3THIA

Thiaminase i from bacillus thiaminolyticus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
362
structure length
362
Chain Sequence
ITLKVAIYPYVPDPARFQAAVLDQWQRQEPGVKLEFTDWDSYSADPPDDLDVFVLDSIFLSHFVDAGYLLPFGSQDIDQAEDVLPFALQGAKRNGEVYGLPQILCTNLLFYRKGDLKIGQVDNIYELYKKIGTSHSEQIPPPQNKGLLINMAGGTTKASMYLEALIDVTGQYTEYDLLPPLDPLNDKVIRGLRLLINMAGEKPSQYVPEDGDAYVRASWFAQGSGRAFIGYSESMMRMGDYAEQVRFKPISSSAGQDIPLFYSDVVSVNSKTAHPELAKKLANVMASADTVEQALRPQADGQYPQYLLPARHQVYEALMQDYPIYSELAQIVNKPSNRVFRLGPEVRTWLKDAKQVLPEALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of thiaminase-I from Bacillus thiaminolyticus at 2.0 A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords PROTEIN (THIAMINASE I)
total genus 116
structure length 362
sequence length 362
ec nomenclature ec 2.5.1.2: Thiamine pyridinylase.
pdb deposition date 1998-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3thiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3thiA02
4F22A 1LAGE 2F7CA 1Q35A 1XHYA 1IIWA 1XVXA 3PPNA 3OEKA 4EF2A 2THIA 4EQ7A 4F1UA 3PMXA 1UIVA 2F36A 1B46A 2Y7IA 3T66A 2X26A 1J1NA 4G8MA 2G93A 3O6IA 4NTLA 1H44A 2RC9A 3SEVA 4P0GA 2QS3A 1A8EA 5ICTA 1B3HA 1MRPA 4FECA 1PEBA 3V5AA 4F3GA 2VD3A 1B1HA 4JXIA 4MLVA 3ZS6A 5DT6A 3E3KA 2AIXA 3G3KA 3QUFA 3G3IA 2I0BA 3G3GA 3USDA 1FTMA 5DYHA 4U1OA 1SBPA 1MQDA 3IAZA 2XX8A 3FIRA 4H67A 2OLBA 1MG1A 4GVOA 3T22A 4QFNA 1JNFA 3O29A 3R7XA 3VXCA 3KN8A 1A8FA 2Q89A 1LLSA 4GXAA 4AB5A 3O28A 3BKIB 1N3WA 5FTIA 3TPAA 1IXCA 1P1QA 2R71A 3B6TA 3K00A 3N94A 3TUSA 4GXSB 2P1SA 5JTYB 3SETA 1SYHA 5I58A 1OVBA 3FVGA 3T9UA 1GGGA 1SW2A 4IO4A 3S2VA 4OETA 5AA2A 1FTLA 1UTHA 1IXGA 5CMBA 2O7UA 1N7XA 4F2QA 2RF1A 2E1SA 5KCJB 3MVXA 4OEUA 3B7DA 1LSTA 3IO6A 2QS1A 3IX1A 5H8HA 3ZKLA 5H8QB 3QAXA 1MPDA 3PMWA 3UORA 1VR5A 2UYEA 3EHTA 2UVHA 3PMVA 4ISUA 4LP2B 4THIA 4UA8A 1SDXA 3DELB 4GL8A 3ECRA 4KR5A 1A7LA 3RUMA 4Q0CA 3E4RA 4NE4A 1PB7A 4ZZEA 1B32A 1ZU0A 1DSNA 2OJTA 3CFXA 4EDPA 4R2FA 3CI8A 1B5IA 3IJOB 2FNCA 2B3BA 2QJEA 3OOAA 1L5TA 4H0WA 1JW1A 2Q8JA 2DWIA 3K4UA 5CMMA 1H76A 1US5A 1XT8A 2VGQA 3FVKA 4YKIA 4BDLA 1ELJA 1Y4CA 1MM7A 1MH3A 1QKBA 2G29A 2OCUA 2RINA 2AL5A 3C31A 1MS7A 3IORA 1N76A 4U4SA 3RN8A 1NNFA 3VV5A 4M4GA 3I5OA 1TT1A 4P0IA 3S9LC 4DLDA 5I59A 3CG3A 1HSLA 2ONSA 4OWDA 3SEWA 2I3WA 2I49A 4OQOA 2HCAA 5F7VA 3GBBA 1MY3A 2F7AA 3S9MC 3M8UA 4ZEBA 1I6AA 1Z7NE 1ZLQA 1B5HA 1JVXA 1JQFA 1MPBA 1B7UA 1IXIA 2B3FA 3PUZE 4N13A 4K3FA 5TPAA 1B7ZA 3HV1A 1JEVA 2ONRA 3H6VA 3IOWA 3OELA 4GFRA 3BFUA 3FD3A 1BIYA 4OYVA 4R74A 4XXUA 4F39A 3CR9A 2ZNTA 4LZ8A 4UACA 3C32A 3E9XA 3PPPA 1OQHA 4ZZAA 2DQVA 2I4BA 3MBPA 3PD8A 4GL0A 4EUOA 2P0SA 1DOTA 1BLFA 3KN3A 3UP9A 5H8NB 1S7YA 3SKPA 1P1OA 1YCJA 1D4NA 3FGSA 1JVYA 1RKMA 4MFIA 2HAUA 3UK4A 4Q5TA 4DXCA 4U4XA 5CBSA 1OQGA 4N6PA 4RJZA 3O9PA 2DP8A 2A5TA 3UN6A 4C0RA 4IO7A 5IKBA 4AB6A 4IB2A 4OVJA 4IO2A 4YICA 2I6EA 2Y7WA 3LC8A 4BDNA 4FAJA 5AA2B 1EZ9A 3KSXA 2PT2A 3VVEA 1MQIA 1VFEA 2VD2A 3TCFA 3U92A 4G8NA 2OWTA 2XXRA 4IY6A 2Q2AA 4RYAA 4U1ZA 4R9GA 4HW8A 3VVFA 5KZTA 4F3SA 1ZBMA 3E13X 1N04A 2QRYA 3MAMA 1O64A 4P11A 3WAEA 3N6UA 1SI1A 4G4PA 2X7PA 1URSA 5M2VA 3U8QA 3FJ7A 3VVDA 2DYXA 4EQ9A 3C33A 4AQ4A 4YB7A 1H45A 2LAOA 4NF6B 1SQYA 5FHNA 2RCAA 3SDFA 4F19A 3A09A 4F31B 1T0KA 3IJXB 2DE3A 2Z8FA 3CSBA 3G7WA 1P99A 2ONKE 3K1NA 1WVJA 3MQ9A 3OD7A 4G68B 1EZOA 1B2HA 1NMUA 2Y84A 5DVFA 1IQ7A 4GRKA 4KQPA 3HPIA 4FEBA 3OEMA 4ELRA 4ZE9A 2DE4A 3FV2A 4RA1A 3RTWB 1LCTA 3ZKKA 1AH5A 5ITPA 2V25A 1F9BA 3CIJA 2F5XA 3DM0A 4RK9A 5JTYA 3H7MA 4R2BA 3TCGA 4H65A 1PDAA 3PU5A 2UVGA 3VE1B 1Z7ME 1GTKA 3QSLA 4F3BA 2QMXA 4F18A 3KSJA 3L6GA 1NFTA 4OXVA 1IXHA 1M5CA 1DTGA 4I9DA 1QKAA 3CFZA 2XXWA 4PFTA 3T93B 4OERA 4KD5A 3ONMA 4ZDMA 2HEUA 3MPKA 1P1UA 3CRBA 1MDP1 1NNKA 4O3AA 4Z0IA 3PD9A 1TWYA 3SEXA 3PPQA 2B65A 2O68A 4ESXA 3KOSA 4ZEDA 3FATA 3EPEA 3MP1A 5A5XB 1CB6A 2HZLA 1IITA 1LAHE 3IO4A 4YKJA 4WKMA 4XIGQ 3H6TA 4N07A 1M5DA 3Q25A 1O7TA 4LQ2A 1WODA 3ILTB 4NF8A 2DVZA 4EQBA 3DP6A 1Q1KA 1DMBA 3TCHA 4QSEA 4E0XA 1IUDA 2O1MA 4QSCA 2O1LA 1B5JA 4NF5B 5I59B 1PB9A 5F1QA 4IGRA 2QS2A 4KPTA 4M1VA 3T9HB 1MDQA 2V3TA 4FIMA 4X48A 5ELVA 2UVIA 1B51A 3KJ7A 3MVWA 3MUQA 2Y7PA 1LGBC 3A3CA 4ZEFA 2PYYA 2RCBA 1LCFA 3KN7A 2KLFA 1I69A 4LQ5A 4RK2A 1A99A 1QW0A 2H9BA 1Y3PA 5H8QA 3S4UA 1B4HA 3MZ1A 1SW1A 4OTEA 4I62A 5DTBA 3TODA 2DWAA 2FYIA 4R6HA 4RY1A 4NWCA 2ESNA 2HXWA 3O97A 1B0HA 1MXYA 2HAVA 4HCYA 1DPPA 4NWDA 4R9FA 4JWYA 4WEDA 3ZSFA 4G8HA 2ABHA 4QSDA 3P7IA 2Z8DA 3M3FA 2Z22A 5I84A 3CVGA 2R9JA 5A5XA 1MQHA 3EHSA 1QUJA 3K1PA 2NWJA 3HSTA 2REJA 1B3GA 1MY1A 3KFMA 3TTLA 1SYIA 1OLCA 1R9LA 1WDNA 3KJTA 3MZ9A 4KYDA 2DOJA 3SEYA 1DTZA 4HTGA 1MQJA 4LONB 1O63A 2UVJA 3W9VA 5B7DA 2CMOA 2XXIA 5AE4A 5HM4B 1Y1MA 3R26A 2CZLA 4EXKA 5EHMA 1FTJA 3T96B 5I58B 1MXUA 3N6TA 3H06B 3TMGA 2DXRA 3A3UA 3D4CA 3I3VA 4R73A 3V8XB 3KBRA 2F7BA 4DE8A 4XKQA 5KCJA 3N5LA 3MVYA 4MLQA 3MJNA 4ZEIA 1B4ZA 1LBBA 4QFOA 1NL5A 2QL3A 2XXPA 2YPNA 1B05A 1AMFA 3HN0A 1FTKA 2H4IA 3K2DA 4IO6A 4QF9A 5CRYA 4BDQA 5L9OA 3UIFA 1H43A 1D9VA 2O6AA 4ONYA 2RC7A 3VXBA 1VSOA 3C36A 3JV9A 4I8CA 3OO8A 2ZYKA 4GOTA 1TFAA 1DPEA 1RYXA 5CBRA 3EN3A 5FTHA 5K2YA 3O6GA 1PBPA 3C4MA 5H8NA 2GH9A 1TFDA 1FQCA 1M5BA 3LSWA 1IEJA 1JETA 2RC8A 2V3UA 1ATGA 4POWA 2Q88A 1RYOA 3G3JA 1N84A 3C34A 2W7YA 4GIZA 1QUIA 2OZZA 3H6WA 4X1BA 2DS9A 2NXOA 2D21A 5BUUA 4PQJA 1PBQA 1A54A 1UTHB 1ZIUA 2V93A 3Q26A 2Y7KA 2ZYNA 4TOZA 4ELQA 2ANJA 4NMYA 1D3KA 4KYEA 4QFKA 3RY3A 2H25A 3VFJA 1N3XA 3PUWE 2WKYA 4H6DA 3WAFA 3IK6B 4LVQA 1SW4A 2H99A 3RT8A 4PETA 1FCKA 3Q29A 4OEVA 3BFTA 4JBZA 3FUZA 1PC3A 3K0VA 2O51A 2ZNUA 3EF7A 3I6VA 3M3LA 3OSRA 2OK2A 3MP8A 4GWOA 5L8DA 3W15C 2QSXA 4NF6A 1HSJA 1UIUA 4JWXA 4ZECA 1XVYA 3GLBA 4RXLA 4YMAA 3UGWA 3FJGA 1FTOA 1MM6A 3MP6A 5CC2A 5I57A 2H98A 2YLNA 2HZKA 3IL1B 4QFLA 2GHBA 1JW4A 1FQDA 1B9JA 4R75A 1FQAA 3EHUA 1OIBA 4LATA 3W9WA 2QMWA 4WXJA 3FJMA 4GLIA 4DXUA 2DSFA 5KDTA 1NNTA 3O2AA 2IA4A 5I2NA 2Z23A 4F2OA 5I56B 3KOTA 2X7QA 3SEUA 3U1OA 2XXVA 1TXFA 3CG1A 3QUJA 4PFUA 1QULA 4FATA 4L17A 2O7IA 3DP4A 3JZJA 4NF4B 5DEXB 5EYFA 1UTBB 5H8FB 1ZTYA 2D3IA 3PGFA 3RQTA 2I3VA 5L9SA 1EZPA 4WEPA 4MBPA 4FORA 1QJMA 4ND9A 4KCCA 1MXZA 2RKMA 3HCQA 4DCYA 3G3FA 1P1NA 3IOUA 4JWOA 3PPRA 4ZE8A 3U94A 4C1UA 1VFDA 1A40A 2XX9A 5AA4A 5TP9B 4PE5B 2ZNSA 5IAIA 3FZVA 4G68A 1R1NA 3UA8A 2Y7RA 4DXBA 3D4GA 2XXTA 4OZ9A 4ESWA 5HBCA 3O6HA 5I2KB 4U23A 1VE4A 2OBGA 3IOTA 1N0TA 5AA3A 1BKAA 4YMBA 1GV8A 3PUYE 5JEIA 3Q28A 4BDMA 3L6HA 2M8CA 3JYRA 4X9TA 1AL3A 4XKPA 2O69A 4FJPA 4NF5A 4QFPA 3TTKA 1R6ZA 4HCWA 1MXVA 4JB7A 2FA7A 2DE2A 4DIGA 5TP9A 1N7WA 1B3FA 3H03A 3IB1A 5DVJA 4YAHX 2XHDA 4KI0E 4LUBA 3B6QA 5I2NB 1FW0A 1LFHA 2I48A 4G77A 3TYHA 5ICQA 3H6UA 3ILUB 4GD5A 3TELA 3FASA 1CE2A 4Z7EA 3SERA 1US4A 1M5FA 2GHAA 1NH8A 1UQWA 2D5WA 1S9TA 2PVUA 2XD3A 4YZZA 2DWJA 1EH3A 3AXFA 1B1XA 5CM6A 3LBSA 4E0WA 3MC2A 3PUXE 4KYSA 4POXA 3RGYA 4OENA 4YB6A 4NEDA 1MH4A 2A5SA 3K6UA 2IEEA 1Y3NA 2XXQA 4PP0A 4BDRA 2NOOA 1EU8A 1SVXB 1B52A 2NUVA 3C9HA 1QVSA 3ODBA 2Q2CA 4PFYA 4Q30B 3OO9A 2VOZA 2ZXTA 3FVOA 2UXAA 5L9MA 4LA9A 1LBCA 4LZ5A 4OFOA 3Q27A 4U2RA 3VLUA 4EF1A 4XKNA 2DXYA 1URGA 1NNPA 5CMCA 3H3GA 4O3CA 2QPQA 4G68C 2I4CA 2V3QA 5KDTB 4ZEKA 3FV1A 2F8DA 4GQOA 4YB5A 4O3BA 3RTFB 3VLWA 1B7HA 4KCDA 1POTA 3GXAA 5B70A 3QK6A 3TQLA 2GFEA 3TTRA 3K1MA 3MW0A 3RNNA 1ANFA 1YPNA 4NF4A 1R9QA 1MY0A 2Z8EA 3GBAA 5DEXA 5J1DA 2F34A 4R6KA 1OLAA 4QHQA 2E0SA 1SW5A 3F11A 3K02A 4TLMB 2F78A 4F29A 3TTMA 3RT6B 2QS4A 2HQ0A 2REGA 5TU0A 4EXLA 4U21A 4F3PA 1MXWA 4GF8A 5BWJA 1Y3QA 4ZS9A 4JSOA 4YKPA 2F6GA 3OENA 1MY2A 3TDJA 3IOVA 1MPCA 1I6BA 5HPQA 2UYFA 3LSXA 4HS7A 3KZGA 1OMPA 1B0LA 1D9YA 2V84A 4IO3A 3RPWA 3MPLA 5ISUA 1YTVA 4RNSA 5AA1A 2O84X 1FQEA 4TLLB 5CI5A 3TAJA 4XTCQ 1I6QA 1OVTA 3T9VA 1S50A 1LFIA 1B58A 1MY4A 2VHAA 3FVNA 3QXMA 4RPNA 5AA4B 3K6VA 1ZJLA 3SESA 3O66A 4YU0A 3LSLA 2XD2A 3PUVE 1XS5A 1B3EA 5JK4A 1USYE 3TKDA 1ZKBA 4OMBA 3TEPA 1Y20A 2AL4A 4IGTA 5CMKA 1LB9A 5EHSA 1NH7A 1GR2A 4F1VA 5FHOA 2PMSA 4OFLA 4RPOA 2R6GE 2ZYOA 5K2XA 2Q9TA 4FEDA 1ZMGA 3K6XA 4IY5A 1URDA 3IB2A 2I58A 3N26A 4PFWA 1HSEA 2BJJX 2AYSA 3MWBA 2F35A 4MH5A 5FHMA 4IO5A 4KHZE 1SD3A 2I0CA 4JSDA 5H8SA 4H8IA 4BDOA 4YKKA 1FQBA 1BTJA 4FE8A 1AIVA 3LR1A 3G3HA 2ZMBA 3M3KA 3FXRA 3CFLA 3FXUA 3U72A 1H3DA 2DVCA 1Y9UA 4F1YA 4X1DA 4H8JA 1SI0A 3VDFA 4I1DA 2H5YA 3LSFB 1Y4TA 4LZ7A 5I2KA 3R6UA 1IZ1A 1XOCA 2VP1A 1B3LA 5LOMA 2P2AA 4OESA 1B6HA 1LB8A 3TFLA 3TTNA 3MZBA 3TZAA 4MF3A 3GZGA 4KFQA 2XXXA 1Y1ZA 2OWSA 3VLVA 4Q8RA 1MQGA 1MXXA 4OHNA 3HHFA 5I56A 3QYTA 5ITOA 1QUKA 3KEIA 3KGCA 3DP8A 3HO7A 3T9XB 3CSGA 4H5GA 2XXHA 3EQ1A 3RLFE 2ZYMA 4ELPA 3C35A 4JDFA 1UTBA 5H8FA 5H8HB 4ECFA 2PT1A 1NKXA 3THIA 2YJPA 1A55A 4QRZA 2F97A 3OXNA 1BP5A 1JW5A 2PX1A 3OMBA 4G2ZA 1KWHA 1II5A 3HHGA 3OO6A 5TPAB 2NVUB 1M5EA 1LAFE 2F6PA 4H5FA 3BBRA 5AA2D 4DCXA 3V83A 1AOVA 2XXUA 1POY1 2GRVA 3LUYA 3MVZA 1XC1A 1P1WA 3K01A 3K6WA 3QIMA 4H1XA 4U22A 4OFJA 4ELOA 3S9NC 2ALUA 1YAEA 1LFGA 2PBWA 2XX7A 3IR1A 4R6YA 3H4ZA 4TQUQ 3FXQA 4R72A 3S9EA 5I57B 4NF8B 4C1TA 1USYH 2XXYA 1LAXA 3OO7A 4BLAA 4XKRA 1B40A 3PPOA 3KG2A 3U93A 3B6WA 3OSQA 2DWHA 2HFBA 5DVIA 3TQWA 1JEUA 1PB8A 3PV0E 1FQFA 2A5TB 4DZ1A 3IB0A 4DDDA 3V89B 1GVCA 3DLNA
