3THIA

Thiaminase i from bacillus thiaminolyticus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
362
structure length
362
Chain Sequence
ITLKVAIYPYVPDPARFQAAVLDQWQRQEPGVKLEFTDWDSYSADPPDDLDVFVLDSIFLSHFVDAGYLLPFGSQDIDQAEDVLPFALQGAKRNGEVYGLPQILCTNLLFYRKGDLKIGQVDNIYELYKKIGTSHSEQIPPPQNKGLLINMAGGTTKASMYLEALIDVTGQYTEYDLLPPLDPLNDKVIRGLRLLINMAGEKPSQYVPEDGDAYVRASWFAQGSGRAFIGYSESMMRMGDYAEQVRFKPISSSAGQDIPLFYSDVVSVNSKTAHPELAKKLANVMASADTVEQALRPQADGQYPQYLLPARHQVYEALMQDYPIYSELAQIVNKPSNRVFRLGPEVRTWLKDAKQVLPEALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of thiaminase-I from Bacillus thiaminolyticus at 2.0 A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords PROTEIN (THIAMINASE I)
total genus 116
structure length 362
sequence length 362
ec nomenclature ec 2.5.1.2: Thiamine pyridinylase.
pdb deposition date 1998-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3thiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3thiA02
1MM7A 3ONMA 4YMBA 4I62A 3S9NC 1IXIA 2VD3A 2DE4A 4RXLA 2Q2CA 5JK4A 2PYYA 4GWOA 5I84A 1IZ1A 3C34A 5H8FB 4QSEA 3BFTA 4EDPA 2XXXA 1IIWA 3N94A 2CZLA 4NF4A 1TFAA 4XKNA 2I3VA 3T96B 3A09A 3EQ1A 4H8JA 3V89B 5KCJA 4FECA 4GL0A 3RY3A 1HSEA 3E13X 1NNKA 4H67A 2H25A 2Z8FA 3QK6A 3IO6A 4NF4B 2IA4A 2Z23A 1Q1KA 1VSOA 3CSBA 3K6VA 1Q35A 3RQTA 2XD3A 5FHNA 1Y1ZA 2BJJX 3MPLA 3U92A 2I6EA 1D9YA 1Y3PA 3FZVA 3JZJA 3GLBA 4X1DA 1B3FA 4QFLA 4EXKA 1AMFA 2XXTA 3MVXA 4O3CA 1XVYA 3TFLA 2KLFA 5B7DA 1NL5A 3IX1A 3TTNA 2DWHA 1AOVA 1II5A 1IXHA 3MZ9A 2X7QA 4F39A 4Z7EA 3O2AA 2NUVA 1QKBA 4IO2A 3L6HA 3C9HA 2ALUA 1AL3A 3PPRA 5DT6A 3VXBA 1WDNA 2I58A 1VFDA 4QRZA 2I4BA 2D3IA 3M3LA 4ZEIA 1P1UA 2DXYA 1OIBA 1P99A 2DWJA 2O7IA 1USYH 3H3GA 5AE4A 3IOVA 3IB1A 5AA2A 3N6UA 3EN3A 1PEBA 3IB2A 3OD7A 4FEBA 5HPQA 4FEDA 1R1NA 2NOOA 4OERA 4YKJA 1JEUA 4RY1A 1RYXA 1I6BA 3SEVA 1OLAA 3FXQA 5AA2B 1LB9A 4H5FA 4ZEKA 2YLNA 5M2VA 3FATA 4LQ2A 4DCXA 1NNTA 4KD5A 2G29A 4YKKA 2OLBA 4DE8A 5ISUA 3TUSA 1FQDA 4NTLA 3MW0A 4JWOA 2ZXTA 3U1OA 3F11A 4ELQA 4KCCA 2GHAA 4RPOA 2O68A 2QS2A 3G3KA 3IOUA 4FIMA 3RN8A 3O29A 3ZKLA 5H8NB 1USYE 3VLWA 3H6WA 1I6AA 3ILTB 3EHTA 3KSXA 3KZGA 4KR5A 1YAEA 4OWDA 2OWSA 3MC2A 5H8QA 3T9XB 4F2QA 5JTYA 1QUIA 1UIUA 5AA4A 1H3DA 4PFWA 1IQ7A 1SW4A 3PU5A 4OZ9A 1EZOA 2XXVA 5K2YA 1D4NA 4M4GA 5EYFA 1OLCA 5A5XB 5DTBA 4DXCA 4R6YA 4F3GA 3TAJA 2V3TA 2GHBA 4BDNA 1P1WA 3PMWA 2H99A 2Y7IA 3RLFE 1NH7A 3FV2A 2YPNA 3G7WA 3KOSA 4WKMA 2F35A 3C31A 3K1NA 1LAGE 1FQEA 2RCBA 4GOTA 2DWAA 1MY3A 3O6IA 1ZU0A 4X9TA 4IO5A 2F7CA 2E1SA 5H8NA 1B3LA 4ELRA 3S4UA 3QAXA 1KWHA 4E0WA 4QF9A 2ZNUA 5CMMA 2G93A 3QUJA 4LA9A 1Z7ME 3T9UA 1T0KA 4NE4A 3O28A 4ESWA 4ZZAA 4OMBA 1YTVA 2CMOA 4AB5A 2XXHA 1LBBA 2I4CA 3G3HA 4IY5A 4PQJA 4RK2A 2ZMBA 1DTZA 1ELJA 4BLAA 5HM4B 3S9LC 2NXOA 3C33A 4EQ7A 1LFIA 4EF2A 3BFUA 4QSCA 2V3QA 3W15C 1QULA 1B0HA 1XT8A 3VFJA 3FXUA 2F97A 1B7ZA 1EU8A 1SW2A 5TPAA 3N5LA 1URDA 2XX8A 2Q8JA 3RTWB 2DE3A 4C0RA 2DOJA 3OELA 2A5SA 4YICA 4NF8A 2AYSA 2VP1A 3FVOA 4YMAA 2UYFA 3O66A 5L9MA 4U23A 5F7VA 3CFZA 4F22A 2XHDA 3ECRA 2XX7A 1QKAA 2V3UA 3HHGA 1N76A 4G8MA 1MXYA 1O7TA 2O1MA 3IAZA 3UK4A 5J1DA 5AA2D 1URGA 4PE5B 3TTKA 3R26A 3VV5A 1VE4A 4HS7A 2QL3A 2W7YA 3B6WA 4O3BA 3TELA 3TQWA 4DIGA 2F6GA 4KPTA 4NWCA 2FNCA 3Q25A 4N13A 3TKDA 5L9SA 3M3FA 4OEUA 4HCWA 3T22A 4KCDA 4EQ9A 1SW1A 3P7IA 3KEIA 3GBAA 3CVGA 3A3CA 4H8IA 1I6QA 3PD9A 3B6QA 4IO3A 4XIGQ 4HCYA 3MP6A 4H5GA 3WAFA 1FTJA 4OETA 3O9PA 1MXVA 4AQ4A 5I56B 1B58A 3EPEA 1SQYA 2DQVA 3FJGA 2OBGA 2XXQA 3PPQA 5AA1A 3LBSA 5EHMA 3CIJA 4P11A 3S2VA 3SETA 5FHMA 3S9EA 1Y9UA 3C32A 1SI0A 3K00A 4IO4A 3MZ1A 2DE2A 3FUZA 4JWYA 4MF3A 2ONKE 3OO9A 2LAOA 4JXIA 1H44A 1JVXA 2FA7A 3G3FA 4I9DA 3G3IA 1MQIA 4NEDA 2UVGA 4LZ8A 2PT1A 2NVUB 5DEXA 3SEXA 4F3PA 5KDTA 3IJXB 1A99A 3M3KA 1B3EA 4MFIA 3TYHA 2I48A 1NH8A 4LP2B 1IXGA 2DVZA 4F18A 1Y4TA 2P0SA 1ATGA 5I59A 4OFLA 3OXNA 5I2KA 2QSXA 5DEXB 3I6VA 5CMBA 2AL4A 4DDDA 1B52A 4U21A 5BUUA 3FIRA 3T9VA 2DSFA 5CMKA 3UN6A 5ITPA 1UTHA 3H7MA 1Y4CA 4X1BA 5K2XA 1N7WA 1QUKA 2UVIA 1WODA 3D4GA 3MVZA 4GXAA 1GV8A 2A5TA 3M8UA 4RYAA 1MXUA 3U93A 1VFEA 2ESNA 3OMBA 4LONB 1LBCA 3O97A 3TMGA 3V83A 1MS7A 3N6TA 1B46A 3G3JA 4LZ7A 3V8XB 3V5AA 4U4SA 1QW0A 1XS5A 3E9XA 3PGFA 2DYXA 4H1XA 1MDP1 3K1PA 3PUZE 4UA8A 5DVIA 3TODA 3VLVA 1IEJA 4ZZEA 4EF1A 1LSTA 2QPQA 4G8HA 3RTFB 3OEKA 2X26A 5I56A 3D4CA 3H4ZA 1JW1A 4G77A 3CI8A 3LSXA 3W9VA 1URSA 3ODBA 4Q8RA 1BTJA 1MY4A 1N3WA 2QRYA 3FD3A 3OSRA 2DP8A 2RINA 1IITA 1B5HA 2PBWA 4R74A 4F3BA 3TTMA 4DZ1A 4MH5A 2HFBA 4O3AA 2WKYA 3DP6A 2HAUA 3OO8A 1MPBA 4G8NA 1POY1 2OZZA 2REGA 3MVYA 4F31B 5I57B 3DM0A 3MQ9A 4RPNA 2VOZA 1YPNA 1MXXA 2IEEA 3B6TA 4KQPA 3H06B 1GTKA 4FORA 3PMXA 1OVBA 1B3GA 1A40A 3K6XA 1H43A 1I69A 2I0CA 3MVWA 2RC7A 4ZDMA 2QS3A 1B5JA 1MQDA 3TCHA 4GLIA 1QVSA 3K0VA 3FASA 5H8QB 3MZBA 3KG2A 4R9FA 1SD3A 2ANJA 2Z8DA 3JYRA 1B40A 4JBZA 4H0WA 4NMYA 4NWDA 3U94A 5CI5A 4BDLA 5ELVA 3U72A 3HO7A 1OQGA 4G2ZA 1B51A 3KJ7A 4GRKA 4U2RA 4KYEA 1PBQA 5I58A 5JTYB 4ZS9A 1OQHA 3CG3A 3G3GA 1WVJA 2UXAA 3KFMA 1FQBA 4ZEDA 4ND9A 1MG1A 4ONYA 2Q89A 4R75A 3HPIA 3MP1A 1CE2A 4MLVA 4R72A 5I58B 3TTLA 1SYIA 2PVUA 1HSLA 3PUXE 2ZNTA 1M5EA 4JDFA 2ZYOA 4R2FA 4N07A 4F19A 4ISUA 4TQUQ 3RT8A 2UVJA 1NKXA 1ZTYA 4QFKA 3L6GA 4XKPA 3C35A 4ZECA 2GFEA 2XXPA 4I1DA 4NF5B 5F1QA 4OXVA 2ZYKA 3OO7A 2B3FA 1A8FA 1MM6A 1US4A 4PFYA 2ONRA 4YKPA 4R2BA 3KN8A 2ABHA 1MRPA 2QS4A 5KCJB 1B0LA 4GIZA 4THIA 3RT6B 4R9GA 1TFDA 2F8DA 4BDMA 1XOCA 3MPKA 1MXZA 1PC3A 4IB2A 4YB6A 1B4HA 4IO6A 4IY6A 5JEIA 3WAEA 1MY2A 2THIA 1F9BA 3PPOA 4QFPA 2I49A 4ELPA 4DXBA 1B3HA 3VVDA 2PX1A 3THIA 1UTBB 2HZKA 4JSDA 4ZEBA 1Y20A 3KOTA 3T93B 4FJPA 4JSOA 1ANFA 4E0XA 2HEUA 3TQLA 5I57A 3HV1A 2DXRA 3PPNA 1JW5A 4U1ZA 3K02A 3MWBA 3PD8A 3QSLA 1RKMA 1LFGA 4I8CA 3SERA 4XXUA 4P0GA 3GXAA 5FHOA 4DCYA 3SEWA 4RK9A 4POWA 1BIYA 1S7YA 3QYTA 2H9BA 4DXUA 2Q9TA 2F36A 3ZS6A 1O64A 1BP5A 3H6VA 1DPPA 1DPEA 1MDQA 3CFLA 3KGCA 3MP8A 4MBPA 4Z0IA 5H8HB 5DYHA 1Y3QA 4OHNA 5H8SA 3HHFA 2OK2A 4HTGA 4M1VA 3O6HA 4YKIA 1N0TA 3SEYA 3HSTA 1IXCA 3LC8A 4ZE8A 4Q5TA 1B2HA 1IUDA 3HN0A 1QJMA 1VR5A 1PB9A 3IORA 1O63A 3LSWA 2GH9A 4XKRA 1ZLQA 1UTBA 2OWTA 1DOTA 2RCAA 1M5BA 2V93A 4BDQA 5I2NB 3CSGA 1FCKA 3DELB 1MXWA 4K3FA 4P0IA 5CMCA 3K6WA 2Y84A 3FV1A 1LGBC 4PETA 2Y7RA 4GQOA 1TXFA 1J1NA 1LAFE 4R73A 2AL5A 1XHYA 2X7PA 3FXRA 3RUMA 1FTMA 2HXWA 1M5CA 2P2AA 3DP4A 4OENA 2QS1A 1S50A 4NF5A 5CBRA 1B9JA 1B4ZA 3E3KA 1EZ9A 3H6UA 3PMVA 3FJ7A 3PV0E 3PUYE 4GL8A 3OENA 3UP9A 1DTGA 3IOWA 2OCUA 2VD2A 3USDA 1JVYA 4MLQA 3VDFA 4EQBA 2Q2AA 3RGYA 4XKQA 2D21A 3FVKA 4F2OA 3IO4A 4KHZE 5ITOA 3I3VA 5HBCA 3K2DA 5TU0A 2R71A 4F29A 1MPCA 1UIVA 5IKBA 4TOZA 1JETA 3DLNA 1B5IA 3IK6B 2ZNSA 4LQ5A 4LUBA 1PB8A 2I3WA 3BKIB 4OEVA 3C4MA 3Q28A 4GFRA 2HZLA 2XXWA 1ZBMA 3FJMA 4NF8B 3OEMA 1M5DA 4OYVA 4OESA 4WEPA 1P1OA 3K1MA 4GF8A 3MUQA 3SDFA 5BWJA 1R9LA 3RPWA 1SVXB 3QXMA 3LSLA 4NF6A 1JEVA 1AH5A 3HCQA 1LCTA 5EHSA 1N04A 2XXIA 3T66A 3DP8A 1A54A 3FGSA 3IL1B 3PPPA 4DLDA 1DMBA 4ECFA 3LSFB 5DVJA 1MY0A 3TZAA 2PMSA 3S9MC 5AA3A 4NF6B 3CRBA 4H65A 4FE8A 2RC9A 4GVOA 4PFUA 3KJTA 1POTA 1GGGA 4TLLB 5A5XA 5I2KB 1FQCA 2H4IA 3LR1A 4F3SA 4N6PA 2B65A 3KBRA 4IGTA 4ZE9A 1FQFA 3ILUB 4ZEFA 4YZZA 1ZJLA 4F1VA 5L8DA 2ZYMA 4H6DA 1Y1MA 2NWJA 3OO6A 3K4UA 4BDOA 4LATA 2F5XA 3ZKKA 3KN3A 3IB0A 2H5YA 3UIFA 4F1YA 1A7LA 1MH3A 4OVJA 3B7DA 1PBPA 1MQJA 4OQOA 1PDAA 4OTEA 4RNSA 4ESXA 2DS9A 1B32A 2UVHA 1B1XA 3KSJA 3MJNA 2Y7PA 2HCAA 3MBPA 3SKPA 1FTOA 3TCFA 1SW5A 1R9QA 2O51A 3GZGA 1B7UA 4KI0E 5H8HA 1QUJA 4FATA 4U4XA 4GD5A 1BLFA 4BDRA 5CM6A 1HSJA 3O6GA 1US5A 3CFXA 1MH4A 1SI1A 2V84A 1TT1A 3VLUA 5CRYA 2XD2A 2F6PA 3TDJA 2Y7KA 5I59B 5TP9B 2V25A 2D5WA 1MPDA 1MQHA 4QSDA 3QIMA 4OFOA 4Q0CA 4WEDA 2QJEA 4GXSB 1LAXA 1UTHB 1LB8A 2YJPA 3E4RA 4POXA 1OMPA 3MAMA 3H6TA 2F7BA 3QUFA 5FTHA 2HAVA 4F1UA 1EZPA 2XX9A 1UQWA 3UORA 2Y7WA 1MQGA 2O6AA 1P1NA 4QFOA 3T9HB 2ONSA 4Q30B 5CC2A 2XXYA 4JWXA 1Z7NE 1H76A 3FVGA 5KDTB 2VHAA 3CR9A 3VE1B 4AB6A 3BBRA 2Z22A 3TTRA 5B70A 5H8FA 2DWIA 3IOTA 2ZYNA 2E0SA 5ICQA 2O1LA 3IJOB 1H45A 2Q88A 1SYHA 1NNPA 1P1QA 1JQFA 1ZKBA 2RF1A 3H03A 3TCGA 1FTKA 2O84X 3K6UA 1B6HA 3N26A 3EHSA 2O7UA 3Q26A 4EUOA 1R6ZA 3OOAA 4ELOA 3VVFA 2I0BA 4R6HA 4YU0A 1GR2A 4KFQA 3TEPA 4QHQA 1NNFA 2M8CA 2OJTA 1GVCA 1XVXA 2F78A 4LVQA 3SESA 4LZ5A 4R6KA 3R7XA 3UA8A 1LCFA 3GBBA 1BKAA 1OVTA 3KN7A 5TPAB 1N84A 2RC8A 1LAHE 1N7XA 5DVFA 3TPAA 1B1HA 1LLSA 2QMXA 1D3KA 3Q29A 1L5TA 3A3UA 5CBSA 4IO7A 4WXJA 3EHUA 2GRVA 3OSQA 3W9WA 5L9OA 3ZSFA 1B05A 2B3BA 3K01A 1B7HA 3IR1A 3R6UA 2H98A 3AXFA 1A55A 4FAJA 3Q27A 4QFNA 3UGWA 4YAHX 1YCJA 1FQAA 2F7AA 2XXRA 2F34A 1M5FA 3I5OA 4PFTA 4EXLA 3SEUA 5KZTA 5TP9A 4U1OA 4G68B 4OFJA 4PP0A 4U22A 2DVCA 4KYSA 1S9TA 2XXUA 3JV9A 4G68C 3EF7A 1Y3NA 1MY1A 1XC1A 3C36A 5FTIA 1ZMGA 2PT2A 1FW0A 1JW4A 1RYOA 4G68A 4X48A 4C1UA 3RNNA 2Z8EA 3VXCA 4HW8A 1AIVA 2AIXA 2A5TB 1CB6A 4IGRA 4JB7A 4UACA 2REJA 3VVEA 4C1TA 1JNFA 5I2NA 3PUWE 2R6GE 5ICTA 4TLMB 4G4PA 4XTCQ 1N3XA 1EH3A 2P1SA 1SDXA 1DSNA 4YB7A 5IAIA 2HQ0A 2QMWA 2VGQA 3PUVE 4YB5A 1PB7A 2RKMA 1A8EA 4RJZA 5AA4B 2FYIA 2O69A 3FVNA 1D9VA 2R9JA 5LOMA 3U8QA 2UYEA 4KYDA 3LUYA 1TWYA 1ZIUA 4RA1A 4L17A 1FTLA 1LFHA 1NFTA 1NMUA 3CG1A 1SBPA
