3THIA

Thiaminase i from bacillus thiaminolyticus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
362
structure length
362
Chain Sequence
ITLKVAIYPYVPDPARFQAAVLDQWQRQEPGVKLEFTDWDSYSADPPDDLDVFVLDSIFLSHFVDAGYLLPFGSQDIDQAEDVLPFALQGAKRNGEVYGLPQILCTNLLFYRKGDLKIGQVDNIYELYKKIGTSHSEQIPPPQNKGLLINMAGGTTKASMYLEALIDVTGQYTEYDLLPPLDPLNDKVIRGLRLLINMAGEKPSQYVPEDGDAYVRASWFAQGSGRAFIGYSESMMRMGDYAEQVRFKPISSSAGQDIPLFYSDVVSVNSKTAHPELAKKLANVMASADTVEQALRPQADGQYPQYLLPARHQVYEALMQDYPIYSELAQIVNKPSNRVFRLGPEVRTWLKDAKQVLPEALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (THIAMINASE I)
publication title Crystal structure of thiaminase-I from Bacillus thiaminolyticus at 2.0 A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 116
structure length 362
sequence length 362
ec nomenclature ec 2.5.1.2: Thiamine pyridinylase.
pdb deposition date 1998-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3thiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3thiA02
1UTBA 3VXBA 1R6ZA 4ECFA 1HSJA 3VE1B 4KD5A 3P7IA 5DT6A 1LFIA 3SEUA 4PFWA 4EQ9A 3KG2A 3SEXA 1N0TA 2QSXA 4N6PA 3V5AA 2F34A 3K6WA 3FUZA 2DSFA 4YB5A 2XXRA 2ZNTA 4R2BA 3PPQA 4G8MA 3G3FA 4C1TA 2F7AA 1LFGA 2HZKA 1H45A 5FHOA 5DEXA 1AL3A 5K2XA 1UTHA 2O69A 4BDLA 3GBBA 1DMBA 4RPNA 2RC9A 4TOZA 5KDTB 4PQJA 1EZ9A 3GZGA 4OWDA 4PP0A 1N3WA 4JWXA 5I59A 2B3BA 2FA7A 2OBGA 2Y7PA 2ZNSA 4N07A 4ZECA 5DYHA 1H43A 3IK6B 4MLQA 5KCJA 4ZEBA 4IB2A 1AH5A 5LOMA 4RPOA 5JTYB 1US5A 4PFTA 4GF8A 2I0BA 3TODA 1FQDA 3T9XB 2ESNA 4U2RA 5AA4A 2G93A 1GGGA 4QFNA 1IXHA 1Q35A 4YU0A 3KN8A 3QUJA 5H8HB 4P11A 5ISUA 1EZPA 3I3VA 5I56A 5DVFA 1SYIA 1O7TA 4YKJA 3K6XA 2OWTA 1MDP1 4IO7A 3CSBA 3JYRA 2DE2A 3KN7A 1MQHA 5CMCA 1OQHA 3IB1A 4WKMA 2YJPA 3MP6A 4OFLA 4MFIA 2PT2A 4IGRA 4OVJA 5CRYA 1IUDA 3UN6A 2XXHA 1LB8A 4LQ2A 5H8QA 3FD3A 3GXAA 