chains in the Genus database with same CATH superfamily
1IIWA 4EF2A 2X26A 4NTLA 4GWZA 2RC9A 1MRPA 4QXDA 4F3GA 1B1HA 3G3KA 1FTMA 5DYHA 1SBPA 2OLBA 3VXCA 3R7XA 3KN8A 4O94A 2R71A 3K00A 3TUSA 1SYHA 3S2VA 4IO4A 4OETA 1UTHA 1FTLA 5CMBA 2O7UA 2Q8MA 5KCJB 4OEUA 3IO6A 2QS1A 3QAXA 1NV1A 4UA8A 4THIA 3DELB 4GL8A 1ZU0A 1DSNA 2OJTA 3SZPA 3CI8A 2FNCA 3OOAA 2DWIA 4YKIA 1Y4CA 1MM7A 4U4SA 3ROJA 1NNFA 4OVSA 4JVCA 4M4GA 3I5OA 1TT1A 4N17A 4OWDA 2ONSA 3SEWA 2HCAA 4JVDA 5EQ8A 3S9MC 1ZLQA 1JVXA 1B7UA 4G61A 1JEVA 2ONRA 3IOWA 3OELA 3LV0A 4OYVA 1OQHA 2I4BA 3PD8A 2P0SA 1DOTA 5H8NB 3SKPA 1D4NA 4MFIA 4RJZA 2DP8A 2A5TA 4FAJA 2KR0A 4PAFA 5AA2B 2PT2A 3VVEA 1MQIA 1VFEA 3TCFA 3U92A 4N8YA 3VVFA 4PCDA 1ZBMA 4UABA 1O64A 4G4PA 2X7PA 3VVDA 2DYXA 2LAOA 1SQYA 3OD7A 3K1NA 1EZOA 1B2HA 1IQ7A 3HPIA 3OEMA 4ELRA 4RA1A 3RTWB 4JVIA 1AH5A 3DM0A 2F5XA 2VPOA 3H7MA 1GTKA 2QMXA 3KC1A 4F18A 2FHYA 1NFTA 4I9DA 4GX6A 1NNKA 4O3AA 3PD9A 1TWYA 3PPQA 5A5XB 2O68A 3FATA 3MP1A 4P47A 3IO4A 4WKMA 3H6TA 4N07A 1M5DA 4LQ2A 1DK4A 4E0XA 5I59B 5F1QA 3T9HB 1B51A 1LCFA 1FBCA 3KN7A 4RK2A 1QW0A 5H8QA 1Y3PA 1B4HA 2Y5LA 4OTEA 2FYIA 4R6HA 4NWCA 1FPGA 1DPPA 2ABHA 4QSDA 4GWXA 4GX4A 1R9LA 2DOJA 1O63A 2UVJA 2CMOA 1Y1MA 3T96B 1MXUA 3N6TA 3D4CA 3I3VA 4DE8A 3N5LA 3IFCA 3MVYA 4MLQA 1B4ZA 1LBBA 4I40A 5L9OA 4O8MA 1H43A 3VXBA 2RC7A 1VSOA 3C36A 3OO8A 2ZYKA 2DDKA 5CBRA 3RPLA 1M5BA 1IEJA 5ET8A 1ATGA 1RYOA 3G3JA 1QUIA 2DS9A 2NXOA 2D21A 5BUUA 1PBQA 2V93A 2Y7KA 3RY3A 3VFJA 3ZS6A 2WKYA 4H6DA 4PETA 3BFTA 2ZNUA 3I6VA 3W15C 3OSRA 2OK2A 4GWOA 1UIUA 4JWXA 5CC2A 2ZZVA 2P3NA 3IL1B 1NI9A 1FQAA 3EHUA 4NN3A 3W9WA 5KDTA 5I2NA 2Z23A 2X7QA 3CG1A 2CEYA 4FATA 1QULA 3DP4A 5DEXB 5H8FB 1ZTYA 2D3IA 3MYUA 4FORA 4JWOA 5AA4A 5TP9B 4PE5B 4G68A 4ESWA 3O6HA 4U23A 4I3YA 3IOTA 5AA3A 4YMBA 3JYRA 4X9TA 2O69A 4NF5A 3QMFA 4HCWA 2DE2A 4DIGA 2QFLA 4NGUA 4YAHX 3B6QA 1FW0A 3TYHA 5ICQA 3H6UA 1US4A 2D5WA 2PVUA 1S9TA 3AXFA 1EH3A 3PUXE 2XXQA 1SVXB 1FBPA 1RDXA 1B52A 2NUVA 3C9HA 1QVSA 4PFYA 2Q2CA 4Q30B 2UXAA 5L9MA 4OFOA 3Q27A 4XKNA 2DXYA 4O3CA 2I4CA 4ZEKA 3FV1A 2F8DA 4YB5A 3RTFB 4KCDA 3TQLA 3MW0A 1ANFA 1YPNA 4NF4A 3BIGA 3GBAA 2Z8EA 1LBYA 4PTKA 2F34A 4OVTA 1SW5A 2REGA 4EXLA 4U21A 5ESYA 4JSOA 2F6GA 3OENA 1MPCA 3LSXA 1OMPA 1B0LA 1D9YA 1IMFA 5AA1A 2O84X 4TLLB 5CI5A 5I7IA 1LFIA 1B58A 3QXMA 2VHAA 4RPNA 1ZJLA 1FBDA 2B4MA 1ZKBA 3EKIA 5FHOA 4KHZE 4JSDA 4H8IA 3T1BA 1BTJA 3LR1A 2ZMBA 3CFLA 1H3DA 4H8JA 2H5YA 3LSFB 2P2AA 4OESA 3TFLA 3GZGA 4KFQA 3IFAA 2HPGA 3CSGA 1NUZA 2WX9A 2XXHA 4PGNA 4JDFA 1UTBA 5IM2A 4QRZA 2F97A 1JW5A 2XWKA 1KWHA 4GWSA 4DCXA 2ZZXA 4U22A 1XC1A 3QIMA 3S9NC 1LFGA 2PBWA 4C1TA 3OO7A 3KG2A 2XXKA 1JEUA 2PFZA 1GVCA 4F22A 1LAGE 3PPNA 3OEKA 3PMXA 2F36A 4GX3A 4MJOA 1B46A 2Y7IA 4P56A 1J1NA 4PDDA 1A8EA 4MX6A 1PEBA 4P8BA 4QBAA 3E3KA 3IAZA 1Q9DA 4H67A 1MG1A 2CEXA 1CNQA 1LLSA 3TPAA 3N94A 3FBPA 1OVBA 3FVGA 1IXGA 4F2QA 2F3BA 5H8QB 3PMWA 3UORA 3EHTA 4LP2B 1NUYA 4KR5A 1A7LA 4Q0CA 1PB7A 4ZZEA 4XEQA 1VDWA 3CFXA 4R2FA 1B5IA 1NV0A 2B3BA 1L5TA 1LBVA 4H0WA 5CMMA 1H76A 2VGQA 4MHFA 2OCUA 1QKBA 2CZKA 2G29A 3IORA 2AL5A 3RN8A 3VV5A 4MEVA 1G0IA 3CG3A 2I49A 4HE2A 2OWZA 2HXRA 3M8UA 1I6AA 1Z7NE 1NV2A 2B3FA 1JQFA 1MPBA 1IXIA 4N13A 5TPAA 5J16A 1B7ZA 3BFUA 4XFEA 3FD3A 4F39A 2ZNTA 4LZ8A 3MBPA 4GBWA 3UP9A 1BLFA 3KN3A 1YCJA 3UK4A 4U4XA 1OQGA 4N6PA 3O9PA 4IO7A 4AB6A 4IO2A 4YICA 3LC8A 2QVVA 2OWTA 2Q2AA 4RYAA 3WAEA 2QRYA 4O7MA 3C33A 4YB7A 4F19A 3IJXB 2DE3A 1JP4A 4WEDA 3MQ9A 4DI3D 2DE4A 5ET7A 1LCTA 3ZKKA 4IR8A 2V25A 5JTYA 3CIJA 3PU5A 2UVGA 3QSLA 3KSJA 3L6GA 1DTGA 3CFZA 3ONMA 4AS5A 4Z0IA 5EQ9A 1LEVA 3EPEA 2HZLA 4EQBA 3TCHA 1YXIA 1IUDA 2O1MA 5DW8A 1PB9A 1FPDA 4FIMA 1IMEA 2OX3A 3MUQA 2H9BA 3S4UA 4I62A 3TODA 2DWAA 2ESNA 2HXWA 4HCYA 4R9FA 5I84A 3M3FA 1MQHA 2REJA 1B3GA 1MY1A 4P1EA 3TTLA 1MQJA 3W9VA 2XXIA 5HM4B 4FBPA 3R26A 4O7IA 5I58B 3KBRA 2WBBA 2FBPA 1NL5A 3E79A 4NQ8A 1AMFA 2H4IA 4QF9A 4MAGA 1D9VA 4ONYA 4I8CA 4X8RA 1RYXA 2Y5KA 5FTHA 5K2YA 1PBPA 2QVUA 2RC8A 2Q88A 3C34A 2W7YA 4GIZA 2OZZA 5F24A 4X1BA 1ZIUA 4TOZA 4QFKA 3PUWE 3WAFA 3RT8A 1SW4A 3EF7A 5L8DA 4NF6A 4ZECA 1HSJA 1NUWA 3UGWA 1MM6A 3CHGA 2H98A 4QFLA 4LATA 2GQ1A 4DXUA 5T3JA 5I56B 3KOTA 3U1OA 4PFUA 3JZJA 4NF4B 5EYFA 1UTBB 3PGFA 4WEPA 4OA4A 1QJMA 2RKMA 3HCQA 4DCYA 3IOUA 4C1UA 3U94A 3FZVA 4PE3A 3D4GA 3RYDA 1VE4A 1BKAA 1GV8A 5JEIA 3L6HA 5A5LA 4QFPA 3TTKA 1R6ZA 3IB1A 1LFHA 2I48A 4G77A 4GD5A 1CE2A 3B50A 1NH8A 4YZZA 4KYSA 4YB6A 1MH4A 4BDRA 3T0JA 4OVPA 3OO9A 2VOZA 4N81A 4EF1A 4LZ5A 4U2RA 1URGA 1NNPA 3H3GA 2WBDA 4HE0A 4GQOA 3VLWA 3GXAA 3TTRA 3RNNA 5J1DA 5DEXA 1R9QA 4F29A 3F11A 3K02A 3RT6B 4F3PA 1MXWA 5EYGA 3IOVA 4PC9A 2WYPA 3RPWA 3MPLA 4OANA 2XWOA 4XTCQ 1I6QA 1OVTA 1S50A 3SESA 1XS5A 1NV3A 1USYE 3TKDA 4OMBA 3TEPA 4IGTA 5CMKA 4F1VA 2PMSA 3PTYA 4OFLA 2R6GE 1FPBA 2Q9TA 4IY5A 3N26A 1HSEA 3MWBA 4IO5A 3ISPA 1YYZA 5H8SA 2MKZA 1INPA 3G3HA 1FBEA 3M3KA 3RPLB 1Y9UA 1SI0A 3R6UA 5IZ3B 1SPIA 1LB8A 4MF3A 2WYKA 2OWSA 4N4UA 4Q8RA 1MQGA 1MXXA 5I56A 5ITOA 1QUKA 3KEIA 1EYJA 3DP8A 3T9XB 4PF6A 4ELPA 3C35A 2XA5A 5H8FA 2PT1A 1NKXA 3THIA 2YJPA 3BIHA 4NHBA 1BP5A 2PX1A 3OO6A 2NVUB 1M5EA 3BBRA 5AA2D 2GRVA 1FSAA 3LUYA 4OFJA 1YAEA 3S9EA 4R6YA 4R72A 4NF8B 2QVRA 4XKRA 3PPOA 3OSQA 2HFBA 1EYKA 4DZ1A 3V89B 3DLNA 2F7CA 1Q35A 1XVXA 3D1RA 4EQ7A 2THIA 4F1UA 2WEFA 4G8MA 2G93A 3SEVA 5ICTA 1B3HA 4FECA 3V5AA 4MIJA 2VD3A 4JXIA 5LTCA 3QUFA 3G3GA 3FIRA 4GVOA 3T22A 1JNFA 1A8FA 2Q89A 2XWIA 4AB5A 1N3WA 5FTIA 1IXCA 1P1QA 3B6TA 2P1SA 3SETA 5I58A 1SW2A 4OVRA 3MVXA 3B7DA 1LSTA 3IX1A 3ZKLA 1VR5A 2UYEA 4ISUA 2UVHA 3ECRA 4NE4A 2QJEA 2Q8JA 3K4UA 1NV5A 3FVKA 1XT8A 1ELJA 1MH3A 2RINA 4P0IA 4DLDA 1HSLA 2I3WA 4OQOA 1MY3A 2F7AA 2PCRA 3PUZE 2FIEA 3H6VA 4GFRA 1BIYA 4XXUA 2KQZA 4UACA 3C32A 3PPPA 1S7YA 1JVYA 1RKMA 4Q5TA 4DXCA 5CBSA 5IKBA 4OVJA 2I6EA 2Y7WA 4G8NA 4IY6A 4U1ZA 4HW8A 4R9GA 1FJ6A 5KZTA 1NV4A 4F3SA 3E13X 3MAMA 4P11A 3N6UA 1URSA 5M2VA 3U8QA 4AQ4A 5FHNA 4NF6B 1LBXA 3SDFA 1EYIA 4KXPA 3G7WA 4G68B 2ONKE 5DVFA 4GRKA 4KQPA 4FEBA 4ZE9A 1XI6A 5ITPA 1IMDA 5EQ7A 1KA0A 4R2BA 4H65A 1PDAA 4F3BA 1Z7ME 1DBZA 2PFYA 4OXVA 1IXHA 1M5CA 2XXWA 4PFTA 3T93B 4ZDMA 2HEUA 3CRBA 1MDP1 1FBFA 1FBHA 2B65A 3KOSA 1CB6A 1O7TA 1WODA 3ILTB 2VT5A 1DMBA 4QSEA 4QSCA 2O1LA 1B5JA 4MCOA 4IGRA 2QS2A 4KPTA 4M1VA 5ELVA 4X48A 2UVIA 4ZEFA 3MVWA 2Y7PA 2RCBA 2KLFA 1A99A 3KC0A 4NF0A 1SW1A 2F3DA 2VPNA 5DTBA 2CZHA 4RY1A 4MMPA 3O97A 2HAVA 4NWDA 3ZSFA 4G8HA 2Z22A 3CVGA 5A5XA 3EHSA 1QUJA 2NWJA 3HSTA 3KFMA 1SYIA 3KJTA 4KYDA 3MZ9A 4HTGA 2CZLA 5EHMA 1FTJA 3H06B 3TMGA 3A3UA 4XKQA 5ET5A 1FPJA 5KCJA 2QL3A 2YPNA 3HN0A 3K2DA 5CRYA 2O6AA 3JV9A 1TFAA 1FPIA 3EN3A 5H8NA 2GH9A 1TFDA 4PAIA 2V3UA 5LDZA 2JJKA 4PQJA 1A54A 1UTHB 3Q26A 2ZYNA 2ANJA 4NMYA 1D3KA 4KYEA 4GWYA 2H99A 4OEVA 3K0VA 4GWUA 3MP8A 2QSXA 4PBHA 3GLBA 4YMAA 1NUXA 3FJGA 3MP6A 5I57A 2HZKA 2FVZA 4NG7A 2GHBA 1JW4A 1FQDA 2QMWA 4WXJA 2IA4A 4F2OA 3SEUA 4L17A 2O7IA 3SEYA 3RQTA 5L9SA 2I3VA 2P3VA 4KCCA 4ZE8A 1A40A 2XX9A 4X04A 1R1NA 2XXTA 4OZ9A 5I2KB 1N0TA 3Q28A 2M8CA 1AL3A 1NV7A 4XKPA 4JB7A 2FA7A 3H03A 5DVJA 5I2NB 2XHDA 4KI0E 4LUBA 4N6DA 4P9KA 3TELA 4Z7EA 2GHAA 2XD3A 2DWJA 3LBSA 4E0WA 4OENA 4NEDA 3K6UA 1EU8A 1FTAA 2ZXTA 3B8BA 2L5VA 5CMCA 2QPQA 4G68C 5FBPA 2V3QA 1B7HA 3K1MA 1FBGA 5ET6A 2Q74A 1G0HA 2ZZWA 1MY0A 4R6KA 1OLAA 4QHQA 2HQ0A 5TU0A 4N8GA 4GF8A 1Y3QA 4ZS9A 4YKPA 5HPQA 3KZGA 1K9YA 5EYHA 5IZZA 1YTVA 4RNSA 1FQEA 3T9VA 3FVNA 1MY4A 3K6VA 3FXBA 2XD2A 3PUVE 1B3EA 1LBWA 1Y20A 1NH7A 1GR2A 4RPOA 1ZMGA 1FPEA 4PFWA 2BJJX 5FHMA 1SD3A 1IMCA 1FQBA 4FE8A 3FXRA 5BWJA 3VDFA 1XOCA 2VP1A 1FPFA 3TTNA 3TZAA 2XXXA 1Y1ZA 4OHNA 3HHFA 3KGCA 3EQ1A 3RLFE 2ZYMA 5H8HB 1A55A 2R8TA 3OMBA 1YZ0A 4G2ZA 4MNPA 2F6PA 4H5FA 2XXUA 3MVZA 4H1XA 