4A 3KBRA 3GBBA 3RT6B 4JBZA 1B9JA 4NE4A 5I58A 2VHAA 4GWYA 3RT8A 4R6YA 3VXCA 3MZ1A 3FXRA 4DI3D 3T22A 3TUSA 3BIHA 2YLNA 4MLVA 3S9EA 1S50A 3FXQA 3RQTA 4X1DA 3MJNA 1HSEA 4N81A 2X7QA 1XS5A 4HE0A 1US4A 1B6HA 4XEQA 1B3LA 1AH5A 5DW8A 4N6DA 4OVQA 3TTLA 3TPAA 2PVUA 1OMPA 3GZGA 3B6QA 4E0XA 3MVXA 3LUYA 3FVKA 3W9VA 2AL5A 3B8BA 3ILUB 1ZKBA 1N7WA 2QS1A 3CFXA 4EXKA 2R8TA 5K2XA 1IXCA 3ODBA 1QUIA 3H3GA 4H46A 1A54A 3K6UA 4OXVA 3HHGA 1EH3A 4O3BA 3LSFB 1FW0A 4GIZA 1K9YA 2P2AA 2YJPA 4Z0IA 4EDPA 1I6QA 3LV0A 3DM0A 5H8QB 5J16A 1IMCA 2V4CA 1ZBMA 1KZ8A 4MFIA 3OXNA 4KHZE 4PAIA 4DE8A 4TQUQ 3VLUA 4GX4A 4GFRA 3OOAA 1I6AA 2WBBA 5AA1A 1DTZA 5I5PA 3IFCA 4H45A 4I1DA 1DOTA 1TWYA 1URDA 4R9GA 4ELRA 1IXHA 2DE2A 2QS3A 2XWVA 3K4UA 1DPPA 3B50A 4PAKA 1YXIA 3DP8A 5H8FB 5K2YA 2ZZVA 4RYAA 2XXRA 2B3FA 1FRPA 2FNCA 3EQ1A 3IB1A 2LAOA 4JVDA 1PDAA 3C36A 4PAFA 2DS9A 2R71A 1NI9A 2O84X 2QMXA 1LEVA 1NV0A 3KZGA 5AA4B 1LB8A 4LZ8A 3PPNA 4GL0A 4R73A 1NH8A 1JEUA 1NV7A 4MF3A 3E78A 2HAUA 2VPNA 4GL8A 3K1MA 4IY6A 3KBZA 2ABHA 3D4GA 3MVWA 3VLWA 4LUBA 1Y9UA 3MC2A 2FIEA 4QSDA 1H44A 2O1MA 2Q89A 3BFTA 2KR0A 3Q29A 4I40A 1SD3A 1MRPA 2UVIA 2F34A 5TU0A 4ZE9A 2ANJA 3PUWE 4IGRA 3T93B 2D3IA 1INPA 1VE4A 3KOSA 1DK4A 3IB2A 1IMFA 2FBPA 5DTBA 1EZPA 3V5AA 3MP8A 4ZECA 2FA7A 4KR5A 2UVHA 1HSLA 4JXIA 4QSEA 1B51A 3MYUA 4KFQA 3BKIB 4OFJA 2P0SA 5H8SA 3FBPA 1FTJA 3IOWA 3KC1A 3Q28A 3SEXA 1Z7ME 3OO9A 3S9MC 1B5HA 2VOZA 4Z7EA 1MQDA 3T1BA 1SVXB 5IZ3A 4OYVA 1QKAA 1LSTA 3OENA 1A7LA 4XFEA 2I3VA 1SQYA 3GLBA 3OSRA 1IXIA 4NHBA 1SI0A 4NF5B 1LBCA 1FBGA 4M1VA 1MQJA 1PC3A 5CMKA 4ELQA 4PFUA 5LOMA 3PD8A 4ECFA 4PF6A 1B52A 3MVYA 4KI0E 3FUZA 1RYXA 2AL4A 4ELOA 4NF6A 5AA2B 5L9SA 4P11A 5IM2A 3VXBA 4I9DA 1Y20A 3IL1B 1SW2A 1H43A 2KQZA 4NF0A 1TXFA 4PP0A 5A5XA 3HPIA 3FD3A 2ZNTA 5ICTA 3OMBA 2Z8FA 4FAJA 1FPEA 1FQBA 4WXJA 4DCXA 1JW1A 1S9TA 3O97A 2I4BA 1ZTYA 4MIJA 1FCKA 4GOTA 4U1OA 1SI1A 3KOTA 1UTBA 2AIXA 4OETA 3LC8A 1YPNA 2RCBA 5I2KA 3ILTB 3S4UA 3A3CA 4QFPA 1WODA 2REJA 5H8NB 1P1QA 2ZZWA 4GXSB 1B05A 4GX3A 4BDNA 4GWXA 4EUOA 4YKIA 1LAFE 4YKJA 1JP4A 3T9UA 5JTYA 3MZ9A 3HSTA 4F1UA 3MAMA 2H9BA 4OMBA 3BBRA 1MDQA 4JVCA 3NOHA 1FBFA 1XVYA 3CRBA 3PMVA 4KCCA 2IEEA 1YYZA 4KPTA 1ATGA 3B6TA 4QF9A 4U1ZA 2Z8EA 4NF8A 4BDRA 4HCYA 2ONRA 1FBHA 4OVRA 4HTGA 3FV1A 3KSJA 4KYDA 3TCGA 4RJZA 2BJJX 3K6WA 3FVGA 4YKPA 4MH5A 4OWDA 1M5DA 3E9XA 4PTKA 3CIJA 4AB5A 4PDHA 4F3BA 4R72A 3MWBA 2Y7WA 4UABA 3TODA 1NV3A 1MXXA 2DE4A 1B4HA 1M5BA 2UVJA 1P1WA 4AS5A 3E13X 4POWA 1FQEA 2OWSA 3RUMA 3PUXE 1Q35A 1Y3NA 2ZXTA 4YICA 4R6KA 1LAGE 2CZIA 4F2QA 1NNKA 1MY3A 2AYSA 4I3YA 2XXHA 4OERA 1DBZA 2VD2A 3T9HB 5TPAA 4QFKA 5CMMA 4X1BA 1UIVA 4NGUA 1ZJLA 3KN8A 4OVPA 4WEPA 1NUWA 1SW1A 4AQ4A 2JJKA 1Z7NE 3OD7A 1TT1A 2XWOA 3S9LC 1Q9DA 2XWIA 2ZZXA 3Q27A 3OEKA 1S7YA 2WBDA 4N07A 2PMSA 4O94A 1MPDA 3F11A 3PPQA 2RINA 4ZZEA 1N0TA 3U8QA 1LCFA 5KCJB 1FBCA 3KN3A 4IO4A 3TTMA 2CZLA 4G2ZA 1OVBA 1H45A 3CFZA 3K01A 2NXOA 1NV1A 3ZSFA 5I84A 4N91A 4PBHA 2XXPA 1FBEA 4WEDA 3R7XA 4NF4B 2DP8A 2DWIA 4GXAA 4MAGA 1D4NA 1B2HA 2F6PA 1CE2A 1NV4A 4H67A 1EZ9A 3W15C 3DP4A 3PGFA 2ZNSA 4F2OA 4POXA 3C32A 1XHYA 1NNTA 1DPEA 1VR5A 1A55A 1IXGA 4QXDA 3A09A 3M3FA 1POTA 4QFOA 5HBCA 4LZ7A 2QVUA 2RC9A 3H6VA 1M5EA 1KWHA 2HZLA 3K6VA 5ESYA 3SESA 4PGPA 4H5FA 3SDFA 1SPIA 1LBVA 5DEXA 2XXWA 1FBPA 5J1DA 1MPCA 4GBVA 2A5TB 2QVRA 4GWWA 4GVOA 1D9VA 2ZYKA 3TAJA 3JV9A 4NEDA 5EYGA 4HS7A 1IMAA 1A40A 1FQFA 4GQOA 4NQ8A 1FQAA 4XKNA 2Q88A 2B3BA 4N6KA 3PUYE 2HEUA 3FV2A 4QBAA 4PFIA 5HPQA 1D3KA 2WEFA 3PUVE 4JSOA 3CG1A 5LDZA 3K00A 2W7YA 4Q8RA 4BDOA 3PTYA 2PYYA 4KQPA 5B7DA 4R2FA 3G7WA 1RDXA 3OO8A 1PB8A 4LQ5A 2GHBA 2B65A 5H8QA 5F24A 4ZEDA 4TLLB 3VVFA 2FHYA 3T9VA 5I57A 4DLDA 3R6UA 2D5WA 4ND9A 5EQ7A 5CBSA 2MKZA 3CHGA 1Y3QA 2ALUA 4H8JA 2QRYA 3R26A 4P0GA 1FPIA 3PV0E 4HXVA 2DXRA 1B0HA 3G3FA 4LONB 4QFNA 3DP6A 1P1OA 4H65A 5H8FA 3FIRA 2OZZA 4PFRA 1ELJA 4HCWA 5ICQA 4XIGQ 1GV8A 1EU8A 4R75A 2NUVA 3QK6A 5EQ8A 3UK4A 1AMFA 5AA4A 1IQ7A 4I3EA 4BDLA 3SZPA 1OQHA 1QULA 3V89B 4O8MA 4MX6A 3IOTA 5B70A 2WX9A 3HO7A 4PC9A 1IEJA 1NH7A 1MY1A 1SW5A 1Y4TA 4OENA 1QGXA 4YB7A 3IB0A 4OHNA 2DWHA 1FPKA 4LZ5A 3JZJA 4I62A 4PCDA 3H4ZA 3OSQA 5EQ9A 1UQWA 2O1LA 1MXWA 4IO7A 2O51A 3C4MA 4G68A 3WAFA 4RPNA 1VDWA 3RPLB 1SW4A 5I59B 2NWJA 3H6TA 2V3UA 2L5VA 4U2RA 1GGGA 4NX1A 3FXBA 2Y84A 1PBQA 4G61A 4R2BA 3H7MA 3S2VA 2Q8JA 2Y5KA 4K3FA 1NNPA 3K6XA 4QFLA 1N7XA 5AA2D 4JSDA 2DE3A 4PFBA 1LAHE 5I56B 5KDTA 4AS4A 3DLNA 3K1NA 4LP2B 4ZEFA 4GD5A 1B3HA 3FZVA 2ZYMA 3EN3A 2F6GA 4JB7A 2RF1A 4DDDA 1URSA 2PFYA 4H8IA 5ET6A 3GYYA 4NF5A 4IO3A 2Q2AA 2HXRA 2ZYNA 4R9FA 1CNQA 1N76A 1USYH 3KJTA 3UIFA 1MDP1 4IR8A 2Q2CA 3IJOB 4G4PA 1NUZA 3CFLA 4N8GA 5AA2A 4IGTA 3MP1A 1N04A 4NG7A 4EQBA 3CI8A 1EYKA 3G3GA 5CMCA 5AE4A 4P0IA 4MCOA 1G0IA 1MXYA 3TFLA 2H98A 2F7BA 2V93A 4U4XA 4FATA 3RLFE 2VPOA 3PMXA 1JW4A 1M5CA 1VSOA 1N84A 1XT8A 2X26A 3L6HA 2O7IA 3VDFA 1LLSA 1LAXA 1NUYA 4EQ9A 4G8MA 3MZBA 1HSJA 1A8EA 3K0VA 1XC1A 4HE2A 3SEWA 2R6GE 4UACA 4PBQA 4LVQA 1PB9A 2CEYA 3KSXA 1H3DA 5CC2A 2NVUB 3D4CA 4JWXA 3RTWB 2HZKA 3RGYA 1SBPA 1H76A 5IZ3B 3RPWA 2XWKA 4X48A 2I6EA 2I48A 4M4GA 1UTHB 4P9KA 4YKKA 2V3TA 1R9LA 3W9WA 1SYHA 2V25A 5DVIA 2WKYA 4QSCA 5EQAA 3O6IA 2GFEA 2Y7RA 4MNCA 1OQGA 4ZZAA 1RYOA 1N3XA 5I2NB 2ESNA 4U22A 2FYIA 3SEVA 4F3SA 2G29A 4YU0A 2Y7IA 4RNSA 3A3UA 3D1RA 1Y1MA 3TYHA 4QHQA 3RY3A 1GR2A 2Y7PA 1FTLA 1USYE 3BFUA 3SERA 1A99A 3T0JA 3O6HA 3O29A 5IZZA 3USDA 5FBPA 1XVXA 4GX6A 5KZTA 1FPGA 2CZKA 1LBWA 2M8CA 2OK2A 4KD5A 3CSBA 3TTKA 3IFAA 4XTCQ 4F39A 1URGA 4OQOA 4H6DA 3SETA 1JQFA 3TMGA 3IOVA 4NWDA 4RPOA 4JDFA 1OLAA 5JK4A 4DZ1A 1UTBB 4FECA 1MH4A 1Y3PA 2XX7A 5ELVA 4G8NA 5EYHA 5F7VA 3WAEA 3UN6A 4OFOA 5ET5A 1B7ZA 4MNPA 2ZMBA 1BIYA 3U92A 2HCAA 2OBGA 4OANA 4GWOA 3RTFB 4F19A 4LA9A 4O7IA 4ZEKA 4OZ9A 1BP5A 4IB2A 1M5FA 1AL3A 2UXAA 1PBPA 4EF1A 1IZ1A 2QL3A 3T9XB 1FPJA 4MNIA 3TTNA 5ET7A 2F7CA 1ZMGA 1B32A 3G3KA 2P3VA 1FJ6A 4Q5TA 5DVJA 3FJGA 4F31B 2BJIA 4ELPA 4DCYA 4DI4B 1SYIA 5H8HB 2NOOA 1I6BA 2Y7KA 1YTVA 4NN3A 2RCAA 3VVDA 2IA4A 1FTKA 2Q74A 3CSGA 4PFWA 4OFLA 1LFIA 3UORA 1FQDA 1LBXA 4R6HA 2P3NA 1T0KA 1NV6A 2O6AA 1AIVA 3ECRA 2DDKA 1FPBA 3E3KA 3H03A 1FJ9A 1GVCA 1JNFA 3FGSA 1QKBA 1B7HA 2QSXA 3TKDA 1DTGA 1LBBA 5L9OA 3MPKA 2DWAA 1IIWA 1EYJA 2DXYA 2H4IA 2O68A 5TP9B 3N6UA 1Y4CA 1MQHA 5CI5A 4FBPA 4ZDMA 2XXTA 1RDZA 3RNNA 2PX1A 4H0WA 3MBPA 3TCFA 1NFTA 2F78A 3EHSA 3U1OA 2A5SA 4XKQA 1FPLA 2XXYA 2Q9TA 1K9ZA 2QJEA 2G93A 4YB5A 2A5TA 2I4CA 3C35A 3OELA 5FTHA 2XXIA 3OEMA 4U23A 5FHOA 4PETA 2XXKA 3LSLA 1FBDA 4BDMA 4ISUA 4LQ2A 4XKPA 4RA1A 4F29A 4BLAA 4P47A 2ONKE 3KJ7A 1B1XA 3TTRA 1JW5A 3VE1B 1O64A 2PCRA 3PD9A 1B40A 1LBYA 1MXUA 2QVVA 5FTIA 3FXUA 4EXLA 2UYFA 3FJMA 2UYEA 2XA5A 3O9PA 4YMAA 1NL5A 2E0SA 1FSAA 3EPEA 3E79A 3I6VA 1MY2A 1QUJA 2D21A 2GHAA 4GWUA 4F3PA 3C33A 1MM7A 3IO6A 1FTAA 2XXUA 2PBWA 4E0WA 1B0LA 4LATA 3THIA 2B4LA 3LBSA 4FJPA 4P56A 1IITA 4YAHX 3SEUA 4ESXA 1BTJA 1MM6A 4G8HA 3SKPA 2F3BA 2OWTA 2GH9A 2H5YA 2Z23A 5DEXB 3LSWA 1A8FA 2I49A 3O66A 1Y1ZA 1NNFA 5I58B 2DSFA 3QUJA 5JEIA 5FHNA 2HHMA 4RK2A 4H1XA 4IO5A 1MPBA 1AWBA 2HPGA 3FVNA 4OTEA 3O28A 4Q30B 2YPNA 3HCQA 4RXLA 3IOUA 4G77A 5EHSA 1ZIUA 4FEBA 3T96B 4KXPA 3H6UA 4LN5A 3G3JA 4OVSA 3C31A 3KEIA 1KA0A 4X04A 1YCJA 5A5LA 2GRVA 1O63A 1LFGA 3B6WA 4Q0CA 1MS7A 1CB6A 4G68C 3L6GA 4U4SA 2OJTA 3VFJA 3RPLA 5I57B 5I59A 3H06B 1FTMA 4XXUA 3GBAA 1OIBA 4N4UA 1P1UA 2B4MA 2WYKA 4MBPA 3UA8A 3CR9A 4OEUA 1LBZA 2XD2A 3PPPA 4U21A 5CRYA 3G3IA 3AXFA 3ISPA 1MY0A 1JETA 4NTLA 1VFEA 4FIMA 4P1LA 5F1QA 3EKIA 1B1HA 2XXVA 1NUXA 3UP9A 1OVTA 1BLFA 1MQGA 3KC0A 4F1YA 2F97A 5I56A 4NMYA 1TFDA 1POY1 2I58A 4GRKA 4MJOA 3SEYA 3RN8A 4MLQA 5T3JA 3IX1A 5I3SA 1ZLQA 2CZHA 5CMBA 2GQ1A 1O7TA 2OX3A 2RKMA 1QW0A 3U65A
