3FGSA

Crystal structure of g65r/k206e double mutant of the n-lobe human transferrin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDARLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serotransferrin
publication title Structural and Functional Consequences of the Substitution of Glycine 65 with Arginine in the N-Lobe of Human Transferrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 99
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fgsA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fgsA02
2AL4A 1QKAA 3RTFB 3FV2A 3FATA 5K2YA 3CRBA 4F1UA 4NF6B 3PU5A 2V93A 1USYE 4LP2B 1SBPA 4ELOA 3QSLA 2OBGA 4XKPA 1MQJA 1F9BA 3K6WA 1B0LA 1MM7A 3EHTA 4HW8A 3G3IA 4OETA 4F1YA 2RCBA 2XXVA 4IGRA 2F7BA 3SEUA 4LVQA 4ND9A 1IXIA 5I2KA 3K02A 4ZE9A 4EF1A 4C0RA 3TQWA 2VP1A 3MPKA 4ZE8A 4OTEA 1UIUA 2CZLA 3MVWA 2ONSA 3FZVA 4NF5B 1YAEA 3SEVA 2DS9A 1D4NA 4LZ8A 4IO6A 4PFTA 1I6AA 3H4ZA 2CMOA 3S9EA 1WODA 3VXBA 1RYXA 1B5HA 1I6BA 4LATA 5JTYB 4FIMA 3LUYA 3RN8A 5CMMA 4G8NA 2O7IA 1B7HA 1XVYA 1L5TA 4NWDA 3W15C 1JQFA 3K1NA 3VLVA 3SEWA 3ONMA 3PUXE 4YB6A 4GIZA 5CMKA 5I2NA 1B4HA 4R73A 3C31A 3OOAA 2NOOA 5H8HB 3SESA 3MUQA 1BKAA 1B3HA 1B4ZA 3TTRA 2UXAA 1ATGA 3RT8A 1MQGA 3TTNA 2UVJA 2D3IA 3IOVA 3MVZA 4YKKA 3DELB 2XXUA 2XXRA 2UVGA 3MP6A 4HTGA 4H8JA 3OD7A 3B6QA 2O6AA 2XD3A 4KHZE 3KG2A 4R2FA 2IA4A 4NF6A 1LFGA 3FJGA 4YMAA 4I1DA 5DTBA 1HSJA 3N5LA 2QL3A 2Q89A 3ILUB 1QUJA 5BUUA 2F34A 4GOTA 2ZMBA 1A8FA 2G93A 5AA2D 3A3UA 3PMXA 3T9HB 1BP5A 2OK2A 1LB8A 3O6GA 3IOTA 1B1XA 3PMVA 2NWJA 1JEUA 1MXXA 5I59B 2NVUB 1SQYA 5EHSA 1OIBA 3TCGA 4H5FA 1FQAA 2OLBA 1USYH 4X48A 3FGSA 1IUDA 4HCWA 1B5JA 1LAGE 4IY6A 4KCCA 4NF5A 1A40A 3MZ9A 1TWYA 1QVSA 2DVZA 4DIGA 5CC2A 2VGQA 4N6PA 1MH4A 1A55A 4XKNA 3I3VA 2ZYKA 1QW0A 4X1BA 1MXVA 4ZEIA 1XC1A 4F31B 1FTMA 3PPRA 2G29A 5AA3A 4F29A 3M3LA 3QAXA 1LBBA 4F3SA 3U72A 2UYFA 3GLBA 1MXUA 1MH3A 5M2VA 4R72A 3Q28A 5IAIA 3MJNA 4OENA 4XKRA 5JEIA 5H8HA 1B6HA 1N7WA 3G7WA 3VVFA 4EXLA 4BDLA 1B58A 4JDFA 3V8XB 4F1VA 2RINA 4MFIA 4BLAA 3PPNA 2HAVA 4JWOA 1JEVA 2I4CA 4JWXA 3SEYA 4ZEKA 1MY2A 3V83A 1JW1A 3SKPA 4GVOA 1IXGA 3O28A 1MXYA 2O84X 2V25A 5F7VA 5ICQA 1FQBA 4K3FA 4OFLA 3USDA 4FEBA 3ECRA 1FW0A 3RQTA 3UA8A 1NNKA 3V5AA 1P99A 2H9BA 4KQPA 2GHAA 1MY1A 4O3CA 3OSQA 2Z22A 5I59A 2RF1A 5CBSA 1BIYA 2I3VA 4P0GA 3M8UA 4HS7A 3VVEA 1XT8A 5DVFA 3TPAA 4PFYA 4YKPA 3EHSA 1I69A 2ZNSA 3CIJA 3RUMA 4Q0CA 1D9YA 1B3FA 2P0SA 2QS4A 4GL0A 2HQ0A 5HM4B 1FQEA 3RNNA 3TAJA 1Y3PA 1GGGA 5TU0A 2F97A 3WAFA 1AOVA 4QHQA 2XXWA 4P0IA 4KD5A 4YKIA 4Q30B 3EQ1A 1MDQA 1NMUA 4RNSA 3FV1A 4POWA 1NH8A 1O7TA 1BLFA 3LSWA 2H98A 1IZ1A 1GV8A 3VLWA 3N26A 3UORA 2UYEA 3FJ7A 4EQ9A 1Y4CA 3IORA 3KOTA 1MPDA 1QUKA 4FE8A 4H1XA 5JK4A 4U4SA 3PV0E 4N07A 3OMBA 3G3FA 5KDTB 2PMSA 1PBQA 5DVJA 4MLVA 4KYEA 3QK6A 3UN6A 1H76A 1LAFE 1ZIUA 2DSFA 1B3LA 5L9MA 4OMBA 3MC2A 4R9GA 1OVBA 1MRPA 4NTLA 2F6PA 2RCAA 1O63A 1UTBB 3LSXA 3VE1B 1MXWA 3OO6A 4OERA 3OO7A 1TFAA 5ISUA 2ALUA 4LONB 1IITA 2Y84A 1SVXB 2GFEA 3FXUA 3MZ1A 2UVHA 3FD3A 1NNTA 1S50A 4DCXA 4RPOA 2PX1A 4IGTA 3UIFA 3O29A 5HBCA 3CG1A 3WAEA 2P1SA 2XXYA 4KI0E 3HO7A 4ECFA 1H3DA 3K6XA 4U2RA 1Y1ZA 4DXBA 2Z8EA 1B05A 1MDP1 5AA4B 3TEPA 5L9SA 3H03A 3KSXA 3I5OA 1B7ZA 2WKYA 1MQIA 1YPNA 3DP4A 3TTMA 3T22A 3K2DA 1URDA 3QIMA 2H5YA 1B1HA 2Y7PA 5H8NB 5H8FB 1B51A 4ZZEA 3FVGA 4FAJA 3S9LC 2XD2A 1KWHA 2F6GA 2XX8A 3DP6A 2XXQA 4Q8RA 1A54A 1SW1A 3BBRA 3BFTA 2D21A 3G3JA 4YZZA 3SERA 4OXVA 4M4GA 4LZ7A 2I0CA 1EZ9A 1Y1MA 4ELQA 5KDTA 3M3FA 4FATA 2O69A 4O3AA 3O2AA 1MPBA 5ITOA 3IO6A 2XXTA 3HSTA 3OSRA 1TXFA 3ZSFA 3KN8A 4Z7EA 1UTBA 3IB0A 5KCJB 4F3PA 3A3CA 2ZYNA 3OO8A 5CI5A 4AB6A 4PETA 4I9DA 5I84A 4ZS9A 5B70A 4UA8A 1DMBA 3FASA 2HZLA 4MBPA 4QSDA 3T96B 3N6TA 3MZBA 4G8MA 3MAMA 1UQWA 2NXOA 1M5DA 2XXPA 1R6ZA 3PPPA 1POTA 4DXCA 1NNFA 4BDOA 3IOWA 2Q9TA 4F3BA 3P7IA 3VXCA 3TUSA 2KLFA 3ZKKA 1GTKA 3KSJA 5EHMA 4LUBA 2PBWA 4YAHX 2NUVA 1H45A 3CVGA 4R74A 5AA4A 1N3WA 1S9TA 1MPCA 3JZJA 2X7QA 2Q2AA 1N3XA 1Z7NE 1JW4A 4LQ2A 1LCFA 1LLSA 1AMFA 2VOZA 2XXIA 5H8NA 5I57B 1SI0A 3VDFA 1SD3A 3HCQA 2ZNTA 2I48A 3TTLA 2OWTA 3FXRA 1EU8A 2QSXA 4IO3A 3FJMA 4ESXA 2DP8A 3MQ9A 1XOCA 3PGFA 5LOMA 1ZU0A 2YJPA 3C35A 4WEPA 5JTYA 2D5WA 2VHAA 3K0VA 5L8DA 5I56B 4E0XA 4KCDA 2YPNA 4JXIA 4LQ5A 5KCJA 1Y3NA 2F7CA 5TPAB 2ZYOA 5KZTA 4PQJA 4KR5A 3JYRA 1RKMA 2FA7A 3W9WA 2F35A 1CB6A 1US5A 3O9PA 4YMBA 1SW5A 5TP9B 1PDAA 1Q35A 1EZPA 1AH5A 2DQVA 4LZ5A 2DE4A 2DOJA 1UTHB 2VD2A 5ELVA 3T9VA 2Q2CA 1S7YA 1ZKBA 3B6TA 5CMCA 3PUYE 4AQ4A 3S9NC 4OEUA 2DXYA 4QF9A 3IX1A 1Z7ME 3IAZA 1NH7A 3OO9A 1EH3A 1DOTA 2M8CA 4R2BA 4JB7A 3TMGA 3AXFA 4JBZA 1AL3A 4THIA 4DXUA 1ZTYA 4C1UA 3HHGA 4IO2A 2DXRA 3TCFA 3JV9A 1P1UA 2PT1A 3KN3A 3VFJA 3PD9A 1LBCA 3GBBA 1QULA 1NFTA 4YICA 4ZDMA 3IOUA 4OEVA 1NKXA 2I6EA 4QSCA 3LR1A 1QUIA 1HSEA 5CMBA 4ONYA 3B7DA 4OZ9A 4KFQA 5I57A 1YTVA 3PD8A 4EXKA 2AYSA 4EQBA 1PB9A 2OCUA 3EPEA 3ILTB 2GHBA 2P2AA 3HPIA 1MS7A 4BDMA 5FHNA 4OVJA 1FQFA 4RK9A 2X26A 4MF3A 3R26A 1PBPA 1B46A 3L6HA 1US4A 5FHMA 4ELRA 2AL5A 3H3GA 3A09A 1ZMGA 4R9FA 1PEBA 4LA9A 3Q29A 3H7MA 4XKQA 3KGCA 4ESWA 1QKBA 1D3KA 4DE8A 4ZEFA 3V89B 5I56A 3EN3A 1DPEA 1B9JA 3Q27A 4GFRA 5H8SA 1M5BA 4MH5A 4G68B 5TPAA 1H44A 5K2XA 3B6WA 2B3BA 1ZLQA 4PFWA 3QYTA 3GZGA 5DVIA 2GH9A 5ICTA 4JSDA 2V3QA 5F1QA 1NL5A 4I62A 5J1DA 1IEJA 3G3GA 4IB2A 4QFLA 3DP8A 5IKBA 3LC8A 4ZEBA 3E3KA 3SEXA 1XVXA 1II5A 3O6HA 1POY1 1FTOA 3GBAA 4F18A 4QRZA 1UIVA 3KOSA 4RYAA 4G8HA 1TFDA 5AA2B 4R6HA 3CSBA 2QS1A 1P1WA 2I49A 2H99A 2V84A 5DYHA 3H6WA 1FTKA 4XIGQ 4WXJA 1N0TA 1FTLA 2PT2A 4M1VA 1SDXA 1D9VA 1WVJA 5I58B 1JVXA 2OWSA 3VLUA 4UACA 1OMPA 2Z8DA 3IL1B 4WKMA 4KPTA 4NF4B 1M5FA 3CFZA 3ODBA 3UGWA 1YCJA 4OFJA 4FECA 3Q26A 3E13X 1N76A 3DM0A 4H65A 1NNPA 3G3HA 3PMWA 1M5CA 3D4CA 2A5TB 4EF2A 1B2HA 1I6QA 2PVUA 3TODA 5DT6A 4GWOA 4ISUA 1QJMA 2REJA 3IJXB 1FTJA 4TQUQ 3U1OA 2ZYMA 3F11A 4NE4A 1CE2A 3IB1A 2HFBA 1VSOA 4IO5A 3VVDA 2B3FA 1XS5A 4ELPA 2I4BA 1HSLA 2E1SA 5CM6A 3O97A 3S4UA 4IY5A 2OZZA 1OQGA 2O1MA 2ANJA 1BTJA 2Z23A 3PUWE 3HHFA 4Q5TA 2RKMA 3T93B 2F8DA 2PYYA 1LB9A 1P1OA 3QXMA 4I8CA 4KYSA 3EF7A 3C34A 4U21A 4EQ7A 2DWAA 2R6GE 3R6UA 1R1NA 1OVTA 3H6VA 3U94A 2Q8JA 2HZKA 2IEEA 5AA2A 4QFOA 4RA1A 2QMWA 1IIWA 4DCYA 2DE3A 2THIA 1Y9UA 3RTWB 2XHDA 3FXQA 3RLFE 3HV1A 1B3GA 4OQOA 4GXAA 3TTKA 3RGYA 3D4GA 1MG1A 4GL8A 5I58A 3MP8A 4RK2A 2R71A 4NEDA 3UK4A 4NF4A 4GLIA 3LSLA 2I58A 4GD5A 1LCTA 1EZOA 2FYIA 1P1NA 3LSFB 3E9XA 1LSTA 1ZJLA 3KZGA 5HPQA 4N13A 2Y7KA 1B40A 3FVOA 4X9TA 1LAHE 2OJTA 2DYXA 1J1NA 4ZZAA 3MVXA 4KYDA 3TYHA 2I3WA 4DDDA 4TLMB 1VR5A 1URGA 2A5TA 3O66A 4QFPA 3H6TA 2ONKE 2HAUA 2E0SA 1Y3QA 3OEMA 2Z8FA 1FCKA 2Y7RA 4H0WA 4POXA 3TDJA 2DWJA 1M5EA 3KJTA 1B0HA 3C36A 4O3BA 5ITPA 4RY1A 3FIRA 1Y4TA 2F5XA 1A99A 3FVNA 4NWCA 5B7DA 4BDRA 1P1QA 4R6KA 1MY0A 4G2ZA 4FORA 4FEDA 3QUJA 3RY3A 1TT1A 4IO4A 5H8FA 2R9JA 3C33A 3LBSA 2XXXA 4GQOA 4PE5B 4U22A 4U4XA 2DVCA 2QJEA 4G4PA 4H5GA 3TCHA 1N7XA 3TELA 3IR1A 3CI8A 3U92A 3U8QA 4QSEA 2QRYA 2B65A 2DE2A 2FNCA 3CR9A 3PUVE 3UP9A 3T66A 2XXHA 3MVYA 3K4UA 3TZAA 2Y7WA 2YLNA 3CFLA 1MQDA 4YU0A 1SI1A 3KJ7A 1JNFA 2HXWA 5EYFA 3K00A 5FHOA 1B3EA 4EDPA 4DZ1A 4PP0A 4GF8A 2DWIA 5AA1A 1JVYA 4ZEDA 1Q1KA 3MWBA 3N94A 3KFMA 1IXHA 1MM6A 2ONRA 4F2OA 2ZNUA 4H67A 1PC3A 4TLLB 4XTCQ 3M3KA 1IQ7A 3CFXA 4NMYA 4DLDA 4U23A 3TQLA 2LAOA 1VFEA 1N84A 2RC8A 2ZXTA 3THIA 4P11A 4YB7A 1R9QA 1AIVA 2V3TA 4GXSB 1PB7A 1VFDA 3IK6B 2F7AA 1FQDA 2Q88A 4QFNA 3IO4A 1ANFA 4L17A 4MLQA 2UVIA 1SW4A 3S9MC 2XX9A 3MPLA 4U1OA 3H06B 4HCYA 4GRKA 1B32A 1MY4A 3TFLA 3OXNA 3RPWA 4TOZA 5CBRA 1N04A 1SW2A 3KEIA 2QS3A 3I6VA 4XXUA 3BKIB 4RXLA 1DSNA 1LAXA 3R7XA 5L9OA 4Z0IA 5AE4A 4RPNA 3GXAA 4ZECA 1DTGA 4F39A 1SYIA 1RYOA 3W9VA 2RC9A 4NF8B 3K6VA 2O1LA 1A7LA 3Q25A 1LFHA 2F36A 3CSGA 2AIXA 1MQHA 4EUOA 1DTZA 1MY3A 3PUZE 1PB8A 3OELA 1OQHA 4YKJA 3SETA 1ELJA 1JW5A 5A5XB 3BFUA 4JWYA 3FUZA 3DLNA 5DEXB 2H4IA 1O64A 4OHNA 4QFKA 1OLAA 5H8QB 4YB5A 3OENA 4RJZA 1XHYA 1SYHA 3MBPA 3N6UA 1B7UA 3C32A 1OLCA 4C1TA 2QPQA 3HN0A 3ZKLA 2O51A 3FVKA 3QUFA 2XX7A 4F3GA 4G68C 4H6DA 1MXZA 3H6UA 5TP9A 2GRVA 3L6GA 2BJJX 4IO7A 3EHUA 1UTHA 1WDNA 2HEUA 4BDNA 3C4MA 1FQCA 3SDFA 1JETA 1URSA 3S2VA 3T9UA 3TKDA 3G3KA 1ZBMA 3KBRA 4F19A 1LFIA 5I2KB 2QMXA 3MP1A 3CG3A 5BWJA 3IJOB 2O68A 2V3UA 3RT6B 3O6IA 1VE4A 5FTHA 3C9HA 2VD3A 4OWDA 3OEKA 3MW0A 2I0BA 1R9LA 1Y20A 1GVCA 2A5SA 2X7PA 2REGA 3U93A 2RC7A 4OESA 4BDQA 3K6UA 4F2QA 2ESNA 3KN7A 4PFUA 4JSOA 2QS2A 4U1ZA 4NF8A 3PPOA 1H43A 1T0KA 3E4RA 2HCAA 2DWHA 2H25A 4X1DA 3K01A 1LGBC 2F78A 4F22A 5CRYA 5FTIA 4OYVA 5A5XA 4R6YA 2O7UA 3IB2A 5DEXA 1GR2A 5I2NB 3PPQA 2ABHA 4OFOA 4AB5A 4G77A 4H8IA 5H8QA 1DPPA 3ZS6A 3VV5A 3K1MA 3K1PA 1B5IA 3T9XB 1A8EA 4R75A 4WEDA 4FJPA 2W7YA 2Y7IA 1IXCA 4G68A 1B52A 4E0WA