4GVOA 2Q89A 1MM7A 4ESXA 4QSEA 5TPAB 3USDA 2CZLA 2F6PA 3KEIA 3PD9A 5FTIA 1M5CA 2H9BA 1BLFA 3TTNA 4F2QA 1A7LA 4AB5A 4DCXA 1B1XA 1JQFA 4EQBA 4FATA 4NF5A 2XHDA 3QSLA 2ANJA 4EF2A 4WXJA 1PC3A 3K2DA 3KJ7A 3TCGA 4RK2A 4YKKA 4NWCA 3TTRA 4G8NA 2UYEA 1H76A 1N04A 5B70A 4BDOA 1ZTYA 3QK6A 3A09A 4NF6B 4F1UA 1SDXA 2O7IA 2ONSA 4IY6A 3OO9A 2ONRA 3N94A 3G3JA 1Y3PA 2PMSA 3O29A 2F7CA 1NKXA 3O6HA 3IX1A 1ELJA 2I4BA 3CRBA 2HXWA 4LZ7A 3U92A 1JW5A 5EYFA 3I5OA 3PPRA 3K4UA 3THIA 2AIXA 4OENA 1B32A 1Y4CA 4R6YA 4YKPA 2A5SA 4XKQA 1D9YA 2F7BA 3KGCA 4YKIA 1QUJA 1MXXA 1B7HA 4ZZEA 1D9VA 2UVIA 2F5XA 4KYDA 3LSWA 1JETA 5K2YA 2IEEA 3MW0A 1OLCA 5ELVA 4ZDMA 1QULA 1LB9A 4XKPA 4MBPA 3I6VA 1OIBA 1UQWA 3OEKA 4RA1A 2ALUA 3S9EA 1DPPA 1ZU0A 1MH4A 3IJOB 5F7VA 4OESA 3LC8A 1YCJA 4QSDA 1B5IA 4QSCA 3V89B 3IJXB 2XX9A 5AA2D 4ELQA 3HCQA 1RYXA 2RINA 4FECA 3PMVA 1NL5A 2F36A 4O3BA 3RTFB 3MUQA 2DYXA 1B46A 5TPAA 3QYTA 3L6HA 1PB7A 4FIMA 3VVEA 1SD3A 3O28A 4R9FA 5FHMA 3HO7A 1DSNA 4RJZA 3O2AA 1WVJA 1FTKA 3H3GA 3M3FA 3OENA 4OHNA 4ISUA 2HZLA 4OERA 4KYEA 3FV2A 1MM6A 1LAHE 2DE3A 1M5EA 4GLIA 5TU0A 2AL5A 1DPEA 4NTLA 3FXQA 2R71A 3S4UA 3TTMA 1FQCA 4LA9A 1CE2A 2QS2A 2ZXTA 1MPBA 4XIGQ 1TFDA 3MZ9A 5M2VA 4JSDA 4GIZA 4KQPA 1SW1A 4NF6A 3TTKA 3EN3A 1LBBA 4JWYA 3OXNA 3MPLA 2ZNUA 5CC2A 4RNSA 1IXCA 5CBSA 4KHZE 3PUVE 5BWJA 1YAEA 3H6TA 4HW8A 1CB6A 5BUUA 5HBCA 3S2VA 3H4ZA 4EDPA 3ILUB 4F3BA 2H25A 1WODA 2H4IA 3MC2A 2OJTA 3Q26A 1EH3A 3O6GA 3ZSFA 1FQFA 2V84A 5H8NA 1URGA 1H3DA 3SEYA 1B0HA 5HM4B 5CMBA 3L6GA 1QUKA 2DP8A 3FXRA 3MVYA 1NFTA 3FATA 4JWOA 3E9XA 4XXUA 2OK2A 3TTLA 3LR1A 2DWIA 3ZS6A 2THIA 4NE4A 3O6IA 5ITPA 3O66A 1MY0A 4JDFA 3H06B 3IOUA 2F8DA 5B7DA 4ZE8A 3FXUA 3ZKKA 5I84A 1ZBMA 4OXVA 2O1LA 1PDAA 1IXGA 2GFEA 4YZZA 1D4NA 3IOVA 4U1OA 2I3VA 2GH9A 1SI1A 1YPNA 3Q25A 5I2NB 2O1MA 2PVUA 2QMWA 4GL8A 2DXYA 3MJNA 