2ALUA 3IR1A 3H4ZA 2XXYA 1LAXA 3A29A 3U93A 3B6WA 5DVIA 3PV0E 3IB0A 4R73A 3K01A 1XHYA 1UIVA 3T66A 3O6IA 1H44A 4P0GA 2QS3A 1AWBA 4MLVA 5DT6A 2AIXA 3G3IA 2I0BA 4DI4B 1BK4A 4U1OA 4H45A 1MQDA 2XX8A 4QFNA 3O29A 4GXAA 3O28A 3BKIB 3USDA 1FPKA 4GXSB 5JTYB 3T9UA 1GGGA 5AA2A 1N7XA 2RF1A 2E1SA 5H8HA 1MPDA 2CZIA 2B4LA 3PMVA 1SDXA 3RUMA 3E4RA 1B32A 4EDPA 3IJOB 1JW1A 1US5A 4BDLA 3VLVA 3C31A 1MS7A 1N76A 3S9LC 5I59A 5F7VA 3GBBA 4ZEBA 1B5HA 4K3FA 4GWWA 4NX1A 3HV1A 4R74A 3CR9A 3HFUA 3E9XA 4ZZAA 2DQVA 4GL0A 4EUOA 1P1OA 3FGSA 2HAUA 4PFRA 1IMAA 3UN6A 4C0RA 4IB2A 4BDNA 1EZ9A 3KSXA 2VD2A 1LBZA 2XXRA 4AS4A 5EQAA 1N04A 1SI1A 3FJ7A 4EQ9A 1H45A 4F31B 2RCAA 3A09A 1FPLA 1T0KA 2Z8FA 3CSBA 1P99A 1WVJA 1NMUA 2Y84A 1QGXA 3FV2A 1RDZA 1F9BA 4RK9A 3TCGA 3VE1B 4N15A 1QKAA 4OERA 4KD5A 3MPKA 1P1UA 2HHMA 5I3SA 3SEXA 4ZEDA 4ESXA 4PDHA 1IITA 1LAHE 4YKJA 4XIGQ 3Q25A 4NF8A 3NOHA 2DVZA 3DP6A 1Q1KA 1FJ9A 4NF5B 1MDQA 2V3TA 3KJ7A 1LGBC 3A3CA 2PYYA 4LQ5A 1I69A 4LN5A 4PF8A 3MZ1A 4OVQA 4NAPA 5IGAA 1B0HA 1MXYA 4JWYA 3P7IA 2Z8DA 2R9JA 3K1PA 5IZ3A 1OLCA 1WDNA 4N91A 1DTZA 4LONB 5B7DA 5AE4A 4EXKA 5IZ1A 2DXRA 3V8XB 2F7BA 3MJNA 4ZEIA 4QFOA 3GYYA 2XXPA 1B05A 1FTKA 4IO6A 4BDQA 3MSTA 3UIFA 4GOTA 1DPEA 3O6GA 3C4MA 1FQCA 3LSWA 2FIXA 1JETA 4POWA 1N84A 3H6WA 4PFIA 4ELQA 4GBVA 2H25A 1N3XA 3IK6B 4LVQA 1FCKA 3Q29A 4JBZA 3FUZA 1PC3A 5TP9A 2O51A 3M3LA 5AA4B 1AOVA 1XVYA 4RXLA 1DCUA 1FTOA 2YLNA 1RDYA 1FRPA 1B9JA 1KZ8A 4R75A 1OIBA 3FJMA 4GLIA 2DSFA 1NNTA 3O2AA 4PAKA 2XXVA 1TXFA 3QUJA 1IMBA 1EZPA 4MBPA 4N6KA 4ND9A 1MXZA 3G3FA 1P1NA 3PPRA 3U65A 2XWVA 1VFDA 5IAIA 2ZNSA 4DXBA 3UA8A 2Y7RA 5HBCA 2OBGA 4P1LA 3PUYE 3E78A 4BDMA 4FJPA 1MXVA 1N7WA 1B3FA 1KA1A 3ILUB 4HXVA 3FASA 4PGPA 3SERA 1M5FA 1UQWA 3LUZA 1B1XA 5CM6A 3MC2A 3RGYA 4POXA 4MNIA 2A5SA 2IEEA 1Y3NA 4PP0A 2NOOA 4MNCA 3ODBA 3FVOA 4LA9A 1LBCA 3VLUA 5KDTB 4O3BA 1POTA 5B70A 3QK6A 2GFEA 1D9QA 2E0SA 4TLMB 3KBZA 2F78A 3TTMA 2QS4A 1NV6A 3TDJA 1MY2A 1I6BA 2UYFA 4HS7A 4IO3A 2V84A 2BJIA 4I3EA 5ISUA 3TAJA 4H46A 4XF5A 3O66A 4YU0A 3LSLA 5JK4A 1K9ZA 2AL4A 4PBQA 1LB9A 5EHSA 5K2XA 2ZYOA 4FEDA 3K6XA 1URDA 3IB2A 2I58A 2AYSA 4MH5A 2F35A 2I0CA 4BDOA 4YKKA 1AIVA 3FXUA 3U72A 4F1YA 2DVCA 5I5PA 4X1DA 4I1DA 4LZ7A 1Y4TA 4PFBA 5I2KA 1IZ1A 1B3LA 5LOMA 1B6HA 3MZBA 4HE1A 3QYTA 3HO7A 4H5GA 4ECFA 3OXNA 3HHGA 1II5A 5TPAB 1LAFE 3V83A 1POY1 4ELOA 1P1WA 3K6WA 4TQUQ 2XX7A 3FXQA 5I57B 4P3LA 1USYH 4BLAA 1B40A 2DWHA 3TQWA 1PB8A 1FQFA 2A5TB 2V4CA 4DDDA
chains in the Genus database with same CATH topology
4F22A 1LAGE 2F7CA 1Q35A 1XHYA 1IIWA 1XVXA 3PPNA 3OEKA 4EF2A 2THIA 4EQ7A 4F1UA 3PMXA 1UIVA 2F36A 1B46A 2Y7IA 3T66A 2X26A 1J1NA 4G8MA 2G93A 3O6IA 4NTLA 1H44A 2RC9A 3SEVA 4P0GA 2QS3A 1A8EA 5ICTA 1B3HA 1MRPA 4FECA 1PEBA 3V5AA 4F3GA 2VD3A 1B1HA 4JXIA 4MLVA 3ZS6A 5DT6A 3E3KA 2AIXA 3G3KA 3QUFA 3G3IA 2I0BA 3G3GA 3USDA 1FTMA 5DYHA 4U1OA 1SBPA 1MQDA 3IAZA 2XX8A 3FIRA 4H67A 2OLBA 1MG1A 4GVOA 3T22A 4QFNA 1JNFA 3O29A 3R7XA 3VXCA 3KN8A 1A8FA 2Q89A 1LLSA 4GXAA 4AB5A 3O28A 3BKIB 1N3WA 5FTIA 3TPAA 1IXCA 1P1QA 2R71A 3B6TA 3K00A 3N94A 3TUSA 4GXSB 2P1SA 5JTYB 3SETA 1SYHA 5I58A 1OVBA 3FVGA 3T9UA 1GGGA 1SW2A 4IO4A 3S2VA 4OETA 5AA2A 1FTLA 1UTHA 1IXGA 5CMBA 2O7UA 1N7XA 4F2QA 2RF1A 2E1SA 5KCJB 3MVXA 4OEUA 3B7DA 1LSTA 3IO6A 2QS1A 3IX1A 5H8HA 3ZKLA 5H8QB 3QAXA 1MPDA 3PMWA 3UORA 1VR5A 2UYEA 3EHTA 2UVHA 3PMVA 4ISUA 4LP2B 4THIA 4UA8A 1SDXA 3DELB 4GL8A 3ECRA 4KR5A 1A7LA 3RUMA 4Q0CA 3E4RA 4NE4A 1PB7A 4ZZEA 1B32A 1ZU0A 1DSNA 2OJTA 3CFXA 4EDPA 4R2FA 3CI8A 1B5IA 3IJOB 2FNCA 2B3BA 2QJEA 3OOAA 1L5TA 4H0WA 1JW1A 2Q8JA 2DWIA 3K4UA 5CMMA 1H76A 1US5A 1XT8A 2VGQA 3FVKA 4YKIA 4BDLA 1ELJA 1Y4CA 1MM7A 1MH3A 1QKBA 2G29A 2OCUA 2RINA 2AL5A 3C31A 1MS7A 3IORA 1N76A 4U4SA 3RN8A 1NNFA 3VV5A 4M4GA 3I5OA 1TT1A 4P0IA 3S9LC 4DLDA 5I59A 3CG3A 1HSLA 2ONSA 4OWDA 3SEWA 2I3WA 2I49A 4OQOA 2HCAA 5F7VA 3GBBA 1MY3A 2F7AA 3S9MC 3M8UA 4ZEBA 1I6AA 1Z7NE 1ZLQA 1B5HA 1JVXA 1JQFA 1MPBA 1B7UA 1IXIA 2B3FA 3PUZE 4N13A 4K3FA 5TPAA 1B7ZA 3HV1A 1JEVA 2ONRA 3H6VA 3IOWA 3OELA 4GFRA 3BFUA 3FD3A 1BIYA 4OYVA 4R74A 4XXUA 4F39A 3CR9A 2ZNTA 4LZ8A 4UACA 3C32A 3E9XA 3PPPA 1OQHA 4ZZAA 2DQVA 2I4BA 3MBPA 3PD8A 4GL0A 4EUOA 2P0SA 1DOTA 1BLFA 3KN3A 3UP9A 5H8NB 1S7YA 3SKPA 1P1OA 1YCJA 1D4NA 3FGSA 1JVYA 1RKMA 4MFIA 2HAUA 3UK4A 4Q5TA 4DXCA 4U4XA 5CBSA 1OQGA 4N6PA 4RJZA 3O9PA 2DP8A 2A5TA 3UN6A 4C0RA 4IO7A 5IKBA 4AB6A 4IB2A 4OVJA 4IO2A 4YICA 2I6EA 2Y7WA 3LC8A 4BDNA 4FAJA 5AA2B 1EZ9A 3KSXA 2PT2A 3VVEA 1MQIA 1VFEA 2VD2A 3TCFA 3U92A 4G8NA 2OWTA 2XXRA 4IY6A 2Q2AA 4RYAA 4U1ZA 4R9GA 4HW8A 3VVFA 5KZTA 4F3SA 1ZBMA 3E13X 1N04A 2QRYA 3MAMA 1O64A 4P11A 3WAEA 3N6UA 1SI1A 4G4PA 2X7PA 1URSA 5M2VA 3U8QA 3FJ7A 3VVDA 2DYXA 4EQ9A 3C33A 4AQ4A 4YB7A 1H45A 2LAOA 4NF6B 1SQYA 5FHNA 2RCAA 3SDFA 4F19A 3A09A 4F31B 1T0KA 3IJXB 2DE3A 2Z8FA 3CSBA 3G7WA 1P99A 2ONKE 3K1NA 1WVJA 3MQ9A 3OD7A 4G68B 1EZOA 1B2HA 1NMUA 2Y84A 5DVFA 1IQ7A 4GRKA 4KQPA 3HPIA 4FEBA 3OEMA 4ELRA 4ZE9A 2DE4A 3FV2A 4RA1A 3RTWB 1LCTA 3ZKKA 1AH5A 5ITPA 2V25A 1F9BA 3CIJA 2F5XA 3DM0A 4RK9A 5JTYA 3H7MA 4R2BA 3TCGA 4H65A 1PDAA 3PU5A 2UVGA 3VE1B 1Z7ME 1GTKA 3QSLA 4F3BA 2QMXA 4F18A 3KSJA 3L6GA 1NFTA 4OXVA 1IXHA 1M5CA 1DTGA 4I9DA 1QKAA 3CFZA 2XXWA 4PFTA 3T93B 4OERA 4KD5A 3ONMA 4ZDMA 2HEUA 3MPKA 1P1UA 3CRBA 1MDP1 1NNKA 4O3AA 4Z0IA 3PD9A 1TWYA 3SEXA 3PPQA 2B65A 2O68A 4ESXA 3KOSA 4ZEDA 3FATA 3EPEA 3MP1A 5A5XB 1CB6A 2HZLA 1IITA 1LAHE 3IO4A 4YKJA 4WKMA 4XIGQ 3H6TA 4N07A 1M5DA 3Q25A 1O7TA 4LQ2A 1WODA 3ILTB 4NF8A 2DVZA 4EQBA 3DP6A 1Q1KA 1DMBA 3TCHA 4QSEA 4E0XA 1IUDA 2O1MA 4QSCA 2O1LA 1B5JA 4NF5B 5I59B 1PB9A 5F1QA 4IGRA 2QS2A 4KPTA 4M1VA 3T9HB 1MDQA 2V3TA 4FIMA 4X48A 5ELVA 2UVIA 1B51A 3KJ7A 3MVWA 3MUQA 2Y7PA 1LGBC 3A3CA 4ZEFA 2PYYA 2RCBA 1LCFA 3KN7A 2KLFA 1I69A 4LQ5A 4RK2A 1A99A 1QW0A 2H9BA 1Y3PA 5H8QA 3S4UA 1B4HA 3MZ1A 1SW1A 4OTEA 4I62A 5DTBA 3TODA 2DWAA 2FYIA 4R6HA 4RY1A 4NWCA 2ESNA 2HXWA 3O97A 1B0HA 1MXYA 2HAVA 4HCYA 1DPPA 4NWDA 4R9FA 4JWYA 4WEDA 3ZSFA 4G8HA 2ABHA 4QSDA 3P7IA 2Z8DA 3M3FA 2Z22A 5I84A 3CVGA 2R9JA 5A5XA 1MQHA 3EHSA 1QUJA 3K1PA 2NWJA 3HSTA 2REJA 1B3GA 1MY1A 3KFMA 3TTLA 1SYIA 1OLCA 1R9LA 1WDNA 3KJTA 3MZ9A 4KYDA 2DOJA 3SEYA 1DTZA 4HTGA 1MQJA 4LONB 1O63A 2UVJA 3W9VA 5B7DA 2CMOA 2XXIA 5AE4A 5HM4B 1Y1MA 3R26A 2CZLA 4EXKA 5EHMA 1FTJA 3T96B 5I58B 1MXUA 3N6TA 3H06B 3TMGA 2DXRA 3A3UA 3D4CA 3I3VA 4R73A 3V8XB 3KBRA 2F7BA 4DE8A 4XKQA 5KCJA 3N5LA 3MVYA 4MLQA 3MJNA 4ZEIA 1B4ZA 1LBBA 4QFOA 1NL5A 2QL3A 2XXPA 2YPNA 1B05A 1AMFA 3HN0A 1FTKA 2H4IA 3K2DA 4IO6A 4QF9A 5CRYA 4BDQA 5L9OA 3UIFA 1H43A 1D9VA 2O6AA 4ONYA 2RC7A 3VXBA 1VSOA 3C36A 3JV9A 4I8CA 3OO8A 2ZYKA 4GOTA 1TFAA 1DPEA 1RYXA 5CBRA 3EN3A 5FTHA 5K2YA 3O6GA 1PBPA 3C4MA 5H8NA 2GH9A 1TFDA 1FQCA 1M5BA 3LSWA 1IEJA 1JETA 2RC8A 2V3UA 1ATGA 4POWA 2Q88A 1RYOA 3G3JA 1N84A 3C34A 2W7YA 4GIZA 1QUIA 2OZZA 3H6WA 4X1BA 2DS9A 2NXOA 2D21A 5BUUA 4PQJA 1PBQA 1A54A 1UTHB 1ZIUA 2V93A 3Q26A 2Y7KA 2ZYNA 4TOZA 4ELQA 2ANJA 4NMYA 1D3KA 4KYEA 4QFKA 3RY3A 2H25A 3VFJA 1N3XA 3PUWE 2WKYA 4H6DA 3WAFA 3IK6B 4LVQA 1SW4A 2H99A 3RT8A 4PETA 1FCKA 3Q29A 4OEVA 3BFTA 4JBZA 3FUZA 1PC3A 3K0VA 2O51A 2ZNUA 3EF7A 3I6VA 3M3LA 3OSRA 2OK2A 3MP8A 4GWOA 5L8DA 3W15C 2QSXA 4NF6A 1HSJA 1UIUA 4JWXA 4ZECA 1XVYA 3GLBA 4RXLA 4YMAA 3UGWA 3FJGA 1FTOA 1MM6A 3MP6A 5CC2A 5I57A 2H98A 2YLNA 2HZKA 3IL1B 4QFLA 2GHBA 1JW4A 1FQDA 1B9JA 4R75A 1FQAA 3EHUA 1OIBA 4LATA 3W9WA 2QMWA 4WXJA 3FJMA 4GLIA 4DXUA 2DSFA 5KDTA 1NNTA 3O2AA 2IA4A 5I2NA 2Z23A 4F2OA 5I56B 3KOTA 2X7QA 3SEUA 3U1OA 2XXVA 1TXFA 3CG1A 3QUJA 4PFUA 1QULA 4FATA 4L17A 2O7IA 3DP4A 3JZJA 4NF4B 5DEXB 5EYFA 1UTBB 5H8FB 1ZTYA 2D3IA 3PGFA 3RQTA 2I3VA 5L9SA 1EZPA 4WEPA 4MBPA 4FORA 1QJMA 4ND9A 4KCCA 1MXZA 2RKMA 3HCQA 4DCYA 3G3FA 1P1NA 3IOUA 4JWOA 3PPRA 4ZE8A 3U94A 4C1UA 1VFDA 1A40A 2XX9A 5AA4A 5TP9B 4PE5B 2ZNSA 5IAIA 3FZVA 4G68A 1R1NA 3UA8A 2Y7RA 4DXBA 3D4GA 2XXTA 4OZ9A 4ESWA 5HBCA 3O6HA 5I2KB 4U23A 1VE4A 2OBGA 3IOTA 1N0TA 5AA3A 1BKAA 4YMBA 1GV8A 3PUYE 5JEIA 3Q28A 4BDMA 3L6HA 2M8CA 3JYRA 4X9TA 1AL3A 4XKPA 2O69A 4FJPA 4NF5A 4QFPA 3TTKA 1R6ZA 4HCWA 1MXVA 4JB7A 2FA7A 2DE2A 4DIGA 5TP9A 1N7WA 1B3FA 3H03A 3IB1A 5DVJA 4YAHX 2XHDA 4KI0E 4LUBA 3B6QA 5I2NB 1FW0A 1LFHA 2I48A 4G77A 3TYHA 5ICQA 3H6UA 3ILUB 4GD5A 3TELA 3FASA 1CE2A 4Z7EA 3SERA 1US4A 1M5FA 2GHAA 1NH8A 1UQWA 2D5WA 1S9TA 2PVUA 2XD3A 4YZZA 2DWJA 1EH3A 3AXFA 1B1XA 5CM6A 3LBSA 4E0WA 3MC2A 3PUXE 4KYSA 4POXA 3RGYA 4OENA 4YB6A 4NEDA 1MH4A 2A5SA 3K6UA 