chains in the Genus database with same CATH topology
4YZZA 3E4RA 4DXUA 1MXZA 4EF2A 1GTKA 4F3GA 2V3QA 3TELA 2OLBA 3K02A 4TOZA 4JWOA 1B7UA 3JYRA 4WKMA 4EQ7A 2RC7A 1DMBA 1ZU0A 4DXCA 3M3KA 4TLMB 3QIMA 1QVSA 2QS2A 2P1SA 3U72A 3EHUA 4QRZA 4PFYA 1LB9A 4ONYA 5ISUA 4GLIA 4G68B 2H25A 2O69A 4ZE8A 3ZKKA 3Q26A 3TQWA 4YMBA 4O3CA 2QS4A 3MQ9A 3C34A 4PE5B 3MP6A 5EHMA 3TDJA 5ITPA 3GXAA 3TEPA 1B3GA 4ZEBA 3VLVA 5IAIA 2F35A 1DSNA 3V83A 3IR1A 2ONSA 1VFDA 2XXXA 5KDTB 1LGBC 1N3WA 1TFAA 3CG3A 2I0CA 4X9TA 2H99A 1MXVA 1D9YA 3N26A 1UTHA 3QSLA 3S9NC 2V84A 3VVEA 2VP1A 1MY4A 4RY1A 3HV1A 3FVOA 1SDXA 5I2NA 1II5A 5H8NA 3KN7A 1B58A 1B3EA 4OESA 3IORA 1XOCA 1R1NA 3G3HA 2XX9A 1JEVA 5AA3A 1FTOA 2F8DA 3QUFA 5IKBA 2HQ0A 1RKMA 3K1PA 2PT2A 2RC8A 5CBRA 1EZOA 3TQLA 4ESWA 3LR1A 4O3AA 4NF6B 3Q25A 2X7PA 1NKXA 5EYFA 4XKRA 3HN0A 4THIA 3QXMA 2HAVA 3OO7A 2DWJA 5A5XB 3PU5A 5L9MA 5L8DA 3M3LA 3UGWA 1Q1KA 3IK6B 1IUDA 4PFTA 3MUQA 2HFBA 1LCTA 3EHTA 5DYHA 2XXQA 4OVJA 2DYXA 4FORA 2OCUA 4RK9A 1BKAA 1PEBA 2CMOA 3KFMA 4H5GA 4OEVA 1QJMA 3PMWA 5DVFA 1F9BA 2HXWA 3FATA 3P7IA 2ZNUA 5I2KB 5DT6A 1JVYA 2QPQA 4DIGA 1B5IA 3KG2A 1B3FA 1R9QA 2VD3A 3ZKLA 3N94A 3VV5A 5H8HA 2THIA 1MH3A 2VGQA 1B46A 4ZS9A 2XX8A 3TCHA 1OLCA 5JTYB 3QAXA 4FE8A 2KLFA 1YAEA 1UIUA 3O6GA 3ZS6A 4F18A 3QYTA 4IO2A 3O2AA 2PT1A 4IO6A 1WVJA 4NF8B 1FQCA 2Z8DA 5KCJA 1QUKA 3K2DA 1NMUA 3U93A 1AOVA 1PB7A 2I3WA 3N5LA 2I0BA 5TP9A 4C0RA 4C1UA 2R9JA 2XD3A 3T66A 1MQIA 4NF4A 4N13A 4L17A 3I3VA 1R6ZA 3IO4A 3KGCA 3PPRA 1LFHA 1JVXA 3MPLA 2DVCA 4KYSA 5FHMA 4I8CA 3TZAA 4JWYA 5ITOA 3B7DA 3PUZE 4KYEA 2F5XA 2ZYOA 1J1NA 4DXBA 2F7AA 3FASA 4ZEIA 2E1SA 4YB6A 3LSXA 2QMWA 3C9HA 4PQJA 4GF8A 2DVZA 3MW0A 3CVGA 5M2VA 5BWJA 5TPAB 4C1TA 5CM6A 3I5OA 4NWCA 4HW8A 4N6PA 3OO6A 2REGA 2Z22A 1ANFA 5BUUA 4R74A 4KCDA 3M8UA 4IY5A 3MVZA 1P1NA 2DOJA 3U94A 3IJXB 1US5A 5HM4B 1WDNA 1P99A 3PPOA 3IAZA 4AB6A 2UVGA 4UA8A 3ONMA 3EF7A 3V8XB 1B5JA 4F1VA 2DQVA 4F22A 1MG1A 3H6WA 4FEDA 1L5TA 2F36A 1B4ZA 2XHDA 4BDQA 2O7UA 1I69A 3N6TA 3DELB 3HHFA 3FJ7A 3KBRA 3GBBA 3RT6B 4JBZA 1B9JA 4NE4A 5I58A 2VHAA 3RT8A 4R6YA 3VXCA 3MZ1A 3FXRA 3T22A 3TUSA 2YLNA 4MLVA 3S9EA 1S50A 3FXQA 3RQTA 4X1DA 3MJNA 1HSEA 2X7QA 1XS5A 1US4A 1B6HA 1B3LA 1AH5A 3TTLA 3TPAA 2PVUA 1OMPA 3GZGA 3B6QA 4E0XA 3MVXA 3LUYA 3FVKA 3W9VA 2AL5A 3ILUB 1ZKBA 1N7WA 2QS1A 3CFXA 4EXKA 5K2XA 1IXCA 3ODBA 1QUIA 3H3GA 1A54A 3K6UA 4OXVA 3HHGA 1EH3A 4O3BA 3LSFB 1FW0A 4GIZA 2P2AA 2YJPA 4Z0IA 4EDPA 1I6QA 3DM0A 5H8QB 1ZBMA 4MFIA 3OXNA 4KHZE 4DE8A 4TQUQ 3VLUA 4GFRA 3OOAA 1I6AA 5AA1A 1DTZA 4I1DA 1DOTA 1TWYA 1URDA 4R9GA 4ELRA 1IXHA 2DE2A 2QS3A 3K4UA 1DPPA 3DP8A 5H8FB 5K2YA 4RYAA 2XXRA 2B3FA 2FNCA 3EQ1A 3IB1A 2LAOA 1PDAA 3C36A 2DS9A 2R71A 2O84X 2QMXA 3KZGA 5AA4B 1LB8A 4LZ8A 3PPNA 4GL0A 4R73A 1NH8A 1JEUA 4MF3A 2HAUA 4GL8A 3K1MA 4IY6A 2ABHA 3D4GA 3MVWA 3VLWA 4LUBA 1Y9UA 3MC2A 4QSDA 1H44A 2O1MA 2Q89A 3BFTA 3Q29A 1SD3A 1MRPA 2UVIA 2F34A 5TU0A 4ZE9A 2ANJA 3PUWE 4IGRA 3T93B 2D3IA 1VE4A 3KOSA 3IB2A 5DTBA 1EZPA 3V5AA 3MP8A 4ZECA 2FA7A 4KR5A 2UVHA 1HSLA 4JXIA 4QSEA 1B51A 4KFQA 3BKIB 4OFJA 2P0SA 5H8SA 1FTJA 3IOWA 3Q28A 3SEXA 1Z7ME 3OO9A 3S9MC 1B5HA 2VOZA 4Z7EA 1MQDA 1SVXB 4OYVA 1QKAA 1LSTA 3OENA 1A7LA 2I3VA 1SQYA 3GLBA 3OSRA 1IXIA 1SI0A 4NF5B 1LBCA 4M1VA 1MQJA 1PC3A 5CMKA 4ELQA 4PFUA 5LOMA 3PD8A 4ECFA 1B52A 3MVYA 4KI0E 3FUZA 5AA2B 1RYXA 2AL4A 4NF6A 4ELOA 5L9SA 4P11A 3VXBA 4I9DA 1Y20A 3IL1B 1SW2A 1H43A 1TXFA 4PP0A 5A5XA 3HPIA 3FD3A 2ZNTA 5ICTA 3OMBA 2Z8FA 4FAJA 1FQBA 4WXJA 4DCXA 1JW1A 1S9TA 3O97A 2I4BA 1ZTYA 1FCKA 4GOTA 4U1OA 1SI1A 3KOTA 1UTBA 2AIXA 4OETA 3LC8A 1YPNA 2RCBA 5I2KA 3ILTB 3S4UA 3A3CA 4QFPA 1WODA 2REJA 5H8NB 1P1QA 4GXSB 1B05A 4BDNA 4EUOA 4YKIA 1LAFE 4YKJA 3T9UA 5JTYA 3MZ9A 3HSTA 4F1UA 3MAMA 2H9BA 4OMBA 3BBRA 1MDQA 1XVYA 3CRBA 3PMVA 4KCCA 2IEEA 4KPTA 1ATGA 3B6TA 4QF9A 4U1ZA 2Z8EA 4NF8A 4BDRA 4HCYA 2ONRA 4HTGA 3FV1A 3KSJA 4KYDA 3TCGA 4RJZA 2BJJX 3K6WA 3FVGA 4YKPA 4MH5A 4OWDA 1M5DA 3E9XA 3CIJA 4AB5A 4F3BA 4R72A 3MWBA 2Y7WA 3TODA 1MXXA 2DE4A 1B4HA 1M5BA 2UVJA 1P1WA 3E13X 4POWA 1FQEA 2OWSA 3RUMA 3PUXE 1Q35A 1Y3NA 2ZXTA 4YICA 4R6KA 1LAGE 4F2QA 1NNKA 1MY3A 2AYSA 2XXHA 4OERA 2VD2A 3T9HB 5TPAA 4QFKA 5CMMA 4X1BA 1UIVA 1ZJLA 3KN8A 4WEPA 1SW1A 4AQ4A 1Z7NE 3OD7A 1TT1A 3S9LC 3Q27A 3OEKA 1S7YA 4N07A 2PMSA 1MPDA 3F11A 3PPQA 2RINA 4ZZEA 1N0TA 3U8QA 1LCFA 5KCJB 3KN3A 4IO4A 3TTMA 2CZLA 4G2ZA 1OVBA 1H45A 3CFZA 3K01A 2NXOA 3ZSFA 5I84A 2XXPA 4WEDA 3R7XA 4NF4B 2DP8A 2DWIA 4GXAA 1D4NA 1B2HA 2F6PA 1CE2A 4H67A 1EZ9A 3W15C 3DP4A 3PGFA 2ZNSA 4F2OA 4POXA 3C32A 1XHYA 1NNTA 1DPEA 1VR5A 1A55A 1IXGA 3A09A 3M3FA 1POTA 4QFOA 5HBCA 4LZ7A 2RC9A 3H6VA 1M5EA 1KWHA 2HZLA 3K6VA 3SESA 4H5FA 3SDFA 5DEXA 2XXWA 5J1DA 1MPCA 2A5TB 4GVOA 1D9VA 2ZYKA 3TAJA 3JV9A 4NEDA 4HS7A 1A40A 1FQFA 4GQOA 1FQAA 4XKNA 2Q88A 2B3BA 3PUYE 2HEUA 3FV2A 5HPQA 1D3KA 3PUVE 4JSOA 3CG1A 3K00A 2W7YA 4Q8RA 4BDOA 2PYYA 4KQPA 5B7DA 4R2FA 3G7WA 3OO8A 1PB8A 4LQ5A 2GHBA 2B65A 5H8QA 4ZEDA 4TLLB 3VVFA 3T9VA 5I57A 4DLDA 3R6UA 2D5WA 4ND9A 5CBSA 1Y3QA 2ALUA 4H8JA 2QRYA 3R26A 4P0GA 3PV0E 2DXRA 1B0HA 3G3FA 4LONB 4QFNA 3DP6A 1P1OA 4H65A 5H8FA 3FIRA 2OZZA 1ELJA 4HCWA 5ICQA 4XIGQ 1GV8A 1EU8A 4R75A 2NUVA 3QK6A 3UK4A 1AMFA 5AA4A 1IQ7A 4BDLA 1OQHA 1QULA 3V89B 3IOTA 5B70A 3HO7A 1IEJA 1NH7A 1MY1A 1SW5A 1Y4TA 4OENA 4YB7A 3IB0A 4OHNA 2DWHA 4LZ5A 3JZJA 4I62A 3H4ZA 3OSQA 1UQWA 2O1LA 1MXWA 4IO7A 2O51A 3C4MA 4G68A 3WAFA 4RPNA 1SW4A 5I59B 2NWJA 3H6TA 2V3UA 4U2RA 1GGGA 2Y84A 1PBQA 4R2BA 3H7MA 3S2VA 2Q8JA 4K3FA 1NNPA 3K6XA 4QFLA 1N7XA 5AA2D 4JSDA 2DE3A 1LAHE 5I56B 5KDTA 3DLNA 3K1NA 4LP2B 4ZEFA 4GD5A 1B3HA 3FZVA 2ZYMA 3EN3A 2F6GA 4JB7A 2RF1A 4DDDA 1URSA 4H8IA 4NF5A 4IO3A 2Q2AA 2ZYNA 4R9FA 1N76A 1USYH 3KJTA 3UIFA 1MDP1 2Q2CA 3IJOB 4G4PA 3CFLA 5AA2A 4IGTA 3MP1A 1N04A 4EQBA 3CI8A 3G3GA 5CMCA 5AE4A 4P0IA 1MXYA 3TFLA 2H98A 2F7BA 2V93A 4U4XA 4FATA 3RLFE 3PMXA 1JW4A 1M5CA 1VSOA 1N84A 1XT8A 2X26A 3L6HA 2O7IA 3VDFA 1LLSA 1LAXA 4EQ9A 4G8MA 3MZBA 1HSJA 1A8EA 3K0VA 1XC1A 3SEWA 2R6GE 4UACA 4LVQA 1PB9A 3KSXA 1H3DA 5CC2A 2NVUB 3D4CA 4JWXA 3RTWB 2HZKA 3RGYA 1SBPA 1H76A 3RPWA 4X48A 2I6EA 2I48A 4M4GA 1UTHB 4YKKA 2V3TA 1R9LA 3W9WA 1SYHA 2V25A 5DVIA 2WKYA 4QSCA 3O6IA 2GFEA 2Y7RA 1OQGA 4ZZAA 1RYOA 1N3XA 5I2NB 2ESNA 4U22A 