3THIA

Thiaminase i from bacillus thiaminolyticus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
362
structure length
362
Chain Sequence
ITLKVAIYPYVPDPARFQAAVLDQWQRQEPGVKLEFTDWDSYSADPPDDLDVFVLDSIFLSHFVDAGYLLPFGSQDIDQAEDVLPFALQGAKRNGEVYGLPQILCTNLLFYRKGDLKIGQVDNIYELYKKIGTSHSEQIPPPQNKGLLINMAGGTTKASMYLEALIDVTGQYTEYDLLPPLDPLNDKVIRGLRLLINMAGEKPSQYVPEDGDAYVRASWFAQGSGRAFIGYSESMMRMGDYAEQVRFKPISSSAGQDIPLFYSDVVSVNSKTAHPELAKKLANVMASADTVEQALRPQADGQYPQYLLPARHQVYEALMQDYPIYSELAQIVNKPSNRVFRLGPEVRTWLKDAKQVLPEALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (THIAMINASE I)
publication title Crystal structure of thiaminase-I from Bacillus thiaminolyticus at 2.0 A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 116
structure length 362
sequence length 362
ec nomenclature ec 2.5.1.2: Thiamine pyridinylase.
pdb deposition date 1998-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3thiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3thiA02
4R74A 4OTEA 3PV0E 4KYEA 1R9LA 2D5WA 2H9BA 2PYYA 1F9BA 5I84A 3LSWA 4H5GA 3GBBA 3USDA 3TZAA 3AXFA 1SDXA 1Z7ME 1XT8A 1S50A 4R6YA 1B52A 4YB5A 4O3BA 4JB7A 1Y9UA 2O68A 5AA2B 3O97A 4QFPA 1UTBA 2XXYA 4U1OA 3H3GA 4DLDA 2RKMA 1ZIUA 2Z8FA 1GGGA 4DXCA 2UYFA 4XKRA 4GXAA 3G3JA 4P0GA 3H6UA 1USYE 3KEIA 3ZKKA 4R9FA 5H8HA 4E0WA 1WODA 4DXBA 5TPAB 1QJMA 4EQBA 1UQWA 4OEUA 1H44A 1M5FA 2LAOA 1UIVA 4H8IA 3KFMA 1N0TA 3OD7A 3C36A 4GFRA 3KOTA 4PETA 5EYFA 4HCYA 3RTFB 4ZZEA 3K02A 3MVXA 1M5EA 2PX1A 2V84A 1POY1 3Q29A 4OQOA 4EQ9A 4POWA 1NH7A 3DM0A 5DTBA 4OMBA 4QFKA 4XIGQ 3VVFA 3SDFA 2DYXA 4F3BA 3V5AA 1NFTA 4F1VA 3HO7A 1AH5A 3MQ9A 4F1UA 4JWXA 3HV1A 4WXJA 2H98A 2HAUA 5H8QA 5I58B 4R2FA 3W9VA 3N6UA 2QSXA 2R9JA 2XX9A 1JW5A 4P11A 4IY5A 4IO4A 3KG2A 1SQYA 1ANFA 3UGWA 4EQ7A 3FIRA 2ONKE 4I8CA 2X7QA 2F35A 3E4RA 4OYVA 2GRVA 3VFJA 5I2KB 1MY2A 2DWJA 4OESA 3S9EA 1DPPA 3OSRA 3BBRA 3S4UA 1MXUA 5LOMA 4YZZA 5DYHA 3TELA 3C4MA 3KN7A 2PT1A 3SEVA 3VLVA 4NF5A 1FTLA 1XVYA 1B1XA 1B0HA 1PB7A 1P1UA 4OETA 2IA4A 5AA3A 3SEUA 1B3FA 3TPAA 3TUSA 2ALUA 1XHYA 3C33A 4PFWA 4UACA 3O6HA 3M3LA 1LB9A 1T0KA 4OVJA 2YJPA 4LP2B 1IEJA 2D3IA 4DZ1A 3PU5A 4FECA 2M8CA 2ZXTA 5TPAA 4O3AA 3O2AA 5ICTA 1OVTA 4YKIA 1TT1A 2CZLA 5F1QA 4F29A 4KQPA 4ESXA 3IAZA 2O7IA 1ZKBA 4F3GA 1LFHA 3FJGA 5KCJA 3H03A 1HSLA 4NF8A 4NTLA 4RNSA 1MS7A 3FXUA 1USYH 4DXUA 4AB6A 1M5BA 5JTYB 2IEEA 1DMBA 1NL5A 2UVIA 4M4GA 5K2YA 3FVKA 1O63A 1JVYA 4KYSA 2B3BA 5I59B 3FD3A 3S9MC 1NMUA 4RXLA 4JWYA 3SEWA 5ITOA 3G3IA 4MH5A 4XTCQ 2ESNA 1PC3A 4GOTA 5L9OA 1MDQA 2BJJX 3H06B 2G29A 2X7PA 3EPEA 4G2ZA 3T66A 1OQHA 1RKMA 3B7DA 1ZTYA 4FATA 3PUZE 4K3FA 1OMPA 5AE4A 3Q25A 5F7VA 3H6TA 2ONRA 1SW4A 3FVGA 4G68C 1Y4CA 4DDDA 3SETA 4ZS9A 3OO9A 3UN6A 1N7WA 2I6EA 1NKXA 4QFOA 5ISUA 3I5OA 3C34A 4ESWA 5H8NB 3K6VA 5DT6A 3ECRA 3I6VA 3LSXA 5A5XB 1IXGA 4FJPA 1QUIA 1YAEA 3T9VA 3PD8A 3HCQA 5AA4B 3C31A 4ZEBA 4RY1A 5H8FA 4ECFA 3RTWB 4NMYA 1B7HA 3WAFA 3ILTB 1B5JA 4OHNA 1LB8A 4XKQA 1ELJA 3FV2A 3EHSA 3PPQA 2DOJA 3G3HA 4WEDA 3N6TA 2Y7KA 2F34A 4JSOA 4TLMB 3CFLA 2DE4A 4U4SA 4UA8A 4ZDMA 4EXLA 4YKJA 4F18A 4IO5A 4Q5TA 4PP0A 3JV9A 3GBAA 2YPNA 2WKYA 1LGBC 4MLVA 1B5IA 4MBPA 2XX8A 4NEDA 2B65A 3FXQA 4IO2A 3B6TA 5AA2D 3C9HA 3V83A 3SEYA 3CSGA 4H6DA 1MXYA 2VP1A 3D4CA 1FQDA 2V3TA 3FUZA 4YKKA 3QSLA 2I0CA 1SW2A 4YMAA 4NWCA 3QXMA 3V89B 4I9DA 4PFTA 3SESA 1IUDA 2XD3A 3ONMA 4X48A 1HSJA 2QL3A 2F78A 4F1YA 1AOVA 1IXHA 2RF1A 1LBBA 1FQBA 3FV1A 4F19A 4BDNA 5IAIA 1LBCA 3TTLA 1XVXA 2UVJA 3U8QA 4LQ2A 1YPNA 2I0BA 1QUJA 2FA7A 1NH8A 1A7LA 2XXIA 1JQFA 3OSQA 2AL5A 4OZ9A 2AL4A 4Q30B 4E0XA 4P0IA 4I62A 5CI5A 1GV8A 2ZYOA 1N7XA 3KN3A 4U4XA 2AIXA 2DVCA 1IZ1A 3MP8A 4EDPA 4GL0A 1XOCA 3EF7A 5H8NA 4ELRA 3CSBA 2DP8A 5A5XA 1MQJA 2R6GE 1CB6A 3E9XA 1D9VA 5JK4A 2F6PA 3TFLA 2VD2A 3T9HB 5CBRA 2ZNUA 3O66A 1QVSA 2A5SA 2OZZA 3CI8A 3VDFA 4G68A 3IB1A 3K0VA 3FXRA 3UA8A 1A40A 3G7WA 1FQFA 3S9LC 3H6VA 1TFAA 3T9UA 4RYAA 4C0RA 4FIMA 1P1NA 2Z22A 1XS5A 4MFIA 3MPLA 1D3KA 3MC2A 5ICQA 2B3FA 2P1SA 4YB7A 3K1NA 4YAHX 1Y3NA 1LAGE 5ELVA 1PEBA 4DCXA 5L9MA 2KLFA 1P1OA 1OLCA 3MWBA 1QULA 3PUYE 4AQ4A 3B6WA 2RCAA 4QF9A 4LZ8A 2DWHA 2QPQA 4RK9A 3TQLA 3VV5A 2DE3A 2XXXA 2GHBA 4Z0IA 1B3LA 4RJZA 5L8DA 3IOVA 2Q2CA 2Q9TA 1KWHA 1OVBA 1US5A 3LSFB 1B46A 1AL3A 1DTZA 3OELA 1SD3A 3W9WA 1H45A 1US4A 2QMXA 4RK2A 3R26A 3A3CA 2F8DA 3E13X 3IOWA 4JSDA 3TKDA 5CMCA 1Z7NE 1BKAA 1EU8A 1UIUA 3HHFA 4LONB 3R6UA 2NXOA 1EH3A 4R73A 2I49A 4PFYA 4HTGA 4RA1A 1NNTA 4F39A 4YB6A 1NNKA 1MQHA 4OERA 2HXWA 1B3GA 5DEXB 4WEPA 3HSTA 2W7YA 3RPWA 5B70A 3ZKLA 4X1BA 4NF6B 3KZGA 4ZE8A 3K4UA 1MH4A 4OXVA 4EF2A 3D4GA 1B3EA 2R71A 5HM4B 1MXXA 1IXIA 4NF4B 5AA2A 1A54A 4KI0E 2H25A 3EHUA 3MPKA 2F36A 1TXFA 2OJTA 3MJNA 4GXSB 3PUXE 3GLBA 3P7IA 4JWOA 2Z8DA 3MP1A 1M5CA 3A3UA 1A99A 3OEMA 1B51A 4O3CA 2Y7PA 2Y7WA 1Y20A 3IK6B 3O9PA 1MPBA 3A09A 4H67A 1Y1ZA 1QKBA 4LA9A 1D4NA 1DPEA 3Q27A 3VVEA 5FTIA 3TODA 1H3DA 1MQIA 4PE5B 5CMMA 1VFEA 3OEKA 2E1SA 2Z8EA 1HSEA 2Z23A 1B0LA 2QJEA 2I48A 1IITA 5I56B 1BIYA 4NWDA 3PGFA 1TFDA 1MG1A 1VR5A 2XXRA 1O7TA 3K1MA 1B4HA 1N76A 4C1UA 4PFUA 2O1LA 3IOTA 3QK6A 2OWSA 2DXRA 4I1DA 4THIA 3VLWA 2F5XA 1IQ7A 3OO8A 5I57B 3S2VA 3MVZA 1URGA 1MPDA 1JEVA 3IJXB 4DCYA 2I3WA 3WAEA 4H8JA 1B6HA 3U92A 1N04A 3N26A 4ELOA 5I58A 3CFXA 2DE2A 3U72A 1P1WA 1JETA 4ZEDA 3THIA 4GQOA 1QW0A 2O69A 1UTHB 3PD9A 4IB2A 2Q89A 5DEXA 4FAJA 1B3HA 1MH3A 3SKPA 5I2KA 4R75A 1VSOA 4X1DA 1JEUA 4JBZA 1FCKA 1VE4A 4OFOA 5FTHA 3R7XA 1WVJA 1N84A 3KSJA 3U94A 4R6KA 1I6BA 1O64A 3LR1A 1EZ9A 3TCGA 2OWTA 2Q88A 1B4ZA 4BDQA 1Q35A 4DE8A 2H4IA 4KCDA 4KYDA 4G8HA 2AYSA 3KN8A 1R1NA 2DVZA 3KGCA 3ODBA 5JEIA 1DTGA 3H4ZA 1Y3QA 1ZJLA 4GL8A 3RLFE 1S7YA 1SVXB 1SI0A 4IO6A 1AMFA 3PPPA 3PMWA 3UIFA 1UTBB 1S9TA 2H99A 4ZEFA 3FJMA 1B58A 2RC7A 2GFEA 3OO7A 2PBWA 4R6HA 4N07A 2DWAA 3K01A 5I56A 3QAXA 1QKAA 5H8HB 1P99A 5JTYA 3MW0A 2RC8A 2FNCA 3H7MA 1MM7A 5AA1A 1SYIA 3N5LA 2P0SA 2X26A 5FHNA 1ATGA 3T22A 3SEXA 5I2NB 3VVDA 4R2BA 3IR1A 1LFIA 5I59A 1ZLQA 2NVUB 1N3XA 5I57A 3SERA 3RGYA 3MZ1A 3O6GA 3FATA 3TQWA 3MP6A 3Q28A 2VGQA 4GVOA 2ZNSA 1OIBA 2XXUA 3FJ7A 2I4CA 4JXIA 1FW0A 3KJ7A 2HCAA 4OENA 2PMSA 4XKNA 2ONSA 2RCBA 4OEVA 1FTKA 1SBPA 4F2QA 1B5HA 1QUKA 4BDOA 5K2XA 2OLBA 2PVUA 4H5FA 4ELQA 5TP9B 2HZLA 3E3KA 1R9QA 1N3WA 3VXCA 3LC8A 3FGSA 2HQ0A 5H8QB 1EZPA 3PMVA 1Y1MA 2UXAA 2YLNA 2V3UA 3IB2A 5EHSA 3ZS6A 4GIZA 2THIA 2A5TB 2Q8JA 1PDAA 3DP8A 3IORA 5AA4A 2NOOA 4OFJA 1A8FA 2XXHA 4U23A 5DVJA 1LAHE 3MZ9A 3H6WA 3MUQA 1Y4TA 1OLAA 2ZYNA 1MQGA 3HHGA 3G3FA 2VOZA 4N13A 4LUBA 1MQDA 4KFQA 4GF8A 4AB5A 5KDTB 2Q2AA 4TOZA 5CC2A 3RN8A 4LVQA 1ZBMA 4ISUA 4NF5B 2NWJA 1TWYA 4F3SA 3FASA 3O29A 3RT8A 2F97A 4EUOA 4ONYA 3MVWA 1CE2A 3RNNA 3RT6B 4ZZAA 1BP5A 5M2VA 1LAXA 3KOSA 1MY3A 3QUJA 1PB8A 5CMBA 2I4BA 4YU0A 4GWOA 4QFLA 1MM6A 2O7UA 3BFTA 2QS2A 4POXA 3BFUA 5CMKA 1Q1KA 5DVFA 2V93A 4JDFA 4BDMA 2RC9A 4HS7A 3G3KA 4TLLB 1FQAA 2Y7IA 3LUYA 4QRZA 3IJOB 4GD5A 2DXYA 4QSDA 4R9GA 5I2NA 5KCJB 3K2DA 1JW1A 4NF8B 1LLSA 2FYIA 3TTNA 4EF1A 1LAFE 3M3KA 3TMGA 1FQEA 4RPNA 3CG1A 3U1OA 3FVOA 4BDLA 3TTRA 2Y84A 3O6IA 1URDA 2ZYKA 2XD2A 1FTOA 1MXVA 2PT2A 1DOTA 4YKPA 2UVHA 3GZGA 3MVYA 4L17A 1L5TA 4ELPA 3M8UA 2RINA 1AIVA 3L6GA 5TP9A 2I3VA 2ZMBA 3IB0A 1MY4A 5HBCA 3OO6A 4U1ZA 4ZEIA 4HW8A 4F22A 4U22A 2DSFA 4M1VA 1MXWA 3CG3A 4QHQA 1B7ZA 1LSTA 2ZYMA 3HN0A 3T9XB 4IO3A 4RPOA 3IOUA 2HZKA 3JYRA 3KBRA 4H0WA 2A5TA 4LATA 3O28A 3PPNA 1IIWA 1RYOA 3GXAA 2ABHA 3L6HA 4OFLA 2XXQA 3K1PA 1B2HA 3U93A 4MLQA 1I69A 3M3FA 4H65A 2F6GA 1MRPA 2F7BA 3HPIA 4X9TA 2OCUA 3K6UA 1M5DA 5KDTA 2D21A 3VE1B 3TCHA 5BUUA 1FTJA 1B7UA 2HFBA 3KJTA 5H8FB 3DELB 2QS1A 1LFGA 5IKBA 4NE4A 1P1QA 1XC1A 1MPCA 3MAMA 5BWJA 3K6WA 4H1XA 4KPTA 2REGA 5J1DA 1URSA 4GLIA 3PPRA 3V8XB 3VLUA 2CMOA 1OQGA 1LCTA 3I3VA 2VD3A 5H8SA 5TU0A 3CVGA 2F7CA 3TDJA 2XXWA 5CM6A 2XXVA 3OMBA 4BLAA 3FZVA 2E0SA 2O84X 3F11A 1A55A 5L9SA 3TYHA 4MF3A 1SW5A 3QUFA 1YTVA 5ITPA 1LCFA 3N94A 1Y3PA 1EZOA 1VFDA 2O1MA 2I58A 1MY1A 4LZ5A 2VHAA 3W15C 3UK4A 3UP9A 4F31B 4OWDA 4IGTA 4KD5A 2XXTA 1BLFA 3Q26A 1RYXA 3PMXA 4U21A 3T96B 2OBGA 1MY0A 3EQ1A 1II5A 5KZTA 3T93B 1H43A 5FHMA 2OK2A 2XX7A 1D9YA 2P2AA 3JZJA 4TQUQ 1NNFA 4NF6A 3B6QA 3KSXA 4ZEKA 2ANJA 1ZU0A 4G4PA 3IL1B 3RQTA 2ZNTA 2F7AA 1I6AA 1FTMA 4BDRA 3TAJA 3OOAA 4IO7A 2O6AA 2O51A 4DIGA 4Q8RA 4NF4A 3TCFA 1GTKA 4QSCA 1J1NA 3FVNA 5HPQA 3BKIB 2NUVA 3ZSFA 4ND9A 3EN3A 4GRKA 4G8NA 3C35A 4XKPA 1B9JA 3PUWE 3UORA 1DSNA 3PPOA 1I6QA 2GHAA 3MZBA 4KHZE 1NNPA 1JW4A 3OXNA 3RY3A 4LQ5A 3EHTA 5CBSA 2DS9A 3IO4A 1ZMGA 2G93A 1B05A 2V25A 4FEDA 1WDNA 3LSLA 1FQCA 1POTA 4G68B 4LZ7A 3C32A 4EXKA 3S9NC 4QFNA 4ZE9A 4YICA 2Y7RA 4IY6A 4KCCA 1BTJA 2QS3A 1B1HA 3DP4A 3K00A 2XHDA 4XXUA 4C1TA 3K6XA 3TTKA 3DP6A 1B40A 4F3PA 1A8EA 3DLNA 1SYHA 3OENA 3MBPA 3CFZA 4R72A 1PB9A 1SI1A 3RUMA 4PQJA 1PBQA 2HAVA 4FORA 3IO6A 4FEBA 1B32A 4YMBA 3QIMA 4FE8A 1MXZA 2UYEA 3CR9A 4IGRA 3CRBA 4Z7EA 1H76A 3TEPA 3ILUB 5DVIA 3VXBA 3G3GA 4N6PA 1JNFA 2DQVA 1JVXA 1MDP1 3IX1A 4KR5A 3LBSA 4U2RA 4WKMA 1UTHA 5EHMA 2V3QA 4G8MA 1R6ZA 2XXPA 1IXCA 2DWIA 1PBPA 2QMWA 2QS4A 2REJA 5CRYA 4G77A 2QRYA 4QSEA 2HEUA 1GR2A 3TTMA 4Q0CA 3QYTA 4HCWA 4F2OA 2UVGA 5B7DA 2GH9A 5FHOA 2H5YA 1SW1A 1YCJA 4ZECA 3PUVE 1GVCA 3CIJA