4DXUA 4FJPA 3UP9A 1LSTA 2I6EA 1BIYA 3N26A 1S9TA 3VXCA 4OYVA 4IGTA 4TLLB 5CI5A 3MZ1A 4OTEA 3W15C 2PYYA 4PETA 4QFKA 3ILTB 1R9LA 4QRZA 3VVFA 1IITA 4POWA 1B5HA 2HCAA 3VFJA 5IAIA 5KZTA 1TWYA 3N5LA 3FZVA 4X1BA 2F6GA 3K0VA 3WAEA 4PFYA 5L9MA 3RT6B 3KFMA 4EXKA 2Q2AA 3IAZA 1OVBA 2AYSA 1B4ZA 4KCCA 1Y1MA 1POY1 1NH7A 2PBWA 3MPKA 3MZBA 2FYIA 3QIMA 1NNFA 3K6UA 4GQOA 4H8IA 4YMBA 4TLMB 2CMOA 3T96B 2XXYA 3RY3A 2VGQA 1VFEA 1GTKA 4MH5A 1SVXB 4G68B 5L9OA 1MH3A 1VFDA 4Q5TA 1B9JA 2X26A 2ZYNA 1B7ZA 1P1OA 1N84A 3TZAA 3TYHA 4GXSB 3CFXA 4NMYA 4GFRA 4KI0E 1P1UA 1NNPA 4QFPA 2Z22A 4I62A 3O9PA 1IQ7A 1I69A 2XXIA 2V3UA 3H7MA 1JW4A 3S9LC 4E0XA 3M3KA 1MXZA 3PMWA 3CIJA 3BBRA 3JV9A 3QUFA 4ZEIA 3QXMA 3UIFA 3B6WA 3V83A 2RF1A 2XD3A 3T22A 3EHTA 4NEDA 1JEUA 3E4RA 1B05A 2ZMBA 1Y1ZA 3IOTA 4RK9A 1MRPA 2O7UA 3VLVA 3LUYA 4BDQA 2DWJA 3F11A 4I8CA 3VVDA 5I2NA 1ZLQA 3HSTA 3VLUA 4PFUA 5H8FB 3OD7A 5DTBA 1OQGA 3SDFA 3FJ7A 5I58B 3UA8A 1BTJA 1Y4TA 2Z8FA 1LCFA 5CMKA 2I4CA 2XXXA 4R6KA 3RQTA 4LVQA 2VHAA 3KZGA 1QKAA 1S50A 1EZOA 3K6VA 1LLSA 4ZEKA 1LAFE 4F18A 3KN3A 4GWOA 4LQ5A 3A3CA 2RCBA 4OEVA 3PU5A 4H65A 4JSOA 3VDFA 3CR9A 4DLDA 4IO5A 2Y7RA 1A55A 4L17A 5ITOA 2OWSA 3TEPA 4YB6A 1QJMA 4H67A 4KYSA 1SI0A 5DVJA 4H6DA 4R73A 4ELRA 1FW0A 1FTLA 4G68C 1IEJA 4I9DA 3UGWA 1B3HA 2QRYA 5KDTA 1MXWA 1T0KA 5IKBA 3C32A 2Y84A 3OO8A 2DWHA 3RLFE 3TCHA 3IO6A 3KSXA 4G4PA 4Q30B 2VP1A 1B51A 4PE5B 5L9SA 2B65A 3TUSA 4G68A 4BLAA 2DE4A 4RY1A 5JTYA 3MVZA 1DOTA 5CBRA 1TT1A 1OMPA 1F9BA 3LSFB 4X48A 2X7PA 1ZJLA 3K02A 1SBPA 4GL0A 3R6UA 1I6BA 3U72A 1DTGA 4XKNA 2F35A 3G3HA 3S9NC 2HEUA 1QW0A 3DM0A 5H8HA 3ECRA 3DP8A 3MP8A 2DWAA 1B1HA 5AA1A 1P1QA 3FJMA 2GRVA 4EQ7A 4DZ1A 1LGBC 1A99A 4OMBA 1SYHA 3TPAA 4EF1A 4LUBA 3UK4A 4F1YA 3IB2A 3M8UA 1GR2A 1B2HA 3E3KA 3R7XA 1XT8A 2HAUA 3MP1A 4Z0IA 2M8CA 1MS7A 1NH8A 4C0RA 3C35A 1USYE 