chains in the Genus database with same CATH superfamily
3ONMA 2VD3A 4RXLA 1FPIA 5H8FB 4QSEA 3BFTA 2CZHA 4H8JA 4JVCA 3E13X 1NNKA 4H67A 3T0JA 2Z8FA 4NF4B 2IA4A 1Q1KA 3CSBA 3U92A 4XEQA 1Y1ZA 2BJJX 4MNIA 1D9YA 1SPIA 1B3FA 4EXKA 5FBPA 1XVYA 5B7DA 4F39A 2X7QA 4Z7EA 4GWUA 1QKBA 3L6HA 2OWZA 3C9HA 2ALUA 1AL3A 3VXBA 3B50A 4ZEIA 1P1UA 2DXYA 4HE2A 3N6UA 3IB2A 4FEBA 1FBCA 2NOOA 1K9ZA 4X8RA 4NHBA 3SEVA 2WYPA 4DCXA 2G29A 2OLBA 4PE3A 3TUSA 2GHAA 2QS2A 4FIMA 3ZKLA 3O29A 4OA4A 1USYE 3KZGA 3ILTB 3MC2A 1UIUA 5IZ1A 1H3DA 1IQ7A 5K2YA 4M4GA 5EYFA 5A5XB 5DTBA 4R6YA 3TAJA 3PMWA 2Y7IA 4GWSA 3KOSA 4WKMA 3T1BA 2F35A 3K1NA 1MY3A 3O6IA 4X9TA 4ELRA 1KWHA 4P47A 1T0KA 2Y5KA 4N6DA 3S9LC 1D9QA 1ELJA 4BLAA 2ZZXA 2V3QA 3W15C 1XT8A 3FXUA 4GX6A 1B7ZA 1SW2A 1YZ0A 2XX8A 2A5SA 3U65A 4YMAA 1YXIA 4U23A 5F7VA 4AS5A 2XHDA 3ECRA 1MXYA 3IAZA 3UK4A 5AA2D 4PE5B 3R26A 3VV5A 1VE4A 2W7YA 3B6WA 4DIGA 4HCWA 4KCDA 3KEIA 3GBAA 3PD9A 4PF6A 4XIGQ 2OX3A 2FIXA 2DQVA 3FJGA 1NV4A 3S9EA 3RYDA 4MF3A 3OO9A 2LAOA 2FA7A 2PT1A 5DEXA 1A99A 1B3EA 2I48A 2P0SA 1ATGA 5CMBA 2AL4A 3FIRA 3UN6A 1Y4CA 5K2XA 1N7WA 3MVZA 3M8UA 1MXUA 4LONB 3O97A 1NI9A 1MS7A 4LZ7A 3PGFA 2DYXA 4UA8A 1MDP1 3PUZE 4GBVA 3OEKA 2X26A 1JW1A 3CI8A 3W9VA 4Q8RA 2DP8A 2RINA 1IITA 2GQ1A 2HFBA 4HE1A 3DP6A 2HAUA 1POY1 3DM0A 2VOZA 1YPNA 2IEEA 1AWBA 4FBPA 4KQPA 1OVBA 4O7IA 3K6XA 3TCHA 2QS3A 3MZBA 4R9FA 1SD3A 4JBZA 3JYRA 4JVDA 4BDLA 1OQGA 5I58A 5JTYB 4ZS9A 3G3GA 1WVJA 3KFMA 4ONYA 3PUXE 2ZNTA 3C35A 4NF5B 4OXVA 5EQ7A 4PFYA 4YKPA 4R2BA 2ABHA 1TFDA 1XOCA 4YB6A 1MXZA 1PC3A 1BK4A 4IO6A 1B3HA 4N15A 3RPLA 3KOTA 3TQLA 4MMPA 2DXRA 3MWBA 4I8CA 4XXUA 4P0GA 4DCYA 4DXUA 2F36A 3T9XB 1DPEA 1Y3QA 4OHNA 3HSTA 3HN0A 1PB9A 1O63A 1EYIA 2WX9A 1ZLQA 1NUWA 1DOTA 4BDQA 4P0IA 2Y84A 3FV1A 4PETA 2Y7RA 3FXRA 1FTMA 1S50A 1IMCA 1B9JA 3H6UA 3UP9A 3FJ7A 4GL8A 4PTKA 3OENA 4EQBA 5ITOA 3I3VA 2KR0A 3K2DA 4F29A 1MPCA 1UIVA 3DLNA 3IK6B 4LQ5A 4PGPA 2HXRA 2HZLA 2XXWA 4NF8B 4WEPA 3SDFA 3K1MA 2CEYA 1AH5A 5EHSA 2XXIA 1A54A 3FGSA 3IL1B 2VPOA 1MY0A 2PMSA 3S9MC 1G0HA 4NF6B 3CRBA 2WYKA 4FE8A 5I2KB 2H4IA 4N6PA 1MH3A 5IZ3A 4OTEA 2DS9A 2UVHA 4GWZA 1B1XA 3MJNA 1B7UA 5CM6A 2PFZA 1BLFA 4BDRA 1US5A 4MNPA 1SI1A 5CRYA 1IMAA 5TP9B 1MPDA 4OFOA 4WEDA 1LAXA 2NVUB 3H6TA 3QUFA 2HAVA 4QFOA 5CC2A 1H76A 3CR9A 4O94A 4I3YA 2Q88A 1SYHA 1P1QA 1FTKA 3K6UA 1B6HA 3BIGA 4ELOA 2I0BA 4YU0A 3TEPA 4QHQA 5LDZA 1GVCA 4LZ5A 2RC8A 1RDYA 3A3UA 5CBSA 1NV0A 4WXJA 3EHUA 3W9WA 3K01A 5IM2A 3R6UA 1NUXA 3Q27A 4PFRA 5EQ8A 1FQAA 4EXLA 4NF0A 5KZTA 5TP9A 4U1OA 2DVCA 5FTIA 4G68A 2Z8EA 2A5TB 4TLMB 4XTCQ 1FBPA 1PB7A 3FXBA 2XXKA 5AA4B 2O69A 4PAFA 5LOMA 2UYEA 4RA1A 1INPA 4IO7A 1FBGA 1IXIA 2Q2CA 3C34A 4EDPA 1VDWA 1IIWA 2XXXA 3N94A 4XKNA 3A09A 5KCJA 4FECA 4GL0A 3RY3A 2H25A 2CZIA 2XWIA 2Z23A 3RQTA 1Q35A 2XD3A 5FHNA 3MPLA 2I6EA 1Y3PA 4GBWA 3JZJA 2XXTA 3MVXA 5EYHA 2KLFA 1AOVA 3TTNA 2DWHA 5A5LA 3MZ9A 2NUVA 3PPRA 5DT6A 1WDNA 2R8TA 2I4BA 3FBPA 1OIBA 1P99A 3IOVA 3EN3A 1PEBA 1JEUA 3D1RA 3FXQA 4G61A 4H45A 4LQ2A 1NNTA 1FPLA 4O8MA 4JWOA 3U1OA 1XI6A 2O68A 3IOUA 3VLWA 4NQ8A 1I6AA 4F2QA 1YAEA 2OWSA 1KZ8A 2FHYA 5AA4A 3PU5A 4OZ9A 2XXVA 1D4NA 4DXCA 2V3TA 3FV2A 2YPNA 3G7WA 1FQEA 3A29A 1ZU0A 5H8NA 3QAXA 5CMMA 1NV2A 2G93A 3T9UA 1Z7ME 3O28A 4ESWA 4OMBA 2CMOA 2XXHA 2I4CA 3G3HA 4IY5A 4RK2A 5HM4B 2ZMBA 4PBQA 2NXOA 3C33A 4EQ7A 2F97A 5TPAA 2DOJA 2AYSA 2VP1A 5ET5A 5L9MA 4F22A 2XX7A 5J1DA 3TELA 5IZZA 4NWCA 3TKDA 5L9SA 4EQ9A 1I6QA 3B6QA 4HCYA 3MP6A 1SQYA 2XXQA 5EHMA 3S2VA 3C32A 4DI3D 2ONKE 4PAIA 4NAPA 4LZ8A 5KDTA 3M3KA 4F18A 4LP2B 1IXGA 1Y4TA 5I59A 5BUUA 4U21A 2DSFA 3H7MA 3U93A 2ESNA 3V83A 3TMGA 4LN5A 3IFAA 3V5AA 3ISPA 5DVIA 4H1XA 3TODA 4G8HA 3D4CA 4G77A 3OSRA 3FD3A 4F3BA 1DCUA 2WEFA 3BIHA 2REGA 5I7IA 3H06B 3PMXA 4OVPA 2RC7A 3K0VA 4NWDA 1FTAA 4P56A 3HO7A 1B51A 3KJ7A 3CG3A 2UXAA 1FQBA 3HPIA 3MP1A 4MLVA 1FBHA 4F19A 1HSLA 2HPGA 4MHFA 4ISUA 4TQUQ 3RT8A 1ZTYA 2BJIA 4XKPA 2ZYKA 3OO7A 1FPBA 2QFLA 4PC9A 4THIA 2F8DA 4IB2A 1B4HA 4IY6A 5ET6A 1MY2A 2THIA 3PPOA 4QFPA 4DXBA 2PX1A 1UTBB 4JSDA 1Y20A 1FPJA 2XWKA 4U1ZA 3K02A 3PD8A 3QSLA 1RKMA 3KC1A 4RK9A 4POWA 1BIYA 1S7YA 3QYTA 3ZS6A 3KGCA 1MDQA 3MP8A 4MBPA 5DYHA 5H8SA 4M1VA 3O6HA 1N0TA 3SEYA 1QJMA 1VR5A 4XKRA 1NV3A 5I2NB 2P3NA 5CMCA 5I5PA 1LGBC 4GQOA 1XHYA 2X7PA 3RUMA 4OENA 4PAKA 3EKIA 1B4ZA 3PMVA 1FPDA 3PUYE 2OCUA 2VD2A 2D21A 3FVKA 4KHZE 1JETA 1B5IA 2HHMA 2I3WA 3BKIB 4MCOA 4OEVA 3C4MA 3Q28A 1ZBMA 5JEIA 1M5DA 2JJKA 1P1OA 5BWJA 1R9LA 3RPWA 1SVXB 1N04A 3IFCA 3PPPA 4ECFA 5DVJA 3TZAA 5AA3A 2RC9A 4TLLB 5A5XA 3KBRA 3ILUB 4H6DA 3KN3A 3UIFA 1FPGA 1MQJA 4RNSA 3KSJA 3SKPA 1FTOA 1R9QA 3GZGA 4KI0E 4U4XA 1Q9DA 4P3LA 1MH4A 1FJ9A 4P8BA 2F6PA 3TDJA 2D5WA 4DI4B 2QJEA 1UTHB 2L5VA 5ISUA 1EZPA 3MAMA 1UQWA 2FBPA 4I3EA 3UORA 1P1NA 5KDTB 5H8FA 2ZZVA 3VE1B 3BBRA 3IOTA 2ZYNA 5ICQA 1NNPA 3H03A 3N26A 3EHSA 2KQZA 3OOAA 1NV6A 4UABA 4R6HA 1GR2A 1NNFA 4JVIA 3UA8A 1BKAA 3KN7A 5TPAB 3QMFA 2Q74A 2QMXA 3Q29A 1B05A 2B3BA 3AXFA 4NG7A 4QFNA 1YCJA 1M5FA 3I5OA 4PFTA 4PP0A 4KYSA 1S9TA 2XXUA 3EF7A 3C36A 4X48A 4NX1A 4C1UA 3VXCA 4JB7A 1N3XA 1EH3A 2P1SA 1SDXA 4GX3A 3LUZA 3PUVE 4YB5A 1D9VA 2R9JA 2Y5LA 4OVTA 4GWXA 5I56A 3CG1A 1FPKA 1MM7A 4I62A 2DE4A 5JK4A 4GWOA 4P9KA 2CZLA 4NF4A 1TFAA 2I3VA 3T96B 3EQ1A 3V89B 1HSEA 3QK6A 1VSOA 3K6VA 4X1DA 4QFLA 3TFLA 1NL5A 3IX1A 1LBYA 4IO2A 1VFDA 4QRZA 2D3IA 3M3LA 2DWJA 1USYH 3H3GA 4FEDA 1R1NA 1OLAA 4H5FA 5M2VA 4YKKA 4DE8A 1FQDA 4NTLA 3MW0A 2ZXTA 4ELQA 3F11A 4RPOA 4YMBA 5H8NB 3G3KA 3ROJA 3EHTA 4KR5A 4OWDA 5H8QA 2PFYA 4PFWA 1SW4A 1FBDA 1IMFA 4F3GA 3GYYA 4BDNA 1NH7A 2DWAA 4IO5A 2F7CA 1B3LA 4E0WA 4N6KA 4LA9A 4NE4A 4AB5A 1LBBA 4PQJA 1LFIA 1QGXA 3BFUA 4QSCA 1QULA 5J16A 1CNQA 4YICA 4NF8A 2UYFA 3O66A 2V3UA 1N76A 1O7TA 1URGA 3TTKA 4O3BA 4FATA 4PBHA 4N13A 3M3FA 3CVGA 4H8IA 3WAFA 5JTYA 1FTJA 1MXVA 5I56B 2OBGA 1FRPA 4P11A 5FHMA 1SI0A 3K00A 2DE2A 4JXIA 1H44A 3G3FA 4I9DA 2UVGA 1NV1A 3IJXB 1NH8A 3OXNA 2QSXA 5DEXB 3I6VA 5ITPA 1QUKA 1FSAA 3D4GA 4GXAA 1GV8A 4RYAA 3E79A 4N4UA 3N6TA 3V8XB 1JP4A 1XS5A 4GWWA 3K1PA 1IEJA 4EF1A 2QPQA 3RTFB 3HFUA 3H4ZA 5EQ9A 3ODBA 1BTJA 1N3WA 2QRYA 4ZZEA 4G8NA 3MVYA 4F31B 5I57B 4RPNA 1MXXA 4FORA 1GTKA 1EYJA 1B3GA 2I0CA 3MVWA 4ZDMA 1B5JA 4GLIA 5H8QB 3FASA 3KC0A 5F24A 4NMYA 1B40A 3U94A 5CI5A 5ELVA 3U72A 5ET8A 4U2RA 1PBQA 5IGAA 4ND9A 4R75A 2Q89A 1CE2A 4N81A 4R72A 5I58B 2WBBA 2PVUA 1M5EA 2ZYOA 4ZECA 3L6GA 2GFEA 2XXPA 1A8FA 1MM6A 1US4A 2ONRA 1MRPA 5KCJB 1B0LA 3RT6B 4N8GA 4ELPA 3VVDA 2HZKA 4ZEBA 3T93B 4JSOA 1ANFA 4E0XA 2HEUA 5I57A 1JW5A 4QXDA 3SEWA 2P3VA 1BP5A 5H8HB 1DPPA 4Z0IA 4PFBA 2OK2A 4HTGA 4PDHA 1LBXA 1IXCA 3LC8A 4Q5TA 1IUDA 3IORA 2GH9A 1UTBA 2OWTA 2V93A 1M5BA 4XF5A 1FCKA 3DELB 1LAFE 2AL5A 4MNCA 2HXWA 2P2AA 2QS1A 4NF5A 3E3KA 3PV0E 3USDA 3VDFA 1JVYA 4MLQA 2Q2AA 3RGYA 4F2OA 3IO4A 5TU0A 5IKBA 4AS4A 4LUBA 1PB8A 5I3SA 3OEMA 1NUYA 4GF8A 3MUQA 4NF6A 4GX4A 3ZSFA 3CHGA 1IMBA 4DLDA 1DMBA 4PFUA 4GVOA 3KJTA 4MIJA 1GGGA 2Q8MA 1NV7A 2B65A 4ZE9A 1FQFA 4ZEFA 4F1VA 2NWJA 3OO6A 2V4CA 3K4UA 4LATA 3ZKKA 3IB0A 4F1YA 4OVJA 3B7DA 4OQOA 1PDAA 4ESXA 1B32A 2Y7PA 2HCAA 3MBPA 3TCFA 5H8HA 1QUJA 4GD5A 4O7MA 2V84A 3VLUA 2Y7KA 2V25A 2DDKA 4QSDA 1LBVA 4Q0CA 4OVQA 4POXA 3E4RA 5FTHA 1OMPA 2F7BA 2Y7WA 1MQGA 2O6AA 3T9HB 2ONSA 4Q30B 4JWXA 1Z7NE 2VHAA 2Z22A 2DWIA 2O1LA 3IJOB 1ZKBA 2O7UA 1R6ZA 4OVRA 4KFQA 2OJTA 2F78A 1LCFA 1OVTA 1N7XA 3TPAA 1YYZA 1B1HA 1LLSA 1D3KA 1L5TA 2GRVA 5ET7A 1RDXA 2CZKA 2XXRA 2F34A 1RDZA 4G68B 4OFJA 4U22A 3JV9A 4G68C 1XC1A 2PT2A 1FW0A 1JW4A 1LBWA 1RYOA 3RNNA 4HW8A 1KA1A 1AIVA 1CB6A 2VT5A 2REJA 2R6GE 5ICTA 4G4PA 4YB7A 5IAIA 2HQ0A 2VGQA 4RJZA 2RKMA 4P1EA 2FYIA 3LUYA 4L17A 1FTLA 1NFTA 4IR8A 1NMUA 3RPLB 1FPFA 3S9NC 5EQAA 2PYYA 5I84A 