chains in the Genus database with same CATH superfamily
4R74A 1VDWA 2FVZA 4XFEA 4OTEA 3PV0E 4KYEA 1R9LA 4N8GA 2D5WA 2H9BA 2PYYA 1F9BA 5I84A 3LSWA 4H5GA 3GBBA 3USDA 3TZAA 1NV6A 3AXFA 1SDXA 1Z7ME 4GWYA 1XT8A 1S50A 4R6YA 1B52A 4YB5A 4O3BA 4JB7A 1Y9UA 2O68A 5AA2B 3O97A 4QFPA 1UTBA 2XXYA 2P3VA 4U1OA 5A5LA 3H3GA 4DLDA 2RKMA 1ZIUA 2Z8FA 1GGGA 4DXCA 2UYFA 4XKRA 4GXAA 3G3JA 4OA4A 4P0GA 3H6UA 1USYE 3KEIA 3ZKKA 4R9FA 5H8HA 4E0WA 1WODA 4DXBA 4HE1A 2MKZA 5TPAB 1QJMA 1IMDA 5IZ3B 4EQBA 1UQWA 2HHMA 4N81A 4OEUA 1H44A 1M5FA 1NUZA 2LAOA 1QGXA 1UIVA 4H8IA 3KFMA 4KXPA 1N0TA 3OD7A 2FHYA 3C36A 4GFRA 1AWBA 3KOTA 4PETA 5EQ9A 5EYFA 4OVQA 4HCYA 3RTFB 2KR0A 1NV1A 4ZZEA 3K02A 3MVXA 1M5EA 2PX1A 2V84A 1POY1 3Q29A 4OQOA 1FBEA 1KZ8A 4EQ9A 4POWA 4N6DA 1NH7A 3DM0A 5DTBA 4OMBA 4QFKA 4PF8A 4XIGQ 2CZHA 3VVFA 3SDFA 2DYXA 4F3BA 3V5AA 2KQZA 1NFTA 4F1VA 3HO7A 1AH5A 3MQ9A 5IM2A 4F1UA 4JWXA 1RDYA 3HV1A 4WXJA 2H98A 1NUXA 5I3SA 2HAUA 5H8QA 5I58B 4R2FA 3W9VA 3N6UA 2QSXA 2R9JA 2XX9A 1JW5A 4P11A 4IY5A 4IO4A 3KG2A 1SQYA 1ANFA 3UGWA 4EQ7A 3FIRA 2ONKE 4I8CA 2X7QA 2F35A 3E4RA 4OYVA 2GRVA 3VFJA 5I2KB 1MY2A 2DWJA 4OESA 4NN3A 3S9EA 1DPPA 3OSRA 3BBRA 3S4UA 1MXUA 5LOMA 4YZZA 5DYHA 4N15A 3TELA 3C4MA 3KN7A 1FBGA 3IFAA 4NX1A 2PT1A 3SEVA 3VLVA 1CNQA 4NF5A 2P3NA 1FTLA 1XVYA 1B1XA 1B0HA 1PB7A 1P1UA 4OETA 2IA4A 5AA3A 4PTKA 4PDDA 3SEUA 1B3FA 3TPAA 4GWUA 3TUSA 2ALUA 1XHYA 3C33A 4PFWA 4UACA 3O6HA 3M3LA 1LB9A 1T0KA 4OVJA 4PFIA 2YJPA 4MMPA 4LP2B 1IEJA 4HXVA 2D3IA 4DZ1A 3PU5A 4FECA 2M8CA 2ZXTA 5TPAA 4O3AA 3O2AA 1FSAA 5ICTA 1BK4A 1OVTA 4YKIA 1TT1A 2CZLA 5F1QA 4F29A 4KQPA 4ESXA 3IAZA 2O7IA 1ZKBA 4F3GA 1LFHA 3FJGA 5KCJA 3H03A 1HSLA 4NF8A 1FPDA 4NTLA 4RNSA 1LBYA 1MS7A 3FXUA 1USYH 4DXUA 4AB6A 3GYYA 1M5BA 5JTYB 2IEEA 1DMBA 4QBAA 1NL5A 2UVIA 4NHBA 4PDHA 4M4GA 5K2YA 3FVKA 1O63A 3BIGA 1JVYA 1NUWA 4KYSA 2B3BA 5I59B 3FD3A 3S9MC 4G61A 1NMUA 4RXLA 4JWYA 3SEWA 5ITOA 1RDZA 3G3IA 4MH5A 5IZZA 4XTCQ 2ESNA 2OWZA 4NGUA 1PC3A 4GOTA 5L9OA 1MDQA 2BJJX 2L5VA 3H06B 2G29A 2X7PA 3EPEA 2HPGA 4G2ZA 3T66A 1OQHA 1RKMA 3B7DA 1ZTYA 4FATA 3PUZE 4K3FA 1OMPA 5AE4A 3Q25A 5F7VA 3H6TA 2ONRA 2WBDA 1SW4A 3FVGA 4G68C 1Y4CA 4DDDA 3SETA 4ZS9A 3OO9A 3T1BA 3UN6A 4NQ8A 1N7WA 2I6EA 2CEXA 2VT5A 4PE3A 1NKXA 4QFOA 5ISUA 3I5OA 3C34A 4ESWA 1LBWA 5H8NB 3K6VA 5DT6A 3ECRA 3I6VA 3LSXA 5A5XB 2WBBA 3QMFA 1IXGA 4NF0A 4FJPA 1QUIA 4N6KA 1YAEA 3T9VA 3PD8A 3HCQA 5AA4B 2CEYA 3C31A 4ZEBA 4RY1A 5H8FA 4ECFA 1NV2A 3RTWB 4MJOA 4NMYA 1B7HA 5J16A 3WAFA 3ILTB 1B5JA 4OHNA 1LB8A 4XKQA 1ELJA 3FV2A 4NAPA 3EHSA 3PPQA 2DOJA 3G3HA 4WEDA 3N6TA 2Y7KA 4I3YA 2F34A 4JSOA 4TLMB 3CFLA 1IMBA 1FPIA 2DE4A 4U4SA 4UA8A 4ZDMA 4EXLA 4YKJA 4F18A 2OX3A 4PF6A 4IO5A 4Q5TA 4PP0A 3JV9A 3GBAA 1FPGA 2YPNA 2WKYA 4P3LA 1LGBC 4MLVA 1IMCA 1B5IA 3FXBA 4MBPA 2XX8A 4NEDA 2B65A 3FXQA 4IO2A 3B6TA 5AA2D 3C9HA 3V83A 3SEYA 3CSGA 4H6DA 1MXYA 2VP1A 3D4CA 1FQDA 2V3TA 3FUZA 4I3EA 4YKKA 3QSLA 2I0CA 1SW2A 1G0IA 4YMAA 4NWCA 4PBHA 3QXMA 3V89B 4I9DA 4PFTA 3SESA 1IUDA 2XD3A 3ONMA 4X48A 1HSJA 2QL3A 2F78A 5LDZA 4DI4B 4F1YA 1AOVA 1IXHA 2RF1A 1LBBA 1FQBA 3FV1A 4F19A 5FBPA 3U65A 4BDNA 1NV4A 5IAIA 1LBCA 3TTLA 1XVXA 2UVJA 3SZPA 3U8QA 4LQ2A 1YPNA 2I0BA 1QUJA 2FA7A 1NH8A 1A7LA 2XXIA 1JQFA 2V4CA 3OSQA 2AL5A 4OZ9A 2AL4A 4Q30B 4E0XA 4P0IA 4I62A 5CI5A 1GV8A 2ZYOA 1N7XA 3KN3A 4U4XA 2AIXA 2DVCA 1IZ1A 3MP8A 4EDPA 3B8BA 4GL0A 1XOCA 3EF7A 5H8NA 4ELRA 3CSBA 2DP8A 5A5XA 1FBHA 1MQJA 2R6GE 1CB6A 3E9XA 1D9VA 5JK4A 2F6PA 2FIEA 3TFLA 2VD2A 3T9HB 5CBRA 2ZNUA 3O66A 1QVSA 2A5SA 2OZZA 1JP4A 3ROJA 3CI8A 3VDFA 4N17A 1RDXA 4G68A 3IB1A 3HFUA 3K0VA 3FXRA 4N91A 3UA8A 1A40A 3G7WA 1NV0A 1FQFA 3S9LC 3H6VA 1TFAA 3T9UA 4RYAA 5LTCA 4C0RA 4FIMA 4P9KA 1P1NA 4P8BA 2Z22A 1XS5A 4MFIA 2R8TA 3MPLA 1D3KA 3MC2A 5ICQA 2B3FA 2P1SA 4YB7A 3K1NA 4YAHX 5ET5A 1Y3NA 1LAGE 5ELVA 1PEBA 3ISPA 4DI3D 4DCXA 5L9MA 2KLFA 1P1OA 1OLCA 3MWBA 1QULA 3PUYE 4AQ4A 4PBQA 3B6WA 2RCAA 3FBPA 4QF9A 3LUZA 4LZ8A 2DWHA 2QPQA 4RK9A 3TQLA 3VV5A 2DE3A 2XXXA 2GHBA 4Z0IA 2CZKA 1B3LA 5EYGA 4RJZA 5L8DA 2WYKA 3IOVA 5I5PA 2Q2CA 2Q9TA 1KWHA 1OVBA 1US5A 3LSFB 1B46A 5ET6A 1KA0A 1AL3A 1DTZA 3OELA 4GBWA 1SD3A 4X04A 3W9WA 1H45A 1US4A 2QMXA 4PAIA 2XWKA 4RK2A 1XI6A 3R26A 3A3CA 4GBVA 2F8DA 3E13X 3IOWA 4JSDA 4GX4A 3TKDA 5CMCA 1Z7NE 1BKAA 1EU8A 1UIUA 3HHFA 4LONB 3R6UA 2NXOA 1EH3A 4R73A 2I49A 4PFYA 4HTGA 4RA1A 4H45A 1NNTA 4F39A 4YB6A 1NNKA 1MQHA 4OERA 2HXWA 1B3GA 5DEXB 4WEPA 3HSTA 2W7YA 3E79A 1EYKA 3RPWA 5B70A 3ZKLA 4X1BA 1DBZA 4NF6B 1FPKA 3KZGA 4ZE8A 3K4UA 1MH4A 1FPJA 1K9ZA 4GWZA 4OXVA 4EF2A 3D4GA 1B3EA 2R71A 5HM4B 1MXXA 1IXIA 4NF4B 5AA2A 1A54A 4KI0E 2H25A 3EHUA 3MPKA 2F36A 1TXFA 2OJTA 3MJNA 4GXSB 3PUXE 3GLBA 3P7IA 4JWOA 2Z8DA 3MP1A 1M5CA 3A3UA 1A99A 1YYZA 3OEMA 1FTAA 1B51A 4O3CA 2Y7PA 2Y7WA 1Y20A 3IK6B 3O9PA 5IZ3A 1MPBA 1FPFA 3A09A 4H67A 1Y1ZA 1QKBA 4O94A 4LA9A 1D4NA 1DPEA 3Q27A 3VVEA 4MNPA 5FTIA 2WEFA 3TODA 1H3DA 1MQIA 4PE5B 5CMMA 1VFEA 2XWOA 3OEKA 2E1SA 2Z8EA 2Q8MA 1HSEA 2Z23A 1B0LA 2QJEA 2I48A 3RYDA 1IITA 5I56B 1BIYA 4NWDA 3PGFA 1TFDA 1MG1A 1VR5A 1FBDA 2XXRA 1O7TA 3K1MA 4PC9A 4MHFA 1B4HA 1N76A 5IZ1A 4C1UA 4PFUA 2O1LA 2Y5KA 2QVVA 3IOTA 3QK6A 2OWSA 2DXRA 4I1DA 4THIA 3VLWA 2F5XA 2ZZVA 1IQ7A 1FBCA 3OO8A 5I57B 3S2VA 3MVZA 1URGA 1MPDA 1JEVA 3IJXB 4DCYA 3IFCA 2I3WA 3NOHA 3WAEA 4H8JA 1B6HA 3U92A 1N04A 3N26A 4ELOA 5I58A 3CFXA 2DE2A 3U72A 1P1WA 1JETA 4XEQA 4ZEDA 4OVSA 3THIA 4GQOA 2CZIA 1QW0A 2O69A 1UTHB 3PD9A 4IB2A 5EQ8A 2DDKA 2Q89A 5DEXA 4FAJA 1B3HA 1MH3A 3SKPA 5I2KA 4R75A 1VSOA 4X1DA 1JEUA 4JBZA 4PAKA 2PFYA 1FCKA 1VE4A 4OFOA 5FTHA 3R7XA 2Y5LA 1D9QA 1WVJA 1N84A 3KSJA 3U94A 1EYIA 4R6KA 1I6BA 1O64A 3LR1A 1EZ9A 3TCGA 2OWTA 5IGAA 2Q88A 1B4ZA 4BDQA 1Q35A 1YXIA 4DE8A 2H4IA 4KCDA 4GWXA 4KYDA 4G8HA 4O8MA 4PFRA 5F24A 2AYSA 3KN8A 1R1NA 2DVZA 3KGCA 3ODBA 5JEIA 1DTGA 3H4ZA 1Y3QA 1ZJLA 4GL8A 2JJKA 3RLFE 1S7YA 1SVXB 2XXKA 2ZZWA 3RPLB 1SI0A 1LBZA 4IO6A 1AMFA 3PPPA 3PMWA 3UIFA 1UTBB 2GQ1A 1S9TA 2H99A 4ZEFA 3FJMA 1B58A 2RC7A 2GFEA 3OO7A 3PTYA 2PBWA 4R6HA 4N07A 2DWAA 3K01A 5I56A 3QAXA 1QKAA 4MEVA 5H8HB 1P99A 5JTYA 3MW0A 2RC8A 2FNCA 3H7MA 1MM7A 4PGNA 5AA1A 1SYIA 3N5LA 2P0SA 2X26A 5FHNA 1ATGA 3T22A 3SEXA 5I2NB 3VVDA 4R2BA 3IR1A 1LFIA 5I59A 4HE0A 1ZLQA 2NVUB 1N3XA 5I57A 3SERA 2PFZA 2F3DA 3RGYA 3MZ1A 3O6GA 3FATA 3TQWA 3MP6A 3Q28A 2VGQA 1FPEA 4GVOA 2F3BA 1K9YA 2ZNSA 1OIBA 2XXUA 3FJ7A 2I4CA 4JXIA 4MIJA 1FW0A 1FRPA 3KJ7A 2HCAA 4OENA 2XWVA 2PMSA 4XKNA 2ONSA 2RCBA 4OEVA 1FTKA 1SBPA 4F2QA 5T3JA 1B5HA 3BIHA 1QUKA 4BDOA 1IMEA 5K2XA 2OLBA 2PVUA 4H5FA 4ELQA 5TP9B 4P56A 2HZLA 1FPLA 3E3KA 1R9QA 1YZ0A 1N3WA 3VXCA 3LC8A 3FGSA 1NV3A 3KC0A 2HQ0A 5H8QB 1EZPA 3PMVA 1Y1MA 2QVRA 2UXAA 2YLNA 2V3UA 3IB2A 2Q74A 5EHSA 3ZS6A 4GIZA 2THIA 2A5TB 2QVUA 2Q8JA 1PDAA 3DP8A 3IORA 5AA4A 3CHGA 2NOOA 4OFJA 1A8FA 2XXHA 4U23A 5DVJA 4OVTA 1LAHE 3MZ9A 3H6WA 3MUQA 1Y4TA 5ET7A 4PCDA 1OLAA 2ZYNA 1MQGA 1FPBA 3HHGA 3G3FA 2VOZA 4N13A 4LUBA 3D1RA 1MQDA 4KFQA 4H46A 4GF8A 4AB5A 5KDTB 2Q2AA 4TOZA 5CC2A 3RN8A 4LVQA 1ZBMA 2FBPA 4ISUA 4NF5B 2NWJA 3RPLA 1TWYA 1DCUA 4F3SA 3FASA 3O29A 4NG7A 3RT8A 5ET8A 2F97A 4EUOA 4ONYA 3MVWA 1CE2A 3RNNA 3RT6B 4ZZAA 1BP5A 5M2VA 1LAXA 3KOSA 1MY3A 3QUJA 1PB8A 5CMBA 2I4BA 4YU0A 4GWOA 4QFLA 1MM6A 2O7UA 3BFTA 1FBPA 2QS2A 4POXA 4IR8A 3BFUA 5CMKA 1Q1KA 4I40A 5DVFA 2V93A 4JDFA 4BDMA 2RC9A 4HS7A 4AS4A 3G3KA 4O7IA 4AS5A 4TLLB 1FQAA 1KA1A 2Y7IA 3LUYA 4QRZA 3IJOB 4GD5A 2DXYA 4QSDA 4LN5A 4R9GA 5I2NA 5KCJB 3K2DA 1JW1A 4NF8B 1LLSA 2FYIA 3TTNA 4EF1A 1LAFE 3M3KA 3TMGA 1FQEA 4RPNA 3CG1A 3U1OA 3FVOA 4BDLA 3TTRA 2Y84A 4MCOA 4FBPA 3O6IA 1URDA 4PGPA 2ZYKA 2XD2A 4JVDA 1FTOA 1MXVA 2PT2A 4XF5A 1DOTA 4GX6A 2ZZXA 4MNIA 4YKPA 2UVHA 3GZGA 3MVYA 4L17A 1L5TA 4ELPA 