2VPOA

High resolution structure of the periplasmic binding protein teaa from teaabc trap transporter of halomonas elongata in complex with hydroxyectoine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
311
structure length
307
Chain Sequence
DNWRYAHEEYEGDVQDVFAQAFKGYVEDNSDHTVQVYRFGELDIMEQTQNGILQFVNQSPGFTGSLIPSAQIFFIPYLMPTDMDTVLEFFDESKAINEMFPKLYAEHGLELLKMYPEGEMVVTADEPITSPEDFDNKKIRTMTNPLLAETYKAFGATPTPLPWGEVYGGLQTGIIDGQENPIFWIESGGLYEVSPNLTFTSHGWFTTAMMANQDFYEGLSEEDQQLVQDAADAAYDHTIEHIKGLSEESLEKIKAASDEVTVTRLNDEQIQAFKERAPQVEEKFIEMTGEQGQELLDQFKADLKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMIC SUBSTRATE BINDING PROTEIN
publication title 1.55 A Structure of the Ectoine Binding Protein Teaa of the Osmoregulated Trap-Transporter Teaabc from Halomonas Elongata.
pubmed doi rcsb
source organism Halomonas elongata
molecule tags Transport
total genus 117
structure length 307
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2vpoA00
4NF0A 4DI4B 4PFBA 4X04A 2HPGA 3U65A 4PCDA 4MHFA 4XEQA 4NX1A 4PDDA 4X8RA 4PAFA 2VPOA 4PBHA 2XWOA 4YICA 2XWKA 4PE3A 4N8GA 4O94A 4XFEA 4PFIA 5I5PA 4OVPA 4PGNA 4MMPA 2XA5A 2ZZWA 4P1EA 4YZZA 5IZZA 4PGPA 4DI3D 4MNCA 2WX9A 4N91A 4NQ8A 4N8YA 2HZKA 4PAIA 2XWIA 4MCOA 4N4UA 4P56A 4P1LA 2WYPA 2HZLA 3GYYA 4P47A 4O7MA 2PFYA 3B50A 4PFRA 2PFZA 5LTCA 4OANA 4NAPA 4O8MA 4NG7A 5CM6A 4PAKA 4PETA 4PF8A 4PBQA 4XF5A 4N6DA 4OVSA 2ZZVA 4NN3A 4NHBA 4MX6A 4NGUA 4PDHA 4MEVA 4OVRA 4N15A 2ZZXA 4P8BA 4N17A 4OVTA 2V4CA 2CEYA 4N6KA 4UABA 5IM2A 4P3LA 2VPNA 4MAGA 5IGAA 2WYKA 4MNIA 4OA4A 5I7IA 4P9KA 3FXBA 4MNPA 4PF6A 2XWVA 2CEXA 4OVQA 4MIJA 4LN5A 4PC9A 2XXKA
chains in the Genus database with same CATH superfamily
4DXCA 4TLLB 3FXQA 4ISUA 5ET8A 2PVUA 1TFAA 3MC2A 3U65A 4MHFA 1R9LA 1M5DA 3WAFA 4GFRA 4IO7A 3OO8A 5J16A 2GFEA 4JVCA 2RC9A 2F36A 4O3AA 4HXVA 5DW8A 1JEVA 4RK2A 2DVZA 3IOVA 1Q35A 2IA4A 4F1UA 3RN8A 4C0RA 2OX3A 3PPPA 3C34A 1UQWA 1B52A 4IR8A 1YYZA 1PBQA 3FUZA 1VR5A 1UTHB 2DWAA 4P56A 4GLIA 4HCYA 3LUYA 4QF9A 3T9HB 3K00A 4LQ2A 2DE4A 4BDLA 5AE4A 2OCUA 4YKJA 1UTHA 2DSFA 2PFZA 1YXIA 1BKAA 1MH4A 1FPBA 3CFXA 3SEVA 1DMBA 1NV3A 2V25A 3TDJA 1VFDA 4GL8A 3EKIA 2XD2A 1OLCA 4YKKA 3T22A 4U23A 1AL3A 4LONB 2O51A 3SZPA 3VVEA 2D21A 3TAJA 1YTVA 3ZKKA 2VP1A 2XXPA 1XS5A 4GWOA 3FVNA 2CEYA 4N6PA 2Z23A 5IM2A 1B3HA 3MVWA 1JETA 1RDZA 4HW8A 2WYKA 4KQPA 4Z0IA 1N7XA 4KXPA 1DSNA 1NV2A 2XWVA 1MY2A 5H8SA 4ZEKA 4RXLA 5ITPA 2QSXA 1B32A 4KYEA 4DDDA 3CFZA 4OZ9A 1B2HA 1MXXA 1XVYA 3K0VA 3B6WA 5AA4B 1JNFA 2Q8MA 1US4A 4PBHA 1KA1A 2NXOA 1PC3A 2DVCA 3KJTA 2QFLA 2QVVA 4QSEA 3TODA 4PFIA 5AA4A 1FTKA 1N3WA 5IZ3A 3VLUA 3FVOA 2HZKA 3M8UA 3BKIB 3MP6A 4P1LA 3EHSA 1FTOA 4GX3A 1A8EA 1N7WA 2P2AA 4YKIA 5H8QA 4RNSA 1KZ8A 3QIMA 4OFJA 3W9VA 3E3KA 1M5FA 1FQDA 2O6AA 2I6EA 4LP2B 4N6DA 3IX1A 3QUFA 2F3BA 4JWYA 4OVRA 1FTLA 2ZYOA 4I3EA 3U94A 1MXWA 2V93A 3RGYA 2F35A 4AB5A 2VD2A 1NH8A 2I58A 2RC7A 2Y5LA 1B7UA 2RC8A 1NUWA 3MAMA 1KWHA 3G3GA 4G8MA 4MAGA 3TTRA 1FTAA 4P11A 2FNCA 1NFTA 5LOMA 1SDXA 4F3BA 3HHGA 2F7CA 1RKMA 5I58B 1S9TA 4IY5A 4L17A 1YZ0A 5I2KB 4F3SA 1DCUA 1ZJLA 2XX7A 3LC8A 4XKPA 2QJEA 1WVJA 3G7WA 3IO6A 1MXYA 2DWIA 4KFQA 3PUVE 3R26A 1FQFA 4X1DA 1SVXB 2XWOA 5I84A 3OO7A 4QFLA 2ZYNA 1EYKA 4I62A 2NOOA 3TCFA 4LATA 3TUSA 4Q8RA 4JSOA 4Q5TA 4FE8A 2DOJA 1DK4A 2WYPA 2Q2CA 2MKZA 3BBRA 4O7MA 3BFTA 3T9VA 3G3KA 2F5XA 1B4HA 2H25A 3SDFA 2B4LA 2A5TA 2GH9A 3MZBA 3IB0A 1ELJA 4NEDA 3S2VA 4ESXA 5DTBA 1IXCA 3PPQA 4IGTA 4GBVA 4JB7A 1XI6A 4YMAA 4NF5B 2XXVA 5TP9B 5JEIA 4O3BA 1QKAA 1B7ZA 2Z8FA 1MDQA 3GBBA 4R6KA 3WAEA 4TOZA 4NF5A 3U8QA 5BUUA 3T0JA 1EZ9A 4GQOA 2H9BA 3M3KA 4P3LA 2VPNA 4PE5B 3G3JA 3AXFA 3T96B 1PB9A 3O29A 4JDFA 2FVZA 4AS4A 4G77A 1IMCA 4PC9A 2HAVA 4DI4B 2ONKE 3OSQA 5F7VA 3KC1A 4PDDA 1NV5A 3F11A 2F7BA 2VPOA 3KSXA 3RPLB 1AH5A 4Q30B 4N8GA 1HSJA 3H7MA 2D5WA 4ONYA 1NUXA 3VV5A 2XA5A 1IZ1A 1FQCA 3RPLA 3HPIA 3QK6A 3QAXA 1FBFA 3E78A 3NOHA 2PX1A 2HFBA 4HCWA 3GYYA 1RYOA 2JJKA 1NV0A 3K01A 3OMBA 3T1BA 2DE2A 5FTHA 2OWSA 4ZZEA 4F2OA 3D4GA 4PAKA 2UYEA 2ZNUA 4OVSA 3ONMA 2RKMA 3HV1A 5EYGA 1MQGA 3S4UA 4GX6A 4BDNA 1GTKA 3LSLA 3FVKA 5F1QA 2V4CA 4N6KA 4GXAA 1LAHE 2XXWA 3HN0A 