2IEEA 1Y3NA 2XXQA 4PP0A 4BDRA 2NOOA 1EU8A 1SVXB 1B52A 2NUVA 3C9HA 1QVSA 3ODBA 2Q2CA 4PFYA 4Q30B 3OO9A 2VOZA 2ZXTA 3FVOA 2UXAA 5L9MA 4LA9A 1LBCA 4LZ5A 4OFOA 3Q27A 4U2RA 3VLUA 4EF1A 4XKNA 2DXYA 1URGA 1NNPA 5CMCA 3H3GA 4O3CA 2QPQA 4G68C 2I4CA 2V3QA 5KDTB 4ZEKA 3FV1A 2F8DA 4GQOA 4YB5A 4O3BA 3RTFB 3VLWA 1B7HA 4KCDA 1POTA 3GXAA 5B70A 3QK6A 3TQLA 2GFEA 3TTRA 3K1MA 3MW0A 3RNNA 1ANFA 1YPNA 4NF4A 1R9QA 1MY0A 2Z8EA 3GBAA 5DEXA 5J1DA 2F34A 4R6KA 1OLAA 4QHQA 2E0SA 1SW5A 3F11A 3K02A 4TLMB 2F78A 4F29A 3TTMA 3RT6B 2QS4A 2HQ0A 2REGA 5TU0A 4EXLA 4U21A 4F3PA 1MXWA 4GF8A 5BWJA 1Y3QA 4ZS9A 4JSOA 4YKPA 2F6GA 3OENA 1MY2A 3TDJA 3IOVA 1MPCA 1I6BA 5HPQA 2UYFA 3LSXA 4HS7A 3KZGA 1OMPA 1B0LA 1D9YA 2V84A 4IO3A 3RPWA 3MPLA 5ISUA 1YTVA 4RNSA 5AA1A 2O84X 1FQEA 4TLLB 5CI5A 3TAJA 4XTCQ 1I6QA 1OVTA 3T9VA 1S50A 1LFIA 1B58A 1MY4A 2VHAA 3FVNA 3QXMA 4RPNA 5AA4B 3K6VA 1ZJLA 3SESA 3O66A 4YU0A 3LSLA 2XD2A 3PUVE 1XS5A 1B3EA 5JK4A 1USYE 3TKDA 1ZKBA 4OMBA 3TEPA 1Y20A 2AL4A 4IGTA 5CMKA 1LB9A 5EHSA 1NH7A 1GR2A 4F1VA 5FHOA 2PMSA 4OFLA 4RPOA 2R6GE 2ZYOA 5K2XA 2Q9TA 4FEDA 1ZMGA 3K6XA 4IY5A 1URDA 3IB2A 2I58A 3N26A 4PFWA 1HSEA 2BJJX 2AYSA 3MWBA 2F35A 4MH5A 5FHMA 4IO5A 4KHZE 1SD3A 2I0CA 4JSDA 5H8SA 4H8IA 4BDOA 4YKKA 1FQBA 1BTJA 4FE8A 1AIVA 3LR1A 3G3HA 2ZMBA 3M3KA 3FXRA 3CFLA 3FXUA 3U72A 1H3DA 2DVCA 1Y9UA 4F1YA 4X1DA 4H8JA 1SI0A 3VDFA 4I1DA 2H5YA 3LSFB 1Y4TA 4LZ7A 5I2KA 3R6UA 1IZ1A 1XOCA 2VP1A 1B3LA 5LOMA 2P2AA 4OESA 1B6HA 1LB8A 3TFLA 3TTNA 3MZBA 3TZAA 4MF3A 3GZGA 4KFQA 2XXXA 1Y1ZA 2OWSA 3VLVA 4Q8RA 1MQGA 1MXXA 4OHNA 3HHFA 5I56A 3QYTA 5ITOA 1QUKA 3KEIA 3KGCA 3DP8A 3HO7A 3T9XB 3CSGA 4H5GA 2XXHA 3EQ1A 3RLFE 2ZYMA 4ELPA 3C35A 4JDFA 1UTBA 5H8FA 5H8HB 4ECFA 2PT1A 1NKXA 3THIA 2YJPA 1A55A 4QRZA 2F97A 3OXNA 1BP5A 1JW5A 2PX1A 3OMBA 4G2ZA 1KWHA 1II5A 3HHGA 3OO6A 5TPAB 2NVUB 1M5EA 1LAFE 2F6PA 4H5FA 3BBRA 5AA2D 4DCXA 3V83A 1AOVA 2XXUA 1POY1 2GRVA 3LUYA 3MVZA 1XC1A 1P1WA 3K01A 3K6WA 3QIMA 4H1XA 4U22A 4OFJA 4ELOA 3S9NC 2ALUA 1YAEA 1LFGA 2PBWA 2XX7A 3IR1A 4R6YA 3H4ZA 4TQUQ 3FXQA 4R72A 3S9EA 5I57B 4NF8B 4C1TA 1USYH 2XXYA 1LAXA 3OO7A 4BLAA 4XKRA 1B40A 3PPOA 3KG2A 3U93A 3B6WA 3OSQA 2DWHA 2HFBA 5DVIA 3TQWA 1JEUA 1PB8A 3PV0E 1FQFA 2A5TB 4DZ1A 3IB0A 4DDDA 3V89B 1GVCA 3DLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F22 A;  1LAG E;  2F7C A;  1Q35 A;  1XHY A;  1IIW A;  1XVX A;  3PPN A;  3OEK A;  4EF2 A;  2THI A;  4EQ7 A;  4F1U A;  3PMX A;  1UIV A;  2F36 A;  1B46 A;  2Y7I A;  3T66 A;  2X26 A;  1J1N A;  4G8M A;  2G93 A;  3O6I A;  4NTL A;  1H44 A;  2RC9 A;  3SEV A;  4P0G A;  2QS3 A;  1A8E A;  5ICT A;  1B3H A;  1MRP A;  4FEC A;  1PEB A;  3V5A A;  4F3G A;  2VD3 A;  1B1H A;  4JXI A;  4MLV A;  3ZS6 A;  5DT6 A;  3E3K A;  2AIX A;  3G3K A;  3QUF A;  3G3I A;  2I0B A;  3G3G A;  3USD A;  1FTM A;  5DYH A;  4U1O A;  1SBP A;  1MQD A;  3IAZ A;  2XX8 A;  3FIR A;  4H67 A;  2OLB A;  1MG1 A;  4GVO A;  3T22 A;  4QFN A;  1JNF A;  3O29 A;  3R7X A;  3VXC A;  3KN8 A;  1A8F A;  2Q89 A;  1LLS A;  4GXA A;  4AB5 A;  3O28 A;  3BKI B;  1N3W A;  5FTI A;  3TPA A;  1IXC A;  1P1Q A;  2R71 A;  3B6T A;  3K00 A;  3N94 A;  3TUS A;  4GXS B;  2P1S A;  5JTY B;  3SET A;  1SYH A;  5I58 A;  1OVB A;  3FVG A;  3T9U A;  1GGG A;  1SW2 A;  4IO4 A;  3S2V A;  4OET A;  5AA2 A;  1FTL A;  1UTH A;  1IXG A;  5CMB A;  2O7U A;  1N7X A;  4F2Q A;  2RF1 A;  2E1S A;  5KCJ B;  3MVX A;  4OEU A;  3B7D A;  1LST A;  3IO6 A;  2QS1 A;  3IX1 A;  5H8H A;  3ZKL A;  5H8Q B;  3QAX A;  1MPD A;  3PMW A;  3UOR A;  1VR5 A;  2UYE A;  3EHT A;  2UVH A;  3PMV A;  4ISU A;  4LP2 B;  4THI A;  4UA8 A;  1SDX A;  3DEL B;  4GL8 A;  3ECR A;  4KR5 A;  1A7L A;  3RUM A;  4Q0C A;  3E4R A;  4NE4 A;  1PB7 A;  4ZZE A;  1B32 A;  1ZU0 A;  1DSN A;  2OJT A;  3CFX A;  4EDP A;  4R2F A;  3CI8 A;  1B5I A;  3IJO B;  2FNC A;  2B3B A;  2QJE A;  3OOA A;  1L5T A;  4H0W A;  1JW1 A;  2Q8J A;  2DWI A;  3K4U A;  5CMM A;  1H76 A;  1US5 A;  1XT8 A;  2VGQ A;  3FVK A;  4YKI A;  4BDL A;  1ELJ A;  1Y4C A;  1MM7 A;  1MH3 A;  1QKB A;  2G29 A;  2OCU A;  2RIN A;  2AL5 A;  3C31 A;  1MS7 A;  3IOR A;  1N76 A;  4U4S A;  3RN8 A;  1NNF A;  3VV5 A;  4M4G A;  3I5O A;  1TT1 A;  4P0I A;  3S9L C;  4DLD A;  5I59 A;  3CG3 A;  1HSL A;  2ONS A;  4OWD A;  3SEW A;  2I3W A;  2I49 A;  4OQO A;  2HCA A;  5F7V A;  3GBB A;  1MY3 A;  2F7A A;  3S9M C;  3M8U A;  4ZEB A;  1I6A A;  1Z7N E;  1ZLQ A;  1B5H A;  1JVX A;  1JQF A;  1MPB A;  1B7U A;  1IXI A;  2B3F A;  3PUZ E;  4N13 A;  4K3F A;  5TPA A;  1B7Z A;  3HV1 A;  1JEV A;  2ONR A;  3H6V A;  3IOW A;  3OEL A;  4GFR A;  3BFU A;  3FD3 A;  1BIY A;  4OYV A;  4R74 A;  4XXU A;  4F39 A;  3CR9 A;  2ZNT A;  4LZ8 A;  4UAC A;  3C32 A;  3E9X A;  3PPP A;  1OQH A;  4ZZA A;  2DQV A;  2I4B A;  3MBP A;  3PD8 A;  4GL0 A;  4EUO A;  2P0S A;  1DOT A;  1BLF A;  3KN3 A;  3UP9 A;  5H8N B;  1S7Y A;  3SKP A;  1P1O A;  1YCJ A;  1D4N A;  3FGS A;  1JVY A;  1RKM A;  4MFI A;  2HAU A;  3UK4 A;  4Q5T A;  4DXC A;  4U4X A;  5CBS A;  1OQG A;  4N6P A;  4RJZ A;  3O9P A;  2DP8 A;  2A5T A;  3UN6 A;  4C0R A;  4IO7 A;  5IKB A;  4AB6 A;  4IB2 A;  4OVJ A;  4IO2 A;  4YIC A;  2I6E A;  2Y7W A;  3LC8 A;  4BDN A;  4FAJ A;  5AA2 B;  1EZ9 A;  3KSX A;  2PT2 A;  3VVE A;  1MQI A;  1VFE A;  2VD2 A;  3TCF A;  3U92 A;  4G8N A;  2OWT A;  2XXR A;  4IY6 A;  2Q2A A;  4RYA A;  4U1Z A;  4R9G A;  4HW8 A;  3VVF A;  5KZT A;  4F3S A;  1ZBM A;  3E13 X;  1N04 A;  2QRY A;  3MAM A;  1O64 A;  4P11 A;  3WAE A;  3N6U A;  1SI1 A;  4G4P A;  2X7P A;  1URS A;  5M2V A;  3U8Q A;  3FJ7 A;  3VVD A;  2DYX A;  4EQ9 A;  3C33 A;  4AQ4 A;  4YB7 A;  1H45 A;  2LAO A;  4NF6 B;  1SQY A;  5FHN A;  2RCA A;  3SDF A;  4F19 A;  3A09 A;  4F31 B;  1T0K A;  3IJX B;  2DE3 A;  2Z8F A;  3CSB A;  3G7W A;  1P99 A;  2ONK E;  3K1N A;  1WVJ A;  3MQ9 A;  3OD7 A;  4G68 B;  1EZO A;  1B2H A;  1NMU A;  2Y84 A;  5DVF A;  1IQ7 A;  4GRK A;  4KQP A;  3HPI A;  4FEB A;  3OEM A;  4ELR A;  4ZE9 A;  2DE4 A;  3FV2 A;  4RA1 A;  3RTW B;  1LCT A;  3ZKK A;  1AH5 A;  5ITP A;  2V25 A;  1F9B A;  3CIJ A;  2F5X A;  3DM0 A;  4RK9 A;  5JTY A;  3H7M A;  4R2B A;  3TCG A;  4H65 A;  1PDA A;  3PU5 A;  2UVG A;  3VE1 B;  1Z7M E;  1GTK A;  3QSL A;  4F3B A;  2QMX A;  4F18 A;  3KSJ A;  3L6G A;  1NFT A;  4OXV A;  1IXH A;  1M5C A;  1DTG A;  4I9D A;  1QKA A;  3CFZ A;  2XXW A;  4PFT A;  3T93 B;  4OER A;  4KD5 A;  3ONM A;  4ZDM A;  2HEU A;  3MPK A;  1P1U A;  3CRB A;  1MDP 1;  1NNK A;  4O3A A;  4Z0I A;  3PD9 A;  1TWY A;  3SEX A;  3PPQ A;  2B65 A;  2O68 A;  4ESX A;  3KOS A;  4ZED A;  3FAT A;  3EPE A;  3MP1 A;  5A5X B;  1CB6 A;  2HZL A;  1IIT A;  1LAH E;  3IO4 A;  4YKJ A;  4WKM A;  4XIG Q;  3H6T A;  4N07 A;  1M5D A;  3Q25 A;  1O7T A;  4LQ2 A;  1WOD A;  3ILT B;  4NF8 A;  2DVZ A;  4EQB A;  3DP6 A;  1Q1K A;  1DMB A;  3TCH A;  4QSE A;  4E0X A;  1IUD A;  2O1M A;  4QSC A;  2O1L A;  1B5J A;  4NF5 B;  5I59 B;  1PB9 A;  5F1Q A;  4IGR A;  2QS2 A;  4KPT A;  4M1V A;  3T9H B;  1MDQ A;  2V3T A;  4FIM A;  4X48 A;  5ELV A;  2UVI A;  1B51 A;  3KJ7 A;  3MVW A;  3MUQ A;  2Y7P A;  1LGB C;  3A3C A;  4ZEF A;  2PYY A;  2RCB A;  1LCF A;  3KN7 A;  2KLF A;  1I69 A;  4LQ5 A;  4RK2 A;  1A99 A;  1QW0 A;  2H9B A;  1Y3P A;  5H8Q A;  3S4U A;  1B4H A;  3MZ1 A;  1SW1 A;  4OTE A;  4I62 A;  5DTB A;  3TOD A;  2DWA A;  2FYI A;  4R6H A;  4RY1 A;  4NWC A;  2ESN A;  2HXW A;  3O97 A;  1B0H A;  1MXY A;  2HAV A;  4HCY A;  1DPP A;  4NWD A;  4R9F A;  4JWY A;  4WED A;  3ZSF A;  4G8H A;  2ABH A;  4QSD A;  3P7I A;  2Z8D A;  3M3F A;  2Z22 A;  5I84 A;  3CVG A;  2R9J A;  5A5X A;  1MQH A;  3EHS A;  1QUJ A;  3K1P A;  2NWJ A;  3HST A;  2REJ A;  1B3G A;  1MY1 A;  3KFM A;  3TTL A;  1SYI A;  1OLC A;  1R9L A;  1WDN A;  3KJT A;  3MZ9 A;  4KYD A;  2DOJ A;  3SEY A;  1DTZ A;  4HTG A;  1MQJ A;  4LON B;  1O63 A;  2UVJ A;  3W9V A;  5B7D A;  2CMO A;  2XXI A;  5AE4 A;  5HM4 B;  1Y1M A;  3R26 A;  2CZL A;  4EXK A;  5EHM A;  1FTJ A;  3T96 B;  5I58 B;  1MXU A;  3N6T A;  3H06 B;  3TMG A;  2DXR A;  3A3U A;  3D4C A;  3I3V A;  4R73 A;  3V8X B;  3KBR A;  2F7B A;  4DE8 A;  4XKQ A;  5KCJ A;  3N5L A;  3MVY A;  4MLQ A;  3MJN A;  4ZEI A;  1B4Z A;  1LBB A;  4QFO A;  1NL5 A;  2QL3 A;  2XXP A;  2YPN A;  1B05 A;  1AMF A;  3HN0 A;  1FTK A;  2H4I A;  3K2D A;  4IO6 A;  4QF9 A;  5CRY A;  4BDQ A;  5L9O A;  3UIF A;  1H43 A;  1D9V A;  2O6A A;  4ONY A;  2RC7 A;  3VXB A;  1VSO A;  3C36 A;  3JV9 A;  