chains in the Genus database with same CATH superfamily
2AL4A 1QKAA 3RTFB 4FBPA 3FV2A 3FATA 5K2YA 3CRBA 1EYKA 4F1UA 4NF6B 3PU5A 2V93A 1USYE 4LP2B 1SBPA 4ELOA 3QSLA 5IM2A 2OBGA 5EQ9A 3FXBA 4XKPA 1AWBA 1LBXA 1MQJA 1F9BA 3K6WA 3BIGA 1Q9DA 1NUWA 1B0LA 1MM7A 3EHTA 4PTKA 4HW8A 3G3IA 4OETA 4F1YA 2RCBA 2XXVA 4IGRA 2F7BA 3SEUA 4LVQA 4ND9A 1IXIA 5I2KA 3K02A 4ZE9A 4EF1A 4C0RA 3TQWA 2VP1A 3MPKA 3ROJA 4ZE8A 4OTEA 1UIUA 2CZLA 3MVWA 4O8MA 2ONSA 3FZVA 1FRPA 4NF5B 1YAEA 3SEVA 4JVIA 2DS9A 1D4NA 4LZ8A 4IO6A 4PFTA 2QFLA 1I6AA 5ET8A 3H4ZA 2CMOA 3S9EA 1WODA 3VXBA 1RYXA 4MEVA 1B5HA 1I6BA 4LATA 5JTYB 4FIMA 3LUYA 3RN8A 4KXPA 5CMMA 4G8NA 2O7IA 1DBZA 1B7HA 4N8GA 1XVYA 1L5TA 4NWDA 3W15C 4N6KA 4N4UA 1JQFA 3K1NA 4P8BA 3VLVA 3SEWA 3ONMA 3PUXE 1YZ0A 4YB6A 4GIZA 5CMKA 5I2NA 1B4HA 4R73A 3C31A 4QBAA 3OOAA 2NOOA 1NV7A 5H8HB 3SESA 3MUQA 1BKAA 1B3HA 1B4ZA 3TTRA 3ISPA 2UXAA 4MNPA 1ATGA 3RT8A 2VT5A 1MQGA 3TTNA 2UVJA 2D3IA 3IOVA 4MAGA 3MVZA 4YKKA 3DELB 2XXUA 4P3LA 4JVCA 2XXRA 2UVGA 3MP6A 4HTGA 4H8JA 3OD7A 3B6QA 2O6AA 2XD3A 2MKZA 4KHZE 3KG2A 4R2FA 2IA4A 3NOHA 4NF6A 1LFGA 3FJGA 1LBVA 4YMAA 4I1DA 5DTBA 1HSJA 3N5LA 2QL3A 2Q89A 2FVZA 3ILUB 5IZZA 1QUJA 5BUUA 2F34A 4GOTA 2ZMBA 1A8FA 2G93A 5AA2D 3A3UA 3PMXA 3T9HB 1BP5A 2OK2A 1LB8A 3O6GA 3IOTA 1B1XA 3PMVA 2NWJA 1JEUA 1MXXA 5I59B 2NVUB 1SQYA 5EHSA 1OIBA 3TCGA 1IMBA 4H5FA 1FQAA 2OLBA 1USYH 4X48A 3FGSA 1IUDA 4HCWA 1B5JA 1LAGE 4IY6A 4KCCA 4NF5A 1A40A 1EYJA 3MZ9A 1TWYA 1QVSA 2DVZA 4DIGA 5CC2A 2VGQA 4N6PA 3EKIA 1MH4A 1A55A 2Q74A 3I3VA 4XKNA 2ZYKA 1QW0A 4X1BA 1MXVA 4ZEIA 1XC1A 1NI9A 4F31B 1FTMA 5ET7A 3PPRA 2G29A 5AA3A 4NHBA 4F29A 1FBPA 3M3LA 1INPA 1LBYA 3QAXA 1LBBA 4F3SA 3U72A 2UYFA 2KR0A 3GLBA 1MXUA 1MH3A 5M2VA 4R72A 3Q28A 5IAIA 3MJNA 4N6DA 4OENA 4XKRA 5JEIA 1FPGA 1FBGA 5H8HA 1B6HA 1N7WA 3G7WA 3VVFA 4EXLA 4BDLA 1B58A 4HE0A 4JDFA 3V8XB 4F1VA 2RINA 4MFIA 4BLAA 1NV1A 3PPNA 2HAVA 4JWOA 2QVVA 1JEVA 2BJIA 2I4CA 4JWXA 3SEYA 1FBEA 4ZEKA 1MY2A 3V83A 1JW1A 3SKPA 4GVOA 1IXGA 2PCRA 3O28A 1MXYA 2O84X 2V25A 4JVDA 5F7VA 5ICQA 1G0HA 1FQBA 4K3FA 4OFLA 3USDA 4I3YA 4FEBA 2L5VA 3ECRA 1FW0A 3RQTA 3UA8A 1FPDA 1NNKA 4PAFA 3V5AA 1P99A 2H9BA 4KQPA 2GHAA 1MY1A 4O3CA 3OSQA 2Z22A 5I59A 2RF1A 5CBSA 5ET5A 1BIYA 2I3VA 1RDZA 4P0GA 3M8UA 4HS7A 3VVEA 1XT8A 5DVFA 3TPAA 4PFYA 4YKPA 4NX1A 3EHSA 1I69A 2ZNSA 3CIJA 3RUMA 4MCOA 1FPBA 4Q0CA 1D9YA 1B3FA 2P0SA 4N8YA 2QS4A 4GL0A 2HQ0A 5HM4B 1FQEA 1NV6A 3RNNA 3TAJA 4PFBA 1Y3PA 1GGGA 5TU0A 2F97A 3WAFA 1AOVA 4QHQA 1BK4A 2XXWA 4P0IA 4KD5A 4YKIA 4Q30B 3EQ1A 1MDQA 1NMUA 4RNSA 3FV1A 2FIEA 1NH8A 4POWA 1O7TA 1BLFA 3LSWA 2H98A 1IZ1A 1FBFA 1GV8A 3VLWA 3N26A 2WYKA 3UORA 2UYEA 5ET6A 3FJ7A 4XEQA 4EQ9A 1Y4CA 3IORA 3QMFA 3KOTA 1MPDA 1QUKA 4FE8A 4H1XA 4O7IA 5JK4A 4U4SA 2WBBA 3PV0E 4N07A 3OMBA 3G3FA 5KDTB 2PMSA 1PBQA 5DVJA 4MLVA 4KYEA 2CZKA 3QK6A 1IMEA 3UN6A 1NV3A 1H76A 1LAFE 1ZIUA 2DSFA 4MX6A 2OWZA 3A29A 1B3LA 5L9MA 4OMBA 3MC2A 4R9GA 1OVBA 4N17A 1MRPA 4NTLA 2F6PA 2RCAA 1O63A 1UTBB 3LSXA 3VE1B 4DI4B 1D9QA 1MXWA 4H45A 3OO6A 4OERA 3OO7A 4PAKA 2JJKA 1TFAA 5ISUA 2ALUA 4LONB 3KC0A 2Y5KA 1IITA 2Y84A 3B8BA 1SVXB 2GFEA 3FXUA 3MZ1A 2UVHA 3FD3A 1NNTA 1S50A 4DCXA 4RPOA 2PX1A 4IGTA 3UIFA 3O29A 5HBCA 5DW8A 1K9ZA 3CG1A 3WAEA 2P1SA 2XXYA 4KI0E 3HO7A 4ECFA 3CHGA 1H3DA 4O7MA 3K6XA 4U2RA 1Y1ZA 4DXBA 2Z8EA 1B05A 1MDP1 5I5PA 5AA4B 3TEPA 5L9SA 3H03A 3KSXA 3I5OA 1B7ZA 2WKYA 5T3JA 1NV5A 2FBPA 1MQIA 1YPNA 4NGUA 4NF0A 1YXIA 3DP4A 4HXVA 3TTMA 4PDDA 3T22A 3K2DA 1URDA 3QIMA 2H5YA 1B1HA 2Y7PA 5H8NB 5H8FB 1RDYA 1B51A 4ZZEA 3FVGA 4FAJA 3S9LC 2WEFA 2XD2A 3PTYA 4OVRA 1KWHA 2F6GA 2XX8A 3DP6A 2XXQA 4Q8RA 1A54A 1SW1A 3BBRA 3BFTA 2D21A 4GBWA 3G3JA 2CZIA 4YZZA 3SERA 4OXVA 4M4GA 4LZ7A 1NUXA 2I0CA 1EZ9A 1Y1MA 4ELQA 5KDTA 3M3FA 4FATA 2O69A 4O3AA 3O2AA 1MPBA 5ITOA 3IO6A 2XXTA 3HSTA 3OSRA 1TXFA 4P47A 3ZSFA 3KN8A 1EYIA 4Z7EA 4IR8A 1UTBA 3IB0A 5KCJB 4F3PA 3A3CA 2ZYNA 3OO8A 5CI5A 4AB6A 4PETA 4I9DA 5I84A 4GWZA 4ZS9A 5B70A 4UA8A 1DMBA 1FBDA 3FASA 2HZLA 4MBPA 4QSDA 3T96B 3N6TA 3MZBA 4G8MA 3MAMA 1UQWA 2NXOA 1M5DA 2XXPA 1R6ZA 3PPPA 4MJOA 1POTA 4DXCA 1NNFA 4BDOA 3IOWA 2Q9TA 4MMPA 4H46A 4F3BA 4MNCA 3P7IA 2ZZVA 3VXCA 3TUSA 2KLFA 3ZKKA 1GTKA 3KSJA 5EHMA 4LUBA 2PBWA 5I3SA 4YAHX 2NUVA 1H45A 3CVGA 4X8RA 4R74A 5AA4A 1N3WA 1S9TA 2CEXA 1MPCA 3JZJA 2XA5A 2X7QA 2Q2AA 2WX9A 1N3XA 1Z7NE 1JW4A 4LQ2A 3MYUA 1LCFA 1LLSA 1AMFA 3BIHA 2VOZA 2XXIA 5H8NA 5I57B 1SI0A 2B4LA 4QXDA 3VDFA 1SD3A 3HCQA 2ZNTA 2I48A 2CZHA 3TTLA 2OWTA 3FXRA 1EU8A 1FBHA 2QSXA 4IO3A 3FJMA 3HFUA 2ZZWA 4ESXA 2DP8A 3MQ9A 4OVQA 2XWVA 1XOCA 3PGFA 5LOMA 1ZU0A 2YJPA 3C35A 4WEPA 5JTYA 2D5WA 2VHAA 3K0VA 5L8DA 5I56B 4E0XA 4KCDA 2YPNA 4JXIA 4LQ5A 5KCJA 1Y3NA 3B50A 2F7CA 2ZYOA 5TPAB 5KZTA 4PQJA 4KR5A 3JYRA 1RKMA 2FA7A 3W9WA 2F35A 1CB6A 1US5A 3O9PA 4YMBA 1SW5A 4P56A 5TP9B 1PDAA 1Q35A 1EZPA 3T1BA 1AH5A 2DQVA 4LZ5A 2DE4A 5LTCA 1SPIA 4GWXA 2DOJA 1UTHB 2VD2A 5ELVA 4NG7A 3T9VA 2Q2CA 1S7YA 1ZKBA 3GYYA 3B6TA 5CMCA 3PUYE 4AQ4A 3S9NC 4OEUA 2DXYA 4QF9A 3IX1A 4PGPA 1Z7ME 3IAZA 1NH7A 3OO9A 2GQ1A 1EH3A 1DOTA 2M8CA 4R2BA 4JB7A 2FIXA 3TMGA 3AXFA 4PC9A 4JBZA 1AL3A 4THIA 4DXUA 1ZTYA 4C1UA 4PGNA 2QVRA 3HHGA 4IO2A 2DXRA 3TCFA 3JV9A 1P1UA 1IMAA 2PT1A 3KN3A 3VFJA 3PD9A 5EQ8A 1LBCA 3GBBA 1QULA 1NFTA 4YICA 4ZDMA 3IOUA 2VPOA 3MSTA 4OEVA 1NKXA 2I6EA 4QSCA 3LR1A 1QUIA 1HSEA 5CMBA 4ONYA 3B7DA 4OZ9A 4KFQA 5I57A 1YTVA 3PD8A 4EXKA 2AYSA 4EQBA 1PB9A 4UABA 2OCUA 3EPEA 1LEVA 3ILTB 2GHBA 2P2AA 2CEYA 3HPIA 1MS7A 4BDMA 4OA4A 5FHNA 4OVJA 1FQFA 4PFRA 1KA1A 4GWYA 4RK9A 2X26A 4MF3A 3R26A 1PBPA 4I40A 4OVPA 1B46A 3L6HA 4GWSA 1US4A 5FHMA 4ELRA 2AL5A 3H3GA 5EYHA 3A09A 1ZMGA 4R9FA 4NQ8A 1PEBA 4LA9A 3Q29A 3H7MA 4XKQA 3KGCA 4ESWA 1QKBA 1D3KA 4PFIA 4DE8A 4ZEFA 3V89B 5I56A 3EN3A 1DPEA 4PDHA 1B9JA 3Q27A 4GFRA 5H8SA 1M5BA 4MH5A 4G68B 5TPAA 1H44A 5K2XA 3B6WA 2B3BA 1ZLQA 4PFWA 2XWOA 1FJ9A 3QYTA 3GZGA 5DVIA 4AS5A 2GH9A 5ICTA 2B4MA 4JSDA 2V3QA 5F1QA 1NL5A 1RDXA 4I62A 4PAIA 2ZZXA 5J1DA 4OANA 1IEJA 3G3GA 4IB2A 4QFLA 3DP8A 5IKBA 5EQAA 3LC8A 4ZEBA 5I7IA 1VDWA 4MHFA 3E3KA 3SEXA 1XVXA 1II5A 4XF5A 3O6HA 1POY1 1FTOA 3GBAA 4F18A 4QRZA 1UIVA 3KOSA 4RYAA 4G8HA 1TFDA 3LUZA 2VPNA 5AA2B 4R6HA 2XXKA 3CSBA 2QS1A 1P1WA 2I49A 2H99A 2V84A 5DYHA 3H6WA 1FTKA 4XIGQ 4WXJA 1N0TA 1FTLA 2PT2A 4M1VA 1SDXA 4PF6A 1D9VA 1WVJA 5I58B 1JVXA 2OWSA 3VLUA 4UACA 1OMPA 2Z8DA 3IL1B 4WKMA 4KPTA 4NF4B 1M5FA 3CFZA 3ODBA 3UGWA 4P1EA 1YCJA 4OFJA 4FECA 1DK4A 3Q26A 3E13X 1N76A 3DM0A 4H65A 1NNPA 3G3HA 3PMWA 1M5CA 2WBDA 3D4CA 2A5TB 4EF2A 1B2HA 1I6QA 2PVUA 3TODA 5DT6A 1KA0A 4GWOA 4ISUA 1QJMA 2REJA 3IJXB 1FTJA 4TQUQ 3U1OA 2ZYMA 3F11A 4NE4A 1CE2A 3IB1A 2HFBA 1VSOA 4IO5A 3VVDA 1G0IA 2HPGA 2B3FA 1XS5A 4PBHA 4ELPA 2I4BA 4GWWA 1HSLA 2E1SA 5CM6A 3O97A 3S4UA 4IY5A 2OZZA 1OQGA 2O1MA 2ANJA 4G61A 1BTJA 2Z23A 3PUWE 2WYPA 1IMFA 3HHFA 4Q5TA 2RKMA 3T93B 2F8DA 2PYYA 3IFAA 1LB9A 2Y5LA 1P1OA 3QXMA 4I8CA 4KYSA 3EF7A 3C34A 4U21A 4EQ7A 2DWAA 4AS4A 4GX6A 2R6GE 3R6UA 1R1NA 1OVTA 3H6VA 3LV0A 3U94A 3T0JA 2Q8JA 2HZKA 2IEEA 1XI6A 1LBZA 5AA2A 4PBQA 4QFOA 4NAPA 4RA1A 2QMWA 1IIWA 4DCYA 2DE3A 2THIA 1Y9UA 3RTWB 2XHDA 3FXQA 3RLFE 3HV1A 1B3GA 4OQOA 1CNQA 4GXAA 3TTKA 3RGYA 3D4GA 1MG1A 4GL8A 5I58A 3MP8A 2OX3A 4RK2A 2R71A 4NEDA 3UK4A 4NF4A 4GLIA 3LSLA 2I58A 4GD5A 1FPJA 1LCTA 1EZOA 1NV0A 1P1NA 2FYIA 3LSFB 3E9XA 2DDKA 1LSTA 1ZJLA 3KZGA 5HPQA 4N13A 2PFZA 3RYDA 2Y7KA 4O94A 1B40A 3FVOA 4X9TA 1LAHE 2OJTA 2DYXA 1J1NA 4ZZAA 3MVXA 4KYDA 3TYHA 2I3WA 4DDDA 4TLMB 1VR5A 1NUYA 2F3DA 2R8TA 1URGA 2A5TA 3O66A 4QFPA 3H6TA 2ONKE 2HAUA 4N81A 4LN5A 1IMCA 2E0SA 1Y3QA 3OEMA 2Z8FA 1FCKA 2Y7RA 1FBCA 4H0WA 4POXA 3TDJA 2DWJA 1M5EA 4GX4A 2HXRA 3KJTA 1B0HA 3C36A 2HHMA 4O3BA 4GWUA 5ITPA 4RY1A 3FIRA 1Y4TA 2F5XA 1A99A 3FVNA 4NWCA 5B7DA 4BDRA 1P1QA 4R6KA 1MY0A 4G2ZA 2F3BA 4FORA 4FEDA 3QUJA 3RY3A 1TT1A 4IO4A 5H8FA 2R9JA 3C33A 3LBSA 2XXXA 4GQOA 4PE5B 4U22A 2V4CA 4U4XA 2DVCA 2QJEA 4G4PA 4H5GA 3TELA 1N7XA 3TCHA 3IR1A 3CI8A 3U92A 3U8QA 4QSEA 2QRYA 2B65A 2DE2A 2FNCA 3CR9A 3PUVE 1FPKA 3UP9A 3T66A 2XXHA 3U65A 4P9KA 3MVYA 