2VPOA

High resolution structure of the periplasmic binding protein teaa from teaabc trap transporter of halomonas elongata in complex with hydroxyectoine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
311
structure length
307
Chain Sequence
DNWRYAHEEYEGDVQDVFAQAFKGYVEDNSDHTVQVYRFGELDIMEQTQNGILQFVNQSPGFTGSLIPSAQIFFIPYLMPTDMDTVLEFFDESKAINEMFPKLYAEHGLELLKMYPEGEMVVTADEPITSPEDFDNKKIRTMTNPLLAETYKAFGATPTPLPWGEVYGGLQTGIIDGQENPIFWIESGGLYEVSPNLTFTSHGWFTTAMMANQDFYEGLSEEDQQLVQDAADAAYDHTIEHIKGLSEESLEKIKAASDEVTVTRLNDEQIQAFKERAPQVEEKFIEMTGEQGQELLDQFKADLKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport
molecule keywords PERIPLASMIC SUBSTRATE BINDING PROTEIN
publication title 1.55 A Structure of the Ectoine Binding Protein Teaa of the Osmoregulated Trap-Transporter Teaabc from Halomonas Elongata.
pubmed doi rcsb
source organism Halomonas elongata
total genus 117
structure length 307
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2vpoA00
3B50A 4MNPA 4PGPA 3GYYA 4X04A 4NQ8A 4PCDA 4PBHA 4X8RA 2WX9A 4PDDA 4P47A 4XF5A 2HZKA 4PF6A 4XFEA 2ZZXA 4PAFA 4P9KA 4XEQA 4PFIA 4OVSA 4N6DA 4NGUA 4O94A 2ZZWA 2PFYA 4PC9A 4LN5A 3FXBA 2XWVA 4N8GA 2XA5A 5I5PA 4OVTA 4MAGA 4PDHA 4NHBA 4O8MA 4N8YA 5IZZA 2XXKA 2CEXA 2XWIA 2CEYA 2V4CA 4N15A 4P3LA 2HZLA 2VPOA 4MNIA 5IGAA 5IM2A 4NAPA 4NX1A 4YZZA 4PFRA 3U65A 4P1LA 4OVRA 4N6KA 4MNCA 4OVPA 2XWOA 4PFBA 4P8BA 4PBQA 4PGNA 4PAIA 2WYKA 4MMPA 5I7IA 5CM6A 4P56A 4PE3A 4NN3A 5LTCA 4OANA 4OVQA 4MHFA 4OA4A 4MX6A 4YICA 2VPNA 4N17A 2XWKA 4DI4B 4MIJA 4PETA 4PF8A 4O7MA 2HPGA 4DI3D 4MCOA 4PAKA 4NG7A 2WYPA 2PFZA 4MEVA 4N4UA 4UABA 4NF0A 4P1EA 2ZZVA 4N91A
chains in the Genus database with same CATH superfamily
2RC8A 3B50A 2VD3A 3W9WA 5ICQA 4H65A 2OLBA 1LAHE 4PDDA 2GHBA 3EHUA 5DVIA 3U93A 1DMBA 1SW1A 3DELB 4LZ5A 4F3SA 4R9GA 4G8HA 3VXBA 3TTKA 1BTJA 4YKPA 4ESWA 4JVCA 3FJ7A 1LBWA 5K2XA 1N7WA 3OELA 1MRPA 1IMFA 1RYXA 4G8MA 2KR0A 5I56A 2WBBA 3VVFA 1BIYA 4PFUA 4FEDA 5IAIA 1HSLA 5IZ1A 1URGA 1AWBA 2VGQA 1OQHA 3M3KA 3QK6A 4POXA 4JSDA 4NAPA 4YZZA 1VR5A 2F6GA 4I3EA 4ONYA 3W15C 4P8BA 1FTOA 3C34A 5A5XA 1NL5A 4BDLA 5CM6A 2F97A 1Y3PA 3D1RA 4JVIA 2VOZA 1Y9UA 4MFIA 3OXNA 4NEDA 3KN3A 4DE8A 4JVDA 1QKBA 3BKIB 1JETA 4E0XA 1A7LA 1FTMA 4O7MA 4XXUA 3RPWA 1JW5A 2CZIA 5M2VA 2R6GE 5ITPA 3FXQA 5F24A 4GWYA 3USDA 1IXCA 1I69A 2P2AA 3MZBA 3RUMA 3H6VA 4DDDA 4NQ8A 3TAJA 4HXVA 2ONRA 2F78A 4OERA 3IOUA 3QUJA 5AA2D 2IEEA 4BDRA 4JWXA 3E78A 4X48A 3IK6B 1B46A 1SYHA 3TTMA 1J1NA 3R26A 2NUVA 4C0RA 4OESA 2AIXA 1O7TA 1FPLA 4IO2A 4M1VA 4O94A 2F5XA 2B4MA 3QIMA 3LSXA 4YAHX 4N8GA 3FGSA 1IXGA 3N6TA 1A8EA 1B7UA 3PMXA 3PMVA 1LB9A 3QYTA 4ZZEA 4F22A 3LC8A 2XXKA 4XKPA 4XIGQ 1A54A 4N15A 4P3LA 4LZ8A 2VPOA 4I62A 3TCGA 4RJZA 2KLFA 3K6UA 3KBRA 2QVRA 3LSLA 4WEPA 3JYRA 4PFTA 1MY3A 4YU0A 1NNTA 4WEDA 4FORA 2VHAA 4YB6A 1NV2A 1B2HA 2QVVA 1NFTA 1B4ZA 3GBBA 4DXUA 4NF6B 1GVCA 4ELQA 4KYDA 1DPEA 4H0WA 4IO6A 4KPTA 3Q27A 4YICA 3PMWA 1NUWA 2Q2AA 4MCOA 1JNFA 2Y5LA 3PD8A 3MVXA 4I3YA 3C36A 2DYXA 4U1OA 1QULA 3E3KA 3M3LA 1MXXA 4FEBA 1FPBA 1N3WA 2QPQA 3KGCA 1FPDA 2GFEA 3FD3A 1A99A 1PB9A 2DXRA 3ROJA 4TLMB 1DBZA 3EKIA 3TQLA 1G0IA 3RY3A 1YCJA 3EPEA 4IO4A 3VV5A 1EYKA 4NGUA 3PUWE 1NMUA 1NH7A 2OJTA 3IFCA 1ELJA 3KSJA 4K3FA 2DVCA 1VE4A 2XXUA 2XA5A 3O6IA 1LCTA 1FQBA 3TKDA 3QSLA 4WKMA 1F9BA 1RDXA 4NF6A 5IGAA 1PC3A 1S9TA 1FPEA 3DM0A 1LBYA 1K9YA 3N26A 4G8NA 3S9LC 3OEKA 1MY0A 4H5GA 4ZE9A 2DP8A 3UORA 4LATA 4MMPA 1XI6A 5I7IA 3G3HA 1Z7NE 5FHNA 2UVGA 3TPAA 3E9XA 4PQJA 4MHFA 3ILTB 3SKPA 4BDNA 2Z8FA 4U22A 1JEUA 3T0JA 3SETA 3KFMA 4UABA 5TU0A 1N0TA 4NF8A 4F31B 1IUDA 3B6TA 1IITA 1Z7ME 5DEXB 1M5FA 3HV1A 3E13X 2BJIA 3BIHA 3I3VA 1B3HA 1PB8A 1B5HA 1LFIA 3R7XA 4HS7A 4ZEDA 3KG2A 3FIRA 3K0VA 3TCFA 3CFLA 3A3CA 1XT8A 2F35A 2ZZXA 3LUZA 3IO4A 3FXRA 4XEQA 2I48A 4ISUA 3T96B 2V3UA 3IB0A 2FIXA 4C1UA 4PFWA 3Q28A 2Q9TA 1VSOA 2GQ1A 1IXIA 5H8HB 4EQ7A 5I3SA 4F3GA 5L9MA 2CEXA 4GXSB 1LFHA 3WAEA 1NNFA 2O7IA 4RY1A 2DWIA 1NUZA 2DE2A 3PUYE 3MBPA 3VFJA 2QL3A 1SW2A 4F2OA 3TEPA 3H03A 2F6PA 2NXOA 3B6QA 5DEXA 4MX6A 3H4ZA 1Y1ZA 1B0LA 1AL3A 2PMSA 1DTGA 4HTGA 1FBHA 4I1DA 3TUSA 1WDNA 4QFPA 2XHDA 1FTJA 1NV1A 