4I8C A;  3OO8 A;  2ZYK A;  4GOT A;  1TFA A;  1DPE A;  1RYX A;  5CBR A;  3EN3 A;  5FTH A;  5K2Y A;  3O6G A;  1PBP A;  3C4M A;  5H8N A;  2GH9 A;  1TFD A;  1FQC A;  1M5B A;  3LSW A;  1IEJ A;  1JET A;  2RC8 A;  2V3U A;  1ATG A;  4POW A;  2Q88 A;  1RYO A;  3G3J A;  1N84 A;  3C34 A;  2W7Y A;  4GIZ A;  1QUI A;  2OZZ A;  3H6W A;  4X1B A;  2DS9 A;  2NXO A;  2D21 A;  5BUU A;  4PQJ A;  1PBQ A;  1A54 A;  1UTH B;  1ZIU A;  2V93 A;  3Q26 A;  2Y7K A;  2ZYN A;  4TOZ A;  4ELQ A;  2ANJ A;  4NMY A;  1D3K A;  4KYE A;  4QFK A;  3RY3 A;  2H25 A;  3VFJ A;  1N3X A;  3PUW E;  2WKY A;  4H6D A;  3WAF A;  3IK6 B;  4LVQ A;  1SW4 A;  2H99 A;  3RT8 A;  4PET A;  1FCK A;  3Q29 A;  4OEV A;  3BFT A;  4JBZ A;  3FUZ A;  1PC3 A;  3K0V A;  2O51 A;  2ZNU A;  3EF7 A;  3I6V A;  3M3L A;  3OSR A;  2OK2 A;  3MP8 A;  4GWO A;  5L8D A;  3W15 C;  2QSX A;  4NF6 A;  1HSJ A;  1UIU A;  4JWX A;  4ZEC A;  1XVY A;  3GLB A;  4RXL A;  4YMA A;  3UGW A;  3FJG A;  1FTO A;  1MM6 A;  3MP6 A;  5CC2 A;  5I57 A;  2H98 A;  2YLN A;  2HZK A;  3IL1 B;  4QFL A;  2GHB A;  1JW4 A;  1FQD A;  1B9J A;  4R75 A;  1FQA A;  3EHU A;  1OIB A;  4LAT A;  3W9W A;  2QMW A;  4WXJ A;  3FJM A;  4GLI A;  4DXU A;  2DSF A;  5KDT A;  1NNT A;  3O2A A;  2IA4 A;  5I2N A;  2Z23 A;  4F2O A;  5I56 B;  3KOT A;  2X7Q A;  3SEU A;  3U1O A;  2XXV A;  1TXF A;  3CG1 A;  3QUJ A;  4PFU A;  1QUL A;  4FAT A;  4L17 A;  2O7I A;  3DP4 A;  3JZJ A;  4NF4 B;  5DEX B;  5EYF A;  1UTB B;  5H8F B;  1ZTY A;  2D3I A;  3PGF A;  3RQT A;  2I3V A;  5L9S A;  1EZP A;  4WEP A;  4MBP A;  4FOR A;  1QJM A;  4ND9 A;  4KCC A;  1MXZ A;  2RKM A;  3HCQ A;  4DCY A;  3G3F A;  1P1N A;  3IOU A;  4JWO A;  3PPR A;  4ZE8 A;  3U94 A;  4C1U A;  1VFD A;  1A40 A;  2XX9 A;  5AA4 A;  5TP9 B;  4PE5 B;  2ZNS A;  5IAI A;  3FZV A;  4G68 A;  1R1N A;  3UA8 A;  2Y7R A;  4DXB A;  3D4G A;  2XXT A;  4OZ9 A;  4ESW A;  5HBC A;  3O6H A;  5I2K B;  4U23 A;  1VE4 A;  2OBG A;  3IOT A;  1N0T A;  5AA3 A;  1BKA A;  4YMB A;  1GV8 A;  3PUY E;  5JEI A;  3Q28 A;  4BDM A;  3L6H A;  2M8C A;  3JYR A;  4X9T A;  1AL3 A;  4XKP A;  2O69 A;  4FJP A;  4NF5 A;  4QFP A;  3TTK A;  1R6Z A;  4HCW A;  1MXV A;  4JB7 A;  2FA7 A;  2DE2 A;  4DIG A;  5TP9 A;  1N7W A;  1B3F A;  3H03 A;  3IB1 A;  5DVJ A;  4YAH X;  2XHD A;  4KI0 E;  4LUB A;  3B6Q A;  5I2N B;  1FW0 A;  1LFH A;  2I48 A;  4G77 A;  3TYH A;  5ICQ A;  3H6U A;  3ILU B;  4GD5 A;  3TEL A;  3FAS A;  1CE2 A;  4Z7E A;  3SER A;  1US4 A;  1M5F A;  2GHA A;  1NH8 A;  1UQW A;  2D5W A;  1S9T A;  2PVU A;  2XD3 A;  4YZZ A;  2DWJ A;  1EH3 A;  3AXF A;  1B1X A;  5CM6 A;  3LBS A;  4E0W A;  3MC2 A;  3PUX E;  4KYS A;  4POX A;  3RGY A;  4OEN A;  4YB6 A;  4NED A;  1MH4 A;  2A5S A;  3K6U A;  2IEE A;  1Y3N A;  2XXQ A;  4PP0 A;  4BDR A;  2NOO A;  1EU8 A;  1SVX B;  1B52 A;  2NUV A;  3C9H A;  1QVS A;  3ODB A;  2Q2C A;  4PFY A;  4Q30 B;  3OO9 A;  2VOZ A;  2ZXT A;  3FVO A;  2UXA A;  5L9M A;  4LA9 A;  1LBC A;  4LZ5 A;  4OFO A;  3Q27 A;  4U2R A;  3VLU A;  4EF1 A;  4XKN A;  2DXY A;  1URG A;  1NNP A;  5CMC A;  3H3G A;  4O3C A;  2QPQ A;  4G68 C;  2I4C A;  2V3Q A;  5KDT B;  4ZEK A;  3FV1 A;  2F8D A;  4GQO A;  4YB5 A;  4O3B A;  3RTF B;  3VLW A;  1B7H A;  4KCD A;  1POT A;  3GXA A;  5B70 A;  3QK6 A;  3TQL A;  2GFE A;  3TTR A;  3K1M A;  3MW0 A;  3RNN A;  1ANF A;  1YPN A;  4NF4 A;  1R9Q A;  1MY0 A;  2Z8E A;  3GBA A;  5DEX A;  5J1D A;  2F34 A;  4R6K A;  1OLA A;  4QHQ A;  2E0S A;  1SW5 A;  3F11 A;  3K02 A;  4TLM B;  2F78 A;  4F29 A;  3TTM A;  3RT6 B;  2QS4 A;  2HQ0 A;  2REG A;  5TU0 A;  4EXL A;  4U21 A;  4F3P A;  1MXW A;  4GF8 A;  5BWJ A;  1Y3Q A;  4ZS9 A;  4JSO A;  4YKP A;  2F6G A;  3OEN A;  1MY2 A;  3TDJ A;  3IOV A;  1MPC A;  1I6B A;  5HPQ A;  2UYF A;  3LSX A;  4HS7 A;  3KZG A;  1OMP A;  1B0L A;  1D9Y A;  2V84 A;  4IO3 A;  3RPW A;  3MPL A;  5ISU A;  1YTV A;  4RNS A;  5AA1 A;  2O84 X;  1FQE A;  4TLL B;  5CI5 A;  3TAJ A;  4XTC Q;  1I6Q A;  1OVT A;  3T9V A;  1S50 A;  1LFI A;  1B58 A;  1MY4 A;  2VHA A;  3FVN A;  3QXM A;  4RPN A;  5AA4 B;  3K6V A;  1ZJL A;  3SES A;  3O66 A;  4YU0 A;  3LSL A;  2XD2 A;  3PUV E;  1XS5 A;  1B3E A;  5JK4 A;  1USY E;  3TKD A;  1ZKB A;  4OMB A;  3TEP A;  1Y20 A;  2AL4 A;  4IGT A;  5CMK A;  1LB9 A;  5EHS A;  1NH7 A;  1GR2 A;  4F1V A;  5FHO A;  2PMS A;  4OFL A;  4RPO A;  2R6G E;  2ZYO A;  5K2X A;  2Q9T A;  4FED A;  1ZMG A;  3K6X A;  4IY5 A;  1URD A;  3IB2 A;  2I58 A;  3N26 A;  4PFW A;  1HSE A;  2BJJ X;  2AYS A;  3MWB A;  2F35 A;  4MH5 A;  5FHM A;  4IO5 A;  4KHZ E;  1SD3 A;  2I0C A;  4JSD A;  5H8S A;  4H8I A;  4BDO A;  4YKK A;  1FQB A;  1BTJ A;  4FE8 A;  1AIV A;  3LR1 A;  3G3H A;  2ZMB A;  3M3K A;  3FXR A;  3CFL A;  3FXU A;  3U72 A;  1H3D A;  2DVC A;  1Y9U A;  4F1Y A;  4X1D A;  4H8J A;  1SI0 A;  3VDF A;  4I1D A;  2H5Y A;  3LSF B;  1Y4T A;  4LZ7 A;  5I2K A;  3R6U A;  1IZ1 A;  1XOC A;  2VP1 A;  1B3L A;  5LOM A;  2P2A A;  4OES A;  1B6H A;  1LB8 A;  3TFL A;  3TTN A;  3MZB A;  3TZA A;  4MF3 A;  3GZG A;  4KFQ A;  2XXX A;  1Y1Z A;  2OWS A;  3VLV A;  4Q8R A;  1MQG A;  1MXX A;  4OHN A;  3HHF A;  5I56 A;  3QYT A;  5ITO A;  1QUK A;  3KEI A;  3KGC A;  3DP8 A;  3HO7 A;  3T9X B;  3CSG A;  4H5G A;  2XXH A;  3EQ1 A;  3RLF E;  2ZYM A;  4ELP A;  3C35 A;  4JDF A;  1UTB A;  5H8F A;  5H8H B;  4ECF A;  2PT1 A;  1NKX A;  3THI A;  2YJP A;  1A55 A;  4QRZ A;  2F97 A;  3OXN A;  1BP5 A;  1JW5 A;  2PX1 A;  3OMB A;  4G2Z A;  1KWH A;  1II5 A;  3HHG A;  3OO6 A;  5TPA B;  2NVU B;  1M5E A;  1LAF E;  2F6P A;  4H5F A;  3BBR A;  5AA2 D;  4DCX A;  3V83 A;  1AOV A;  2XXU A;  1POY 1;  2GRV A;  3LUY A;  3MVZ A;  1XC1 A;  1P1W A;  3K01 A;  3K6W A;  3QIM A;  4H1X A;  4U22 A;  4OFJ A;  4ELO A;  3S9N C;  2ALU A;  1YAE A;  1LFG A;  2PBW A;  2XX7 A;  3IR1 A;  4R6Y A;  3H4Z A;  4TQU Q;  3FXQ A;  4R72 A;  3S9E A;  5I57 B;  4NF8 B;  4C1T A;  1USY H;  2XXY A;  1LAX A;  3OO7 A;  4BLA A;  4XKR A;  1B40 A;  3PPO A;  3KG2 A;  3U93 A;  3B6W A;  3OSQ A;  2DWH A;  2HFB A;  5DVI A;  3TQW A;  1JEU A;  1PB8 A;  3PV0 E;  1FQF A;  2A5T B;  4DZ1 A;  3IB0 A;  4DDD A;  3V89 B;  1GVC A;  3DLN A; 
#chains in the Genus database with same CATH topology
 1IIW A;  4EF2 A;  2X26 A;  4NTL A;  4GWZ A;  2RC9 A;  1MRP A;  4QXD A;  4F3G A;  1B1H A;  3G3K A;  1FTM A;  5DYH A;  1SBP A;  2OLB A;  3VXC A;  3R7X A;  3KN8 A;  4O94 A;  2R71 A;  3K00 A;  3TUS A;  1SYH A;  3S2V A;  4IO4 A;  4OET A;  1UTH A;  1FTL A;  5CMB A;  2O7U A;  2Q8M A;  5KCJ B;  4OEU A;  3IO6 A;  2QS1 A;  3QAX A;  1NV1 A;  4UA8 A;  4THI A;  3DEL B;  4GL8 A;  1ZU0 A;  1DSN A;  2OJT A;  3SZP A;  3CI8 A;  2FNC A;  3OOA A;  2DWI A;  4YKI A;  1Y4C A;  1MM7 A;  4U4S A;  3ROJ A;  1NNF A;  4OVS A;  4JVC A;  4M4G A;  3I5O A;  1TT1 A;  4N17 A;  4OWD A;  2ONS A;  3SEW A;  2HCA A;  4JVD A;  5EQ8 A;  3S9M C;  1ZLQ A;  1JVX A;  1B7U A;  4G61 A;  1JEV A;  2ONR A;  3IOW A;  3OEL A;  3LV0 A;  4OYV A;  1OQH A;  2I4B A;  3PD8 A;  2P0S A;  1DOT A;  5H8N B;  3SKP A;  1D4N A;  4MFI A;  4RJZ A;  2DP8 A;  2A5T A;  4FAJ A;  2KR0 A;  4PAF A;  5AA2 B;  2PT2 A;  3VVE A;  1MQI A;  1VFE A;  3TCF A;  3U92 A;  4N8Y A;  3VVF A;  4PCD A;  1ZBM A;  4UAB A;  1O64 A;  4G4P A;  2X7P A;  3VVD A;  2DYX A;  2LAO A;  1SQY A;  3OD7 A;  3K1N A;  1EZO A;  1B2H A;  1IQ7 A;  3HPI A;  3OEM A;  4ELR A;  4RA1 A;  3RTW B;  4JVI A;  1AH5 A;  3DM0 A;  2F5X A;  2VPO A;  3H7M A;  1GTK A;  2QMX A;  3KC1 A;  4F18 A;  2FHY A;  1NFT A;  4I9D A;  4GX6 A;  1NNK A;  4O3A A;  3PD9 A;  1TWY A;  3PPQ A;  5A5X B;  2O68 A;  3FAT A;  3MP1 A;  4P47 A;  3IO4 A;  4WKM A;  3H6T A;  4N07 A;  1M5D A;  4LQ2 A;  1DK4 A;  4E0X A;  5I59 B;  5F1Q A;  3T9H B;  1B51 A;  1LCF A;  1FBC A;  3KN7 A;  4RK2 A;  1QW0 A;  5H8Q A;  1Y3P A;  1B4H A;  2Y5L A;  4OTE A;  2FYI A;  4R6H A;  4NWC A;  1FPG A;  1DPP A;  2ABH A;  4QSD A;  4GWX A;  4GX4 A;  1R9L A;  2DOJ A;  1O63 A;  2UVJ A;  2CMO A;  1Y1M A;  3T96 B;  1MXU A;  3N6T A;  3D4C A;  3I3V A;  4DE8 A;  3N5L A;  3IFC A;  3MVY A;  4MLQ A;  1B4Z A;  1LBB A;  4I40 A;  5L9O A;  4O8M A;  1H43 A;  3VXB A;  2RC7 A;  1VSO A;  3C36 A;  3OO8 A;  2ZYK A;  2DDK A;  5CBR A;  3RPL A;  1M5B A;  1IEJ A;  5ET8 A;  1ATG A;  1RYO A;  3G3J A;  1QUI A;  2DS9 A;  2NXO A;  2D21 A;  5BUU A;  1PBQ A;  2V93 A;  2Y7K A;  3RY3 A;  3VFJ A;  3ZS6 A;  2WKY A;  4H6D A;  4PET A;  3BFT A;  2ZNU A;  3I6V A;  3W15 C;  3OSR A;  