3K4UA 3TZAA 1FSAA 2Y7WA 2YLNA 3CFLA 1MQDA 4YU0A 1SI1A 3KJ7A 1JNFA 2HXWA 5EQ7A 2QVUA 5EYFA 3K00A 5FHOA 4PCDA 1B3EA 4EDPA 4PE3A 4DZ1A 4PP0A 4GF8A 2DWIA 5AA1A 4OVSA 1JVYA 4ZEDA 1Q1KA 3MWBA 3N94A 3KFMA 1IXHA 1MM6A 2ONRA 4F2OA 2ZNUA 4H67A 1PC3A 4TLLB 4XTCQ 2Q8MA 3M3KA 1IQ7A 3CFXA 4NMYA 4N15A 4DLDA 4U23A 3TQLA 2LAOA 1VFEA 1N84A 2RC8A 2ZXTA 3THIA 2P3VA 4P11A 3FBPA 4YB7A 1R9QA 1AIVA 2V3TA 4GXSB 5IZ3B 1PB7A 1VFDA 3IK6B 2F7AA 4MIJA 1FQDA 2Q88A 4QFNA 3SZPA 3IO4A 1ANFA 4L17A 4MLQA 1QGXA 2UVIA 1SW4A 3S9MC 2XX9A 3MPLA 1KZ8A 4U1OA 2FHYA 3H06B 4HCYA 4GRKA 1B32A 1MY4A 3TFLA 3OXNA 3RPWA 4TOZA 5F24A 5CBRA 1N04A 1SW2A 1LBWA 3KEIA 2QS3A 3I6VA 4XXUA 3KBZA 3BKIB 2XWKA 4RXLA 1DSNA 5ESYA 1LAXA 3R7XA 2PFYA 5L9OA 4Z0IA 5AE4A 4RPNA 3GXAA 4ZECA 1DTGA 4F39A 1SYIA 4NN3A 1RYOA 3W9VA 2RC9A 3E78A 4NF8B 3K6VA 2O1LA 1A7LA 3Q25A 1LFHA 2F36A 3CSGA 2AIXA 4GX3A 1MQHA 1JP4A 4EUOA 1DTZA 1MY3A 3PUZE 1PB8A 3OELA 1OQHA 4YKJA 3SETA 1ELJA 1JW5A 5A5XB 3BFUA 4JWYA 3FUZA 3DLNA 5DEXB 2H4IA 1NUZA 1O64A 4OHNA 4QFKA 1OLAA 2P3NA 5H8QB 4YB5A 1NV2A 3OENA 5FBPA 4RJZA 1XHYA 1SYHA 3RPLB 3MBPA 4GBVA 3N6UA 1B7UA 3C32A 1OLCA 4C1TA 2QPQA 3HN0A 3ZKLA 2O51A 3FVKA 4P1LA 4X04A 3QUFA 5A5LA 2XX7A 4F3GA 4G68C 4H6DA 1MXZA 4HE2A 3H6UA 1IMDA 5TP9A 4N91A 4I3EA 2GRVA 1YYZA 3L6GA 2KQZA 2BJJX 4IO7A 3EHUA 1UTHA 1WDNA 2HEUA 3D1RA 1NV4A 4BDNA 3C4MA 1FQCA 3IFCA 5IZ3A 3SDFA 1JETA 1URSA 3S2VA 3T9UA 3TKDA 3G3KA 1ZBMA 3KBRA 5EYGA 5J16A 4F19A 1LFIA 5I2KB 2QMXA 3MP1A 3CG3A 5BWJA 3IJOB 2O68A 2V3UA 3RT6B 1FPFA 3O6IA 1VE4A 1DCUA 1FPLA 5FTHA 3C9HA 4XFEA 2VD3A 4OWDA 3OEKA 3MW0A 2I0BA 1R9LA 1Y20A 1GVCA 3E79A 3KC1A 1FTAA 2A5SA 2X7PA 2REGA 3U93A 2RC7A 4OESA 4BDQA 1FJ6A 3K6UA 4F2QA 2ESNA 3KN7A 5IGAA 4PFUA 4HE1A 4JSOA 2QS2A 1FPIA 4U1ZA 4NF8A 3PPOA 1H43A 1T0KA 3E4RA 2HCAA 4PF8A 2DWHA 2H25A 2XWIA 4X1DA 3K01A 1LGBC 2F78A 5IZ1A 4F22A 5CRYA 5FTIA 4OYVA 5A5XA 4R6YA 2O7UA 3IB2A 5DEXA 1GR2A 5I2NB 5LDZA 4MNIA 1K9YA 3PPQA 2ABHA 4OFOA 4AB5A 1FPEA 4G77A 4H8IA 5H8QA 1DPPA 3ZS6A 3VV5A 3K1MA 3K1PA 1B5IA 3T9XB 1A8EA 3RPLA 4R75A 4WEDA 4FJPA 2W7YA 2Y7IA 4OVTA 1IXCA 4DI3D 4G68A 1B52A 4E0WA
chains in the Genus database with same CATH topology
2AL4A 1QKAA 3RTFB 3FV2A 3FATA 5K2YA 3CRBA 4F1UA 4NF6B 3PU5A 2V93A 1USYE 4LP2B 1SBPA 4ELOA 3QSLA 2OBGA 4XKPA 1MQJA 1F9BA 3K6WA 1B0LA 1MM7A 3EHTA 4HW8A 3G3IA 4OETA 4F1YA 2RCBA 2XXVA 4IGRA 2F7BA 3SEUA 4LVQA 4ND9A 1IXIA 5I2KA 3K02A 4ZE9A 4EF1A 4C0RA 3TQWA 2VP1A 3MPKA 4ZE8A 4OTEA 1UIUA 2CZLA 3MVWA 2ONSA 3FZVA 4NF5B 1YAEA 3SEVA 2DS9A 1D4NA 4LZ8A 4IO6A 4PFTA 1I6AA 3H4ZA 2CMOA 3S9EA 1WODA 3VXBA 1RYXA 1B5HA 1I6BA 4LATA 5JTYB 4FIMA 3LUYA 3RN8A 5CMMA 4G8NA 2O7IA 1B7HA 1XVYA 1L5TA 4NWDA 3W15C 1JQFA 3K1NA 3VLVA 3SEWA 3ONMA 3PUXE 4YB6A 4GIZA 5CMKA 5I2NA 1B4HA 4R73A 3C31A 3OOAA 2NOOA 5H8HB 3SESA 3MUQA 1BKAA 1B3HA 1B4ZA 3TTRA 2UXAA 1ATGA 3RT8A 1MQGA 3TTNA 2UVJA 2D3IA 3IOVA 3MVZA 4YKKA 3DELB 2XXUA 2XXRA 2UVGA 3MP6A 4HTGA 4H8JA 3OD7A 3B6QA 2O6AA 2XD3A 4KHZE 3KG2A 4R2FA 2IA4A 4NF6A 1LFGA 3FJGA 4YMAA 4I1DA 5DTBA 1HSJA 3N5LA 2QL3A 2Q89A 3ILUB 1QUJA 5BUUA 2F34A 4GOTA 2ZMBA 1A8FA 2G93A 5AA2D 3A3UA 3PMXA 3T9HB 1BP5A 2OK2A 1LB8A 3O6GA 3IOTA 1B1XA 3PMVA 2NWJA 1JEUA 1MXXA 5I59B 2NVUB 1SQYA 5EHSA 1OIBA 3TCGA 4H5FA 1FQAA 2OLBA 1USYH 4X48A 3FGSA 1IUDA 4HCWA 1B5JA 1LAGE 4IY6A 4KCCA 4NF5A 1A40A 3MZ9A 1TWYA 1QVSA 2DVZA 4DIGA 5CC2A 2VGQA 4N6PA 1MH4A 1A55A 4XKNA 3I3VA 2ZYKA 1QW0A 4X1BA 1MXVA 4ZEIA 1XC1A 4F31B 1FTMA 3PPRA 2G29A 5AA3A 4F29A 3M3LA 3QAXA 1LBBA 4F3SA 3U72A 2UYFA 3GLBA 1MXUA 1MH3A 5M2VA 4R72A 3Q28A 5IAIA 3MJNA 4OENA 4XKRA 5JEIA 5H8HA 1B6HA 1N7WA 3G7WA 3VVFA 4EXLA 4BDLA 1B58A 4JDFA 3V8XB 4F1VA 2RINA 4MFIA 4BLAA 3PPNA 2HAVA 4JWOA 1JEVA 2I4CA 4JWXA 3SEYA 4ZEKA 1MY2A 3V83A 1JW1A 3SKPA 4GVOA 1IXGA 3O28A 1MXYA 2O84X 2V25A 5F7VA 5ICQA 1FQBA 4K3FA 4OFLA 3USDA 4FEBA 3ECRA 1FW0A 3RQTA 3UA8A 1NNKA 3V5AA 1P99A 2H9BA 4KQPA 2GHAA 1MY1A 4O3CA 3OSQA 2Z22A 5I59A 2RF1A 5CBSA 1BIYA 2I3VA 4P0GA 3M8UA 4HS7A 3VVEA 1XT8A 5DVFA 3TPAA 4PFYA 4YKPA 3EHSA 1I69A 2ZNSA 3CIJA 3RUMA 4Q0CA 1D9YA 1B3FA 2P0SA 2QS4A 4GL0A 2HQ0A 5HM4B 1FQEA 3RNNA 3TAJA 1Y3PA 1GGGA 5TU0A 2F97A 3WAFA 1AOVA 4QHQA 2XXWA 4P0IA 4KD5A 4YKIA 4Q30B 3EQ1A 1MDQA 1NMUA 4RNSA 3FV1A 4POWA 1NH8A 1O7TA 1BLFA 3LSWA 2H98A 1IZ1A 1GV8A 3VLWA 3N26A 3UORA 2UYEA 3FJ7A 4EQ9A 1Y4CA 3IORA 3KOTA 1MPDA 1QUKA 4FE8A 4H1XA 5JK4A 4U4SA 3PV0E 4N07A 3OMBA 3G3FA 5KDTB 2PMSA 1PBQA 5DVJA 4MLVA 4KYEA 3QK6A 3UN6A 1H76A 1LAFE 1ZIUA 2DSFA 1B3LA 5L9MA 4OMBA 3MC2A 4R9GA 1OVBA 1MRPA 4NTLA 2F6PA 2RCAA 1O63A 1UTBB 3LSXA 3VE1B 1MXWA 3OO6A 4OERA 3OO7A 1TFAA 5ISUA 2ALUA 4LONB 1IITA 2Y84A 1SVXB 2GFEA 3FXUA 3MZ1A 2UVHA 3FD3A 1NNTA 1S50A 4DCXA 4RPOA 2PX1A 4IGTA 3UIFA 3O29A 5HBCA 3CG1A 3WAEA 2P1SA 2XXYA 4KI0E 3HO7A 4ECFA 1H3DA 3K6XA 4U2RA 1Y1ZA 4DXBA 2Z8EA 1B05A 1MDP1 5AA4B 3TEPA 5L9SA 3H03A 3KSXA 3I5OA 1B7ZA 2WKYA 1MQIA 1YPNA 3DP4A 3TTMA 3T22A 3K2DA 1URDA 3QIMA 2H5YA 1B1HA 2Y7PA 5H8NB 5H8FB 1B51A 4ZZEA 3FVGA 4FAJA 3S9LC 2XD2A 1KWHA 2F6GA 2XX8A 3DP6A 2XXQA 4Q8RA 1A54A 1SW1A 3BBRA 3BFTA 2D21A 3G3JA 4YZZA 3SERA 4OXVA 4M4GA 4LZ7A 2I0CA 1EZ9A 1Y1MA 4ELQA 5KDTA 3M3FA 4FATA 2O69A 4O3AA 3O2AA 1MPBA 5ITOA 3IO6A 2XXTA 3HSTA 3OSRA 1TXFA 3ZSFA 3KN8A 4Z7EA 1UTBA 3IB0A 5KCJB 4F3PA 3A3CA 2ZYNA 3OO8A 5CI5A 4AB6A 4PETA 4I9DA 5I84A 4ZS9A 5B70A 4UA8A 1DMBA 3FASA 2HZLA 4MBPA 4QSDA 3T96B 3N6TA 3MZBA 4G8MA 3MAMA 1UQWA 2NXOA 1M5DA 2XXPA 1R6ZA 3PPPA 1POTA 4DXCA 1NNFA 4BDOA 3IOWA 2Q9TA 4F3BA 3P7IA 3VXCA 3TUSA 2KLFA 3ZKKA 1GTKA 3KSJA 5EHMA 4LUBA 2PBWA 4YAHX 2NUVA 1H45A 3CVGA 4R74A 5AA4A 1N3WA 1S9TA 1MPCA 3JZJA 2X7QA 2Q2AA 1N3XA 1Z7NE 1JW4A 4LQ2A 1LCFA 1LLSA 1AMFA 2VOZA 2XXIA 5H8NA 5I57B 1SI0A 3VDFA 1SD3A 3HCQA 2ZNTA 2I48A 3TTLA 2OWTA 3FXRA 1EU8A 2QSXA 4IO3A 3FJMA 4ESXA 2DP8A 3MQ9A 1XOCA 3PGFA 5LOMA 1ZU0A 2YJPA 3C35A 4WEPA 5JTYA 2D5WA 2VHAA 3K0VA 5L8DA 5I56B 4E0XA 4KCDA 2YPNA 4JXIA 4LQ5A 5KCJA 1Y3NA 2F7CA 5TPAB 2ZYOA 5KZTA 4PQJA 4KR5A 3JYRA 1RKMA 2FA7A 3W9WA 2F35A 1CB6A 1US5A 3O9PA 4YMBA 1SW5A 5TP9B 1PDAA 1Q35A 1EZPA 1AH5A 2DQVA 4LZ5A 2DE4A 2DOJA 1UTHB 2VD2A 5ELVA 3T9VA 2Q2CA 1S7YA 1ZKBA 3B6TA 5CMCA 3PUYE 4AQ4A 3S9NC 4OEUA 2DXYA 4QF9A 3IX1A 1Z7ME 3IAZA 1NH7A 3OO9A 1EH3A 1DOTA 2M8CA 4R2BA 4JB7A 3TMGA 3AXFA 4JBZA 1AL3A 4THIA 4DXUA 1ZTYA 4C1UA 3HHGA 4IO2A 2DXRA 3TCFA 3JV9A 1P1UA 2PT1A 3KN3A 3VFJA 3PD9A 1LBCA 3GBBA 1QULA 1NFTA 4YICA 4ZDMA 3IOUA 4OEVA 1NKXA 2I6EA 4QSCA 3LR1A 1QUIA 1HSEA 5CMBA 4ONYA 3B7DA 4OZ9A 4KFQA 5I57A 1YTVA 3PD8A 4EXKA 2AYSA 4EQBA 1PB9A 2OCUA 3EPEA 3ILTB 2GHBA 2P2AA 3HPIA 1MS7A 4BDMA 5FHNA 4OVJA 1FQFA 4RK9A 2X26A 4MF3A 3R26A 1PBPA 1B46A 3L6HA 1US4A 5FHMA 4ELRA 2AL5A 3H3GA 3A09A 1ZMGA 4R9FA 1PEBA 4LA9A 3Q29A 3H7MA 4XKQA 3KGCA 4ESWA 1QKBA 1D3KA 4DE8A 4ZEFA 3V89B 5I56A 3EN3A 1DPEA 1B9JA 3Q27A 4GFRA 5H8SA 1M5BA 4MH5A 4G68B 5TPAA 1H44A 5K2XA 3B6WA 2B3BA 1ZLQA 4PFWA 3QYTA 3GZGA 5DVIA 2GH9A 5ICTA 4JSDA 2V3QA 5F1QA 1NL5A 4I62A 5J1DA 1IEJA 3G3GA 4IB2A 4QFLA 3DP8A 5IKBA 3LC8A 4ZEBA 3E3KA 3SEXA 1XVXA 1II5A 3O6HA 1POY1 1FTOA 3GBAA 4F18A 4QRZA 1UIVA 3KOSA 4RYAA 4G8HA 1TFDA 5AA2B 4R6HA 3CSBA 2QS1A 1P1WA 2I49A 2H99A 2V84A 5DYHA 3H6WA 1FTKA 4XIGQ 4WXJA 1N0TA 1FTLA 2PT2A 4M1VA 1SDXA 1D9VA 1WVJA 5I58B 1JVXA 2OWSA 3VLUA 4UACA 1OMPA 2Z8DA 3IL1B 4WKMA 4KPTA 4NF4B 1M5FA 3CFZA 3ODBA 3UGWA 1YCJA 4OFJA 4FECA 3Q26A 3E13X 1N76A 3DM0A 4H65A 1NNPA 3G3HA 3PMWA 1M5CA 3D4CA 2A5TB 4EF2A 1B2HA 1I6QA 2PVUA 3TODA 5DT6A 4GWOA 4ISUA 1QJMA 2REJA 3IJXB 1FTJA 4TQUQ 3U1OA 2ZYMA 3F11A 4NE4A 1CE2A 3IB1A 2HFBA 1VSOA 4IO5A 3VVDA 2B3FA 1XS5A 4ELPA 2I4BA 1HSLA 2E1SA 5CM6A 3O97A 3S4UA 4IY5A 2OZZA 1OQGA 2O1MA 2ANJA 1BTJA 2Z23A 3PUWE 3HHFA 4Q5TA 2RKMA 3T93B 2F8DA 2PYYA 1LB9A 1P1OA 3QXMA 4I8CA 4KYSA 3EF7A 3C34A 4U21A 4EQ7A 2DWAA 2R6GE 3R6UA 1R1NA 1OVTA 3H6VA 3U94A 2Q8JA 2HZKA 2IEEA 5AA2A 4QFOA 4RA1A 2QMWA 1IIWA 4DCYA 2DE3A 2THIA 1Y9UA 3RTWB 2XHDA 3FXQA 3RLFE 3HV1A 1B3GA 4OQOA 4GXAA 3TTKA 3RGYA 3D4GA 1MG1A 4GL8A 5I58A 3MP8A 4RK2A 2R71A 4NEDA 3UK4A 4NF4A 4GLIA 3LSLA 2I58A 4GD5A 1LCTA 1EZOA 2FYIA 1P1NA 3LSFB 3E9XA 1LSTA 1ZJLA 3KZGA 5HPQA 4N13A 2Y7KA 1B40A 3FVOA 4X9TA 1LAHE 2OJTA 2DYXA 1J1NA 4ZZAA 3MVXA 4KYDA 3TYHA 2I3WA 4DDDA 4TLMB 1VR5A 1URGA 2A5TA 3O66A 4QFPA 3H6TA 2ONKE 2HAUA 2E0SA 1Y3QA 3OEMA 2Z8FA 1FCKA 2Y7RA 4H0WA 4POXA 3TDJA 2DWJA 1M5EA 3KJTA 1B0HA 3C36A 4O3BA 5ITPA 4RY1A 3FIRA 1Y4TA 2F5XA 1A99A 