3EQ1A 2UYFA 3VDFA 2FIEA 1SW5A 2UYEA 2ZYKA 3RPLB 1SI0A 3RT8A 5ET7A 4ELRA 2F7AA 3HPIA 2F3BA 5H8HA 2X7QA 2HXRA 1SQYA 4GOTA 3BBRA 1IMBA 3LR1A 3I6VA 4NWCA 2VD2A 3FXBA 5CMMA 2O69A 3TODA 1RDZA 4M4GA 3VXCA 3A09A 1JEVA 2I0BA 4IO7A 1FRPA 3TELA 3U94A 1QGXA 2H5YA 2OK2A 1K9ZA 2HZLA 1B3GA 1P1NA 1R6ZA 2O6AA 5TP9B 1CNQA 2ZMBA 2E0SA 2DE4A 4OETA 4U21A 2ZNTA 4N6KA 4MNCA 4QSDA 3O6GA 1IMCA 4PBQA 4OZ9A 5CRYA 1MDQA 4G61A 4E0WA 4NMYA 4QSCA 3EN3A 5AE4A 1OVTA 1TXFA 2Z8DA 5ITOA 3OO8A 4BDOA 5HPQA 4HE0A 1R9QA 2QVUA 1TT1A 3RPLA 4POWA 4U23A 4LVQA 1FQDA 1QUJA 5AA3A 4N4UA 1MM7A 1M5BA 1PBPA 4EF2A 3MUQA 2R71A 2GRVA 2BJJX 2HHMA 3IAZA 1B52A 3PPOA 4LZ7A 3GZGA 1KWHA 4HCWA 1FBGA 1XS5A 3TDJA 3C4MA 1FQCA 3FASA 3KEIA 5DT6A 1D9YA 4ECFA 5TP9A 5I2KB 3T66A 3HO7A 4MAGA 1OMPA 3H6TA 4O8MA 3ZKLA 4KQPA 5EYGA 5F1QA 3TTLA 5CMKA 5I58B 4EF1A 2FNCA 3FXUA 3O6HA 4H5FA 4R72A 2I4CA 4EXKA 1GTKA 2QS3A 1IMEA 3PPQA 3PUZE 4OVPA 1NV0A 1SPIA 2XWOA 1MQHA 1YYZA 1DSNA 1SI1A 3PGFA 1UTHB 2AL4A 3T1BA 4OMBA 1DCUA 3PU5A 5H8QB 1N3XA 1VFEA 4QFKA 4FE8A 4JB7A 2V3QA 1FBPA 3IORA 2HEUA 1BP5A 3NOHA 5EHSA 1MH4A 4PP0A 5ESYA 5HBCA 1IXHA 3CRBA 2B3FA 1JQFA 1EYJA 2ZZVA 1JP4A 5FBPA 1FTKA 3KJTA 3C32A 1OIBA 1UTBB 3MP6A 1FPFA 1NUXA 5K2YA 3LUYA 4H46A 4GWWA 1FPGA 4P0GA 4KFQA 1USYH 3OMBA 4KCCA 3OOAA 3VVEA 1JVYA 3HFUA 1P99A 4PAFA 3RN8A 2IA4A 3U8QA 5I58A 1AIVA 4OQOA 3IX1A 1XVXA 4G68B 2HQ0A 1FTLA 2QJEA 5JTYB 3TQWA 5LOMA 2PT1A 3FVOA 2HAUA 2OCUA 1B3LA 3TTNA 1UTHA 1B1XA 3MQ9A 3O97A 2P1SA 1XOCA 4HE1A 3MVZA 3QMFA 5H8QA 1Y4TA 1B05A 1A8FA 4AB5A 4EDPA 1Q35A 3V8XB 5I2NB 3E4RA 4G2ZA 1H3DA 5AA4B 4DZ1A 2WYKA 1ZKBA 4R2BA 3SZPA 3E79A 3ILUB 1ATGA 4F3BA 1B4HA 4G68C 3TTRA 1UTBA 2CZKA 1FQEA 5CMBA 2R9JA 4N07A 3ZKKA 4DI4B 4KHZE 4ZECA 4U2RA 4DI3D 5EYHA 2PFZA 4ESXA 3MJNA 2HAVA 3C9HA 1FBFA 4N91A 3DP8A 1MQJA 1MXVA 4PGPA 3OD7A 4F3PA 3GYYA 4G68A 5CBRA 4GL8A 3SEWA 2WX9A 5JTYA 1B32A 5IKBA 4ZEIA 4NF4B 1URSA 4EUOA 4JDFA 1QVSA 2FA7A 4XKRA 4PFIA 2ZYNA 2Z23A 1XC1A 2WKYA 1MQGA 1ZJLA 1NV3A 1OQGA 2G29A 2ZZWA 1Y3QA 4QXDA 4ZZAA 4GRKA 2P3VA 3UA8A 2AL5A 2VT5A 2V3TA 4IO3A 5I2NA 3TMGA 1WODA 3JV9A 3FVNA 1IMDA 2Q89A 1POY1 4LA9A 3W9VA 2WBDA 1P1UA 3M3FA 3IFAA 1MM6A 4N8YA 5IZZA 2V4CA 1ZBMA 4AQ4A 5KCJB 1PDAA 2PX1A 4HCYA 4THIA 4R73A 3OSQA 1ZU0A 4P1LA 4X1DA 3ODBA 2HCAA 4BLAA 1A40A 3MP8A 4Q0CA 1IIWA 1RYOA 4IO5A 4Q30B 1A55A 1I6BA 2Q8MA 2ANJA 2XXIA 1M5EA 4GFRA 2XWKA 4R6KA 2Y7RA 1FBDA 3IJOB 3IOVA 1XHYA 4NF4A 1AMFA 4OVJA 4L17A 5JEIA 1NKXA 1BLFA 1D4NA 1MPCA 1GR2A 3MVYA 4N13A 4N6PA 4U4SA 4YKIA 1B0HA 5EQAA 4QRZA 2GH9A 2F7CA 2OX3A 3AXFA 2FYIA 1R9LA 2PT2A 1SD3A 3N6UA 2ABHA 1TFAA 3CHGA 4Z0IA 5KCJA 4HW8A 1YPNA 1EYIA 3R6UA 4OFJA 2Y7IA 3HN0A 4F18A 4TLLB 3QAXA 4OVTA 2B4LA 3BFUA 1US5A 1VDWA 3OEMA 5L8DA 2QS1A 3K6VA 2Q2CA 1B3FA 2M8CA 4OTEA 5DTBA 1M5CA 4ELOA 5KZTA 4XKNA 4GWZA 1LBBA 3CI8A 4OVRA 1LAFE 5A5LA 4F39A 4H67A 1B7ZA 2UXAA 1KA0A 5T3JA 1QUIA 2A5SA 5EYFA 4OA4A 4KYSA 4RK2A 1EZPA 5B70A 2VPNA 3S2VA 4PETA 1D3KA 1B9JA 2XXRA 3VLWA 1YAEA 4G4PA 4OEUA 2X7PA 1QUKA 3SESA 3KJ7A 5EQ7A 1G0HA 2DVZA 5FTHA 2H4IA 2QS4A 1MH3A 4O3AA 3CSGA 5H8SA 2XX7A 3OO6A 3ECRA 1LBCA 3FV1A 4PCDA 3G3FA 3D4GA 4X8RA 2I49A 1NV7A 4PFYA 3UP9A 1I6QA 3T9XB 5I59B 4F1YA 2DWHA 4KR5A 4ND9A 4GF8A 4RNSA 4KYEA 3B7DA 4O3CA 4RYAA 4AS4A 1Q1KA 2PFYA 3D4CA 1PBQA 4OEVA 4XKQA 2XXQA 2ZXTA 4GVOA 2PBWA 5KDTB 3H7MA 3C35A 3FVKA 5CI5A 3ZSFA 3CFXA 3FJMA 3KN7A 1FPIA 2REGA 2PVUA 1ZLQA 2XD3A 1LBZA 3FBPA 3HCQA 1O63A 1B58A 3KC0A 5FHOA 1FBCA 4PAIA 2F8DA 1IEJA 3MAMA 1N04A 2A5TB 2CMOA 1B1HA 4MLQA 4OVQA 4OHNA 3HHFA 3O2AA 4DLDA 3CG1A 3MPLA 3L6GA 3MZ1A 4DXCA 2DOJA 1POTA 4GBVA 4FATA 4PE5B 3SDFA 5ISUA 1HSJA 2HXWA 5AA2B 5I59A 2XXWA 2RC9A 2V25A 4UA8A 4MNPA 4Z7EA 1MY2A 2XXVA 2JJKA 2W7YA 3S4UA 1NV6A 1BKAA 3FV2A 4X04A 3SEUA 4U1ZA 4JBZA 1SYIA 5FTIA 3A3UA 4WXJA 4O3BA 3CFZA 1EU8A 3Q26A 2HZKA 4I8CA 1H44A 3LSFB 2KQZA 5KDTA 4PF6A 3MP1A 3S9MC 3FZVA 4GLIA 4OXVA 4FIMA 2ALUA 3O28A 3UN6A 3PV0E 2L5VA 2XWVA 2OWSA 3OO9A 2OWTA 3PPPA 4RPNA 4F1VA 1LB8A 2GHAA 2A5TA 3PTYA 1ZMGA 2O68A 1FPKA 1ZIUA 3C33A 2DWJA 1FW0A 2RF1A 3MW0A 4TQUQ 2WEFA 1I6AA 3LV0A 4DCYA 4NF5B 2DQVA 1PEBA 5AA1A 1JW1A 1NH8A 4P11A 4QSEA 3WAFA 3TYHA 2HFBA 5AA2A 2XD2A 