3M8UA 2RINA 4MNCA 1AIVA 3L6GA 1NV7A 5TP9A 2I3VA 2ZMBA 3IB0A 1MY4A 5HBCA 3OO6A 4U1ZA 4ZEIA 4HW8A 4F22A 4U22A 2DSFA 3A29A 4M1VA 1MXWA 3CG3A 4QHQA 1B7ZA 1LSTA 4JVCA 2ZYMA 3HN0A 3T9XB 4IO3A 2HXRA 1FJ9A 4RPOA 3IOUA 2HZKA 3JYRA 3KBRA 4H0WA 2A5TA 4LATA 1SPIA 3O28A 4HE2A 3PPNA 1IIWA 5EQ7A 1RYOA 3GXAA 3MSTA 2VPNA 1INPA 2ABHA 3L6HA 4OFLA 2XXQA 3K1PA 3E78A 1B2HA 3U93A 4MLQA 3EKIA 1I69A 3M3FA 4H65A 2F6GA 1MRPA 2F7BA 3HPIA 4X9TA 2B4MA 2OCUA 3K6UA 1M5DA 5KDTA 2D21A 3VE1B 3TCHA 5BUUA 1FTJA 1B7UA 2WX9A 2HFBA 3KJTA 5H8FB 3DELB 4P1EA 1IMAA 2QS1A 1LFGA 5IKBA 4NE4A 1DK4A 1P1QA 1XC1A 1MPCA 3MAMA 1FJ6A 5BWJA 3K6WA 4H1XA 4OVPA 4KPTA 2REGA 5J1DA 2QFLA 1URSA 4GLIA 3PPRA 3V8XB 5I7IA 1LEVA 1NUYA 3VLUA 2CMOA 1OQGA 1LCTA 3I3VA 2VD3A 2FIXA 5H8SA 5TU0A 3CVGA 2F7CA 3TDJA 2XXWA 5CM6A 2XXVA 3OMBA 4BLAA 1Q9DA 3FZVA 2E0SA 2O84X 1FBFA 3F11A 1A55A 5L9SA 4N4UA 3TYHA 4MF3A 1EYJA 4QXDA 1SW5A 3QUFA 1YTVA 5ITPA 4N8YA 1LCFA 3N94A 1Y3PA 1EZOA 3MYUA 4PAFA 1VFDA 2O1MA 2I58A 1MY1A 4LZ5A 1IMFA 2VHAA 3W15C 3UK4A 3UP9A 4F31B 4OWDA 4GX3A 4IGTA 4KD5A 1LBVA 2XXTA 1BLFA 3Q26A 1RYXA 3PMXA 4U21A 3T96B 3LV0A 2OBGA 1MY0A 3EQ1A 1II5A 5KZTA 3T93B 1H43A 2BJIA 5FHMA 2OK2A 2XX7A 3KBZA 1D9YA 2P2AA 3JZJA 4TQUQ 1NNFA 4NF6A 3B6QA 4OVRA 3KSXA 4OANA 2PCRA 4ZEKA 2ANJA 1ZU0A 4G4PA 3IL1B 4PFBA 2ZNTA 3RQTA 2F7AA 1I6AA 1FTMA 4BDRA 3TAJA 3OOAA 4MAGA 4IO7A 2O6AA 2O51A 1NV5A 4DIGA 5EYHA 3B50A 4Q8RA 4NF4A 3TCFA 1GTKA 4QSCA 1J1NA 3FVNA 5HPQA 3BKIB 2NUVA 3ZSFA 4ND9A 4UABA 3EN3A 4GRKA 4G8NA 3C35A 4XKPA 4O7MA 1B9JA 3PUWE 3UORA 1DSNA 3PPOA 1I6QA 2GHAA 3MZBA 4KHZE 1NNPA 1JW4A 3OXNA 3RY3A 4LQ5A 3EHTA 5CBSA 2DS9A 3IO4A 1ZMGA 2G93A 1B05A 2V25A 4FEDA 1WDNA 3LSLA 1FQCA 1POTA 4G68B 4LZ7A 3C32A 4EXKA 3S9NC 4QFNA 4ZE9A 4YICA 2XA5A 2Y7RA 4IY6A 4KCCA 1BTJA 2QS3A 3KC1A 1B1HA 3DP4A 1G0HA 3K00A 2XHDA 4XXUA 2B4LA 4C1TA 3K6XA 3TTKA 1LBXA 3DP6A 4GWSA 1B40A 4P47A 4F3PA 4X8RA 1A8EA 3DLNA 5EQAA 1SYHA 2WYPA 3OENA 3MBPA 4JVIA 5ESYA 3CFZA 4R72A 1PB9A 1SI1A 3RUMA 4PQJA 1PBQA 2HAVA 4FORA 3IO6A 4FEBA 1B32A 4YMBA 3QIMA 4FE8A 1MXZA 2UYEA 3CR9A 4IGRA 3CRBA 4Z7EA 1H76A 3TEPA 3ILUB 5DVIA 4P1LA 3VXBA 3G3GA 4N6PA 1JNFA 3T0JA 2DQVA 1JVXA 4MX6A 1MDP1 2XWIA 3IX1A 4KR5A 3LBSA 4U2RA 4WKMA 1UTHA 5EHMA 2V3QA 4G8MA 1R6ZA 5DW8A 2XXPA 1IXCA 2DWIA 1PBPA 2QMWA 2QS4A 2REJA 5CRYA 2VPOA 4G77A 2QRYA 4QSEA 2HEUA 1GR2A 3TTMA 1NI9A 3QYTA 4HCWA 4Q0CA 4F2OA 2UVGA 5B7DA 2GH9A 5FHOA 2H5YA 1SW1A 4GWWA 1YCJA 4ZECA 3PUVE 1GVCA 3CIJA
chains in the Genus database with same CATH topology
4R74A 4OTEA 3PV0E 4KYEA 1R9LA 2D5WA 2H9BA 2PYYA 1F9BA 5I84A 3LSWA 4H5GA 3GBBA 3USDA 3TZAA 3AXFA 1SDXA 1Z7ME 1XT8A 1S50A 4R6YA 1B52A 4YB5A 4O3BA 4JB7A 1Y9UA 2O68A 5AA2B 3O97A 4QFPA 1UTBA 2XXYA 4U1OA 3H3GA 4DLDA 2RKMA 1ZIUA 2Z8FA 1GGGA 4DXCA 2UYFA 4XKRA 4GXAA 3G3JA 4P0GA 3H6UA 1USYE 3KEIA 3ZKKA 4R9FA 5H8HA 4E0WA 1WODA 4DXBA 5TPAB 1QJMA 4EQBA 1UQWA 4OEUA 1H44A 1M5FA 2LAOA 1UIVA 4H8IA 3KFMA 1N0TA 3OD7A 3C36A 4GFRA 3KOTA 4PETA 5EYFA 4HCYA 3RTFB 4ZZEA 3K02A 3MVXA 1M5EA 2PX1A 2V84A 1POY1 3Q29A 4OQOA 4EQ9A 4POWA 1NH7A 3DM0A 5DTBA 4OMBA 4QFKA 4XIGQ 3VVFA 3SDFA 2DYXA 4F3BA 3V5AA 1NFTA 4F1VA 3HO7A 1AH5A 3MQ9A 4F1UA 4JWXA 3HV1A 4WXJA 2H98A 2HAUA 5H8QA 5I58B 4R2FA 3W9VA 3N6UA 2QSXA 2R9JA 2XX9A 1JW5A 4P11A 4IY5A 4IO4A 3KG2A 1SQYA 1ANFA 3UGWA 4EQ7A 3FIRA 2ONKE 4I8CA 2X7QA 2F35A 3E4RA 4OYVA 2GRVA 3VFJA 5I2KB 1MY2A 2DWJA 4OESA 3S9EA 1DPPA 3OSRA 3BBRA 3S4UA 1MXUA 5LOMA 4YZZA 5DYHA 3TELA 3C4MA 3KN7A 2PT1A 3SEVA 3VLVA 4NF5A 1FTLA 1XVYA 1B1XA 1B0HA 1PB7A 1P1UA 4OETA 2IA4A 5AA3A 3SEUA 1B3FA 3TPAA 3TUSA 2ALUA 1XHYA 3C33A 4PFWA 4UACA 3O6HA 3M3LA 1LB9A 1T0KA 4OVJA 2YJPA 4LP2B 1IEJA 2D3IA 4DZ1A 3PU5A 4FECA 2M8CA 2ZXTA 5TPAA 4O3AA 3O2AA 5ICTA 1OVTA 4YKIA 1TT1A 2CZLA 5F1QA 4F29A 4KQPA 4ESXA 3IAZA 2O7IA 1ZKBA 4F3GA 1LFHA 3FJGA 5KCJA 3H03A 1HSLA 4NF8A 4NTLA 4RNSA 1MS7A 3FXUA 1USYH 4DXUA 4AB6A 1M5BA 5JTYB 2IEEA 1DMBA 1NL5A 2UVIA 4M4GA 5K2YA 3FVKA 1O63A 1JVYA 4KYSA 2B3BA 5I59B 3FD3A 3S9MC 1NMUA 4RXLA 4JWYA 3SEWA 5ITOA 3G3IA 4MH5A 4XTCQ 2ESNA 1PC3A 4GOTA 5L9OA 1MDQA 2BJJX 3H06B 2G29A 2X7PA 3EPEA 4G2ZA 3T66A 1OQHA 1RKMA 3B7DA 1ZTYA 4FATA 3PUZE 4K3FA 1OMPA 5AE4A 3Q25A 5F7VA 3H6TA 2ONRA 1SW4A 3FVGA 4G68C 1Y4CA 4DDDA 3SETA 4ZS9A 3OO9A 3UN6A 1N7WA 2I6EA 1NKXA 4QFOA 5ISUA 3I5OA 3C34A 4ESWA 5H8NB 3K6VA 5DT6A 3ECRA 3I6VA 3LSXA 5A5XB 1IXGA 4FJPA 1QUIA 1YAEA 3T9VA 3PD8A 3HCQA 5AA4B 3C31A 4ZEBA 4RY1A 5H8FA 4ECFA 3RTWB 4NMYA 1B7HA 3WAFA 3ILTB 1B5JA 4OHNA 1LB8A 4XKQA 1ELJA 3FV2A 3EHSA 3PPQA 2DOJA 3G3HA 4WEDA 3N6TA 2Y7KA 2F34A 4JSOA 4TLMB 3CFLA 2DE4A 4U4SA 4UA8A 4ZDMA 4EXLA 4YKJA 4F18A 4IO5A 4Q5TA 4PP0A 3JV9A 3GBAA 2YPNA 2WKYA 1LGBC 4MLVA 1B5IA 4MBPA 2XX8A 4NEDA 2B65A 3FXQA 4IO2A 3B6TA 5AA2D 3C9HA 3V83A 3SEYA 3CSGA 4H6DA 1MXYA 2VP1A 3D4CA 1FQDA 2V3TA 3FUZA 4YKKA 3QSLA 2I0CA 1SW2A 4YMAA 4NWCA 3QXMA 3V89B 4I9DA 4PFTA 3SESA 1IUDA 2XD3A 3ONMA 4X48A 1HSJA 2QL3A 2F78A 4F1YA 1AOVA 1IXHA 2RF1A 1LBBA 1FQBA 3FV1A 4F19A 4BDNA 5IAIA 1LBCA 3TTLA 1XVXA 2UVJA 3U8QA 4LQ2A 1YPNA 2I0BA 1QUJA 2FA7A 1NH8A 1A7LA 2XXIA 1JQFA 3OSQA 2AL5A 4OZ9A 2AL4A 4Q30B 4E0XA 4P0IA 4I62A 5CI5A 1GV8A 2ZYOA 1N7XA 3KN3A 4U4XA 2AIXA 2DVCA 1IZ1A 3MP8A 4EDPA 4GL0A 1XOCA 3EF7A 5H8NA 4ELRA 3CSBA 2DP8A 5A5XA 1MQJA 2R6GE 1CB6A 3E9XA 1D9VA 5JK4A 2F6PA 3TFLA 2VD2A 3T9HB 5CBRA 2ZNUA 3O66A 1QVSA 2A5SA 2OZZA 3CI8A 3VDFA 4G68A 3IB1A 3K0VA 3FXRA 3UA8A 1A40A 3G7WA 1FQFA 3S9LC 3H6VA 1TFAA 3T9UA 4RYAA 4C0RA 4FIMA 1P1NA 2Z22A 1XS5A 4MFIA 3MPLA 1D3KA 3MC2A 5ICQA 2B3FA 2P1SA 4YB7A 3K1NA 4YAHX 1Y3NA 1LAGE 5ELVA 1PEBA 4DCXA 5L9MA 2KLFA 1P1OA 1OLCA 3MWBA 1QULA 3PUYE 4AQ4A 3B6WA 2RCAA 4QF9A 4LZ8A 2DWHA 2QPQA 4RK9A 3TQLA 3VV5A 2DE3A 2XXXA 2GHBA 4Z0IA 1B3LA 4RJZA 5L8DA 3IOVA 2Q2CA 2Q9TA 1KWHA 1OVBA 1US5A 3LSFB 1B46A 1AL3A 1DTZA 3OELA 1SD3A 3W9WA 1H45A 1US4A 2QMXA 4RK2A 3R26A 3A3CA 2F8DA 3E13X 3IOWA 4JSDA 3TKDA 5CMCA 1Z7NE 1BKAA 1EU8A 1UIUA 3HHFA 4LONB 3R6UA 2NXOA 1EH3A 4R73A 2I49A 4PFYA 4HTGA 4RA1A 1NNTA 4F39A 4YB6A 1NNKA 1MQHA 4OERA 2HXWA 1B3GA 5DEXB 4WEPA 3HSTA 2W7YA 3RPWA 5B70A 3ZKLA 4X1BA 4NF6B 3KZGA 4ZE8A 3K4UA 1MH4A 4OXVA 4EF2A 3D4GA 1B3EA 2R71A 5HM4B 1MXXA 1IXIA 4NF4B 5AA2A 1A54A 4KI0E 2H25A 3EHUA 3MPKA 2F36A 1TXFA 2OJTA 3MJNA 4GXSB 3PUXE 3GLBA 3P7IA 4JWOA 2Z8DA 3MP1A 1M5CA 3A3UA 1A99A 3OEMA 1B51A 4O3CA 2Y7PA 2Y7WA 1Y20A 3IK6B 3O9PA 1MPBA 3A09A 4H67A 1Y1ZA 1QKBA 4LA9A 1D4NA 1DPEA 3Q27A 3VVEA 5FTIA 3TODA 1H3DA 1MQIA 4PE5B 5CMMA 1VFEA 3OEKA 2E1SA 2Z8EA 1HSEA 2Z23A 1B0LA 2QJEA 2I48A 1IITA 5I56B 1BIYA 4NWDA 3PGFA 1TFDA 1MG1A 1VR5A 2XXRA 1O7TA 3K1MA 1B4HA 1N76A 4C1UA 4PFUA 2O1LA 3IOTA 3QK6A 2OWSA 2DXRA 4I1DA 4THIA 3VLWA 2F5XA 1IQ7A 3OO8A 5I57B 3S2VA 3MVZA 1URGA 1MPDA 1JEVA 3IJXB 4DCYA 2I3WA 3WAEA 4H8JA 1B6HA 3U92A 1N04A 3N26A 4ELOA 5I58A 3CFXA 2DE2A 3U72A 1P1WA 1JETA 4ZEDA 3THIA 4GQOA 1QW0A 2O69A 1UTHB 3PD9A 4IB2A 2Q89A 5DEXA 4FAJA 1B3HA 1MH3A 3SKPA 5I2KA 4R75A 1VSOA 4X1DA 1JEUA 4JBZA 1FCKA 1VE4A 4OFOA 5FTHA 3R7XA 1WVJA 1N84A 3KSJA 3U94A 4R6KA 1I6BA 1O64A 3LR1A 1EZ9A 3TCGA 2OWTA 2Q88A 1B4ZA 4BDQA 1Q35A 4DE8A 2H4IA 4KCDA 4KYDA 4G8HA 2AYSA 3KN8A 1R1NA 2DVZA 3KGCA 3ODBA 5JEIA 1DTGA 3H4ZA 1Y3QA 1ZJLA 4GL8A 3RLFE 1S7YA 1SVXB 1SI0A 4IO6A 1AMFA 3PPPA 3PMWA 3UIFA 1UTBB 1S9TA 2H99A 4ZEFA 3FJMA 1B58A 2RC7A 2GFEA 3OO7A 2PBWA 4R6HA 4N07A 2DWAA 3K01A 5I56A 3QAXA 1QKAA 5H8HB 1P99A 5JTYA 3MW0A 2RC8A 2FNCA 3H7MA 1MM7A 5AA1A 1SYIA 3N5LA 2P0SA 2X26A 5FHNA 1ATGA 3T22A 3SEXA 5I2NB 3VVDA 4R2BA 3IR1A 1LFIA 5I59A 1ZLQA 2NVUB 1N3XA 5I57A 3SERA 3RGYA 3MZ1A 3O6GA 3FATA 3TQWA 3MP6A 3Q28A 2VGQA 4GVOA 2ZNSA 1OIBA 2XXUA 3FJ7A 2I4CA 4JXIA 1FW0A 3KJ7A 2HCAA 4OENA 2PMSA 4XKNA 2ONSA 2RCBA 4OEVA 1FTKA 1SBPA 4F2QA 1B5HA 1QUKA 4BDOA 5K2XA 2OLBA 2PVUA 4H5FA 4ELQA 5TP9B 2HZLA 3E3KA 1R9QA 1N3WA 3VXCA 3LC8A 3FGSA 2HQ0A 5H8QB 1EZPA 3PMVA 1Y1MA 2UXAA 2YLNA 2V3UA 3IB2A 5EHSA 3ZS6A 4GIZA 2THIA 2A5TB 2Q8JA 1PDAA 3DP8A 3IORA 5AA4A 2NOOA 4OFJA 1A8FA 2XXHA 4U23A 5DVJA 1LAHE 3MZ9A 3H6WA 3MUQA 1Y4TA 1OLAA 2ZYNA 1MQGA 3HHGA 3G3FA 2VOZA 4N13A 4LUBA 1MQDA 4KFQA 4GF8A 4AB5A 5KDTB 2Q2AA 4TOZA 5CC2A 3RN8A 4LVQA 1ZBMA 4ISUA 4NF5B 2NWJA 1TWYA 4F3SA 3FASA 3O29A 3RT8A 2F97A 4EUOA 4ONYA 3MVWA 1CE2A 3RNNA 3RT6B 4ZZAA 1BP5A 5M2VA 1LAXA 3KOSA 1MY3A 3QUJA 1PB8A 5CMBA 2I4BA 4YU0A 4GWOA 4QFLA 1MM6A 2O7UA 3BFTA 2QS2A 4POXA 3BFUA 5CMKA 1Q1KA 5DVFA 2V93A 4JDFA 4BDMA 2RC9A 4HS7A 3G3KA 4TLLB 1FQAA 2Y7IA 3LUYA 4QRZA 3IJOB 4GD5A 