3FVNA 4NWCA 5B7DA 4BDRA 1P1QA 4R6KA 1MY0A 4G2ZA 4FORA 4FEDA 3QUJA 3RY3A 1TT1A 4IO4A 5H8FA 2R9JA 3C33A 3LBSA 2XXXA 4GQOA 4PE5B 4U22A 4U4XA 2DVCA 2QJEA 4G4PA 4H5GA 3TCHA 1N7XA 3TELA 3IR1A 3CI8A 3U92A 3U8QA 4QSEA 2QRYA 2B65A 2DE2A 2FNCA 3CR9A 3PUVE 3UP9A 3T66A 2XXHA 3MVYA 3K4UA 3TZAA 2Y7WA 2YLNA 3CFLA 1MQDA 4YU0A 1SI1A 3KJ7A 1JNFA 2HXWA 5EYFA 3K00A 5FHOA 1B3EA 4EDPA 4DZ1A 4PP0A 4GF8A 2DWIA 5AA1A 1JVYA 4ZEDA 1Q1KA 3MWBA 3N94A 3KFMA 1IXHA 1MM6A 2ONRA 4F2OA 2ZNUA 4H67A 1PC3A 4TLLB 4XTCQ 3M3KA 1IQ7A 3CFXA 4NMYA 4DLDA 4U23A 3TQLA 2LAOA 1VFEA 1N84A 2RC8A 2ZXTA 3THIA 4P11A 4YB7A 1R9QA 1AIVA 2V3TA 4GXSB 1PB7A 1VFDA 3IK6B 2F7AA 1FQDA 2Q88A 4QFNA 3IO4A 1ANFA 4L17A 4MLQA 2UVIA 1SW4A 3S9MC 2XX9A 3MPLA 4U1OA 3H06B 4HCYA 4GRKA 1B32A 1MY4A 3TFLA 3OXNA 3RPWA 4TOZA 5CBRA 1N04A 1SW2A 3KEIA 2QS3A 3I6VA 4XXUA 3BKIB 4RXLA 1DSNA 1LAXA 3R7XA 5L9OA 4Z0IA 5AE4A 4RPNA 3GXAA 4ZECA 1DTGA 4F39A 1SYIA 1RYOA 3W9VA 2RC9A 4NF8B 3K6VA 2O1LA 1A7LA 3Q25A 1LFHA 2F36A 3CSGA 2AIXA 1MQHA 4EUOA 1DTZA 1MY3A 3PUZE 1PB8A 3OELA 1OQHA 4YKJA 3SETA 1ELJA 1JW5A 5A5XB 3BFUA 4JWYA 3FUZA 3DLNA 5DEXB 2H4IA 1O64A 4OHNA 4QFKA 1OLAA 5H8QB 4YB5A 3OENA 4RJZA 1XHYA 1SYHA 3MBPA 3N6UA 1B7UA 3C32A 1OLCA 4C1TA 2QPQA 3HN0A 3ZKLA 2O51A 3FVKA 3QUFA 2XX7A 4F3GA 4G68C 4H6DA 1MXZA 3H6UA 5TP9A 2GRVA 3L6GA 2BJJX 4IO7A 3EHUA 1UTHA 1WDNA 2HEUA 4BDNA 3C4MA 1FQCA 3SDFA 1JETA 1URSA 3S2VA 3T9UA 3TKDA 3G3KA 1ZBMA 3KBRA 4F19A 1LFIA 5I2KB 2QMXA 3MP1A 3CG3A 5BWJA 3IJOB 2O68A 2V3UA 3RT6B 3O6IA 1VE4A 5FTHA 3C9HA 2VD3A 4OWDA 3OEKA 3MW0A 2I0BA 1R9LA 1Y20A 1GVCA 2A5SA 2X7PA 2REGA 3U93A 2RC7A 4OESA 4BDQA 3K6UA 4F2QA 2ESNA 3KN7A 4PFUA 4JSOA 2QS2A 4U1ZA 4NF8A 3PPOA 1H43A 1T0KA 3E4RA 2HCAA 2DWHA 2H25A 4X1DA 3K01A 1LGBC 2F78A 4F22A 5CRYA 5FTIA 4OYVA 5A5XA 4R6YA 2O7UA 3IB2A 5DEXA 1GR2A 5I2NB 3PPQA 2ABHA 4OFOA 4AB5A 4G77A 4H8IA 5H8QA 1DPPA 3ZS6A 3VV5A 3K1MA 3K1PA 1B5IA 3T9XB 1A8EA 4R75A 4WEDA 4FJPA 2W7YA 2Y7IA 1IXCA 4G68A 1B52A 4E0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL4 A;  1QKA A;  3RTF B;  3FV2 A;  3FAT A;  5K2Y A;  3CRB A;  4F1U A;  4NF6 B;  3PU5 A;  2V93 A;  1USY E;  4LP2 B;  1SBP A;  4ELO A;  3QSL A;  2OBG A;  4XKP A;  1MQJ A;  1F9B A;  3K6W A;  1B0L A;  1MM7 A;  3EHT A;  4HW8 A;  3G3I A;  4OET A;  4F1Y A;  2RCB A;  2XXV A;  4IGR A;  2F7B A;  3SEU A;  4LVQ A;  4ND9 A;  1IXI A;  5I2K A;  3K02 A;  4ZE9 A;  4EF1 A;  4C0R A;  3TQW A;  2VP1 A;  3MPK A;  4ZE8 A;  4OTE A;  1UIU A;  2CZL A;  3MVW A;  2ONS A;  3FZV A;  4NF5 B;  1YAE A;  3SEV A;  2DS9 A;  1D4N A;  4LZ8 A;  4IO6 A;  4PFT A;  1I6A A;  3H4Z A;  2CMO A;  3S9E A;  1WOD A;  3VXB A;  1RYX A;  1B5H A;  1I6B A;  4LAT A;  5JTY B;  4FIM A;  3LUY A;  3RN8 A;  5CMM A;  4G8N A;  2O7I A;  1B7H A;  1XVY A;  1L5T A;  4NWD A;  3W15 C;  1JQF A;  3K1N A;  3VLV A;  3SEW A;  3ONM A;  3PUX E;  4YB6 A;  4GIZ A;  5CMK A;  5I2N A;  1B4H A;  4R73 A;  3C31 A;  3OOA A;  2NOO A;  5H8H B;  3SES A;  3MUQ A;  1BKA A;  1B3H A;  1B4Z A;  3TTR A;  2UXA A;  1ATG A;  3RT8 A;  1MQG A;  3TTN A;  2UVJ A;  2D3I A;  3IOV A;  3MVZ A;  4YKK A;  3DEL B;  2XXU A;  2XXR A;  2UVG A;  3MP6 A;  4HTG A;  4H8J A;  3OD7 A;  3B6Q A;  2O6A A;  2XD3 A;  4KHZ E;  3KG2 A;  4R2F A;  2IA4 A;  4NF6 A;  1LFG A;  3FJG A;  4YMA A;  4I1D A;  5DTB A;  1HSJ A;  3N5L A;  2QL3 A;  2Q89 A;  3ILU B;  1QUJ A;  5BUU A;  2F34 A;  4GOT A;  2ZMB A;  1A8F A;  2G93 A;  5AA2 D;  3A3U A;  3PMX A;  3T9H B;  1BP5 A;  2OK2 A;  1LB8 A;  3O6G A;  3IOT A;  1B1X A;  3PMV A;  2NWJ A;  1JEU A;  1MXX A;  5I59 B;  2NVU B;  1SQY A;  5EHS A;  1OIB A;  3TCG A;  4H5F A;  1FQA A;  2OLB A;  1USY H;  4X48 A;  3FGS A;  1IUD A;  4HCW A;  1B5J A;  1LAG E;  4IY6 A;  4KCC A;  4NF5 A;  1A40 A;  3MZ9 A;  1TWY A;  1QVS A;  2DVZ A;  4DIG A;  5CC2 A;  2VGQ A;  4N6P A;  1MH4 A;  1A55 A;  4XKN A;  3I3V A;  2ZYK A;  1QW0 A;  4X1B A;  1MXV A;  4ZEI A;  1XC1 A;  4F31 B;  1FTM A;  3PPR A;  2G29 A;  5AA3 A;  4F29 A;  3M3L A;  3QAX A;  1LBB A;  4F3S A;  3U72 A;  2UYF A;  3GLB A;  1MXU A;  1MH3 A;  5M2V A;  4R72 A;  3Q28 A;  5IAI A;  3MJN A;  4OEN A;  4XKR A;  5JEI A;  5H8H A;  1B6H A;  1N7W A;  3G7W A;  3VVF A;  4EXL A;  4BDL A;  1B58 A;  4JDF A;  3V8X B;  4F1V A;  2RIN A;  4MFI A;  4BLA A;  3PPN A;  2HAV A;  4JWO A;  1JEV A;  2I4C A;  4JWX A;  3SEY A;  4ZEK A;  1MY2 A;  3V83 A;  1JW1 A;  3SKP A;  4GVO A;  1IXG A;  3O28 A;  1MXY A;  2O84 X;  2V25 A;  5F7V A;  5ICQ A;  1FQB A;  4K3F A;  4OFL A;  3USD A;  4FEB A;  3ECR A;  1FW0 A;  3RQT A;  3UA8 A;  1NNK A;  3V5A A;  1P99 A;  2H9B A;  4KQP A;  2GHA A;  1MY1 A;  4O3C A;  3OSQ A;  2Z22 A;  5I59 A;  2RF1 A;  5CBS A;  1BIY A;  2I3V A;  4P0G A;  3M8U A;  4HS7 A;  3VVE A;  1XT8 A;  5DVF A;  3TPA A;  4PFY A;  4YKP A;  3EHS A;  1I69 A;  2ZNS A;  3CIJ A;  3RUM A;  4Q0C A;  1D9Y A;  1B3F A;  2P0S A;  2QS4 A;  4GL0 A;  2HQ0 A;  5HM4 B;  1FQE A;  3RNN A;  3TAJ A;  1Y3P A;  1GGG A;  5TU0 A;  2F97 A;  3WAF A;  1AOV A;  4QHQ A;  2XXW A;  4P0I A;  4KD5 A;  4YKI A;  4Q30 B;  3EQ1 A;  1MDQ A;  1NMU A;  4RNS A;  3FV1 A;  4POW A;  1NH8 A;  1O7T A;  1BLF A;  3LSW A;  2H98 A;  1IZ1 A;  1GV8 A;  3VLW A;  3N26 A;  3UOR A;  2UYE A;  3FJ7 A;  4EQ9 A;  1Y4C A;  3IOR A;  3KOT A;  1MPD A;  1QUK A;  4FE8 A;  4H1X A;  5JK4 A;  4U4S A;  3PV0 E;  4N07 A;  3OMB A;  3G3F A;  5KDT B;  2PMS A;  1PBQ A;  5DVJ A;  4MLV A;  4KYE A;  3QK6 A;  3UN6 A;  1H76 A;  1LAF E;  1ZIU A;  2DSF A;  1B3L A;  5L9M A;  4OMB A;  3MC2 A;  4R9G A;  1OVB A;  1MRP A;  4NTL A;  2F6P A;  2RCA A;  1O63 A;  1UTB B;  3LSX A;  3VE1 B;  1MXW A;  3OO6 A;  4OER A;  3OO7 A;  1TFA A;  5ISU A;  2ALU A;  4LON B;  1IIT A;  2Y84 A;  1SVX B;  2GFE A;  3FXU A;  3MZ1 A;  2UVH A;  3FD3 A;  1NNT A;  1S50 A;  4DCX A;  4RPO A;  2PX1 A;  4IGT A;  3UIF A;  3O29 A;  5HBC A;  3CG1 A;  3WAE A;  2P1S A;  2XXY A;  4KI0 E;  3HO7 A;  4ECF A;  1H3D A;  3K6X A;  4U2R A;  1Y1Z A;  4DXB A;  2Z8E A;  1B05 A;  1MDP 1;  5AA4 B;  3TEP A;  5L9S A;  3H03 A;  3KSX A;  3I5O A;  1B7Z A;  2WKY A;  1MQI A;  1YPN A;  3DP4 A;  3TTM A;  3T22 A;  3K2D A;  1URD A;  3QIM A;  2H5Y A;  1B1H A;  2Y7P A;  5H8N B;  5H8F B;  1B51 A;  4ZZE A;  3FVG A;  4FAJ A;  3S9L C;  2XD2 A;  1KWH A;  2F6G A;  2XX8 A;  3DP6 A;  2XXQ A;  4Q8R A;  1A54 A;  1SW1 A;  3BBR A;  3BFT A;  2D21 A;  3G3J A;  4YZZ A;  3SER A;  4OXV A;  4M4G A;  4LZ7 A;  2I0C A;  1EZ9 A;  1Y1M A;  4ELQ A;  5KDT A;  3M3F A;  4FAT A;  2O69 A;  4O3A A;  3O2A A;  1MPB A;  5ITO A;  3IO6 A;  2XXT A;  3HST A;  3OSR A;  1TXF A;  3ZSF A;  3KN8 A;  4Z7E A;  1UTB A;  3IB0 A;  5KCJ B;  4F3P A;  3A3C A;  2ZYN A;  3OO8 A;  5CI5 A;  4AB6 A;  4PET A;  4I9D A;  5I84 A;  4ZS9 A;  5B70 A;  4UA8 A;  1DMB A;  3FAS A;  2HZL A;  4MBP A;  4QSD A;  3T96 B;  3N6T A;  3MZB A;  4G8M A;  3MAM A;  1UQW A;  2NXO A;  1M5D A;  2XXP A;  1R6Z A;  3PPP A;  1POT A;  4DXC A;  1NNF A;  4BDO A;  3IOW A;  2Q9T A;  4F3B A;  3P7I A;  3VXC A;  3TUS A;  2KLF A;  3ZKK A;  1GTK A;  3KSJ A;  5EHM A;  4LUB A;  2PBW A;  4YAH X;  2NUV A;  1H45 A;  3CVG A;  4R74 A;  5AA4 A;  1N3W A;  1S9T A;  1MPC A;  3JZJ A;  2X7Q A;  2Q2A A;  1N3X A;  1Z7N E;  1JW4 A;  4LQ2 A;  1LCF A;  1LLS A;  1AMF A;  2VOZ A;  2XXI A;  5H8N A;  5I57 B;  1SI0 A;  3VDF A;  1SD3 A;  3HCQ A;  2ZNT A;  2I48 A;  3TTL A;  2OWT A;  3FXR A;  1EU8 A;  2QSX A;  4IO3 A;  3FJM A;  4ESX A;  2DP8 A;  3MQ9 A;  1XOC A;  3PGF A;  5LOM A;  1ZU0 A;  2YJP A;  3C35 A;  4WEP A;  5JTY A;  2D5W A;  2VHA A;  3K0V A;  5L8D A;  5I56 B;  4E0X A;  4KCD A;  2YPN A;  4JXI A;  4LQ5 A;  5KCJ A;  1Y3N A;  2F7C A;  5TPA B;  2ZYO A;  5KZT A;  4PQJ A;  4KR5 A;  3JYR A;  1RKM A;  2FA7 A;  3W9W A;  2F35 A;  1CB6 A;  1US5 A;  3O9P A;  4YMB A;  1SW5 A;  5TP9 B;  1PDA A;  1Q35 A;  1EZP A;  1AH5 A;  2DQV A;  4LZ5 A;  2DE4 A;  2DOJ A;  1UTH B;  2VD2 A;  5ELV A;  3T9V A;  2Q2C A;  1S7Y A;  1ZKB A;  3B6T A;  5CMC A;  3PUY E;  4AQ4 A;  3S9N C;  4OEU A;  2DXY A;  4QF9 A;  3IX1 A;  1Z7M E;  3IAZ A;  1NH7 A;  3OO9 A;  1EH3 A;  1DOT A;  2M8C A;  4R2B A;  4JB7 A;  3TMG A;  3AXF A;  4JBZ A;  1AL3 A;  4THI A;  4DXU A;  1ZTY A;  4C1U A;  3HHG A;  4IO2 A;  2DXR A;  3TCF A;  3JV9 A;  1P1U A;  2PT1 A;  3KN3 A;  3VFJ A;  3PD9 A;  1LBC A;  3GBB A;  1QUL A;  1NFT A;  4YIC A;  4ZDM A;  3IOU A;  4OEV A;  1NKX A;  2I6E