4AB6A 1N84A 4RY1A 5FTIA 1MQJA 4YB7A 1LAFE 3K6WA 3PMVA 4P9KA 5TPAB 2QS3A 4G8NA 1BTJA 4PF6A 5TU0A 5JTYA 4LA9A 1MH3A 4MBPA 1DPPA 1LFHA 4LN5A 2XXKA 1M5CA 4XKNA 5TPAA 4DLDA 1R1NA 2CZHA 3T9XB 1LBXA 1TXFA 4I40A 4NWDA 3EHTA 1XHYA 4R73A 2AYSA 3IR1A 4OERA 5FHOA 4NF6B 5LDZA 4TQUQ 3I3VA 4MNCA 3IOUA 1IMDA 4ELOA 2XX8A 4F3GA 5CMBA 1D3KA 4H6DA 3PPRA 1FPLA 1FBCA 1IXIA 3RUMA 4KCCA 4FEBA 4DCXA 4PFWA 5KCJB 2I49A 3PUZE 4X48A 4H65A 1B0HA 3QUJA 1ANFA 4XF5A 1JW4A 1HSLA 1LFGA 2I3VA 3VFJA 4WEDA 4G61A 1JW5A 3RTWB 3GXAA 3SERA 2GHAA 3K1MA 4R9FA 3PUXE 2OWTA 4MLVA 4GX4A 1O63A 3O9PA 3JYRA 2QS4A 1FBPA 3FXBA 3LR1A 5DT6A 3K6VA 1Q1KA 3VVDA 4GWUA 1MDP1 4U1ZA 1URSA 4NTLA 5JK4A 2RCAA 1AMFA 1SW1A 2REJA 2F8DA 4K3FA 3TTNA 4U1OA 3VVFA 1USYH 1YAEA 3PV0E 1G0HA 2UXAA 3S9MC 4RYAA 4GVOA 4THIA 2VT5A 3VE1B 5F24A 3RY3A 4FORA 1DOTA 3MBPA 5ET6A 1MG1A 2CZKA 5A5XA 1LBWA 3G3HA 1OVBA 2WBDA 5EQ8A 3PUYE 2ANJA 4PAIA 4ZE8A 2VGQA 1TWYA 5DEXB 2OBGA 3MVXA 5HM4B 1B3GA 1LBZA 1NNPA 3KOTA 1OQHA 1P1UA 4EXLA 3MUQA 5CMCA 4KYDA 4YB5A 3I5OA 3PD8A 4FATA 4ZE9A 4U4SA 1JP4A 1D4NA 2P3NA 4NN3A 2XXXA 2ZZXA 1LBYA 3ILTB 4QRZA 1US5A 1LEVA 3V8XB 3PPOA 3RTFB 1UIVA 4F22A 5ELVA 1IQ7A 3SKPA 4HE1A 4OVTA 4YAHX 1FPJA 3MJNA 1Y3NA 1URGA 4YMBA 2B65A 4DCYA 4IO5A 2PYYA 2V3TA 4RPNA 4IY6A 4IB2A 4JBZA 5DVIA 2Z22A 2ZYMA 1SBPA 4G68B 5EHMA 5L9MA 1K9YA 1B1HA 1RDXA 1AIVA 4IO6A 1ZBMA 2HPGA 4OVJA 4PCDA 3G3IA 4GXSB 4KR5A 4IO4A 4DZ1A 2OWZA 4R75A 4U4XA 3C36A 4ELQA 5ICQA 3VXBA 4R72A 3K6UA 3OSRA 3O2AA 3T93B 5HBCA 1SW4A 1OVTA 1XOCA 4MF3A 3RNNA 5H8FB 1B46A 1MY4A 4NMYA 1P99A 3IAZA 2KR0A 4EUOA 4N91A 3TFLA 2Q74A 3E13X 5I56B 1NL5A 5H8FA 5EYHA 4H45A 1R9QA 2F3DA 3FJGA 1UTBB 1Y3PA 5I56A 1EYJA 3FXUA 4EF2A 2RF1A 4RPOA 1MM7A 5M2VA 1QKBA 2G93A 4EQ9A 5L9SA 1MXVA 2ONRA 4WXJA 4NGUA 4FIMA 4IO2A 1P1OA 2HAUA 4DXUA 2ABHA 3K02A 4GWSA 4PP0A 1FBDA 2DXRA 3LSXA 1NNFA 4N07A 2NWJA 3TKDA 3FV2A 4GWYA 5CC2A 4UABA 1NNTA 2DXYA 1B40A 3UK4A 1Z7ME 4P0GA 4QXDA 4M1VA 4OWDA 3MYUA 3RQTA 2R71A 3MP1A 4ZZAA 2XXHA 4H67A 4PFTA 1IEJA 2DS9A 2DP8A 3B8BA 1CE2A 4OTEA 1Y4CA 2I4BA 4PTKA 2ESNA 1R6ZA 3VLVA 3L6GA 3TYHA 2M8CA 3KFMA 3VLWA 3PMXA 2XX9A 3DLNA 1GGGA 1P1NA 2VD3A 4OESA 2XD3A 2DWJA 4EDPA 5H8HB 4QFPA 1GVCA 4YZZA 3H3GA 4BDQA 3GLBA 3R6UA 1Y20A 1JQFA 5H8HA 5I58A 4H5FA 2XWIA 3RLFE 4BDRA 5I2KA 3FXRA 2HZLA 4PFYA 2PT2A 2PFYA 1FJ9A 1MY3A 4F31B 4OFOA 2I48A 5B7DA 1LCFA 1JVYA 1Y4TA 2R8TA 3FBPA 2QS1A 4NF4B 2UVJA 3FVGA 1MM6A 4FJPA 2VHAA 4PDHA 2O1MA 4MEVA 2V84A 3PU5A 3PPNA 3M3LA 2RCBA 2AIXA 3GZGA 4I3YA 4NF4A 4F39A 5CBRA 4N17A 3Q27A 4H8JA 1S50A 3LBSA 1MPBA 5L8DA 2XXUA 4F19A 3TELA 2X7QA 3DELB 3DP8A 2PCRA 2QPQA 3H6UA 4H8IA 1FW0A 2O68A 2UVHA 3QSLA 3UIFA 4PFUA 1EZPA 1NH7A 1B5HA 4EQ7A 2HQ0A 1QUJA 4GF8A 4RK9A 1OQGA 1FBGA 1LBVA 3MWBA 4MH5A 1B7HA 3MPKA 3OEMA 1PB7A 3SETA 2W7YA 5AA2B 2WBBA 5TP9A 2BJJX 1A55A 2E0SA 1YCJA 5BWJA 3UA8A 2AL5A 5AA2A 1I6QA 1Q9DA 4KD5A 2UVIA 4DXBA 3KBRA 2DE3A 3JZJA 5FHNA 1O64A 1B4ZA 3BFUA 5I5PA 4JWOA 1JEUA 3C33A 3OELA 2ZNTA 3E9XA 1F9BA 3DP6A 4NQ8A 3CSGA 4GWWA 3ZKLA 4MCOA 4MFIA 3LSFB 4H5GA 3CFLA 2O7IA 4JWXA 1JW1A 1IMAA 4BDMA 2X26A 1EZOA 2Y7IA 4PF8A 3OEKA 4PBQA 3K4UA 3ZSFA 1I6AA 5EQAA 2ZZVA 4NHBA 5ISUA 2AL4A 2BJIA 5K2XA 1LSTA 5K2YA 5IKBA 5ESYA 5DVJA 3PMWA 3RYDA 2Y7RA 3MZ1A 1IUDA 4FAJA 5FHMA 1IIWA 1MPDA 2UVGA 5ET7A 1T0KA 4G4PA 1FPKA 4I8CA 1YPNA 1ZIUA 3H6VA 2Q89A 2XXTA 3S9NC 4EQBA 1PB8A 3MZ9A 4E0XA 5CBSA 3U92A 1BIYA 5I2NB 2B3FA 2YLNA 2Z8EA 2F97A 4NF0A 3PGFA 1FBEA 5I2NA 4XEQA 1DTGA 4O3CA 4OMBA 3Q28A 3IJOB 4U21A 3IORA 3O97A 2Y7WA 2CMOA 3O66A 3U1OA 3H6TA 4PE3A 2HXRA 1D9YA 3K1NA 4X9TA 3GBAA 2G29A 1INPA 1S7YA 3HHFA 2IEEA 4WEPA 4ZEDA 2HCAA 4QFNA 1OLAA 1A40A 4P47A 2Y7PA 1MQIA 3Q25A 1B1XA 5AA3A 1FPEA 3UP9A 4R2BA 2HXWA 3KG2A 1QUKA 1MRPA 4EF1A 4F2QA 4OEVA 4Z7EA 2ZXTA 4NF6A 1P1WA 4P8BA 2I0BA 3TEPA 1EU8A 4G68C 5FBPA 3V83A 4HE2A 1ZLQA 3H6WA 4XIGQ 3B7DA 1SYIA 3G3FA 2Y5KA 2XHDA 3N6UA 4MNIA 4XKQA 5KCJA 3P7IA 1MS7A 1N0TA 3VDFA 3O28A 4OVQA 3CVGA 5IZ1A 4XFEA 1N3XA 1NMUA 2I0CA 1ZMGA 2F34A 3O6GA 1EYIA 2Y7KA 3TTKA 1VDWA 2XXQA 1FTJA 2HEUA 3MVZA 5CMKA 1FPGA 4BLAA 2D3IA 5B70A 5IAIA 4KYSA 1FPFA 4O94A 4ECFA 4XKRA 4H0WA 3CR9A 2WX9A 5L9OA 3UGWA 4LVQA 1FCKA 