2DXYA 4QSDA 4R9GA 5I2NA 5KCJB 3K2DA 1JW1A 4NF8B 1LLSA 2FYIA 3TTNA 4EF1A 1LAFE 3M3KA 3TMGA 1FQEA 4RPNA 3CG1A 3U1OA 3FVOA 4BDLA 3TTRA 2Y84A 3O6IA 1URDA 2ZYKA 2XD2A 1FTOA 1MXVA 2PT2A 1DOTA 4YKPA 2UVHA 3GZGA 3MVYA 4L17A 1L5TA 4ELPA 3M8UA 2RINA 1AIVA 3L6GA 5TP9A 2I3VA 2ZMBA 3IB0A 1MY4A 5HBCA 3OO6A 4U1ZA 4ZEIA 4HW8A 4F22A 4U22A 2DSFA 4M1VA 1MXWA 3CG3A 4QHQA 1B7ZA 1LSTA 2ZYMA 3HN0A 3T9XB 4IO3A 4RPOA 3IOUA 2HZKA 3JYRA 3KBRA 4H0WA 2A5TA 4LATA 3O28A 3PPNA 1IIWA 1RYOA 3GXAA 2ABHA 3L6HA 4OFLA 2XXQA 3K1PA 1B2HA 3U93A 4MLQA 1I69A 3M3FA 4H65A 2F6GA 1MRPA 2F7BA 3HPIA 4X9TA 2OCUA 3K6UA 1M5DA 5KDTA 2D21A 3VE1B 3TCHA 5BUUA 1FTJA 1B7UA 2HFBA 3KJTA 5H8FB 3DELB 2QS1A 1LFGA 5IKBA 4NE4A 1P1QA 1XC1A 1MPCA 3MAMA 5BWJA 3K6WA 4H1XA 4KPTA 2REGA 5J1DA 1URSA 4GLIA 3PPRA 3V8XB 3VLUA 2CMOA 1OQGA 1LCTA 3I3VA 2VD3A 5H8SA 5TU0A 3CVGA 2F7CA 3TDJA 2XXWA 5CM6A 2XXVA 3OMBA 4BLAA 3FZVA 2E0SA 2O84X 3F11A 1A55A 5L9SA 3TYHA 4MF3A 1SW5A 3QUFA 1YTVA 5ITPA 1LCFA 3N94A 1Y3PA 1EZOA 1VFDA 2O1MA 2I58A 1MY1A 4LZ5A 2VHAA 3W15C 3UK4A 3UP9A 4F31B 4OWDA 4IGTA 4KD5A 2XXTA 1BLFA 3Q26A 1RYXA 3PMXA 4U21A 3T96B 2OBGA 1MY0A 3EQ1A 1II5A 5KZTA 3T93B 1H43A 5FHMA 2OK2A 2XX7A 1D9YA 2P2AA 3JZJA 4TQUQ 1NNFA 4NF6A 3B6QA 3KSXA 4ZEKA 2ANJA 1ZU0A 4G4PA 3IL1B 3RQTA 2ZNTA 2F7AA 1I6AA 1FTMA 4BDRA 3TAJA 3OOAA 4IO7A 2O6AA 2O51A 4DIGA 4Q8RA 4NF4A 3TCFA 1GTKA 4QSCA 1J1NA 3FVNA 5HPQA 3BKIB 2NUVA 3ZSFA 4ND9A 3EN3A 4GRKA 4G8NA 3C35A 4XKPA 1B9JA 3PUWE 3UORA 1DSNA 3PPOA 1I6QA 2GHAA 3MZBA 4KHZE 1NNPA 1JW4A 3OXNA 3RY3A 4LQ5A 3EHTA 5CBSA 2DS9A 3IO4A 1ZMGA 2G93A 1B05A 2V25A 4FEDA 1WDNA 3LSLA 1FQCA 1POTA 4G68B 4LZ7A 3C32A 4EXKA 3S9NC 4QFNA 4ZE9A 4YICA 2Y7RA 4IY6A 4KCCA 1BTJA 2QS3A 1B1HA 3DP4A 3K00A 2XHDA 4XXUA 4C1TA 3K6XA 3TTKA 3DP6A 1B40A 4F3PA 1A8EA 3DLNA 1SYHA 3OENA 3MBPA 3CFZA 4R72A 1PB9A 1SI1A 3RUMA 4PQJA 1PBQA 2HAVA 4FORA 3IO6A 4FEBA 1B32A 4YMBA 3QIMA 4FE8A 1MXZA 2UYEA 3CR9A 4IGRA 3CRBA 4Z7EA 1H76A 3TEPA 3ILUB 5DVIA 3VXBA 3G3GA 4N6PA 1JNFA 2DQVA 1JVXA 1MDP1 3IX1A 4KR5A 3LBSA 4U2RA 4WKMA 1UTHA 5EHMA 2V3QA 4G8MA 1R6ZA 2XXPA 1IXCA 2DWIA 1PBPA 2QMWA 2QS4A 2REJA 5CRYA 4G77A 2QRYA 4QSEA 2HEUA 1GR2A 3TTMA 4Q0CA 3QYTA 4HCWA 4F2OA 2UVGA 5B7DA 2GH9A 5FHOA 2H5YA 1SW1A 1YCJA 4ZECA 3PUVE 1GVCA 3CIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R74 A;  4OTE A;  3PV0 E;  4KYE A;  1R9L A;  2D5W A;  2H9B A;  2PYY A;  1F9B A;  5I84 A;  3LSW A;  4H5G A;  3GBB A;  3USD A;  3TZA A;  3AXF A;  1SDX A;  1Z7M E;  1XT8 A;  1S50 A;  4R6Y A;  1B52 A;  4YB5 A;  4O3B A;  4JB7 A;  1Y9U A;  2O68 A;  5AA2 B;  3O97 A;  4QFP A;  1UTB A;  2XXY A;  4U1O A;  3H3G A;  4DLD A;  2RKM A;  1ZIU A;  2Z8F A;  1GGG A;  4DXC A;  2UYF A;  4XKR A;  4GXA A;  3G3J A;  4P0G A;  3H6U A;  1USY E;  3KEI A;  3ZKK A;  4R9F A;  5H8H A;  4E0W A;  1WOD A;  4DXB A;  5TPA B;  1QJM A;  4EQB A;  1UQW A;  4OEU A;  1H44 A;  1M5F A;  2LAO A;  1UIV A;  4H8I A;  3KFM A;  1N0T A;  3OD7 A;  3C36 A;  4GFR A;  3KOT A;  4PET A;  5EYF A;  4HCY A;  3RTF B;  4ZZE A;  3K02 A;  3MVX A;  1M5E A;  2PX1 A;  2V84 A;  1POY 1;  3Q29 A;  4OQO A;  4EQ9 A;  4POW A;  1NH7 A;  3DM0 A;  5DTB A;  4OMB A;  4QFK A;  4XIG Q;  3VVF A;  3SDF A;  2DYX A;  4F3B A;  3V5A A;  1NFT A;  4F1V A;  3HO7 A;  1AH5 A;  3MQ9 A;  4F1U A;  4JWX A;  3HV1 A;  4WXJ A;  2H98 A;  2HAU A;  5H8Q A;  5I58 B;  4R2F A;  3W9V A;  3N6U A;  2QSX A;  2R9J A;  2XX9 A;  1JW5 A;  4P11 A;  4IY5 A;  4IO4 A;  3KG2 A;  1SQY A;  1ANF A;  3UGW A;  4EQ7 A;  3FIR A;  2ONK E;  4I8C A;  2X7Q A;  2F35 A;  3E4R A;  4OYV A;  2GRV A;  3VFJ A;  5I2K B;  1MY2 A;  2DWJ A;  4OES A;  3S9E A;  1DPP A;  3OSR A;  3BBR A;  3S4U A;  1MXU A;  5LOM A;  4YZZ A;  5DYH A;  3TEL A;  3C4M A;  3KN7 A;  2PT1 A;  3SEV A;  3VLV A;  4NF5 A;  1FTL A;  1XVY A;  1B1X A;  1B0H A;  1PB7 A;  1P1U A;  4OET A;  2IA4 A;  5AA3 A;  3SEU A;  1B3F A;  3TPA A;  3TUS A;  2ALU A;  1XHY A;  3C33 A;  4PFW A;  4UAC A;  3O6H A;  3M3L A;  1LB9 A;  1T0K A;  4OVJ A;  2YJP A;  4LP2 B;  1IEJ A;  2D3I A;  4DZ1 A;  3PU5 A;  4FEC A;  2M8C A;  2ZXT A;  5TPA A;  4O3A A;  3O2A A;  5ICT A;  1OVT A;  4YKI A;  1TT1 A;  2CZL A;  5F1Q A;  4F29 A;  4KQP A;  4ESX A;  3IAZ A;  2O7I A;  1ZKB A;  4F3G A;  1LFH A;  3FJG A;  5KCJ A;  3H03 A;  1HSL A;  4NF8 A;  4NTL A;  4RNS A;  1MS7 A;  3FXU A;  1USY H;  4DXU A;  4AB6 A;  1M5B A;  5JTY B;  2IEE A;  1DMB A;  1NL5 A;  2UVI A;  4M4G A;  5K2Y A;  3FVK A;  1O63 A;  1JVY A;  4KYS A;  2B3B A;  5I59 B;  3FD3 A;  3S9M C;  1NMU A;  4RXL A;  4JWY A;  3SEW A;  5ITO A;  3G3I A;  4MH5 A;  4XTC Q;  2ESN A;  1PC3 A;  4GOT A;  5L9O A;  1MDQ A;  2BJJ X;  3H06 B;  2G29 A;  2X7P A;  3EPE A;  4G2Z A;  3T66 A;  1OQH A;  1RKM A;  3B7D A;  1ZTY A;  4FAT A;  3PUZ E;  4K3F A;  1OMP A;  5AE4 A;  3Q25 A;  5F7V A;  3H6T A;  2ONR A;  1SW4 A;  3FVG A;  4G68 C;  1Y4C A;  4DDD A;  3SET A;  4ZS9 A;  3OO9 A;  3UN6 A;  1N7W A;  2I6E A;  1NKX A;  4QFO A;  5ISU A;  3I5O A;  3C34 A;  4ESW A;  5H8N B;  3K6V A;  5DT6 A;  3ECR A;  3I6V A;  3LSX A;  5A5X B;  1IXG A;  4FJP A;  1QUI A;  1YAE A;  3T9V A;  3PD8 A;  3HCQ A;  5AA4 B;  3C31 A;  4ZEB A;  4RY1 A;  5H8F A;  4ECF A;  3RTW B;  4NMY A;  1B7H A;  3WAF A;  3ILT B;  1B5J A;  4OHN A;  1LB8 A;  4XKQ A;  1ELJ A;  3FV2 A;  3EHS A;  3PPQ A;  2DOJ A;  3G3H A;  4WED A;  3N6T A;  2Y7K A;  2F34 A;  4JSO A;  4TLM B;  3CFL A;  2DE4 A;  4U4S A;  4UA8 A;  4ZDM A;  4EXL A;  4YKJ A;  4F18 A;  4IO5 A;  4Q5T A;  4PP0 A;  3JV9 A;  3GBA A;  2YPN A;  2WKY A;  1LGB C;  4MLV A;  1B5I A;  4MBP A;  2XX8 A;  4NED A;  2B65 A;  3FXQ A;  4IO2 A;  3B6T A;  5AA2 D;  3C9H A;  3V83 A;  3SEY A;  3CSG A;  4H6D A;  1MXY A;  2VP1 A;  3D4C A;  1FQD A;  2V3T A;  3FUZ A;  4YKK A;  3QSL A;  2I0C A;  1SW2 A;  4YMA A;  4NWC A;  3QXM A;  3V89 B;  4I9D A;  4PFT A;  3SES A;  1IUD A;  2XD3 A;  3ONM A;  4X48 A;  1HSJ A;  2QL3 A;  2F78 A;  4F1Y A;  1AOV A;  1IXH A;  2RF1 A;  1LBB A;  1FQB A;  3FV1 A;  4F19 A;  4BDN A;  5IAI A;  1LBC A;  3TTL A;  1XVX A;  2UVJ A;  3U8Q A;  4LQ2 A;  1YPN A;  2I0B A;  1QUJ A;  2FA7 A;  1NH8 A;  1A7L A;  2XXI A;  1JQF A;  3OSQ A;  2AL5 A;  4OZ9 A;  2AL4 A;  4Q30 B;  4E0X A;  4P0I A;  4I62 A;  5CI5 A;  1GV8 A;  2ZYO A;  1N7X A;  3KN3 A;  4U4X A;  2AIX A;  2DVC A;  1IZ1 A;  3MP8 A;  4EDP A;  4GL0 A;  1XOC A;  3EF7 A;  5H8N A;  4ELR A;  3CSB A;  2DP8 A;  5A5X A;  1MQJ A;  2R6G E;  1CB6 A;  3E9X A;  1D9V A;  5JK4 A;  2F6P A;  3TFL A;  2VD2 A;  3T9H B;  5CBR A;  2ZNU A;  3O66 A;  1QVS A;  2A5S A;  2OZZ A;  3CI8 A;  3VDF A;  4G68 A;  3IB1 A;  3K0V A;  3FXR A;  3UA8 A;  1A40 A;  3G7W A;  1FQF A;  3S9L C;  3H6V A;  1TFA A;  3T9U A;  4RYA A;  4C0R A;  4FIM A;  1P1N A;  2Z22 A;  1XS5 A;  4MFI A;  3MPL A;  1D3K A;  3MC2 A;  5ICQ A;  2B3F A;  2P1S A;  4YB7 A;  3K1N A;  4YAH X;  1Y3N A;  1LAG E;  5ELV A;  1PEB A;  4DCX A;  5L9M A;  2KLF A;  1P1O A;  1OLC A;  3MWB A;  1QUL A;  3PUY E;  4AQ4 A;  3B6W A;  2RCA A;  4QF9 A;  4LZ8 A;  2DWH A;  2QPQ A;  4RK9 A;  3TQL A;  3VV5 A;  2DE3 A;  2XXX A;  2GHB A;  4Z0I A;  1B3L A;  4RJZ A;  5L8D A;  3IOV A;  2Q2C A;  2Q9T A;  1KWH A;  1OVB A;  1US5 A;  3LSF B;  1B46 A;  1AL3 A;  1DTZ A;  3OEL A;  1SD3 A;  3W9W A;  1H45 A;  1US4 A;  2QMX A;  4RK2 A;  3R26 A;  3A3C A;  2F8D A;  3E13 X;  3IOW A;  4JSD A;  3TKD A;  5CMC A;  1Z7N E;  1BKA A;  1EU8 A;  1UIU A;  3HHF A;  4LON B;  3R6U A;  2NXO A;  1EH3 A;  4R73 A;  2I49 A;  4PFY A;  4HTG A;  4RA1 A;  1NNT A;  4F39 A;  4YB6 A;  1NNK A;  1MQH A;  4OER A;  2HXW A;  1B3G A;  5DEX B;  4WEP A;  3HST A;  2W7Y A;  3RPW A;  5B70 A;  3ZKL A;  4X1B A;  4NF6 B;  3KZG A;  4ZE8 A;  3K4U A;  1MH4 A;  4OXV A;  4EF2 A;  3D4G A;  1B3E A;  2R71 A;  5HM4 B;  1MXX A;  1IXI A;  4NF4 B;  5AA2 A;  1A54 A;  4KI0 E;  2H25 A;  3EHU A;  3MPK A;  2F36 A;  1TXF A;  2OJT A;  3MJN A;  4GXS B;  3PUX E;  3GLB A;  3P7I A;  4JWO A;  2Z8D A;  3MP1 A;  1M5C A;  3A3U A;  1A99 A;  3OEM A;  1B51 A;  4O3C A;  2Y7P A;  2Y7W A;  1Y20 A;  3IK6 B;  3O9P A;  1MPB A;  3A09 A;  4H67 A;  1Y1Z A;  1QKB A;  4LA9 A;  1D4N A;  1DPE A;  3Q27 A;  3VVE A;  5FTI A;  3TOD A;  1H3D A;  1MQI A;  4PE5 B;  5CMM A;  1VFE A;  3OEK A;  2E1S A;  2Z8E A;  1HSE A;  2Z23 A;  1B0L A;  2QJE A;  2I48 A;  1IIT A;  5I56 B;  1BIY A;  4NWD A;  3PGF A;  1TFD A;  1MG1 A;  1VR5 A;  2XXR A;  1O7T A;  3K1M A;  1B4H A;  1N76 A;  4C1U A;  4PFU