A;  4QSC A;  3LR1 A;  1QUI A;  1HSE A;  5CMB A;  4ONY A;  3B7D A;  4OZ9 A;  4KFQ A;  5I57 A;  1YTV A;  3PD8 A;  4EXK A;  2AYS A;  4EQB A;  1PB9 A;  2OCU A;  3EPE A;  3ILT B;  2GHB A;  2P2A A;  3HPI A;  1MS7 A;  4BDM A;  5FHN A;  4OVJ A;  1FQF A;  4RK9 A;  2X26 A;  4MF3 A;  3R26 A;  1PBP A;  1B46 A;  3L6H A;  1US4 A;  5FHM A;  4ELR A;  2AL5 A;  3H3G A;  3A09 A;  1ZMG A;  4R9F A;  1PEB A;  4LA9 A;  3Q29 A;  3H7M A;  4XKQ A;  3KGC A;  4ESW A;  1QKB A;  1D3K A;  4DE8 A;  4ZEF A;  3V89 B;  5I56 A;  3EN3 A;  1DPE A;  1B9J A;  3Q27 A;  4GFR A;  5H8S A;  1M5B A;  4MH5 A;  4G68 B;  5TPA A;  1H44 A;  5K2X A;  3B6W A;  2B3B A;  1ZLQ A;  4PFW A;  3QYT A;  3GZG A;  5DVI A;  2GH9 A;  5ICT A;  4JSD A;  2V3Q A;  5F1Q A;  1NL5 A;  4I62 A;  5J1D A;  1IEJ A;  3G3G A;  4IB2 A;  4QFL A;  3DP8 A;  5IKB A;  3LC8 A;  4ZEB A;  3E3K A;  3SEX A;  1XVX A;  1II5 A;  3O6H A;  1POY 1;  1FTO A;  3GBA A;  4F18 A;  4QRZ A;  1UIV A;  3KOS A;  4RYA A;  4G8H A;  1TFD A;  5AA2 B;  4R6H A;  3CSB A;  2QS1 A;  1P1W A;  2I49 A;  2H99 A;  2V84 A;  5DYH A;  3H6W A;  1FTK A;  4XIG Q;  4WXJ A;  1N0T A;  1FTL A;  2PT2 A;  4M1V A;  1SDX A;  1D9V A;  1WVJ A;  5I58 B;  1JVX A;  2OWS A;  3VLU A;  4UAC A;  1OMP A;  2Z8D A;  3IL1 B;  4WKM A;  4KPT A;  4NF4 B;  1M5F A;  3CFZ A;  3ODB A;  3UGW A;  1YCJ A;  4OFJ A;  4FEC A;  3Q26 A;  3E13 X;  1N76 A;  3DM0 A;  4H65 A;  1NNP A;  3G3H A;  3PMW A;  1M5C A;  3D4C A;  2A5T B;  4EF2 A;  1B2H A;  1I6Q A;  2PVU A;  3TOD A;  5DT6 A;  4GWO A;  4ISU A;  1QJM A;  2REJ A;  3IJX B;  1FTJ A;  4TQU Q;  3U1O A;  2ZYM A;  3F11 A;  4NE4 A;  1CE2 A;  3IB1 A;  2HFB A;  1VSO A;  4IO5 A;  3VVD A;  2B3F A;  1XS5 A;  4ELP A;  2I4B A;  1HSL A;  2E1S A;  5CM6 A;  3O97 A;  3S4U A;  4IY5 A;  2OZZ A;  1OQG A;  2O1M A;  2ANJ A;  1BTJ A;  2Z23 A;  3PUW E;  3HHF A;  4Q5T A;  2RKM A;  3T93 B;  2F8D A;  2PYY A;  1LB9 A;  1P1O A;  3QXM A;  4I8C A;  4KYS A;  3EF7 A;  3C34 A;  4U21 A;  4EQ7 A;  2DWA A;  2R6G E;  3R6U A;  1R1N A;  1OVT A;  3H6V A;  3U94 A;  2Q8J A;  2HZK A;  2IEE A;  5AA2 A;  4QFO A;  4RA1 A;  2QMW A;  1IIW A;  4DCY A;  2DE3 A;  2THI A;  1Y9U A;  3RTW B;  2XHD A;  3FXQ A;  3RLF E;  3HV1 A;  1B3G A;  4OQO A;  4GXA A;  3TTK A;  3RGY A;  3D4G A;  1MG1 A;  4GL8 A;  5I58 A;  3MP8 A;  4RK2 A;  2R71 A;  4NED A;  3UK4 A;  4NF4 A;  4GLI A;  3LSL A;  2I58 A;  4GD5 A;  1LCT A;  1EZO A;  2FYI A;  1P1N A;  3LSF B;  3E9X A;  1LST A;  1ZJL A;  3KZG A;  5HPQ A;  4N13 A;  2Y7K A;  1B40 A;  3FVO A;  4X9T A;  1LAH E;  2OJT A;  2DYX A;  1J1N A;  4ZZA A;  3MVX A;  4KYD A;  3TYH A;  2I3W A;  4DDD A;  4TLM B;  1VR5 A;  1URG A;  2A5T A;  3O66 A;  4QFP A;  3H6T A;  2ONK E;  2HAU A;  2E0S A;  1Y3Q A;  3OEM A;  2Z8F A;  1FCK A;  2Y7R A;  4H0W A;  4POX A;  3TDJ A;  2DWJ A;  1M5E A;  3KJT A;  1B0H A;  3C36 A;  4O3B A;  5ITP A;  4RY1 A;  3FIR A;  1Y4T A;  2F5X A;  1A99 A;  3FVN A;  4NWC A;  5B7D A;  4BDR A;  1P1Q A;  4R6K A;  1MY0 A;  4G2Z A;  4FOR A;  4FED A;  3QUJ A;  3RY3 A;  1TT1 A;  4IO4 A;  5H8F A;  2R9J A;  3C33 A;  3LBS A;  2XXX A;  4GQO A;  4PE5 B;  4U22 A;  4U4X A;  2DVC A;  2QJE A;  4G4P A;  4H5G A;  3TCH A;  1N7X A;  3TEL A;  3IR1 A;  3CI8 A;  3U92 A;  3U8Q A;  4QSE A;  2QRY A;  2B65 A;  2DE2 A;  2FNC A;  3CR9 A;  3PUV E;  3UP9 A;  3T66 A;  2XXH A;  3MVY A;  3K4U A;  3TZA A;  2Y7W A;  2YLN A;  3CFL A;  1MQD A;  4YU0 A;  1SI1 A;  3KJ7 A;  1JNF A;  2HXW A;  5EYF A;  3K00 A;  5FHO A;  1B3E A;  4EDP A;  4DZ1 A;  4PP0 A;  4GF8 A;  2DWI A;  5AA1 A;  1JVY A;  4ZED A;  1Q1K A;  3MWB A;  3N94 A;  3KFM A;  1IXH A;  1MM6 A;  2ONR A;  4F2O A;  2ZNU A;  4H67 A;  1PC3 A;  4TLL B;  4XTC Q;  3M3K A;  1IQ7 A;  3CFX A;  4NMY A;  4DLD A;  4U23 A;  3TQL A;  2LAO A;  1VFE A;  1N84 A;  2RC8 A;  2ZXT A;  3THI A;  4P11 A;  4YB7 A;  1R9Q A;  1AIV A;  2V3T A;  4GXS B;  1PB7 A;  1VFD A;  3IK6 B;  2F7A A;  1FQD A;  2Q88 A;  4QFN A;  3IO4 A;  1ANF A;  4L17 A;  4MLQ A;  2UVI A;  1SW4 A;  3S9M C;  2XX9 A;  3MPL A;  4U1O A;  3H06 B;  4HCY A;  4GRK A;  1B32 A;  1MY4 A;  3TFL A;  3OXN A;  3RPW A;  4TOZ A;  5CBR A;  1N04 A;  1SW2 A;  3KEI A;  2QS3 A;  3I6V A;  4XXU A;  3BKI B;  4RXL A;  1DSN A;  1LAX A;  3R7X A;  5L9O A;  4Z0I A;  5AE4 A;  4RPN A;  3GXA A;  4ZEC A;  1DTG A;  4F39 A;  1SYI A;  1RYO A;  3W9V A;  2RC9 A;  4NF8 B;  3K6V A;  2O1L A;  1A7L A;  3Q25 A;  1LFH A;  2F36 A;  3CSG A;  2AIX A;  1MQH A;  4EUO A;  1DTZ A;  1MY3 A;  3PUZ E;  1PB8 A;  3OEL A;  1OQH A;  4YKJ A;  3SET A;  1ELJ A;  1JW5 A;  5A5X B;  3BFU A;  4JWY A;  3FUZ A;  3DLN A;  5DEX B;  2H4I A;  1O64 A;  4OHN A;  4QFK A;  1OLA A;  5H8Q B;  4YB5 A;  3OEN A;  4RJZ A;  1XHY A;  1SYH A;  3MBP A;  3N6U A;  1B7U A;  3C32 A;  1OLC A;  4C1T A;  2QPQ A;  3HN0 A;  3ZKL A;  2O51 A;  3FVK A;  3QUF A;  2XX7 A;  4F3G A;  4G68 C;  4H6D A;  1MXZ A;  3H6U A;  5TP9 A;  2GRV A;  3L6G A;  2BJJ X;  4IO7 A;  3EHU A;  1UTH A;  1WDN A;  2HEU A;  4BDN A;  3C4M A;  1FQC A;  3SDF A;  1JET A;  1URS A;  3S2V A;  3T9U A;  3TKD A;  3G3K A;  1ZBM A;  3KBR A;  4F19 A;  1LFI A;  5I2K B;  2QMX A;  3MP1 A;  3CG3 A;  5BWJ A;  3IJO B;  2O68 A;  2V3U A;  3RT6 B;  3O6I A;  1VE4 A;  5FTH A;  3C9H A;  2VD3 A;  4OWD A;  3OEK A;  3MW0 A;  2I0B A;  1R9L A;  1Y20 A;  1GVC A;  2A5S A;  2X7P A;  2REG A;  3U93 A;  2RC7 A;  4OES A;  4BDQ A;  3K6U A;  4F2Q A;  2ESN A;  3KN7 A;  4PFU A;  4JSO A;  2QS2 A;  4U1Z A;  4NF8 A;  3PPO A;  1H43 A;  1T0K A;  3E4R A;  2HCA A;  2DWH A;  2H25 A;  4X1D A;  3K01 A;  1LGB C;  2F78 A;  4F22 A;  5CRY A;  5FTI A;  4OYV A;  5A5X A;  4R6Y A;  2O7U A;  3IB2 A;  5DEX A;  1GR2 A;  5I2N B;  3PPQ A;  2ABH A;  4OFO A;  4AB5 A;  4G77 A;  4H8I A;  5H8Q A;  1DPP A;  3ZS6 A;  3VV5 A;  3K1M A;  3K1P A;  1B5I A;  3T9X B;  1A8E A;  4R75 A;  4WED A;  4FJP A;  2W7Y A;  2Y7I A;  1IXC A;  4G68 A;  1B52 A;  4E0W A; 
#chains in the Genus database with same CATH topology
 2AL4 A;  1QKA A;  3RTF B;  4FBP A;  3FV2 A;  3FAT A;  5K2Y A;  3CRB A;  1EYK A;  4F1U A;  4NF6 B;  3PU5 A;  2V93 A;  1USY E;  4LP2 B;  1SBP A;  4ELO A;  3QSL A;  5IM2 A;  2OBG A;  5EQ9 A;  3FXB A;  4XKP A;  1AWB A;  1LBX A;  1MQJ A;  1F9B A;  3K6W A;  3BIG A;  1Q9D A;  1NUW A;  1B0L A;  1MM7 A;  3EHT A;  4PTK A;  4HW8 A;  3G3I A;  4OET A;  4F1Y A;  2RCB A;  2XXV A;  4IGR A;  2F7B A;  3SEU A;  4LVQ A;  4ND9 A;  1IXI A;  5I2K A;  3K02 A;  4ZE9 A;  4EF1 A;  4C0R A;  3TQW A;  2VP1 A;  3MPK A;  3ROJ A;  4ZE8 A;  4OTE A;  1UIU A;  2CZL A;  3MVW A;  4O8M A;  2ONS A;  3FZV A;  1FRP A;  4NF5 B;  1YAE A;  3SEV A;  4JVI A;  2DS9 A;  1D4N A;  4LZ8 A;  4IO6 A;  4PFT A;  2QFL A;  1I6A A;  5ET8 A;  3H4Z A;  2CMO A;  3S9E A;  1WOD A;  3VXB A;  1RYX A;  4MEV A;  1B5H A;  1I6B A;  4LAT A;  5JTY B;  4FIM A;  3LUY A;  3RN8 A;  4KXP A;  5CMM A;  4G8N A;  2O7I A;  1DBZ A;  1B7H A;  4N8G A;  1XVY A;  1L5T A;  4NWD A;  3W15 C;  4N6K A;  4N4U A;  1JQF A;  3K1N A;  4P8B A;  3VLV A;  3SEW A;  3ONM A;  3PUX E;  1YZ0 A;  4YB6 A;  4GIZ A;  5CMK A;  5I2N A;  1B4H A;  4R73 A;  3C31 A;  4QBA A;  3OOA A;  2NOO A;  1NV7 A;  5H8H B;  3SES A;  3MUQ A;  1BKA A;  1B3H A;  1B4Z A;  3TTR A;  3ISP A;  2UXA A;  4MNP A;  1ATG A;  3RT8 A;  2VT5 A;  1MQG A;  3TTN A;  2UVJ A;  2D3I A;  3IOV A;  4MAG A;  3MVZ A;  4YKK A;  3DEL B;  2XXU A;  4P3L A;  4JVC A;  2XXR A;  2UVG A;  3MP6 A;  4HTG A;  4H8J A;  3OD7 A;  3B6Q A;  2O6A A;  2XD3 A;  2MKZ A;  4KHZ E;  3KG2 A;  4R2F A;  2IA4 A;  3NOH A;  4NF6 A;  1LFG A;  3FJG A;  1LBV A;  4YMA A;  4I1D A;  5DTB A;  1HSJ A;  3N5L A;  2QL3 A;  2Q89 A;  2FVZ A;  3ILU B;  5IZZ A;  1QUJ A;  5BUU A;  2F34 A;  4GOT A;  2ZMB A;  1A8F A;  2G93 A;  5AA2 D;  3A3U A;  3PMX A;  3T9H B;  1BP5 A;  2OK2 A;  1LB8 A;  3O6G A;  3IOT A;  1B1X A;  3PMV A;  2NWJ A;  1JEU A;  1MXX A;  5I59 B;  2NVU B;  1SQY A;  5EHS A;  1OIB A;  3TCG A;  1IMB A;  4H5F A;  1FQA A;  2OLB A;  1USY H;  4X48 A;  3FGS A;  1IUD A;  4HCW A;  1B5J A;  1LAG E;  4IY6 A;  4KCC A;  4NF5 A;  1A40 A;  1EYJ A;  3MZ9 A;  1TWY A;  1QVS A;  2DVZ A;  4DIG A;  5CC2 A;  2VGQ A;  4N6P A;  3EKI A;  1MH4 A;  1A55 A;  2Q74 A;  3I3V A;  4XKN A;  2ZYK A;  1QW0 A;  4X1B A;  1MXV A;  4ZEI A;  1XC1 A;  1NI9 A;  4F31 B;  1FTM A;  5ET7 A;  3PPR A;  2G29 A;  5AA3 A;  4NHB A;  4F29 A;  1FBP A;  3M3L