2FYIA 3SEVA 4F3SA 2G29A 4YU0A 2Y7IA 4RNSA 3A3UA 1Y1MA 3TYHA 4QHQA 3RY3A 1GR2A 2Y7PA 1FTLA 1USYE 3BFUA 3SERA 1A99A 3O6HA 3O29A 3USDA 1XVXA 5KZTA 2M8CA 2OK2A 4KD5A 3CSBA 3TTKA 4XTCQ 4F39A 1URGA 4OQOA 4H6DA 3SETA 1JQFA 3TMGA 3IOVA 4NWDA 4RPOA 4JDFA 1OLAA 5JK4A 4DZ1A 1UTBB 4FECA 1MH4A 1Y3PA 2XX7A 5ELVA 4G8NA 5F7VA 3WAEA 3UN6A 4OFOA 1B7ZA 2ZMBA 1BIYA 3U92A 2HCAA 2OBGA 4GWOA 3RTFB 4F19A 4LA9A 4ZEKA 4OZ9A 1BP5A 4IB2A 1M5FA 1AL3A 2UXAA 1PBPA 4EF1A 1IZ1A 2QL3A 3T9XB 3TTNA 2F7CA 1ZMGA 1B32A 3G3KA 4Q5TA 5DVJA 3FJGA 4F31B 4ELPA 4DCYA 1SYIA 5H8HB 2NOOA 1I6BA 2Y7KA 1YTVA 2RCAA 3VVDA 2IA4A 1FTKA 3CSGA 4PFWA 4OFLA 1LFIA 3UORA 1FQDA 4R6HA 1T0KA 2O6AA 1AIVA 3ECRA 3E3KA 3H03A 1GVCA 1JNFA 3FGSA 1QKBA 1B7HA 2QSXA 3TKDA 1DTGA 1LBBA 5L9OA 3MPKA 2DWAA 1IIWA 2DXYA 2H4IA 2O68A 5TP9B 3N6UA 1Y4CA 1MQHA 5CI5A 4ZDMA 2XXTA 3RNNA 2PX1A 4H0WA 3MBPA 3TCFA 1NFTA 2F78A 3EHSA 3U1OA 2A5SA 4XKQA 2XXYA 2Q9TA 2QJEA 2G93A 4YB5A 2A5TA 2I4CA 3C35A 3OELA 5FTHA 2XXIA 3OEMA 4U23A 5FHOA 4PETA 3LSLA 4BDMA 4ISUA 4LQ2A 4XKPA 4RA1A 4F29A 4BLAA 2ONKE 3KJ7A 1B1XA 3TTRA 1JW5A 3VE1B 1O64A 3PD9A 1B40A 1MXUA 5FTIA 3FXUA 4EXLA 2UYFA 3FJMA 2UYEA 3O9PA 4YMAA 1NL5A 2E0SA 3EPEA 3I6VA 1MY2A 1QUJA 2D21A 2GHAA 4F3PA 3C33A 1MM7A 3IO6A 2XXUA 2PBWA 4E0WA 1B0LA 4LATA 3THIA 3LBSA 4FJPA 1IITA 4YAHX 3SEUA 4ESXA 1BTJA 1MM6A 4G8HA 3SKPA 2OWTA 2GH9A 2H5YA 2Z23A 5DEXB 3LSWA 1A8FA 2I49A 3O66A 1Y1ZA 1NNFA 5I58B 2DSFA 3QUJA 5JEIA 5FHNA 4RK2A 4H1XA 4IO5A 1MPBA 3FVNA 4OTEA 3O28A 4Q30B 2YPNA 3HCQA 4RXLA 3IOUA 4G77A 5EHSA 1ZIUA 4FEBA 3T96B 3H6UA 3G3JA 3C31A 3KEIA 1YCJA 2GRVA 1O63A 1LFGA 3B6WA 4Q0CA 1MS7A 1CB6A 4G68C 3L6GA 4U4SA 2OJTA 3VFJA 5I57B 5I59A 3H06B 1FTMA 4XXUA 3GBAA 1OIBA 1P1UA 4MBPA 3UA8A 3CR9A 4OEUA 2XD2A 3PPPA 4U21A 5CRYA 3G3IA 3AXFA 1MY0A 1JETA 4NTLA 1VFEA 4FIMA 5F1QA 1B1HA 2XXVA 3UP9A 1OVTA 1BLFA 1MQGA 4F1YA 2F97A 5I56A 4NMYA 1TFDA 1POY1 2I58A 4GRKA 3SEYA 3RN8A 4MLQA 3IX1A 1ZLQA 5CMBA 1O7TA 2RKMA 1QW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZZ A;  3E4R A;  4DXU A;  1MXZ A;  4EF2 A;  1GTK A;  4F3G A;  2V3Q A;  3TEL A;  2OLB A;  3K02 A;  4TOZ A;  4JWO A;  1B7U A;  3JYR A;  4WKM A;  4EQ7 A;  2RC7 A;  1DMB A;  1ZU0 A;  4DXC A;  3M3K A;  4TLM B;  3QIM A;  1QVS A;  2QS2 A;  2P1S A;  3U72 A;  3EHU A;  4QRZ A;  4PFY A;  1LB9 A;  4ONY A;  5ISU A;  4GLI A;  4G68 B;  2H25 A;  2O69 A;  4ZE8 A;  3ZKK A;  3Q26 A;  3TQW A;  4YMB A;  4O3C A;  2QS4 A;  3MQ9 A;  3C34 A;  4PE5 B;  3MP6 A;  5EHM A;  3TDJ A;  5ITP A;  3GXA A;  3TEP A;  1B3G A;  4ZEB A;  3VLV A;  5IAI A;  2F35 A;  1DSN A;  3V83 A;  3IR1 A;  2ONS A;  1VFD A;  2XXX A;  5KDT B;  1LGB C;  1N3W A;  1TFA A;  3CG3 A;  2I0C A;  4X9T A;  2H99 A;  1MXV A;  1D9Y A;  3N26 A;  1UTH A;  3QSL A;  3S9N C;  2V84 A;  3VVE A;  2VP1 A;  1MY4 A;  4RY1 A;  3HV1 A;  3FVO A;  1SDX A;  5I2N A;  1II5 A;  5H8N A;  3KN7 A;  1B58 A;  1B3E A;  4OES A;  3IOR A;  1XOC A;  1R1N A;  3G3H A;  2XX9 A;  1JEV A;  5AA3 A;  1FTO A;  2F8D A;  3QUF A;  5IKB A;  2HQ0 A;  1RKM A;  3K1P A;  2PT2 A;  2RC8 A;  5CBR A;  1EZO A;  3TQL A;  4ESW A;  3LR1 A;  4O3A A;  4NF6 B;  3Q25 A;  2X7P A;  1NKX A;  5EYF A;  4XKR A;  3HN0 A;  4THI A;  3QXM A;  2HAV A;  3OO7 A;  2DWJ A;  5A5X B;  3PU5 A;  5L9M A;  5L8D A;  3M3L A;  3UGW A;  1Q1K A;  3IK6 B;  1IUD A;  4PFT A;  3MUQ A;  2HFB A;  1LCT A;  3EHT A;  5DYH A;  2XXQ A;  4OVJ A;  2DYX A;  4FOR A;  2OCU A;  4RK9 A;  1BKA A;  1PEB A;  2CMO A;  3KFM A;  4H5G A;  4OEV A;  1QJM A;  3PMW A;  5DVF A;  1F9B A;  2HXW A;  3FAT A;  3P7I A;  2ZNU A;  5I2K B;  5DT6 A;  1JVY A;  2QPQ A;  4DIG A;  1B5I A;  3KG2 A;  1B3F A;  1R9Q A;  2VD3 A;  3ZKL A;  3N94 A;  3VV5 A;  5H8H A;  2THI A;  1MH3 A;  2VGQ A;  1B46 A;  4ZS9 A;  2XX8 A;  3TCH A;  1OLC A;  5JTY B;  3QAX A;  4FE8 A;  2KLF A;  1YAE A;  1UIU A;  3O6G A;  3ZS6 A;  4F18 A;  3QYT A;  4IO2 A;  3O2A A;  2PT1 A;  4IO6 A;  1WVJ A;  4NF8 B;  1FQC A;  2Z8D A;  5KCJ A;  1QUK A;  3K2D A;  1NMU A;  3U93 A;  1AOV A;  1PB7 A;  2I3W A;  3N5L A;  2I0B A;  5TP9 A;  4C0R A;  4C1U A;  2R9J A;  2XD3 A;  3T66 A;  1MQI A;  4NF4 A;  4N13 A;  4L17 A;  3I3V A;  1R6Z A;  3IO4 A;  3KGC A;  3PPR A;  1LFH A;  1JVX A;  3MPL A;  2DVC A;  4KYS A;  5FHM A;  4I8C A;  3TZA A;  4JWY A;  5ITO A;  3B7D A;  3PUZ E;  4KYE A;  2F5X A;  2ZYO A;  1J1N A;  4DXB A;  2F7A A;  3FAS A;  4ZEI A;  2E1S A;  4YB6 A;  3LSX A;  2QMW A;  3C9H A;  4PQJ A;  4GF8 A;  2DVZ A;  3MW0 A;  3CVG A;  5M2V A;  5BWJ A;  5TPA B;  4C1T A;  5CM6 A;  3I5O A;  4NWC A;  4HW8 A;  4N6P A;  3OO6 A;  2REG A;  2Z22 A;  1ANF A;  5BUU A;  4R74 A;  4KCD A;  3M8U A;  4IY5 A;  3MVZ A;  1P1N A;  2DOJ A;  3U94 A;  3IJX B;  1US5 A;  5HM4 B;  1WDN A;  1P99 A;  3PPO A;  3IAZ A;  4AB6 A;  2UVG A;  4UA8 A;  3ONM A;  3EF7 A;  3V8X B;  1B5J A;  4F1V A;  2DQV A;  4F22 A;  1MG1 A;  3H6W A;  4FED A;  1L5T A;  2F36 A;  1B4Z A;  2XHD A;  4BDQ A;  2O7U A;  1I69 A;  3N6T A;  3DEL B;  3HHF A;  3FJ7 A;  3KBR A;  3GBB A;  3RT6 B;  4JBZ A;  1B9J A;  4NE4 A;  5I58 A;  2VHA A;  3RT8 A;  4R6Y A;  3VXC A;  3MZ1 A;  3FXR A;  3T22 A;  3TUS A;  2YLN A;  4MLV A;  3S9E A;  1S50 A;  3FXQ A;  3RQT A;  4X1D A;  3MJN A;  1HSE A;  2X7Q A;  1XS5 A;  1US4 A;  1B6H A;  1B3L A;  1AH5 A;  3TTL A;  3TPA A;  2PVU A;  1OMP A;  3GZG A;  3B6Q A;  4E0X A;  3MVX A;  3LUY A;  3FVK A;  3W9V A;  2AL5 A;  3ILU B;  1ZKB A;  1N7W A;  2QS1 A;  3CFX A;  4EXK A;  5K2X A;  1IXC A;  3ODB A;  1QUI A;  3H3G A;  1A54 A;  3K6U A;  4OXV A;  3HHG A;  1EH3 A;  4O3B A;  3LSF B;  1FW0 A;  4GIZ A;  2P2A A;  2YJP A;  4Z0I A;  4EDP A;  1I6Q A;  3DM0 A;  5H8Q B;  1ZBM A;  4MFI A;  3OXN A;  4KHZ E;  4DE8 A;  4TQU Q;  3VLU A;  4GFR A;  3OOA A;  1I6A A;  5AA1 A;  1DTZ A;  4I1D A;  1DOT A;  1TWY A;  1URD A;  4R9G A;  4ELR A;  1IXH A;  2DE2 A;  2QS3 A;  3K4U A;  1DPP A;  3DP8 A;  5H8F B;  5K2Y A;  4RYA A;  2XXR A;  2B3F A;  2FNC A;  3EQ1 A;  3IB1 A;  2LAO A;  1PDA A;  3C36 A;  2DS9 A;  2R71 A;  2O84 X;  2QMX A;  3KZG A;  5AA4 B;  1LB8 A;  4LZ8 A;  3PPN A;  4GL0 A;  4R73 A;  1NH8 A;  1JEU A;  4MF3 A;  2HAU A;  4GL8 A;  3K1M A;  4IY6 A;  2ABH A;  3D4G A;  3MVW A;  3VLW A;  4LUB A;  1Y9U A;  3MC2 A;  4QSD A;  1H44 A;  2O1M A;  2Q89 A;  3BFT A;  3Q29 A;  1SD3 A;  1MRP A;  2UVI A;  2F34 A;  5TU0 A;  4ZE9 A;  2ANJ A;  3PUW E;  4IGR A;  3T93 B;  2D3I A;  1VE4 A;  3KOS A;  3IB2 A;  5DTB A;  1EZP A;  3V5A A;  3MP8 A;  4ZEC A;  2FA7 A;  4KR5 A;  2UVH A;  1HSL A;  4JXI A;  4QSE A;  1B51 A;  4KFQ A;  3BKI B;  4OFJ A;  2P0S A;  5H8S A;  1FTJ A;  3IOW A;  3Q28 A;  3SEX A;  1Z7M E;  3OO9 A;  3S9M C;  1B5H A;  2VOZ A;  4Z7E A;  1MQD A;  1SVX B;  4OYV A;  1QKA A;  1LST A;  3OEN A;  1A7L A;  2I3V A;  1SQY A;  3GLB A;  3OSR A;  1IXI A;  1SI0 A;  4NF5 B;  1LBC A;  4M1V A;  1MQJ A;  1PC3 A;  5CMK A;  4ELQ A;  4PFU A;  5LOM A;  3PD8 A;  4ECF A;  1B52 A;  3MVY A;  4KI0 E;  3FUZ A;  5AA2 B;  1RYX A;  