A;  2O1L A;  3IOT A;  3QK6 A;  2OWS A;  2DXR A;  4I1D A;  4THI A;  3VLW A;  2F5X A;  1IQ7 A;  3OO8 A;  5I57 B;  3S2V A;  3MVZ A;  1URG A;  1MPD A;  1JEV A;  3IJX B;  4DCY A;  2I3W A;  3WAE A;  4H8J A;  1B6H A;  3U92 A;  1N04 A;  3N26 A;  4ELO A;  5I58 A;  3CFX A;  2DE2 A;  3U72 A;  1P1W A;  1JET A;  4ZED A;  3THI A;  4GQO A;  1QW0 A;  2O69 A;  1UTH B;  3PD9 A;  4IB2 A;  2Q89 A;  5DEX A;  4FAJ A;  1B3H A;  1MH3 A;  3SKP A;  5I2K A;  4R75 A;  1VSO A;  4X1D A;  1JEU A;  4JBZ A;  1FCK A;  1VE4 A;  4OFO A;  5FTH A;  3R7X A;  1WVJ A;  1N84 A;  3KSJ A;  3U94 A;  4R6K A;  1I6B A;  1O64 A;  3LR1 A;  1EZ9 A;  3TCG A;  2OWT A;  2Q88 A;  1B4Z A;  4BDQ A;  1Q35 A;  4DE8 A;  2H4I A;  4KCD A;  4KYD A;  4G8H A;  2AYS A;  3KN8 A;  1R1N A;  2DVZ A;  3KGC A;  3ODB A;  5JEI A;  1DTG A;  3H4Z A;  1Y3Q A;  1ZJL A;  4GL8 A;  3RLF E;  1S7Y A;  1SVX B;  1SI0 A;  4IO6 A;  1AMF A;  3PPP A;  3PMW A;  3UIF A;  1UTB B;  1S9T A;  2H99 A;  4ZEF A;  3FJM A;  1B58 A;  2RC7 A;  2GFE A;  3OO7 A;  2PBW A;  4R6H A;  4N07 A;  2DWA A;  3K01 A;  5I56 A;  3QAX A;  1QKA A;  5H8H B;  1P99 A;  5JTY A;  3MW0 A;  2RC8 A;  2FNC A;  3H7M A;  1MM7 A;  5AA1 A;  1SYI A;  3N5L A;  2P0S A;  2X26 A;  5FHN A;  1ATG A;  3T22 A;  3SEX A;  5I2N B;  3VVD A;  4R2B A;  3IR1 A;  1LFI A;  5I59 A;  1ZLQ A;  2NVU B;  1N3X A;  5I57 A;  3SER A;  3RGY A;  3MZ1 A;  3O6G A;  3FAT A;  3TQW A;  3MP6 A;  3Q28 A;  2VGQ A;  4GVO A;  2ZNS A;  1OIB A;  2XXU A;  3FJ7 A;  2I4C A;  4JXI A;  1FW0 A;  3KJ7 A;  2HCA A;  4OEN A;  2PMS A;  4XKN A;  2ONS A;  2RCB A;  4OEV A;  1FTK A;  1SBP A;  4F2Q A;  1B5H A;  1QUK A;  4BDO A;  5K2X A;  2OLB A;  2PVU A;  4H5F A;  4ELQ A;  5TP9 B;  2HZL A;  3E3K A;  1R9Q A;  1N3W A;  3VXC A;  3LC8 A;  3FGS A;  2HQ0 A;  5H8Q B;  1EZP A;  3PMV A;  1Y1M A;  2UXA A;  2YLN A;  2V3U A;  3IB2 A;  5EHS A;  3ZS6 A;  4GIZ A;  2THI A;  2A5T B;  2Q8J A;  1PDA A;  3DP8 A;  3IOR A;  5AA4 A;  2NOO A;  4OFJ A;  1A8F A;  2XXH A;  4U23 A;  5DVJ A;  1LAH E;  3MZ9 A;  3H6W A;  3MUQ A;  1Y4T A;  1OLA A;  2ZYN A;  1MQG A;  3HHG A;  3G3F A;  2VOZ A;  4N13 A;  4LUB A;  1MQD A;  4KFQ A;  4GF8 A;  4AB5 A;  5KDT B;  2Q2A A;  4TOZ A;  5CC2 A;  3RN8 A;  4LVQ A;  1ZBM A;  4ISU A;  4NF5 B;  2NWJ A;  1TWY A;  4F3S A;  3FAS A;  3O29 A;  3RT8 A;  2F97 A;  4EUO A;  4ONY A;  3MVW A;  1CE2 A;  3RNN A;  3RT6 B;  4ZZA A;  1BP5 A;  5M2V A;  1LAX A;  3KOS A;  1MY3 A;  3QUJ A;  1PB8 A;  5CMB A;  2I4B A;  4YU0 A;  4GWO A;  4QFL A;  1MM6 A;  2O7U A;  3BFT A;  2QS2 A;  4POX A;  3BFU A;  5CMK A;  1Q1K A;  5DVF A;  2V93 A;  4JDF A;  4BDM A;  2RC9 A;  4HS7 A;  3G3K A;  4TLL B;  1FQA A;  2Y7I A;  3LUY A;  4QRZ A;  3IJO B;  4GD5 A;  2DXY A;  4QSD A;  4R9G A;  5I2N A;  5KCJ B;  3K2D A;  1JW1 A;  4NF8 B;  1LLS A;  2FYI A;  3TTN A;  4EF1 A;  1LAF E;  3M3K A;  3TMG A;  1FQE A;  4RPN A;  3CG1 A;  3U1O A;  3FVO A;  4BDL A;  3TTR A;  2Y84 A;  3O6I A;  1URD A;  2ZYK A;  2XD2 A;  1FTO A;  1MXV A;  2PT2 A;  1DOT A;  4YKP A;  2UVH A;  3GZG A;  3MVY A;  4L17 A;  1L5T A;  4ELP A;  3M8U A;  2RIN A;  1AIV A;  3L6G A;  5TP9 A;  2I3V A;  2ZMB A;  3IB0 A;  1MY4 A;  5HBC A;  3OO6 A;  4U1Z A;  4ZEI A;  4HW8 A;  4F22 A;  4U22 A;  2DSF A;  4M1V A;  1MXW A;  3CG3 A;  4QHQ A;  1B7Z A;  1LST A;  2ZYM A;  3HN0 A;  3T9X B;  4IO3 A;  4RPO A;  3IOU A;  2HZK A;  3JYR A;  3KBR A;  4H0W A;  2A5T A;  4LAT A;  3O28 A;  3PPN A;  1IIW A;  1RYO A;  3GXA A;  2ABH A;  3L6H A;  4OFL A;  2XXQ A;  3K1P A;  1B2H A;  3U93 A;  4MLQ A;  1I69 A;  3M3F A;  4H65 A;  2F6G A;  1MRP A;  2F7B A;  3HPI A;  4X9T A;  2OCU A;  3K6U A;  1M5D A;  5KDT A;  2D21 A;  3VE1 B;  3TCH A;  5BUU A;  1FTJ A;  1B7U A;  2HFB A;  3KJT A;  5H8F B;  3DEL B;  2QS1 A;  1LFG A;  5IKB A;  4NE4 A;  1P1Q A;  1XC1 A;  1MPC A;  3MAM A;  5BWJ A;  3K6W A;  4H1X A;  4KPT A;  2REG A;  5J1D A;  1URS A;  4GLI A;  3PPR A;  3V8X B;  3VLU A;  2CMO A;  1OQG A;  1LCT A;  3I3V A;  2VD3 A;  5H8S A;  5TU0 A;  3CVG A;  2F7C A;  3TDJ A;  2XXW A;  5CM6 A;  2XXV A;  3OMB A;  4BLA A;  3FZV A;  2E0S A;  2O84 X;  3F11 A;  1A55 A;  5L9S A;  3TYH A;  4MF3 A;  1SW5 A;  3QUF A;  1YTV A;  5ITP A;  1LCF A;  3N94 A;  1Y3P A;  1EZO A;  1VFD A;  2O1M A;  2I58 A;  1MY1 A;  4LZ5 A;  2VHA A;  3W15 C;  3UK4 A;  3UP9 A;  4F31 B;  4OWD A;  4IGT A;  4KD5 A;  2XXT A;  1BLF A;  3Q26 A;  1RYX A;  3PMX A;  4U21 A;  3T96 B;  2OBG A;  1MY0 A;  3EQ1 A;  1II5 A;  5KZT A;  3T93 B;  1H43 A;  5FHM A;  2OK2 A;  2XX7 A;  1D9Y A;  2P2A A;  3JZJ A;  4TQU Q;  1NNF A;  4NF6 A;  3B6Q A;  3KSX A;  4ZEK A;  2ANJ A;  1ZU0 A;  4G4P A;  3IL1 B;  3RQT A;  2ZNT A;  2F7A A;  1I6A A;  1FTM A;  4BDR A;  3TAJ A;  3OOA A;  4IO7 A;  2O6A A;  2O51 A;  4DIG A;  4Q8R A;  4NF4 A;  3TCF A;  1GTK A;  4QSC A;  1J1N A;  3FVN A;  5HPQ A;  3BKI B;  2NUV A;  3ZSF A;  4ND9 A;  3EN3 A;  4GRK A;  4G8N A;  3C35 A;  4XKP A;  1B9J A;  3PUW E;  3UOR A;  1DSN A;  3PPO A;  1I6Q A;  2GHA A;  3MZB A;  4KHZ E;  1NNP A;  1JW4 A;  3OXN A;  3RY3 A;  4LQ5 A;  3EHT A;  5CBS A;  2DS9 A;  3IO4 A;  1ZMG A;  2G93 A;  1B05 A;  2V25 A;  4FED A;  1WDN A;  3LSL A;  1FQC A;  1POT A;  4G68 B;  4LZ7 A;  3C32 A;  4EXK A;  3S9N C;  4QFN A;  4ZE9 A;  4YIC A;  2Y7R A;  4IY6 A;  4KCC A;  1BTJ A;  2QS3 A;  1B1H A;  3DP4 A;  3K00 A;  2XHD A;  4XXU A;  4C1T A;  3K6X A;  3TTK A;  3DP6 A;  1B40 A;  4F3P A;  1A8E A;  3DLN A;  1SYH A;  3OEN A;  3MBP A;  3CFZ A;  4R72 A;  1PB9 A;  1SI1 A;  3RUM A;  4PQJ A;  1PBQ A;  2HAV A;  4FOR A;  3IO6 A;  4FEB A;  1B32 A;  4YMB A;  3QIM A;  4FE8 A;  1MXZ A;  2UYE A;  3CR9 A;  4IGR A;  3CRB A;  4Z7E A;  1H76 A;  3TEP A;  3ILU B;  5DVI A;  3VXB A;  3G3G A;  4N6P A;  1JNF A;  2DQV A;  1JVX A;  1MDP 1;  3IX1 A;  4KR5 A;  3LBS A;  4U2R A;  4WKM A;  1UTH A;  5EHM A;  2V3Q A;  4G8M A;  1R6Z A;  2XXP A;  1IXC A;  2DWI A;  1PBP A;  2QMW A;  2QS4 A;  2REJ A;  5CRY A;  4G77 A;  2QRY A;  4QSE A;  2HEU A;  1GR2 A;  3TTM A;  4Q0C A;  3QYT A;  4HCW A;  4F2O A;  2UVG A;  5B7D A;  2GH9 A;  5FHO A;  2H5Y A;  1SW1 A;  1YCJ A;  4ZEC A;  3PUV E;  1GVC A;  3CIJ A; 
#chains in the Genus database with same CATH topology
 4R74 A;  1VDW A;  2FVZ A;  4XFE A;  4OTE A;  3PV0 E;  4KYE A;  1R9L A;  4N8G A;  2D5W A;  2H9B A;  2PYY A;  1F9B A;  5I84 A;  3LSW A;  4H5G A;  3GBB A;  3USD A;  3TZA A;  1NV6 A;  3AXF A;  1SDX A;  1Z7M E;  4GWY A;  1XT8 A;  1S50 A;  4R6Y A;  1B52 A;  4YB5 A;  4O3B A;  4JB7 A;  1Y9U A;  2O68 A;  5AA2 B;  3O97 A;  4QFP A;  1UTB A;  2XXY A;  2P3V A;  4U1O A;  5A5L A;  3H3G A;  4DLD A;  2RKM A;  1ZIU A;  2Z8F A;  1GGG A;  4DXC A;  2UYF A;  4XKR A;  4GXA A;  3G3J A;  4OA4 A;  4P0G A;  3H6U A;  1USY E;  3KEI A;  3ZKK A;  4R9F A;  5H8H A;  4E0W A;  1WOD A;  4DXB A;  4HE1 A;  2MKZ A;  5TPA B;  1QJM A;  1IMD A;  5IZ3 B;  4EQB A;  1UQW A;  2HHM A;  4N81 A;  4OEU A;  1H44 A;  1M5F A;  1NUZ A;  2LAO A;  1QGX A;  1UIV A;  4H8I A;  3KFM A;  4KXP A;  1N0T A;  3OD7 A;  2FHY A;  3C36 A;  4GFR A;  1AWB A;  3KOT A;  4PET A;  5EQ9 A;  5EYF A;  4OVQ A;  4HCY A;  3RTF B;  2KR0 A;  1NV1 A;  4ZZE A;  3K02 A;  3MVX A;  1M5E A;  2PX1 A;  2V84 A;  1POY 1;  3Q29 A;  4OQO A;  1FBE A;  1KZ8 A;  4EQ9 A;  4POW A;  4N6D A;  1NH7 A;  3DM0 A;  5DTB A;  4OMB A;  4QFK A;  4PF8 A;  4XIG Q;  2CZH A;  3VVF A;  3SDF A;  2DYX A;  4F3B A;  3V5A A;  2KQZ A;  1NFT A;  4F1V A;  3HO7 A;  1AH5 A;  3MQ9 A;  5IM2 A;  4F1U A;  4JWX A;  1RDY A;  3HV1 A;  4WXJ A;  2H98 A;  1NUX A;  5I3S A;  2HAU A;  5H8Q A;  5I58 B;  4R2F A;  3W9V A;  3N6U A;  2QSX A;  2R9J A;  2XX9 A;  1JW5 A;  4P11 A;  4IY5 A;  4IO4 A;  3KG2 A;  1SQY A;  1ANF A;  3UGW A;  4EQ7 A;  3FIR A;  2ONK E;  4I8C A;  2X7Q A;  2F35 A;  3E4R A;  4OYV A;  2GRV A;  3VFJ A;  5I2K B;  1MY2 A;  2DWJ A;  4OES A;  4NN3 A;  3S9E A;  1DPP A;  3OSR A;  3BBR A;  3S4U A;  1MXU A;  5LOM A;  4YZZ A;  5DYH A;  4N15 A;  3TEL A;  3C4M A;  3KN7 A;  1FBG A;  3IFA A;  4NX1 A;  2PT1 A;  3SEV A;  3VLV A;  1CNQ A;  4NF5 A;  2P3N A;  1FTL A;  1XVY A;  1B1X A;  1B0H A;  1PB7 A;  1P1U A;  4OET A;  2IA4 A;  5AA3 A;  4PTK A;  4PDD A;  3SEU A;  1B3F A;  3TPA A;  4GWU A;  3TUS A;  2ALU A;  1XHY A;  3C33 A;  4PFW A;  4UAC A;  3O6H A;  3M3L A;  1LB9 A;  1T0K A;  4OVJ A;  4PFI A;  2YJP A;  4MMP A;  4LP2 B;  1IEJ A;  4HXV A;  2D3I A;  4DZ1 A;  3PU5 A;  4FEC A;  2M8C A;  2ZXT A;  5TPA