2OK2 A;  4GWO A;  1UIU A;  4JWX A;  5CC2 A;  2ZZV A;  2P3N A;  3IL1 B;  1NI9 A;  1FQA A;  3EHU A;  4NN3 A;  3W9W A;  5KDT A;  5I2N A;  2Z23 A;  2X7Q A;  3CG1 A;  2CEY A;  4FAT A;  1QUL A;  3DP4 A;  5DEX B;  5H8F B;  1ZTY A;  2D3I A;  3MYU A;  4FOR A;  4JWO A;  5AA4 A;  5TP9 B;  4PE5 B;  4G68 A;  4ESW A;  3O6H A;  4U23 A;  4I3Y A;  3IOT A;  5AA3 A;  4YMB A;  3JYR A;  4X9T A;  2O69 A;  4NF5 A;  3QMF A;  4HCW A;  2DE2 A;  4DIG A;  2QFL A;  4NGU A;  4YAH X;  3B6Q A;  1FW0 A;  3TYH A;  5ICQ A;  3H6U A;  1US4 A;  2D5W A;  2PVU A;  1S9T A;  3AXF A;  1EH3 A;  3PUX E;  2XXQ A;  1SVX B;  1FBP A;  1RDX A;  1B52 A;  2NUV A;  3C9H A;  1QVS A;  4PFY A;  2Q2C A;  4Q30 B;  2UXA A;  5L9M A;  4OFO A;  3Q27 A;  4XKN A;  2DXY A;  4O3C A;  2I4C A;  4ZEK A;  3FV1 A;  2F8D A;  4YB5 A;  3RTF B;  4KCD A;  3TQL A;  3MW0 A;  1ANF A;  1YPN A;  4NF4 A;  3BIG A;  3GBA A;  2Z8E A;  1LBY A;  4PTK A;  2F34 A;  4OVT A;  1SW5 A;  2REG A;  4EXL A;  4U21 A;  5ESY A;  4JSO A;  2F6G A;  3OEN A;  1MPC A;  3LSX A;  1OMP A;  1B0L A;  1D9Y A;  1IMF A;  5AA1 A;  2O84 X;  4TLL B;  5CI5 A;  5I7I A;  1LFI A;  1B58 A;  3QXM A;  2VHA A;  4RPN A;  1ZJL A;  1FBD A;  2B4M A;  1ZKB A;  3EKI A;  5FHO A;  4KHZ E;  4JSD A;  4H8I A;  3T1B A;  1BTJ A;  3LR1 A;  2ZMB A;  3CFL A;  1H3D A;  4H8J A;  2H5Y A;  3LSF B;  2P2A A;  4OES A;  3TFL A;  3GZG A;  4KFQ A;  3IFA A;  2HPG A;  3CSG A;  1NUZ A;  2WX9 A;  2XXH A;  4PGN A;  4JDF A;  1UTB A;  5IM2 A;  4QRZ A;  2F97 A;  1JW5 A;  2XWK A;  1KWH A;  4GWS A;  4DCX A;  2ZZX A;  4U22 A;  1XC1 A;  3QIM A;  3S9N C;  1LFG A;  2PBW A;  4C1T A;  3OO7 A;  3KG2 A;  2XXK A;  1JEU A;  2PFZ A;  1GVC A;  4F22 A;  1LAG E;  3PPN A;  3OEK A;  3PMX A;  2F36 A;  4GX3 A;  4MJO A;  1B46 A;  2Y7I A;  4P56 A;  1J1N A;  4PDD A;  1A8E A;  4MX6 A;  1PEB A;  4P8B A;  4QBA A;  3E3K A;  3IAZ A;  1Q9D A;  4H67 A;  1MG1 A;  2CEX A;  1CNQ A;  1LLS A;  3TPA A;  3N94 A;  3FBP A;  1OVB A;  3FVG A;  1IXG A;  4F2Q A;  2F3B A;  5H8Q B;  3PMW A;  3UOR A;  3EHT A;  4LP2 B;  1NUY A;  4KR5 A;  1A7L A;  4Q0C A;  1PB7 A;  4ZZE A;  4XEQ A;  1VDW A;  3CFX A;  4R2F A;  1B5I A;  1NV0 A;  2B3B A;  1L5T A;  1LBV A;  4H0W A;  5CMM A;  1H76 A;  2VGQ A;  4MHF A;  2OCU A;  1QKB A;  2CZK A;  2G29 A;  3IOR A;  2AL5 A;  3RN8 A;  3VV5 A;  4MEV A;  1G0I A;  3CG3 A;  2I49 A;  4HE2 A;  2OWZ A;  2HXR A;  3M8U A;  1I6A A;  1Z7N E;  1NV2 A;  2B3F A;  1JQF A;  1MPB A;  1IXI A;  4N13 A;  5TPA A;  5J16 A;  1B7Z A;  3BFU A;  4XFE A;  3FD3 A;  4F39 A;  2ZNT A;  4LZ8 A;  3MBP A;  4GBW A;  3UP9 A;  1BLF A;  3KN3 A;  1YCJ A;  3UK4 A;  4U4X A;  1OQG A;  4N6P A;  3O9P A;  4IO7 A;  4AB6 A;  4IO2 A;  4YIC A;  3LC8 A;  2QVV A;  2OWT A;  2Q2A A;  4RYA A;  3WAE A;  2QRY A;  4O7M A;  3C33 A;  4YB7 A;  4F19 A;  3IJX B;  2DE3 A;  1JP4 A;  4WED A;  3MQ9 A;  4DI3 D;  2DE4 A;  5ET7 A;  1LCT A;  3ZKK A;  4IR8 A;  2V25 A;  5JTY A;  3CIJ A;  3PU5 A;  2UVG A;  3QSL A;  3KSJ A;  3L6G A;  1DTG A;  3CFZ A;  3ONM A;  4AS5 A;  4Z0I A;  5EQ9 A;  1LEV A;  3EPE A;  2HZL A;  4EQB A;  3TCH A;  1YXI A;  1IUD A;  2O1M A;  5DW8 A;  1PB9 A;  1FPD A;  4FIM A;  1IME A;  2OX3 A;  3MUQ A;  2H9B A;  3S4U A;  4I62 A;  3TOD A;  2DWA A;  2ESN A;  2HXW A;  4HCY A;  4R9F A;  5I84 A;  3M3F A;  1MQH A;  2REJ A;  1B3G A;  1MY1 A;  4P1E A;  3TTL A;  1MQJ A;  3W9V A;  2XXI A;  5HM4 B;  4FBP A;  3R26 A;  4O7I A;  5I58 B;  3KBR A;  2WBB A;  2FBP A;  1NL5 A;  3E79 A;  4NQ8 A;  1AMF A;  2H4I A;  4QF9 A;  4MAG A;  1D9V A;  4ONY A;  4I8C A;  4X8R A;  1RYX A;  2Y5K A;  5FTH A;  5K2Y A;  1PBP A;  2QVU A;  2RC8 A;  2Q88 A;  3C34 A;  2W7Y A;  4GIZ A;  2OZZ A;  5F24 A;  4X1B A;  1ZIU A;  4TOZ A;  4QFK A;  3PUW E;  3WAF A;  3RT8 A;  1SW4 A;  3EF7 A;  5L8D A;  4NF6 A;  4ZEC A;  1HSJ A;  1NUW A;  3UGW A;  1MM6 A;  3CHG A;  2H98 A;  4QFL A;  4LAT A;  2GQ1 A;  4DXU A;  5T3J A;  5I56 B;  3KOT A;  3U1O A;  4PFU A;  3JZJ A;  4NF4 B;  5EYF A;  1UTB B;  3PGF A;  4WEP A;  4OA4 A;  1QJM A;  2RKM A;  3HCQ A;  4DCY A;  3IOU A;  4C1U A;  3U94 A;  3FZV A;  4PE3 A;  3D4G A;  3RYD A;  1VE4 A;  1BKA A;  1GV8 A;  5JEI A;  3L6H A;  5A5L A;  4QFP A;  3TTK A;  1R6Z A;  3IB1 A;  1LFH A;  2I48 A;  4G77 A;  4GD5 A;  1CE2 A;  3B50 A;  1NH8 A;  4YZZ A;  4KYS A;  4YB6 A;  1MH4 A;  4BDR A;  3T0J A;  4OVP A;  3OO9 A;  2VOZ A;  4N81 A;  4EF1 A;  4LZ5 A;  4U2R A;  1URG A;  1NNP A;  3H3G A;  2WBD A;  4HE0 A;  4GQO A;  3VLW A;  3GXA A;  3TTR A;  3RNN A;  5J1D A;  5DEX A;  1R9Q A;  4F29 A;  3F11 A;  3K02 A;  3RT6 B;  4F3P A;  1MXW A;  5EYG A;  3IOV A;  4PC9 A;  2WYP A;  3RPW A;  3MPL A;  4OAN A;  2XWO A;  4XTC Q;  1I6Q A;  1OVT A;  1S50 A;  3SES A;  1XS5 A;  1NV3 A;  1USY E;  3TKD A;  4OMB A;  3TEP A;  4IGT A;  5CMK A;  4F1V A;  2PMS A;  3PTY A;  4OFL A;  2R6G E;  1FPB A;  2Q9T A;  4IY5 A;  3N26 A;  1HSE A;  3MWB A;  4IO5 A;  3ISP A;  1YYZ A;  5H8S A;  2MKZ A;  1INP A;  3G3H A;  1FBE A;  3M3K A;  3RPL B;  1Y9U A;  1SI0 A;  3R6U A;  5IZ3 B;  1SPI A;  1LB8 A;  4MF3 A;  2WYK A;  2OWS A;  4N4U A;  4Q8R A;  1MQG A;  1MXX A;  5I56 A;  5ITO A;  1QUK A;  3KEI A;  1EYJ A;  3DP8 A;  3T9X B;  4PF6 A;  4ELP A;  3C35 A;  2XA5 A;  5H8F A;  2PT1 A;  1NKX A;  3THI A;  2YJP A;  3BIH A;  4NHB A;  1BP5 A;  2PX1 A;  3OO6 A;  2NVU B;  1M5E A;  3BBR A;  5AA2 D;  2GRV A;  1FSA A;  3LUY A;  4OFJ A;  1YAE A;  3S9E A;  4R6Y A;  4R72 A;  4NF8 B;  2QVR A;  4XKR A;  3PPO A;  3OSQ A;  2HFB A;  1EYK A;  4DZ1 A;  3V89 B;  3DLN A;  2F7C A;  1Q35 A;  1XVX A;  3D1R A;  4EQ7 A;  2THI A;  4F1U A;  2WEF A;  4G8M A;  2G93 A;  3SEV A;  5ICT A;  1B3H A;  4FEC A;  3V5A A;  4MIJ A;  2VD3 A;  4JXI A;  5LTC A;  3QUF A;  3G3G A;  3FIR A;  4GVO A;  3T22 A;  1JNF A;  1A8F A;  2Q89 A;  2XWI A;  4AB5 A;  1N3W A;  5FTI A;  1IXC A;  1P1Q A;  3B6T A;  2P1S A;  3SET A;  5I58 A;  1SW2 A;  4OVR A;  3MVX A;  3B7D A;  1LST A;  3IX1 A;  3ZKL A;  1VR5 A;  2UYE A;  4ISU A;  2UVH A;  3ECR A;  4NE4 A;  2QJE A;  2Q8J A;  3K4U A;  1NV5 A;  3FVK A;  1XT8 A;  1ELJ A;  1MH3 A;  2RIN A;  4P0I A;  4DLD A;  1HSL A;  2I3W A;  4OQO A;  1MY3 A;  2F7A A;  2PCR A;  3PUZ E;  2FIE A;  3H6V A;  4GFR A;  1BIY A;  4XXU A;  2KQZ A;  4UAC A;  3C32 A;  3PPP A;  1S7Y A;  1JVY A;  1RKM A;  4Q5T A;  4DXC A;  5CBS A;  5IKB A;  4OVJ A;  2I6E A;  2Y7W A;  4G8N A;  4IY6 A;  4U1Z A;  4HW8 A;  4R9G A;  1FJ6 A;  5KZT A;  1NV4 A;  4F3S A;  3E13 X;  3MAM A;  4P11 A;  3N6U A;  1URS A;  5M2V A;  3U8Q A;  4AQ4 A;  5FHN A;  4NF6 B;  1LBX A;  3SDF A;  1EYI A;  4KXP A;  3G7W A;  4G68 B;  2ONK E;  5DVF A;  4GRK A;  4KQP A;  4FEB A;  4ZE9 A;  1XI6 A;  5ITP A;  1IMD A;  5EQ7 A;  1KA0 A;  4R2B A;  4H65 A;  1PDA A;  4F3B A;  1Z7M E;  1DBZ A;  2PFY A;  4OXV A;  1IXH A;  1M5C A;  2XXW A;  4PFT A;  3T93 B;  4ZDM A;  2HEU A;  3CRB A;  1MDP 1;  1FBF A;  1FBH A;  2B65 A;  3KOS A;  1CB6 A;  1O7T A;  1WOD A;  3ILT B;  2VT5 A;  1DMB A;  4QSE A;  4QSC A;  2O1L A;  1B5J A;  4MCO A;  4IGR A;  2QS2 A;  4KPT A;  4M1V A;  5ELV A;  4X48 A;  2UVI A;  4ZEF A;  3MVW A;  2Y7P A;  2RCB A;  2KLF A;  1A99 A;  3KC0 A;  4NF0 A;  1SW1 A;  2F3D A;  2VPN A;  5DTB A;  2CZH A;  4RY1 A;  4MMP A;  3O97 A;  2HAV A;  4NWD A;  3ZSF A;  4G8H A;  2Z22 A;  3CVG A;  5A5X A;  3EHS A;  1QUJ A;  2NWJ A;  3HST A;  3KFM A;  1SYI A;  3KJT A;  4KYD A;  3MZ9 A;  4HTG A;  2CZL A;  5EHM A;  1FTJ A;  3H06 B;  3TMG A;  3A3U A;  4XKQ A;  5ET5 A;  1FPJ A;  5KCJ A;  2QL3 A;  2YPN A;  3HN0 A;  3K2D A;  5CRY A;  2O6A A;  3JV9 A;  1TFA A;  1FPI A;  3EN3 A;  5H8N A;  2GH9 A;  1TFD A;  4PAI A;  2V3U A;  5LDZ A;  2JJK A;  4PQJ A;  1A54 A;  1UTH B;  3Q26 A;  2ZYN A;  2ANJ A;  4NMY A;  1D3K A;  4KYE A;  4GWY A;  2H99 A;  4OEV A;  3K0V A;  4GWU A;  3MP8 A;  2QSX A;  4PBH A;  3GLB A;  4YMA A;  1NUX A;  3FJG A;  3MP6 A;  5I57 A;  2HZK A;  2FVZ A;  4NG7 A;  2GHB A;  1JW4 A;  1FQD A;  2QMW A;  4WXJ A;  2IA4 A;  4F2O A;  3SEU A;  4L17 A;  2O7I A;  3SEY A;  3RQT A;  5L9S A;  2I3V A;  2P3V A;  4KCC A;  4ZE8 A;  1A40 A;  2XX9 A;  4X04 A;  1R1N A;  2XXT A;  4OZ9 A;  5I2K B;  1N0T A;  3Q28 A;  2M8C A;  1AL3 A;  1NV7 A;  4XKP A;  4JB7 A;  2FA7 A;  3H03 A;  5DVJ A;  5I2N B;  2XHD A;  4KI0 E;  4LUB A;  4N6D A;  4P9K A;  3TEL A;  4Z7E A;  2GHA A;  2XD3 A;  2DWJ A;  3LBS A;  4E0W A;  4OEN A;  4NED A;  3K6U A;  1EU8 A;  1FTA A;  2ZXT A;  3B8B A;  