2AL4 A;  4NF6 A;  4ELO A;  5L9S A;  4P11 A;  3VXB A;  4I9D A;  1Y20 A;  3IL1 B;  1SW2 A;  1H43 A;  1TXF A;  4PP0 A;  5A5X A;  3HPI A;  3FD3 A;  2ZNT A;  5ICT A;  3OMB A;  2Z8F A;  4FAJ A;  1FQB A;  4WXJ A;  4DCX A;  1JW1 A;  1S9T A;  3O97 A;  2I4B A;  1ZTY A;  1FCK A;  4GOT A;  4U1O A;  1SI1 A;  3KOT A;  1UTB A;  2AIX A;  4OET A;  3LC8 A;  1YPN A;  2RCB A;  5I2K A;  3ILT B;  3S4U A;  3A3C A;  4QFP A;  1WOD A;  2REJ A;  5H8N B;  1P1Q A;  4GXS B;  1B05 A;  4BDN A;  4EUO A;  4YKI A;  1LAF E;  4YKJ A;  3T9U A;  5JTY A;  3MZ9 A;  3HST A;  4F1U A;  3MAM A;  2H9B A;  4OMB A;  3BBR A;  1MDQ A;  1XVY A;  3CRB A;  3PMV A;  4KCC A;  2IEE A;  4KPT A;  1ATG A;  3B6T A;  4QF9 A;  4U1Z A;  2Z8E A;  4NF8 A;  4BDR A;  4HCY A;  2ONR A;  4HTG A;  3FV1 A;  3KSJ A;  4KYD A;  3TCG A;  4RJZ A;  2BJJ X;  3K6W A;  3FVG A;  4YKP A;  4MH5 A;  4OWD A;  1M5D A;  3E9X A;  3CIJ A;  4AB5 A;  4F3B A;  4R72 A;  3MWB A;  2Y7W A;  3TOD A;  1MXX A;  2DE4 A;  1B4H A;  1M5B A;  2UVJ A;  1P1W A;  3E13 X;  4POW A;  1FQE A;  2OWS A;  3RUM A;  3PUX E;  1Q35 A;  1Y3N A;  2ZXT A;  4YIC A;  4R6K A;  1LAG E;  4F2Q A;  1NNK A;  1MY3 A;  2AYS A;  2XXH A;  4OER A;  2VD2 A;  3T9H B;  5TPA A;  4QFK A;  5CMM A;  4X1B A;  1UIV A;  1ZJL A;  3KN8 A;  4WEP A;  1SW1 A;  4AQ4 A;  1Z7N E;  3OD7 A;  1TT1 A;  3S9L C;  3Q27 A;  3OEK A;  1S7Y A;  4N07 A;  2PMS A;  1MPD A;  3F11 A;  3PPQ A;  2RIN A;  4ZZE A;  1N0T A;  3U8Q A;  1LCF A;  5KCJ B;  3KN3 A;  4IO4 A;  3TTM A;  2CZL A;  4G2Z A;  1OVB A;  1H45 A;  3CFZ A;  3K01 A;  2NXO A;  3ZSF A;  5I84 A;  2XXP A;  4WED A;  3R7X A;  4NF4 B;  2DP8 A;  2DWI A;  4GXA A;  1D4N A;  1B2H A;  2F6P A;  1CE2 A;  4H67 A;  1EZ9 A;  3W15 C;  3DP4 A;  3PGF A;  2ZNS A;  4F2O A;  4POX A;  3C32 A;  1XHY A;  1NNT A;  1DPE A;  1VR5 A;  1A55 A;  1IXG A;  3A09 A;  3M3F A;  1POT A;  4QFO A;  5HBC A;  4LZ7 A;  2RC9 A;  3H6V A;  1M5E A;  1KWH A;  2HZL A;  3K6V A;  3SES A;  4H5F A;  3SDF A;  5DEX A;  2XXW A;  5J1D A;  1MPC A;  2A5T B;  4GVO A;  1D9V A;  2ZYK A;  3TAJ A;  3JV9 A;  4NED A;  4HS7 A;  1A40 A;  1FQF A;  4GQO A;  1FQA A;  4XKN A;  2Q88 A;  2B3B A;  3PUY E;  2HEU A;  3FV2 A;  5HPQ A;  1D3K A;  3PUV E;  4JSO A;  3CG1 A;  3K00 A;  2W7Y A;  4Q8R A;  4BDO A;  2PYY A;  4KQP A;  5B7D A;  4R2F A;  3G7W A;  3OO8 A;  1PB8 A;  4LQ5 A;  2GHB A;  2B65 A;  5H8Q A;  4ZED A;  4TLL B;  3VVF A;  3T9V A;  5I57 A;  4DLD A;  3R6U A;  2D5W A;  4ND9 A;  5CBS A;  1Y3Q A;  2ALU A;  4H8J A;  2QRY A;  3R26 A;  4P0G A;  3PV0 E;  2DXR A;  1B0H A;  3G3F A;  4LON B;  4QFN A;  3DP6 A;  1P1O A;  4H65 A;  5H8F A;  3FIR A;  2OZZ A;  1ELJ A;  4HCW A;  5ICQ A;  4XIG Q;  1GV8 A;  1EU8 A;  4R75 A;  2NUV A;  3QK6 A;  3UK4 A;  1AMF A;  5AA4 A;  1IQ7 A;  4BDL A;  1OQH A;  1QUL A;  3V89 B;  3IOT A;  5B70 A;  3HO7 A;  1IEJ A;  1NH7 A;  1MY1 A;  1SW5 A;  1Y4T A;  4OEN A;  4YB7 A;  3IB0 A;  4OHN A;  2DWH A;  4LZ5 A;  3JZJ A;  4I62 A;  3H4Z A;  3OSQ A;  1UQW A;  2O1L A;  1MXW A;  4IO7 A;  2O51 A;  3C4M A;  4G68 A;  3WAF A;  4RPN A;  1SW4 A;  5I59 B;  2NWJ A;  3H6T A;  2V3U A;  4U2R A;  1GGG A;  2Y84 A;  1PBQ A;  4R2B A;  3H7M A;  3S2V A;  2Q8J A;  4K3F A;  1NNP A;  3K6X A;  4QFL A;  1N7X A;  5AA2 D;  4JSD A;  2DE3 A;  1LAH E;  5I56 B;  5KDT A;  3DLN A;  3K1N A;  4LP2 B;  4ZEF A;  4GD5 A;  1B3H A;  3FZV A;  2ZYM A;  3EN3 A;  2F6G A;  4JB7 A;  2RF1 A;  4DDD A;  1URS A;  4H8I A;  4NF5 A;  4IO3 A;  2Q2A A;  2ZYN A;  4R9F A;  1N76 A;  1USY H;  3KJT A;  3UIF A;  1MDP 1;  2Q2C A;  3IJO B;  4G4P A;  3CFL A;  5AA2 A;  4IGT A;  3MP1 A;  1N04 A;  4EQB A;  3CI8 A;  3G3G A;  5CMC A;  5AE4 A;  4P0I A;  1MXY A;  3TFL A;  2H98 A;  2F7B A;  2V93 A;  4U4X A;  4FAT A;  3RLF E;  3PMX A;  1JW4 A;  1M5C A;  1VSO A;  1N84 A;  1XT8 A;  2X26 A;  3L6H A;  2O7I A;  3VDF A;  1LLS A;  1LAX A;  4EQ9 A;  4G8M A;  3MZB A;  1HSJ A;  1A8E A;  3K0V A;  1XC1 A;  3SEW A;  2R6G E;  4UAC A;  4LVQ A;  1PB9 A;  3KSX A;  1H3D A;  5CC2 A;  2NVU B;  3D4C A;  4JWX A;  3RTW B;  2HZK A;  3RGY A;  1SBP A;  1H76 A;  3RPW A;  4X48 A;  2I6E A;  2I48 A;  4M4G A;  1UTH B;  4YKK A;  2V3T A;  1R9L A;  3W9W A;  1SYH A;  2V25 A;  5DVI A;  2WKY A;  4QSC A;  3O6I A;  2GFE A;  2Y7R A;  1OQG A;  4ZZA A;  1RYO A;  1N3X A;  5I2N B;  2ESN A;  4U22 A;  2FYI A;  3SEV A;  4F3S A;  2G29 A;  4YU0 A;  2Y7I A;  4RNS A;  3A3U A;  1Y1M A;  3TYH A;  4QHQ A;  3RY3 A;  1GR2 A;  2Y7P A;  1FTL A;  1USY E;  3BFU A;  3SER A;  1A99 A;  3O6H A;  3O29 A;  3USD A;  1XVX A;  5KZT A;  2M8C A;  2OK2 A;  4KD5 A;  3CSB A;  3TTK A;  4XTC Q;  4F39 A;  1URG A;  4OQO A;  4H6D A;  3SET A;  1JQF A;  3TMG A;  3IOV A;  4NWD A;  4RPO A;  4JDF A;  1OLA A;  5JK4 A;  4DZ1 A;  1UTB B;  4FEC A;  1MH4 A;  1Y3P A;  2XX7 A;  5ELV A;  4G8N A;  5F7V A;  3WAE A;  3UN6 A;  4OFO A;  1B7Z A;  2ZMB A;  1BIY A;  3U92 A;  2HCA A;  2OBG A;  4GWO A;  3RTF B;  4F19 A;  4LA9 A;  4ZEK A;  4OZ9 A;  1BP5 A;  4IB2 A;  1M5F A;  1AL3 A;  2UXA A;  1PBP A;  4EF1 A;  1IZ1 A;  2QL3 A;  3T9X B;  3TTN A;  2F7C A;  1ZMG A;  1B32 A;  3G3K A;  4Q5T A;  5DVJ A;  3FJG A;  4F31 B;  4ELP A;  4DCY A;  1SYI A;  5H8H B;  2NOO A;  1I6B A;  2Y7K A;  1YTV A;  2RCA A;  3VVD A;  2IA4 A;  1FTK A;  3CSG A;  4PFW A;  4OFL A;  1LFI A;  3UOR A;  1FQD A;  4R6H A;  1T0K A;  2O6A A;  1AIV A;  3ECR A;  3E3K A;  3H03 A;  1GVC A;  1JNF A;  3FGS A;  1QKB A;  1B7H A;  2QSX A;  3TKD A;  1DTG A;  1LBB A;  5L9O A;  3MPK A;  2DWA A;  1IIW A;  2DXY A;  2H4I A;  2O68 A;  5TP9 B;  3N6U A;  1Y4C A;  1MQH A;  5CI5 A;  4ZDM A;  2XXT A;  3RNN A;  2PX1 A;  4H0W A;  3MBP A;  3TCF A;  1NFT A;  2F78 A;  3EHS A;  3U1O A;  2A5S A;  4XKQ A;  2XXY A;  2Q9T A;  2QJE A;  2G93 A;  4YB5 A;  2A5T A;  2I4C A;  3C35 A;  3OEL A;  5FTH A;  2XXI A;  3OEM A;  4U23 A;  5FHO A;  4PET A;  3LSL A;  4BDM A;  4ISU A;  4LQ2 A;  4XKP A;  4RA1 A;  4F29 A;  4BLA A;  2ONK E;  3KJ7 A;  1B1X A;  3TTR A;  1JW5 A;  3VE1 B;  1O64 A;  3PD9 A;  1B40 A;  1MXU A;  5FTI A;  3FXU A;  4EXL A;  2UYF A;  3FJM A;  2UYE A;  3O9P A;  4YMA A;  1NL5 A;  2E0S A;  3EPE A;  3I6V A;  1MY2 A;  1QUJ A;  2D21 A;  2GHA A;  4F3P A;  3C33 A;  1MM7 A;  3IO6 A;  2XXU A;  2PBW A;  4E0W A;  1B0L A;  4LAT A;  3THI A;  3LBS A;  4FJP A;  1IIT A;  4YAH X;  3SEU A;  4ESX A;  1BTJ A;  1MM6 A;  4G8H A;  3SKP A;  2OWT A;  2GH9 A;  2H5Y A;  2Z23 A;  5DEX B;  3LSW A;  1A8F A;  2I49 A;  3O66 A;  1Y1Z A;  1NNF A;  5I58 B;  2DSF A;  3QUJ A;  5JEI A;  5FHN A;  4RK2 A;  4H1X A;  4IO5 A;  1MPB A;  3FVN A;  4OTE A;  3O28 A;  4Q30 B;  2YPN A;  3HCQ A;  4RXL A;  3IOU A;  4G77 A;  5EHS A;  1ZIU A;  4FEB A;  3T96 B;  3H6U A;  3G3J A;  3C31 A;  3KEI A;  1YCJ A;  2GRV A;  1O63 A;  1LFG A;  3B6W A;  4Q0C A;  1MS7 A;  1CB6 A;  4G68 C;  3L6G A;  4U4S A;  2OJT A;  3VFJ A;  5I57 B;  5I59 A;  3H06 B;  1FTM A;  4XXU A;  3GBA A;  1OIB A;  1P1U A;  4MBP A;  3UA8 A;  3CR9 A;  4OEU A;  2XD2 A;  3PPP A;  4U21 A;  5CRY A;  3G3I A;  3AXF A;  1MY0 A;  1JET A;  4NTL A;  1VFE A;  4FIM A;  5F1Q A;  1B1H A;  2XXV A;  3UP9 A;  1OVT A;  1BLF A;  1MQG A;  4F1Y A;  2F97 A;  5I56 A;  4NMY A;  1TFD A;  1POY 1;  2I58 A;  4GRK A;  3SEY A;  3RN8 A;  4MLQ A;  3IX1 A;  1ZLQ A;  5CMB A;  1O7T A;  2RKM A;  1QW0 A; 