3OOAA 4R2FA 3W9WA 2D5WA 3HPIA 4IO3A 2ZYMA 2R9JA 1ZIUA 3PPNA 4GD5A 3SEWA 3G3IA 4DIGA 1B58A 2VD2A 2P1SA 3SEVA 4EXLA 5I58A 4O3AA 3EHSA 4ZE9A 1MDQA 2Z23A 3T9VA 3RTWB 4NF4B 1A40A 2ZYKA 5ICTA 1HSEA 3GBAA 4U22A 1URDA 1AIVA 1O64A 2GHBA 3Q29A 5EHMA 3PGFA 1MY1A 3PUYE 3Q28A 1FTMA 1MXVA 4OEUA 2IA4A 2ZYOA 3AXFA 1GV8A 2Q88A 1D3KA 4N13A 3IORA 2H99A 2E1SA 4OFOA 3OELA 1MQIA 1QVSA 1MQJA 1SW4A 3V8XB 2OZZA 2HFBA 3DLNA 3SESA 3RGYA 5FTHA 2V3TA 3FASA 4R74A 5F1QA 1KWHA 4POXA 3DELB 3T66A 5AE4A 1M5FA 3FV1A 3FVGA 1TFAA 1NMUA 2YPNA 3PD8A 2QL3A 4OQOA 1BP5A 2XXWA 2FNCA 3ZKLA 3BFTA 3SERA 3MQ9A 3M3LA 4KPTA 4DDDA 4AB6A 4G2ZA 4JB7A 1MY4A 5L8DA 1DTZA 2UVHA 3H6VA 1II5A 2QJEA 5AA4B 3MVXA 1XOCA 1USYH 3W9VA 2RC7A 3DP4A 2DS9A 2ONKE 3HV1A 1NNTA 3TDJA 4O3CA 2Y7KA 5I56B 1LCTA 5JK4A 2I49A 1O63A 3D4CA 1B6HA 1P99A 1ATGA 4QHQA 1N7WA 4F1VA 4LATA 1AMFA 4RXLA 1QKBA 2H5YA 2Q8JA 3C31A 2R6GE 4MF3A 1Z7NE 1S7YA 2QMXA 4LZ8A 1B7UA 1M5BA 1PBQA 3MVWA 1TXFA 2KLFA 1LAXA 1P1NA 3RT8A 1I6QA 4UA8A 4ZS9A 2H98A 3KJTA 4GRKA 4NF4A 1NNKA 1XHYA 2HAVA 4BDMA 3CFLA 4THIA 3KSJA 4OETA 4FEDA 2XX8A 2AL4A 3IB0A 3FJGA 4EUOA 4YICA 3C4MA 1AOVA 2Q2CA 4GXAA 1SW2A 2QS3A 2NOOA 2I3WA 2DOJA 4P0GA 4U1ZA 1US4A 5TP9B 3D4GA 2I58A 1LFHA 4F3PA 3K01A 2UYFA 4ZEFA 4XTCQ 4JXIA 2OCUA 4OFJA 4K3FA 2DXRA 1VR5A 3DP6A 4DXCA 3CG3A 1QUIA 1VSOA 3HN0A 1FQEA 3E13X 1UIVA 4U4SA 4X1DA 1R9QA 3CVGA 1P1WA 3TQLA 4Q0CA 3VV5A 2X7QA 4ZEDA 2F97A 3ONMA 1ZKBA 1ZMGA 2HQ0A 3GLBA 4M4GA 2DVCA 3OMBA 3K1NA 2XXVA 5JEIA 4BDRA 2V3QA 3G3KA 5AA2B 4HS7A 5EHSA 3PMXA 2REJA 3MWBA 2XX7A 1PB9A 5I57B 3BKIB 4R6HA 2ABHA 3U93A 3OSRA 1FCKA 1RYOA 3KOSA 1FTOA 1XS5A 4U4XA 4KR5A 4LONB 2V25A 5H8SA 4UACA 4H0WA 4FORA 4RYAA 4NWDA 2XXQA 3IOWA 5ICQA 1Z7ME 4YAHX 2PX1A 1A8EA 2QS4A 1SW5A 2DVZA 1URSA 5FHNA 1JNFA 4ESWA 2RC8A 2LAOA 3U1OA 2REGA 1MPCA 4WEDA 4QFLA 3B7DA 