A;  1INP A;  1LBY A;  3QAX A;  1LBB A;  4F3S A;  3U72 A;  2UYF A;  2KR0 A;  3GLB A;  1MXU A;  1MH3 A;  5M2V A;  4R72 A;  3Q28 A;  5IAI A;  3MJN A;  4N6D A;  4OEN A;  4XKR A;  5JEI A;  1FPG A;  1FBG A;  5H8H A;  1B6H A;  1N7W A;  3G7W A;  3VVF A;  4EXL A;  4BDL A;  1B58 A;  4HE0 A;  4JDF A;  3V8X B;  4F1V A;  2RIN A;  4MFI A;  4BLA A;  1NV1 A;  3PPN A;  2HAV A;  4JWO A;  2QVV A;  1JEV A;  2BJI A;  2I4C A;  4JWX A;  3SEY A;  1FBE A;  4ZEK A;  1MY2 A;  3V83 A;  1JW1 A;  3SKP A;  4GVO A;  1IXG A;  2PCR A;  3O28 A;  1MXY A;  2O84 X;  2V25 A;  4JVD A;  5F7V A;  5ICQ A;  1G0H A;  1FQB A;  4K3F A;  4OFL A;  3USD A;  4I3Y A;  4FEB A;  2L5V A;  3ECR A;  1FW0 A;  3RQT A;  3UA8 A;  1FPD A;  1NNK A;  4PAF A;  3V5A A;  1P99 A;  2H9B A;  4KQP A;  2GHA A;  1MY1 A;  4O3C A;  3OSQ A;  2Z22 A;  5I59 A;  2RF1 A;  5CBS A;  5ET5 A;  1BIY A;  2I3V A;  1RDZ A;  4P0G A;  3M8U A;  4HS7 A;  3VVE A;  1XT8 A;  5DVF A;  3TPA A;  4PFY A;  4YKP A;  4NX1 A;  3EHS A;  1I69 A;  2ZNS A;  3CIJ A;  3RUM A;  4MCO A;  1FPB A;  4Q0C A;  1D9Y A;  1B3F A;  2P0S A;  4N8Y A;  2QS4 A;  4GL0 A;  2HQ0 A;  5HM4 B;  1FQE A;  1NV6 A;  3RNN A;  3TAJ A;  4PFB A;  1Y3P A;  1GGG A;  5TU0 A;  2F97 A;  3WAF A;  1AOV A;  4QHQ A;  1BK4 A;  2XXW A;  4P0I A;  4KD5 A;  4YKI A;  4Q30 B;  3EQ1 A;  1MDQ A;  1NMU A;  4RNS A;  3FV1 A;  2FIE A;  1NH8 A;  4POW A;  1O7T A;  1BLF A;  3LSW A;  2H98 A;  1IZ1 A;  1FBF A;  1GV8 A;  3VLW A;  3N26 A;  2WYK A;  3UOR A;  2UYE A;  5ET6 A;  3FJ7 A;  4XEQ A;  4EQ9 A;  1Y4C A;  3IOR A;  3QMF A;  3KOT A;  1MPD A;  1QUK A;  4FE8 A;  4H1X A;  4O7I A;  5JK4 A;  4U4S A;  2WBB A;  3PV0 E;  4N07 A;  3OMB A;  3G3F A;  5KDT B;  2PMS A;  1PBQ A;  5DVJ A;  4MLV A;  4KYE A;  2CZK A;  3QK6 A;  1IME A;  3UN6 A;  1NV3 A;  1H76 A;  1LAF E;  1ZIU A;  2DSF A;  4MX6 A;  2OWZ A;  3A29 A;  1B3L A;  5L9M A;  4OMB A;  3MC2 A;  4R9G A;  1OVB A;  4N17 A;  1MRP A;  4NTL A;  2F6P A;  2RCA A;  1O63 A;  1UTB B;  3LSX A;  3VE1 B;  4DI4 B;  1D9Q A;  1MXW A;  4H45 A;  3OO6 A;  4OER A;  3OO7 A;  4PAK A;  2JJK A;  1TFA A;  5ISU A;  2ALU A;  4LON B;  3KC0 A;  2Y5K A;  1IIT A;  2Y84 A;  3B8B A;  1SVX B;  2GFE A;  3FXU A;  3MZ1 A;  2UVH A;  3FD3 A;  1NNT A;  1S50 A;  4DCX A;  4RPO A;  2PX1 A;  4IGT A;  3UIF A;  3O29 A;  5HBC A;  5DW8 A;  1K9Z A;  3CG1 A;  3WAE A;  2P1S A;  2XXY A;  4KI0 E;  3HO7 A;  4ECF A;  3CHG A;  1H3D A;  4O7M A;  3K6X A;  4U2R A;  1Y1Z A;  4DXB A;  2Z8E A;  1B05 A;  1MDP 1;  5I5P A;  5AA4 B;  3TEP A;  5L9S A;  3H03 A;  3KSX A;  3I5O A;  1B7Z A;  2WKY A;  5T3J A;  1NV5 A;  2FBP A;  1MQI A;  1YPN A;  4NGU A;  4NF0 A;  1YXI A;  3DP4 A;  4HXV A;  3TTM A;  4PDD A;  3T22 A;  3K2D A;  1URD A;  3QIM A;  2H5Y A;  1B1H A;  2Y7P A;  5H8N B;  5H8F B;  1RDY A;  1B51 A;  4ZZE A;  3FVG A;  4FAJ A;  3S9L C;  2WEF A;  2XD2 A;  3PTY A;  4OVR A;  1KWH A;  2F6G A;  2XX8 A;  3DP6 A;  2XXQ A;  4Q8R A;  1A54 A;  1SW1 A;  3BBR A;  3BFT A;  2D21 A;  4GBW A;  3G3J A;  2CZI A;  4YZZ A;  3SER A;  4OXV A;  4M4G A;  4LZ7 A;  1NUX A;  2I0C A;  1EZ9 A;  1Y1M A;  4ELQ A;  5KDT A;  3M3F A;  4FAT A;  2O69 A;  4O3A A;  3O2A A;  1MPB A;  5ITO A;  3IO6 A;  2XXT A;  3HST A;  3OSR A;  1TXF A;  4P47 A;  3ZSF A;  3KN8 A;  1EYI A;  4Z7E A;  4IR8 A;  1UTB A;  3IB0 A;  5KCJ B;  4F3P A;  3A3C A;  2ZYN A;  3OO8 A;  5CI5 A;  4AB6 A;  4PET A;  4I9D A;  5I84 A;  4GWZ A;  4ZS9 A;  5B70 A;  4UA8 A;  1DMB A;  1FBD A;  3FAS A;  2HZL A;  4MBP A;  4QSD A;  3T96 B;  3N6T A;  3MZB A;  4G8M A;  3MAM A;  1UQW A;  2NXO A;  1M5D A;  2XXP A;  1R6Z A;  3PPP A;  4MJO A;  1POT A;  4DXC A;  1NNF A;  4BDO A;  3IOW A;  2Q9T A;  4MMP A;  4H46 A;  4F3B A;  4MNC A;  3P7I A;  2ZZV A;  3VXC A;  3TUS A;  2KLF A;  3ZKK A;  1GTK A;  3KSJ A;  5EHM A;  4LUB A;  2PBW A;  5I3S A;  4YAH X;  2NUV A;  1H45 A;  3CVG A;  4X8R A;  4R74 A;  5AA4 A;  1N3W A;  1S9T A;  2CEX A;  1MPC A;  3JZJ A;  2XA5 A;  2X7Q A;  2Q2A A;  2WX9 A;  1N3X A;  1Z7N E;  1JW4 A;  4LQ2 A;  3MYU A;  1LCF A;  1LLS A;  1AMF A;  3BIH A;  2VOZ A;  2XXI A;  5H8N A;  5I57 B;  1SI0 A;  2B4L A;  4QXD A;  3VDF A;  1SD3 A;  3HCQ A;  2ZNT A;  2I48 A;  2CZH A;  3TTL A;  2OWT A;  3FXR A;  1EU8 A;  1FBH A;  2QSX A;  4IO3 A;  3FJM A;  3HFU A;  2ZZW A;  4ESX A;  2DP8 A;  3MQ9 A;  4OVQ A;  2XWV A;  1XOC A;  3PGF A;  5LOM A;  1ZU0 A;  2YJP A;  3C35 A;  4WEP A;  5JTY A;  2D5W A;  2VHA A;  3K0V A;  5L8D A;  5I56 B;  4E0X A;  4KCD A;  2YPN A;  4JXI A;  4LQ5 A;  5KCJ A;  1Y3N A;  3B50 A;  2F7C A;  2ZYO A;  5TPA B;  5KZT A;  4PQJ A;  4KR5 A;  3JYR A;  1RKM A;  2FA7 A;  3W9W A;  2F35 A;  1CB6 A;  1US5 A;  3O9P A;  4YMB A;  1SW5 A;  4P56 A;  5TP9 B;  1PDA A;  1Q35 A;  1EZP A;  3T1B A;  1AH5 A;  2DQV A;  4LZ5 A;  2DE4 A;  5LTC A;  1SPI A;  4GWX A;  2DOJ A;  1UTH B;  2VD2 A;  5ELV A;  4NG7 A;  3T9V A;  2Q2C A;  1S7Y A;  1ZKB A;  3GYY A;  3B6T A;  5CMC A;  3PUY E;  4AQ4 A;  3S9N C;  4OEU A;  2DXY A;  4QF9 A;  3IX1 A;  4PGP A;  1Z7M E;  3IAZ A;  1NH7 A;  3OO9 A;  2GQ1 A;  1EH3 A;  1DOT A;  2M8C A;  4R2B A;  4JB7 A;  2FIX A;  3TMG A;  3AXF A;  4PC9 A;  4JBZ A;  1AL3 A;  4THI A;  4DXU A;  1ZTY A;  4C1U A;  4PGN A;  2QVR A;  3HHG A;  4IO2 A;  2DXR A;  3TCF A;  3JV9 A;  1P1U A;  1IMA A;  2PT1 A;  3KN3 A;  3VFJ A;  3PD9 A;  5EQ8 A;  1LBC A;  3GBB A;  1QUL A;  1NFT A;  4YIC A;  4ZDM A;  3IOU A;  2VPO A;  3MST A;  4OEV A;  1NKX A;  2I6E A;  4QSC A;  3LR1 A;  1QUI A;  1HSE A;  5CMB A;  4ONY A;  3B7D A;  4OZ9 A;  4KFQ A;  5I57 A;  1YTV A;  3PD8 A;  4EXK A;  2AYS A;  4EQB A;  1PB9 A;  4UAB A;  2OCU A;  3EPE A;  1LEV A;  3ILT B;  2GHB A;  2P2A A;  2CEY A;  3HPI A;  1MS7 A;  4BDM A;  4OA4 A;  5FHN A;  4OVJ A;  1FQF A;  4PFR A;  1KA1 A;  4GWY A;  4RK9 A;  2X26 A;  4MF3 A;  3R26 A;  1PBP A;  4I40 A;  4OVP A;  1B46 A;  3L6H A;  4GWS A;  1US4 A;  5FHM A;  4ELR A;  2AL5 A;  3H3G A;  5EYH A;  3A09 A;  1ZMG A;  4R9F A;  4NQ8 A;  1PEB A;  4LA9 A;  3Q29 A;  3H7M A;  4XKQ A;  3KGC A;  4ESW A;  1QKB A;  1D3K A;  4PFI A;  4DE8 A;  4ZEF A;  3V89 B;  5I56 A;  3EN3 A;  1DPE A;  4PDH A;  1B9J A;  3Q27 A;  4GFR A;  5H8S A;  1M5B A;  4MH5 A;  4G68 B;  5TPA A;  1H44 A;  5K2X A;  3B6W A;  2B3B A;  1ZLQ A;  4PFW A;  2XWO A;  1FJ9 A;  3QYT A;  3GZG A;  5DVI A;  4AS5 A;  2GH9 A;  5ICT A;  2B4M A;  4JSD A;  2V3Q A;  5F1Q A;  1NL5 A;  1RDX A;  4I62 A;  4PAI A;  2ZZX A;  5J1D A;  4OAN A;  1IEJ A;  3G3G A;  4IB2 A;  4QFL A;  3DP8 A;  5IKB A;  5EQA A;  3LC8 A;  4ZEB A;  5I7I A;  1VDW A;  4MHF A;  3E3K A;  3SEX A;  1XVX A;  1II5 A;  4XF5 A;  3O6H A;  1POY 1;  1FTO A;  3GBA A;  4F18 A;  4QRZ A;  1UIV A;  3KOS A;  4RYA A;  4G8H A;  1TFD A;  3LUZ A;  2VPN A;  5AA2 B;  4R6H A;  2XXK A;  3CSB A;  2QS1 A;  1P1W A;  2I49 A;  2H99 A;  2V84 A;  5DYH A;  3H6W A;  1FTK A;  4XIG Q;  4WXJ A;  1N0T A;  1FTL A;  2PT2 A;  4M1V A;  1SDX A;  4PF6 A;  1D9V A;  1WVJ A;  5I58 B;  1JVX A;  2OWS A;  3VLU A;  4UAC A;  1OMP A;  2Z8D A;  3IL1 B;  4WKM A;  4KPT A;  4NF4 B;  1M5F A;  3CFZ A;  3ODB A;  3UGW A;  4P1E A;  1YCJ A;  4OFJ A;  4FEC A;  1DK4 A;  3Q26 A;  3E13 X;  1N76 A;  3DM0 A;  4H65 A;  1NNP A;  3G3H A;  3PMW A;  1M5C A;  2WBD A;  3D4C A;  2A5T B;  4EF2 A;  1B2H A;  1I6Q A;  2PVU A;  3TOD A;  5DT6 A;  1KA0 A;  4GWO A;  4ISU A;  1QJM A;  2REJ A;  3IJX B;  1FTJ A;  4TQU Q;  3U1O A;  2ZYM A;  3F11 A;  4NE4 A;  1CE2 A;  3IB1 A;  2HFB A;  1VSO A;  4IO5 A;  3VVD A;  1G0I A;  2HPG A;  2B3F A;  1XS5 A;  4PBH A;  4ELP A;  2I4B A;  4GWW A;  1HSL A;  2E1S A;  5CM6 A;  3O97 A;  3S4U A;  4IY5 A;  2OZZ A;  1OQG A;  2O1M A;  2ANJ A;  4G61 A;  1BTJ A;  2Z23 A;  3PUW E;  2WYP A;  1IMF A;  3HHF A;  4Q5T A;  2RKM A;  3T93 B;  2F8D A;  2PYY A;  3IFA A;  1LB9 A;  2Y5L A;  1P1O A;  3QXM A;  4I8C A;  4KYS A;  3EF7 A;  3C34 A;  4U21 A;  4EQ7 A;  2DWA A;  4AS4 A;  4GX6 A;  2R6G E;  3R6U A;  1R1N A;  1OVT A;  3H6V A;  3LV0 A;  3U94 A;  3T0J A;  2Q8J A;  2HZK A;  2IEE A;  1XI6 A;  1LBZ A;  5AA2 A;  4PBQ A;  4QFO A;  4NAP A;  4RA1 A;  2QMW A;  1IIW A;  4DCY A;  2DE3 A;  2THI A;  1Y9U A;  3RTW B;  2XHD A;  3FXQ A;  3RLF E;  3HV1 A;  1B3G A;  4OQO A;  1CNQ A;  4GXA A;  3TTK A;  3RGY A;  3D4G A;  1MG1 A;  4GL8 A;  5I58 A;  3MP8 A;  2OX3 A;  4RK2 A;  2R71 A;  4NED A;  3UK4 A;  4NF4 A;  4GLI A;  3LSL A;  2I58 