4N4UA 4U22A 4QFKA 1J1NA 1BP5A 4P0IA 4R2FA 4AS5A 5DVFA 1QULA 4OYVA 4F3PA 3KEIA 4F1YA 3OXNA 4N81A 3MSTA 4PETA 2B4MA 4QSDA 1NV4A 1USYE 3DP4A 4JVIA 4MX6A 5I3SA 3D4CA 4KCDA 2Q88A 4GWXA 5T3JA 2F78A 3B6QA 4FECA 1H76A 2R6GE 5DEXA 1O7TA 5IGAA 1IMEA 3BIHA 4F1VA 3W9WA 4XTCQ 1NUYA 2PBWA 4G8HA 3VXCA 2LAOA 4DIGA 3O6HA 3BIGA 3EHUA 3QYTA 5AA1A 2CZLA 3USDA 4PFBA 1DTZA 1MQHA 2ZNSA 1A7LA 3U93A 1IXGA 2GQ1A 2PMSA 2XXIA 3UN6A 4X8RA 1ZKBA 1VFEA 5CRYA 4ZEBA 2NVUB 1BLFA 2E1SA 2QVRA 5A5LA 4DE8A 1H3DA 2KQZA 1SPIA 5J1DA 1XVXA 2ZZWA 1FQBA 5IZZA 3MW0A 3MVYA 3KBZA 4GWZA 4G68A 3CRBA 4POXA 2YPNA 1QGXA 4PFRA 2O7UA 1SI1A 4KPTA 4OETA 1WDNA 4O8MA 1AOVA 3A29A 5H8NB 3S9LC 2V3QA 1FJ6A 1IMBA 3K6XA 3ZS6A 1IMFA 3FD3A 3N5LA 1G0IA 4HS7A 5H8NA 3FASA 5ICTA 3KN7A 1Z7NE 1URDA 4ELPA 2ALUA 1FBHA 1B6HA 3ROJA 4ELRA 2UYFA 2PT1A 3PD9A 1SI0A 4O7IA 3OENA 4PQJA 3RPWA 1B3FA 3H06B 1DPEA 1UTBA 4C1UA 2GRVA 3A09A 3RT8A 2FBPA 5IZ3B 1N76A 3CHGA 4R74A 4OHNA 2OJTA 3IFAA 5I59B 1FPIA 4C1TA 1TFDA 4NF8B 2P0SA 4GL0A 1LLSA 1GR2A 2O69A 2V3UA 5KDTB 3K1PA 1POTA 4NX1A 5H8QB 5I59A 1A54A 4H46A 4NF8A 4IO3A 4WKMA 1SD3A 4F29A 1PEBA 1FPDA 5KDTA 1XC1A 3O6IA 4QBAA 4PGNA 3N26A 1SQYA 3IOWA 4P1EA 1NV7A 3IB2A 1TT1A 1FSAA 4EXKA 3C4MA 1VE4A 4MLQA 1I69A 3KN8A 3TCHA 3B50A 1KA0A 4QHQA 5LTCA 4NAPA 1A8FA 2CZIA 3ODBA 3V89B 1JVXA 3A3UA 1B05A 3IK6B 4OENA 4ESWA 4N13A 3ISPA 3OO9A 1POY1 3TPAA 4ZS9A 1QJMA 3EPEA 5AA2D 2FIXA 1B5JA 3CI8A 3TMGA 3TTLA 1MXUA 1NV6A 4GIZA 4HTGA 3T66A 4ZECA 3N94A 2ZYKA 4JVDA 4LZ5A 1DBZA 2H99A 5EHSA 3V5AA 3KZGA 1SW2A 2H98A 3OD7A 2A5TB 4PAFA 4LZ8A 4TLMB 1LAGE 3KJ7A 5HPQA 4POWA 4LZ7A 4OVPA 1H45A 1AWBA 4Q0CA 2OZZA 2HHMA 3HFUA 4N8YA 2R9JA 1FQEA 3KOSA 3TQWA 1Y9UA 3PUWE 2DQVA 1NKXA 3Q29A 1MQDA 3KGCA 3FJ7A 4HE0A 2FHYA 2QRYA 3SEXA 1GV8A 4R6YA 5CM6A 1CNQA 2XXYA 1MY1A 3TZAA 1OIBA 3EN3A 3FJMA 1Y1ZA 4M4GA 1B58A 4N15A 3IFCA 3QMFA 1FQAA 1PBPA 3C35A 1PDAA 1QW0A 3IOTA 4RA1A 1QUIA 3FIRA 4OQOA 1H44A 1LBCA 3OOAA 1LB9A 4X1BA 4KI0E 4OA4A 3SEYA 4AQ4A 3HCQA 4XXUA 2X7PA 1LFIA 4MNPA 2F6PA 1WODA 2CEXA 3HO7A 3SEWA 1M5EA 2I3WA 2P1SA 1BK4A 1SYHA 4OXVA 2FIEA 3C32A 1IXHA 1B9JA 2ONSA 3FGSA 5EQ9A 4GRKA 2XXRA 3E79A 2RINA 2WEFA 4ZEFA 4OEUA 4F18A 3Q26A 1EH3A 3THIA 1QVSA 3LV0A 2QMWA 4DI3D 2Q8JA 2REGA 4JXIA 3EF7A 3S9EA 3OO6A 1MXZA 4QSCA 2QL3A 4IGRA 3UORA 3W15C 4GOTA 2Y84A 3MP8A 3SEUA 5DYHA 1MY0A 2DWHA 1I6BA 2QVUA 3T9UA 4OANA 3TTMA 2QMXA 4NG7A 2DYXA 3H4ZA 2OLBA 5JTYB 3KN3A 1NNKA 5CI5A 1RYXA 1B3EA 4BDOA 4OFLA 5ITOA 3TQLA 2VOZA 2Q2AA 4NE4A 2H4IA 5EQ7A 3MPLA 3CIJA 1L5TA 1MPCA 3U72A 2GHBA 3H03A 4MJOA 3R7XA 1NI9A 1SW5A 4I1DA 1B51A 1LB8A 3CSBA 2H5YA 3FATA 4ZDMA 3DM0A 3KSJA 3I6VA 3FZVA 2Q9TA 4ZEIA 3KC0A 4MIJA 3C9HA 2B3BA 3TCGA 3ECRA 4H1XA 3LSWA 2WKYA 1D9QA 2THIA 3IL1B 4LUBA 1LGBC 1LCTA 3A3CA 3D1RA 4X04A 2NUVA 4UACA 1D9VA 2I4CA 2O84X 4R6HA 4UA8A 4ND9A 1ATGA 1FRPA 1CB6A 3SESA 2Z8DA 4YICA 4U2RA 2XWKA 4I9DA 3L6HA 5ET5A 2O1LA 3C31A 3JV9A 1H43A 4LQ5A 4MMPA 2P3VA 4YU0A 1Y3QA 4PGPA 3E4RA 4GD5A 2YJPA 1VSOA 2L5VA 1FTMA 4YKPA 3CG3A 5KZTA 4R9GA 1K9ZA 4JSDA 1LBBA 1P1QA 3EQ1A 3PTYA 3CG1A 1OMPA 1ZU0A 2QS2A 1LAXA 3LUZA 1HSEA 4E0WA 1M5BA 1RDYA 1A99A 2OK2A 3HSTA 4RJZA 5CMMA 1IITA 3FV1A 3N6TA 4FBPA 4GBWA 4QFOA 2FYIA 2DDKA 4KHZE 3QXMA 3B6TA 1NV1A 2F7AA 3IJXB 3ILUB 3IO4A 5EYFA 2A5SA 1Y1MA 1B5IA 1B0LA 4YB6A 4NWCA 1XT8A 1ZTYA 3M3FA 2ZMBA 3K2DA 1UIUA 3RT6B 1N04A 1II5A 5I57B 1NUZA 5A5XB 5I7IA 2F6GA 4G2ZA 2FA7A 3MQ9A 2KLFA 3IB1A 1B3LA 4FEDA 5I57A
chains in the Genus database with same CATH topology
2WBBA 5ET8A 2CZHA 1LBXA 3U65A 4MHFA 4NX1A 4I40A 4H46A 5J16A 4JVCA 1Q9DA 4HXVA 1FPDA 5DW8A 2DE3A 2DVZA 4QBAA 5I5PA 4PGNA 4F1UA 5LDZA 2OX3A 4P1EA 1NV7A 4IR8A 4MNCA 1FSAA 1YYZA 1IMDA 4NQ8A 4GWWA 4MCOA 4P56A 4HCYA 1FPLA 1FBCA 3B50A 1KA0A 2DE4A 2PFZA 5LTCA 1YXIA 1IMAA 4NAPA 2CZIA 1FPBA 4PF8A 4PBQA 4XF5A 1NV3A 5EQAA 2ZZVA 3EKIA 4NHBA 2BJIA 5ESYA 3SZPA 4G61A 3RYDA 3ISPA 2CEYA 2FIXA 5IM2A 5ET7A 4GX4A 1FPKA 1RDZA 2WYKA 1NV6A 1FBPA 3FXBA 4KXPA 1NV2A 2XWVA 4JVDA 4GWUA 1DBZA 4NF0A 1FBEA 5JK4A 4XEQA 4PAFA 2Q8MA 4PBHA 1KA1A 1G0HA 2QFLA 2QVVA 4PE3A 2HXRA 2VT5A 4PFIA 5F24A 4OVPA 5ET6A 2CZKA 1AWBA 1LBWA 5IZ3A 4X9TA 2HHMA 3HFUA 4N8YA 2WBDA 5EQ8A 