3VE1B 2NWJA 4OANA 5I57B 1MY1A 5IZ3B 4KI0E 2QS2A 3MC2A 4IB2A 1UIVA 1QKAA 4I40A 5H8FB 4R2FA 2P3NA 4GX4A 2DE3A 2CZLA 3PPRA 1B6HA 1CB6A 5DVJA 4AS5A 1XVYA 3SEXA 1P1OA 2PCRA 3IO6A 3T9UA 2OBGA 3OENA 1TWYA 3ZS6A 5H8NB 5DW8A 1MXUA 1UQWA 4RA1A 5ET5A 3O29A 4RXLA 4H1XA 4HE2A 3L6HA 3TFLA 3F11A 3K6XA 4GD5A 1US4A 3PUXE 2X26A 4ZE8A 2Y5KA 4DXBA 4FJPA 3G7WA 1R1NA 4GL0A 4H45A 4NF5A 4XTCQ 3O66A 4P0IA 1LSTA 5I2KA 1AH5A 3K4UA 1MPDA 3RT6B 1D9VA 4DCXA 2XWIA 4RPOA 1Q9DA 3C31A 1D9QA 3HSTA 5I57A 5IM2A 4N81A 2O1LA 5IZ3A 3U92A 2UVJA 4GX6A 4NX1A 2QFLA 3FUZA 4GXAA 3MWBA 4JSOA 1AOVA 4KCDA 5H8FA 1NNKA 2RC7A 1FBEA 1MG1A 1KZ8A 4PE3A 5J1DA 4PTKA 3K00A 5LDZA 1NV4A 2I4BA 1JVXA 4R9FA 3H06B 5H8NA 3U72A 1B51A 4JWOA 3FJGA 1FSAA 2HPGA 4Q5TA 4MEVA 3RYDA 3K2DA 5CBSA 1N7XA 2FVZA 4OFLA 2Z8EA 2UVHA 1FJ9A 3OO7A 1TFDA 2MKZA 4IR8A 1BK4A 3IB1A 2H99A 4ZEFA 1Y20A 2I3VA 1SVXB 4P47A 2O51A 4X9TA 5ELVA 1FJ6A 5B7DA 3A29A 1QJMA 4ZEBA 3VLUA 4X1BA 2NOOA 2H9BA 2G93A 1MY4A 3T22A 1DTZA 1N84A 2DS9A 4QFLA 1II5A 3MVWA 2YJPA 5ICTA 2Y7KA 4FBPA 4QHQA 2Q88A 4F29A 1FPJA 4PC9A 3FVGA 3K1PA 2I3WA 4AB6A 4MLVA 4BDQA 1NNPA 4BDMA 4ZDMA 4U4XA 3THIA 1S50A 1MPBA 3OSRA 2QMWA 3IJXB 1EZ9A 2ZYOA 1YZ0A 3PPNA 4IY6A 3SERA 3B6WA 1H76A 2CZHA 2CEYA 2THIA 3P7IA 4G77A 1ANFA 5DVFA 3KC1A 3K1MA 3I5OA 2I58A 1B7HA 2ZNSA 2I6EA 1GV8A 1USYE 3CG3A 2B65A 4GQOA 5AA4A 2RCAA 3IB2A 4R6YA 1WVJA 1QW0A 3QXMA 3MYUA 2XX8A 4Q8RA 2DSFA 5J16A 3U1OA 4YB7A 2XXHA 3JZJA 4RK9A 3GXAA 2RKMA 3FATA 4ZS9A 1FTAA 1O64A 4QFNA 4NF8B 2QSXA 4KXPA 3EHSA 3Q25A 3CVGA 4UACA 2H25A 1VFDA 2I0CA 4LQ2A 4OFOA 1OLCA 3KSXA 3PUVE 1SDXA 4TOZA 3G3JA 3DP4A 4GWOA 1LGBC 3ONMA 1OLAA 1KA1A 1EH3A 4QFOA 3O9PA 3T9HB 1MXWA 3B8BA 5EHMA 4XFEA 1Y4CA 2D5WA 4ELPA 2QMXA 1MXYA 3K6WA 4P9KA 4EXLA 2DDKA 1P1QA 4IGTA 4OVSA 4KD5A 5BUUA 1LLSA 4IGRA 1URDA 2Y7PA 1MS7A 5ET6A 2B3BA 3IOTA 4GWSA 1MQDA 3MZ9A 2FHYA 3S9EA 1LBXA 4R75A 5HM4B 3KBZA 5DYHA 5I5PA 4NHBA 4MBPA 1H45A 3UIFA 4O7IA 2F3DA 3V83A 3HHGA 4YB5A 5EQ8A 1ZTYA 3VVDA 3RNNA 2Z22A 2R8TA 2F34A 1T0KA 1NV5A 4MH5A 3M8UA 4PFBA 1DPPA 5L9SA 5ET8A 1Y1MA 4F1UA 3RTFB 4FECA 2ZYMA 3SEVA 3G3GA 5BWJA 1SBPA 4OYVA 2XX9A 4YMBA 3V5AA 5F7VA 2FBPA 3SEYA 3QUFA 3VLVA 4LQ5A 3RTWB 4PF8A 4GWUA 4PAKA 4NG7A 3CR9A 4H6DA 2XXPA 3KOTA 4P1EA 5I84A 1DK4A 4YKJA 1MXZA 3GBAA 4MF3A 3K01A 3TZAA 2RINA 4XF5A 5FHMA 1JW4A 1CE2A 2ONSA 4OENA 1INPA 1IMAA 2AYSA 2YLNA 1S7YA 3G3KA 4NE4A 1YXIA 5CC2A 4H8JA 4N6DA 4NWDA 2V93A 2VP1A 3IR1A 4F2QA 1B40A 3UGWA 2DXYA 2QRYA 3KZGA 4QF9A 3PD9A 1NUYA 4EQ9A 2NVUB 2F36A 3RQTA 1N76A 2DWAA 1MDP1 1DOTA 2PYYA 3KOSA 2H98A 1B5IA 2P0SA 4OWDA 1RKMA 4YKKA 1FQAA 3GLBA 4PGNA 1LEVA 1B5JA 1FQFA 2ESNA 4NN3A 3N94A 3H6WA 2YPNA 3IOWA 3CIJA 3RLFE 3MPKA 2E1SA 1OVBA 3ISPA 3K02A 3KN8A 3K1NA 4LONB 4N17A 2Y84A 4MIJA 1P1WA 1YTVA 4GIZA 2Q8JA 5TPAB 2D21A 2WYPA 1MQIA 4JXIA 4GBWA 2REJA 3TCHA 2V84A 2Q74A 4EQBA 4ZEKA 5CMCA 3BIGA 2XXTA 3S9NC 2D3IA 1LAGE 2OZZA 2Y7WA 4JWYA 4PBHA 4F19A 1NI9A 1LFGA 2O7UA 3CSBA 3LSWA 1IQ7A 3MSTA 4R6HA 3LBSA 3EHTA 1UIUA 4C1TA 1B3EA 1FCKA 1SW4A 4R74A 1L5TA 2ZNUA 2RCBA 1EZOA 4LN5A 1HSEA 5L9OA 3DLNA 4PDHA 4YMAA 2XXXA 3UK4A 1H43A 3IL1B 2OWZA 3EF7A 4MNIA 3V89B 3Q29A 1Y3NA 5JK4A 2O84X 3T93B 4H8IA 4MJOA 2O1MA 4LUBA 4PFRA 4I9DA 3H3GA 5I56B 3U65A 1M5DA 4NTLA 5TPAA 1PB7A 5EQ9A 2XXYA 1LAXA 1IZ1A 4P56A 5LTCA 4FAJA 2LAOA 2UVIA 3BFTA 3G3IA 3T9VA 3N5LA 2ONKE 1LCFA 4IY5A 4GWXA 3DP6A 4GX3A 1RDYA 1GGGA 5A5XB 1LBVA 2F7BA 4LP2B 4NF0A 4QBAA 4DIGA 3H6UA 3RGYA
chains in the Genus database with same CATH topology
1FJ9A 3B50A 3W9WA 2MKZA 2FIEA 4IR8A 1BK4A 3RPLB 4PDDA 4P47A 4X9TA 5ET7A 1FJ6A 5EQAA 3A29A 2F3BA 2OX3A 2HXRA 4JVCA 1LBWA 1IMBA 3CHGA 4FBPA 1IMFA 1FPJA 4PC9A 1EYIA 3FXBA 2KR0A 4F18A 1RDZA 2WBBA 4OVTA 2B4LA 5IZ1A 1FRPA 1YZ0A 1VDWA 1QGXA 1AWBA 2CZHA 2CEYA 1K9ZA 2HZLA 3KC1A 4NAPA 4YZZA 1CNQA 2DE4A 4GWZA 4OVRA 4N6KA 4MNCA 5A5LA 4I3EA 4P8BA 1IMCA 4PBQA 4G61A 1KA0A 5T3JA 5CM6A 3D1RA 4JVIA 3MYUA 5J16A 4OA4A 4HE0A 2QVUA 4JVDA 2VPNA 3RPLA 4PETA 1FTAA 4O7MA 4N4UA 4KXPA 2CZIA 5EQ7A 2DVZA 1G0HA 5F24A 4GWYA 4NQ8A 4HXVA 2HHMA 4PCDA 4X8RA 1NV7A 1KA1A 3B8BA 4HCWA 3E78A 1FBGA 4XFEA 4P9KA 2DDKA 4OVSA 1FPLA 4M1VA 4AS4A 4O94A 2F5XA 2B4MA 5ET6A 