A;  4GD5 A;  1FPJ A;  1LCT A;  1EZO A;  1NV0 A;  1P1N A;  2FYI A;  3LSF B;  3E9X A;  2DDK A;  1LST A;  1ZJL A;  3KZG A;  5HPQ A;  4N13 A;  2PFZ A;  3RYD A;  2Y7K A;  4O94 A;  1B40 A;  3FVO A;  4X9T A;  1LAH E;  2OJT A;  2DYX A;  1J1N A;  4ZZA A;  3MVX A;  4KYD A;  3TYH A;  2I3W A;  4DDD A;  4TLM B;  1VR5 A;  1NUY A;  2F3D A;  2R8T A;  1URG A;  2A5T A;  3O66 A;  4QFP A;  3H6T A;  2ONK E;  2HAU A;  4N81 A;  4LN5 A;  1IMC A;  2E0S A;  1Y3Q A;  3OEM A;  2Z8F A;  1FCK A;  2Y7R A;  1FBC A;  4H0W A;  4POX A;  3TDJ A;  2DWJ A;  1M5E A;  4GX4 A;  2HXR A;  3KJT A;  1B0H A;  3C36 A;  2HHM A;  4O3B A;  4GWU A;  5ITP A;  4RY1 A;  3FIR A;  1Y4T A;  2F5X A;  1A99 A;  3FVN A;  4NWC A;  5B7D A;  4BDR A;  1P1Q A;  4R6K A;  1MY0 A;  4G2Z A;  2F3B A;  4FOR A;  4FED A;  3QUJ A;  3RY3 A;  1TT1 A;  4IO4 A;  5H8F A;  2R9J A;  3C33 A;  3LBS A;  2XXX A;  4GQO A;  4PE5 B;  4U22 A;  2V4C A;  4U4X A;  2DVC A;  2QJE A;  4G4P A;  4H5G A;  3TEL A;  1N7X A;  3TCH A;  3IR1 A;  3CI8 A;  3U92 A;  3U8Q A;  4QSE A;  2QRY A;  2B65 A;  2DE2 A;  2FNC A;  3CR9 A;  3PUV E;  1FPK A;  3UP9 A;  3T66 A;  2XXH A;  3U65 A;  4P9K A;  3MVY A;  3K4U A;  3TZA A;  1FSA A;  2Y7W A;  2YLN A;  3CFL A;  1MQD A;  4YU0 A;  1SI1 A;  3KJ7 A;  1JNF A;  2HXW A;  5EQ7 A;  2QVU A;  5EYF A;  3K00 A;  5FHO A;  4PCD A;  1B3E A;  4EDP A;  4PE3 A;  4DZ1 A;  4PP0 A;  4GF8 A;  2DWI A;  5AA1 A;  4OVS A;  1JVY A;  4ZED A;  1Q1K A;  3MWB A;  3N94 A;  3KFM A;  1IXH A;  1MM6 A;  2ONR A;  4F2O A;  2ZNU A;  4H67 A;  1PC3 A;  4TLL B;  4XTC Q;  2Q8M A;  3M3K A;  1IQ7 A;  3CFX A;  4NMY A;  4N15 A;  4DLD A;  4U23 A;  3TQL A;  2LAO A;  1VFE A;  1N84 A;  2RC8 A;  2ZXT A;  3THI A;  2P3V A;  4P11 A;  3FBP A;  4YB7 A;  1R9Q A;  1AIV A;  2V3T A;  4GXS B;  5IZ3 B;  1PB7 A;  1VFD A;  3IK6 B;  2F7A A;  4MIJ A;  1FQD A;  2Q88 A;  4QFN A;  3SZP A;  3IO4 A;  1ANF A;  4L17 A;  4MLQ A;  1QGX A;  2UVI A;  1SW4 A;  3S9M C;  2XX9 A;  3MPL A;  1KZ8 A;  4U1O A;  2FHY A;  3H06 B;  4HCY A;  4GRK A;  1B32 A;  1MY4 A;  3TFL A;  3OXN A;  3RPW A;  4TOZ A;  5F24 A;  5CBR A;  1N04 A;  1SW2 A;  1LBW A;  3KEI A;  2QS3 A;  3I6V A;  4XXU A;  3KBZ A;  3BKI B;  2XWK A;  4RXL A;  1DSN A;  5ESY A;  1LAX A;  3R7X A;  2PFY A;  5L9O A;  4Z0I A;  5AE4 A;  4RPN A;  3GXA A;  4ZEC A;  1DTG A;  4F39 A;  1SYI A;  4NN3 A;  1RYO A;  3W9V A;  2RC9 A;  3E78 A;  4NF8 B;  3K6V A;  2O1L A;  1A7L A;  3Q25 A;  1LFH A;  2F36 A;  3CSG A;  2AIX A;  4GX3 A;  1MQH A;  1JP4 A;  4EUO A;  1DTZ A;  1MY3 A;  3PUZ E;  1PB8 A;  3OEL A;  1OQH A;  4YKJ A;  3SET A;  1ELJ A;  1JW5 A;  5A5X B;  3BFU A;  4JWY A;  3FUZ A;  3DLN A;  5DEX B;  2H4I A;  1NUZ A;  1O64 A;  4OHN A;  4QFK A;  1OLA A;  2P3N A;  5H8Q B;  4YB5 A;  1NV2 A;  3OEN A;  5FBP A;  4RJZ A;  1XHY A;  1SYH A;  3RPL B;  3MBP A;  4GBV A;  3N6U A;  1B7U A;  3C32 A;  1OLC A;  4C1T A;  2QPQ A;  3HN0 A;  3ZKL A;  2O51 A;  3FVK A;  4P1L A;  4X04 A;  3QUF A;  5A5L A;  2XX7 A;  4F3G A;  4G68 C;  4H6D A;  1MXZ A;  4HE2 A;  3H6U A;  1IMD A;  5TP9 A;  4N91 A;  4I3E A;  2GRV A;  1YYZ A;  3L6G A;  2KQZ A;  2BJJ X;  4IO7 A;  3EHU A;  1UTH A;  1WDN A;  2HEU A;  3D1R A;  1NV4 A;  4BDN A;  3C4M A;  1FQC A;  3IFC A;  5IZ3 A;  3SDF A;  1JET A;  1URS A;  3S2V A;  3T9U A;  3TKD A;  3G3K A;  1ZBM A;  3KBR A;  5EYG A;  5J16 A;  4F19 A;  1LFI A;  5I2K B;  2QMX A;  3MP1 A;  3CG3 A;  5BWJ A;  3IJO B;  2O68 A;  2V3U A;  3RT6 B;  1FPF A;  3O6I A;  1VE4 A;  1DCU A;  1FPL A;  5FTH A;  3C9H A;  4XFE A;  2VD3 A;  4OWD A;  3OEK A;  3MW0 A;  2I0B A;  1R9L A;  1Y20 A;  1GVC A;  3E79 A;  3KC1 A;  1FTA A;  2A5S A;  2X7P A;  2REG A;  3U93 A;  2RC7 A;  4OES A;  4BDQ A;  1FJ6 A;  3K6U A;  4F2Q A;  2ESN A;  3KN7 A;  5IGA A;  4PFU A;  4HE1 A;  4JSO A;  2QS2 A;  1FPI A;  4U1Z A;  4NF8 A;  3PPO A;  1H43 A;  1T0K A;  3E4R A;  2HCA A;  4PF8 A;  2DWH A;  2H25 A;  2XWI A;  4X1D A;  3K01 A;  1LGB C;  2F78 A;  5IZ1 A;  4F22 A;  5CRY A;  5FTI A;  4OYV A;  5A5X A;  4R6Y A;  2O7U A;  3IB2 A;  5DEX A;  1GR2 A;  5I2N B;  5LDZ A;  4MNI A;  1K9Y A;  3PPQ A;  2ABH A;  4OFO A;  4AB5 A;  1FPE A;  4G77 A;  4H8I A;  5H8Q A;  1DPP A;  3ZS6 A;  3VV5 A;  3K1M A;  3K1P A;  1B5I A;  3T9X B;  1A8E A;  3RPL A;  4R75 A;  4WED A;  4FJP A;  2W7Y A;  2Y7I A;  4OVT A;  1IXC A;  4DI3 D;  4G68 A;  1B52 A;  4E0W A; 
#chains in the Genus database with same CATH homology
 2AL4 A;  1QKA A;  3RTF B;  3FV2 A;  3FAT A;  5K2Y A;  3CRB A;  4F1U A;  4NF6 B;  3PU5 A;  2V93 A;  1USY E;  4LP2 B;  1SBP A;  4ELO A;  3QSL A;  2OBG A;  4XKP A;  1MQJ A;  1F9B A;  3K6W A;  1B0L A;  1MM7 A;  3EHT A;  4HW8 A;  3G3I A;  4OET A;  4F1Y A;  2RCB A;  2XXV A;  4IGR A;  2F7B A;  3SEU A;  4LVQ A;  4ND9 A;  1IXI A;  5I2K A;  3K02 A;  4ZE9 A;  4EF1 A;  4C0R A;  3TQW A;  2VP1 A;  3MPK A;  4ZE8 A;  4OTE A;  1UIU A;  2CZL A;  3MVW A;  2ONS A;  3FZV A;  4NF5 B;  1YAE A;  3SEV A;  2DS9 A;  1D4N A;  4LZ8 A;  4IO6 A;  4PFT A;  1I6A A;  3H4Z A;  2CMO A;  3S9E A;  1WOD A;  3VXB A;  1RYX A;  1B5H A;  1I6B A;  4LAT A;  5JTY B;  4FIM A;  3LUY A;  3RN8 A;  5CMM A;  4G8N A;  2O7I A;  1B7H A;  1XVY A;  1L5T A;  4NWD A;  3W15 C;  1JQF A;  3K1N A;  3VLV A;  3SEW A;  3ONM A;  3PUX E;  4YB6 A;  4GIZ A;  5CMK A;  5I2N A;  1B4H A;  4R73 A;  3C31 A;  3OOA A;  2NOO A;  5H8H B;  3SES A;  3MUQ A;  1BKA A;  1B3H A;  1B4Z A;  3TTR A;  2UXA A;  1ATG A;  3RT8 A;  1MQG A;  3TTN A;  2UVJ A;  2D3I A;  3IOV A;  3MVZ A;  4YKK A;  3DEL B;  2XXU A;  2XXR A;  2UVG A;  3MP6 A;  4HTG A;  4H8J A;  3OD7 A;  3B6Q A;  2O6A A;  2XD3 A;  4KHZ E;  3KG2 A;  4R2F A;  2IA4 A;  4NF6 A;  1LFG A;  3FJG A;  4YMA A;  4I1D A;  5DTB A;  1HSJ A;  3N5L A;  2QL3 A;  2Q89 A;  3ILU B;  1QUJ A;  5BUU A;  2F34 A;  4GOT A;  2ZMB A;  1A8F A;  2G93 A;  5AA2 D;  3A3U A;  3PMX A;  3T9H B;  1BP5 A;  2OK2 A;  1LB8 A;  3O6G A;  3IOT A;  1B1X A;  3PMV A;  2NWJ A;  1JEU A;  1MXX A;  5I59 B;  2NVU B;  1SQY A;  5EHS A;  1OIB A;  3TCG A;  4H5F A;  1FQA A;  2OLB A;  1USY H;  4X48 A;  3FGS A;  1IUD A;  4HCW A;  1B5J A;  1LAG E;  4IY6 A;  4KCC A;  4NF5 A;  1A40 A;  3MZ9 A;  1TWY A;  1QVS A;  2DVZ A;  4DIG A;  5CC2 A;  2VGQ A;  4N6P A;  1MH4 A;  1A55 A;  4XKN A;  3I3V A;  2ZYK A;  1QW0 A;  4X1B A;  1MXV A;  4ZEI A;  1XC1 A;  4F31 B;  1FTM A;  3PPR A;  2G29 A;  5AA3 A;  4F29 A;  3M3L A;  3QAX A;  1LBB A;  4F3S A;  3U72 A;  2UYF A;  3GLB A;  1MXU A;  1MH3 A;  5M2V A;  4R72 A;  3Q28 A;  5IAI A;  3MJN A;  4OEN A;  4XKR A;  5JEI A;  5H8H A;  1B6H A;  1N7W A;  3G7W A;  3VVF A;  4EXL A;  4BDL A;  1B58 A;  4JDF A;  3V8X B;  4F1V A;  2RIN A;  4MFI A;  4BLA A;  3PPN A;  2HAV A;  4JWO A;  1JEV A;  2I4C A;  4JWX A;  3SEY A;  4ZEK A;  1MY2 A;  3V83 A;  1JW1 A;  3SKP A;  4GVO A;  1IXG A;  3O28 A;  1MXY A;  2O84 X;  2V25 A;  5F7V A;  5ICQ A;  1FQB A;  4K3F A;  4OFL A;  3USD A;  4FEB A;  3ECR A;  1FW0 A;  3RQT A;  3UA8 A;  1NNK A;  3V5A A;  1P99 A;  2H9B A;  4KQP A;  2GHA A;  1MY1 A;  4O3C A;  3OSQ A;  2Z22 A;  5I59 A;  2RF1 A;  5CBS A;  1BIY A;  2I3V A;  4P0G A;  3M8U A;  4HS7 A;  3VVE A;  1XT8 A;  5DVF A;  3TPA A;  4PFY A;  4YKP A;  3EHS A;  1I69 A;  2ZNS A;  3CIJ A;  3RUM A;  4Q0C A;  1D9Y A;  1B3F A;  2P0S A;  2QS4 A;  4GL0 A;  2HQ0 A;  5HM4 B;  1FQE A;  3RNN A;  3TAJ A;  1Y3P A;  1GGG A;  5TU0 A;  2F97 A;  3WAF A;  1AOV A;  4QHQ A;  2XXW A;  4P0I A;  4KD5 A;  4YKI A;  4Q30 B;  3EQ1 A;  1MDQ A;  1NMU A;  4RNS A;  3FV1 A;  4POW A;  1NH8 A;  1O7T A;  1BLF A;  3LSW A;  2H98 A;  1IZ1 A;  1GV8 A;  3VLW A;  3N26 A;  3UOR A;  2UYE A;  3FJ7 A;  4EQ9 A;  1Y4C A;  3IOR A;  3KOT A;  1MPD A;  1QUK A;  4FE8 A;  4H1X A;  5JK4 A;  4U4S A;  3PV0 E;  4N07 A;  3OMB A;  3G3F A;  5KDT B;  2PMS A;  1PBQ A;  5DVJ A;  4MLV A;  4KYE A;  3QK6 A;  3UN6 A;  1H76 A;  1LAF E;  1ZIU A;  2DSF A;  1B3L A;  5L9M A;  4OMB A;  3MC2 A;  4R9G A;  1OVB A;  1MRP A;  4NTL A;  2F6P A;  2RCA A;  1O63 A;  1UTB B;  3LSX A;  3VE1 B;  1MXW A;  3OO6 A;  4OER A;  3OO7 A;  1TFA A;  5ISU A;  2ALU A;  4LON B;  1IIT A;  2Y84 A;  1SVX B;  2GFE A;  3FXU A;  3MZ1 A;  2UVH A;  3FD3 A;  1NNT A;  1S50 A;  4DCX A;  4RPO A;  2PX1 A;  4IGT A;  3UIF A;  3O29 A;  5HBC A;  3CG1 A;  3WAE A;  2P1S A;  2XXY A;  4KI0 E;  3HO7 A;  4ECF A;  1H3D A;  3K6X A;  4U2R A;  1Y1Z A;  4DXB A;  2Z8E