1INPA 2HZKA 4PAIA 4P1LA 4P47A 4GX3A 1LBZA 4HE0A 2FHYA 1FPEA 1KZ8A 5CM6A 1CNQA 3W9VA 1JP4A 2P3NA 4N6DA 4NN3A 2F3BA 4OVRA 4N15A 2ZZXA 4I3EA 1LBYA 3IFCA 4P8BA 3QMFA 1LEVA 4HE1A 4OVTA 1FPJA 5FBPA 2Y5LA 4HE2A 1NUWA 4MAGA 2Y5KA 1FTAA 4MNIA 4OA4A 4MNPA 2CEXA 4OVQA 5IZ1A 4XFEA 1YZ0A 1K9YA 1RDXA 1EYIA 1DCUA 1BK4A 1VDWA 2HPGA 4PCDA 2FIEA 1FPGA 5EQ9A 2OWZA 3E79A 2XWOA 2WEFA 1EYKA 4F18A 1FPFA 4O94A 3LV0A 4DI3D 2KR0A 2WX9A 4N91A 2Q74A 4N4UA 1DK4A 2WYPA 5EYHA 2MKZA 4H45A 4O7MA 2F3DA 4AS5A 2QVUA 2F5XA 4OANA 1EYJA 2B4LA 4NG7A 4N81A 3MSTA 4PETA 2B4MA 1NV4A 4GBVA 1XI6A 4JVIA 4MX6A 4NGUA 5I3SA 5EQ7A 4GWSA 4MJOA 4GWXA 5T3JA 1FBDA 1NI9A 3T0JA 4GWYA 4UABA 4P3LA 1IMEA 2VPNA 5IGAA 3BIHA 4F1VA 3W9WA 4QXDA 4M1VA 1NUYA 2Q9TA 3MYUA 2FVZA 4AS4A 3BIGA 1IMCA 3KC0A 4MIJA 4PC9A 1D9QA 4DI4B 3B8BA 4PFBA 4PTKA 3D1RA 4X04A 3KC1A 2GQ1A 4PDDA 4X8RA 1NV5A 1FRPA 2VPOA 3RPLB 4YICA 2XWKA 2QVRA 5ET5A 5A5LA 4N8GA 4MMPA 2P3VA 1NUXA 2KQZA 1SPIA 2XA5A 5J1DA 2ZZWA 4YZZA 5IZZA 3RPLA 4PGPA 2L5VA 3KBZA 4GWZA 1FBFA 3E78A 2XWIA 3NOHA 1K9ZA 2HZLA 4HCWA 3GYYA 1QGXA 2PFYA 2JJKA 4PFRA 1NV0A 1FJ9A 3T1BA 3PTYA 2DE2A 3LUZA 4O8MA 1RDYA 2R8TA 3A29A 3FBPA 4PAKA 2V3QA 1FJ6A 1IMBA 4OVSA 4FBPA 4GBWA 1IMFA 4PDHA 4MEVA 1G0IA 5EYGA 2DDKA 4I3YA 4GX6A 1FBHA 4N17A 3ROJA 1NV1A 4F19A 2V4CA 4N6KA 2PCRA 4O7IA 2QPQA 1NUZA 5I7IA 4P9KA 2FBPA 5IZ3B 3CHGA 4PF6A 1FBGA 1LBVA 3IFAA 4LN5A 1FPIA 2XXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NF0 A;  4DI4 B;  4PFB A;  4X04 A;  2HPG A;  3U65 A;  4PCD A;  4MHF A;  4XEQ A;  4NX1 A;  4PDD A;  4X8R A;  4PAF A;  2VPO A;  4PBH A;  2XWO A;  4YIC A;  2XWK A;  4PE3 A;  4N8G A;  4O94 A;  4XFE A;  4PFI A;  5I5P A;  4OVP A;  4PGN A;  4MMP A;  2XA5 A;  2ZZW A;  4P1E A;  4YZZ A;  5IZZ A;  4PGP A;  4DI3 D;  4MNC A;  2WX9 A;  4N91 A;  4NQ8 A;  4N8Y A;  2HZK A;  4PAI A;  2XWI A;  4MCO A;  4N4U A;  4P56 A;  4P1L A;  2WYP A;  2HZL A;  3GYY A;  4P47 A;  4O7M A;  2PFY A;  3B50 A;  4PFR A;  2PFZ A;  5LTC A;  4OAN A;  4NAP A;  4O8M A;  4NG7 A;  5CM6 A;  4PAK A;  4PET A;  4PF8 A;  4PBQ A;  4XF5 A;  4N6D A;  4OVS A;  2ZZV A;  4NN3 A;  4NHB A;  4MX6 A;  4NGU A;  4PDH A;  4MEV A;  4OVR A;  4N15 A;  2ZZX A;  4P8B A;  4N17 A;  4OVT A;  2V4C A;  2CEY A;  4N6K A;  4UAB A;  5IM2 A;  4P3L A;  2VPN A;  4MAG A;  5IGA A;  2WYK A;  4MNI A;  4OA4 A;  5I7I A;  4P9K A;  3FXB A;  4MNP A;  4PF6 A;  2XWV A;  2CEX A;  4OVQ A;  4MIJ A;  4LN5 A;  4PC9 A;  2XXK A; 
#chains in the Genus database with same CATH topology
 4DXC A;  4TLL B;  3FXQ A;  4ISU A;  5ET8 A;  2PVU A;  1TFA A;  3MC2 A;  3U65 A;  4MHF A;  1R9L A;  1M5D A;  3WAF A;  4GFR A;  4IO7 A;  3OO8 A;  5J16 A;  2GFE A;  4JVC A;  2RC9 A;  2F36 A;  4O3A A;  4HXV A;  5DW8 A;  1JEV A;  4RK2 A;  2DVZ A;  3IOV A;  1Q35 A;  2IA4 A;  4F1U A;  3RN8 A;  4C0R A;  2OX3 A;  3PPP A;  3C34 A;  1UQW A;  1B52 A;  4IR8 A;  1YYZ A;  1PBQ A;  3FUZ A;  1VR5 A;  1UTH B;  2DWA A;  4P56 A;  4GLI A;  4HCY A;  3LUY A;  4QF9 A;  3T9H B;  3K00 A;  4LQ2 A;  2DE4 A;  4BDL A;  5AE4 A;  2OCU A;  4YKJ A;  1UTH A;  2DSF A;  2PFZ A;  1YXI A;  1BKA A;  1MH4 A;  1FPB A;  3CFX A;  3SEV A;  1DMB A;  1NV3 A;  2V25 A;  3TDJ A;  1VFD A;  4GL8 A;  3EKI A;  2XD2 A;  1OLC A;  4YKK A;  3T22 A;  4U23 A;  1AL3 A;  4LON B;  2O51 A;  3SZP A;  3VVE A;  2D21 A;  3TAJ A;  1YTV A;  3ZKK A;  2VP1 A;  2XXP A;  1XS5 A;  4GWO A;  3FVN A;  2CEY A;  4N6P A;  2Z23 A;  5IM2 A;  1B3H A;  3MVW A;  1JET A;  1RDZ A;  4HW8 A;  2WYK A;  4KQP A;  4Z0I A;  1N7X A;  4KXP A;  1DSN A;  1NV2 A;  2XWV A;  1MY2 A;  5H8S A;  4ZEK A;  4RXL A;  5ITP A;  2QSX A;  1B32 A;  4KYE A;  4DDD A;  3CFZ A;  4OZ9 A;  1B2H A;  1MXX A;  1XVY A;  3K0V A;  3B6W A;  5AA4 B;  1JNF A;  2Q8M A;  1US4 A;  4PBH A;  1KA1 A;  2NXO A;  1PC3 A;  2DVC A;  3KJT A;  2QFL A;  2QVV A;  4QSE A;  3TOD A;  4PFI A;  5AA4 A;  1FTK A;  1N3W A;  5IZ3 A;  3VLU A;  3FVO A;  2HZK A;  3M8U A;  3BKI B;  3MP6 A;  4P1L A;  3EHS A;  1FTO A;  4GX3 A;  1A8E A;  1N7W A;  2P2A A;  4YKI A;  5H8Q A;  4RNS A;  1KZ8 A;  3QIM A;  4OFJ A;  3W9V A;  3E3K A;  1M5F A;  1FQD A;  2O6A A;  2I6E A;  4LP2 B;  4N6D A;  3IX1 