4YMAA 2UXAA 2XXPA 3MAMA 1B5JA 3WAFA 2V93A 5DVIA 1B0LA 3U8QA 3TAJA 3HHFA 3TQWA 3R26A 3T9HB 2XXUA 2W7YA 5HPQA 2PT1A 1XVXA 3IO4A 3N6UA 1B3LA 3RPWA 1OLAA 2VD3A 3EHUA 1MQDA 1N3XA 3SETA 4F39A 4F3GA 2YLNA 4G77A 5TP9A 4Q8RA 3H6UA 4AQ4A 1XC1A 3IL1B 4P0IA 1Y9UA 2Z8DA 1Y20A 4FEBA 3H6WA 3OO6A 3C9HA 4F31B 1UIUA 4R9GA 1BKAA 1Q1KA 4MLVA 2RKMA 3G3GA 3U94A 3TCFA 2NXOA 1B40A 1A8FA 3EQ1A 4QF9A 2G29A 3RUMA 3TELA 3PPOA 4F19A 1L5TA 3K00A 5I2KB 4XKRA 1MQGA 3PUXE 1IIWA 1SQYA 4H8JA 5H8NB 4H5FA 3HHGA 1JW1A 4F2OA 1N7XA 2XXTA 1MXUA 4IY5A 3KOTA 4X9TA 2I0CA 4KCDA 2Y7IA 3TMGA 5AA2A 1I6AA 2A5TB 4OZ9A 5A5XB 1MY3A 3PV0E 4HCYA 3RN8A 4R72A 5I57A 4G8HA 3CSGA 3JZJA 4DXBA 2VOZA 4FE8A 4ONYA 4U21A 2Q9TA 4TQUQ 3N6TA 1PB8A 1RKMA 3FGSA 3FIRA 3CG1A 5J1DA 3PUZE 4HTGA 4NF8B 1H44A 5H8FA 3EPEA 3OO7A 1A54A 2B3FA 3UORA 4F3SA 4C1UA 3H03A 4HCWA 5CM6A 2O51A 3TFLA 3QAXA 3EF7A 1MG1A 1WDNA 1PBPA 1M5DA 2DQVA 3CFZA 4H5GA 3OEMA 1B52A 1UTBB 2P0SA 1Y3QA 4U23A 2NWJA 1Y3NA 4WEPA 4ELPA 3S9MC 4DCYA 2XD2A 2Z8EA 2F78A 1MPDA 1LBCA 2QPQA 3FVKA 3C34A 1N76A 1PEBA 1B3FA 2NVUB 3Q27A 1HSLA 2UVJA 5DEXB 4ELOA 1UTHB 4IO4A 3PPPA 4DE8A 3K1MA 2I48A 3SKPA 4FAJA 3PUWE 3BFUA 1YTVA 3FVNA 1B3EA 4R75A 3LBSA 5I59B 1EU8A 1IZ1A 4H1XA 2P2AA 2O68A 5KCJB 4ND9A 3O97A 3K1PA 2GHAA 4LP2B 1JVYA 2O84X 1FQAA 5I2KA 4F22A 3C33A 3LSLA 2NUVA 4LZ5A 3LSXA 4QFOA 2O6AA 4IO6A 4JBZA 5CMMA 1JEVA 4F29A 3VLWA 3B6QA 2QS1A 4YB7A 2Y7WA 3OSQA 2E0SA 3IR1A 2A5TA 5A5XA 4M1VA 3C36A 1J1NA 1MXYA 1LAGE 1ANFA 2RCAA 4IO2A 1OVTA 3KBRA 1XVYA 2UVGA 4GOTA 3B6TA 1POTA 2WKYA 4Z7EA 1FTJA 5AA3A 2OLBA 4KFQA 3T93B 3ODBA 3RNNA 3MBPA 5H8QB 2D3IA 3A3UA 4NF8A 4E0WA 4BDNA 1R1NA 4I1DA 1JVXA 1MY2A 4ZZAA 2BJJX 1B3GA 1IXIA 3FVOA 1FQBA 1B4HA 1GVCA 3TKDA 3CI8A 3T9UA 1VE4A 4NF5B 3G7WA 2D21A
chains in the Genus database with same CATH superfamily