1IZ1A 4OANA 3IO6A 3FZVA 3GLBA 1AMFA 4O3CA 1II5A 1IXHA 3O2AA 2I58A 2B4MA 2O7IA 5AE4A 3IB1A 5AA2A 3OD7A 5HPQA 4OERA 4MEVA 4YKJA 4RY1A 1RYXA 1I6BA 5AA2B 1LB9A 5LTCA 4ZEKA 2YLNA 3FATA 4KD5A 4KCCA 2FIEA 3RN8A 4MAGA 1FJ6A 3H6WA 3KSXA 5I2NA 1QUIA 1EZOA 1OLCA 1G0IA 2GHBA 1P1WA 2H99A 4N17A 3RLFE 3C31A 5EYGA 1LAGE 4I40A 2RCBA 4GOTA 1FPEA 3LV0A 2E1SA 1KA0A 3MSTA 3S4UA 4QF9A 2ZNUA 1IMEA 3QUJA 4PDDA 1DBZA 4XFEA 4ZZAA 3E78A 1YTVA 1DTZA 3KBZA 4EF2A 1B0HA 3VFJA 1EU8A 3N5LA 1URDA 2Q8JA 3RTWB 2DE3A 4C0RA 3OELA 2XWOA 3FVOA 3CFZA 1QKAA 3HHGA 4G8MA 2O1MA 4HS7A 2QL3A 3TQWA 4MJOA 2F6GA 4KPTA 2FNCA 3Q25A 1K9YA 4OEUA 2CEXA 3T22A 1SW1A 3P7IA 3A3CA 2PCRA 4IO3A 4H5GA 4OETA 4AQ4A 3O9PA 1B58A 3EPEA 5AA1A 3PPQA 4OVSA 3LBSA 3CIJA 4H46A 3SETA 1Y9UA 4IO4A 3MZ1A 3FUZA 4JWYA 4PCDA 1JVXA 3B8BA 4NEDA 4F1UA 3G3IA 1MQIA 3SEXA 4F3PA 4MFIA 3TYHA 2DVZA 4OFLA 5I2KA 4DDDA 1B52A 5CMKA 3T9VA 1UTHA 4X1BA 2UVIA 1WODA 2A5TA 5IZ3B 1VFEA 1IMDA 3OMBA 1LBCA 1B46A 3G3JA 4U4SA 1QW0A 3E9XA 3VLVA 1LSTA 4HE0A 3LSXA 1URSA 1MY4A 1B5HA 1FBEA 2PBWA 4R74A 3TTMA 4DZ1A 2WBDA 4MH5A 4O3AA 2WKYA 3OO8A 1MPBA 2OZZA 3MQ9A 3B6TA 2XA5A 1A40A 1H43A 1I69A 1MQDA 5T3JA 1QVSA 3SZPA 3KG2A 2ANJA 2Z8DA 4H0WA 1EYKA 4G2ZA 3MYUA 4GRKA 4KYEA 1OQHA 4ZEDA 1MG1A 3NOHA 2F3DA 3TTLA 1SYIA 4JDFA 4R2FA 4N07A 2UVJA 1NKXA 4QFKA 4I1DA 5F1QA 1DK4A 2B3FA 3KN8A 2QS4A 4GIZA 4R9GA 4BDMA 3MPKA 3WAEA 1LBZA 3PTYA 1F9BA 2I49A 4X04A 3THIA 4P1LA 4FJPA 4N8YA 3HV1A 3PPNA 3SERA 1LFGA 3GXAA 5FHOA 2H9BA 2Q9TA 1O64A 3H6VA 3CFLA 4PFIA 3HHFA 4YKIA 4ZE8A 1B2HA 3LSWA 2MKZA 2RCAA 3CSGA 1MXWA 4K3FA 3K6WA 1TXFA 1J1NA 4R73A 1M5CA 3DP4A 5CBRA 1EZ9A 1DTGA 3IOWA 4XKQA 5HBCA 2R71A 4TOZA 4QBAA 2ZNSA 1FBFA 2QVVA 5ESYA 4GFRA 3FJMA 2QVUA 4OYVA 4OESA 3QXMA 3LSLA 1JEVA 3HCQA 1LCTA 3T66A 3DP8A 2QVRA 3LSFB 4H65A 1POTA 1FQCA 3LR1A 4F3SA 4IGTA 4YZZA 1ZJLA 5L8DA 2ZYMA 1Y1MA 4BDOA 2F5XA 2H5YA 1A7LA 5DW8A 1PBPA 4GWYA 1SW5A 2O51A 2B4LA 1HSJA 3O6GA 3CFXA 1TT1A 2FVZA 2XD2A 5I59B 1MQHA 2ZZWA 3QIMA 4NGUA 4GXSB 1LB8A 2YJPA 4PF8A 4N91A 2XX9A 2XXYA 3FVGA 4AB6A 5B70A 2XWVA 3TTRA 2E0SA 1H45A 3TCGA 1JQFA 2RF1A 4KXPA 3Q26A 2O84X 4EUOA 2F3BA 3VVFA 4PGNA 2M8CA 1XVXA 4LVQA 3SESA 4R6KA 3R7XA 1NV5A 3GBBA 1N84A 1LAHE 5DVFA 5L9OA 3OSQA 4HXVA 1B7HA 3IR1A 2H98A 1A55A 4FAJA 3UGWA 4YAHX 2F7AA 3SEUA 1Y3NA 1MY1A 1ZMGA 2VPNA 2AIXA 4IGRA 4UACA 1NUZA 4C1TA 3VVEA 1JNFA 3PUWE 4NN3A 1DSNA 2QMWA 1A8EA 1LEVA 3FVNA 3U8QA 4KYDA 1TWYA 4MX6A 1ZIUA 1LFHA 1SBPA
chains in the Genus database with same CATH topology
1MM7A 3ONMA 4YMBA 4I62A 3S9NC 1IXIA 2VD3A 2DE4A 4RXLA 2Q2CA 5JK4A 2PYYA 4GWOA 5I84A 1IZ1A 3C34A 5H8FB 4QSEA 3BFTA 4EDPA 2XXXA 1IIWA 3N94A 2CZLA 4NF4A 1TFAA 4XKNA 2I3VA 3T96B 3A09A 3EQ1A 4H8JA 3V89B 5KCJA 4FECA 4GL0A 3RY3A 1HSEA 3E13X 1NNKA 4H67A 2H25A 2Z8FA 3QK6A 3IO6A 4NF4B 2IA4A 2Z23A 1Q1KA 1VSOA 3CSBA 3K6VA 1Q35A 3RQTA 2XD3A 5FHNA 1Y1ZA 2BJJX 3MPLA 3U92A 2I6EA 1D9YA 1Y3PA 3FZVA 3JZJA 3GLBA 4X1DA 1B3FA 4QFLA 4EXKA 1AMFA 2XXTA 3MVXA 4O3CA 1XVYA 3TFLA 2KLFA 5B7DA 1NL5A 3IX1A 3TTNA 2DWHA 1AOVA 1II5A 1IXHA 3MZ9A 2X7QA 4F39A 4Z7EA 3O2AA 2NUVA 1QKBA 4IO2A 3L6HA 3C9HA 2ALUA 1AL3A 3PPRA 5DT6A 3VXBA 1WDNA 2I58A 1VFDA 4QRZA 2I4BA 2D3IA 3M3LA 4ZEIA 1P1UA 2DXYA 1OIBA 1P99A 2DWJA 2O7IA 1USYH 3H3GA 5AE4A 3IOVA 3IB1A 5AA2A 3N6UA 3EN3A 1PEBA 3IB2A 3OD7A 4FEBA 5HPQA 4FEDA 1R1NA 2NOOA 4OERA 4YKJA 1JEUA 4RY1A 1RYXA 1I6BA 3SEVA 1OLAA 3FXQA 5AA2B 1LB9A 4H5FA 4ZEKA 2YLNA 5M2VA 3FATA 4LQ2A 4DCXA 1NNTA 4KD5A 2G29A 4YKKA 2OLBA 4DE8A 5ISUA 3TUSA 1FQDA 4NTLA 3MW0A 4JWOA 2ZXTA 3U1OA 3F11A 4ELQA 4KCCA 2GHAA 4RPOA 2O68A 2QS2A 3G3KA 3IOUA 4FIMA 3RN8A 3O29A 3ZKLA 5H8NB 1USYE 3VLWA 3H6WA 1I6AA 3ILTB 3EHTA 3KSXA 3KZGA 4KR5A 1YAEA 4OWDA 2OWSA 3MC2A 5H8QA 3T9XB 4F2QA 5JTYA 1QUIA 1UIUA 5AA4A 1H3DA 4PFWA 1IQ7A 1SW4A 3PU5A 4OZ9A 1EZOA 2XXVA 5K2YA 1D4NA 4M4GA 5EYFA 1OLCA 5A5XB 5DTBA 4DXCA 4R6YA 4F3GA 3TAJA 2V3TA 2GHBA 4BDNA 1P1WA 3PMWA 2H99A 2Y7IA 3RLFE 1NH7A 3FV2A 2YPNA 3G7WA 3KOSA 4WKMA 2F35A 3C31A 3K1NA 1LAGE 1FQEA 2RCBA 4GOTA 2DWAA 1MY3A 3O6IA 1ZU0A 4X9TA 4IO5A 2F7CA 2E1SA 5H8NA 1B3LA 4ELRA 3S4UA 3QAXA 1KWHA 4E0WA 4QF9A 2ZNUA 5CMMA 2G93A 3QUJA 4LA9A 1Z7ME 3T9UA 1T0KA 4NE4A 3O28A 4ESWA 4ZZAA 4OMBA 1YTVA 2CMOA 4AB5A 2XXHA 1LBBA 2I4CA 3G3HA 4IY5A 4PQJA 4RK2A 2ZMBA 1DTZA 1ELJA 4BLAA 5HM4B 3S9LC 2NXOA 3C33A 4EQ7A 1LFIA 4EF2A 3BFUA 4QSCA 2V3QA 3W15C 1QULA 1B0HA 1XT8A 3VFJA 3FXUA 2F97A 1B7ZA 1EU8A 1SW2A 5TPAA 3N5LA 1URDA 2XX8A 2Q8JA 3RTWB 2DE3A 4C0RA 2DOJA 3OELA 2A5SA 4YICA 4NF8A 2AYSA 2VP1A 3FVOA 4YMAA 2UYFA 3O66A 5L9MA 4U23A 5F7VA 3CFZA 4F22A 2XHDA 3ECRA 2XX7A 1QKAA 2V3UA 3HHGA 1N76A 4G8MA 1MXYA 1O7TA 2O1MA 3IAZA 3UK4A 5J1DA 5AA2D 1URGA 4PE5B 3TTKA 3R26A 3VV5A 1VE4A 4HS7A 2QL3A 2W7YA 3B6WA 4O3BA 3TELA 3TQWA 4DIGA 2F6GA 4KPTA 4NWCA 2FNCA 3Q25A 4N13A 3TKDA 5L9SA 3M3FA 4OEUA 4HCWA 3T22A 4KCDA 4EQ9A 1SW1A 3P7IA 3KEIA 3GBAA 3CVGA 3A3CA 4H8IA 1I6QA 3PD9A 3B6QA 4IO3A 4XIGQ 4HCYA 3MP6A 4H5GA 3WAFA 1FTJA 4OETA 3O9PA 1MXVA 4AQ4A 5I56B 1B58A 3EPEA 1SQYA 2DQVA 3FJGA 2OBGA 2XXQA 3PPQA 5AA1A 3LBSA 5EHMA 3CIJA 4P11A 3S2VA 3SETA 5FHMA 3S9EA 1Y9UA 3C32A 1SI0A 3K00A 4IO4A 3MZ1A 2DE2A 3FUZA 4JWYA 4MF3A 2ONKE 3OO9A 2LAOA 4JXIA 1H44A 1JVXA 2FA7A 3G3FA 4I9DA 3G3IA 1MQIA 4NEDA 2UVGA 4LZ8A 2PT1A 2NVUB 5DEXA 3SEXA 4F3PA 5KDTA 3IJXB 1A99A 3M3KA 1B3EA 4MFIA 3TYHA 2I48A 1NH8A 4LP2B 1IXGA 2DVZA 4F18A 1Y4TA 2P0SA 1ATGA 5I59A 4OFLA 3OXNA 5I2KA 2QSXA 5DEXB 3I6VA 5CMBA 2AL4A 4DDDA 1B52A 4U21A 5BUUA 3FIRA 3T9VA 2DSFA 5CMKA 3UN6A 5ITPA 1UTHA 3H7MA 1Y4CA 4X1BA 5K2XA 1N7WA 1QUKA 2UVIA 1WODA 3D4GA 3MVZA 4GXAA 1GV8A 2A5TA 3M8UA 4RYAA 1MXUA 3U93A 1VFEA 2ESNA 3OMBA 4LONB 1LBCA 3O97A 3TMGA 3V83A 1MS7A 3N6TA 1B46A 3G3JA 4LZ7A 3V8XB 3V5AA 4U4SA 1QW0A 1XS5A 3E9XA 3PGFA 2DYXA 4H1XA 1MDP1 3K1PA 3PUZE 4UA8A 5DVIA 3TODA 3VLVA 1IEJA 4ZZEA 4EF1A 1LSTA 2QPQA 4G8HA 3RTFB 3OEKA 2X26A 5I56A 3D4CA 3H4ZA 1JW1A 4G77A 3CI8A 3LSXA 3W9VA 1URSA 3ODBA 4Q8RA 1BTJA 1MY4A 1N3WA 2QRYA 3FD3A 3OSRA 2DP8A 2RINA 1IITA 1B5HA 2PBWA 4R74A 4F3BA 3TTMA 4DZ1A 4MH5A 2HFBA 4O3AA 2WKYA 3DP6A 2HAUA 3OO8A 1MPBA 4G8NA 1POY1 2OZZA 2REGA 3MVYA 4F31B 5I57B 3DM0A 3MQ9A 4RPNA 2VOZA 1YPNA 1MXXA 2IEEA 3B6TA 4KQPA 3H06B 1GTKA 4FORA 3PMXA 1OVBA 1B3GA 1A40A 3K6XA 1H43A 1I69A 2I0CA 3MVWA 2RC7A 4ZDMA 2QS3A 1B5JA 1MQDA 3TCHA 4GLIA 1QVSA 3K0VA 3FASA 5H8QB 3MZBA 3KG2A 4R9FA 1SD3A 2ANJA 2Z8DA 3JYRA 1B40A 4JBZA 4H0WA 4NMYA 4NWDA 3U94A 5CI5A 4BDLA 5ELVA 3U72A 3HO7A 1OQGA 4G2ZA 1B51A 3KJ7A 4GRKA 4U2RA 4KYEA 1PBQA 5I58A 5JTYB 4ZS9A 1OQHA 3CG3A 3G3GA 1WVJA 2UXAA 3KFMA 1FQBA 4ZEDA 4ND9A 1MG1A 4ONYA 2Q89A 4R75A 3HPIA 3MP1A 1CE2A 4MLVA 4R72A 5I58B 3TTLA 1SYIA 2PVUA 1HSLA 3PUXE 2ZNTA 1M5EA 4JDFA 2ZYOA 4R2FA 4N07A 4F19A 4ISUA 4TQUQ 3RT8A 2UVJA 1NKXA 1ZTYA 4QFKA 3L6GA 4XKPA 3C35A 4ZECA 2GFEA 2XXPA 4I1DA 4NF5B 5F1QA 4OXVA 2ZYKA 3OO7A 2B3FA 1A8FA 1MM6A 1US4A 4PFYA 2ONRA 4YKPA 4R2BA 3KN8A 2ABHA 1MRPA 2QS4A 5KCJB 1B0LA 4GIZA 4THIA 3RT6B 4R9GA 1TFDA 2F8DA 4BDMA 1XOCA 3MPKA 1MXZA 1PC3A 4IB2A 4YB6A 1B4HA 4IO6A 4IY6A 5JEIA 3WAEA 1MY2A 2THIA 1F9BA 3PPOA 4QFPA 2I49A 4ELPA 4DXBA 1B3HA 3VVDA 2PX1A 3THIA 1UTBB 2HZKA 4JSDA 4ZEBA 1Y20A 3KOTA 3T93B 4FJPA 4JSOA 1ANFA 4E0XA 2HEUA 3TQLA 5I57A 3HV1A 2DXRA 3PPNA 1JW5A 4U1ZA 3K02A 3MWBA 3PD8A 3QSLA 1RKMA 1LFGA 4I8CA 3SERA 4XXUA 4P0GA 3GXAA 5FHOA 4DCYA 3SEWA 4RK9A 4POWA 1BIYA 1S7YA 3QYTA 2H9BA 4DXUA 2Q9TA 2F36A 3ZS6A 1O64A 1BP5A 3H6VA 1DPPA 1DPEA 1MDQA 3CFLA 3KGCA 3MP8A 4MBPA 4Z0IA 5H8HB 5DYHA 1Y3QA 4OHNA 5H8SA 3HHFA 2OK2A 4HTGA 4M1VA 3O6HA 4YKIA 1N0TA 3SEYA 3HSTA 1IXCA 3LC8A 4ZE8A 4Q5TA 1B2HA 1IUDA 3HN0A 1QJMA 1VR5A 1PB9A 3IORA 1O63A 3LSWA 2GH9A 4XKRA 1ZLQA 1UTBA 2OWTA 1DOTA 2RCAA 1M5BA 2V93A 4BDQA 5I2NB 3CSGA 1FCKA 3DELB 1MXWA 4K3FA 4P0IA 5CMCA 3K6WA 2Y84A 3FV1A 1LGBC 4PETA 2Y7RA 4GQOA 1TXFA 1J1NA 1LAFE 4R73A 2AL5A 1XHYA 2X7PA 3FXRA 3RUMA 1FTMA 2HXWA 1M5CA 2P2AA 3DP4A 4OENA 2QS1A 1S50A 4NF5A 5CBRA 1B9JA 1B4ZA 3E3KA 1EZ9A 3H6UA 3PMVA 3FJ7A 3PV0E 3PUYE 4GL8A 3OENA 3UP9A 1DTGA 3IOWA 2OCUA 2VD2A 3USDA 1JVYA 4MLQA 3VDFA 4EQBA 2Q2AA 3RGYA 4XKQA 2D21A 3FVKA 4F2OA 3IO4A 4KHZE 5ITOA 3I3VA 5HBCA 3K2DA 5TU0A 2R71A 4F29A 1MPCA 1UIVA 5IKBA 4TOZA 1JETA 3DLNA 1B5IA 3IK6B 2ZNSA 4LQ5A 4LUBA 1PB8A 2I3WA 3BKIB 4OEVA 3C4MA 3Q28A 4GFRA 2HZLA 2XXWA 1ZBMA 3FJMA 4NF8B 3OEMA 1M5DA 4OYVA 4OESA 4WEPA 1P1OA 3K1MA 4GF8A 3MUQA 3SDFA 5BWJA 1R9LA 3RPWA 1SVXB 3QXMA 3LSLA 4NF6A 1JEVA 1AH5A 3HCQA 1LCTA 