A;  3QUF A;  2F3B A;  4JWY A;  4OVR A;  1FTL A;  2ZYO A;  4I3E A;  3U94 A;  1MXW A;  2V93 A;  3RGY A;  2F35 A;  4AB5 A;  2VD2 A;  1NH8 A;  2I58 A;  2RC7 A;  2Y5L A;  1B7U A;  2RC8 A;  1NUW A;  3MAM A;  1KWH A;  3G3G A;  4G8M A;  4MAG A;  3TTR A;  1FTA A;  4P11 A;  2FNC A;  1NFT A;  5LOM A;  1SDX A;  4F3B A;  3HHG A;  2F7C A;  1RKM A;  5I58 B;  1S9T A;  4IY5 A;  4L17 A;  1YZ0 A;  5I2K B;  4F3S A;  1DCU A;  1ZJL A;  2XX7 A;  3LC8 A;  4XKP A;  2QJE A;  1WVJ A;  3G7W A;  3IO6 A;  1MXY A;  2DWI A;  4KFQ A;  3PUV E;  3R26 A;  1FQF A;  4X1D A;  1SVX B;  2XWO A;  5I84 A;  3OO7 A;  4QFL A;  2ZYN A;  1EYK A;  4I62 A;  2NOO A;  3TCF A;  4LAT A;  3TUS A;  4Q8R A;  4JSO A;  4Q5T A;  4FE8 A;  2DOJ A;  1DK4 A;  2WYP A;  2Q2C A;  2MKZ A;  3BBR A;  4O7M A;  3BFT A;  3T9V A;  3G3K A;  2F5X A;  1B4H A;  2H25 A;  3SDF A;  2B4L A;  2A5T A;  2GH9 A;  3MZB A;  3IB0 A;  1ELJ A;  4NED A;  3S2V A;  4ESX A;  5DTB A;  1IXC A;  3PPQ A;  4IGT A;  4GBV A;  4JB7 A;  1XI6 A;  4YMA A;  4NF5 B;  2XXV A;  5TP9 B;  5JEI A;  4O3B A;  1QKA A;  1B7Z A;  2Z8F A;  1MDQ A;  3GBB A;  4R6K A;  3WAE A;  4TOZ A;  4NF5 A;  3U8Q A;  5BUU A;  3T0J A;  1EZ9 A;  4GQO A;  2H9B A;  3M3K A;  4P3L A;  2VPN A;  4PE5 B;  3G3J A;  3AXF A;  3T96 B;  1PB9 A;  3O29 A;  4JDF A;  2FVZ A;  4AS4 A;  4G77 A;  1IMC A;  4PC9 A;  2HAV A;  4DI4 B;  2ONK E;  3OSQ A;  5F7V A;  3KC1 A;  4PDD A;  1NV5 A;  3F11 A;  2F7B A;  2VPO A;  3KSX A;  3RPL B;  1AH5 A;  4Q30 B;  4N8G A;  1HSJ A;  3H7M A;  2D5W A;  4ONY A;  1NUX A;  3VV5 A;  2XA5 A;  1IZ1 A;  1FQC A;  3RPL A;  3HPI A;  3QK6 A;  3QAX A;  1FBF A;  3E78 A;  3NOH A;  2PX1 A;  2HFB A;  4HCW A;  3GYY A;  1RYO A;  2JJK A;  1NV0 A;  3K01 A;  3OMB A;  3T1B A;  2DE2 A;  5FTH A;  2OWS A;  4ZZE A;  4F2O A;  3D4G A;  4PAK A;  2UYE A;  2ZNU A;  4OVS A;  3ONM A;  2RKM A;  3HV1 A;  5EYG A;  1MQG A;  3S4U A;  4GX6 A;  4BDN A;  1GTK A;  3LSL A;  3FVK A;  5F1Q A;  2V4C A;  4N6K A;  4GXA A;  1LAH E;  2XXW A;  3HN0 A;  4AB6 A;  1N84 A;  4RY1 A;  5FTI A;  1MQJ A;  4YB7 A;  1LAF E;  3K6W A;  3PMV A;  4P9K A;  5TPA B;  2QS3 A;  4G8N A;  1BTJ A;  4PF6 A;  5TU0 A;  5JTY A;  4LA9 A;  1MH3 A;  4MBP A;  1DPP A;  1LFH A;  4LN5 A;  2XXK A;  1M5C A;  4XKN A;  5TPA A;  4DLD A;  1R1N A;  2CZH A;  3T9X B;  1LBX A;  1TXF A;  4I40 A;  4NWD A;  3EHT A;  1XHY A;  4R73 A;  2AYS A;  3IR1 A;  4OER A;  5FHO A;  4NF6 B;  5LDZ A;  4TQU Q;  3I3V A;  4MNC A;  3IOU A;  1IMD A;  4ELO A;  2XX8 A;  4F3G A;  5CMB A;  1D3K A;  4H6D A;  3PPR A;  1FPL A;  1FBC A;  1IXI A;  3RUM A;  4KCC A;  4FEB A;  4DCX A;  4PFW A;  5KCJ B;  2I49 A;  3PUZ E;  4X48 A;  4H65 A;  1B0H A;  3QUJ A;  1ANF A;  4XF5 A;  1JW4 A;  1HSL A;  1LFG A;  2I3V A;  3VFJ A;  4WED A;  4G61 A;  1JW5 A;  3RTW B;  3GXA A;  3SER A;  2GHA A;  3K1M A;  4R9F A;  3PUX E;  2OWT A;  4MLV A;  4GX4 A;  1O63 A;  3O9P A;  3JYR A;  2QS4 A;  1FBP A;  3FXB A;  3LR1 A;  5DT6 A;  3K6V A;  1Q1K A;  3VVD A;  4GWU A;  1MDP 1;  4U1Z A;  1URS A;  4NTL A;  5JK4 A;  2RCA A;  1AMF A;  1SW1 A;  2REJ A;  2F8D A;  4K3F A;  3TTN A;  4U1O A;  3VVF A;  1USY H;  1YAE A;  3PV0 E;  1G0H A;  2UXA A;  3S9M C;  4RYA A;  4GVO A;  4THI A;  2VT5 A;  3VE1 B;  5F24 A;  3RY3 A;  4FOR A;  1DOT A;  3MBP A;  5ET6 A;  1MG1 A;  2CZK A;  5A5X A;  1LBW A;  3G3H A;  1OVB A;  2WBD A;  5EQ8 A;  3PUY E;  2ANJ A;  4PAI A;  4ZE8 A;  2VGQ A;  1TWY A;  5DEX B;  2OBG A;  3MVX A;  5HM4 B;  1B3G A;  1LBZ A;  1NNP A;  3KOT A;  1OQH A;  1P1U A;  4EXL A;  3MUQ A;  5CMC A;  4KYD A;  4YB5 A;  3I5O A;  3PD8 A;  4FAT A;  4ZE9 A;  4U4S A;  1JP4 A;  1D4N A;  2P3N A;  4NN3 A;  2XXX A;  2ZZX A;  1LBY A;  3ILT B;  4QRZ A;  1US5 A;  1LEV A;  3V8X B;  3PPO A;  3RTF B;  1UIV A;  4F22 A;  5ELV A;  1IQ7 A;  3SKP A;  4HE1 A;  4OVT A;  4YAH X;  1FPJ A;  3MJN A;  1Y3N A;  1URG A;  4YMB A;  2B65 A;  4DCY A;  4IO5 A;  2PYY A;  2V3T A;  4RPN A;  4IY6 A;  4IB2 A;  4JBZ A;  5DVI A;  2Z22 A;  2ZYM A;  1SBP A;  4G68 B;  5EHM A;  5L9M A;  1K9Y A;  1B1H A;  1RDX A;  1AIV A;  4IO6 A;  1ZBM A;  2HPG A;  4OVJ A;  4PCD A;  3G3I A;  4GXS B;  4KR5 A;  4IO4 A;  4DZ1 A;  2OWZ A;  