#chains in the Genus database with same CATH topology
 2QFL A;  4YZZ A;  3E4R A;  4DXU A;  1MXZ A;  4EF2 A;  1GTK A;  4F3G A;  2V3Q A;  3TEL A;  2OLB A;  3K02 A;  4TOZ A;  4JWO A;  1B7U A;  3JYR A;  4WKM A;  4EQ7 A;  2RC7 A;  1DMB A;  1ZU0 A;  2Y5L A;  4DXC A;  3M3K A;  4TLM B;  3QIM A;  1QVS A;  2QS2 A;  2P1S A;  3U72 A;  3EHU A;  4QRZ A;  4PFY A;  1LB9 A;  1FPD A;  4ONY A;  5ISU A;  4GLI A;  4G68 B;  2H25 A;  2O69 A;  5ET8 A;  4ZE8 A;  3ZKK A;  3Q26 A;  3TQW A;  4YMB A;  4O3C A;  2QS4 A;  3MQ9 A;  3C34 A;  4PE5 B;  3MP6 A;  5EHM A;  3TDJ A;  5ITP A;  3GXA A;  3TEP A;  1B3G A;  4ZEB A;  3VLV A;  5IAI A;  1FPF A;  2F35 A;  1KA1 A;  1DSN A;  3A29 A;  3V83 A;  3IR1 A;  2ONS A;  1VFD A;  2XXX A;  5KDT B;  1LGB C;  1N3W A;  1TFA A;  3CG3 A;  2FVZ A;  2I0C A;  4X9T A;  2H99 A;  3RYD A;  1MXV A;  1D9Y A;  3N26 A;  1UTH A;  3HFU A;  3QSL A;  3S9N C;  2V84 A;  3VVE A;  2VP1 A;  1MY4 A;  4RY1 A;  3HV1 A;  3FVO A;  3QMF A;  1IMB A;  1SDX A;  5I2N A;  1II5 A;  2Q8M A;  5H8N A;  3KN7 A;  1B58 A;  4P8B A;  1B3E A;  4OES A;  3IOR A;  1XOC A;  1R1N A;  3G3H A;  2XX9 A;  1JEV A;  2CEX A;  1RDY A;  5AA3 A;  1FTO A;  2F8D A;  3QUF A;  5IKB A;  2HQ0 A;  2VT5 A;  3ROJ A;  1RKM A;  3K1P A;  4XF5 A;  2PT2 A;  2RC8 A;  5CBR A;  1EZO A;  3TQL A;  4ESW A;  3LR1 A;  1D9Q A;  4O3A A;  4NF6 B;  3Q25 A;  2X7P A;  1NKX A;  5EYF A;  1G0H A;  1YZ0 A;  5IZ1 A;  4XKR A;  3HN0 A;  4THI A;  3QXM A;  2HAV A;  3OO7 A;  2DWJ A;  5A5X B;  3PU5 A;  5L9M A;  5L8D A;  3M3L A;  1Q1K A;  3UGW A;  3IK6 B;  4PDD A;  1IUD A;  4PFT A;  3MUQ A;  2HFB A;  2FIX A;  1LCT A;  5IGA A;  4P1E A;  3EHT A;  5DYH A;  2XXQ A;  4OVJ A;  2DYX A;  4FOR A;  2OCU A;  4RK9 A;  1BKA A;  1PEB A;  2CMO A;  1BK4 A;  3KFM A;  4H5G A;  4OEV A;  1QJM A;  4PF8 A;  3PMW A;  5DVF A;  1F9B A;  2HXW A;  3FAT A;  3P7I A;  2ZNU A;  5I2K B;  5DT6 A;  1JVY A;  2QPQ A;  4DIG A;  1B5I A;  3KG2 A;  2F3D A;  1B3F A;  1R9Q A;  3LUZ A;  2VD3 A;  3ZKL A;  3N94 A;  1IMD A;  3VV5 A;  5H8H A;  1EYI A;  2THI A;  1MH3 A;  2VGQ A;  4PGN A;  1B46 A;  4ZS9 A;  2XX8 A;  1DCU A;  3TCH A;  1OLC A;  5JTY B;  3QAX A;  4FE8 A;  2KLF A;  1YAE A;  1UIU A;  3O6G A;  3MST A;  3ZS6 A;  4F18 A;  3QYT A;  4IO2 A;  4MHF A;  3O2A A;  2PT1 A;  4IO6 A;  1WVJ A;  4NF8 B;  1FQC A;  4NAP A;  2Z8D A;  5KCJ A;  3BIG A;  1QUK A;  3K2D A;  1NMU A;  3U93 A;  1AOV A;  1PB7 A;  2I3W A;  3N5L A;  2I0B A;  5TP9 A;  4C0R A;  4C1U A;  2R9J A;  2XD3 A;  3T66 A;  1MQI A;  4MMP A;  4NF4 A;  2OWZ A;  4N13 A;  4L17 A;  3I3V A;  2PFZ A;  1R6Z A;  3IO4 A;  3KGC A;  3PPR A;  1LFH A;  1JVX A;  4N17 A;  3MPL A;  2DVC A;  1XI6 A;  4KYS A;  5FHM A;  4I8C A;  3TZA A;  4JWY A;  5ITO A;  3B7D A;  3PUZ E;  5LTC A;  4KYE A;  2F5X A;  2ZYO A;  1J1N A;  4DXB A;  2F7A A;  4GBW A;  3FAS A;  4ZEI A;  2E1S A;  4YB6 A;  3LSX A;  2QMW A;  3C9H A;  4N15 A;  4PQJ A;  4GF8 A;  2DVZ A;  3MW0 A;  3CVG A;  5M2V A;  5BWJ A;  5TPA B;  4C1T A;  5CM6 A;  3I5O A;  4PE3 A;  4NWC A;  4GWZ A;  4O7M A;  4HW8 A;  4N6P A;  3OO6 A;  2REG A;  2Z22 A;  1ANF A;  1NV5 A;  5BUU A;  4R74 A;  4KCD A;  3M8U A;  4IY5 A;  3MVZ A;  1P1N A;  2DOJ A;  3U94 A;  5I7I A;  3IJX B;  1US5 A;  5HM4 B;  4HE1 A;  1WDN A;  1P99 A;  3PPO A;  3IAZ A;  4AB6 A;  2UVG A;  4UA8 A;  3ONM A;  4P3L A;  3EF7 A;  3V8X B;  4GWS A;  1IME A;  1B5J A;  4F1V A;  2DQV A;  4OVT A;  4F22 A;  1MG1 A;  3H6W A;  4FED A;  4MEV A;  1L5T A;  2F36 A;  4N8Y A;  4JVI A;  2WYP A;  1B4Z A;  2XHD A;  4BDQ A;  2O7U A;  4X8R A;  1I69 A;  1NV2 A;  3N6T A;  3DEL B;  3HHF A;  3FJ7 A;  4OA4 A;  3KBR A;  3GBB A;  3RT6 B;  4JBZ A;  1B9J A;  4NE4 A;  5I58 A;  2VHA A;  4GWY A;  3RT8 A;  4R6Y A;  3VXC A;  3MZ1 A;  3FXR A;  4DI3 D;  3T22 A;  3TUS A;  3BIH A;  2YLN A;  4MLV A;  3S9E A;  1S50 A;  3FXQ A;  3RQT A;  4X1D A;  3MJN A;  1HSE A;  4N81 A;  2X7Q A;  1XS5 A;  4HE0 A;  1US4 A;  1B6H A;  4XEQ A;  1B3L A;  1AH5 A;  5DW8 A;  4N6D A;  4OVQ A;  3TTL A;  3TPA A;  2PVU A;  1OMP A;  3GZG A;  3B6Q A;  4E0X A;  3MVX A;  3LUY A;  3FVK A;  3W9V A;  2AL5 A;  3B8B A;  3ILU B;  1ZKB A;  1N7W A;  2QS1 A;  3CFX A;  4EXK A;  2R8T A;  5K2X A;  1IXC A;  3ODB A;  1QUI A;  3H3G A;  4H46 A;  1A54 A;  3K6U A;  4OXV A;  3HHG A;  1EH3 A;  4O3B A;  3LSF B;  1FW0 A;  4GIZ A;  1K9Y A;  2P2A A;  2YJP A;  4Z0I A;  4EDP A;  1I6Q A;  3LV0 A;  3DM0 A;  5H8Q B;  5J16 A;  1IMC A;  2V4C A;  1ZBM A;  1KZ8 A;  4MFI A;  3OXN A;  4KHZ E;  4PAI A;  4DE8 A;  4TQU Q;  3VLU A;  4GX4 A;  4GFR A;  3OOA A;  1I6A A;  2WBB A;  5AA1 A;  1DTZ A;  5I5P A;  3IFC A;  4H45 A;  4I1D A;  1DOT A;  1TWY A;  1URD A;  4R9G A;  4ELR A;  1IXH A;  2DE2 A;  2QS3 A;  2XWV A;  3K4U A;  1DPP A;  3B50 A;  4PAK A;  1YXI A;  3DP8 A;  5H8F B;  5K2Y A;  2ZZV A;  4RYA A;  2XXR A;  2B3F A;  1FRP A;  2FNC A;  3EQ1 A;  3IB1 A;  2LAO A;  4JVD A;  1PDA A;  3C36 A;  4PAF A;  2DS9 A;  2R71 A;  1NI9 A;  2O84 X;  2QMX A;  1LEV A;  1NV0 A;  3KZG A;  5AA4 B;  1LB8 A;  4LZ8 A;  3PPN A;  4GL0 A;  4R73 A;  1NH8 A;  1JEU A;  1NV7 A;  4MF3 A;  3E78 A;  2HAU A;  2VPN A;  4GL8 A;  3K1M A;  4IY6 A;  3KBZ A;  2ABH A;  3D4G A;  3MVW A;  3VLW A;  4LUB A;  1Y9U A;  3MC2 A;  2FIE A;  4QSD A;  1H44 A;  2O1M A;  2Q89 A;  3BFT A;  2KR0 A;  3Q29 A;  4I40 A;  1SD3 A;  1MRP A;  2UVI A;  2F34 A;  5TU0 A;  4ZE9 A;  2ANJ A;  3PUW E;  4IGR A;  3T93 B;  2D3I A;  1INP A;  1VE4 A;  3KOS A;  1DK4 A;  3IB2 A;  1IMF A;  2FBP A;  5DTB A;  1EZP A;  3V5A A;  3MP8 A;  4ZEC A;  2FA7 A;  4KR5 A;  2UVH A;  1HSL A;  4JXI A;  4QSE A;  1B51 A;  3MYU A;  4KFQ A;  3BKI B;  4OFJ A;  2P0S A;  5H8S A;  3FBP A;  1FTJ A;  3IOW A;  3KC1 A;  3Q28 A;  3SEX A;  1Z7M E;  3OO9 A;  3S9M C;  1B5H A;  2VOZ A;  4Z7E A;  1MQD A;  3T1B A;  1SVX B;  5IZ3 A;  4OYV A;  1QKA A;  1LST A;  3OEN A;  1A7L A;  4XFE A;  2I3V A;  1SQY A;  3GLB A;  3OSR A;  1IXI A;  4NHB A;  1SI0 A;  4NF5 B;  1LBC A;  1FBG A;  4M1V A;  1MQJ A;  1PC3 A;  5CMK A;  4ELQ A;  4PFU A;  5LOM A;  3PD8 A;  4ECF A;  4PF6 A;  1B52 A;  3MVY A;  4KI0 E;  3FUZ A;  1RYX A;  2AL4 A;  4ELO A;  4NF6 A;  5AA2 B;  5L9S A;  4P11 A;  5IM2 A;  3VXB A;  4I9D A;  1Y20 A;  3IL1 B;  1SW2 A;  1H43 A;  2KQZ A;  4NF0 A;  1TXF A;  4PP0 A;  5A5X A;  3HPI A;  3FD3 A;  2ZNT A;  5ICT A;  3OMB A;  2Z8F A;  4FAJ A;  1FPE A;  1FQB A;  4WXJ A;  4DCX A;  1JW1 A;  1S9T A;  3O97 A;  2I4B A;  1ZTY A;  4MIJ A;  1FCK A;  4GOT A;  4U1O A;  1SI1 A;  3KOT A;  1UTB A;  2AIX A;  4OET A;  3LC8 A;  1YPN A;  2RCB A;  5I2K A;  3ILT B;  3S4U A;  3A3C A;  4QFP A;  1WOD A;  2REJ A;  5H8N B;  