A;  1B05 A;  1MDP 1;  5AA4 B;  3TEP A;  5L9S A;  3H03 A;  3KSX A;  3I5O A;  1B7Z A;  2WKY A;  1MQI A;  1YPN A;  3DP4 A;  3TTM A;  3T22 A;  3K2D A;  1URD A;  3QIM A;  2H5Y A;  1B1H A;  2Y7P A;  5H8N B;  5H8F B;  1B51 A;  4ZZE A;  3FVG A;  4FAJ A;  3S9L C;  2XD2 A;  1KWH A;  2F6G A;  2XX8 A;  3DP6 A;  2XXQ A;  4Q8R A;  1A54 A;  1SW1 A;  3BBR A;  3BFT A;  2D21 A;  3G3J A;  4YZZ A;  3SER A;  4OXV A;  4M4G A;  4LZ7 A;  2I0C A;  1EZ9 A;  1Y1M A;  4ELQ A;  5KDT A;  3M3F A;  4FAT A;  2O69 A;  4O3A A;  3O2A A;  1MPB A;  5ITO A;  3IO6 A;  2XXT A;  3HST A;  3OSR A;  1TXF A;  3ZSF A;  3KN8 A;  4Z7E A;  1UTB A;  3IB0 A;  5KCJ B;  4F3P A;  3A3C A;  2ZYN A;  3OO8 A;  5CI5 A;  4AB6 A;  4PET A;  4I9D A;  5I84 A;  4ZS9 A;  5B70 A;  4UA8 A;  1DMB A;  3FAS A;  2HZL A;  4MBP A;  4QSD A;  3T96 B;  3N6T A;  3MZB A;  4G8M A;  3MAM A;  1UQW A;  2NXO A;  1M5D A;  2XXP A;  1R6Z A;  3PPP A;  1POT A;  4DXC A;  1NNF A;  4BDO A;  3IOW A;  2Q9T A;  4F3B A;  3P7I A;  3VXC A;  3TUS A;  2KLF A;  3ZKK A;  1GTK A;  3KSJ A;  5EHM A;  4LUB A;  2PBW A;  4YAH X;  2NUV A;  1H45 A;  3CVG A;  4R74 A;  5AA4 A;  1N3W A;  1S9T A;  1MPC A;  3JZJ A;  2X7Q A;  2Q2A A;  1N3X A;  1Z7N E;  1JW4 A;  4LQ2 A;  1LCF A;  1LLS A;  1AMF A;  2VOZ A;  2XXI A;  5H8N A;  5I57 B;  1SI0 A;  3VDF A;  1SD3 A;  3HCQ A;  2ZNT A;  2I48 A;  3TTL A;  2OWT A;  3FXR A;  1EU8 A;  2QSX A;  4IO3 A;  3FJM A;  4ESX A;  2DP8 A;  3MQ9 A;  1XOC A;  3PGF A;  5LOM A;  1ZU0 A;  2YJP A;  3C35 A;  4WEP A;  5JTY A;  2D5W A;  2VHA A;  3K0V A;  5L8D A;  5I56 B;  4E0X A;  4KCD A;  2YPN A;  4JXI A;  4LQ5 A;  5KCJ A;  1Y3N A;  2F7C A;  5TPA B;  2ZYO A;  5KZT A;  4PQJ A;  4KR5 A;  3JYR A;  1RKM A;  2FA7 A;  3W9W A;  2F35 A;  1CB6 A;  1US5 A;  3O9P A;  4YMB A;  1SW5 A;  5TP9 B;  1PDA A;  1Q35 A;  1EZP A;  1AH5 A;  2DQV A;  4LZ5 A;  2DE4 A;  2DOJ A;  1UTH B;  2VD2 A;  5ELV A;  3T9V A;  2Q2C A;  1S7Y A;  1ZKB A;  3B6T A;  5CMC A;  3PUY E;  4AQ4 A;  3S9N C;  4OEU A;  2DXY A;  4QF9 A;  3IX1 A;  1Z7M E;  3IAZ A;  1NH7 A;  3OO9 A;  1EH3 A;  1DOT A;  2M8C A;  4R2B A;  4JB7 A;  3TMG A;  3AXF A;  4JBZ A;  1AL3 A;  4THI A;  4DXU A;  1ZTY A;  4C1U A;  3HHG A;  4IO2 A;  2DXR A;  3TCF A;  3JV9 A;  1P1U A;  2PT1 A;  3KN3 A;  3VFJ A;  3PD9 A;  1LBC A;  3GBB A;  1QUL A;  1NFT A;  4YIC A;  4ZDM A;  3IOU A;  4OEV A;  1NKX A;  2I6E A;  4QSC A;  3LR1 A;  1QUI A;  1HSE A;  5CMB A;  4ONY A;  3B7D A;  4OZ9 A;  4KFQ A;  5I57 A;  1YTV A;  3PD8 A;  4EXK A;  2AYS A;  4EQB A;  1PB9 A;  2OCU A;  3EPE A;  3ILT B;  2GHB A;  2P2A A;  3HPI A;  1MS7 A;  4BDM A;  5FHN A;  4OVJ A;  1FQF A;  4RK9 A;  2X26 A;  4MF3 A;  3R26 A;  1PBP A;  1B46 A;  3L6H A;  1US4 A;  5FHM A;  4ELR A;  2AL5 A;  3H3G A;  3A09 A;  1ZMG A;  4R9F A;  1PEB A;  4LA9 A;  3Q29 A;  3H7M A;  4XKQ A;  3KGC A;  4ESW A;  1QKB A;  1D3K A;  4DE8 A;  4ZEF A;  3V89 B;  5I56 A;  3EN3 A;  1DPE A;  1B9J A;  3Q27 A;  4GFR A;  5H8S A;  1M5B A;  4MH5 A;  4G68 B;  5TPA A;  1H44 A;  5K2X A;  3B6W A;  2B3B A;  1ZLQ A;  4PFW A;  3QYT A;  3GZG A;  5DVI A;  2GH9 A;  5ICT A;  4JSD A;  2V3Q A;  5F1Q A;  1NL5 A;  4I62 A;  5J1D A;  1IEJ A;  3G3G A;  4IB2 A;  4QFL A;  3DP8 A;  5IKB A;  3LC8 A;  4ZEB A;  3E3K A;  3SEX A;  1XVX A;  1II5 A;  3O6H A;  1POY 1;  1FTO A;  3GBA A;  4F18 A;  4QRZ A;  1UIV A;  3KOS A;  4RYA A;  4G8H A;  1TFD A;  5AA2 B;  4R6H A;  3CSB A;  2QS1 A;  1P1W A;  2I49 A;  2H99 A;  2V84 A;  5DYH A;  3H6W A;  1FTK A;  4XIG Q;  4WXJ A;  1N0T A;  1FTL A;  2PT2 A;  4M1V A;  1SDX A;  1D9V A;  1WVJ A;  5I58 B;  1JVX A;  2OWS A;  3VLU A;  4UAC A;  1OMP A;  2Z8D A;  3IL1 B;  4WKM A;  4KPT A;  4NF4 B;  1M5F A;  3CFZ A;  3ODB A;  3UGW A;  1YCJ A;  4OFJ A;  4FEC A;  3Q26 A;  3E13 X;  1N76 A;  3DM0 A;  4H65 A;  1NNP A;  3G3H A;  3PMW A;  1M5C A;  3D4C A;  2A5T B;  4EF2 A;  1B2H A;  1I6Q A;  2PVU A;  3TOD A;  5DT6 A;  4GWO A;  4ISU A;  1QJM A;  2REJ A;  3IJX B;  1FTJ A;  4TQU Q;  3U1O A;  2ZYM A;  3F11 A;  4NE4 A;  1CE2 A;  3IB1 A;  2HFB A;  1VSO A;  4IO5 A;  3VVD A;  2B3F A;  1XS5 A;  4ELP A;  2I4B A;  1HSL A;  2E1S A;  5CM6 A;  3O97 A;  3S4U A;  4IY5 A;  2OZZ A;  1OQG A;  2O1M A;  2ANJ A;  1BTJ A;  2Z23 A;  3PUW E;  3HHF A;  4Q5T A;  2RKM A;  3T93 B;  2F8D A;  2PYY A;  1LB9 A;  1P1O A;  3QXM A;  4I8C A;  4KYS A;  3EF7 A;  3C34 A;  4U21 A;  4EQ7 A;  2DWA A;  2R6G E;  3R6U A;  1R1N A;  1OVT A;  3H6V A;  3U94 A;  2Q8J A;  2HZK A;  2IEE A;  5AA2 A;  4QFO A;  4RA1 A;  2QMW A;  1IIW A;  4DCY A;  2DE3 A;  2THI A;  1Y9U A;  3RTW B;  2XHD A;  3FXQ A;  3RLF E;  3HV1 A;  1B3G A;  4OQO A;  4GXA A;  3TTK A;  3RGY A;  3D4G A;  1MG1 A;  4GL8 A;  5I58 A;  3MP8 A;  4RK2 A;  2R71 A;  4NED A;  3UK4 A;  4NF4 A;  4GLI A;  3LSL A;  2I58 A;  4GD5 A;  1LCT A;  1EZO A;  2FYI A;  1P1N A;  3LSF B;  3E9X A;  1LST A;  1ZJL A;  3KZG A;  5HPQ A;  4N13 A;  2Y7K A;  1B40 A;  3FVO A;  4X9T A;  1LAH E;  2OJT A;  2DYX A;  1J1N A;  4ZZA A;  3MVX A;  4KYD A;  3TYH A;  2I3W A;  4DDD A;  4TLM B;  1VR5 A;  1URG A;  2A5T A;  3O66 A;  4QFP A;  3H6T A;  2ONK E;  2HAU A;  2E0S A;  1Y3Q A;  3OEM A;  2Z8F A;  1FCK A;  2Y7R A;  4H0W A;  4POX A;  3TDJ A;  2DWJ A;  1M5E A;  3KJT A;  1B0H A;  3C36 A;  4O3B A;  5ITP A;  4RY1 A;  3FIR A;  1Y4T A;  2F5X A;  1A99 A;  3FVN A;  4NWC A;  5B7D A;  4BDR A;  1P1Q A;  4R6K A;  1MY0 A;  4G2Z A;  4FOR A;  4FED A;  3QUJ A;  3RY3 A;  1TT1 A;  4IO4 A;  5H8F A;  2R9J A;  3C33 A;  3LBS A;  2XXX A;  4GQO A;  4PE5 B;  4U22 A;  4U4X A;  2DVC A;  2QJE A;  4G4P A;  4H5G A;  3TCH A;  1N7X A;  3TEL A;  3IR1 A;  3CI8 A;  3U92 A;  3U8Q A;  4QSE A;  2QRY A;  2B65 A;  2DE2 A;  2FNC A;  3CR9 A;  3PUV E;  3UP9 A;  3T66 A;  2XXH A;  3MVY A;  3K4U A;  3TZA A;  2Y7W A;  2YLN A;  3CFL A;  1MQD A;  4YU0 A;  1SI1 A;  3KJ7 A;  1JNF A;  2HXW A;  5EYF A;  3K00 A;  5FHO A;  1B3E A;  4EDP A;  4DZ1 A;  4PP0 A;  4GF8 A;  2DWI A;  5AA1 A;  1JVY A;  4ZED A;  1Q1K A;  3MWB A;  3N94 A;  3KFM A;  1IXH A;  1MM6 A;  2ONR A;  4F2O A;  2ZNU A;  4H67 A;  1PC3 A;  4TLL B;  4XTC Q;  3M3K A;  1IQ7 A;  3CFX A;  4NMY A;  4DLD A;  4U23 A;  3TQL A;  2LAO A;  1VFE A;  1N84 A;  2RC8 A;  2ZXT A;  3THI A;  4P11 A;  4YB7 A;  1R9Q A;  1AIV A;  2V3T A;  4GXS B;  1PB7 A;  1VFD A;  3IK6 B;  2F7A A;  1FQD A;  2Q88 A;  4QFN A;  3IO4 A;  1ANF A;  4L17 A;  4MLQ A;  2UVI A;  1SW4 A;  3S9M C;  2XX9 A;  3MPL A;  4U1O A;  3H06 B;  4HCY A;  4GRK A;  1B32 A;  1MY4 A;  3TFL A;  3OXN A;  3RPW A;  4TOZ A;  5CBR A;  1N04 A;  1SW2 A;  3KEI A;  2QS3 A;  3I6V A;  4XXU A;  3BKI B;  4RXL A;  1DSN A;  1LAX A;  3R7X A;  5L9O A;  4Z0I A;  5AE4 A;  4RPN A;  3GXA A;  4ZEC A;  1DTG A;  4F39 A;  1SYI A;  1RYO A;  3W9V A;  2RC9 A;  4NF8 B;  3K6V A;  2O1L A;  1A7L A;  3Q25 A;  1LFH A;  2F36 A;  3CSG A;  2AIX A;  1MQH A;  4EUO A;  1DTZ A;  1MY3 A;  3PUZ E;  1PB8 A;  3OEL A;  1OQH A;  4YKJ A;  3SET A;  1ELJ A;  1JW5 A;  5A5X B;  3BFU A;  4JWY A;  3FUZ A;  3DLN A;  5DEX B;  2H4I A;  1O64 A;  4OHN A;  4QFK A;  1OLA A;  5H8Q B;  4YB5 A;  3OEN A;  4RJZ A;  1XHY A;  1SYH A;  3MBP A;  3N6U A;  1B7U A;  3C32 A;  1OLC A;  4C1T A;  2QPQ A;  3HN0 A;  3ZKL A;  2O51 A;  3FVK A;  3QUF A;  2XX7 A;  4F3G A;  4G68 C;  4H6D A;  1MXZ A;  3H6U A;  5TP9 A;  2GRV A;  3L6G A;  2BJJ X;  4IO7 A;  3EHU A;  1UTH A;  1WDN A;  2HEU A;  4BDN A;  3C4M A;  1FQC A;  3SDF A;  1JET A;  1URS A;  3S2V A;  3T9U A;  3TKD A;  3G3K A;  1ZBM A;  3KBR A;  4F19 A;  1LFI A;  5I2K B;  2QMX A;  3MP1 A;  3CG3 A;  5BWJ A;  3IJO B;  2O68 A;  2V3U A;  3RT6 B;  3O6I A;  1VE4 A;  5FTH A;  3C9H A;  2VD3 A;  4OWD A;  3OEK A;  3MW0 A;  2I0B A;  1R9L A;  1Y20 A;  1GVC A;  2A5S A;  2X7P A;  2REG A;  3U93 A;  2RC7 A;  4OES A;  4BDQ A;  3K6U A;  4F2Q A;  2ESN A;  3KN7 A;  4PFU A;  4JSO A;  2QS2 A;  4U1Z A;  4NF8 A;  3PPO A;  1H43 A;  1T0K A;  3E4R A;  2HCA A;  2DWH A;  2H25 A;  4X1D A;  3K01 A;  1LGB C;  2F78 A;  4F22 A;  5CRY A;  5FTI A;  4OYV A;  5A5X A;  4R6Y A;  2O7U A;  3IB2 A;  5DEX A;  1GR2 A;  5I2N B;  3PPQ A;  2ABH A;  4OFO A;  4AB5 A;  4G77 A;  4H8I A;  5H8Q A;  1DPP A;  3ZS6 A;  3VV5 A;  3K1M A;  3K1P A;  1B5I A;  3T9X B;  1A8E A;  4R75 A;  4WED A;  4FJP A;  2W7Y A;  2Y7I A;  1IXC A;  4G68 A;  1B52 A;  4E0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...