A;  4O3A A;  3O2A A;  1FSA A;  5ICT A;  1BK4 A;  1OVT A;  4YKI A;  1TT1 A;  2CZL A;  5F1Q A;  4F29 A;  4KQP A;  4ESX A;  3IAZ A;  2O7I A;  1ZKB A;  4F3G A;  1LFH A;  3FJG A;  5KCJ A;  3H03 A;  1HSL A;  4NF8 A;  1FPD A;  4NTL A;  4RNS A;  1LBY A;  1MS7 A;  3FXU A;  1USY H;  4DXU A;  4AB6 A;  3GYY A;  1M5B A;  5JTY B;  2IEE A;  1DMB A;  4QBA A;  1NL5 A;  2UVI A;  4NHB A;  4PDH A;  4M4G A;  5K2Y A;  3FVK A;  1O63 A;  3BIG A;  1JVY A;  1NUW A;  4KYS A;  2B3B A;  5I59 B;  3FD3 A;  3S9M C;  4G61 A;  1NMU A;  4RXL A;  4JWY A;  3SEW A;  5ITO A;  1RDZ A;  3G3I A;  4MH5 A;  5IZZ A;  4XTC Q;  2ESN A;  2OWZ A;  4NGU A;  1PC3 A;  4GOT A;  5L9O A;  1MDQ A;  2BJJ X;  2L5V A;  3H06 B;  2G29 A;  2X7P A;  3EPE A;  2HPG A;  4G2Z A;  3T66 A;  1OQH A;  1RKM A;  3B7D A;  1ZTY A;  4FAT A;  3PUZ E;  4K3F A;  1OMP A;  5AE4 A;  3Q25 A;  5F7V A;  3H6T A;  2ONR A;  2WBD A;  1SW4 A;  3FVG A;  4G68 C;  1Y4C A;  4DDD A;  3SET A;  4ZS9 A;  3OO9 A;  3T1B A;  3UN6 A;  4NQ8 A;  1N7W A;  2I6E A;  2CEX A;  2VT5 A;  4PE3 A;  1NKX A;  4QFO A;  5ISU A;  3I5O A;  3C34 A;  4ESW A;  1LBW A;  5H8N B;  3K6V A;  5DT6 A;  3ECR A;  3I6V A;  3LSX A;  5A5X B;  2WBB A;  3QMF A;  1IXG A;  4NF0 A;  4FJP A;  1QUI A;  4N6K A;  1YAE A;  3T9V A;  3PD8 A;  3HCQ A;  5AA4 B;  2CEY A;  3C31 A;  4ZEB A;  4RY1 A;  5H8F A;  4ECF A;  1NV2 A;  3RTW B;  4MJO A;  4NMY A;  1B7H A;  5J16 A;  3WAF A;  3ILT B;  1B5J A;  4OHN A;  1LB8 A;  4XKQ A;  1ELJ A;  3FV2 A;  4NAP A;  3EHS A;  3PPQ A;  2DOJ A;  3G3H A;  4WED A;  3N6T A;  2Y7K A;  4I3Y A;  2F34 A;  4JSO A;  4TLM B;  3CFL A;  1IMB A;  1FPI A;  2DE4 A;  4U4S A;  4UA8 A;  4ZDM A;  4EXL A;  4YKJ A;  4F18 A;  2OX3 A;  4PF6 A;  4IO5 A;  4Q5T A;  4PP0 A;  3JV9 A;  3GBA A;  1FPG A;  2YPN A;  2WKY A;  4P3L A;  1LGB C;  4MLV A;  1IMC A;  1B5I A;  3FXB A;  4MBP A;  2XX8 A;  4NED A;  2B65 A;  3FXQ A;  4IO2 A;  3B6T A;  5AA2 D;  3C9H A;  3V83 A;  3SEY A;  3CSG A;  4H6D A;  1MXY A;  2VP1 A;  3D4C A;  1FQD A;  2V3T A;  3FUZ A;  4I3E A;  4YKK A;  3QSL A;  2I0C A;  1SW2 A;  1G0I A;  4YMA A;  4NWC A;  4PBH A;  3QXM A;  3V89 B;  4I9D A;  4PFT A;  3SES A;  1IUD A;  2XD3 A;  3ONM A;  4X48 A;  1HSJ A;  2QL3 A;  2F78 A;  5LDZ A;  4DI4 B;  4F1Y A;  1AOV A;  1IXH A;  2RF1 A;  1LBB A;  1FQB A;  3FV1 A;  4F19 A;  5FBP A;  3U65 A;  4BDN A;  1NV4 A;  5IAI A;  1LBC A;  3TTL A;  1XVX A;  2UVJ A;  3SZP A;  3U8Q A;  4LQ2 A;  1YPN A;  2I0B A;  1QUJ A;  2FA7 A;  1NH8 A;  1A7L A;  2XXI A;  1JQF A;  2V4C A;  3OSQ A;  2AL5 A;  4OZ9 A;  2AL4 A;  4Q30 B;  4E0X A;  4P0I A;  4I62 A;  5CI5 A;  1GV8 A;  2ZYO A;  1N7X A;  3KN3 A;  4U4X A;  2AIX A;  2DVC A;  1IZ1 A;  3MP8 A;  4EDP A;  3B8B A;  4GL0 A;  1XOC A;  3EF7 A;  5H8N A;  4ELR A;  3CSB A;  2DP8 A;  5A5X A;  1FBH A;  1MQJ A;  2R6G E;  1CB6 A;  3E9X A;  1D9V A;  5JK4 A;  2F6P A;  2FIE A;  3TFL A;  2VD2 A;  3T9H B;  5CBR A;  2ZNU A;  3O66 A;  1QVS A;  2A5S A;  2OZZ A;  1JP4 A;  3ROJ A;  3CI8 A;  3VDF A;  4N17 A;  1RDX A;  4G68 A;  3IB1 A;  3HFU A;  3K0V A;  3FXR A;  4N91 A;  3UA8 A;  1A40 A;  3G7W A;  1NV0 A;  1FQF A;  3S9L C;  3H6V A;  1TFA A;  3T9U A;  4RYA A;  5LTC A;  4C0R A;  4FIM A;  4P9K A;  1P1N A;  4P8B A;  2Z22 A;  1XS5 A;  4MFI A;  2R8T A;  3MPL A;  1D3K A;  3MC2 A;  5ICQ A;  2B3F A;  2P1S A;  4YB7 A;  3K1N A;  4YAH X;  5ET5 A;  1Y3N A;  1LAG E;  5ELV A;  1PEB A;  3ISP A;  4DI3 D;  4DCX A;  5L9M A;  2KLF A;  1P1O A;  1OLC A;  3MWB A;  1QUL A;  3PUY E;  4AQ4 A;  4PBQ A;  3B6W A;  2RCA A;  3FBP A;  4QF9 A;  3LUZ A;  4LZ8 A;  2DWH A;  2QPQ A;  4RK9 A;  3TQL A;  3VV5 A;  2DE3 A;  2XXX A;  2GHB A;  4Z0I A;  2CZK A;  1B3L A;  5EYG A;  4RJZ A;  5L8D A;  2WYK A;  3IOV A;  5I5P A;  2Q2C A;  2Q9T A;  1KWH A;  1OVB A;  1US5 A;  3LSF B;  1B46 A;  5ET6 A;  1KA0 A;  1AL3 A;  1DTZ A;  3OEL A;  4GBW A;  1SD3 A;  4X04 A;  3W9W A;  1H45 A;  1US4 A;  2QMX A;  4PAI A;  2XWK A;  4RK2 A;  1XI6 A;  3R26 A;  3A3C A;  4GBV A;  2F8D A;  3E13 X;  3IOW A;  4JSD A;  4GX4 A;  3TKD A;  5CMC A;  1Z7N E;  1BKA A;  1EU8 A;  1UIU A;  3HHF A;  4LON B;  3R6U A;  2NXO A;  1EH3 A;  4R73 A;  2I49 A;  4PFY A;  4HTG A;  4RA1 A;  4H45 A;  1NNT A;  4F39 A;  4YB6 A;  1NNK A;  1MQH A;  4OER A;  2HXW A;  1B3G A;  5DEX B;  4WEP A;  3HST A;  2W7Y A;  3E79 A;  1EYK A;  3RPW A;  5B70 A;  3ZKL A;  4X1B A;  1DBZ A;  4NF6 B;  1FPK A;  3KZG A;  4ZE8 A;  3K4U A;  1MH4 A;  1FPJ A;  1K9Z A;  4GWZ A;  4OXV A;  4EF2 A;  3D4G A;  1B3E A;  2R71 A;  5HM4 B;  1MXX A;  1IXI A;  4NF4 B;  5AA2 A;  1A54 A;  4KI0 E;  2H25 A;  3EHU A;  3MPK A;  2F36 A;  1TXF A;  2OJT A;  3MJN A;  4GXS B;  3PUX E;  3GLB A;  3P7I A;  4JWO A;  2Z8D A;  3MP1 A;  1M5C A;  3A3U A;  1A99 A;  1YYZ A;  3OEM A;  1FTA A;  1B51 A;  4O3C A;  2Y7P A;  2Y7W A;  1Y20 A;  3IK6 B;  3O9P A;  5IZ3 A;  1MPB A;  1FPF A;  3A09 A;  4H67 A;  1Y1Z A;  1QKB A;  4O94 A;  4LA9 A;  1D4N A;  1DPE A;  3Q27 A;  3VVE A;  4MNP A;  5FTI A;  2WEF A;  3TOD A;  1H3D A;  1MQI A;  4PE5 B;  5CMM A;  1VFE A;  2XWO A;  3OEK A;  2E1S A;  2Z8E A;  2Q8M A;  1HSE A;  2Z23 A;  1B0L A;  2QJE A;  2I48 A;  3RYD A;  1IIT A;  5I56 B;  1BIY A;  4NWD A;  3PGF A;  1TFD A;  1MG1 A;  1VR5 A;  1FBD A;  2XXR A;  1O7T A;  3K1M A;  4PC9 A;  4MHF A;  1B4H A;  1N76 A;  5IZ1 A;  4C1U A;  4PFU A;  2O1L A;  2Y5K A;  2QVV A;  3IOT A;  3QK6 A;  2OWS A;  2DXR A;  4I1D A;  4THI A;  3VLW A;  2F5X A;  2ZZV A;  1IQ7 A;  1FBC A;  3OO8 A;  5I57 B;  3S2V A;  3MVZ A;  1URG A;  1MPD A;  1JEV A;  3IJX B;  4DCY A;  3IFC A;  2I3W A;  3NOH A;  3WAE A;  4H8J A;  1B6H A;  3U92 A;  1N04 A;  3N26 A;  4ELO A;  5I58 A;  3CFX A;  2DE2 A;  3U72 A;  1P1W A;  1JET A;  4XEQ A;  4ZED A;  4OVS A;  3THI A;  4GQO A;  2CZI A;  1QW0 A;  2O69 A;  1UTH B;  3PD9 A;  4IB2 A;  5EQ8 A;  2DDK A;  2Q89 A;  5DEX A;  4FAJ A;  1B3H A;  1MH3 A;  3SKP A;  5I2K A;  4R75 A;  1VSO A;  4X1D A;  1JEU A;  4JBZ A;  4PAK A;  2PFY A;  1FCK A;  1VE4 A;  4OFO A;  5FTH A;  3R7X A;  2Y5L A;  1D9Q A;  1WVJ A;  1N84 A;  3KSJ A;  3U94 A;  1EYI A;  4R6K A;  1I6B A;  1O64 A;  3LR1 A;  1EZ9 A;  3TCG A;  2OWT A;  5IGA A;  2Q88 A;  1B4Z A;  4BDQ A;  1Q35 A;  1YXI A;  4DE8 A;  2H4I A;  4KCD A;  4GWX A;  4KYD A;  4G8H A;  4O8M A;  4PFR A;  5F24 A;  2AYS A;  3KN8 A;  1R1N A;  2DVZ A;  3KGC A;  3ODB A;  5JEI A;  1DTG A;  3H4Z A;  1Y3Q A;  1ZJL A;  4GL8 A;  2JJK A;  3RLF E;  1S7Y A;  1SVX B;  2XXK A;  2ZZW A;  3RPL B;  1SI0 A;  1LBZ A;  4IO6 A;  1AMF A;  3PPP A;  3PMW A;  3UIF A;  1UTB B;  2GQ1 A;  1S9T A;  2H99 A;  4ZEF A;  3FJM A;  1B58 A;  2RC7 A;  2GFE A;  3OO7 A;  3PTY A;  2PBW A;  4R6H A;  4N07 A;  2DWA A;  3K01 A;  5I56 A;  3QAX A;  1QKA A;  4MEV A;  5H8H B;  1P99 A;  5JTY A;  3MW0 A;  2RC8 A;  2FNC A;  3H7M A;  1MM7 A;  4PGN A;  5AA1 A;  1SYI A;  3N5L A;  2P0S A;  2X26 A;  5FHN A;  1ATG A;  3T22 A;  3SEX A;  5I2N B;  3VVD A;  4R2B A;  3IR1 A;  1LFI A;  5I59 A;  4HE0 A;  1ZLQ A;  2NVU B;  1N3X A;  5I57 A;  3SER A;  2PFZ A;  2F3D A;  3RGY A;  3MZ1 A;  3O6G A;  3FAT A;  3TQW A;  3MP6 A;  3Q28 A;  2VGQ A;  1FPE A;  4GVO A;  2F3B A;  1K9Y A;  2ZNS A;  1OIB A;  2XXU A;  3FJ7 A;  2I4C A;  4JXI A;  4MIJ A;  1FW0 A;  1FRP A;  3KJ7 A;  2HCA A;  4OEN A;  2XWV A;  2PMS A;  4XKN A;  2ONS A;  2RCB A;  4OEV A;  1FTK A;  1SBP A;  4F2Q A;  5T3J A;  1B5H A;  3BIH A;  1QUK A;  4BDO A;  1IME A;  5K2X A;  2OLB A;  2PVU A;  4H5F A;  4ELQ A;  5TP9 B;  4P56 A;  2HZL A;  1FPL A;  3E3K A;  1R9Q A;  1YZ0 A;  1N3W A;  3VXC A;  3LC8 A;  3FGS A;  1NV3 A;  3KC0 A;  2HQ0 A;  5H8Q B;  1EZP A;  3PMV A;  1Y1M A;  2QVR A;  2UXA A;  2YLN A;  2V3U A;  3IB2 A;  2Q74 A;  5EHS A;  3ZS6 A;  4GIZ A;  2THI A;  2A5T B;  2QVU A;  2Q8J A;  1PDA A;  3DP8 A;  3IOR A;  5AA4 A;  3CHG A;  2NOO A;  4OFJ A;  1A8F A;  2XXH A;  4U23 A;  5DVJ A;  4OVT A;  1LAH E;  3MZ9 A;  3H6W A;  3MUQ A;  1Y4T A;  5ET7 A;  4PCD A;  1OLA A;  2ZYN A;  1MQG A;  1FPB A;  3HHG A;  3G3F A;  2VOZ A;  4N13 A;  4LUB A;  3D1R A;  1MQD A;  4KFQ A;  4H46 A;  4GF8 A;  4AB5 A;  5KDT B;  2Q2A A;  4TOZ A;  5CC2 A;  3RN8 A;  4LVQ A;  1ZBM A;  2FBP A;  4ISU A;  4NF5 B;  2NWJ A;  3RPL A;  1TWY A;  1DCU A;  4F3S A;  3FAS A;  3O29 A;  4NG7 A;  3RT8 A;  5ET8 A;  2F97 A;  4EUO A;  4ONY A;  3MVW A;  1CE2 A;  3RNN A;  3RT6 B;  4ZZA A;  1BP5 A;  5M2V A;  1LAX A;  3KOS A;  1MY3 A;  3QUJ A;  1PB8 