1P1Q A;  2ZZW A;  4GXS B;  1B05 A;  4GX3 A;  4BDN A;  4GWX A;  4EUO A;  4YKI A;  1LAF E;  4YKJ A;  1JP4 A;  3T9U A;  5JTY A;  3MZ9 A;  3HST A;  4F1U A;  3MAM A;  2H9B A;  4OMB A;  3BBR A;  1MDQ A;  4JVC A;  3NOH A;  1FBF A;  1XVY A;  3CRB A;  3PMV A;  4KCC A;  2IEE A;  1YYZ A;  4KPT A;  1ATG A;  3B6T A;  4QF9 A;  4U1Z A;  2Z8E A;  4NF8 A;  4BDR A;  4HCY A;  2ONR A;  1FBH A;  4OVR A;  4HTG A;  3FV1 A;  3KSJ A;  4KYD A;  3TCG A;  4RJZ A;  2BJJ X;  3K6W A;  3FVG A;  4YKP A;  4MH5 A;  4OWD A;  1M5D A;  3E9X A;  4PTK A;  3CIJ A;  4AB5 A;  4PDH A;  4F3B A;  4R72 A;  3MWB A;  2Y7W A;  4UAB A;  3TOD A;  1NV3 A;  1MXX A;  2DE4 A;  1B4H A;  1M5B A;  2UVJ A;  1P1W A;  4AS5 A;  3E13 X;  4POW A;  1FQE A;  2OWS A;  3RUM A;  3PUX E;  1Q35 A;  1Y3N A;  2ZXT A;  4YIC A;  4R6K A;  1LAG E;  2CZI A;  4F2Q A;  1NNK A;  1MY3 A;  2AYS A;  4I3Y A;  2XXH A;  4OER A;  1DBZ A;  2VD2 A;  3T9H B;  5TPA A;  4QFK A;  5CMM A;  4X1B A;  1UIV A;  4NGU A;  1ZJL A;  3KN8 A;  4OVP A;  4WEP A;  1NUW A;  1SW1 A;  4AQ4 A;  2JJK A;  1Z7N E;  3OD7 A;  1TT1 A;  2XWO A;  3S9L C;  1Q9D A;  2XWI A;  2ZZX A;  3Q27 A;  3OEK A;  1S7Y A;  2WBD A;  4N07 A;  2PMS A;  4O94 A;  1MPD A;  3F11 A;  3PPQ A;  2RIN A;  4ZZE A;  1N0T A;  3U8Q A;  1LCF A;  5KCJ B;  1FBC A;  3KN3 A;  4IO4 A;  3TTM A;  2CZL A;  4G2Z A;  1OVB A;  1H45 A;  3CFZ A;  3K01 A;  2NXO A;  1NV1 A;  3ZSF A;  5I84 A;  4N91 A;  4PBH A;  2XXP A;  1FBE A;  4WED A;  3R7X A;  4NF4 B;  2DP8 A;  2DWI A;  4GXA A;  4MAG A;  1D4N A;  1B2H A;  2F6P A;  1CE2 A;  1NV4 A;  4H67 A;  1EZ9 A;  3W15 C;  3DP4 A;  3PGF A;  2ZNS A;  4F2O A;  4POX A;  3C32 A;  1XHY A;  1NNT A;  1DPE A;  1VR5 A;  1A55 A;  1IXG A;  4QXD A;  3A09 A;  3M3F A;  1POT A;  4QFO A;  5HBC A;  4LZ7 A;  2QVU A;  2RC9 A;  3H6V A;  1M5E A;  1KWH A;  2HZL A;  3K6V A;  5ESY A;  3SES A;  4PGP A;  4H5F A;  3SDF A;  1SPI A;  1LBV A;  5DEX A;  2XXW A;  1FBP A;  5J1D A;  1MPC A;  4GBV A;  2A5T B;  2QVR A;  4GWW A;  4GVO A;  1D9V A;  2ZYK A;  3TAJ A;  3JV9 A;  4NED A;  5EYG A;  4HS7 A;  1IMA A;  1A40 A;  1FQF A;  4GQO A;  4NQ8 A;  1FQA A;  4XKN A;  2Q88 A;  2B3B A;  4N6K A;  3PUY E;  2HEU A;  3FV2 A;  4QBA A;  4PFI A;  5HPQ A;  1D3K A;  2WEF A;  3PUV E;  4JSO A;  3CG1 A;  5LDZ A;  3K00 A;  2W7Y A;  4Q8R A;  4BDO A;  3PTY A;  2PYY A;  4KQP A;  5B7D A;  4R2F A;  3G7W A;  1RDX A;  3OO8 A;  1PB8 A;  4LQ5 A;  2GHB A;  2B65 A;  5H8Q A;  5F24 A;  4ZED A;  4TLL B;  3VVF A;  2FHY A;  3T9V A;  5I57 A;  4DLD A;  3R6U A;  2D5W A;  4ND9 A;  5EQ7 A;  5CBS A;  2MKZ A;  3CHG A;  1Y3Q A;  2ALU A;  4H8J A;  2QRY A;  3R26 A;  4P0G A;  1FPI A;  3PV0 E;  4HXV A;  2DXR A;  1B0H A;  3G3F A;  4LON B;  4QFN A;  3DP6 A;  1P1O A;  4H65 A;  5H8F A;  3FIR A;  2OZZ A;  4PFR A;  1ELJ A;  4HCW A;  5ICQ A;  4XIG Q;  1GV8 A;  1EU8 A;  4R75 A;  2NUV A;  3QK6 A;  5EQ8 A;  3UK4 A;  1AMF A;  5AA4 A;  1IQ7 A;  4I3E A;  4BDL A;  3SZP A;  1OQH A;  1QUL A;  3V89 B;  4O8M A;  4MX6 A;  3IOT A;  5B70 A;  2WX9 A;  3HO7 A;  4PC9 A;  1IEJ A;  1NH7 A;  1MY1 A;  1SW5 A;  1Y4T A;  4OEN A;  1QGX A;  4YB7 A;  3IB0 A;  4OHN A;  2DWH A;  1FPK A;  4LZ5 A;  3JZJ A;  4I62 A;  4PCD A;  3H4Z A;  3OSQ A;  5EQ9 A;  1UQW A;  2O1L A;  1MXW A;  4IO7 A;  2O51 A;  3C4M A;  4G68 A;  3WAF A;  4RPN A;  1VDW A;  3RPL B;  1SW4 A;  5I59 B;  2NWJ A;  3H6T A;  2V3U A;  2L5V A;  4U2R A;  1GGG A;  4NX1 A;  3FXB A;  2Y84 A;  1PBQ A;  4G61 A;  4R2B A;  3H7M A;  3S2V A;  2Q8J A;  2Y5K A;  4K3F A;  1NNP A;  3K6X A;  4QFL A;  1N7X A;  5AA2 D;  4JSD A;  2DE3 A;  4PFB A;  1LAH E;  5I56 B;  5KDT A;  4AS4 A;  3DLN A;  3K1N A;  4LP2 B;  4ZEF A;  4GD5 A;  1B3H A;  3FZV A;  2ZYM A;  3EN3 A;  2F6G A;  4JB7 A;  2RF1 A;  4DDD A;  1URS A;  2PFY A;  4H8I A;  5ET6 A;  3GYY A;  4NF5 A;  4IO3 A;  2Q2A A;  2HXR A;  2ZYN A;  4R9F A;  1CNQ A;  1N76 A;  1USY H;  3KJT A;  3UIF A;  1MDP 1;  4IR8 A;  2Q2C A;  3IJO B;  4G4P A;  1NUZ A;  3CFL A;  4N8G A;  5AA2 A;  4IGT A;  3MP1 A;  1N04 A;  4NG7 A;  4EQB A;  3CI8 A;  1EYK A;  3G3G A;  5CMC A;  5AE4 A;  4P0I A;  4MCO A;  1G0I A;  1MXY A;  3TFL A;  2H98 A;  2F7B A;  2V93 A;  4U4X A;  4FAT A;  3RLF E;  2VPO A;  3PMX A;  1JW4 A;  1M5C A;  1VSO A;  1N84 A;  1XT8 A;  2X26 A;  3L6H A;  2O7I A;  3VDF A;  1LLS A;  1LAX A;  1NUY A;  4EQ9 A;  4G8M A;  3MZB A;  1HSJ A;  1A8E A;  3K0V A;  1XC1 A;  4HE2 A;  3SEW A;  2R6G E;  4UAC A;  4PBQ A;  4LVQ A;  1PB9 A;  2CEY A;  3KSX A;  1H3D A;  5CC2 A;  2NVU B;  3D4C A;  4JWX A;  3RTW B;  2HZK A;  3RGY A;  1SBP A;  1H76 A;  5IZ3 B;  3RPW A;  2XWK A;  4X48 A;  2I6E A;  2I48 A;  4M4G A;  1UTH B;  4P9K A;  4YKK A;  2V3T A;  1R9L A;  3W9W A;  1SYH A;  2V25 A;  5DVI A;  2WKY A;  4QSC A;  5EQA A;  3O6I A;  2GFE A;  2Y7R A;  4MNC A;  1OQG A;  4ZZA A;  1RYO A;  1N3X A;  5I2N B;  2ESN A;  4U22 A;  2FYI A;  3SEV A;  4F3S A;  2G29 A;  4YU0 A;  2Y7I A;  4RNS A;  3A3U A;  3D1R A;  1Y1M A;  3TYH A;  4QHQ A;  3RY3 A;  1GR2 A;  2Y7P A;  1FTL A;  1USY E;  3BFU A;  3SER A;  1A99 A;  3T0J A;  3O6H A;  3O29 A;  5IZZ A;  3USD A;  5FBP A;  1XVX A;  4GX6 A;  5KZT A;  1FPG A;  2CZK A;  1LBW A;  2M8C A;  2OK2 A;  4KD5 A;  3CSB A;  3TTK A;  3IFA A;  4XTC Q;  4F39 A;  1URG A;  4OQO A;  4H6D A;  3SET A;  1JQF A;  3TMG A;  3IOV A;  4NWD A;  4RPO A;  4JDF A;  1OLA A;  5JK4 A;  4DZ1 A;  1UTB B;  4FEC A;  1MH4 A;  1Y3P A;  2XX7 A;  5ELV A;  4G8N A;  5EYH A;  5F7V A;  3WAE A;  3UN6 A;  4OFO A;  5ET5 A;  1B7Z A;  4MNP A;  2ZMB A;  1BIY A;  3U92 A;  2HCA A;  2OBG A;  4OAN A;  4GWO A;  3RTF B;  4F19 A;  4LA9 A;  4O7I A;  4ZEK A;  4OZ9 A;  1BP5 A;  4IB2 A;  1M5F A;  1AL3 A;  2UXA A;  1PBP A;  4EF1 A;  1IZ1 A;  2QL3 A;  3T9X B;  1FPJ A;  4MNI A;  3TTN A;  5ET7 A;  2F7C A;  1ZMG A;  1B32 A;  3G3K A;  2P3V A;  1FJ6 A;  4Q5T A;  5DVJ A;  3FJG A;  4F31 B;  2BJI A;  4ELP A;  4DCY A;  4DI4 B;  1SYI A;  5H8H B;  2NOO A;  1I6B A;  2Y7K A;  1YTV A;  4NN3 A;  2RCA A;  3VVD A;  2IA4 A;  1FTK A;  2Q74 A;  3CSG A;  4PFW A;  4OFL A;  1LFI A;  3UOR A;  1FQD A;  1LBX A;  4R6H A;  2P3N A;  1T0K A;  1NV6 A;  2O6A A;  1AIV A;  3ECR A;  2DDK A;  1FPB A;  3E3K A;  3H03 A;  1FJ9 A;  1GVC A;  1JNF A;  3FGS A;  1QKB A;  1B7H A;  2QSX A;  3TKD A;  1DTG A;  1LBB A;  5L9O A;  3MPK A;  2DWA A;  1IIW A;  1EYJ A;  2DXY A;  2H4I A;  2O68 A;  5TP9 B;  3N6U A;  1Y4C A;  1MQH A;  5CI5 A;  4FBP A;  4ZDM A;  2XXT A;  1RDZ A;  3RNN A;  2PX1 A;  4H0W A;  3MBP A;  3TCF A;  1NFT A;  2F78 A;  3EHS A;  3U1O A;  2A5S A;  4XKQ A;  1FPL A;  2XXY A;  2Q9T A;  1K9Z A;  2QJE A;  2G93 A;  4YB5 A;  2A5T A;  2I4C A;  3C35 A;  3OEL A;  5FTH A;  2XXI A;  3OEM A;  4U23 A;  5FHO A;  4PET A;  2XXK A;  3LSL A;  1FBD A;  4BDM A;  4ISU A;  4LQ2 A;  4XKP A;  4RA1 A;  4F29 A;  4BLA A;  4P47 A;  2ONK E;  3KJ7 A;  1B1X A;  3TTR A;  1JW5 A;  3VE1 B;  1O64 A;  2PCR A;  3PD9 A;  1B40 A;  1LBY A;  1MXU A;  2QVV A;  5FTI