2PFYA 4GWSA 2FHYA 4N8GA 1LBXA 3KBZA 5I5PA 4MAGA 4NHBA 4O7IA 2F3DA 4O8MA 5EQ8A 5EYGA 2XXKA 1FPIA 4N15A 4P3LA 2VPOA 2R8TA 1LBZA 2QVRA 3FBPA 1NV5A 1IMEA 4OVPA 1NV0A 1SPIA 2XWOA 1NV2A 1YYZA 4PFBA 3KC0A 1FBCA 4PAIA 5ET8A 4F1UA 2QVVA 3T1BA 1DCUA 4OVQA 2FBPA 2V3QA 1FBPA 3NOHA 4YICA 4PF8A 1NUWA 4GBVA 4GWUA 4MCOA 4PAKA 4NG7A 2Y5LA 5ESYA 4I3YA 4P1EA 1EYJA 2ZZVA 1JP4A 5FBPA 1FPBA 4MNPA 1DK4A 2JJKA 1FPFA 1NV6A 4X04A 1NUXA 2QPQA 1FPDA 4H46A 4GWWA 1FPGA 4XF5A 2HZKA 3ROJA 1DBZA 3EKIA 1INPA 1IMAA 2KQZA 4PF6A 1G0IA 3HFUA 4PAFA 1YXIA 1EYKA 4N6DA 4NGUA 3IFCA 2L5VA 2XWVA 1NUYA 2XA5A 4F1VA 3PTYA 4HE1A 1FPKA 3QMFA 1RDXA 5IGAA 1FPEA 2WEFA 3LV0A 1LBYA 1K9YA 4PGNA 2WYKA 1LEVA 3SZPA 4MMPA 1XI6A 5I7IA 3E79A 4NN3A 4OANA 5IZ3B 4MHFA 2CZKA 3ISPA 4N17A 4DI4B 4MIJA 4I40A 4DI3D 2WYPA 5EYHA 2P3NA 2PFZA 3T0JA 4GX4A 2DE3A 4UABA 4GBWA 1FBFA 2Q74A 4N91A 4AS5A 4PGPA 3BIGA 2PCRA 3GYYA 2BJIA 3BIHA 5DW8A 4PBHA 2WX9A 4F19A 1NI9A 5ET5A 2ZZXA 3LUZA 4XEQA 3MSTA 4HE2A 4PFIA 2FIXA 2Y5KA 2ZZWA 1NV3A 4QXDA 2Q9TA 2P3VA 4LN5A 2VT5A 4H45A 2GQ1A 1IMDA 3W9VA 4PDHA 2WBDA 3IFAA 5I3SA 4N8YA 5IZZA 2OWZA 2CEXA 2XWIA 1Q9DA 2V4CA 4MNIA 1D9QA 5IM2A 4N81A 5IZ3A 4GX6A 5JK4A 4NX1A 4HCYA 4MJOA 2QFLA 4PFRA 3U65A 4P1LA 1NUZA 2DE2A 1FBEA 5EQ9A 1KZ8A 4P56A 4PE3A 5J1DA 4PTKA 5LTCA 5LDZA 1NV4A 2Q8MA 4MX6A 2XWKA 4GWXA 1FBHA 1FSAA 2HPGA 4GX3A 1FBDA 1RDYA 4MEVA 3RYDA 1LBVA 2FVZA 4NF0A 4QBAA 1NV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B50 A;  4MNP A;  4PGP A;  3GYY A;  4X04 A;  4NQ8 A;  4PCD A;  4PBH A;  4X8R A;  2WX9 A;  4PDD A;  4P47 A;  4XF5 A;  2HZK A;  4PF6 A;  4XFE A;  2ZZX A;  4PAF A;  4P9K A;  4XEQ A;  4PFI A;  4OVS A;  4N6D A;  4NGU A;  4O94 A;  2ZZW A;  2PFY A;  4PC9 A;  4LN5 A;  3FXB A;  2XWV A;  4N8G A;  2XA5 A;  5I5P A;  4OVT A;  4MAG A;  4PDH A;  4NHB A;  4O8M A;  4N8Y A;  5IZZ A;  2XXK A;  2CEX A;  2XWI A;  2CEY A;  2V4C A;  4N15 A;  4P3L A;  2HZL A;  2VPO A;  4MNI A;  5IGA A;  5IM2 A;  4NAP A;  4NX1 A;  4YZZ A;  4PFR A;  3U65 A;  4P1L A;  4OVR A;  4N6K A;  4MNC A;  4OVP A;  2XWO A;  4PFB A;  4P8B A;  4PBQ A;  4PGN A;  4PAI A;  2WYK A;  4MMP A;  5I7I A;  5CM6 A;  4P56 A;  4PE3 A;  4NN3 A;  5LTC A;  4OAN A;  4OVQ A;  4MHF A;  4OA4 A;  4MX6 A;  4YIC A;  2VPN A;  4N17 A;  2XWK A;  4DI4 B;  4MIJ A;  4PET A;  4PF8 A;  4O7M A;  2HPG A;  4DI3 D;  4MCO A;  4PAK A;  4NG7 A;  2WYP A;  2PFZ A;  4MEV A;  4N4U A;  4UAB A;  4NF0 A;  4P1E A;  2ZZV A;  4N91 A; 
#chains in the Genus database with same CATH topology
 2RC8 A;  3B50 A;  2VD3 A;  3W9W A;  5ICQ A;  4H65 A;  2OLB A;  1LAH E;  4PDD A;  2GHB A;  3EHU A;  5DVI A;  3U93 A;  1DMB A;  1SW1 A;  3DEL B;  4LZ5 A;  4F3S A;  4R9G A;  4G8H A;  3VXB A;  3TTK A;  1BTJ A;  4YKP A;  4ESW A;  4JVC A;  3FJ7 A;  1LBW A;  5K2X A;  1N7W A;  3OEL A;  1MRP A;  1IMF A;  1RYX A;  4G8M A;  2KR0 A;  5I56 A;  2WBB A;  3VVF A;  1BIY A;  4PFU A;  4FED A;  5IAI A;  1HSL A;  5IZ1 A;  1URG A;  1AWB A;  2VGQ A;  1OQH A;  3M3K A;  3QK6 A;  4POX A;  4JSD A;  4NAP A;  4YZZ A;  1VR5 A;  2F6G A;  4I3E A;  4ONY A;  3W15 C;  4P8B A;  1FTO A;  3C34 A;  5A5X A;  1NL5 A;  4BDL A;  5CM6 A;  2F97 A;  1Y3P A;  3D1R A;  4JVI A;  2VOZ A;  1Y9U A;  4MFI A;  3OXN A;  4NED A;  3KN3 A;  4DE8 A;  4JVD A;  1QKB A;  3BKI B;  1JET A;  4E0X A;  1A7L A;  1FTM A;  4O7M A;  4XXU A;  3RPW A;  1JW5 A;  2CZI A;  5M2V A;  2R6G E;  5ITP A;  3FXQ A;  5F24 A;  4GWY A;  3USD A;  1IXC A;  1I69 A;  2P2A A;  3MZB A;  3RUM A;  3H6V A;  4DDD A;  4NQ8 A;  3TAJ A;  4HXV A;  2ONR A;  2F78 A;  4OER A;  3IOU A;  3QUJ A;  5AA2 D;  2IEE A;  4BDR A;  4JWX A;  3E78 A;  4X48 A;  3IK6 B;  1B46 A;  1SYH A;  3TTM A;  1J1N A;  3R26 A;  2NUV A;  4C0R A;  4OES A;  2AIX A;  1O7T A;  1FPL A;  4IO2 A;  4M1V A;  4O94 A;  2F5X A;  2B4M A;  3QIM A;  3LSX A;  4YAH X;  4N8G A;  3FGS A;  1IXG A;  3N6T A;  1A8E A;  1B7U A;  3PMX A;  3PMV A;  1LB9 A;  3QYT A;  4ZZE A;  4F22 A;  3LC8 A;  2XXK A;  4XKP A;  4XIG Q;  1A54 A;  4N15 A;  4P3L A;  4LZ8 A;  2VPO A;  4I62 A;  3TCG A;  4RJZ A;  2KLF A;  3K6U A;  3KBR A;  2QVR A;  3LSL A;  4WEP A;  3JYR A;  4PFT A;  1MY3 A;  4YU0 A;  1NNT