A;  5CMB A;  2I4B A;  4YU0 A;  4GWO A;  4QFL A;  1MM6 A;  2O7U A;  3BFT A;  1FBP A;  2QS2 A;  4POX A;  4IR8 A;  3BFU A;  5CMK A;  1Q1K A;  4I40 A;  5DVF A;  2V93 A;  4JDF A;  4BDM A;  2RC9 A;  4HS7 A;  4AS4 A;  3G3K A;  4O7I A;  4AS5 A;  4TLL B;  1FQA A;  1KA1 A;  2Y7I A;  3LUY A;  4QRZ A;  3IJO B;  4GD5 A;  2DXY A;  4QSD A;  4LN5 A;  4R9G A;  5I2N A;  5KCJ B;  3K2D A;  1JW1 A;  4NF8 B;  1LLS A;  2FYI A;  3TTN A;  4EF1 A;  1LAF E;  3M3K A;  3TMG A;  1FQE A;  4RPN A;  3CG1 A;  3U1O A;  3FVO A;  4BDL A;  3TTR A;  2Y84 A;  4MCO A;  4FBP A;  3O6I A;  1URD A;  4PGP A;  2ZYK A;  2XD2 A;  4JVD A;  1FTO A;  1MXV A;  2PT2 A;  4XF5 A;  1DOT A;  4GX6 A;  2ZZX A;  4MNI A;  4YKP A;  2UVH A;  3GZG A;  3MVY A;  4L17 A;  1L5T A;  4ELP A;  3M8U A;  2RIN A;  4MNC A;  1AIV A;  3L6G A;  1NV7 A;  5TP9 A;  2I3V A;  2ZMB A;  3IB0 A;  1MY4 A;  5HBC A;  3OO6 A;  4U1Z A;  4ZEI A;  4HW8 A;  4F22 A;  4U22 A;  2DSF A;  3A29 A;  4M1V A;  1MXW A;  3CG3 A;  4QHQ A;  1B7Z A;  1LST A;  4JVC A;  2ZYM A;  3HN0 A;  3T9X B;  4IO3 A;  2HXR A;  1FJ9 A;  4RPO A;  3IOU A;  2HZK A;  3JYR A;  3KBR A;  4H0W A;  2A5T A;  4LAT A;  1SPI A;  3O28 A;  4HE2 A;  3PPN A;  1IIW A;  5EQ7 A;  1RYO A;  3GXA A;  3MST A;  2VPN A;  1INP A;  2ABH A;  3L6H A;  4OFL A;  2XXQ A;  3K1P A;  3E78 A;  1B2H A;  3U93 A;  4MLQ A;  3EKI A;  1I69 A;  3M3F A;  4H65 A;  2F6G A;  1MRP A;  2F7B A;  3HPI A;  4X9T A;  2B4M A;  2OCU A;  3K6U A;  1M5D A;  5KDT A;  2D21 A;  3VE1 B;  3TCH A;  5BUU A;  1FTJ A;  1B7U A;  2WX9 A;  2HFB A;  3KJT A;  5H8F B;  3DEL B;  4P1E A;  1IMA A;  2QS1 A;  1LFG A;  5IKB A;  4NE4 A;  1DK4 A;  1P1Q A;  1XC1 A;  1MPC A;  3MAM A;  1FJ6 A;  5BWJ A;  3K6W A;  4H1X A;  4OVP A;  4KPT A;  2REG A;  5J1D A;  2QFL A;  1URS A;  4GLI A;  3PPR A;  3V8X B;  5I7I A;  1LEV A;  1NUY A;  3VLU A;  2CMO A;  1OQG A;  1LCT A;  3I3V A;  2VD3 A;  2FIX A;  5H8S A;  5TU0 A;  3CVG A;  2F7C A;  3TDJ A;  2XXW A;  5CM6 A;  2XXV A;  3OMB A;  4BLA A;  1Q9D A;  3FZV A;  2E0S A;  2O84 X;  1FBF A;  3F11 A;  1A55 A;  5L9S A;  4N4U A;  3TYH A;  4MF3 A;  1EYJ A;  4QXD A;  1SW5 A;  3QUF A;  1YTV A;  5ITP A;  4N8Y A;  1LCF A;  3N94 A;  1Y3P A;  1EZO A;  3MYU A;  4PAF A;  1VFD A;  2O1M A;  2I58 A;  1MY1 A;  4LZ5 A;  1IMF A;  2VHA A;  3W15 C;  3UK4 A;  3UP9 A;  4F31 B;  4OWD A;  4GX3 A;  4IGT A;  4KD5 A;  1LBV A;  2XXT A;  1BLF A;  3Q26 A;  1RYX A;  3PMX A;  4U21 A;  3T96 B;  3LV0 A;  2OBG A;  1MY0 A;  3EQ1 A;  1II5 A;  5KZT A;  3T93 B;  1H43 A;  2BJI A;  5FHM A;  2OK2 A;  2XX7 A;  3KBZ A;  1D9Y A;  2P2A A;  3JZJ A;  4TQU Q;  1NNF A;  4NF6 A;  3B6Q A;  4OVR A;  3KSX A;  4OAN A;  2PCR A;  4ZEK A;  2ANJ A;  1ZU0 A;  4G4P A;  3IL1 B;  4PFB A;  2ZNT A;  3RQT A;  2F7A A;  1I6A A;  1FTM A;  4BDR A;  3TAJ A;  3OOA A;  4MAG A;  4IO7 A;  2O6A A;  2O51 A;  1NV5 A;  4DIG A;  5EYH A;  3B50 A;  4Q8R A;  4NF4 A;  3TCF A;  1GTK A;  4QSC A;  1J1N A;  3FVN A;  5HPQ A;  3BKI B;  2NUV A;  3ZSF A;  4ND9 A;  4UAB A;  3EN3 A;  4GRK A;  4G8N A;  3C35 A;  4XKP A;  4O7M A;  1B9J A;  3PUW E;  3UOR A;  1DSN A;  3PPO A;  1I6Q A;  2GHA A;  3MZB A;  4KHZ E;  1NNP A;  1JW4 A;  3OXN A;  3RY3 A;  4LQ5 A;  3EHT A;  5CBS A;  2DS9 A;  3IO4 A;  1ZMG A;  2G93 A;  1B05 A;  2V25 A;  4FED A;  1WDN A;  3LSL A;  1FQC A;  1POT A;  4G68 B;  4LZ7 A;  3C32 A;  4EXK A;  3S9N C;  4QFN A;  4ZE9 A;  4YIC A;  2XA5 A;  2Y7R A;  4IY6 A;  4KCC A;  1BTJ A;  2QS3 A;  3KC1 A;  1B1H A;  3DP4 A;  1G0H A;  3K00 A;  2XHD A;  4XXU A;  2B4L A;  4C1T A;  3K6X A;  3TTK A;  1LBX A;  3DP6 A;  4GWS A;  1B40 A;  4P47 A;  4F3P A;  4X8R A;  1A8E A;  3DLN A;  5EQA A;  1SYH A;  2WYP A;  3OEN A;  3MBP A;  4JVI A;  5ESY A;  3CFZ A;  4R72 A;  1PB9 A;  1SI1 A;  3RUM A;  4PQJ A;  1PBQ A;  2HAV A;  4FOR A;  3IO6 A;  4FEB A;  1B32 A;  4YMB A;  3QIM A;  4FE8 A;  1MXZ A;  2UYE A;  3CR9 A;  4IGR A;  3CRB A;  4Z7E A;  1H76 A;  3TEP A;  3ILU B;  5DVI A;  4P1L A;  3VXB A;  3G3G A;  4N6P A;  1JNF A;  3T0J A;  2DQV A;  1JVX A;  4MX6 A;  1MDP 1;  2XWI A;  3IX1 A;  4KR5 A;  3LBS A;  4U2R A;  4WKM A;  1UTH A;  5EHM A;  2V3Q A;  4G8M A;  1R6Z A;  5DW8 A;  2XXP A;  1IXC A;  2DWI A;  1PBP A;  2QMW A;  2QS4 A;  2REJ A;  5CRY A;  2VPO A;  4G77 A;  2QRY A;  4QSE A;  2HEU A;  1GR2 A;  3TTM A;  1NI9 A;  3QYT A;  4HCW A;  4Q0C A;  4F2O A;  2UVG A;  5B7D A;  2GH9 A;  5FHO A;  2H5Y A;  1SW1 A;  4GWW A;  1YCJ A;  4ZEC A;  3PUV E;  1GVC A;  3CIJ A; 
#chains in the Genus database with same CATH homology
 4R74 A;  4OTE A;  3PV0 E;  4KYE A;  1R9L A;  2D5W A;  2H9B A;  2PYY A;  1F9B A;  5I84 A;  3LSW A;  4H5G A;  3GBB A;  3USD A;  3TZA A;  3AXF A;  1SDX A;  1Z7M E;  1XT8 A;  1S50 A;  4R6Y A;  1B52 A;  4YB5 A;  4O3B A;  4JB7 A;  1Y9U A;  2O68 A;  5AA2 B;  3O97 A;  4QFP A;  1UTB A;  2XXY A;  4U1O A;  3H3G A;  4DLD A;  2RKM A;  1ZIU A;  2Z8F A;  1GGG A;  4DXC A;  2UYF A;  4XKR A;  4GXA A;  3G3J A;  4P0G A;  3H6U A;  1USY E;  3KEI A;  3ZKK A;  4R9F A;  5H8H A;  4E0W A;  1WOD A;  4DXB A;  5TPA B;  1QJM A;  4EQB A;  1UQW A;  4OEU A;  1H44 A;  1M5F A;  2LAO A;  1UIV A;  4H8I A;  3KFM A;  1N0T A;  3OD7 A;  3C36 A;  4GFR A;  3KOT A;  4PET A;  5EYF A;  4HCY A;  3RTF B;  4ZZE A;  3K02 A;  3MVX A;  1M5E A;  2PX1 A;  2V84 A;  1POY 1;  3Q29 A;  4OQO A;  4EQ9 A;  4POW A;  1NH7 A;  3DM0 A;  5DTB A;  4OMB A;  4QFK A;  4XIG Q;  3VVF A;  3SDF A;  2DYX A;  4F3B A;  3V5A A;  1NFT A;  4F1V A;  3HO7 A;  1AH5 A;  3MQ9 A;  4F1U A;  4JWX A;  3HV1 A;  4WXJ A;  2H98 A;  2HAU A;  5H8Q A;  5I58 B;  4R2F A;  3W9V A;  3N6U A;  2QSX A;  2R9J A;  2XX9 A;  1JW5 A;  4P11 A;  4IY5 A;  4IO4 A;  3KG2 A;  1SQY A;  1ANF A;  3UGW A;  4EQ7 A;  3FIR A;  2ONK E;  4I8C A;  2X7Q A;  2F35 A;  3E4R A;  4OYV A;  2GRV A;  3VFJ A;  5I2K B;  1MY2 A;  2DWJ A;  4OES A;  3S9E A;  1DPP A;  3OSR A;  3BBR A;  3S4U A;  1MXU A;  5LOM A;  4YZZ A;  5DYH A;  3TEL A;  3C4M A;  3KN7 A;  2PT1 A;  3SEV A;  3VLV A;  4NF5 A;  1FTL A;  1XVY A;  1B1X A;  1B0H A;  1PB7 A;  1P1U A;  4OET A;  2IA4 A;  5AA3 A;  3SEU A;  1B3F A;  3TPA A;  3TUS A;  2ALU A;  1XHY A;  3C33 A;  4PFW A;  4UAC A;  3O6H A;  3M3L A;  1LB9 A;  1T0K A;  4OVJ A;  2YJP A;  4LP2 B;  1IEJ A;  2D3I A;  4DZ1 A;  3PU5 A;  4FEC A;  2M8C A;  2ZXT A;  5TPA A;  4O3A A;  3O2A A;  5ICT A;  1OVT A;  4YKI A;  1TT1 A;  2CZL A;  5F1Q A;  4F29 A;  4KQP A;  4ESX A;  3IAZ A;  2O7I A;  1ZKB A;  4F3G A;  1LFH A;  3FJG A;  5KCJ A;  3H03 A;  1HSL A;  4NF8 A;  4NTL A;  4RNS A;  1MS7 A;  3FXU A;  1USY H;  4DXU A;  4AB6 A;  1M5B A;  5JTY B;  2IEE A;  1DMB A;  1NL5 A;  2UVI A;  4M4G A;  5K2Y A;  3FVK A;  1O63 A;  1JVY A;  4KYS A;  2B3B A;  5I59 B;  3FD3 A;  3S9M C;  1NMU A;  4RXL A;  4JWY A;  3SEW A;  5ITO A;  3G3I A;  4MH5 A;  4XTC Q;  2ESN A;  1PC3 A;  4GOT A;  5L9O A;  1MDQ A;  2BJJ X;  3H06 B;  2G29 A;  2X7P A;  3EPE A;  4G2Z A;  3T66 A;  1OQH A;  1RKM A;  3B7D A;  1ZTY A;  4FAT A;  3PUZ E;  4K3F A;  1OMP A;  5AE4 A;  3Q25 A;  5F7V A;  3H6T A;  2ONR A;  1SW4 A;  3FVG A;  4G68 C;  1Y4C A;  4DDD A;  3SET A;  4ZS9 A;  3OO9 A;  3UN6 A;  1N7W A;  2I6E A;  1NKX A;  4QFO A;  5ISU A;  3I5O A;  3C34 A;  4ESW A;  5H8N B;  3K6V A;  5DT6 A;  3ECR A;  3I6V A;  3LSX A;  5A5X B;  1IXG A;  4FJP A;  1QUI A;  1YAE A;  3T9V A;  3PD8 A;  3HCQ A;  5AA4 B;  3C31 A;  4ZEB A;  4RY1 A;  5H8F A;  4ECF A;  3RTW B;  4NMY A;  1B7H A;  3WAF A;  3ILT B;  1B5J A;  4OHN A;  1LB8 A;  4XKQ A;  1ELJ A;  3FV2 A;  3EHS A;  3PPQ A;  2DOJ A;  3G3H A;  4WED A;  3N6T A;  2Y7K A;  2F34 A;  4JSO A;  4TLM B;  3CFL A;  2DE4 A;  4U4S A;  4UA8 A;  4ZDM A;  4EXL A;  4YKJ A;  4F18 A;  4IO5 A;  4Q5T A;  4PP0 A;  3JV9 A;  3GBA A;  2YPN A;  2WKY A;  1LGB C;  4MLV A;  1B5I A;  4MBP A;  2XX8 A;  4NED A;  2B65 A;  3FXQ A;  4IO2 A;  3B6T A;  5AA2 D;  3C9H A;  3V83 A;  3SEY A;  3CSG A;  4H6D A;  1MXY A;  2VP1 A;  3D4C A;  1FQD A;  2V3T A;  3FUZ A;  4YKK A;  3QSL A;  2I0C A;  1SW2 A;  4YMA A;  4NWC A;  3QXM A;  3V89 B;  4I9D A;  4PFT A;  3SES A;  1IUD A;  2XD3 A;  3ONM A;  4X48 A;  1HSJ A;  2QL3 A;  2F78 A;  4F1Y A;  1AOV A;  1IXH A;  2RF1 A;  1LBB A;  1FQB A;  3FV1 A;  4F19 A;  4BDN A;  5IAI A;  1LBC A;  3TTL A;  1XVX A;  2UVJ A;  3U8Q A;  4LQ2 A;  1YPN A;  2I0B A;  1QUJ A;  2FA7 A;  1NH8 A;  1A7L A;  2XXI A;  1JQF A;  3OSQ A;  2AL5 A;  4OZ9 A;  2AL4 A;  4Q30 B;  4E0X