4R75 A;  4U4X A;  3C36 A;  4ELQ A;  5ICQ A;  3VXB A;  4R72 A;  3K6U A;  3OSR A;  3O2A A;  3T93 B;  5HBC A;  1SW4 A;  1OVT A;  1XOC A;  4MF3 A;  3RNN A;  5H8F B;  1B46 A;  1MY4 A;  4NMY A;  1P99 A;  3IAZ A;  2KR0 A;  4EUO A;  4N91 A;  3TFL A;  2Q74 A;  3E13 X;  5I56 B;  1NL5 A;  5H8F A;  5EYH A;  4H45 A;  1R9Q A;  2F3D A;  3FJG A;  1UTB B;  1Y3P A;  5I56 A;  1EYJ A;  3FXU A;  4EF2 A;  2RF1 A;  4RPO A;  1MM7 A;  5M2V A;  1QKB A;  2G93 A;  4EQ9 A;  5L9S A;  1MXV A;  2ONR A;  4WXJ A;  4NGU A;  4FIM A;  4IO2 A;  1P1O A;  2HAU A;  4DXU A;  2ABH A;  3K02 A;  4GWS A;  4PP0 A;  1FBD A;  2DXR A;  3LSX A;  1NNF A;  4N07 A;  2NWJ A;  3TKD A;  3FV2 A;  4GWY A;  5CC2 A;  4UAB A;  1NNT A;  2DXY A;  1B40 A;  3UK4 A;  1Z7M E;  4P0G A;  4QXD A;  4M1V A;  4OWD A;  3MYU A;  3RQT A;  2R71 A;  3MP1 A;  4ZZA A;  2XXH A;  4H67 A;  4PFT A;  1IEJ A;  2DS9 A;  2DP8 A;  3B8B A;  1CE2 A;  4OTE A;  1Y4C A;  2I4B A;  4PTK A;  2ESN A;  1R6Z A;  3VLV A;  3L6G A;  3TYH A;  2M8C A;  3KFM A;  3VLW A;  3PMX A;  2XX9 A;  3DLN A;  1GGG A;  1P1N A;  2VD3 A;  4OES A;  2XD3 A;  2DWJ A;  4EDP A;  5H8H B;  4QFP A;  1GVC A;  4YZZ A;  3H3G A;  4BDQ A;  3GLB A;  3R6U A;  1Y20 A;  1JQF A;  5H8H A;  5I58 A;  4H5F A;  2XWI A;  3RLF E;  4BDR A;  5I2K A;  3FXR A;  2HZL A;  4PFY A;  2PT2 A;  2PFY A;  1FJ9 A;  1MY3 A;  4F31 B;  4OFO A;  2I48 A;  5B7D A;  1LCF A;  1JVY A;  1Y4T A;  2R8T A;  3FBP A;  2QS1 A;  4NF4 B;  2UVJ A;  3FVG A;  1MM6 A;  4FJP A;  2VHA A;  4PDH A;  2O1M A;  4MEV A;  2V84 A;  3PU5 A;  3PPN A;  3M3L A;  2RCB A;  2AIX A;  3GZG A;  4I3Y A;  4NF4 A;  4F39 A;  5CBR A;  4N17 A;  3Q27 A;  4H8J A;  1S50 A;  3LBS A;  1MPB A;  5L8D A;  2XXU A;  4F19 A;  3TEL A;  2X7Q A;  3DEL B;  3DP8 A;  2PCR A;  2QPQ A;  3H6U A;  4H8I A;  1FW0 A;  2O68 A;  2UVH A;  3QSL A;  3UIF A;  4PFU A;  1EZP A;  1NH7 A;  1B5H A;  4EQ7 A;  2HQ0 A;  1QUJ A;  4GF8 A;  4RK9 A;  1OQG A;  1FBG A;  1LBV A;  3MWB A;  4MH5 A;  1B7H A;  3MPK A;  3OEM A;  1PB7 A;  3SET A;  2W7Y A;  5AA2 B;  2WBB A;  5TP9 A;  2BJJ X;  1A55 A;  2E0S A;  1YCJ A;  5BWJ A;  3UA8 A;  2AL5 A;  5AA2 A;  1I6Q A;  1Q9D A;  4KD5 A;  2UVI A;  4DXB A;  3KBR A;  2DE3 A;  3JZJ A;  5FHN A;  1O64 A;  1B4Z A;  3BFU A;  5I5P A;  4JWO A;  1JEU A;  3C33 A;  3OEL A;  2ZNT A;  3E9X A;  1F9B A;  3DP6 A;  4NQ8 A;  3CSG A;  4GWW A;  3ZKL A;  4MCO A;  4MFI A;  3LSF B;  4H5G A;  3CFL A;  2O7I A;  4JWX A;  1JW1 A;  1IMA A;  4BDM A;  2X26 A;  1EZO A;  2Y7I A;  4PF8 A;  3OEK A;  4PBQ A;  3K4U A;  3ZSF A;  1I6A A;  5EQA A;  2ZZV A;  4NHB A;  5ISU A;  2AL4 A;  2BJI A;  5K2X A;  1LST A;  5K2Y A;  5IKB A;  5ESY A;  5DVJ A;  3PMW A;  3RYD A;  2Y7R A;  3MZ1 A;  1IUD A;  4FAJ A;  5FHM A;  1IIW A;  1MPD A;  2UVG A;  5ET7 A;  1T0K A;  4G4P A;  1FPK A;  4I8C A;  1YPN A;  1ZIU A;  3H6V A;  2Q89 A;  2XXT A;  3S9N C;  4EQB A;  1PB8 A;  3MZ9 A;  4E0X A;  5CBS A;  3U92 A;  1BIY A;  5I2N B;  2B3F A;  2YLN A;  2Z8E A;  2F97 A;  4NF0 A;  3PGF A;  1FBE A;  5I2N A;  4XEQ A;  1DTG A;  4O3C A;  4OMB A;  3Q28 A;  3IJO B;  4U21 A;  3IOR A;  3O97 A;  2Y7W A;  2CMO A;  3O66 A;  3U1O A;  3H6T A;  4PE3 A;  2HXR A;  1D9Y A;  3K1N A;  4X9T A;  3GBA A;  2G29 A;  1INP A;  1S7Y A;  3HHF A;  2IEE A;  4WEP A;  4ZED A;  2HCA A;  4QFN A;  1OLA A;  1A40 A;  4P47 A;  2Y7P A;  1MQI A;  3Q25 A;  1B1X A;  5AA3 A;  1FPE A;  3UP9 A;  4R2B A;  2HXW A;  3KG2 A;  1QUK A;  1MRP A;  4EF1 A;  4F2Q A;  4OEV A;  4Z7E A;  2ZXT A;  4NF6 A;  1P1W A;  4P8B A;  2I0B A;  3TEP A;  1EU8 A;  4G68 C;  5FBP A;  3V83 A;  4HE2 A;  1ZLQ A;  3H6W A;  4XIG Q;  3B7D A;  1SYI A;  3G3F A;  2Y5K A;  2XHD A;  3N6U A;  4MNI A;  4XKQ A;  5KCJ A;  3P7I A;  1MS7 A;  1N0T A;  3VDF A;  3O28 A;  4OVQ A;  3CVG A;  5IZ1 A;  4XFE A;  1N3X A;  1NMU A;  2I0C A;  1ZMG A;  2F34 A;  3O6G A;  1EYI A;  2Y7K A;  3TTK A;  1VDW A;  2XXQ A;  1FTJ A;  2HEU A;  3MVZ A;  5CMK A;  1FPG A;  4BLA A;  2D3I A;  5B70 A;  5IAI A;  4KYS A;  1FPF A;  4O94 A;  4ECF A;  4XKR A;  4H0W A;  3CR9 A;  2WX9 A;  5L9O A;  3UGW A;  4LVQ A;  1FCK A;  4N4U A;  4U22 A;  4QFK A;  1J1N A;  1BP5 A;  4P0I A;  4R2F A;  