A;  3FXU A;  4EXL A;  2UYF A;  3FJM A;  2UYE A;  2XA5 A;  3O9P A;  4YMA A;  1NL5 A;  2E0S A;  1FSA A;  3EPE A;  3E79 A;  3I6V A;  1MY2 A;  1QUJ A;  2D21 A;  2GHA A;  4GWU A;  4F3P A;  3C33 A;  1MM7 A;  3IO6 A;  1FTA A;  2XXU A;  2PBW A;  4E0W A;  1B0L A;  4LAT A;  3THI A;  2B4L A;  3LBS A;  4FJP A;  4P56 A;  1IIT A;  4YAH X;  3SEU A;  4ESX A;  1BTJ A;  1MM6 A;  4G8H A;  3SKP A;  2F3B A;  2OWT A;  2GH9 A;  2H5Y A;  2Z23 A;  5DEX B;  3LSW A;  1A8F A;  2I49 A;  3O66 A;  1Y1Z A;  1NNF A;  5I58 B;  2DSF A;  3QUJ A;  5JEI A;  5FHN A;  2HHM A;  4RK2 A;  4H1X A;  4IO5 A;  1MPB A;  1AWB A;  2HPG A;  3FVN A;  4OTE A;  3O28 A;  4Q30 B;  2YPN A;  3HCQ A;  4RXL A;  3IOU A;  4G77 A;  5EHS A;  1ZIU A;  4FEB A;  3T96 B;  4KXP A;  3H6U A;  4LN5 A;  3G3J A;  4OVS A;  3C31 A;  3KEI A;  1KA0 A;  4X04 A;  1YCJ A;  5A5L A;  2GRV A;  1O63 A;  1LFG A;  3B6W A;  4Q0C A;  1MS7 A;  1CB6 A;  4G68 C;  3L6G A;  4U4S A;  2OJT A;  3VFJ A;  3RPL A;  5I57 B;  5I59 A;  3H06 B;  1FTM A;  4XXU A;  3GBA A;  1OIB A;  4N4U A;  1P1U A;  2B4M A;  2WYK A;  4MBP A;  3UA8 A;  3CR9 A;  4OEU A;  1LBZ A;  2XD2 A;  3PPP A;  4U21 A;  5CRY A;  3G3I A;  3AXF A;  3ISP A;  1MY0 A;  1JET A;  4NTL A;  1VFE A;  4FIM A;  4P1L A;  5F1Q A;  3EKI A;  1B1H A;  2XXV A;  1NUX A;  3UP9 A;  1OVT A;  1BLF A;  1MQG A;  3KC0 A;  4F1Y A;  2F97 A;  5I56 A;  4NMY A;  1TFD A;  1POY 1;  2I58 A;  4GRK A;  4MJO A;  3SEY A;  3RN8 A;  4MLQ A;  5T3J A;  3IX1 A;  5I3S A;  1ZLQ A;  2CZH A;  5CMB A;  2GQ1 A;  1O7T A;  2OX3 A;  2RKM A;  1QW0 A;  3U65 A; 
#chains in the Genus database with same CATH homology
 4YZZ A;  3E4R A;  4DXU A;  1MXZ A;  4EF2 A;  1GTK A;  4F3G A;  2V3Q A;  3TEL A;  2OLB A;  3K02 A;  4TOZ A;  4JWO A;  1B7U A;  3JYR A;  4WKM A;  4EQ7 A;  2RC7 A;  1DMB A;  1ZU0 A;  4DXC A;  3M3K A;  4TLM B;  3QIM A;  1QVS A;  2QS2 A;  2P1S A;  3U72 A;  3EHU A;  4QRZ A;  4PFY A;  1LB9 A;  4ONY A;  5ISU A;  4GLI A;  4G68 B;  2H25 A;  2O69 A;  4ZE8 A;  3ZKK A;  3Q26 A;  3TQW A;  4YMB A;  4O3C A;  2QS4 A;  3MQ9 A;  3C34 A;  4PE5 B;  3MP6 A;  5EHM A;  3TDJ A;  5ITP A;  3GXA A;  3TEP A;  1B3G A;  4ZEB A;  3VLV A;  5IAI A;  2F35 A;  1DSN A;  3V83 A;  3IR1 A;  2ONS A;  1VFD A;  2XXX A;  5KDT B;  1LGB C;  1N3W A;  1TFA A;  3CG3 A;  2I0C A;  4X9T A;  2H99 A;  1MXV A;  1D9Y A;  3N26 A;  1UTH A;  3QSL A;  3S9N C;  2V84 A;  3VVE A;  2VP1 A;  1MY4 A;  4RY1 A;  3HV1 A;  3FVO A;  1SDX A;  5I2N A;  1II5 A;  5H8N A;  3KN7 A;  1B58 A;  1B3E A;  4OES A;  3IOR A;  1XOC A;  1R1N A;  3G3H A;  2XX9 A;  1JEV A;  5AA3 A;  1FTO A;  2F8D A;  3QUF A;  5IKB A;  2HQ0 A;  1RKM A;  3K1P A;  2PT2 A;  2RC8 A;  5CBR A;  1EZO A;  3TQL A;  4ESW A;  3LR1 A;  4O3A A;  4NF6 B;  3Q25 A;  2X7P A;  1NKX A;  5EYF A;  4XKR A;  3HN0 A;  4THI A;  3QXM A;  2HAV A;  3OO7 A;  2DWJ A;  5A5X B;  3PU5 A;  5L9M A;  5L8D A;  3M3L A;  3UGW A;  1Q1K A;  3IK6 B;  1IUD A;  4PFT A;  3MUQ A;  2HFB A;  1LCT A;  3EHT A;  5DYH A;  2XXQ A;  4OVJ A;  2DYX A;  4FOR A;  2OCU A;  4RK9 A;  1BKA A;  1PEB A;  2CMO A;  3KFM A;  4H5G A;  4OEV A;  1QJM A;  3PMW A;  5DVF A;  1F9B A;  2HXW A;  3FAT A;  3P7I A;  2ZNU A;  5I2K B;  5DT6 A;  1JVY A;  2QPQ A;  4DIG A;  1B5I A;  3KG2 A;  1B3F A;  1R9Q A;  2VD3 A;  3ZKL A;  3N94 A;  3VV5 A;  5H8H A;  2THI A;  1MH3 A;  2VGQ A;  1B46 A;  4ZS9 A;  2XX8 A;  3TCH A;  1OLC A;  5JTY B;  3QAX A;  4FE8 A;  2KLF A;  1YAE A;  1UIU A;  3O6G A;  3ZS6 A;  4F18 A;  3QYT A;  4IO2 A;  3O2A A;  2PT1 A;  4IO6 A;  1WVJ A;  4NF8 B;  1FQC A;  2Z8D A;  5KCJ A;  1QUK A;  3K2D A;  1NMU A;  3U93 A;  1AOV A;  1PB7 A;  2I3W A;  3N5L A;  2I0B A;  5TP9 A;  4C0R A;  4C1U A;  2R9J A;  2XD3 A;  3T66 A;  1MQI A;  4NF4 A;  4N13 A;  4L17 A;  3I3V A;  1R6Z A;  3IO4 A;  3KGC A;  3PPR A;  1LFH A;  1JVX A;  3MPL A;  2DVC A;  4KYS A;  5FHM A;  4I8C A;  3TZA A;  4JWY A;  5ITO A;  3B7D A;  3PUZ E;  4KYE A;  2F5X A;  2ZYO A;  1J1N A;  4DXB A;  2F7A A;  3FAS A;  4ZEI A;  2E1S A;  4YB6 A;  3LSX A;  2QMW A;  3C9H A;  4PQJ A;  4GF8 A;  2DVZ A;  3MW0 A;  3CVG A;  5M2V A;  5BWJ A;  5TPA B;  4C1T A;  5CM6 A;  3I5O A;  4NWC A;  4HW8 A;  4N6P A;  3OO6 A;  2REG A;  2Z22 A;  1ANF A;  5BUU A;  4R74 A;  4KCD A;  3M8U A;  4IY5 A;  3MVZ A;  1P1N A;  2DOJ A;  3U94 A;  3IJX B;  1US5 A;  5HM4 B;  1WDN A;  1P99 A;  3PPO A;  3IAZ A;  4AB6 A;  2UVG A;  4UA8 A;  3ONM A;  3EF7 A;  3V8X B;  1B5J A;  4F1V A;  2DQV A;  4F22 A;  1MG1 A;  3H6W A;  4FED A;  1L5T A;  2F36 A;  1B4Z A;  2XHD A;  4BDQ A;  2O7U A;  1I69 A;  3N6T A;  3DEL B;  3HHF A;  3FJ7 A;  3KBR A;  3GBB A;  3RT6 B;  4JBZ A;  1B9J A;  4NE4 A;  5I58 A;  2VHA A;  3RT8 A;  4R6Y A;  3VXC A;  3MZ1 A;  3FXR A;  3T22 A;  3TUS A;  2YLN A;  4MLV A;  3S9E A;  1S50 A;  3FXQ A;  3RQT A;  4X1D A;  3MJN A;  1HSE A;  2X7Q A;  1XS5 A;  1US4 A;  1B6H A;  1B3L A;  1AH5 A;  3TTL A;  3TPA A;  2PVU A;  1OMP A;  3GZG A;  3B6Q A;  4E0X A;  3MVX A;  3LUY A;  3FVK A;  3W9V A;  2AL5 A;  3ILU B;  1ZKB A;  1N7W A;  2QS1 A;  3CFX A;  4EXK A;  5K2X A;  1IXC A;  3ODB A;  1QUI A;  3H3G A;  1A54 A;  3K6U A;  4OXV A;  3HHG A;  1EH3 A;  4O3B A;  3LSF B;  1FW0 A;  4GIZ A;  2P2A A;  2YJP A;  4Z0I A;  4EDP A;  1I6Q A;  3DM0 A;  5H8Q B;  1ZBM A;  4MFI A;  3OXN A;  4KHZ E;  4DE8 A;  4TQU Q;  3VLU A;  4GFR A;  3OOA A;  1I6A A;  5AA1 A;  1DTZ A;  4I1D A;  1DOT A;  1TWY A;  1URD A;  4R9G A;  4ELR A;  1IXH A;  2DE2 A;  2QS3 A;  3K4U A;  1DPP A;  3DP8 A;  5H8F B;  5K2Y A;  4RYA A;  2XXR A;  2B3F A;  2FNC A;  3EQ1 A;  3IB1 A;  2LAO A;  1PDA A;  3C36 A;  2DS9 A;  2R71 A;  2O84 X;  2QMX A;  3KZG A;  5AA4 B;  1LB8 A;  4LZ8 A;  3PPN A;  4GL0 A;  4R73 A;  1NH8 A;  1JEU A;  4MF3 A;  2HAU A;  4GL8 A;  3K1M A;  4IY6 A;  2ABH A;  3D4G A;  3MVW A;  3VLW A;  4LUB A;  1Y9U A;  3MC2 A;  4QSD A;  1H44 A;  2O1M A;  2Q89 A;  3BFT A;  3Q29 A;  1SD3 A;  1MRP A;  2UVI A;  2F34 A;  5TU0 A;  4ZE9 A;  2ANJ A;  3PUW E;  4IGR A;  3T93 B;  2D3I A;  1VE4 A;  3KOS A;  3IB2 A;  5DTB A;  1EZP A;  3V5A A;  3MP8 A;  4ZEC A;  2FA7 A;  4KR5 A;  2UVH A;  1HSL A;  4JXI A;  4QSE A;  1B51 A;  4KFQ A;  3BKI B;  4OFJ A;  2P0S A;  5H8S A;  1FTJ A;  3IOW A;  3Q28 A;  3SEX A;  1Z7M E;  3OO9 A;  3S9M C;  1B5H A;  2VOZ A;  4Z7E A;  1MQD A;  1SVX B;  4OYV A;  1QKA A;  1LST A;  3OEN A;  1A7L A;  2I3V A;  1SQY A;  3GLB A;  3OSR A;  1IXI A;  1SI0 A;  4NF5 B;  1LBC A;  4M1V A;  1MQJ A;  1PC3 A;  5CMK A;  4ELQ A;  4PFU A;  5LOM A;  3PD8 A;  4ECF A;  1B52 A;  3MVY A;  4KI0 E;  3FUZ A;  5AA2 B;  1RYX A;  2AL4 A;  4NF6 A;  4ELO A;  5L9S A;  4P11 A;  3VXB A;  4I9D A;  1Y20 A;  3IL1 B;  1SW2 A;  1H43 A;  1TXF A;  4PP0 A;  5A5X A;  3HPI A;  3FD3 A;  2ZNT A;  5ICT A;  3OMB A;  2Z8F A;  4FAJ A;  1FQB A;  4WXJ A;  4DCX A;  1JW1 A;  1S9T A;  3O97 A;  2I4B A;  1ZTY A;  1FCK A;  4GOT A;  4U1O A;  1SI1 A;  3KOT A;  1UTB A;  2AIX A;  4OET A;  3LC8 A;  1YPN A;  2RCB A;  5I2K