5EHSA 1N04A 2XXIA 3T66A 3DP8A 1A54A 3FGSA 3IL1B 3PPPA 4DLDA 1DMBA 4ECFA 3LSFB 5DVJA 1MY0A 3TZAA 2PMSA 3S9MC 5AA3A 4NF6B 3CRBA 4H65A 4FE8A 2RC9A 4GVOA 4PFUA 3KJTA 1POTA 1GGGA 4TLLB 5A5XA 5I2KB 1FQCA 2H4IA 3LR1A 4F3SA 4N6PA 2B65A 3KBRA 4IGTA 4ZE9A 1FQFA 3ILUB 4ZEFA 4YZZA 1ZJLA 4F1VA 5L8DA 2ZYMA 4H6DA 1Y1MA 2NWJA 3OO6A 3K4UA 4BDOA 4LATA 2F5XA 3ZKKA 3KN3A 3IB0A 2H5YA 3UIFA 4F1YA 1A7LA 1MH3A 4OVJA 3B7DA 1PBPA 1MQJA 4OQOA 1PDAA 4OTEA 4RNSA 4ESXA 2DS9A 1B32A 2UVHA 1B1XA 3KSJA 3MJNA 2Y7PA 2HCAA 3MBPA 3SKPA 1FTOA 3TCFA 1SW5A 1R9QA 2O51A 3GZGA 1B7UA 4KI0E 5H8HA 1QUJA 4FATA 4U4XA 4GD5A 1BLFA 4BDRA 5CM6A 1HSJA 3O6GA 1US5A 3CFXA 1MH4A 1SI1A 2V84A 1TT1A 3VLUA 5CRYA 2XD2A 2F6PA 3TDJA 2Y7KA 5I59B 5TP9B 2V25A 2D5WA 1MPDA 1MQHA 4QSDA 3QIMA 4OFOA 4Q0CA 4WEDA 2QJEA 4GXSB 1LAXA 1UTHB 1LB8A 2YJPA 3E4RA 4POXA 1OMPA 3MAMA 3H6TA 2F7BA 3QUFA 5FTHA 2HAVA 4F1UA 1EZPA 2XX9A 1UQWA 3UORA 2Y7WA 1MQGA 2O6AA 1P1NA 4QFOA 3T9HB 2ONSA 4Q30B 5CC2A 2XXYA 4JWXA 1Z7NE 1H76A 3FVGA 5KDTB 2VHAA 3CR9A 3VE1B 4AB6A 3BBRA 2Z22A 3TTRA 5B70A 5H8FA 2DWIA 3IOTA 2ZYNA 2E0SA 5ICQA 2O1LA 3IJOB 1H45A 2Q88A 1SYHA 1NNPA 1P1QA 1JQFA 1ZKBA 2RF1A 3H03A 3TCGA 1FTKA 2O84X 3K6UA 1B6HA 3N26A 3EHSA 2O7UA 3Q26A 4EUOA 1R6ZA 3OOAA 4ELOA 3VVFA 2I0BA 4R6HA 4YU0A 1GR2A 4KFQA 3TEPA 4QHQA 1NNFA 2M8CA 2OJTA 1GVCA 1XVXA 2F78A 4LVQA 3SESA 4LZ5A 4R6KA 3R7XA 3UA8A 1LCFA 3GBBA 1BKAA 1OVTA 3KN7A 5TPAB 1N84A 2RC8A 1LAHE 1N7XA 5DVFA 3TPAA 1B1HA 1LLSA 2QMXA 1D3KA 3Q29A 1L5TA 3A3UA 5CBSA 4IO7A 4WXJA 3EHUA 2GRVA 3OSQA 3W9WA 5L9OA 3ZSFA 1B05A 2B3BA 3K01A 1B7HA 3IR1A 3R6UA 2H98A 3AXFA 1A55A 4FAJA 3Q27A 4QFNA 3UGWA 4YAHX 1YCJA 1FQAA 2F7AA 2XXRA 2F34A 1M5FA 3I5OA 4PFTA 4EXLA 3SEUA 5KZTA 5TP9A 4U1OA 4G68B 4OFJA 4PP0A 4U22A 2DVCA 4KYSA 1S9TA 2XXUA 3JV9A 4G68C 3EF7A 1Y3NA 1MY1A 1XC1A 3C36A 5FTIA 1ZMGA 2PT2A 1FW0A 1JW4A 1RYOA 4G68A 4X48A 4C1UA 3RNNA 2Z8EA 3VXCA 4HW8A 1AIVA 2AIXA 2A5TB 1CB6A 4IGRA 4JB7A 4UACA 2REJA 3VVEA 4C1TA 1JNFA 5I2NA 3PUWE 2R6GE 5ICTA 4TLMB 4G4PA 4XTCQ 1N3XA 1EH3A 2P1SA 1SDXA 1DSNA 4YB7A 5IAIA 2HQ0A 2QMWA 2VGQA 3PUVE 4YB5A 1PB7A 2RKMA 1A8EA 4RJZA 5AA4B 2FYIA 2O69A 3FVNA 1D9VA 2R9JA 5LOMA 3U8QA 2UYEA 4KYDA 3LUYA 1TWYA 1ZIUA 4RA1A 4L17A 1FTLA 1LFHA 1NFTA 1NMUA 3CG1A 1SBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM7 A;  3ONM A;  4YMB A;  4I62 A;  3S9N C;  1IXI A;  2VD3 A;  2DE4 A;  4RXL A;  2Q2C A;  5JK4 A;  2PYY A;  4GWO A;  5I84 A;  1IZ1 A;  3C34 A;  5H8F B;  4QSE A;  3BFT A;  4EDP A;  2XXX A;  1IIW A;  3N94 A;  2CZL A;  4NF4 A;  1TFA A;  4XKN A;  2I3V A;  3T96 B;  3A09 A;  3EQ1 A;  4H8J A;  3V89 B;  5KCJ A;  4FEC A;  4GL0 A;  3RY3 A;  1HSE A;  3E13 X;  1NNK A;  4H67 A;  2H25 A;  2Z8F A;  3QK6 A;  3IO6 A;  4NF4 B;  2IA4 A;  2Z23 A;  1Q1K A;  1VSO A;  3CSB A;  3K6V A;  1Q35 A;  3RQT A;  2XD3 A;  5FHN A;  1Y1Z A;  2BJJ X;  3MPL A;  3U92 A;  2I6E A;  1D9Y A;  1Y3P A;  3FZV A;  3JZJ A;  3GLB A;  4X1D A;  1B3F A;  4QFL A;  4EXK A;  1AMF A;  2XXT A;  3MVX A;  4O3C A;  1XVY A;  3TFL A;  2KLF A;  5B7D A;  1NL5 A;  3IX1 A;  3TTN A;  2DWH A;  1AOV A;  1II5 A;  1IXH A;  3MZ9 A;  2X7Q A;  4F39 A;  4Z7E A;  3O2A A;  2NUV A;  1QKB A;  4IO2 A;  3L6H A;  3C9H A;  2ALU A;  1AL3 A;  3PPR A;  5DT6 A;  3VXB A;  1WDN A;  2I58 A;  1VFD A;  4QRZ A;  2I4B A;  2D3I A;  3M3L A;  4ZEI A;  1P1U A;  2DXY A;  1OIB A;  1P99 A;  2DWJ A;  2O7I A;  1USY H;  3H3G A;  5AE4 A;  3IOV A;  3IB1 A;  5AA2 A;  3N6U A;  3EN3 A;  1PEB A;  3IB2 A;  3OD7 A;  4FEB A;  5HPQ A;  4FED A;  1R1N A;  2NOO A;  4OER A;  4YKJ A;  1JEU A;  4RY1 A;  1RYX A;  1I6B A;  3SEV A;  1OLA A;  3FXQ A;  5AA2 B;  1LB9 A;  4H5F A;  4ZEK A;  2YLN A;  5M2V A;  3FAT A;  4LQ2 A;  4DCX A;  1NNT A;  4KD5 A;  2G29 A;  4YKK A;  2OLB A;  4DE8 A;  5ISU A;  3TUS A;  1FQD A;  4NTL A;  3MW0 A;  4JWO A;  2ZXT A;  3U1O A;  3F11 A;  4ELQ A;  4KCC A;  2GHA A;  4RPO A;  2O68 A;  2QS2 A;  3G3K A;  3IOU A;  4FIM A;  3RN8 A;  3O29 A;  3ZKL A;  5H8N B;  1USY E;  3VLW A;  3H6W A;  1I6A A;  3ILT B;  3EHT A;  3KSX A;  3KZG A;  4KR5 A;  1YAE A;  4OWD A;  2OWS A;  3MC2 A;  5H8Q A;  3T9X B;  4F2Q A;  5JTY A;  1QUI A;  1UIU A;  5AA4 A;  1H3D A;  4PFW A;  1IQ7 A;  1SW4 A;  3PU5 A;  4OZ9 A;  1EZO A;  2XXV A;  5K2Y A;  1D4N A;  4M4G A;  5EYF A;  1OLC A;  5A5X B;  5DTB A;  4DXC A;  4R6Y A;  4F3G A;  3TAJ A;  2V3T A;  2GHB A;  4BDN A;  1P1W A;  3PMW A;  2H99 A;  2Y7I A;  3RLF E;  1NH7 A;  3FV2 A;  2YPN A;  3G7W A;  3KOS A;  4WKM A;  2F35 A;  3C31 A;  3K1N A;  1LAG E;  1FQE A;  2RCB A;  4GOT A;  2DWA A;  1MY3 A;  3O6I A;  1ZU0 A;  4X9T A;  4IO5 A;  2F7C A;  2E1S A;  5H8N A;  1B3L A;  4ELR A;  3S4U A;  3QAX A;  1KWH A;  4E0W A;  4QF9 A;  2ZNU A;  5CMM A;  2G93 A;  3QUJ A;  4LA9 A;  1Z7M E;  3T9U A;  1T0K A;  4NE4 A;  3O28 A;  4ESW A;  4ZZA A;  4OMB A;  1YTV A;  2CMO A;  4AB5 A;  2XXH A;  1LBB A;  2I4C A;  3G3H A;  4IY5 A;  4PQJ A;  4RK2 A;  2ZMB A;  1DTZ A;  1ELJ A;  4BLA A;  5HM4 B;  3S9L C;  2NXO A;  3C33 A;  4EQ7 A;  1LFI A;  4EF2 A;  3BFU A;  4QSC A;  2V3Q A;  3W15 C;  1QUL A;  1B0H A;  1XT8 A;  3VFJ A;  3FXU A;  2F97 A;  1B7Z A;  1EU8 A;  1SW2 A;  5TPA A;  3N5L A;  1URD A;  2XX8 A;  2Q8J A;  3RTW B;  2DE3 A;  4C0R A;  2DOJ A;  3OEL A;  2A5S A;  4YIC A;  4NF8 A;  2AYS A;  2VP1 A;  3FVO A;  4YMA A;  2UYF A;  3O66 A;  5L9M A;  4U23 A;  5F7V A;  3CFZ A;  4F22 A;  2XHD A;  3ECR A;  2XX7 A;  1QKA A;  2V3U A;  3HHG A;  1N76 A;  4G8M A;  1MXY A;  1O7T A;  2O1M A;  3IAZ A;  3UK4 A;  5J1D A;  5AA2 D;  1URG A;  4PE5 B;  3TTK A;  3R26 A;  3VV5 A;  1VE4 A;  4HS7 A;  2QL3 A;  2W7Y A;  3B6W A;  4O3B A;  3TEL A;  3TQW A;  4DIG A;  2F6G A;  4KPT A;  4NWC A;  2FNC A;  3Q25 A;  4N13 A;  3TKD A;  5L9S A;  3M3F A;  4OEU A;  4HCW A;  3T22 A;  4KCD A;  4EQ9 A;  1SW1 A;  3P7I A;  3KEI A;  3GBA A;  3CVG A;  3A3C A;  4H8I A;  1I6Q A;  3PD9 A;  3B6Q A;  4IO3 A;  4XIG Q;  4HCY A;  3MP6 A;  4H5G A;  3WAF A;  1FTJ A;  4OET A;  3O9P A;  1MXV A;  4AQ4 A;  5I56 B;  1B58 A;  3EPE A;  1SQY A;  2DQV A;  3FJG A;  2OBG A;  2XXQ A;  3PPQ A;  5AA1 A;  3LBS A;  5EHM A;  3CIJ A;  4P11 A;  3S2V A;  3SET A;  5FHM A;  3S9E A;  1Y9U A;  3C32 A;  1SI0 A;  3K00 A;  4IO4 A;  3MZ1 A;  2DE2 A;  3FUZ A;  4JWY A;  4MF3 A;  2ONK E;  3OO9 A;  2LAO A;  4JXI A;  1H44 A;  1JVX A;  2FA7 A;  3G3F A;  4I9D A;  3G3I A;  1MQI A;  4NED A;  2UVG A;  4LZ8 A;  2PT1 A;  2NVU B;  5DEX A;  3SEX A;  4F3P A;  5KDT A;  3IJX B;  1A99 A;  3M3K A;  1B3E A;  4MFI A;  3TYH A;  2I48 A;  1NH8 A;  4LP2 B;  1IXG A;  2DVZ A;  4F18 A;  1Y4T A;  2P0S A;  1ATG A;  5I59 A;  4OFL A;  3OXN A;  5I2K A;  2QSX A;  5DEX B;  3I6V A;  5CMB A;  2AL4 A;  4DDD A;  1B52 A;  4U21 A;  5BUU A;  3FIR A;  3T9V A;  2DSF A;  5CMK A;  3UN6 A;  5ITP A;  1UTH A;  3H7M A;  1Y4C A;  4X1B A;  5K2X A;  1N7W A;  1QUK A;  2UVI A;  1WOD A;  3D4G A;  3MVZ A;  4GXA A;  1GV8 A;  2A5T A;  3M8U A;  4RYA A;  1MXU A;  3U93 A;  1VFE A;  2ESN A;  3OMB A;  4LON B;  1LBC A;  3O97 A;  3TMG A;  3V83 A;  1MS7 A;  3N6T A;  1B46 A;  3G3J A;  4LZ7 A;  3V8X B;  3V5A A;  4U4S A;  1QW0 A;  1XS5 A;  3E9X A;  3PGF A;  2DYX A;  4H1X A;  1MDP 1;  3K1P A;  3PUZ E;  4UA8 A;  5DVI A;  3TOD A;  3VLV A;  1IEJ A;  4ZZE A;  4EF1 A;  1LST A;  2QPQ A;  4G8H A;  3RTF B;  3OEK A;  2X26 A;  5I56 A;  3D4C A;  3H4Z A;  1JW1 A;  4G77 A;  3CI8 A;  3LSX A;  3W9V A;  1URS A;  3ODB A;  4Q8R A;  1BTJ A;  1MY4 A;  1N3W A;  2QRY A;  3FD3 A;  3OSR A;  2DP8 A;  2RIN A;  1IIT A;  1B5H A;  2PBW A;  4R74 A;  4F3B A;  3TTM A;  4DZ1 A;  4MH5 A;  2HFB A;  4O3A A;  2WKY A;  3DP6 A;  2HAU A;  3OO8 A;  1MPB A;  4G8N A;  1POY 1;  2OZZ A;  2REG A;  3MVY A;  4F31 B;  5I57 B;  3DM0 A;  3MQ9 A;  4RPN A;  2VOZ A;  1YPN A;  1MXX A;  2IEE A;  3B6T A;  4KQP A;  3H06 B;  1GTK A;  4FOR A;  3PMX A;  1OVB A;  1B3G A;  1A40 A;  3K6X A;  1H43 A;  1I69 A;  2I0C A;  3MVW A;  2RC7 A;  4ZDM A;  2QS3 A;  1B5J A;  1MQD A;  3TCH A;  4GLI A;  1QVS A;  3K0V A;  3FAS A;  5H8Q B;  3MZB A;  3KG2 A;  4R9F A;  1SD3 A;  2ANJ A;  2Z8D A;  3JYR A;  1B40 A;  4JBZ A;  4H0W A;  4NMY A;  4NWD A;  3U94 A;  5CI5 A;  4BDL A;  5ELV A;  3U72 A;  3HO7 A;  1OQG A;  4G2Z A;  1B51 A;  3KJ7 A;  4GRK A;  4U2R A;  4KYE A;  1PBQ A;  5I58 A;  5JTY B;  4ZS9 A;  1OQH A;  3CG3 A;  3G3G A;  1WVJ A;  2UXA A;  3KFM A;  1FQB A;  4ZED A;  4ND9 A;  1MG1 A;  4ONY A;  2Q89 A;  