2L5V A;  5CMC A;  2QPQ A;  4G68 C;  5FBP A;  2V3Q A;  1B7H A;  3K1M A;  1FBG A;  5ET6 A;  2Q74 A;  1G0H A;  2ZZW A;  1MY0 A;  4R6K A;  1OLA A;  4QHQ A;  2HQ0 A;  5TU0 A;  4N8G A;  4GF8 A;  1Y3Q A;  4ZS9 A;  4YKP A;  5HPQ A;  3KZG A;  1K9Y A;  5EYH A;  5IZZ A;  1YTV A;  4RNS A;  1FQE A;  3T9V A;  3FVN A;  1MY4 A;  3K6V A;  3FXB A;  2XD2 A;  3PUV E;  1B3E A;  1LBW A;  1Y20 A;  1NH7 A;  1GR2 A;  4RPO A;  1ZMG A;  1FPE A;  4PFW A;  2BJJ X;  5FHM A;  1SD3 A;  1IMC A;  1FQB A;  4FE8 A;  3FXR A;  5BWJ A;  3VDF A;  1XOC A;  2VP1 A;  1FPF A;  3TTN A;  3TZA A;  2XXX A;  1Y1Z A;  4OHN A;  3HHF A;  3KGC A;  3EQ1 A;  3RLF E;  2ZYM A;  5H8H B;  1A55 A;  2R8T A;  3OMB A;  1YZ0 A;  4G2Z A;  4MNP A;  2F6P A;  4H5F A;  2XXU A;  3MVZ A;  4H1X A;  2ALU A;  3IR1 A;  3H4Z A;  2XXY A;  1LAX A;  3A29 A;  3U93 A;  3B6W A;  5DVI A;  3PV0 E;  3IB0 A;  4R73 A;  3K01 A;  1XHY A;  1UIV A;  3T66 A;  3O6I A;  1H44 A;  4P0G A;  2QS3 A;  1AWB A;  4MLV A;  5DT6 A;  2AIX A;  3G3I A;  2I0B A;  4DI4 B;  1BK4 A;  4U1O A;  4H45 A;  1MQD A;  2XX8 A;  4QFN A;  3O29 A;  4GXA A;  3O28 A;  3BKI B;  3USD A;  1FPK A;  4GXS B;  5JTY B;  3T9U A;  1GGG A;  5AA2 A;  1N7X A;  2RF1 A;  2E1S A;  5H8H A;  1MPD A;  2CZI A;  2B4L A;  3PMV A;  1SDX A;  3RUM A;  3E4R A;  1B32 A;  4EDP A;  3IJO B;  1JW1 A;  1US5 A;  4BDL A;  3VLV A;  3C31 A;  1MS7 A;  1N76 A;  3S9L C;  5I59 A;  5F7V A;  3GBB A;  4ZEB A;  1B5H A;  4K3F A;  4GWW A;  4NX1 A;  3HV1 A;  4R74 A;  3CR9 A;  3HFU A;  3E9X A;  4ZZA A;  2DQV A;  4GL0 A;  4EUO A;  1P1O A;  3FGS A;  2HAU A;  4PFR A;  1IMA A;  3UN6 A;  4C0R A;  4IB2 A;  4BDN A;  1EZ9 A;  3KSX A;  2VD2 A;  1LBZ A;  2XXR A;  4AS4 A;  5EQA A;  1N04 A;  1SI1 A;  3FJ7 A;  4EQ9 A;  1H45 A;  4F31 B;  2RCA A;  3A09 A;  1FPL A;  1T0K A;  2Z8F A;  3CSB A;  1P99 A;  1WVJ A;  1NMU A;  2Y84 A;  1QGX A;  3FV2 A;  1RDZ A;  1F9B A;  4RK9 A;  3TCG A;  3VE1 B;  4N15 A;  1QKA A;  4OER A;  4KD5 A;  3MPK A;  1P1U A;  2HHM A;  5I3S A;  3SEX A;  4ZED A;  4ESX A;  4PDH A;  1IIT A;  1LAH E;  4YKJ A;  4XIG Q;  3Q25 A;  4NF8 A;  3NOH A;  2DVZ A;  3DP6 A;  1Q1K A;  1FJ9 A;  4NF5 B;  1MDQ A;  2V3T A;  3KJ7 A;  1LGB C;  3A3C A;  2PYY A;  4LQ5 A;  1I69 A;  4LN5 A;  4PF8 A;  3MZ1 A;  4OVQ A;  4NAP A;  5IGA A;  1B0H A;  1MXY A;  4JWY A;  3P7I A;  2Z8D A;  2R9J A;  3K1P A;  5IZ3 A;  1OLC A;  1WDN A;  4N91 A;  1DTZ A;  4LON B;  5B7D A;  5AE4 A;  4EXK A;  5IZ1 A;  2DXR A;  3V8X B;  2F7B A;  3MJN A;  4ZEI A;  4QFO A;  3GYY A;  2XXP A;  1B05 A;  1FTK A;  4IO6 A;  4BDQ A;  3MST A;  3UIF A;  4GOT A;  1DPE A;  3O6G A;  3C4M A;  1FQC A;  3LSW A;  2FIX A;  1JET A;  4POW A;  1N84 A;  3H6W A;  4PFI A;  4ELQ A;  4GBV A;  2H25 A;  1N3X A;  3IK6 B;  4LVQ A;  1FCK A;  3Q29 A;  4JBZ A;  3FUZ A;  1PC3 A;  5TP9 A;  2O51 A;  3M3L A;  5AA4 B;  1AOV A;  1XVY A;  4RXL A;  1DCU A;  1FTO A;  2YLN A;  1RDY A;  1FRP A;  1B9J A;  1KZ8 A;  4R75 A;  1OIB A;  3FJM A;  4GLI A;  2DSF A;  1NNT A;  3O2A A;  4PAK A;  2XXV A;  1TXF A;  3QUJ A;  1IMB A;  1EZP A;  4MBP A;  4N6K A;  4ND9 A;  1MXZ A;  3G3F A;  1P1N A;  3PPR A;  3U65 A;  2XWV A;  1VFD A;  5IAI A;  2ZNS A;  4DXB A;  3UA8 A;  2Y7R A;  5HBC A;  2OBG A;  4P1L A;  3PUY E;  3E78 A;  4BDM A;  4FJP A;  1MXV A;  1N7W A;  1B3F A;  1KA1 A;  3ILU B;  4HXV A;  3FAS A;  4PGP A;  3SER A;  1M5F A;  1UQW A;  3LUZ A;  1B1X A;  5CM6 A;  3MC2 A;  3RGY A;  4POX A;  4MNI A;  2A5S A;  2IEE A;  1Y3N A;  4PP0 A;  2NOO A;  4MNC A;  3ODB A;  3FVO A;  4LA9 A;  1LBC A;  3VLU A;  5KDT B;  4O3B A;  1POT A;  5B70 A;  3QK6 A;  2GFE A;  1D9Q A;  2E0S A;  4TLM B;  3KBZ A;  2F78 A;  3TTM A;  2QS4 A;  1NV6 A;  3TDJ A;  1MY2 A;  1I6B A;  2UYF A;  4HS7 A;  4IO3 A;  2V84 A;  2BJI A;  4I3E A;  5ISU A;  3TAJ A;  4H46 A;  4XF5 A;  3O66 A;  4YU0 A;  3LSL A;  5JK4 A;  1K9Z A;  2AL4 A;  4PBQ A;  1LB9 A;  5EHS A;  5K2X A;  2ZYO A;  4FED A;  3K6X A;  1URD A;  3IB2 A;  2I58 A;  2AYS A;  4MH5 A;  2F35 A;  2I0C A;  4BDO A;  4YKK A;  1AIV A;  3FXU A;  3U72 A;  4F1Y A;  2DVC A;  5I5P A;  4X1D A;  4I1D A;  4LZ7 A;  1Y4T A;  4PFB A;  5I2K A;  1IZ1 A;  1B3L A;  5LOM A;  1B6H A;  3MZB A;  4HE1 A;  3QYT A;  3HO7 A;  4H5G A;  4ECF A;  3OXN A;  3HHG A;  1II5 A;  5TPA B;  1LAF E;  3V83 A;  1POY 1;  4ELO A;  1P1W A;  3K6W A;  4TQU Q;  2XX7 A;  3FXQ A;  5I57 B;  4P3L A;  1USY H;  4BLA A;  1B40 A;  2DWH A;  3TQW A;  1PB8 A;  1FQF A;  2A5T B;  2V4C A;  4DDD A; 
#chains in the Genus database with same CATH homology
 4F22 A;  1LAG E;  2F7C A;  1Q35 A;  1XHY A;  1IIW A;  1XVX A;  3PPN A;  3OEK A;  4EF2 A;  2THI A;  4EQ7 A;  4F1U A;  3PMX A;  1UIV A;  2F36 A;  1B46 A;  2Y7I A;  3T66 A;  2X26 A;  1J1N A;  4G8M A;  2G93 A;  3O6I A;  4NTL A;  1H44 A;  2RC9 A;  3SEV A;  4P0G A;  2QS3 A;  1A8E A;  5ICT A;  1B3H A;  1MRP A;  4FEC A;  1PEB A;  3V5A A;  4F3G A;  2VD3 A;  1B1H A;  4JXI A;  4MLV A;  3ZS6 A;  5DT6 A;  3E3K A;  2AIX A;  3G3K A;  3QUF A;  3G3I A;  2I0B A;  3G3G A;  3USD A;  1FTM A;  5DYH A;  4U1O A;  1SBP A;  1MQD A;  3IAZ A;  2XX8 A;  3FIR A;  4H67 A;  2OLB A;  1MG1 A;  4GVO A;  3T22 A;  4QFN A;  1JNF A;  3O29 A;  3R7X A;  3VXC A;  3KN8 A;  1A8F A;  2Q89 A;  1LLS A;  4GXA A;  4AB5 A;  3O28 A;  3BKI B;  1N3W A;  5FTI A;  3TPA A;  1IXC A;  1P1Q A;  2R71 A;  3B6T A;  3K00 A;  3N94 A;  3TUS A;  4GXS B;  2P1S A;  5JTY B;  3SET A;  1SYH A;  5I58 A;  1OVB A;  3FVG A;  3T9U A;  1GGG A;  1SW2 A;  4IO4 A;  3S2V A;  4OET A;  5AA2 A;  1FTL A;  1UTH A;  1IXG A;  5CMB A;  2O7U A;  1N7X A;  4F2Q A;  2RF1 A;  2E1S A;  5KCJ B;  3MVX A;  4OEU A;  3B7D A;  1LST A;  3IO6 A;  2QS1 A;  3IX1 A;  5H8H A;  3ZKL A;  5H8Q B;  3QAX A;  1MPD A;  3PMW A;  3UOR A;  1VR5 A;  2UYE A;  3EHT A;  2UVH A;  3PMV A;  4ISU A;  4LP2 B;  4THI A;  4UA8 A;  1SDX A;  3DEL B;  4GL8 A;  3ECR A;  4KR5 A;  1A7L A;  3RUM A;  4Q0C A;  3E4R A;  4NE4 A;  1PB7 A;  4ZZE A;  1B32 A;  1ZU0 A;  1DSN A;  2OJT A;  3CFX A;  4EDP A;  4R2F A;  3CI8 A;  1B5I A;  3IJO B;  2FNC A;  2B3B A;  2QJE A;  3OOA A;  1L5T A;  4H0W A;  1JW1 A;  2Q8J A;  2DWI A;  3K4U A;  5CMM A;  1H76 A;  1US5 A;  1XT8 A;  2VGQ A;  3FVK A;  4YKI A;  4BDL A;  1ELJ A;  1Y4C A;  1MM7 A;  1MH3 A;  1QKB A;  2G29 A;  2OCU A;  2RIN A;  2AL5 A;  3C31 A;  1MS7 A;  3IOR A;  1N76 A;  4U4S A;  3RN8 A;  1NNF A;  3VV5 A;  4M4G A;  3I5O A;  1TT1 A;  4P0I A;  3S9L C;  4DLD A;  5I59 A;  3CG3 A;  1HSL A;  2ONS A;  4OWD A;  3SEW A;  2I3W A;  2I49 A;  4OQO A;  2HCA A;  5F7V A;  3GBB A;  1MY3 A;  2F7A A;  3S9M C;  3M8U A;  4ZEB A;  1I6A A;  1Z7N E;  1ZLQ A;  1B5H A;  1JVX A;  1JQF A;  1MPB A;  1B7U A;  1IXI A;  2B3F A;  3PUZ E;  4N13 A;  4K3F A;  5TPA A;  1B7Z A;  3HV1 A;  1JEV A;  2ONR A;  3H6V A;  3IOW A;  3OEL A;  4GFR A;  3BFU A;  3FD3 A;  1BIY A;  4OYV A;  4R74 A;  4XXU A;  4F39 A;  3CR9 A;  2ZNT A;  4LZ8 A;  4UAC A;  3C32 A;  3E9X A;  3PPP A;  1OQH A;  4ZZA A;  2DQV A;  2I4B A;  3MBP A;  3PD8 A;  4GL0 A;  4EUO A;  2P0S A;  1DOT A;  1BLF A;  3KN3 A;  3UP9 A;  5H8N B;  1S7Y A;  3SKP A;  1P1O A;  1YCJ A;  1D4N A;  3FGS A;  1JVY A;  1RKM A;  4MFI A;  2HAU A;  3UK4 A;  4Q5T A;  4DXC A;  4U4X A;  5CBS A;  1OQG A;  4N6P A;  4RJZ A;  3O9P A;  2DP8 A;  2A5T A;  3UN6 A;  4C0R A;  4IO7 A;  5IKB A;  4AB6 A;  4IB2 A;  4OVJ A;  4IO2 A;  4YIC A;  2I6E A;  2Y7W A;  3LC8 A;  4BDN A;  4FAJ A;  5AA2 B;  1EZ9 A;  3KSX A;  2PT2 A;  3VVE A;  1MQI A;  1VFE A;  2VD2 A;  3TCF A;  3U92 A;  4G8N A;  2OWT A;  2XXR A;  4IY6 A;  2Q2A A;  4RYA A;  4U1Z A;  4R9G A;  4HW8 A;  3VVF A;  5KZT A;  4F3S A;  1ZBM A;  3E13 X;  1N04 A;  2QRY A;  3MAM A;  1O64 A;  4P11 A;  3WAE A;  3N6U A;  1SI1 A;  4G4P A;  2X7P A;  1URS A;  5M2V A;  3U8Q A;  3FJ7 A;  3VVD A;  2DYX A;  4EQ9 A;  3C33 A;  4AQ4 A;  4YB7 A;  1H45 A;  2LAO A;  4NF6 B;  1SQY A;  5FHN A;  2RCA A;  3SDF A;  4F19 A;  3A09 A;  4F31 B;  1T0K A;  3IJX B;  2DE3 A;  2Z8F A;  3CSB A;  3G7W A;  1P99 A;  2ONK E;  3K1N A;  1WVJ A;  3MQ9 A;  3OD7 A;  4G68 B;  1EZO A;  1B2H A;  1NMU A;  2Y84 A;  5DVF A;  1IQ7 A;  4GRK A;  4KQP A;  3HPI A;  4FEB A;  3OEM A;  4ELR A;  4ZE9 A;  2DE4 A;  3FV2 A;  4RA1 A;  3RTW B;  1LCT A;  3ZKK A;  1AH5 A;  5ITP A;  2V25 A;  1F9B A;  3CIJ A;  2F5X A;  3DM0 A;  4RK9 A;  5JTY A;  3H7M A;  4R2B A;  3TCG A;  4H65 A;  1PDA A;  3PU5 A;  2UVG A;  3VE1 B;  1Z7M E;  1GTK