A;  3ILT B;  3S4U A;  3A3C A;  4QFP A;  1WOD A;  2REJ A;  5H8N B;  1P1Q A;  4GXS B;  1B05 A;  4BDN A;  4EUO A;  4YKI A;  1LAF E;  4YKJ A;  3T9U A;  5JTY A;  3MZ9 A;  3HST A;  4F1U A;  3MAM A;  2H9B A;  4OMB A;  3BBR A;  1MDQ A;  1XVY A;  3CRB A;  3PMV A;  4KCC A;  2IEE A;  4KPT A;  1ATG A;  3B6T A;  4QF9 A;  4U1Z A;  2Z8E A;  4NF8 A;  4BDR A;  4HCY A;  2ONR A;  4HTG A;  3FV1 A;  3KSJ A;  4KYD A;  3TCG A;  4RJZ A;  2BJJ X;  3K6W A;  3FVG A;  4YKP A;  4MH5 A;  4OWD A;  1M5D A;  3E9X A;  3CIJ A;  4AB5 A;  4F3B A;  4R72 A;  3MWB A;  2Y7W A;  3TOD A;  1MXX A;  2DE4 A;  1B4H A;  1M5B A;  2UVJ A;  1P1W A;  3E13 X;  4POW A;  1FQE A;  2OWS A;  3RUM A;  3PUX E;  1Q35 A;  1Y3N A;  2ZXT A;  4YIC A;  4R6K A;  1LAG E;  4F2Q A;  1NNK A;  1MY3 A;  2AYS A;  2XXH A;  4OER A;  2VD2 A;  3T9H B;  5TPA A;  4QFK A;  5CMM A;  4X1B A;  1UIV A;  1ZJL A;  3KN8 A;  4WEP A;  1SW1 A;  4AQ4 A;  1Z7N E;  3OD7 A;  1TT1 A;  3S9L C;  3Q27 A;  3OEK A;  1S7Y A;  4N07 A;  2PMS A;  1MPD A;  3F11 A;  3PPQ A;  2RIN A;  4ZZE A;  1N0T A;  3U8Q A;  1LCF A;  5KCJ B;  3KN3 A;  4IO4 A;  3TTM A;  2CZL A;  4G2Z A;  1OVB A;  1H45 A;  3CFZ A;  3K01 A;  2NXO A;  3ZSF A;  5I84 A;  2XXP A;  4WED A;  3R7X A;  4NF4 B;  2DP8 A;  2DWI A;  4GXA A;  1D4N A;  1B2H A;  2F6P A;  1CE2 A;  4H67 A;  1EZ9 A;  3W15 C;  3DP4 A;  3PGF A;  2ZNS A;  4F2O A;  4POX A;  3C32 A;  1XHY A;  1NNT A;  1DPE A;  1VR5 A;  1A55 A;  1IXG A;  3A09 A;  3M3F A;  1POT A;  4QFO A;  5HBC A;  4LZ7 A;  2RC9 A;  3H6V A;  1M5E A;  1KWH A;  2HZL A;  3K6V A;  3SES A;  4H5F A;  3SDF A;  5DEX A;  2XXW A;  5J1D A;  1MPC A;  2A5T B;  4GVO A;  1D9V A;  2ZYK A;  3TAJ A;  3JV9 A;  4NED A;  4HS7 A;  1A40 A;  1FQF A;  4GQO A;  1FQA A;  4XKN A;  2Q88 A;  2B3B A;  3PUY E;  2HEU A;  3FV2 A;  5HPQ A;  1D3K A;  3PUV E;  4JSO A;  3CG1 A;  3K00 A;  2W7Y A;  4Q8R A;  4BDO A;  2PYY A;  4KQP A;  5B7D A;  4R2F A;  3G7W A;  3OO8 A;  1PB8 A;  4LQ5 A;  2GHB A;  2B65 A;  5H8Q A;  4ZED A;  4TLL B;  3VVF A;  3T9V A;  5I57 A;  4DLD A;  3R6U A;  2D5W A;  4ND9 A;  5CBS A;  1Y3Q A;  2ALU A;  4H8J A;  2QRY A;  3R26 A;  4P0G A;  3PV0 E;  2DXR A;  1B0H A;  3G3F A;  4LON B;  4QFN A;  3DP6 A;  1P1O A;  4H65 A;  5H8F A;  3FIR A;  2OZZ A;  1ELJ A;  4HCW A;  5ICQ A;  4XIG Q;  1GV8 A;  1EU8 A;  4R75 A;  2NUV A;  3QK6 A;  3UK4 A;  1AMF A;  5AA4 A;  1IQ7 A;  4BDL A;  1OQH A;  1QUL A;  3V89 B;  3IOT A;  5B70 A;  3HO7 A;  1IEJ A;  1NH7 A;  1MY1 A;  1SW5 A;  1Y4T A;  4OEN A;  4YB7 A;  3IB0 A;  4OHN A;  2DWH A;  4LZ5 A;  3JZJ A;  4I62 A;  3H4Z A;  3OSQ A;  1UQW A;  2O1L A;  1MXW A;  4IO7 A;  2O51 A;  3C4M A;  4G68 A;  3WAF A;  4RPN A;  1SW4 A;  5I59 B;  2NWJ A;  3H6T A;  2V3U A;  4U2R A;  1GGG A;  2Y84 A;  1PBQ A;  4R2B A;  3H7M A;  3S2V A;  2Q8J A;  4K3F A;  1NNP A;  3K6X A;  4QFL A;  1N7X A;  5AA2 D;  4JSD A;  2DE3 A;  1LAH E;  5I56 B;  5KDT A;  3DLN A;  3K1N A;  4LP2 B;  4ZEF A;  4GD5 A;  1B3H A;  3FZV A;  2ZYM A;  3EN3 A;  2F6G A;  4JB7 A;  2RF1 A;  4DDD A;  1URS A;  4H8I A;  4NF5 A;  4IO3 A;  2Q2A A;  2ZYN A;  4R9F A;  1N76 A;  1USY H;  3KJT A;  3UIF A;  1MDP 1;  2Q2C A;  3IJO B;  4G4P A;  3CFL A;  5AA2 A;  4IGT A;  3MP1 A;  1N04 A;  4EQB A;  3CI8 A;  3G3G A;  5CMC A;  5AE4 A;  4P0I A;  1MXY A;  3TFL A;  2H98 A;  2F7B A;  2V93 A;  4U4X A;  4FAT A;  3RLF E;  3PMX A;  1JW4 A;  1M5C A;  1VSO A;  1N84 A;  1XT8 A;  2X26 A;  3L6H A;  2O7I A;  3VDF A;  1LLS A;  1LAX A;  4EQ9 A;  4G8M A;  3MZB A;  1HSJ A;  1A8E A;  3K0V A;  1XC1 A;  3SEW A;  2R6G E;  4UAC A;  4LVQ A;  1PB9 A;  3KSX A;  1H3D A;  5CC2 A;  2NVU B;  3D4C A;  4JWX A;  3RTW B;  2HZK A;  3RGY A;  1SBP A;  1H76 A;  3RPW A;  4X48 A;  2I6E A;  2I48 A;  4M4G A;  1UTH B;  4YKK A;  2V3T A;  1R9L A;  3W9W A;  1SYH A;  2V25 A;  5DVI A;  2WKY A;  4QSC A;  3O6I A;  2GFE A;  2Y7R A;  1OQG A;  4ZZA A;  1RYO A;  1N3X A;  5I2N B;  2ESN A;  4U22 A;  2FYI A;  3SEV A;  4F3S A;  2G29 A;  4YU0 A;  2Y7I A;  4RNS A;  3A3U A;  1Y1M A;  3TYH A;  4QHQ A;  3RY3 A;  1GR2 A;  2Y7P A;  1FTL A;  1USY E;  3BFU A;  3SER A;  1A99 A;  3O6H A;  3O29 A;  3USD A;  1XVX A;  5KZT A;  2M8C A;  2OK2 A;  4KD5 A;  3CSB A;  3TTK A;  4XTC Q;  4F39 A;  1URG A;  4OQO A;  4H6D A;  3SET A;  1JQF A;  3TMG A;  3IOV A;  4NWD A;  4RPO A;  4JDF A;  1OLA A;  5JK4 A;  4DZ1 A;  1UTB B;  4FEC A;  1MH4 A;  1Y3P A;  2XX7 A;  5ELV A;  4G8N A;  5F7V A;  3WAE A;  3UN6 A;  4OFO A;  1B7Z A;  2ZMB A;  1BIY A;  3U92 A;  2HCA A;  2OBG A;  4GWO A;  3RTF B;  4F19 A;  4LA9 A;  4ZEK A;  4OZ9 A;  1BP5 A;  4IB2 A;  1M5F A;  1AL3 A;  2UXA A;  1PBP A;  4EF1 A;  1IZ1 A;  2QL3 A;  3T9X B;  3TTN A;  2F7C A;  1ZMG A;  1B32 A;  3G3K A;  4Q5T A;  5DVJ A;  3FJG A;  4F31 B;  4ELP A;  4DCY A;  1SYI A;  5H8H B;  2NOO A;  1I6B A;  2Y7K A;  1YTV A;  2RCA A;  3VVD A;  2IA4 A;  1FTK A;  3CSG A;  4PFW A;  4OFL A;  1LFI A;  3UOR A;  1FQD A;  4R6H A;  1T0K A;  2O6A A;  1AIV A;  3ECR A;  3E3K A;  3H03 A;  1GVC A;  1JNF A;  3FGS A;  1QKB A;  1B7H A;  2QSX A;  3TKD A;  1DTG A;  1LBB A;  5L9O A;  3MPK A;  2DWA A;  1IIW A;  2DXY A;  2H4I A;  2O68 A;  5TP9 B;  3N6U A;  1Y4C A;  1MQH A;  5CI5 A;  4ZDM A;  2XXT A;  3RNN A;  2PX1 A;  4H0W A;  3MBP A;  3TCF A;  1NFT A;  2F78 A;  3EHS A;  3U1O A;  2A5S A;  4XKQ A;  2XXY A;  2Q9T A;  2QJE A;  2G93 A;  4YB5 A;  2A5T A;  2I4C A;  3C35 A;  3OEL A;  5FTH A;  2XXI A;  3OEM A;  4U23 A;  5FHO A;  4PET A;  3LSL A;  4BDM A;  4ISU A;  4LQ2 A;  4XKP A;  4RA1 A;  4F29 A;  4BLA A;  2ONK E;  3KJ7 A;  1B1X A;  3TTR A;  1JW5 A;  3VE1 B;  1O64 A;  3PD9 A;  1B40 A;  1MXU A;  5FTI A;  3FXU A;  4EXL A;  2UYF A;  3FJM A;  2UYE A;  3O9P A;  4YMA A;  1NL5 A;  2E0S A;  3EPE A;  3I6V A;  1MY2 A;  1QUJ A;  2D21 A;  2GHA A;  4F3P A;  3C33 A;  1MM7 A;  3IO6 A;  2XXU A;  2PBW A;  4E0W A;  1B0L A;  4LAT A;  3THI A;  3LBS A;  4FJP A;  1IIT A;  4YAH X;  3SEU A;  4ESX A;  1BTJ A;  1MM6 A;  4G8H A;  3SKP A;  2OWT A;  2GH9 A;  2H5Y A;  2Z23 A;  5DEX B;  3LSW A;  1A8F A;  2I49 A;  3O66 A;  1Y1Z A;  1NNF A;  5I58 B;  2DSF A;  3QUJ A;  5JEI A;  5FHN A;  4RK2 A;  4H1X A;  4IO5 A;  1MPB A;  3FVN A;  4OTE A;  3O28 A;  4Q30 B;  2YPN A;  3HCQ A;  4RXL A;  3IOU A;  4G77 A;  5EHS A;  1ZIU A;  4FEB A;  3T96 B;  3H6U A;  3G3J A;  3C31 A;  3KEI A;  1YCJ A;  2GRV A;  1O63 A;  1LFG A;  3B6W A;  4Q0C A;  1MS7 A;  1CB6 A;  4G68 C;  3L6G A;  4U4S A;  2OJT A;  3VFJ A;  5I57 B;  5I59 A;  3H06 B;  1FTM A;  4XXU A;  3GBA A;  1OIB A;  1P1U A;  4MBP A;  3UA8 A;  3CR9 A;  4OEU A;  2XD2 A;  3PPP A;  4U21 A;  5CRY A;  3G3I A;  3AXF A;  1MY0 A;  1JET A;  4NTL A;  1VFE A;  4FIM A;  5F1Q A;  1B1H A;  2XXV A;  3UP9 A;  1OVT A;  1BLF A;  1MQG A;  4F1Y A;  2F97 A;  5I56 A;  4NMY A;  1TFD A;  1POY 1;  2I58 A;  4GRK A;  3SEY A;  3RN8 A;  4MLQ A;  3IX1 A;  1ZLQ A;  5CMB A;  1O7T A;  2RKM A;  1QW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...