4R75 A;  3HPI A;  3MP1 A;  1CE2 A;  4MLV A;  4R72 A;  5I58 B;  3TTL A;  1SYI A;  2PVU A;  1HSL A;  3PUX E;  2ZNT A;  1M5E A;  4JDF A;  2ZYO A;  4R2F A;  4N07 A;  4F19 A;  4ISU A;  4TQU Q;  3RT8 A;  2UVJ A;  1NKX A;  1ZTY A;  4QFK A;  3L6G A;  4XKP A;  3C35 A;  4ZEC A;  2GFE A;  2XXP A;  4I1D A;  4NF5 B;  5F1Q A;  4OXV A;  2ZYK A;  3OO7 A;  2B3F A;  1A8F A;  1MM6 A;  1US4 A;  4PFY A;  2ONR A;  4YKP A;  4R2B A;  3KN8 A;  2ABH A;  1MRP A;  2QS4 A;  5KCJ B;  1B0L A;  4GIZ A;  4THI A;  3RT6 B;  4R9G A;  1TFD A;  2F8D A;  4BDM A;  1XOC A;  3MPK A;  1MXZ A;  1PC3 A;  4IB2 A;  4YB6 A;  1B4H A;  4IO6 A;  4IY6 A;  5JEI A;  3WAE A;  1MY2 A;  2THI A;  1F9B A;  3PPO A;  4QFP A;  2I49 A;  4ELP A;  4DXB A;  1B3H A;  3VVD A;  2PX1 A;  3THI A;  1UTB B;  2HZK A;  4JSD A;  4ZEB A;  1Y20 A;  3KOT A;  3T93 B;  4FJP A;  4JSO A;  1ANF A;  4E0X A;  2HEU A;  3TQL A;  5I57 A;  3HV1 A;  2DXR A;  3PPN A;  1JW5 A;  4U1Z A;  3K02 A;  3MWB A;  3PD8 A;  3QSL A;  1RKM A;  1LFG A;  4I8C A;  3SER A;  4XXU A;  4P0G A;  3GXA A;  5FHO A;  4DCY A;  3SEW A;  4RK9 A;  4POW A;  1BIY A;  1S7Y A;  3QYT A;  2H9B A;  4DXU A;  2Q9T A;  2F36 A;  3ZS6 A;  1O64 A;  1BP5 A;  3H6V A;  1DPP A;  1DPE A;  1MDQ A;  3CFL A;  3KGC A;  3MP8 A;  4MBP A;  4Z0I A;  5H8H B;  5DYH A;  1Y3Q A;  4OHN A;  5H8S A;  3HHF A;  2OK2 A;  4HTG A;  4M1V A;  3O6H A;  4YKI A;  1N0T A;  3SEY A;  3HST A;  1IXC A;  3LC8 A;  4ZE8 A;  4Q5T A;  1B2H A;  1IUD A;  3HN0 A;  1QJM A;  1VR5 A;  1PB9 A;  3IOR A;  1O63 A;  3LSW A;  2GH9 A;  4XKR A;  1ZLQ A;  1UTB A;  2OWT A;  1DOT A;  2RCA A;  1M5B A;  2V93 A;  4BDQ A;  5I2N B;  3CSG A;  1FCK A;  3DEL B;  1MXW A;  4K3F A;  4P0I A;  5CMC A;  3K6W A;  2Y84 A;  3FV1 A;  1LGB C;  4PET A;  2Y7R A;  4GQO A;  1TXF A;  1J1N A;  1LAF E;  4R73 A;  2AL5 A;  1XHY A;  2X7P A;  3FXR A;  3RUM A;  1FTM A;  2HXW A;  1M5C A;  2P2A A;  3DP4 A;  4OEN A;  2QS1 A;  1S50 A;  4NF5 A;  5CBR A;  1B9J A;  1B4Z A;  3E3K A;  1EZ9 A;  3H6U A;  3PMV A;  3FJ7 A;  3PV0 E;  3PUY E;  4GL8 A;  3OEN A;  3UP9 A;  1DTG A;  3IOW A;  2OCU A;  2VD2 A;  3USD A;  1JVY A;  4MLQ A;  3VDF A;  4EQB A;  2Q2A A;  3RGY A;  4XKQ A;  2D21 A;  3FVK A;  4F2O A;  3IO4 A;  4KHZ E;  5ITO A;  3I3V A;  5HBC A;  3K2D A;  5TU0 A;  2R71 A;  4F29 A;  1MPC A;  1UIV A;  5IKB A;  4TOZ A;  1JET A;  3DLN A;  1B5I A;  3IK6 B;  2ZNS A;  4LQ5 A;  4LUB A;  1PB8 A;  2I3W A;  3BKI B;  4OEV A;  3C4M A;  3Q28 A;  4GFR A;  2HZL A;  2XXW A;  1ZBM A;  3FJM A;  4NF8 B;  3OEM A;  1M5D A;  4OYV A;  4OES A;  4WEP A;  1P1O A;  3K1M A;  4GF8 A;  3MUQ A;  3SDF A;  5BWJ A;  1R9L A;  3RPW A;  1SVX B;  3QXM A;  3LSL A;  4NF6 A;  1JEV A;  1AH5 A;  3HCQ A;  1LCT A;  5EHS A;  1N04 A;  2XXI A;  3T66 A;  3DP8 A;  1A54 A;  3FGS A;  3IL1 B;  3PPP A;  4DLD A;  1DMB A;  4ECF A;  3LSF B;  5DVJ A;  1MY0 A;  3TZA A;  2PMS A;  3S9M C;  5AA3 A;  4NF6 B;  3CRB A;  4H65 A;  4FE8 A;  2RC9 A;  4GVO A;  4PFU A;  3KJT A;  1POT A;  1GGG A;  4TLL B;  5A5X A;  5I2K B;  1FQC A;  2H4I A;  3LR1 A;  4F3S A;  4N6P A;  2B65 A;  3KBR A;  4IGT A;  4ZE9 A;  1FQF A;  3ILU B;  4ZEF A;  4YZZ A;  1ZJL A;  4F1V A;  5L8D A;  2ZYM A;  4H6D A;  1Y1M A;  2NWJ A;  3OO6 A;  3K4U A;  4BDO A;  4LAT A;  2F5X A;  3ZKK A;  3KN3 A;  3IB0 A;  2H5Y A;  3UIF A;  4F1Y A;  1A7L A;  1MH3 A;  4OVJ A;  3B7D A;  1PBP A;  1MQJ A;  4OQO A;  1PDA A;  4OTE A;  4RNS A;  4ESX A;  2DS9 A;  1B32 A;  2UVH A;  1B1X A;  3KSJ A;  3MJN A;  2Y7P A;  2HCA A;  3MBP A;  3SKP A;  1FTO A;  3TCF A;  1SW5 A;  1R9Q A;  2O51 A;  3GZG A;  1B7U A;  4KI0 E;  5H8H A;  1QUJ A;  4FAT A;  4U4X A;  4GD5 A;  1BLF A;  4BDR A;  5CM6 A;  1HSJ A;  3O6G A;  1US5 A;  3CFX A;  1MH4 A;  1SI1 A;  2V84 A;  1TT1 A;  3VLU A;  5CRY A;  2XD2 A;  2F6P A;  3TDJ A;  2Y7K A;  5I59 B;  5TP9 B;  2V25 A;  2D5W A;  1MPD A;  1MQH A;  4QSD A;  3QIM A;  4OFO A;  4Q0C A;  4WED A;  2QJE A;  4GXS B;  1LAX A;  1UTH B;  1LB8 A;  2YJP A;  3E4R A;  4POX A;  1OMP A;  3MAM A;  3H6T A;  2F7B A;  3QUF A;  5FTH A;  2HAV A;  4F1U A;  1EZP A;  2XX9 A;  1UQW A;  3UOR A;  2Y7W A;  1MQG A;  2O6A A;  1P1N A;  4QFO A;  3T9H B;  2ONS A;  4Q30 B;  5CC2 A;  2XXY A;  4JWX A;  1Z7N E;  1H76 A;  3FVG A;  5KDT B;  2VHA A;  3CR9 A;  3VE1 B;  4AB6 A;  3BBR A;  2Z22 A;  3TTR A;  5B70 A;  5H8F A;  2DWI A;  3IOT A;  2ZYN A;  2E0S A;  5ICQ A;  2O1L A;  3IJO B;  1H45 A;  2Q88 A;  1SYH A;  1NNP A;  1P1Q A;  1JQF A;  1ZKB A;  2RF1 A;  3H03 A;  3TCG A;  1FTK A;  2O84 X;  3K6U A;  1B6H A;  3N26 A;  3EHS A;  2O7U A;  3Q26 A;  4EUO A;  1R6Z A;  3OOA A;  4ELO A;  3VVF A;  2I0B A;  4R6H A;  4YU0 A;  1GR2 A;  4KFQ A;  3TEP A;  4QHQ A;  1NNF A;  2M8C A;  2OJT A;  1GVC A;  1XVX A;  2F78 A;  4LVQ A;  3SES A;  4LZ5 A;  4R6K A;  3R7X A;  3UA8 A;  1LCF A;  3GBB A;  1BKA A;  1OVT A;  3KN7 A;  5TPA B;  1N84 A;  2RC8 A;  1LAH E;  1N7X A;  5DVF A;  3TPA A;  1B1H A;  1LLS A;  2QMX A;  1D3K A;  3Q29 A;  1L5T A;  3A3U A;  5CBS A;  4IO7 A;  4WXJ A;  3EHU A;  2GRV A;  3OSQ A;  3W9W A;  5L9O A;  3ZSF A;  1B05 A;  2B3B A;  3K01 A;  1B7H A;  3IR1 A;  3R6U A;  2H98 A;  3AXF A;  1A55 A;  4FAJ A;  3Q27 A;  4QFN A;  3UGW A;  4YAH X;  1YCJ A;  1FQA A;  2F7A A;  2XXR A;  2F34 A;  1M5F A;  3I5O A;  4PFT A;  4EXL A;  3SEU A;  5KZT A;  5TP9 A;  4U1O A;  4G68 B;  4OFJ A;  4PP0 A;  4U22 A;  2DVC A;  4KYS A;  1S9T A;  2XXU A;  3JV9 A;  4G68 C;  3EF7 A;  1Y3N A;  1MY1 A;  1XC1 A;  3C36 A;  5FTI A;  1ZMG A;  2PT2 A;  1FW0 A;  1JW4 A;  1RYO A;  4G68 A;  4X48 A;  4C1U A;  3RNN A;  2Z8E A;  3VXC A;  4HW8 A;  1AIV A;  2AIX A;  2A5T B;  1CB6 A;  4IGR A;  4JB7 A;  4UAC A;  2REJ A;  3VVE A;  4C1T A;  1JNF A;  5I2N A;  3PUW E;  2R6G E;  5ICT A;  4TLM B;  4G4P A;  4XTC Q;  1N3X A;  1EH3 A;  2P1S A;  1SDX A;  1DSN A;  4YB7 A;  5IAI A;  2HQ0 A;  2QMW A;  2VGQ A;  3PUV E;  4YB5 A;  1PB7 A;  2RKM A;  1A8E A;  4RJZ A;  5AA4 B;  2FYI A;  2O69 A;  3FVN A;  1D9V A;  2R9J A;  5LOM A;  3U8Q A;  2UYE A;  4KYD A;  3LUY A;  1TWY A;  1ZIU A;  4RA1 A;  4L17 A;  1FTL A;  1LFH A;  1NFT A;  1NMU A;  3CG1 A;  1SBP A; 
#chains in the Genus database with same CATH topology
 3ONM A;  2VD3 A;  4RXL A;  1FPI A;  5H8F B;  4QSE A;  3BFT A;  2CZH A;  4H8J A;  4JVC A;  3E13 X;  1NNK A;  4H67 A;  3T0J A;  2Z8F A;  4NF4 B;  2IA4 A;  1Q1K A;  3CSB A;  3U92 A;  4XEQ A;  1Y1Z A;  2BJJ X;  4MNI A;  1D9Y A;  1SPI A;  1B3F A;  4EXK A;  5FBP A;  1XVY A;  5B7D A;  4F39 A;  2X7Q A;  4Z7E A;  4GWU A;  1QKB A;  3L6H A;  2OWZ A;  3C9H A;  2ALU A;  1AL3 A;  3VXB A;  3B50 A;  4ZEI A;  1P1U A;  2DXY A;  4HE2 A;  3N6U A;  3IB2 A;  4FEB A;  1FBC A;  2NOO A;  1K9Z A;  4X8R A;  4NHB A;  3SEV A;  2WYP A;  4DCX A;  2G29 A;  2OLB A;  4PE3 A;  3TUS A;  2GHA A;  2QS2 A;  4FIM A;  3ZKL A;  3O29 A;  4OA4 A;  1USY E;  3KZG A;  3ILT B;  3MC2 A;  1UIU A;  5IZ1 A;  1H3D A;  1IQ7 A;  5K2Y A;  4M4G A;  5EYF A;  5A5X B;  5DTB A;  4R6Y A;  3TAJ A;  3PMW A;  2Y7I A;  4GWS A;  3KOS A;  4WKM A;  3T1B A;  2F35 A;  3K1N A;  1MY3 A;  3O6I A;  4X9T A;  4ELR A;  1KWH A;  4P47 A;  1T0K A;  2Y5K A;  4N6D A;  3S9L C;  1D9Q A;  1ELJ A;  4BLA A;  2ZZX A;  2V3Q A;  3W15 C;  1XT8 A;  3FXU A;  4GX6 A;  1B7Z A;  1SW2 A;  1YZ0 A;  2XX8 A;  2A5S A;  3U65 A;  4YMA A;  1YXI A;  4U23 A;  5F7V A;  4AS5 A;  2XHD A;  3ECR A;  1MXY A;  3IAZ A;  3UK4 A;  5AA2 D;  4PE5 B;  3R26 A;  3VV5 A;  1VE4 A;  2W7Y A;  3B6W A;  4DIG A;  4HCW A;  4KCD A;  3KEI A;  3GBA A;  3PD9 A;  4PF6 A;  4XIG Q;  2OX3 A;  2FIX A;  2DQV A;  3FJG A;  1NV4 A;  3S9E A;  3RYD A;  4MF3 A;  3OO9 A;  2LAO A;  2FA7 A;  2PT1 A;  5DEX A;  1A99 A;  1B3E A;  2I48 A;  2P0S A;  1ATG A;  5CMB A;  2AL4 A;  3FIR A;  3UN6 A;  1Y4C A;  5K2X A;  1N7W A;  3MVZ A;  3M8U A;  1MXU A;  4LON B;  3O97 A;  1NI9 A;  1MS7 A;  4LZ7 A;  3PGF A;  2DYX A;  4UA8 A;  1MDP 1;  3PUZ E;  4GBV A;  3OEK A;  2X26 A;  1JW1 A;  3CI8 A;  3W9V A;  4Q8R A;  2DP8 A;  2RIN A;  1IIT A;  2GQ1 A;  2HFB A;  4HE1 A;  3DP6 A;  2HAU A;  1POY 1;  3DM0 A;  2VOZ A;  1YPN A;  2IEE A;  1AWB A;  4FBP A;  4KQP A;  1OVB A;  4O7I A;  3K6X A;  3TCH A;  2QS3 A;  3MZB A;  4R9F A;  1SD3 A;  4JBZ A;  3JYR A;  4JVD A;  4BDL A;  1OQG A;  5I58 A;  5JTY B;  4ZS9 A;  3G3G A;  1WVJ A;  3KFM A;  4ONY A;  3PUX E;  2ZNT A;  3C35 A;  4NF5 B;  4OXV A;  5EQ7 A;  4PFY A;  4YKP A;  4R2B A;  2ABH A;  1TFD A;  