A;  4WED A;  4FOR A;  2VHA A;  4YB6 A;  1NV2 A;  1B2H A;  2QVV A;  1NFT A;  1B4Z A;  3GBB A;  4DXU A;  4NF6 B;  1GVC A;  4ELQ A;  4KYD A;  1DPE A;  4H0W A;  4IO6 A;  4KPT A;  3Q27 A;  4YIC A;  3PMW A;  1NUW A;  2Q2A A;  4MCO A;  1JNF A;  2Y5L A;  3PD8 A;  3MVX A;  4I3Y A;  3C36 A;  2DYX A;  4U1O A;  1QUL A;  3E3K A;  3M3L A;  1MXX A;  4FEB A;  1FPB A;  1N3W A;  2QPQ A;  3KGC A;  1FPD A;  2GFE A;  3FD3 A;  1A99 A;  1PB9 A;  2DXR A;  3ROJ A;  4TLM B;  1DBZ A;  3EKI A;  3TQL A;  1G0I A;  3RY3 A;  1YCJ A;  3EPE A;  4IO4 A;  3VV5 A;  1EYK A;  4NGU A;  3PUW E;  1NMU A;  1NH7 A;  2OJT A;  3IFC A;  1ELJ A;  3KSJ A;  4K3F A;  2DVC A;  1VE4 A;  2XXU A;  2XA5 A;  3O6I A;  1LCT A;  1FQB A;  3TKD A;  3QSL A;  4WKM A;  1F9B A;  1RDX A;  4NF6 A;  5IGA A;  1PC3 A;  1S9T A;  1FPE A;  3DM0 A;  1LBY A;  1K9Y A;  3N26 A;  4G8N A;  3S9L C;  3OEK A;  1MY0 A;  4H5G A;  4ZE9 A;  2DP8 A;  3UOR A;  4LAT A;  4MMP A;  1XI6 A;  5I7I A;  3G3H A;  1Z7N E;  5FHN A;  2UVG A;  3TPA A;  3E9X A;  4PQJ A;  4MHF A;  3ILT B;  3SKP A;  4BDN A;  2Z8F A;  4U22 A;  1JEU A;  3T0J A;  3SET A;  3KFM A;  4UAB A;  5TU0 A;  1N0T A;  4NF8 A;  4F31 B;  1IUD A;  3B6T A;  1IIT A;  1Z7M E;  5DEX B;  1M5F A;  3HV1 A;  3E13 X;  2BJI A;  3BIH A;  3I3V A;  1B3H A;  1PB8 A;  1B5H A;  1LFI A;  3R7X A;  4HS7 A;  4ZED A;  3KG2 A;  3FIR A;  3K0V A;  3TCF A;  3CFL A;  3A3C A;  1XT8 A;  2F35 A;  2ZZX A;  3LUZ A;  3IO4 A;  3FXR A;  4XEQ A;  2I48 A;  4ISU A;  3T96 B;  2V3U A;  3IB0 A;  2FIX A;  4C1U A;  4PFW A;  3Q28 A;  2Q9T A;  1VSO A;  2GQ1 A;  1IXI A;  5H8H B;  4EQ7 A;  5I3S A;  4F3G A;  5L9M A;  2CEX A;  4GXS B;  1LFH A;  3WAE A;  1NNF A;  2O7I A;  4RY1 A;  2DWI A;  1NUZ A;  2DE2 A;  3PUY E;  3MBP A;  3VFJ A;  2QL3 A;  1SW2 A;  4F2O A;  3TEP A;  3H03 A;  2F6P A;  2NXO A;  3B6Q A;  5DEX A;  4MX6 A;  3H4Z A;  1Y1Z A;  1B0L A;  1AL3 A;  2PMS A;  1DTG A;  4HTG A;  1FBH A;  4I1D A;  3TUS A;  1WDN A;  4QFP A;  2XHD A;  1FTJ A;  1NV1 A;  3EQ1 A;  2UYF A;  3VDF A;  2FIE A;  1SW5 A;  2UYE A;  2ZYK A;  3RPL B;  1SI0 A;  3RT8 A;  5ET7 A;  4ELR A;  2F7A A;  3HPI A;  2F3B A;  5H8H A;  2X7Q A;  2HXR A;  1SQY A;  4GOT A;  3BBR A;  1IMB A;  3LR1 A;  3I6V A;  4NWC A;  2VD2 A;  3FXB A;  5CMM A;  2O69 A;  3TOD A;  1RDZ A;  4M4G A;  3VXC A;  3A09 A;  1JEV A;  2I0B A;  4IO7 A;  1FRP A;  3TEL A;  3U94 A;  1QGX A;  2H5Y A;  2OK2 A;  1K9Z A;  2HZL A;  1B3G A;  1P1N A;  1R6Z A;  2O6A A;  5TP9 B;  1CNQ A;  2ZMB A;  2E0S A;  2DE4 A;  4OET A;  4U21 A;  2ZNT A;  4N6K A;  4MNC A;  4QSD A;  3O6G A;  1IMC A;  4PBQ A;  4OZ9 A;  5CRY A;  1MDQ A;  4G61 A;  4E0W A;  4NMY A;  4QSC A;  3EN3 A;  5AE4 A;  1OVT A;  1TXF A;  2Z8D A;  5ITO A;  3OO8 A;  4BDO A;  5HPQ A;  4HE0 A;  1R9Q A;  2QVU A;  1TT1 A;  3RPL A;  4POW A;  4U23 A;  4LVQ A;  1FQD A;  1QUJ A;  5AA3 A;  4N4U A;  1MM7 A;  1M5B A;  1PBP A;  4EF2 A;  3MUQ A;  2R71 A;  2GRV A;  2BJJ X;  2HHM A;  3IAZ A;  1B52 A;  3PPO A;  4LZ7 A;  3GZG A;  1KWH A;  4HCW A;  1FBG A;  1XS5 A;  3TDJ A;  3C4M A;  1FQC A;  3FAS A;  3KEI A;  5DT6 A;  1D9Y A;  4ECF A;  5TP9 A;  5I2K B;  3T66 A;  3HO7 A;  4MAG A;  1OMP A;  3H6T A;  4O8M A;  3ZKL A;  4KQP A;  5EYG A;  5F1Q A;  3TTL A;  5CMK A;  5I58 B;  4EF1 A;  2FNC A;  3FXU A;  3O6H A;  4H5F A;  4R72 A;  2I4C A;  4EXK A;  1GTK A;  2QS3 A;  1IME A;  3PPQ A;  3PUZ E;  4OVP A;  1NV0 A;  1SPI A;  2XWO A;  1MQH A;  1YYZ A;  1DSN A;  1SI1 A;  3PGF A;  1UTH B;  2AL4 A;  3T1B A;  4OMB A;  1DCU A;  3PU5 A;  5H8Q B;  1N3X A;  1VFE A;  4QFK A;  4FE8 A;  4JB7 A;  2V3Q A;  1FBP A;  3IOR A;  2HEU A;  1BP5 A;  3NOH A;  5EHS A;  1MH4 A;  4PP0 A;  5ESY A;  5HBC A;  1IXH A;  3CRB A;  2B3F A;  1JQF A;  1EYJ A;  2ZZV A;  1JP4 A;  5FBP A;  1FTK A;  3KJT A;  3C32 A;  1OIB A;  1UTB B;  3MP6 A;  1FPF A;  1NUX A;  5K2Y A;  3LUY A;  4H46 A;  4GWW A;  1FPG A;  4P0G A;  4KFQ A;  1USY H;  3OMB A;  4KCC A;  3OOA A;  3VVE A;  1JVY A;  3HFU A;  1P99 A;  4PAF A;  3RN8 A;  2IA4 A;  3U8Q A;  5I58 A;  1AIV A;  4OQO A;  3IX1 A;  1XVX A;  4G68 B;  2HQ0 A;  1FTL A;  2QJE A;  5JTY B;  3TQW A;  5LOM A;  2PT1 A;  3FVO A;  2HAU