A;  3QSL A;  4F3B A;  2QMX A;  4F18 A;  3KSJ A;  3L6G A;  1NFT A;  4OXV A;  1IXH A;  1M5C A;  1DTG A;  4I9D A;  1QKA A;  3CFZ A;  2XXW A;  4PFT A;  3T93 B;  4OER A;  4KD5 A;  3ONM A;  4ZDM A;  2HEU A;  3MPK A;  1P1U A;  3CRB A;  1MDP 1;  1NNK A;  4O3A A;  4Z0I A;  3PD9 A;  1TWY A;  3SEX A;  3PPQ A;  2B65 A;  2O68 A;  4ESX A;  3KOS A;  4ZED A;  3FAT A;  3EPE A;  3MP1 A;  5A5X B;  1CB6 A;  2HZL A;  1IIT A;  1LAH E;  3IO4 A;  4YKJ A;  4WKM A;  4XIG Q;  3H6T A;  4N07 A;  1M5D A;  3Q25 A;  1O7T A;  4LQ2 A;  1WOD A;  3ILT B;  4NF8 A;  2DVZ A;  4EQB A;  3DP6 A;  1Q1K A;  1DMB A;  3TCH A;  4QSE A;  4E0X A;  1IUD A;  2O1M A;  4QSC A;  2O1L A;  1B5J A;  4NF5 B;  5I59 B;  1PB9 A;  5F1Q A;  4IGR A;  2QS2 A;  4KPT A;  4M1V A;  3T9H B;  1MDQ A;  2V3T A;  4FIM A;  4X48 A;  5ELV A;  2UVI A;  1B51 A;  3KJ7 A;  3MVW A;  3MUQ A;  2Y7P A;  1LGB C;  3A3C A;  4ZEF A;  2PYY A;  2RCB A;  1LCF A;  3KN7 A;  2KLF A;  1I69 A;  4LQ5 A;  4RK2 A;  1A99 A;  1QW0 A;  2H9B A;  1Y3P A;  5H8Q A;  3S4U A;  1B4H A;  3MZ1 A;  1SW1 A;  4OTE A;  4I62 A;  5DTB A;  3TOD A;  2DWA A;  2FYI A;  4R6H A;  4RY1 A;  4NWC A;  2ESN A;  2HXW A;  3O97 A;  1B0H A;  1MXY A;  2HAV A;  4HCY A;  1DPP A;  4NWD A;  4R9F A;  4JWY A;  4WED A;  3ZSF A;  4G8H A;  2ABH A;  4QSD A;  3P7I A;  2Z8D A;  3M3F A;  2Z22 A;  5I84 A;  3CVG A;  2R9J A;  5A5X A;  1MQH A;  3EHS A;  1QUJ A;  3K1P A;  2NWJ A;  3HST A;  2REJ A;  1B3G A;  1MY1 A;  3KFM A;  3TTL A;  1SYI A;  1OLC A;  1R9L A;  1WDN A;  3KJT A;  3MZ9 A;  4KYD A;  2DOJ A;  3SEY A;  1DTZ A;  4HTG A;  1MQJ A;  4LON B;  1O63 A;  2UVJ A;  3W9V A;  5B7D A;  2CMO A;  2XXI A;  5AE4 A;  5HM4 B;  1Y1M A;  3R26 A;  2CZL A;  4EXK A;  5EHM A;  1FTJ A;  3T96 B;  5I58 B;  1MXU A;  3N6T A;  3H06 B;  3TMG A;  2DXR A;  3A3U A;  3D4C A;  3I3V A;  4R73 A;  3V8X B;  3KBR A;  2F7B A;  4DE8 A;  4XKQ A;  5KCJ A;  3N5L A;  3MVY A;  4MLQ A;  3MJN A;  4ZEI A;  1B4Z A;  1LBB A;  4QFO A;  1NL5 A;  2QL3 A;  2XXP A;  2YPN A;  1B05 A;  1AMF A;  3HN0 A;  1FTK A;  2H4I A;  3K2D A;  4IO6 A;  4QF9 A;  5CRY A;  4BDQ A;  5L9O A;  3UIF A;  1H43 A;  1D9V A;  2O6A A;  4ONY A;  2RC7 A;  3VXB A;  1VSO A;  3C36 A;  3JV9 A;  4I8C A;  3OO8 A;  2ZYK A;  4GOT A;  1TFA A;  1DPE A;  1RYX A;  5CBR A;  3EN3 A;  5FTH A;  5K2Y A;  3O6G A;  1PBP A;  3C4M A;  5H8N A;  2GH9 A;  1TFD A;  1FQC A;  1M5B A;  3LSW A;  1IEJ A;  1JET A;  2RC8 A;  2V3U A;  1ATG A;  4POW A;  2Q88 A;  1RYO A;  3G3J A;  1N84 A;  3C34 A;  2W7Y A;  4GIZ A;  1QUI A;  2OZZ A;  3H6W A;  4X1B A;  2DS9 A;  2NXO A;  2D21 A;  5BUU A;  4PQJ A;  1PBQ A;  1A54 A;  1UTH B;  1ZIU A;  2V93 A;  3Q26 A;  2Y7K A;  2ZYN A;  4TOZ A;  4ELQ A;  2ANJ A;  4NMY A;  1D3K A;  4KYE A;  4QFK A;  3RY3 A;  2H25 A;  3VFJ A;  1N3X A;  3PUW E;  2WKY A;  4H6D A;  3WAF A;  3IK6 B;  4LVQ A;  1SW4 A;  2H99 A;  3RT8 A;  4PET A;  1FCK A;  3Q29 A;  4OEV A;  3BFT A;  4JBZ A;  3FUZ A;  1PC3 A;  3K0V A;  2O51 A;  2ZNU A;  3EF7 A;  3I6V A;  3M3L A;  3OSR A;  2OK2 A;  3MP8 A;  4GWO A;  5L8D A;  3W15 C;  2QSX A;  4NF6 A;  1HSJ A;  1UIU A;  4JWX A;  4ZEC A;  1XVY A;  3GLB A;  4RXL A;  4YMA A;  3UGW A;  3FJG A;  1FTO A;  1MM6 A;  3MP6 A;  5CC2 A;  5I57 A;  2H98 A;  2YLN A;  2HZK A;  3IL1 B;  4QFL A;  2GHB A;  1JW4 A;  1FQD A;  1B9J A;  4R75 A;  1FQA A;  3EHU A;  1OIB A;  4LAT A;  3W9W A;  2QMW A;  4WXJ A;  3FJM A;  4GLI A;  4DXU A;  2DSF A;  5KDT A;  1NNT A;  3O2A A;  2IA4 A;  5I2N A;  2Z23 A;  4F2O A;  5I56 B;  3KOT A;  2X7Q A;  3SEU A;  3U1O A;  2XXV A;  1TXF A;  3CG1 A;  3QUJ A;  4PFU A;  1QUL A;  4FAT A;  4L17 A;  2O7I A;  3DP4 A;  3JZJ A;  4NF4 B;  5DEX B;  5EYF A;  1UTB B;  5H8F B;  1ZTY A;  2D3I A;  3PGF A;  3RQT A;  2I3V A;  5L9S A;  1EZP A;  4WEP A;  4MBP A;  4FOR A;  1QJM A;  4ND9 A;  4KCC A;  1MXZ A;  2RKM A;  3HCQ A;  4DCY A;  3G3F A;  1P1N A;  3IOU A;  4JWO A;  3PPR A;  4ZE8 A;  3U94 A;  4C1U A;  1VFD A;  1A40 A;  2XX9 A;  5AA4 A;  5TP9 B;  4PE5 B;  2ZNS A;  5IAI A;  3FZV A;  4G68 A;  1R1N A;  3UA8 A;  2Y7R A;  4DXB A;  3D4G A;  2XXT A;  4OZ9 A;  4ESW A;  5HBC A;  3O6H A;  5I2K B;  4U23 A;  1VE4 A;  2OBG A;  3IOT A;  1N0T A;  5AA3 A;  1BKA A;  4YMB A;  1GV8 A;  3PUY E;  5JEI A;  3Q28 A;  4BDM A;  3L6H A;  2M8C A;  3JYR A;  4X9T A;  1AL3 A;  4XKP A;  2O69 A;  4FJP A;  4NF5 A;  4QFP A;  3TTK A;  1R6Z A;  4HCW A;  1MXV A;  4JB7 A;  2FA7 A;  2DE2 A;  4DIG A;  5TP9 A;  1N7W A;  1B3F A;  3H03 A;  3IB1 A;  5DVJ A;  4YAH X;  2XHD A;  4KI0 E;  4LUB A;  3B6Q A;  5I2N B;  1FW0 A;  1LFH A;  2I48 A;  4G77 A;  3TYH A;  5ICQ A;  3H6U A;  3ILU B;  4GD5 A;  3TEL A;  3FAS A;  1CE2 A;  4Z7E A;  3SER A;  1US4 A;  1M5F A;  2GHA A;  1NH8 A;  1UQW A;  2D5W A;  1S9T A;  2PVU A;  2XD3 A;  4YZZ A;  2DWJ A;  1EH3 A;  3AXF A;  1B1X A;  5CM6 A;  3LBS A;  4E0W A;  3MC2 A;  3PUX E;  4KYS A;  4POX A;  3RGY A;  4OEN A;  4YB6 A;  4NED A;  1MH4 A;  2A5S A;  3K6U A;  2IEE A;  1Y3N A;  2XXQ A;  4PP0 A;  4BDR A;  2NOO A;  1EU8 A;  1SVX B;  1B52 A;  2NUV A;  3C9H A;  1QVS A;  3ODB A;  2Q2C A;  4PFY A;  4Q30 B;  3OO9 A;  2VOZ A;  2ZXT A;  3FVO A;  2UXA A;  5L9M A;  4LA9 A;  1LBC A;  4LZ5 A;  4OFO A;  3Q27 A;  4U2R A;  3VLU A;  4EF1 A;  4XKN A;  2DXY A;  1URG A;  1NNP A;  5CMC A;  3H3G A;  4O3C A;  2QPQ A;  4G68 C;  2I4C A;  2V3Q A;  5KDT B;  4ZEK A;  3FV1 A;  2F8D A;  4GQO A;  4YB5 A;  4O3B A;  3RTF B;  3VLW A;  1B7H A;  4KCD A;  1POT A;  3GXA A;  5B70 A;  3QK6 A;  3TQL A;  2GFE A;  3TTR A;  3K1M A;  3MW0 A;  3RNN A;  1ANF A;  1YPN A;  4NF4 A;  1R9Q A;  1MY0 A;  2Z8E A;  3GBA A;  5DEX A;  5J1D A;  2F34 A;  4R6K A;  1OLA A;  4QHQ A;  2E0S A;  1SW5 A;  3F11 A;  3K02 A;  4TLM B;  2F78 A;  4F29 A;  3TTM A;  3RT6 B;  2QS4 A;  2HQ0 A;  2REG A;  5TU0 A;  4EXL A;  4U21 A;  4F3P A;  1MXW A;  4GF8 A;  5BWJ A;  1Y3Q A;  4ZS9 A;  4JSO A;  4YKP A;  2F6G A;  3OEN A;  1MY2 A;  3TDJ A;  3IOV A;  1MPC A;  1I6B A;  5HPQ A;  2UYF A;  3LSX A;  4HS7 A;  3KZG A;  1OMP A;  1B0L A;  1D9Y A;  2V84 A;  4IO3 A;  3RPW A;  3MPL A;  5ISU A;  1YTV A;  4RNS A;  5AA1 A;  2O84 X;  1FQE A;  4TLL B;  5CI5 A;  3TAJ A;  4XTC Q;  1I6Q A;  1OVT A;  3T9V A;  1S50 A;  1LFI A;  1B58 A;  1MY4 A;  2VHA A;  3FVN A;  3QXM A;  4RPN A;  5AA4 B;  3K6V A;  1ZJL A;  3SES A;  3O66 A;  4YU0 A;  3LSL A;  2XD2 A;  3PUV E;  1XS5 A;  1B3E A;  5JK4 A;  1USY E;  3TKD A;  1ZKB A;  4OMB A;  3TEP A;  1Y20 A;  2AL4 A;  4IGT A;  5CMK A;  1LB9 A;  5EHS A;  1NH7 A;  1GR2 A;  4F1V A;  5FHO A;  2PMS A;  4OFL A;  4RPO A;  2R6G E;  2ZYO A;  5K2X A;  2Q9T A;  4FED A;  1ZMG A;  3K6X A;  4IY5 A;  1URD A;  3IB2 A;  2I58 A;  3N26 A;  4PFW A;  1HSE A;  2BJJ X;  2AYS A;  3MWB A;  2F35 A;  4MH5 A;  5FHM A;  4IO5 A;  4KHZ E;  1SD3 A;  2I0C A;  4JSD A;  5H8S A;  4H8I A;  4BDO A;  4YKK A;  1FQB A;  1BTJ A;  4FE8 A;  1AIV A;  3LR1 A;  3G3H A;  2ZMB A;  3M3K A;  3FXR A;  3CFL A;  3FXU A;  3U72 A;  1H3D A;  2DVC A;  1Y9U A;  4F1Y A;  4X1D A;  4H8J A;  1SI0 A;  3VDF A;  4I1D A;  2H5Y A;  3LSF B;  1Y4T A;  4LZ7 A;  5I2K A;  3R6U A;  1IZ1 A;  1XOC A;  2VP1 A;  1B3L A;  5LOM A;  2P2A A;  4OES A;  1B6H A;  1LB8 A;  3TFL A;  3TTN A;  3MZB A;  3TZA A;  4MF3 A;  3GZG A;  4KFQ A;  2XXX A;  1Y1Z A;  2OWS A;  3VLV A;  4Q8R A;  1MQG A;  1MXX A;  4OHN A;  3HHF A;  5I56 A;  3QYT A;  5ITO A;  1QUK A;  3KEI A;  3KGC A;  3DP8 A;  3HO7 A;  3T9X B;  3CSG A;  4H5G A;  2XXH A;  3EQ1 A;  3RLF E;  2ZYM A;  4ELP A;  3C35 A;  4JDF A;  1UTB A;  5H8F A;  5H8H B;  4ECF A;  2PT1 A;  1NKX A;  3THI A;  2YJP A;  1A55 A;  4QRZ A;  2F97 A;  3OXN A;  1BP5 A;  1JW5 A;  2PX1 A;  3OMB A;  4G2Z A;  1KWH A;  1II5 A;  3HHG A;  3OO6 A;  5TPA B;  2NVU B;  1M5E A;  1LAF E;  2F6P A;  4H5F A;  3BBR A;  5AA2 D;  4DCX A;  3V83 A;  1AOV A;  2XXU A;  1POY 1;  2GRV A;  3LUY A;  3MVZ A;  1XC1 A;  1P1W A;  3K01 A;  3K6W A;  3QIM A;  4H1X A;  4U22 A;  4OFJ A;  4ELO A;  3S9N C;  2ALU A;  1YAE A;  1LFG A;  2PBW A;  2XX7 A;  3IR1 A;  4R6Y A;  3H4Z A;  4TQU Q;  3FXQ A;  4R72 A;  3S9E A;  5I57 B;  4NF8 B;  4C1T A;  1USY H;  2XXY A;  1LAX A;  3OO7 A;  4BLA A;  4XKR A;  1B40 A;  3PPO A;  3KG2 A;  3U93 A;  3B6W A;  3OSQ A;  2DWH A;  2HFB A;  5DVI A;  3TQW A;  1JEU A;  1PB8 A;  3PV0 E;  1FQF A;  2A5T B;  4DZ1 A;  3IB0 A;  4DDD A;  3V89 B;  1GVC A;  3DLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...