1XOC A;  4YB6 A;  1MXZ A;  1PC3 A;  1BK4 A;  4IO6 A;  1B3H A;  4N15 A;  3RPL A;  3KOT A;  3TQL A;  4MMP A;  2DXR A;  3MWB A;  4I8C A;  4XXU A;  4P0G A;  4DCY A;  4DXU A;  2F36 A;  3T9X B;  1DPE A;  1Y3Q A;  4OHN A;  3HST A;  3HN0 A;  1PB9 A;  1O63 A;  1EYI A;  2WX9 A;  1ZLQ A;  1NUW A;  1DOT A;  4BDQ A;  4P0I A;  2Y84 A;  3FV1 A;  4PET A;  2Y7R A;  3FXR A;  1FTM A;  1S50 A;  1IMC A;  1B9J A;  3H6U A;  3UP9 A;  3FJ7 A;  4GL8 A;  4PTK A;  3OEN A;  4EQB A;  5ITO A;  3I3V A;  2KR0 A;  3K2D A;  4F29 A;  1MPC A;  1UIV A;  3DLN A;  3IK6 B;  4LQ5 A;  4PGP A;  2HXR A;  2HZL A;  2XXW A;  4NF8 B;  4WEP A;  3SDF A;  3K1M A;  2CEY A;  1AH5 A;  5EHS A;  2XXI A;  1A54 A;  3FGS A;  3IL1 B;  2VPO A;  1MY0 A;  2PMS A;  3S9M C;  1G0H A;  4NF6 B;  3CRB A;  2WYK A;  4FE8 A;  5I2K B;  2H4I A;  4N6P A;  1MH3 A;  5IZ3 A;  4OTE A;  2DS9 A;  2UVH A;  4GWZ A;  1B1X A;  3MJN A;  1B7U A;  5CM6 A;  2PFZ A;  1BLF A;  4BDR A;  1US5 A;  4MNP A;  1SI1 A;  5CRY A;  1IMA A;  5TP9 B;  1MPD A;  4OFO A;  4WED A;  1LAX A;  2NVU B;  3H6T A;  3QUF A;  2HAV A;  4QFO A;  5CC2 A;  1H76 A;  3CR9 A;  4O94 A;  4I3Y A;  2Q88 A;  1SYH A;  1P1Q A;  1FTK A;  3K6U A;  1B6H A;  3BIG A;  4ELO A;  2I0B A;  4YU0 A;  3TEP A;  4QHQ A;  5LDZ A;  1GVC A;  4LZ5 A;  2RC8 A;  1RDY A;  3A3U A;  5CBS A;  1NV0 A;  4WXJ A;  3EHU A;  3W9W A;  3K01 A;  5IM2 A;  3R6U A;  1NUX A;  3Q27 A;  4PFR A;  5EQ8 A;  1FQA A;  4EXL A;  4NF0 A;  5KZT A;  5TP9 A;  4U1O A;  2DVC A;  5FTI A;  4G68 A;  2Z8E A;  2A5T B;  4TLM B;  4XTC Q;  1FBP A;  1PB7 A;  3FXB A;  2XXK A;  5AA4 B;  2O69 A;  4PAF A;  5LOM A;  2UYE A;  4RA1 A;  1INP A;  4IO7 A;  1FBG A;  1IXI A;  2Q2C A;  3C34 A;  4EDP A;  1VDW A;  1IIW A;  2XXX A;  3N94 A;  4XKN A;  3A09 A;  5KCJ A;  4FEC A;  4GL0 A;  3RY3 A;  2H25 A;  2CZI A;  2XWI A;  2Z23 A;  3RQT A;  1Q35 A;  2XD3 A;  5FHN A;  3MPL A;  2I6E A;  1Y3P A;  4GBW A;  3JZJ A;  2XXT A;  3MVX A;  5EYH A;  2KLF A;  1AOV A;  3TTN A;  2DWH A;  5A5L A;  3MZ9 A;  2NUV A;  3PPR A;  5DT6 A;  1WDN A;  2R8T A;  2I4B A;  3FBP A;  1OIB A;  1P99 A;  3IOV A;  3EN3 A;  1PEB A;  1JEU A;  3D1R A;  3FXQ A;  4G61 A;  4H45 A;  4LQ2 A;  1NNT A;  1FPL A;  4O8M A;  4JWO A;  3U1O A;  1XI6 A;  2O68 A;  3IOU A;  3VLW A;  4NQ8 A;  1I6A A;  4F2Q A;  1YAE A;  2OWS A;  1KZ8 A;  2FHY A;  5AA4 A;  3PU5 A;  4OZ9 A;  2XXV A;  1D4N A;  4DXC A;  2V3T A;  3FV2 A;  2YPN A;  3G7W A;  1FQE A;  3A29 A;  1ZU0 A;  5H8N A;  3QAX A;  5CMM A;  1NV2 A;  2G93 A;  3T9U A;  1Z7M E;  3O28 A;  4ESW A;  4OMB A;  2CMO A;  2XXH A;  2I4C A;  3G3H A;  4IY5 A;  4RK2 A;  5HM4 B;  2ZMB A;  4PBQ A;  2NXO A;  3C33 A;  4EQ7 A;  2F97 A;  5TPA A;  2DOJ A;  2AYS A;  2VP1 A;  5ET5 A;  5L9M A;  4F22 A;  2XX7 A;  5J1D A;  3TEL A;  5IZZ A;  4NWC A;  3TKD A;  5L9S A;  4EQ9 A;  1I6Q A;  3B6Q A;  4HCY A;  3MP6 A;  1SQY A;  2XXQ A;  5EHM A;  3S2V A;  3C32 A;  4DI3 D;  2ONK E;  4PAI A;  4NAP A;  4LZ8 A;  5KDT A;  3M3K A;  4F18 A;  4LP2 B;  1IXG A;  1Y4T A;  5I59 A;  5BUU A;  4U21 A;  2DSF A;  3H7M A;  3U93 A;  2ESN A;  3V83 A;  3TMG A;  4LN5 A;  3IFA A;  3V5A A;  3ISP A;  5DVI A;  4H1X A;  3TOD A;  4G8H A;  3D4C A;  4G77 A;  3OSR A;  3FD3 A;  4F3B A;  1DCU A;  2WEF A;  3BIH A;  2REG A;  5I7I A;  3H06 B;  3PMX A;  4OVP A;  2RC7 A;  3K0V A;  4NWD A;  1FTA A;  4P56 A;  3HO7 A;  1B51 A;  3KJ7 A;  3CG3 A;  2UXA A;  1FQB A;  3HPI A;  3MP1 A;  4MLV A;  1FBH A;  4F19 A;  1HSL A;  2HPG A;  4MHF A;  4ISU A;  4TQU Q;  3RT8 A;  1ZTY A;  2BJI A;  4XKP A;  2ZYK A;  3OO7 A;  1FPB A;  2QFL A;  4PC9 A;  4THI A;  2F8D A;  4IB2 A;  1B4H A;  4IY6 A;  5ET6 A;  1MY2 A;  2THI A;  3PPO A;  4QFP A;  4DXB A;  2PX1 A;  1UTB B;  4JSD A;  1Y20 A;  1FPJ A;  2XWK A;  4U1Z A;  3K02 A;  3PD8 A;  3QSL A;  1RKM A;  3KC1 A;  4RK9 A;  4POW A;  1BIY A;  1S7Y A;  3QYT A;  3ZS6 A;  3KGC A;  1MDQ A;  3MP8 A;  4MBP A;  5DYH A;  5H8S A;  4M1V A;  3O6H A;  1N0T A;  3SEY A;  1QJM A;  1VR5 A;  4XKR A;  1NV3 A;  5I2N B;  2P3N A;  5CMC A;  5I5P A;  1LGB C;  4GQO A;  1XHY A;  2X7P A;  3RUM A;  4OEN A;  4PAK A;  3EKI A;  1B4Z A;  3PMV A;  1FPD A;  3PUY E;  2OCU A;  2VD2 A;  2D21 A;  3FVK A;  4KHZ E;  1JET A;  1B5I A;  2HHM A;  2I3W A;  3BKI B;  4MCO A;  4OEV A;  3C4M A;  3Q28 A;  1ZBM A;  5JEI A;  1M5D A;  2JJK A;  1P1O A;  5BWJ A;  1R9L A;  3RPW A;  1SVX B;  1N04 A;  3IFC A;  3PPP A;  4ECF A;  5DVJ A;  3TZA A;  5AA3 A;  2RC9 A;  4TLL B;  5A5X A;  3KBR A;  3ILU B;  4H6D A;  3KN3 A;  3UIF A;  1FPG A;  1MQJ A;  4RNS A;  3KSJ A;  3SKP A;  1FTO A;  1R9Q A;  3GZG A;  4KI0 E;  4U4X A;  1Q9D A;  4P3L A;  1MH4 A;  1FJ9 A;  4P8B A;  2F6P A;  3TDJ A;  2D5W A;  4DI4 B;  2QJE A;  1UTH B;  2L5V A;  5ISU A;  1EZP A;  3MAM A;  1UQW A;  2FBP A;  4I3E A;  3UOR A;  1P1N A;  5KDT B;  5H8F A;  2ZZV A;  3VE1 B;  3BBR A;  3IOT A;  2ZYN A;  5ICQ A;  1NNP A;  3H03 A;  3N26 A;  3EHS A;  2KQZ A;  3OOA A;  1NV6 A;  4UAB A;  4R6H A;  1GR2 A;  1NNF A;  4JVI A;  3UA8 A;  1BKA A;  3KN7 A;  5TPA B;  3QMF A;  2Q74 A;  2QMX A;  3Q29 A;  1B05 A;  2B3B A;  3AXF A;  4NG7 A;  4QFN A;  1YCJ A;  1M5F A;  3I5O A;  4PFT A;  4PP0 A;  4KYS A;  1S9T A;  2XXU A;  3EF7 A;  3C36 A;  4X48 A;  4NX1 A;  4C1U A;  3VXC A;  4JB7 A;  1N3X A;  1EH3 A;  2P1S A;  1SDX A;  4GX3 A;  3LUZ A;  3PUV E;  4YB5 A;  1D9V A;  2R9J A;  2Y5L A;  4OVT A;  4GWX A;  5I56 A;  3CG1 A;  1FPK A;  1MM7 A;  4I62 A;  2DE4 A;  5JK4 A;  4GWO A;  4P9K A;  2CZL A;  4NF4 A;  1TFA A;  2I3V A;  3T96 B;  3EQ1 A;  3V89 B;  1HSE A;  3QK6 A;  1VSO A;  3K6V A;  4X1D A;  4QFL A;  3TFL A;  1NL5 A;  3IX1 A;  1LBY A;  4IO2 A;  1VFD A;  4QRZ A;  2D3I A;  3M3L A;  2DWJ A;  1USY H;  3H3G A;  4FED A;  1R1N A;  1OLA A;  4H5F A;  5M2V A;  4YKK A;  4DE8 A;  1FQD A;  4NTL A;  3MW0 A;  2ZXT A;  4ELQ A;  3F11 A;  4RPO A;  4YMB A;  5H8N B;  3G3K A;  3ROJ A;  3EHT A;  4KR5 A;  4OWD A;  5H8Q A;  2PFY A;  4PFW A;  1SW4 A;  1FBD A;  1IMF A;  4F3G A;  3GYY A;  4BDN A;  1NH7 A;  2DWA A;  4IO5 A;  2F7C A;  1B3L A;  4E0W A;  4N6K A;  4LA9 A;  4NE4 A;  4AB5 A;  1LBB A;  4PQJ A;  1LFI A;  1QGX A;  3BFU A;  4QSC A;  1QUL A;  5J16 A;  1CNQ A;  4YIC A;  4NF8 A;  2UYF A;  3O66 A;  2V3U A;  1N76 A;  1O7T A;  1URG A;  3TTK A;  4O3B A;  4FAT A;  4PBH A;  4N13 A;  3M3F A;  3CVG A;  4H8I A;  3WAF A;  5JTY A;  1FTJ A;  1MXV A;  5I56 B;  2OBG A;  1FRP A;  4P11 A;  5FHM A;  1SI0 A;  3K00 A;  2DE2 A;  4JXI A;  1H44 A;  3G3F A;  4I9D A;  2UVG A;  1NV1 A;  3IJX B;  1NH8 A;  3OXN A;  2QSX A;  5DEX B;  3I6V A;  5ITP A;  1QUK A;  1FSA A;  3D4G A;  4GXA A;  1GV8 A;  4RYA A;  3E79 A;  4N4U A;  3N6T A;  3V8X B;  1JP4 A;  1XS5 A;  4GWW A;  3K1P A;  1IEJ A;  4EF1 A;  2QPQ A;  3RTF B;  3HFU A;  3H4Z A;  5EQ9 A;  3ODB A;  1BTJ A;  1N3W A;  2QRY A;  4ZZE A;  4G8N A;  3MVY A;  4F31 B;  5I57 B;  4RPN A;  1MXX A;  4FOR A;  1GTK A;  1EYJ A;  1B3G A;  2I0C A;  3MVW A;  4ZDM A;  1B5J A;  4GLI A;  5H8Q B;  3FAS A;  3KC0 A;  5F24 A;  4NMY A;  1B40 A;  3U94 A;  5CI5 A;  5ELV A;  3U72 A;  5ET8 A;  4U2R A;  1PBQ A;  5IGA A;  4ND9 A;  4R75 A;  2Q89 A;  1CE2 A;  4N81 A;  4R72 A;  5I58 B;  2WBB A;  2PVU A;  1M5E A;  2ZYO A;  4ZEC A;  3L6G A;  2GFE A;  2XXP A;  1A8F A;  1MM6 A;  1US4 A;  2ONR A;  1MRP A;  5KCJ B;  1B0L A;  3RT6 B;  4N8G A;  4ELP A;  3VVD A;  2HZK A;  4ZEB A;  3T93 B;  4JSO A;  1ANF A;  4E0X A;  2HEU A;  5I57 A;  1JW5 A;  4QXD A;  3SEW A;  2P3V A;  1BP5 A;  5H8H B;  1DPP A;  4Z0I A;  4PFB A;  2OK2 A;  4HTG A;  4PDH A;  1LBX A;  1IXC A;  3LC8 A;  4Q5T A;  1IUD A;  3IOR A;  2GH9 A;  1UTB A;  2OWT A;  2V93 A;  1M5B A;  4XF5 A;  1FCK A;  3DEL B;  1LAF E;  2AL5 A;  4MNC A;  2HXW A;  2P2A A;  2QS1 A;  4NF5 A;  3E3K A;  3PV0 E;  3USD A;  3VDF A;  1JVY A;  4MLQ A;  2Q2A A;  3RGY A;  4F2O A;  3IO4 A;  5TU0 A;  5IKB A;  4AS4 A;  4LUB A;  1PB8 A;  5I3S A;  3OEM A;  1NUY A;  4GF8 A;  3MUQ A;  4NF6 A;  4GX4 A;  3ZSF A;  3CHG A;  1IMB A;  4DLD A;  1DMB A;  4PFU A;  4GVO A;  3KJT A;  4MIJ A;  1GGG A;  2Q8M A;  1NV7 A;  2B65 A;  4ZE9 A;  1FQF A;  4ZEF A;  4F1V A;  2NWJ A;  3OO6 A;  2V4C A;  3K4U A;  4LAT A;  3ZKK A;  3IB0 A;  4F1Y A;  4OVJ A;  3B7D A;  4OQO A;  1PDA A;  4ESX A;  1B32 A;  2Y7P A;  2HCA A;  3MBP A;  3TCF A;  5H8H A;  1QUJ A;  4GD5 A;  4O7M A;  2V84 A;  3VLU A;  2Y7K A;  2V25 A;  2DDK A;  4QSD A;  1LBV A;  4Q0C A;  4OVQ A;  