A;  2OCU A;  1B3L A;  3TTN A;  1UTH A;  1B1X A;  3MQ9 A;  3O97 A;  2P1S A;  1XOC A;  4HE1 A;  3MVZ A;  3QMF A;  5H8Q A;  1Y4T A;  1B05 A;  1A8F A;  4AB5 A;  4EDP A;  1Q35 A;  3V8X B;  5I2N B;  3E4R A;  4G2Z A;  1H3D A;  5AA4 B;  4DZ1 A;  2WYK A;  1ZKB A;  4R2B A;  3SZP A;  3E79 A;  3ILU B;  1ATG A;  4F3B A;  1B4H A;  4G68 C;  3TTR A;  1UTB A;  2CZK A;  1FQE A;  5CMB A;  2R9J A;  4N07 A;  3ZKK A;  4DI4 B;  4KHZ E;  4ZEC A;  4U2R A;  4DI3 D;  5EYH A;  2PFZ A;  4ESX A;  3MJN A;  2HAV A;  3C9H A;  1FBF A;  4N91 A;  3DP8 A;  1MQJ A;  1MXV A;  4PGP A;  3OD7 A;  4F3P A;  3GYY A;  4G68 A;  5CBR A;  4GL8 A;  3SEW A;  2WX9 A;  5JTY A;  1B32 A;  5IKB A;  4ZEI A;  4NF4 B;  1URS A;  4EUO A;  4JDF A;  1QVS A;  2FA7 A;  4XKR A;  4PFI A;  2ZYN A;  2Z23 A;  1XC1 A;  2WKY A;  1MQG A;  1ZJL A;  1NV3 A;  1OQG A;  2G29 A;  2ZZW A;  1Y3Q A;  4QXD A;  4ZZA A;  4GRK A;  2P3V A;  3UA8 A;  2AL5 A;  2VT5 A;  2V3T A;  4IO3 A;  5I2N A;  3TMG A;  1WOD A;  3JV9 A;  3FVN A;  1IMD A;  2Q89 A;  1POY 1;  4LA9 A;  3W9V A;  2WBD A;  1P1U A;  3M3F A;  3IFA A;  1MM6 A;  4N8Y A;  5IZZ A;  2V4C A;  1ZBM A;  4AQ4 A;  5KCJ B;  1PDA A;  2PX1 A;  4HCY A;  4THI A;  4R73 A;  3OSQ A;  1ZU0 A;  4P1L A;  4X1D A;  3ODB A;  2HCA A;  4BLA A;  1A40 A;  3MP8 A;  4Q0C A;  1IIW A;  1RYO A;  4IO5 A;  4Q30 B;  1A55 A;  1I6B A;  2Q8M A;  2ANJ A;  2XXI A;  1M5E A;  4GFR A;  2XWK A;  4R6K A;  2Y7R A;  1FBD A;  3IJO B;  3IOV A;  1XHY A;  4NF4 A;  1AMF A;  4OVJ A;  4L17 A;  5JEI A;  1NKX A;  1BLF A;  1D4N A;  1MPC A;  1GR2 A;  3MVY A;  4N13 A;  4N6P A;  4U4S A;  4YKI A;  1B0H A;  5EQA A;  4QRZ A;  2GH9 A;  2F7C A;  2OX3 A;  3AXF A;  2FYI A;  1R9L A;  2PT2 A;  1SD3 A;  3N6U A;  2ABH A;  1TFA A;  3CHG A;  4Z0I A;  5KCJ A;  4HW8 A;  1YPN A;  1EYI A;  3R6U A;  4OFJ A;  2Y7I A;  3HN0 A;  4F18 A;  4TLL B;  3QAX A;  4OVT A;  2B4L A;  3BFU A;  1US5 A;  1VDW A;  3OEM A;  5L8D A;  2QS1 A;  3K6V A;  2Q2C A;  1B3F A;  2M8C A;  4OTE A;  5DTB A;  1M5C A;  4ELO A;  5KZT A;  4XKN A;  4GWZ A;  1LBB A;  3CI8 A;  4OVR A;  1LAF E;  5A5L A;  4F39 A;  4H67 A;  1B7Z A;  2UXA A;  1KA0 A;  5T3J A;  1QUI A;  2A5S A;  5EYF A;  4OA4 A;  4KYS A;  4RK2 A;  1EZP A;  5B70 A;  2VPN A;  3S2V A;  4PET A;  1D3K A;  1B9J A;  2XXR A;  3VLW A;  1YAE A;  4G4P A;  4OEU A;  2X7P A;  1QUK A;  3SES A;  3KJ7 A;  5EQ7 A;  1G0H A;  2DVZ A;  5FTH A;  2H4I A;  2QS4 A;  1MH3 A;  4O3A A;  3CSG A;  5H8S A;  2XX7 A;  3OO6 A;  3ECR A;  1LBC A;  3FV1 A;  4PCD A;  3G3F A;  3D4G A;  4X8R A;  2I49 A;  1NV7 A;  4PFY A;  3UP9 A;  1I6Q A;  3T9X B;  5I59 B;  4F1Y A;  2DWH A;  4KR5 A;  4ND9 A;  4GF8 A;  4RNS A;  4KYE A;  3B7D A;  4O3C A;  4RYA A;  4AS4 A;  1Q1K A;  2PFY A;  3D4C A;  1PBQ A;  4OEV A;  4XKQ A;  2XXQ A;  2ZXT A;  4GVO A;  2PBW A;  5KDT B;  3H7M A;  3C35 A;  3FVK A;  5CI5 A;  3ZSF A;  3CFX A;  3FJM A;  3KN7 A;  1FPI A;  2REG A;  2PVU A;  1ZLQ A;  2XD3 A;  1LBZ A;  3FBP A;  3HCQ A;  1O63 A;  1B58 A;  3KC0 A;  5FHO A;  1FBC A;  4PAI A;  2F8D A;  1IEJ A;  3MAM A;  1N04 A;  2A5T B;  2CMO A;  1B1H A;  4MLQ A;  4OVQ A;  4OHN A;  3HHF A;  3O2A A;  4DLD A;  3CG1 A;  3MPL A;  3L6G A;  3MZ1 A;  4DXC A;  2DOJ A;  1POT A;  4GBV A;  4FAT A;  4PE5 B;  3SDF A;  5ISU A;  1HSJ A;  2HXW A;  5AA2 B;  5I59 A;  2XXW A;  2RC9 A;  2V25 A;  4UA8 A;  4MNP A;  4Z7E A;  1MY2 A;  2XXV A;  2JJK A;  2W7Y A;  3S4U A;  1NV6 A;  1BKA A;  3FV2 A;  4X04 A;  3SEU A;  4U1Z A;  4JBZ A;  1SYI A;  5FTI A;  3A3U A;  4WXJ A;  4O3B A;  3CFZ A;  1EU8 A;  3Q26 A;  2HZK A;  4I8C A;  1H44 A;  3LSF B;  2KQZ A;  5KDT A;  4PF6 A;  3MP1 A;  3S9M C;  3FZV A;  4GLI A;  4OXV A;  4FIM A;  2ALU A;  3O28 A;  3UN6 A;  3PV0 E;  2L5V A;  2XWV A;  2OWS A;  3OO9 A;  2OWT A;  3PPP A;  4RPN A;  4F1V A;  1LB8 A;  2GHA A;  2A5T A;  3PTY A;  1ZMG A;  2O68 A;  1FPK A;  1ZIU A;  3C33 A;  2DWJ A;  1FW0 A;  2RF1 A;  3MW0 A;  4TQU Q;  2WEF A;  1I6A A;  3LV0 A;  4DCY A;  4NF5 B;  2DQV A;  1PEB A;  5AA1 A;  1JW1 A;  1NH8 A;  4P11 A;  4QSE A;  3WAF A;  3TYH A;  2HFB A;  5AA2 A;  2XD2 A;  3VE1 B;  2NWJ A;  4OAN A;  5I57 B;  1MY1 A;  5IZ3 B;  4KI0 E;  2QS2 A;  