4AS5 A;  5DVF A;  1QUL A;  4OYV A;  4F3P A;  3KEI A;  4F1Y A;  3OXN A;  4N81 A;  3MST A;  4PET A;  2B4M A;  4QSD A;  1NV4 A;  1USY E;  3DP4 A;  4JVI A;  4MX6 A;  5I3S A;  3D4C A;  4KCD A;  2Q88 A;  4GWX A;  5T3J A;  2F78 A;  3B6Q A;  4FEC A;  1H76 A;  2R6G E;  5DEX A;  1O7T A;  5IGA A;  1IME A;  3BIH A;  4F1V A;  3W9W A;  4XTC Q;  1NUY A;  2PBW A;  4G8H A;  3VXC A;  2LAO A;  4DIG A;  3O6H A;  3BIG A;  3EHU A;  3QYT A;  5AA1 A;  2CZL A;  3USD A;  4PFB A;  1DTZ A;  1MQH A;  2ZNS A;  1A7L A;  3U93 A;  1IXG A;  2GQ1 A;  2PMS A;  2XXI A;  3UN6 A;  4X8R A;  1ZKB A;  1VFE A;  5CRY A;  4ZEB A;  2NVU B;  1BLF A;  2E1S A;  2QVR A;  5A5L A;  4DE8 A;  1H3D A;  2KQZ A;  1SPI A;  5J1D A;  1XVX A;  2ZZW A;  1FQB A;  5IZZ A;  3MW0 A;  3MVY A;  3KBZ A;  4GWZ A;  4G68 A;  3CRB A;  4POX A;  2YPN A;  1QGX A;  4PFR A;  2O7U A;  1SI1 A;  4KPT A;  4OET A;  1WDN A;  4O8M A;  1AOV A;  3A29 A;  5H8N B;  3S9L C;  2V3Q A;  1FJ6 A;  1IMB A;  3K6X A;  3ZS6 A;  1IMF A;  3FD3 A;  3N5L A;  1G0I A;  4HS7 A;  5H8N A;  3FAS A;  5ICT A;  3KN7 A;  1Z7N E;  1URD A;  4ELP A;  2ALU A;  1FBH A;  1B6H A;  3ROJ A;  4ELR A;  2UYF A;  2PT1 A;  3PD9 A;  1SI0 A;  4O7I A;  3OEN A;  4PQJ A;  3RPW A;  1B3F A;  3H06 B;  1DPE A;  1UTB A;  4C1U A;  2GRV A;  3A09 A;  3RT8 A;  2FBP A;  5IZ3 B;  1N76 A;  3CHG A;  4R74 A;  4OHN A;  2OJT A;  3IFA A;  5I59 B;  1FPI A;  4C1T A;  1TFD A;  4NF8 B;  2P0S A;  4GL0 A;  1LLS A;  1GR2 A;  2O69 A;  2V3U A;  5KDT B;  3K1P A;  1POT A;  4NX1 A;  5H8Q B;  5I59 A;  1A54 A;  4H46 A;  4NF8 A;  4IO3 A;  4WKM A;  1SD3 A;  4F29 A;  1PEB A;  1FPD A;  5KDT A;  1XC1 A;  3O6I A;  4QBA A;  4PGN A;  3N26 A;  1SQY A;  3IOW A;  4P1E A;  1NV7 A;  3IB2 A;  1TT1 A;  1FSA A;  4EXK A;  3C4M A;  1VE4 A;  4MLQ A;  1I69 A;  3KN8 A;  3TCH A;  3B50 A;  1KA0 A;  4QHQ A;  5LTC A;  4NAP A;  1A8F A;  2CZI A;  3ODB A;  3V89 B;  1JVX A;  3A3U A;  1B05 A;  3IK6 B;  4OEN A;  4ESW A;  4N13 A;  3ISP A;  3OO9 A;  1POY 1;  3TPA A;  4ZS9 A;  1QJM A;  3EPE A;  5AA2 D;  2FIX A;  1B5J A;  3CI8 A;  3TMG A;  3TTL A;  1MXU A;  1NV6 A;  4GIZ A;  4HTG A;  3T66 A;  4ZEC A;  3N94 A;  2ZYK A;  4JVD A;  4LZ5 A;  1DBZ A;  2H99 A;  5EHS A;  3V5A A;  3KZG A;  1SW2 A;  2H98 A;  3OD7 A;  2A5T B;  4PAF A;  4LZ8 A;  4TLM B;  1LAG E;  3KJ7 A;  5HPQ A;  4POW A;  4LZ7 A;  4OVP A;  1H45 A;  1AWB A;  4Q0C A;  2OZZ A;  2HHM A;  3HFU A;  4N8Y A;  2R9J A;  1FQE A;  3KOS A;  3TQW A;  1Y9U A;  3PUW E;  2DQV A;  1NKX A;  3Q29 A;  1MQD A;  3KGC A;  3FJ7 A;  4HE0 A;  2FHY A;  2QRY A;  3SEX A;  1GV8 A;  4R6Y A;  5CM6 A;  1CNQ A;  2XXY A;  1MY1 A;  3TZA A;  1OIB A;  3EN3 A;  3FJM A;  1Y1Z A;  4M4G A;  1B58 A;  4N15 A;  3IFC A;  3QMF A;  1FQA A;  1PBP A;  3C35 A;  1PDA A;  1QW0 A;  3IOT A;  4RA1 A;  1QUI A;  3FIR A;  4OQO A;  1H44 A;  1LBC A;  3OOA A;  1LB9 A;  4X1B A;  4KI0 E;  4OA4 A;  3SEY A;  4AQ4 A;  3HCQ A;  4XXU A;  2X7P A;  1LFI A;  4MNP A;  2F6P A;  1WOD A;  2CEX A;  3HO7 A;  3SEW A;  1M5E A;  2I3W A;  2P1S A;  1BK4 A;  1SYH A;  4OXV A;  2FIE A;  3C32 A;  1IXH A;  1B9J A;  2ONS A;  3FGS A;  5EQ9 A;  4GRK A;  2XXR A;  3E79 A;  2RIN A;  2WEF A;  4ZEF A;  4OEU A;  4F18 A;  3Q26 A;  1EH3 A;  3THI A;  1QVS A;  3LV0 A;  2QMW A;  4DI3 D;  2Q8J A;  2REG A;  4JXI A;  3EF7 A;  3S9E A;  3OO6 A;  1MXZ A;  4QSC A;  2QL3 A;  4IGR A;  3UOR A;  3W15 C;  4GOT A;  2Y84 A;  3MP8 A;  3SEU A;  5DYH A;  1MY0 A;  2DWH A;  1I6B A;  2QVU A;  3T9U A;  4OAN A;  3TTM A;  2QMX A;  4NG7 A;  2DYX A;  3H4Z A;  2OLB A;  5JTY B;  3KN3 A;  1NNK A;  5CI5 A;  1RYX A;  1B3E A;  4BDO A;  4OFL A;  5ITO A;  3TQL A;  2VOZ A;  2Q2A A;  4NE4 A;  2H4I A;  5EQ7 A;  3MPL A;  3CIJ A;  1L5T A;  1MPC A;  3U72 A;  2GHB A;  3H03 A;  4MJO A;  3R7X A;  1NI9 A;  1SW5 A;  4I1D A;  1B51 A;  1LB8 A;  3CSB A;  2H5Y A;  3FAT A;  4ZDM A;  3DM0 A;  3KSJ A;  3I6V A;  3FZV A;  2Q9T A;  4ZEI A;  3KC0 A;  4MIJ A;  3C9H A;  2B3B A;  3TCG A;  3ECR A;  4H1X A;  3LSW A;  2WKY A;  1D9Q A;  2THI A;  3IL1 B;  4LUB A;  1LGB C;  1LCT A;  3A3C A;  3D1R A;  4X04 A;  2NUV A;  4UAC A;  1D9V A;  2I4C A;  2O84 X;  4R6H A;  4UA8 A;  4ND9 