4POX A;  3E4R A;  5FTH A;  1OMP A;  2F7B A;  2Y7W A;  1MQG A;  2O6A A;  3T9H B;  2ONS A;  4Q30 B;  4JWX A;  1Z7N E;  2VHA A;  2Z22 A;  2DWI A;  2O1L A;  3IJO B;  1ZKB A;  2O7U A;  1R6Z A;  4OVR A;  4KFQ A;  2OJT A;  2F78 A;  1LCF A;  1OVT A;  1N7X A;  3TPA A;  1YYZ A;  1B1H A;  1LLS A;  1D3K A;  1L5T A;  2GRV A;  5ET7 A;  1RDX A;  2CZK A;  2XXR A;  2F34 A;  1RDZ A;  4G68 B;  4OFJ A;  4U22 A;  3JV9 A;  4G68 C;  1XC1 A;  2PT2 A;  1FW0 A;  1JW4 A;  1LBW A;  1RYO A;  3RNN A;  4HW8 A;  1KA1 A;  1AIV A;  1CB6 A;  2VT5 A;  2REJ A;  2R6G E;  5ICT A;  4G4P A;  4YB7 A;  5IAI A;  2HQ0 A;  2VGQ A;  4RJZ A;  2RKM A;  4P1E A;  2FYI A;  3LUY A;  4L17 A;  1FTL A;  1NFT A;  4IR8 A;  1NMU A;  3RPL B;  1FPF A;  3S9N C;  5EQA A;  2PYY A;  5I84 A;  1IZ1 A;  4OAN A;  3IO6 A;  3FZV A;  3GLB A;  1AMF A;  4O3C A;  1II5 A;  1IXH A;  3O2A A;  2I58 A;  2B4M A;  2O7I A;  5AE4 A;  3IB1 A;  5AA2 A;  3OD7 A;  5HPQ A;  4OER A;  4MEV A;  4YKJ A;  4RY1 A;  1RYX A;  1I6B A;  5AA2 B;  1LB9 A;  5LTC A;  4ZEK A;  2YLN A;  3FAT A;  4KD5 A;  4KCC A;  2FIE A;  3RN8 A;  4MAG A;  1FJ6 A;  3H6W A;  3KSX A;  5I2N A;  1QUI A;  1EZO A;  1OLC A;  1G0I A;  2GHB A;  1P1W A;  2H99 A;  4N17 A;  3RLF E;  3C31 A;  5EYG A;  1LAG E;  4I40 A;  2RCB A;  4GOT A;  1FPE A;  3LV0 A;  2E1S A;  1KA0 A;  3MST A;  3S4U A;  4QF9 A;  2ZNU A;  1IME A;  3QUJ A;  4PDD A;  1DBZ A;  4XFE A;  4ZZA A;  3E78 A;  1YTV A;  1DTZ A;  3KBZ A;  4EF2 A;  1B0H A;  3VFJ A;  1EU8 A;  3N5L A;  1URD A;  2Q8J A;  3RTW B;  2DE3 A;  4C0R A;  3OEL A;  2XWO A;  3FVO A;  3CFZ A;  1QKA A;  3HHG A;  4G8M A;  2O1M A;  4HS7 A;  2QL3 A;  3TQW A;  4MJO A;  2F6G A;  4KPT A;  2FNC A;  3Q25 A;  1K9Y A;  4OEU A;  2CEX A;  3T22 A;  1SW1 A;  3P7I A;  3A3C A;  2PCR A;  4IO3 A;  4H5G A;  4OET A;  4AQ4 A;  3O9P A;  1B58 A;  3EPE A;  5AA1 A;  3PPQ A;  4OVS A;  3LBS A;  3CIJ A;  4H46 A;  3SET A;  1Y9U A;  4IO4 A;  3MZ1 A;  3FUZ A;  4JWY A;  4PCD A;  1JVX A;  3B8B A;  4NED A;  4F1U A;  3G3I A;  1MQI A;  3SEX A;  4F3P A;  4MFI A;  3TYH A;  2DVZ A;  4OFL A;  5I2K A;  4DDD A;  1B52 A;  5CMK A;  3T9V A;  1UTH A;  4X1B A;  2UVI A;  1WOD A;  2A5T A;  5IZ3 B;  1VFE A;  1IMD A;  3OMB A;  1LBC A;  1B46 A;  3G3J A;  4U4S A;  1QW0 A;  3E9X A;  3VLV A;  1LST A;  4HE0 A;  3LSX A;  1URS A;  1MY4 A;  1B5H A;  1FBE A;  2PBW A;  4R74 A;  3TTM A;  4DZ1 A;  2WBD A;  4MH5 A;  4O3A A;  2WKY A;  3OO8 A;  1MPB A;  2OZZ A;  3MQ9 A;  3B6T A;  2XA5 A;  1A40 A;  1H43 A;  1I69 A;  1MQD A;  5T3J A;  1QVS A;  3SZP A;  3KG2 A;  2ANJ A;  2Z8D A;  4H0W A;  1EYK A;  4G2Z A;  3MYU A;  4GRK A;  4KYE A;  1OQH A;  4ZED A;  1MG1 A;  3NOH A;  2F3D A;  3TTL A;  1SYI A;  4JDF A;  4R2F A;  4N07 A;  2UVJ A;  1NKX A;  4QFK A;  4I1D A;  5F1Q A;  1DK4 A;  2B3F A;  3KN8 A;  2QS4 A;  4GIZ A;  4R9G A;  4BDM A;  3MPK A;  3WAE A;  1LBZ A;  3PTY A;  1F9B A;  2I49 A;  4X04 A;  3THI A;  4P1L A;  4FJP A;  4N8Y A;  3HV1 A;  3PPN A;  3SER A;  1LFG A;  3GXA A;  5FHO A;  2H9B A;  2Q9T A;  1O64 A;  3H6V A;  3CFL A;  4PFI A;  3HHF A;  4YKI A;  4ZE8 A;  1B2H A;  3LSW A;  2MKZ A;  2RCA A;  3CSG A;  1MXW A;  4K3F A;  3K6W A;  1TXF A;  1J1N A;  4R73 A;  1M5C A;  3DP4 A;  5CBR A;  1EZ9 A;  1DTG A;  3IOW A;  4XKQ A;  5HBC A;  2R71 A;  4TOZ A;  4QBA A;  2ZNS A;  1FBF A;  2QVV A;  5ESY A;  4GFR A;  3FJM A;  2QVU A;  4OYV A;  4OES A;  3QXM A;  3LSL A;  1JEV A;  3HCQ A;  1LCT A;  3T66 A;  3DP8 A;  2QVR A;  3LSF B;  4H65 A;  1POT A;  1FQC A;  3LR1 A;  4F3S A;  4IGT A;  4YZZ A;  1ZJL A;  5L8D A;  2ZYM A;  1Y1M A;  4BDO A;  2F5X A;  2H5Y A;  1A7L A;  5DW8 A;  1PBP A;  4GWY A;  1SW5 A;  2O51 A;  2B4L A;  1HSJ A;  3O6G A;  3CFX A;  1TT1 A;  2FVZ A;  2XD2 A;  5I59 B;  1MQH A;  2ZZW A;  3QIM A;  4NGU A;  4GXS B;  1LB8 A;  2YJP A;  4PF8 A;  4N91 A;  2XX9 A;  2XXY A;  3FVG A;  4AB6 A;  5B70 A;  2XWV A;  3TTR A;  2E0S A;  1H45 A;  3TCG A;  1JQF A;  2RF1 A;  4KXP A;  3Q26 A;  2O84 X;  4EUO A;  2F3B A;  3VVF A;  4PGN A;  2M8C A;  1XVX A;  4LVQ A;  3SES A;  4R6K A;  3R7X A;  1NV5 A;  3GBB A;  1N84 A;  1LAH E;  5DVF A;  5L9O A;  3OSQ A;  4HXV A;  1B7H A;  3IR1 A;  2H98 A;  1A55 A;  4FAJ A;  3UGW A;  4YAH X;  2F7A A;  3SEU A;  1Y3N A;  1MY1 A;  1ZMG A;  2VPN A;  2AIX A;  4IGR A;  4UAC A;  1NUZ A;  4C1T A;  3VVE A;  1JNF A;  3PUW E;  4NN3 A;  1DSN A;  2QMW A;  1A8E A;  1LEV A;  3FVN A;  3U8Q A;  4KYD A;  1TWY A;  4MX6 A;  1ZIU A;  1LFH A;  1SBP A; 
#chains in the Genus database with same CATH homology
 1MM7 A;  3ONM A;  4YMB A;  4I62 A;  3S9N C;  1IXI A;  2VD3 A;  2DE4 A;  4RXL A;  2Q2C A;  5JK4 A;  2PYY A;  4GWO A;  5I84 A;  1IZ1 A;  3C34 A;  5H8F B;  4QSE A;  3BFT A;  4EDP A;  2XXX A;  1IIW A;  3N94 A;  2CZL A;  4NF4 A;  1TFA A;  4XKN A;  2I3V A;  3T96 B;  3A09 A;  3EQ1 A;  4H8J A;  3V89 B;  5KCJ A;  4FEC A;  4GL0 A;  3RY3 A;  1HSE A;  3E13 X;  1NNK A;  4H67 A;  2H25 A;  2Z8F A;  3QK6 A;  3IO6 A;  4NF4 B;  2IA4 A;  2Z23 A;  1Q1K A;  1VSO A;  3CSB A;  3K6V A;  1Q35 A;  3RQT A;  2XD3 A;  5FHN A;  1Y1Z A;  2BJJ X;  3MPL A;  3U92 A;  2I6E A;  1D9Y A;  1Y3P A;  3FZV A;  3JZJ A;  3GLB A;  4X1D A;  1B3F A;  4QFL A;  4EXK A;  1AMF A;  2XXT A;  3MVX A;  4O3C A;  1XVY A;  3TFL A;  2KLF A;  5B7D A;  1NL5 A;  3IX1 A;  3TTN A;  2DWH A;  1AOV A;  1II5 A;  1IXH A;  3MZ9 A;  2X7Q A;  4F39 A;  4Z7E A;  3O2A A;  2NUV A;  1QKB A;  4IO2 A;  3L6H A;  3C9H A;  2ALU A;  1AL3 A;  3PPR A;  5DT6 A;  3VXB A;  1WDN A;  2I58 A;  1VFD A;  4QRZ A;  2I4B A;  2D3I A;  3M3L A;  4ZEI A;  1P1U A;  2DXY A;  1OIB A;  1P99 A;  2DWJ A;  2O7I A;  1USY H;  3H3G A;  5AE4 A;  3IOV A;  3IB1 A;  5AA2 A;  3N6U A;  3EN3 A;  1PEB A;  3IB2 A;  3OD7 A;  4FEB A;  5HPQ A;  4FED A;  1R1N A;  2NOO A;  4OER A;  4YKJ A;  1JEU A;  4RY1 A;  1RYX A;  1I6B A;  3SEV A;  1OLA A;  3FXQ A;  5AA2 B;  1LB9 A;  4H5F A;  4ZEK A;  2YLN A;  5M2V A;  3FAT A;  4LQ2 A;  4DCX A;  1NNT A;  4KD5 A;  2G29 A;  4YKK A;  2OLB A;  4DE8 A;  5ISU A;  3TUS A;  1FQD A;  4NTL A;  3MW0 A;  4JWO A;  2ZXT A;  3U1O A;  3F11 A;  4ELQ A;  4KCC A;  2GHA A;  4RPO A;  2O68 A;  2QS2 A;  3G3K A;  3IOU A;  4FIM A;  3RN8 A;  3O29 A;  3ZKL A;  5H8N B;  1USY E;  3VLW A;  3H6W A;  1I6A A;  3ILT B;  3EHT A;  3KSX A;  3KZG A;  4KR5 A;  1YAE A;  4OWD A;  2OWS A;  3MC2 A;  5H8Q A;  3T9X B;  4F2Q A;  5JTY A;  1QUI A;  1UIU A;  5AA4 A;  1H3D A;  4PFW A;  1IQ7 A;  1SW4 A;  3PU5 A;  4OZ9 A;  1EZO A;  2XXV A;  5K2Y A;  1D4N A;  4M4G A;  5EYF A;  1OLC A;  5A5X B;  5DTB A;  4DXC A;  4R6Y A;  4F3G A;  3TAJ A;  2V3T A;  2GHB A;  4BDN A;  1P1W A;  3PMW A;  2H99 A;  2Y7I A;  3RLF E;  1NH7 A;  3FV2 A;  2YPN A;  3G7W A;  3KOS A;  4WKM A;  2F35 A;  3C31 A;  3K1N A;  1LAG E;  1FQE A;  2RCB A;  4GOT A;  2DWA A;  1MY3 A;  3O6I A;  1ZU0 A;  4X9T A;  4IO5 A;  2F7C A;  2E1S A;  5H8N A;  1B3L A;  4ELR A;  3S4U A;  3QAX A;  1KWH A;  4E0W A;  4QF9 A;  2ZNU A;  5CMM A;  2G93 A;  3QUJ A;  4LA9 A;  1Z7M E;  3T9U A;  1T0K A;  4NE4 A;  3O28 A;  4ESW A;  4ZZA A;  4OMB A;  1YTV A;  2CMO A;  4AB5 A;  2XXH A;  1LBB A;  2I4C A;  3G3H A;  4IY5 A;  4PQJ A;  4RK2 A;  2ZMB A;  1DTZ A;  1ELJ A;  4BLA A;  5HM4 B;  3S9L C;  2NXO A;  3C33 A;  4EQ7 A;  1LFI A;  4EF2 A;  3BFU A;  4QSC A;  2V3Q A;  3W15 C;  1QUL A;  1B0H A;  1XT8 A;  3VFJ A;  3FXU A;  2F97 A;  1B7Z A;  1EU8 A;  1SW2 A;  5TPA A;  3N5L A;  1URD A;  2XX8 A;  2Q8J A;  3RTW B;  2DE3 A;  4C0R A;  2DOJ A;  3OEL A;  2A5S A;  4YIC A;  4NF8 A;  2AYS A;  2VP1 A;  3FVO A;  4YMA A;  2UYF A;  3O66 A;  5L9M A;  4U23 A;  5F7V A;  3CFZ A;  4F22 A;  2XHD A;  3ECR A;  2XX7 A;  1QKA A;  2V3U A;  3HHG A;  1N76 A;  4G8M A;  1MXY A;  1O7T A;  2O1M A;  3IAZ A;  3UK4 A;  5J1D A;  5AA2 D;  1URG A;  4PE5 B;  3TTK A;  3R26 A;  3VV5 A;  1VE4 A;  4HS7 A;  2QL3 A;  2W7Y A;  3B6W A;  4O3B A;  3TEL A;  3TQW A;  4DIG A;  2F6G A;  4KPT A;  4NWC A;  2FNC A;  3Q25 A;  4N13 A;  3TKD A;  5L9S A;  3M3F A;  4OEU A;  4HCW A;  3T22 A;  4KCD A;  4EQ9 A;  1SW1 A;  3P7I A;  3KEI A;  3GBA A;  3CVG A;  3A3C A;  4H8I A;  1I6Q A;  3PD9 A;  3B6Q A;  4IO3 A;  4XIG Q;  4HCY A;  3MP6 A;  4H5G A;  3WAF A;  1FTJ A;  4OET A;  3O9P A;  1MXV A;  4AQ4 A;  5I56 B;  1B58 A;  3EPE A;  1SQY A;  2DQV A;  3FJG A;  2OBG A;  2XXQ A;  3PPQ A;  5AA1 A;  3LBS A;  5EHM A;  3CIJ A;  4P11 A;  3S2V A;  3SET A;  5FHM A;  3S9E A;  1Y9U