3MC2 A;  4IB2 A;  1UIV A;  1QKA A;  4I40 A;  5H8F B;  4R2F A;  2P3N A;  4GX4 A;  2DE3 A;  2CZL A;  3PPR A;  1B6H A;  1CB6 A;  5DVJ A;  4AS5 A;  1XVY A;  3SEX A;  1P1O A;  2PCR A;  3IO6 A;  3T9U A;  2OBG A;  3OEN A;  1TWY A;  3ZS6 A;  5H8N B;  5DW8 A;  1MXU A;  1UQW A;  4RA1 A;  5ET5 A;  3O29 A;  4RXL A;  4H1X A;  4HE2 A;  3L6H A;  3TFL A;  3F11 A;  3K6X A;  4GD5 A;  1US4 A;  3PUX E;  2X26 A;  4ZE8 A;  2Y5K A;  4DXB A;  4FJP A;  3G7W A;  1R1N A;  4GL0 A;  4H45 A;  4NF5 A;  4XTC Q;  3O66 A;  4P0I A;  1LST A;  5I2K A;  1AH5 A;  3K4U A;  1MPD A;  3RT6 B;  1D9V A;  4DCX A;  2XWI A;  4RPO A;  1Q9D A;  3C31 A;  1D9Q A;  3HST A;  5I57 A;  5IM2 A;  4N81 A;  2O1L A;  5IZ3 A;  3U92 A;  2UVJ A;  4GX6 A;  4NX1 A;  2QFL A;  3FUZ A;  4GXA A;  3MWB A;  4JSO A;  1AOV A;  4KCD A;  5H8F A;  1NNK A;  2RC7 A;  1FBE A;  1MG1 A;  1KZ8 A;  4PE3 A;  5J1D A;  4PTK A;  3K00 A;  5LDZ A;  1NV4 A;  2I4B A;  1JVX A;  4R9F A;  3H06 B;  5H8N A;  3U72 A;  1B51 A;  4JWO A;  3FJG A;  1FSA A;  2HPG A;  4Q5T A;  4MEV A;  3RYD A;  3K2D A;  5CBS A;  1N7X A;  2FVZ A;  4OFL A;  2Z8E A;  2UVH A;  1FJ9 A;  3OO7 A;  1TFD A;  2MKZ A;  4IR8 A;  1BK4 A;  3IB1 A;  2H99 A;  4ZEF A;  1Y20 A;  2I3V A;  1SVX B;  4P47 A;  2O51 A;  4X9T A;  5ELV A;  1FJ6 A;  5B7D A;  3A29 A;  1QJM A;  4ZEB A;  3VLU A;  4X1B A;  2NOO A;  2H9B A;  2G93 A;  1MY4 A;  3T22 A;  1DTZ A;  1N84 A;  2DS9 A;  4QFL A;  1II5 A;  3MVW A;  2YJP A;  5ICT A;  2Y7K A;  4FBP A;  4QHQ A;  2Q88 A;  4F29 A;  1FPJ A;  4PC9 A;  3FVG A;  3K1P A;  2I3W A;  4AB6 A;  4MLV A;  4BDQ A;  1NNP A;  4BDM A;  4ZDM A;  4U4X A;  3THI A;  1S50 A;  1MPB A;  3OSR A;  2QMW A;  3IJX B;  1EZ9 A;  2ZYO A;  1YZ0 A;  3PPN A;  4IY6 A;  3SER A;  3B6W A;  1H76 A;  2CZH A;  2CEY A;  2THI A;  3P7I A;  4G77 A;  1ANF A;  5DVF A;  3KC1 A;  3K1M A;  3I5O A;  2I58 A;  1B7H A;  2ZNS A;  2I6E A;  1GV8 A;  1USY E;  3CG3 A;  2B65 A;  4GQO A;  5AA4 A;  2RCA A;  3IB2 A;  4R6Y A;  1WVJ A;  1QW0 A;  3QXM A;  3MYU A;  2XX8 A;  4Q8R A;  2DSF A;  5J16 A;  3U1O A;  4YB7 A;  2XXH A;  3JZJ A;  4RK9 A;  3GXA A;  2RKM A;  3FAT A;  4ZS9 A;  1FTA A;  1O64 A;  4QFN A;  4NF8 B;  2QSX A;  4KXP A;  3EHS A;  3Q25 A;  3CVG A;  4UAC A;  2H25 A;  1VFD A;  2I0C A;  4LQ2 A;  4OFO A;  1OLC A;  3KSX A;  3PUV E;  1SDX A;  4TOZ A;  3G3J A;  3DP4 A;  4GWO A;  1LGB C;  3ONM A;  1OLA A;  1KA1 A;  1EH3 A;  4QFO A;  3O9P A;  3T9H B;  1MXW A;  3B8B A;  5EHM A;  4XFE A;  1Y4C A;  2D5W A;  4ELP A;  2QMX A;  1MXY A;  3K6W A;  4P9K A;  4EXL A;  2DDK A;  1P1Q A;  4IGT A;  4OVS A;  4KD5 A;  5BUU A;  1LLS A;  4IGR A;  1URD A;  2Y7P A;  1MS7 A;  5ET6 A;  2B3B A;  3IOT A;  4GWS A;  1MQD A;  3MZ9 A;  2FHY A;  3S9E A;  1LBX A;  4R75 A;  5HM4 B;  3KBZ A;  5DYH A;  5I5P A;  4NHB A;  4MBP A;  1H45 A;  3UIF A;  4O7I A;  2F3D A;  3V83 A;  3HHG A;  4YB5 A;  5EQ8 A;  1ZTY A;  3VVD A;  3RNN A;  2Z22 A;  2R8T A;  2F34 A;  1T0K A;  1NV5 A;  4MH5 A;  3M8U A;  4PFB A;  1DPP A;  5L9S A;  5ET8 A;  1Y1M A;  4F1U A;  3RTF B;  4FEC A;  2ZYM A;  3SEV A;  3G3G A;  5BWJ A;  1SBP A;  4OYV A;  2XX9 A;  4YMB A;  3V5A A;  5F7V A;  2FBP A;  3SEY A;  3QUF A;  3VLV A;  4LQ5 A;  3RTW B;  4PF8 A;  4GWU A;  4PAK A;  4NG7 A;  3CR9 A;  4H6D A;  2XXP A;  3KOT A;  4P1E A;  5I84 A;  1DK4 A;  4YKJ A;  1MXZ A;  3GBA A;  4MF3 A;  3K01 A;  3TZA A;  2RIN A;  4XF5 A;  5FHM A;  1JW4 A;  1CE2 A;  2ONS A;  4OEN A;  1INP A;  1IMA A;  2AYS A;  2YLN A;  1S7Y A;  3G3K A;  4NE4 A;  1YXI A;  5CC2 A;  4H8J A;  4N6D A;  4NWD A;  2V93 A;  2VP1 A;  3IR1 A;  4F2Q A;  1B40 A;  3UGW A;  2DXY A;  2QRY A;  3KZG A;  4QF9 A;  3PD9 A;  1NUY A;  4EQ9 A;  2NVU B;  2F36 A;  3RQT A;  1N76 A;  2DWA A;  1MDP 1;  1DOT A;  2PYY A;  3KOS A;  2H98 A;  1B5I A;  2P0S A;  4OWD A;  1RKM A;  4YKK A;  1FQA A;  3GLB A;  4PGN A;  1LEV A;  1B5J A;  1FQF A;  2ESN A;  4NN3 A;  3N94 A;  3H6W A;  2YPN A;  3IOW A;  3CIJ A;  3RLF E;  3MPK A;  2E1S A;  1OVB A;  3ISP A;  3K02 A;  3KN8 A;  3K1N A;  4LON B;  4N17 A;  2Y84 A;  4MIJ A;  1P1W A;  1YTV A;  4GIZ A;  2Q8J A;  5TPA B;  2D21 A;  2WYP A;  1MQI A;  4JXI A;  4GBW A;  2REJ A;  3TCH