A;  1ATG A;  1FRP A;  1CB6 A;  3SES A;  2Z8D A;  4YIC A;  4U2R A;  2XWK A;  4I9D A;  3L6H A;  5ET5 A;  2O1L A;  3C31 A;  3JV9 A;  1H43 A;  4LQ5 A;  4MMP A;  2P3V A;  4YU0 A;  1Y3Q A;  4PGP A;  3E4R A;  4GD5 A;  2YJP A;  1VSO A;  2L5V A;  1FTM A;  4YKP A;  3CG3 A;  5KZT A;  4R9G A;  1K9Z A;  4JSD A;  1LBB A;  1P1Q A;  3EQ1 A;  3PTY A;  3CG1 A;  1OMP A;  1ZU0 A;  2QS2 A;  1LAX A;  3LUZ A;  1HSE A;  4E0W A;  1M5B A;  1RDY A;  1A99 A;  2OK2 A;  3HST A;  4RJZ A;  5CMM A;  1IIT A;  3FV1 A;  3N6T A;  4FBP A;  4GBW A;  4QFO A;  2FYI A;  2DDK A;  4KHZ E;  3QXM A;  3B6T A;  1NV1 A;  2F7A A;  3IJX B;  3ILU B;  3IO4 A;  5EYF A;  2A5S A;  1Y1M A;  1B5I A;  1B0L A;  4YB6 A;  4NWC A;  1XT8 A;  1ZTY A;  3M3F A;  2ZMB A;  3K2D A;  1UIU A;  3RT6 B;  1N04 A;  1II5 A;  5I57 B;  1NUZ A;  5A5X B;  5I7I A;  2F6G A;  4G2Z A;  2FA7 A;  3MQ9 A;  2KLF A;  3IB1 A;  1B3L A;  4FED A;  5I57 A; 
#chains in the Genus database with same CATH homology
 2WBB A;  5ET8 A;  2CZH A;  1LBX A;  3U65 A;  4MHF A;  4NX1 A;  4I40 A;  4H46 A;  5J16 A;  4JVC A;  1Q9D A;  4HXV A;  1FPD A;  5DW8 A;  2DE3 A;  2DVZ A;  4QBA A;  5I5P A;  4PGN A;  4F1U A;  5LDZ A;  2OX3 A;  4P1E A;  1NV7 A;  4IR8 A;  4MNC A;  1FSA A;  1YYZ A;  1IMD A;  4NQ8 A;  4GWW A;  4MCO A;  4P56 A;  4HCY A;  1FPL A;  1FBC A;  3B50 A;  1KA0 A;  2DE4 A;  2PFZ A;  5LTC A;  1YXI A;  1IMA A;  4NAP A;  2CZI A;  1FPB A;  4PF8 A;  4PBQ A;  4XF5 A;  1NV3 A;  5EQA A;  2ZZV A;  3EKI A;  4NHB A;  2BJI A;  5ESY A;  3SZP A;  4G61 A;  3RYD A;  3ISP A;  2CEY A;  2FIX A;  5IM2 A;  5ET7 A;  4GX4 A;  1FPK A;  1RDZ A;  2WYK A;  1NV6 A;  1FBP A;  3FXB A;  4KXP A;  1NV2 A;  2XWV A;  4JVD A;  4GWU A;  1DBZ A;  4NF0 A;  1FBE A;  5JK4 A;  4XEQ A;  4PAF A;  2Q8M A;  4PBH A;  1KA1 A;  1G0H A;  2QFL A;  2QVV A;  4PE3 A;  2HXR A;  2VT5 A;  4PFI A;  5F24 A;  4OVP A;  5ET6 A;  2CZK A;  1AWB A;  1LBW A;  5IZ3 A;  4X9T A;  2HHM A;  3HFU A;  4N8Y A;  2WBD A;  5EQ8 A;  1INP A;  2HZK A;  4PAI A;  4P1L A;  4P47 A;  4GX3 A;  1LBZ A;  4HE0 A;  2FHY A;  1FPE A;  1KZ8 A;  5CM6 A;  1CNQ A;  3W9V A;  1JP4 A;  2P3N A;  4N6D A;  4NN3 A;  2F3B A;  4OVR A;  4N15 A;  2ZZX A;  4I3E A;  1LBY A;  3IFC A;  4P8B A;  3QMF A;  1LEV A;  4HE1 A;  4OVT A;  1FPJ A;  5FBP A;  2Y5L A;  4HE2 A;  1NUW A;  4MAG A;  2Y5K A;  1FTA A;  4MNI A;  4OA4 A;  4MNP A;  2CEX A;  4OVQ A;  5IZ1 A;  4XFE A;  1YZ0 A;  1K9Y A;  1RDX A;  1EYI A;  1DCU A;  1BK4 A;  1VDW A;  2HPG A;  4PCD A;  2FIE A;  1FPG A;  5EQ9 A;  2OWZ A;  3E79 A;  2XWO A;  2WEF A;  1EYK A;  4F18 A;  1FPF A;  4O94 A;  3LV0 A;  4DI3 D;  2KR0 A;  2WX9 A;  4N91 A;  2Q74 A;  4N4U A;  1DK4 A;  2WYP A;  5EYH A;  2MKZ A;  4H45 A;  4O7M A;  2F3D A;  4AS5 A;  2QVU A;  2F5X A;  4OAN A;  1EYJ A;  2B4L A;  4NG7 A;  4N81 A;  3MST A;  4PET A;  2B4M A;  1NV4 A;  4GBV A;  1XI6 A;  4JVI A;  4MX6 A;  4NGU A;  5I3S A;  5EQ7 A;  4GWS A;  4MJO A;  4GWX A;  5T3J A;  1FBD A;  1NI9 A;  3T0J A;  4GWY A;  4UAB A;  4P3L A;  1IME A;  2VPN A;  5IGA A;  3BIH A;  4F1V A;  3W9W A;  4QXD A;  4M1V A;  1NUY A;  2Q9T A;  3MYU A;  2FVZ A;  4AS4 A;  3BIG A;  1IMC A;  3KC0 A;  4MIJ A;  4PC9 A;  1D9Q A;  4DI4 B;  3B8B A;  4PFB A;  4PTK A;  3D1R A;  4X04 A;  3KC1 A;  2GQ1 A;  4PDD A;  4X8R A;  1NV5 A;  1FRP A;  2VPO A;  3RPL B;  4YIC A;  2XWK A;  2QVR A;  5ET5 A;  5A5L A;  4N8G A;  4MMP A;  2P3V A;  1NUX A;  2KQZ A;  1SPI A;  2XA5 A;  5J1D A;  2ZZW A;  4YZZ A;  5IZZ A;  3RPL A;  4PGP A;  2L5V A;  3KBZ A;  4GWZ A;  1FBF A;  3E78 A;  2XWI A;  3NOH A;  1K9Z A;  2HZL A;  4HCW A;  3GYY A;  1QGX A;  2PFY A;  2JJK A;  4PFR A;  1NV0 A;  1FJ9 A;  3T1B A;  3PTY A;  2DE2 A;  3LUZ A;  4O8M A;  1RDY A;  2R8T A;  3A29 A;  3FBP A;  4PAK A;  2V3Q A;  1FJ6 A;  1IMB A;  4OVS A;  4FBP A;  4GBW A;  1IMF A;  4PDH A;  4MEV A;  1G0I A;  5EYG A;  2DDK A;  4I3Y A;  4GX6 A;  1FBH A;  4N17 A;  3ROJ A;  1NV1 A;  4F19 A;  2V4C A;  4N6K A;  2PCR A;  4O7I A;  2QPQ A;  1NUZ A;  5I7I A;  4P9K A;  2FBP A;  5IZ3 B;  3CHG A;  4PF6 A;  1FBG A;  1LBV A;  3IFA A;  4LN5 A;  1FPI A;  2XXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...