A;  3C32 A;  1SI0 A;  3K00 A;  4IO4 A;  3MZ1 A;  2DE2 A;  3FUZ A;  4JWY A;  4MF3 A;  2ONK E;  3OO9 A;  2LAO A;  4JXI A;  1H44 A;  1JVX A;  2FA7 A;  3G3F A;  4I9D A;  3G3I A;  1MQI A;  4NED A;  2UVG A;  4LZ8 A;  2PT1 A;  2NVU B;  5DEX A;  3SEX A;  4F3P A;  5KDT A;  3IJX B;  1A99 A;  3M3K A;  1B3E A;  4MFI A;  3TYH A;  2I48 A;  1NH8 A;  4LP2 B;  1IXG A;  2DVZ A;  4F18 A;  1Y4T A;  2P0S A;  1ATG A;  5I59 A;  4OFL A;  3OXN A;  5I2K A;  2QSX A;  5DEX B;  3I6V A;  5CMB A;  2AL4 A;  4DDD A;  1B52 A;  4U21 A;  5BUU A;  3FIR A;  3T9V A;  2DSF A;  5CMK A;  3UN6 A;  5ITP A;  1UTH A;  3H7M A;  1Y4C A;  4X1B A;  5K2X A;  1N7W A;  1QUK A;  2UVI A;  1WOD A;  3D4G A;  3MVZ A;  4GXA A;  1GV8 A;  2A5T A;  3M8U A;  4RYA A;  1MXU A;  3U93 A;  1VFE A;  2ESN A;  3OMB A;  4LON B;  1LBC A;  3O97 A;  3TMG A;  3V83 A;  1MS7 A;  3N6T A;  1B46 A;  3G3J A;  4LZ7 A;  3V8X B;  3V5A A;  4U4S A;  1QW0 A;  1XS5 A;  3E9X A;  3PGF A;  2DYX A;  4H1X A;  1MDP 1;  3K1P A;  3PUZ E;  4UA8 A;  5DVI A;  3TOD A;  3VLV A;  1IEJ A;  4ZZE A;  4EF1 A;  1LST A;  2QPQ A;  4G8H A;  3RTF B;  3OEK A;  2X26 A;  5I56 A;  3D4C A;  3H4Z A;  1JW1 A;  4G77 A;  3CI8 A;  3LSX A;  3W9V A;  1URS A;  3ODB A;  4Q8R A;  1BTJ A;  1MY4 A;  1N3W A;  2QRY A;  3FD3 A;  3OSR A;  2DP8 A;  2RIN A;  1IIT A;  1B5H A;  2PBW A;  4R74 A;  4F3B A;  3TTM A;  4DZ1 A;  4MH5 A;  2HFB A;  4O3A A;  2WKY A;  3DP6 A;  2HAU A;  3OO8 A;  1MPB A;  4G8N A;  1POY 1;  2OZZ A;  2REG A;  3MVY A;  4F31 B;  5I57 B;  3DM0 A;  3MQ9 A;  4RPN A;  2VOZ A;  1YPN A;  1MXX A;  2IEE A;  3B6T A;  4KQP A;  3H06 B;  1GTK A;  4FOR A;  3PMX A;  1OVB A;  1B3G A;  1A40 A;  3K6X A;  1H43 A;  1I69 A;  2I0C A;  3MVW A;  2RC7 A;  4ZDM A;  2QS3 A;  1B5J A;  1MQD A;  3TCH A;  4GLI A;  1QVS A;  3K0V A;  3FAS A;  5H8Q B;  3MZB A;  3KG2 A;  4R9F A;  1SD3 A;  2ANJ A;  2Z8D A;  3JYR A;  1B40 A;  4JBZ A;  4H0W A;  4NMY A;  4NWD A;  3U94 A;  5CI5 A;  4BDL A;  5ELV A;  3U72 A;  3HO7 A;  1OQG A;  4G2Z A;  1B51 A;  3KJ7 A;  4GRK A;  4U2R A;  4KYE A;  1PBQ A;  5I58 A;  5JTY B;  4ZS9 A;  1OQH A;  3CG3 A;  3G3G A;  1WVJ A;  2UXA A;  3KFM A;  1FQB A;  4ZED A;  4ND9 A;  1MG1 A;  4ONY A;  2Q89 A;  4R75 A;  3HPI A;  3MP1 A;  1CE2 A;  4MLV A;  4R72 A;  5I58 B;  3TTL A;  1SYI A;  2PVU A;  1HSL A;  3PUX E;  2ZNT A;  1M5E A;  4JDF A;  2ZYO A;  4R2F A;  4N07 A;  4F19 A;  4ISU A;  4TQU Q;  3RT8 A;  2UVJ A;  1NKX A;  1ZTY A;  4QFK A;  3L6G A;  4XKP A;  3C35 A;  4ZEC A;  2GFE A;  2XXP A;  4I1D A;  4NF5 B;  5F1Q A;  4OXV A;  2ZYK A;  3OO7 A;  2B3F A;  1A8F A;  1MM6 A;  1US4 A;  4PFY A;  2ONR A;  4YKP A;  4R2B A;  3KN8 A;  2ABH A;  1MRP A;  2QS4 A;  5KCJ B;  1B0L A;  4GIZ A;  4THI A;  3RT6 B;  4R9G A;  1TFD A;  2F8D A;  4BDM A;  1XOC A;  3MPK A;  1MXZ A;  1PC3 A;  4IB2 A;  4YB6 A;  1B4H A;  4IO6 A;  4IY6 A;  5JEI A;  3WAE A;  1MY2 A;  2THI A;  1F9B A;  3PPO A;  4QFP A;  2I49 A;  4ELP A;  4DXB A;  1B3H A;  3VVD A;  2PX1 A;  3THI A;  1UTB B;  2HZK A;  4JSD A;  4ZEB A;  1Y20 A;  3KOT A;  3T93 B;  4FJP A;  4JSO A;  1ANF A;  4E0X A;  2HEU A;  3TQL A;  5I57 A;  3HV1 A;  2DXR A;  3PPN A;  1JW5 A;  4U1Z A;  3K02 A;  3MWB A;  3PD8 A;  3QSL A;  1RKM A;  1LFG A;  4I8C A;  3SER A;  4XXU A;  4P0G A;  3GXA A;  5FHO A;  4DCY A;  3SEW A;  4RK9 A;  4POW A;  1BIY A;  1S7Y A;  3QYT A;  2H9B A;  4DXU A;  2Q9T A;  2F36 A;  3ZS6 A;  1O64 A;  1BP5 A;  3H6V A;  1DPP A;  1DPE A;  1MDQ A;  3CFL A;  3KGC A;  3MP8 A;  4MBP A;  4Z0I A;  5H8H B;  5DYH A;  1Y3Q A;  4OHN A;  5H8S A;  3HHF A;  2OK2 A;  4HTG A;  4M1V A;  3O6H A;  4YKI A;  1N0T A;  3SEY A;  3HST A;  1IXC A;  3LC8 A;  4ZE8 A;  4Q5T A;  1B2H A;  1IUD A;  3HN0 A;  1QJM A;  1VR5 A;  1PB9 A;  3IOR A;  1O63 A;  3LSW A;  2GH9 A;  4XKR A;  1ZLQ A;  1UTB A;  2OWT A;  1DOT A;  2RCA A;  1M5B A;  2V93 A;  4BDQ A;  5I2N B;  3CSG A;  1FCK A;  3DEL B;  1MXW A;  4K3F A;  4P0I A;  5CMC A;  3K6W A;  2Y84 A;  3FV1 A;  1LGB C;  4PET A;  2Y7R A;  4GQO A;  1TXF A;  1J1N A;  1LAF E;  4R73 A;  2AL5 A;  1XHY A;  2X7P A;  3FXR A;  3RUM A;  1FTM A;  2HXW A;  1M5C A;  2P2A A;  3DP4 A;  4OEN A;  2QS1 A;  1S50 A;  4NF5 A;  5CBR A;  1B9J A;  1B4Z A;  3E3K A;  1EZ9 A;  3H6U A;  3PMV A;  3FJ7 A;  3PV0 E;  3PUY E;  4GL8 A;  3OEN A;  3UP9 A;  1DTG A;  3IOW A;  2OCU A;  2VD2 A;  3USD A;  1JVY A;  4MLQ A;  3VDF A;  4EQB A;  2Q2A A;  3RGY A;  4XKQ A;  2D21 A;  3FVK A;  4F2O A;  3IO4 A;  4KHZ E;  5ITO A;  3I3V A;  5HBC A;  3K2D A;  5TU0 A;  2R71 A;  4F29 A;  1MPC A;  1UIV A;  5IKB A;  4TOZ A;  1JET A;  3DLN A;  1B5I A;  3IK6 B;  2ZNS A;  4LQ5 A;  4LUB A;  1PB8 A;  2I3W A;  3BKI B;  4OEV A;  3C4M A;  3Q28 A;  4GFR A;  2HZL A;  2XXW A;  1ZBM A;  3FJM A;  4NF8 B;  3OEM A;  1M5D A;  4OYV A;  4OES A;  4WEP A;  1P1O A;  3K1M A;  4GF8 A;  3MUQ A;  3SDF A;  5BWJ A;  1R9L A;  3RPW A;  1SVX B;  3QXM A;  3LSL A;  4NF6 A;  1JEV A;  1AH5 A;  3HCQ A;  1LCT A;  5EHS A;  1N04 A;  2XXI A;  3T66 A;  3DP8 A;  1A54 A;  3FGS A;  3IL1 B;  3PPP A;  4DLD A;  1DMB A;  4ECF A;  3LSF B;  5DVJ A;  1MY0 A;  3TZA A;  2PMS A;  3S9M C;  5AA3 A;  4NF6 B;  3CRB A;  4H65 A;  4FE8 A;  2RC9 A;  4GVO A;  4PFU A;  3KJT A;  1POT A;  1GGG A;  4TLL B;  5A5X A;  5I2K B;  1FQC A;  2H4I A;  3LR1 A;  4F3S A;  4N6P A;  2B65 A;  3KBR A;  4IGT A;  4ZE9 A;  1FQF A;  3ILU B;  4ZEF A;  4YZZ A;  1ZJL A;  4F1V A;  5L8D A;  2ZYM A;  4H6D A;  1Y1M A;  2NWJ A;  3OO6 A;  3K4U A;  4BDO A;  4LAT A;  2F5X A;  3ZKK A;  3KN3 A;  3IB0 A;  2H5Y A;  3UIF A;  4F1Y A;  1A7L A;  1MH3 A;  4OVJ A;  3B7D A;  1PBP A;  1MQJ A;  4OQO A;  1PDA A;  4OTE A;  4RNS A;  4ESX A;  2DS9 A;  1B32 A;  2UVH A;  1B1X A;  3KSJ A;  3MJN A;  2Y7P A;  2HCA A;  3MBP A;  3SKP A;  1FTO A;  3TCF A;  1SW5 A;  1R9Q A;  2O51 A;  3GZG A;  1B7U A;  4KI0 E;  5H8H A;  1QUJ A;  4FAT A;  4U4X A;  4GD5 A;  1BLF A;  4BDR A;  5CM6 A;  1HSJ A;  3O6G A;  1US5 A;  3CFX A;  1MH4 A;  1SI1 A;  2V84 A;  1TT1 A;  3VLU A;  5CRY A;  2XD2 A;  2F6P A;  3TDJ A;  2Y7K A;  5I59 B;  5TP9 B;  2V25 A;  2D5W A;  1MPD A;  1MQH A;  4QSD A;  3QIM A;  4OFO A;  4Q0C A;  4WED A;  2QJE A;  4GXS B;  1LAX A;  1UTH B;  1LB8 A;  2YJP A;  3E4R A;  4POX A;  1OMP A;  3MAM A;  3H6T A;  2F7B A;  3QUF A;  5FTH A;  2HAV A;  4F1U A;  1EZP A;  2XX9 A;  1UQW A;  3UOR A;  2Y7W A;  1MQG A;  2O6A A;  1P1N A;  4QFO A;  3T9H B;  2ONS A;  4Q30 B;  5CC2 A;  2XXY A;  4JWX A;  1Z7N E;  1H76 A;  3FVG A;  5KDT B;  2VHA A;  3CR9 A;  3VE1 B;  4AB6 A;  3BBR A;  2Z22 A;  3TTR A;  5B70 A;  5H8F A;  2DWI A;  3IOT A;  2ZYN A;  2E0S A;  5ICQ A;  2O1L A;  3IJO B;  1H45 A;  2Q88 A;  1SYH A;  1NNP A;  1P1Q A;  1JQF A;  1ZKB A;  2RF1 A;  3H03 A;  3TCG A;  1FTK A;  2O84 X;  3K6U A;  1B6H A;  3N26 A;  3EHS A;  2O7U A;  3Q26 A;  4EUO A;  1R6Z A;  3OOA A;  4ELO A;  3VVF A;  2I0B A;  4R6H A;  4YU0 A;  1GR2 A;  4KFQ A;  3TEP A;  4QHQ A;  1NNF A;  2M8C A;  2OJT A;  1GVC A;  1XVX A;  2F78 A;  4LVQ A;  3SES A;  4LZ5 A;  4R6K A;  3R7X A;  3UA8 A;  1LCF A;  3GBB A;  1BKA A;  1OVT A;  3KN7 A;  5TPA B;  1N84 A;  2RC8 A;  1LAH E;  1N7X A;  5DVF A;  3TPA A;  1B1H A;  1LLS A;  2QMX A;  1D3K A;  3Q29 A;  1L5T A;  3A3U A;  5CBS A;  4IO7 A;  4WXJ A;  3EHU A;  2GRV A;  3OSQ A;  3W9W A;  5L9O A;  3ZSF A;  1B05 A;  2B3B A;  3K01 A;  1B7H A;  3IR1 A;  3R6U A;  2H98 A;  3AXF A;  1A55 A;  4FAJ A;  3Q27 A;  4QFN A;  3UGW A;  4YAH X;  1YCJ A;  1FQA A;  2F7A A;  2XXR A;  2F34 A;  1M5F A;  3I5O A;  4PFT A;  4EXL A;  3SEU A;  5KZT A;  5TP9 A;  4U1O A;  4G68 B;  4OFJ A;  4PP0 A;  4U22 A;  2DVC A;  4KYS A;  1S9T A;  2XXU A;  3JV9 A;  4G68 C;  3EF7 A;  1Y3N A;  1MY1 A;  1XC1 A;  3C36 A;  5FTI A;  1ZMG A;  2PT2 A;  1FW0 A;  1JW4 A;  1RYO A;  4G68 A;  4X48 A;  4C1U A;  3RNN A;  2Z8E A;  3VXC A;  4HW8 A;  1AIV A;  2AIX A;  2A5T B;  1CB6 A;  4IGR A;  4JB7 A;  4UAC A;  2REJ A;  3VVE A;  4C1T A;  1JNF A;  5I2N A;  3PUW E;  2R6G E;  5ICT A;  4TLM B;  4G4P A;  4XTC Q;  1N3X A;  1EH3 A;  2P1S A;  1SDX A;  1DSN A;  4YB7 A;  5IAI A;  2HQ0 A;  2QMW A;  2VGQ A;  3PUV E;  4YB5 A;  1PB7 A;  2RKM A;  1A8E A;  4RJZ A;  5AA4 B;  2FYI A;  2O69 A;  3FVN A;  1D9V A;  2R9J A;  5LOM A;  3U8Q A;  2UYE A;  4KYD A;  3LUY A;  1TWY A;  1ZIU A;  4RA1 A;  4L17 A;  1FTL A;  1LFH A;  1NFT A;  1NMU A;  3CG1 A;  1SBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...