A;  2V84 A;  2Q74 A;  4EQB A;  4ZEK A;  5CMC A;  3BIG A;  2XXT A;  3S9N C;  2D3I A;  1LAG E;  2OZZ A;  2Y7W A;  4JWY A;  4PBH A;  4F19 A;  1NI9 A;  1LFG A;  2O7U A;  3CSB A;  3LSW A;  1IQ7 A;  3MST A;  4R6H A;  3LBS A;  3EHT A;  1UIU A;  4C1T A;  1B3E A;  1FCK A;  1SW4 A;  4R74 A;  1L5T A;  2ZNU A;  2RCB A;  1EZO A;  4LN5 A;  1HSE A;  5L9O A;  3DLN A;  4PDH A;  4YMA A;  2XXX A;  3UK4 A;  1H43 A;  3IL1 B;  2OWZ A;  3EF7 A;  4MNI A;  3V89 B;  3Q29 A;  1Y3N A;  5JK4 A;  2O84 X;  3T93 B;  4H8I A;  4MJO A;  2O1M A;  4LUB A;  4PFR A;  4I9D A;  3H3G A;  5I56 B;  3U65 A;  1M5D A;  4NTL A;  5TPA A;  1PB7 A;  5EQ9 A;  2XXY A;  1LAX A;  1IZ1 A;  4P56 A;  5LTC A;  4FAJ A;  2LAO A;  2UVI A;  3BFT A;  3G3I A;  3T9V A;  3N5L A;  2ONK E;  1LCF A;  4IY5 A;  4GWX A;  3DP6 A;  4GX3 A;  1RDY A;  1GGG A;  5A5X B;  1LBV A;  2F7B A;  4LP2 B;  4NF0 A;  4QBA A;  4DIG A;  3H6U A;  3RGY A; 
#chains in the Genus database with same CATH homology
 1FJ9 A;  3B50 A;  3W9W A;  2MKZ A;  2FIE A;  4IR8 A;  1BK4 A;  3RPL B;  4PDD A;  4P47 A;  4X9T A;  5ET7 A;  1FJ6 A;  5EQA A;  3A29 A;  2F3B A;  2OX3 A;  2HXR A;  4JVC A;  1LBW A;  1IMB A;  3CHG A;  4FBP A;  1IMF A;  1FPJ A;  4PC9 A;  1EYI A;  3FXB A;  2KR0 A;  4F18 A;  1RDZ A;  2WBB A;  4OVT A;  2B4L A;  5IZ1 A;  1FRP A;  1YZ0 A;  1VDW A;  1QGX A;  1AWB A;  2CZH A;  2CEY A;  1K9Z A;  2HZL A;  3KC1 A;  4NAP A;  4YZZ A;  1CNQ A;  2DE4 A;  4GWZ A;  4OVR A;  4N6K A;  4MNC A;  5A5L A;  4I3E A;  4P8B A;  1IMC A;  4PBQ A;  4G61 A;  1KA0 A;  5T3J A;  5CM6 A;  3D1R A;  4JVI A;  3MYU A;  5J16 A;  4OA4 A;  4HE0 A;  2QVU A;  4JVD A;  2VPN A;  3RPL A;  4PET A;  1FTA A;  4O7M A;  4N4U A;  4KXP A;  2CZI A;  5EQ7 A;  2DVZ A;  1G0H A;  5F24 A;  4GWY A;  4NQ8 A;  4HXV A;  2HHM A;  4PCD A;  4X8R A;  1NV7 A;  1KA1 A;  3B8B A;  4HCW A;  3E78 A;  1FBG A;  4XFE A;  4P9K A;  2DDK A;  4OVS A;  1FPL A;  4M1V A;  4AS4 A;  4O94 A;  2F5X A;  2B4M A;  5ET6 A;  2PFY A;  4GWS A;  2FHY A;  4N8G A;  1LBX A;  3KBZ A;  5I5P A;  4MAG A;  4NHB A;  4O7I A;  2F3D A;  4O8M A;  5EQ8 A;  5EYG A;  2XXK A;  1FPI A;  4N15 A;  4P3L A;  2VPO A;  2R8T A;  1LBZ A;  2QVR A;  3FBP A;  1NV5 A;  1IME A;  4OVP A;  1NV0 A;  1SPI A;  2XWO A;  1NV2 A;  1YYZ A;  4PFB A;  3KC0 A;  1FBC A;  4PAI A;  5ET8 A;  4F1U A;  2QVV A;  3T1B A;  1DCU A;  4OVQ A;  2FBP A;  2V3Q A;  1FBP A;  3NOH A;  4YIC A;  4PF8 A;  1NUW A;  4GBV A;  4GWU A;  4MCO A;  4PAK A;  4NG7 A;  2Y5L A;  5ESY A;  4I3Y A;  4P1E A;  1EYJ A;  2ZZV A;  1JP4 A;  5FBP A;  1FPB A;  4MNP A;  1DK4 A;  2JJK A;  1FPF A;  1NV6 A;  4X04 A;  1NUX A;  2QPQ A;  1FPD A;  4H46 A;  4GWW A;  1FPG A;  4XF5 A;  2HZK A;  3ROJ A;  1DBZ A;  3EKI A;  1INP A;  1IMA A;  2KQZ A;  4PF6 A;  1G0I A;  3HFU A;  4PAF A;  1YXI A;  1EYK A;  4N6D A;  4NGU A;  3IFC A;  2L5V A;  2XWV A;  1NUY A;  2XA5 A;  4F1V A;  3PTY A;  4HE1 A;  1FPK A;  3QMF A;  1RDX A;  5IGA A;  1FPE A;  2WEF A;  3LV0 A;  1LBY A;  1K9Y A;  4PGN A;  2WYK A;  1LEV A;  3SZP A;  4MMP A;  1XI6 A;  5I7I A;  3E79 A;  4NN3 A;  4OAN A;  5IZ3 B;  4MHF A;  2CZK A;  3ISP A;  4N17 A;  4DI4 B;  4MIJ A;  4I40 A;  4DI3 D;  2WYP A;  5EYH A;  2P3N A;  2PFZ A;  3T0J A;  4GX4 A;  2DE3 A;  4UAB A;  4GBW A;  1FBF A;  2Q74 A;  4N91 A;  4AS5 A;  4PGP A;  3BIG A;  2PCR A;  3GYY A;  2BJI A;  3BIH A;  5DW8 A;  4PBH A;  2WX9 A;  4F19 A;  1NI9 A;  5ET5 A;  2ZZX A;  3LUZ A;  4XEQ A;  3MST A;  4HE2 A;  4PFI A;  2FIX A;  2Y5K A;  2ZZW A;  1NV3 A;  4QXD A;  2Q9T A;  2P3V A;  4LN5 A;  2VT5 A;  4H45 A;  2GQ1 A;  1IMD A;  3W9V A;  4PDH A;  2WBD A;  3IFA A;  5I3S A;  4N8Y A;  5IZZ A;  2OWZ A;  2CEX A;  2XWI A;  1Q9D A;  2V4C A;  4MNI A;  1D9Q A;  5IM2 A;  4N81 A;  5IZ3 A;  4GX6 A;  5JK4 A;  4NX1 A;  4HCY A;  4MJO A;  2QFL A;  4PFR A;  3U65 A;  4P1L A;  1NUZ A;  2DE2 A;  1FBE A;  5EQ9 A;  1KZ8 A;  4P56 A;  4PE3 A;  5J1D A;  4PTK A;  5LTC A;  5LDZ A;  1NV4 A;  2Q8M A;  4MX6 A;  2XWK A;  4GWX A;  1FBH A;  1FSA A;  2HPG A;  4GX3 A;  1FBD A;  1RDY A;  4MEV A;  3RYD A;  1LBV A;  2FVZ A;  4NF0 A;  4QBA A;  1NV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...