A;  4P0I A;  4I62 A;  5CI5 A;  1GV8 A;  2ZYO A;  1N7X A;  3KN3 A;  4U4X A;  2AIX A;  2DVC A;  1IZ1 A;  3MP8 A;  4EDP A;  4GL0 A;  1XOC A;  3EF7 A;  5H8N A;  4ELR A;  3CSB A;  2DP8 A;  5A5X A;  1MQJ A;  2R6G E;  1CB6 A;  3E9X A;  1D9V A;  5JK4 A;  2F6P A;  3TFL A;  2VD2 A;  3T9H B;  5CBR A;  2ZNU A;  3O66 A;  1QVS A;  2A5S A;  2OZZ A;  3CI8 A;  3VDF A;  4G68 A;  3IB1 A;  3K0V A;  3FXR A;  3UA8 A;  1A40 A;  3G7W A;  1FQF A;  3S9L C;  3H6V A;  1TFA A;  3T9U A;  4RYA A;  4C0R A;  4FIM A;  1P1N A;  2Z22 A;  1XS5 A;  4MFI A;  3MPL A;  1D3K A;  3MC2 A;  5ICQ A;  2B3F A;  2P1S A;  4YB7 A;  3K1N A;  4YAH X;  1Y3N A;  1LAG E;  5ELV A;  1PEB A;  4DCX A;  5L9M A;  2KLF A;  1P1O A;  1OLC A;  3MWB A;  1QUL A;  3PUY E;  4AQ4 A;  3B6W A;  2RCA A;  4QF9 A;  4LZ8 A;  2DWH A;  2QPQ A;  4RK9 A;  3TQL A;  3VV5 A;  2DE3 A;  2XXX A;  2GHB A;  4Z0I A;  1B3L A;  4RJZ A;  5L8D A;  3IOV A;  2Q2C A;  2Q9T A;  1KWH A;  1OVB A;  1US5 A;  3LSF B;  1B46 A;  1AL3 A;  1DTZ A;  3OEL A;  1SD3 A;  3W9W A;  1H45 A;  1US4 A;  2QMX A;  4RK2 A;  3R26 A;  3A3C A;  2F8D A;  3E13 X;  3IOW A;  4JSD A;  3TKD A;  5CMC A;  1Z7N E;  1BKA A;  1EU8 A;  1UIU A;  3HHF A;  4LON B;  3R6U A;  2NXO A;  1EH3 A;  4R73 A;  2I49 A;  4PFY A;  4HTG A;  4RA1 A;  1NNT A;  4F39 A;  4YB6 A;  1NNK A;  1MQH A;  4OER A;  2HXW A;  1B3G A;  5DEX B;  4WEP A;  3HST A;  2W7Y A;  3RPW A;  5B70 A;  3ZKL A;  4X1B A;  4NF6 B;  3KZG A;  4ZE8 A;  3K4U A;  1MH4 A;  4OXV A;  4EF2 A;  3D4G A;  1B3E A;  2R71 A;  5HM4 B;  1MXX A;  1IXI A;  4NF4 B;  5AA2 A;  1A54 A;  4KI0 E;  2H25 A;  3EHU A;  3MPK A;  2F36 A;  1TXF A;  2OJT A;  3MJN A;  4GXS B;  3PUX E;  3GLB A;  3P7I A;  4JWO A;  2Z8D A;  3MP1 A;  1M5C A;  3A3U A;  1A99 A;  3OEM A;  1B51 A;  4O3C A;  2Y7P A;  2Y7W A;  1Y20 A;  3IK6 B;  3O9P A;  1MPB A;  3A09 A;  4H67 A;  1Y1Z A;  1QKB A;  4LA9 A;  1D4N A;  1DPE A;  3Q27 A;  3VVE A;  5FTI A;  3TOD A;  1H3D A;  1MQI A;  4PE5 B;  5CMM A;  1VFE A;  3OEK A;  2E1S A;  2Z8E A;  1HSE A;  2Z23 A;  1B0L A;  2QJE A;  2I48 A;  1IIT A;  5I56 B;  1BIY A;  4NWD A;  3PGF A;  1TFD A;  1MG1 A;  1VR5 A;  2XXR A;  1O7T A;  3K1M A;  1B4H A;  1N76 A;  4C1U A;  4PFU A;  2O1L A;  3IOT A;  3QK6 A;  2OWS A;  2DXR A;  4I1D A;  4THI A;  3VLW A;  2F5X A;  1IQ7 A;  3OO8 A;  5I57 B;  3S2V A;  3MVZ A;  1URG A;  1MPD A;  1JEV A;  3IJX B;  4DCY A;  2I3W A;  3WAE A;  4H8J A;  1B6H A;  3U92 A;  1N04 A;  3N26 A;  4ELO A;  5I58 A;  3CFX A;  2DE2 A;  3U72 A;  1P1W A;  1JET A;  4ZED A;  3THI A;  4GQO A;  1QW0 A;  2O69 A;  1UTH B;  3PD9 A;  4IB2 A;  2Q89 A;  5DEX A;  4FAJ A;  1B3H A;  1MH3 A;  3SKP A;  5I2K A;  4R75 A;  1VSO A;  4X1D A;  1JEU A;  4JBZ A;  1FCK A;  1VE4 A;  4OFO A;  5FTH A;  3R7X A;  1WVJ A;  1N84 A;  3KSJ A;  3U94 A;  4R6K A;  1I6B A;  1O64 A;  3LR1 A;  1EZ9 A;  3TCG A;  2OWT A;  2Q88 A;  1B4Z A;  4BDQ A;  1Q35 A;  4DE8 A;  2H4I A;  4KCD A;  4KYD A;  4G8H A;  2AYS A;  3KN8 A;  1R1N A;  2DVZ A;  3KGC A;  3ODB A;  5JEI A;  1DTG A;  3H4Z A;  1Y3Q A;  1ZJL A;  4GL8 A;  3RLF E;  1S7Y A;  1SVX B;  1SI0 A;  4IO6 A;  1AMF A;  3PPP A;  3PMW A;  3UIF A;  1UTB B;  1S9T A;  2H99 A;  4ZEF A;  3FJM A;  1B58 A;  2RC7 A;  2GFE A;  3OO7 A;  2PBW A;  4R6H A;  4N07 A;  2DWA A;  3K01 A;  5I56 A;  3QAX A;  1QKA A;  5H8H B;  1P99 A;  5JTY A;  3MW0 A;  2RC8 A;  2FNC A;  3H7M A;  1MM7 A;  5AA1 A;  1SYI A;  3N5L A;  2P0S A;  2X26 A;  5FHN A;  1ATG A;  3T22 A;  3SEX A;  5I2N B;  3VVD A;  4R2B A;  3IR1 A;  1LFI A;  5I59 A;  1ZLQ A;  2NVU B;  1N3X A;  5I57 A;  3SER A;  3RGY A;  3MZ1 A;  3O6G A;  3FAT A;  3TQW A;  3MP6 A;  3Q28 A;  2VGQ A;  4GVO A;  2ZNS A;  1OIB A;  2XXU A;  3FJ7 A;  2I4C A;  4JXI A;  1FW0 A;  3KJ7 A;  2HCA A;  4OEN A;  2PMS A;  4XKN A;  2ONS A;  2RCB A;  4OEV A;  1FTK A;  1SBP A;  4F2Q A;  1B5H A;  1QUK A;  4BDO A;  5K2X A;  2OLB A;  2PVU A;  4H5F A;  4ELQ A;  5TP9 B;  2HZL A;  3E3K A;  1R9Q A;  1N3W A;  3VXC A;  3LC8 A;  3FGS A;  2HQ0 A;  5H8Q B;  1EZP A;  3PMV A;  1Y1M A;  2UXA A;  2YLN A;  2V3U A;  3IB2 A;  5EHS A;  3ZS6 A;  4GIZ A;  2THI A;  2A5T B;  2Q8J A;  1PDA A;  3DP8 A;  3IOR A;  5AA4 A;  2NOO A;  4OFJ A;  1A8F A;  2XXH A;  4U23 A;  5DVJ A;  1LAH E;  3MZ9 A;  3H6W A;  3MUQ A;  1Y4T A;  1OLA A;  2ZYN A;  1MQG A;  3HHG A;  3G3F A;  2VOZ A;  4N13 A;  4LUB A;  1MQD A;  4KFQ A;  4GF8 A;  4AB5 A;  5KDT B;  2Q2A A;  4TOZ A;  5CC2 A;  3RN8 A;  4LVQ A;  1ZBM A;  4ISU A;  4NF5 B;  2NWJ A;  1TWY A;  4F3S A;  3FAS A;  3O29 A;  3RT8 A;  2F97 A;  4EUO A;  4ONY A;  3MVW A;  1CE2 A;  3RNN A;  3RT6 B;  4ZZA A;  1BP5 A;  5M2V A;  1LAX A;  3KOS A;  1MY3 A;  3QUJ A;  1PB8 A;  5CMB A;  2I4B A;  4YU0 A;  4GWO A;  4QFL A;  1MM6 A;  2O7U A;  3BFT A;  2QS2 A;  4POX A;  3BFU A;  5CMK A;  1Q1K A;  5DVF A;  2V93 A;  4JDF A;  4BDM A;  2RC9 A;  4HS7 A;  3G3K A;  4TLL B;  1FQA A;  2Y7I A;  3LUY A;  4QRZ A;  3IJO B;  4GD5 A;  2DXY A;  4QSD A;  4R9G A;  5I2N A;  5KCJ B;  3K2D A;  1JW1 A;  4NF8 B;  1LLS A;  2FYI A;  3TTN A;  4EF1 A;  1LAF E;  3M3K A;  3TMG A;  1FQE A;  4RPN A;  3CG1 A;  3U1O A;  3FVO A;  4BDL A;  3TTR A;  2Y84 A;  3O6I A;  1URD A;  2ZYK A;  2XD2 A;  1FTO A;  1MXV A;  2PT2 A;  1DOT A;  4YKP A;  2UVH A;  3GZG A;  3MVY A;  4L17 A;  1L5T A;  4ELP A;  3M8U A;  2RIN A;  1AIV A;  3L6G A;  5TP9 A;  2I3V A;  2ZMB A;  3IB0 A;  1MY4 A;  5HBC A;  3OO6 A;  4U1Z A;  4ZEI A;  4HW8 A;  4F22 A;  4U22 A;  2DSF A;  4M1V A;  1MXW A;  3CG3 A;  4QHQ A;  1B7Z A;  1LST A;  2ZYM A;  3HN0 A;  3T9X B;  4IO3 A;  4RPO A;  3IOU A;  2HZK A;  3JYR A;  3KBR A;  4H0W A;  2A5T A;  4LAT A;  3O28 A;  3PPN A;  1IIW A;  1RYO A;  3GXA A;  2ABH A;  3L6H A;  4OFL A;  2XXQ A;  3K1P A;  1B2H A;  3U93 A;  4MLQ A;  1I69 A;  3M3F A;  4H65 A;  2F6G A;  1MRP A;  2F7B A;  3HPI A;  4X9T A;  2OCU A;  3K6U A;  1M5D A;  5KDT A;  2D21 A;  3VE1 B;  3TCH A;  5BUU A;  1FTJ A;  1B7U A;  2HFB A;  3KJT A;  5H8F B;  3DEL B;  2QS1 A;  1LFG A;  5IKB A;  4NE4 A;  1P1Q A;  1XC1 A;  1MPC A;  3MAM A;  5BWJ A;  3K6W A;  4H1X A;  4KPT A;  2REG A;  5J1D A;  1URS A;  4GLI A;  3PPR A;  3V8X B;  3VLU A;  2CMO A;  1OQG A;  1LCT A;  3I3V A;  2VD3 A;  5H8S A;  5TU0 A;  3CVG A;  2F7C A;  3TDJ A;  2XXW A;  5CM6 A;  2XXV A;  3OMB A;  4BLA A;  3FZV A;  2E0S A;  2O84 X;  3F11 A;  1A55 A;  5L9S A;  3TYH A;  4MF3 A;  1SW5 A;  3QUF A;  1YTV A;  5ITP A;  1LCF A;  3N94 A;  1Y3P A;  1EZO A;  1VFD A;  2O1M A;  2I58 A;  1MY1 A;  4LZ5 A;  2VHA A;  3W15 C;  3UK4 A;  3UP9 A;  4F31 B;  4OWD A;  4IGT A;  4KD5 A;  2XXT A;  1BLF A;  3Q26 A;  1RYX A;  3PMX A;  4U21 A;  3T96 B;  2OBG A;  1MY0 A;  3EQ1 A;  1II5 A;  5KZT A;  3T93 B;  1H43 A;  5FHM A;  2OK2 A;  2XX7 A;  1D9Y A;  2P2A A;  3JZJ A;  4TQU Q;  1NNF A;  4NF6 A;  3B6Q A;  3KSX A;  4ZEK A;  2ANJ A;  1ZU0 A;  4G4P A;  3IL1 B;  3RQT A;  2ZNT A;  2F7A A;  1I6A A;  1FTM A;  4BDR A;  3TAJ A;  3OOA A;  4IO7 A;  2O6A A;  2O51 A;  4DIG A;  4Q8R A;  4NF4 A;  3TCF A;  1GTK A;  4QSC A;  1J1N A;  3FVN A;  5HPQ A;  3BKI B;  2NUV A;  3ZSF A;  4ND9 A;  3EN3 A;  4GRK A;  4G8N A;  3C35 A;  4XKP A;  1B9J A;  3PUW E;  3UOR A;  1DSN A;  3PPO A;  1I6Q A;  2GHA A;  3MZB A;  4KHZ E;  1NNP A;  1JW4 A;  3OXN A;  3RY3 A;  4LQ5 A;  3EHT A;  5CBS A;  2DS9 A;  3IO4 A;  1ZMG A;  2G93 A;  1B05 A;  2V25 A;  4FED A;  1WDN A;  3LSL A;  1FQC A;  1POT A;  4G68 B;  4LZ7 A;  3C32 A;  4EXK A;  3S9N C;  4QFN A;  4ZE9 A;  4YIC A;  2Y7R A;  4IY6 A;  4KCC A;  1BTJ A;  2QS3 A;  1B1H A;  3DP4 A;  3K00 A;  2XHD A;  4XXU A;  4C1T A;  3K6X A;  3TTK A;  3DP6 A;  1B40 A;  4F3P A;  1A8E A;  3DLN A;  1SYH A;  3OEN A;  3MBP A;  3CFZ A;  4R72 A;  1PB9 A;  1SI1 A;  3RUM A;  4PQJ A;  1PBQ A;  2HAV A;  4FOR A;  3IO6 A;  4FEB A;  1B32 A;  4YMB A;  3QIM A;  4FE8 A;  1MXZ A;  2UYE A;  3CR9 A;  4IGR A;  3CRB A;  4Z7E A;  1H76 A;  3TEP A;  3ILU B;  5DVI A;  3VXB A;  3G3G A;  4N6P A;  1JNF A;  2DQV A;  1JVX A;  1MDP 1;  3IX1 A;  4KR5 A;  3LBS A;  4U2R A;  4WKM A;  1UTH A;  5EHM A;  2V3Q A;  4G8M A;  1R6Z A;  2XXP A;  1IXC A;  2DWI A;  1PBP A;  2QMW A;  2QS4 A;  2REJ A;  5CRY A;  4G77 A;  2QRY A;  4QSE A;  2HEU A;  1GR2 A;  3TTM A;  4Q0C A;  3QYT A;  4HCW A;  4F2O A;  2UVG A;  5B7D A;  2GH9 A;  5FHO A;  2H5Y A;  1SW1 A;  1YCJ A;  4ZEC A;  3PUV E;  1GVC A;  3CIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...