1UTBA 3VXBA 1R6ZA 4ECFA 1HSJA 3VE1B 4KD5A 3P7IA 5DT6A 1LFIA 3SEUA 4PFWA 4EQ9A 3KG2A 3SEXA 1N0TA 2QSXA 4N6PA 2QVUA 3V5AA 2F34A 3U65A 3K6WA 1SPIA 2FHYA 3FUZA 2DSFA 4YB5A 2XXRA 2ZNTA 4R2BA 3PPQA 4G8MA 3G3FA 4C1TA 2F7AA 1LFGA 2HZKA 4PFBA 1H45A 2L5VA 5FHOA 5DEXA 1AL3A 5K2XA 1UTHA 2O69A 4BDLA 3GBBA 1DMBA 4RPNA 2RC9A 4TOZA 5KDTB 4PQJA 1EZ9A 3GZGA 4OWDA 4PP0A 5F24A 1N3WA 4JWXA 5I59A 2B3BA 2FA7A 2OBGA 2Y7PA 2ZNSA 4N07A 4ZECA 5DYHA 1H43A 3IK6B 4OANA 4MLQA 5KCJA 4ZEBA 4IB2A 1AH5A 5LOMA 4RPOA 5JTYB 1US5A 4PFTA 4GF8A 2I0BA 3TODA 4NGUA 4P3LA 1FQDA 3T9XB 2ESNA 4U2RA 5AA4A 2G93A 2HXRA 1GGGA 3EKIA 4QFNA 1LBZA 1IXHA 1Q35A 4YU0A 3KN8A 3QUJA 5H8HB 4HE2A 4P11A 5ET5A 5ESYA 5ISUA 1EZPA 3I3VA 5I56A 5DVFA 1SYIA 1RDZA 1O7TA 4YKJA 5I5PA 3K6XA 2OWTA 1MDP1 4GWYA 4IO7A 3CSBA 3JYRA 2DE2A 3KN7A 1MQHA 5CMCA 1OQHA 3IB1A 4WKMA 2YJPA 3MP6A 4OFLA 4MFIA 2JJKA 2PT2A 4IGRA 4OVJA 5CRYA 1IUDA 3UN6A 2XXHA 1FPFA 1VDWA 2QFLA 4X8RA 1LB8A 1FPGA 1NV5A 3KC0A 4LQ2A 5H8QA 3FD3A 3GXAA 4GVOA 3B50A 2Q89A 1MM7A 4ESXA 4QSEA 5TPAB 3USDA 2Y5LA 2CZLA 2F6PA 3KEIA 3PD9A 5FTIA 1M5CA 2QVVA 2H9BA 1BLFA 3TTNA 4F2QA 1A7LA 2Y5KA 4AB5A 4DCXA 1B1XA 1JQFA 4EQBA 4GWZA 4FATA 4NF5A 2XHDA 3QSLA 2ANJA 4EF2A 4WXJA 1PC3A 3K2DA 5IGAA 3KJ7A 3TCGA 4I3EA 4RK2A 4YKKA 4NWCA 3TTRA 4PTKA 2ZZWA 2PFYA 4G8NA 2UYEA 1NUYA 5DW8A 1H76A 1N04A 4HXVA 5B70A 4BDOA 1ZTYA 3QK6A 3A09A 1IMFA 4NF6B 4F1UA 3T1BA 1SDXA 2O7IA 2ONSA 4IY6A 3OO9A 2ONRA 3N94A 3G3JA 1Y3PA 2PMSA 3O29A 2F7CA 1NKXA 3O6HA 3IX1A 1ELJA 2I4BA 3CRBA 2HXWA 4LZ7A 3U92A 1JW5A 4NF0A 5EYFA 3I5OA 3PPRA 3K4UA 3MSTA 3THIA 2AIXA 4OENA 1B32A 1Y4CA 4R6YA 4YKPA 2A5SA 4XKQA 1D9YA 2F7BA 3KGCA 4YKIA 1QUJA 1MXXA 4P1LA 5EYHA 1B7HA 4ZZEA 4GBVA 4GWSA 1D9VA 2UVIA 2F5XA 4KYDA 3LSWA 1JETA 5K2YA 4N6KA 2IEEA 3MW0A 1OLCA 4N17A 5ELVA 5J16A 1KZ8A 4ZDMA 1QULA 1LB9A 1LEVA 4XKPA 4MBPA 5T3JA 3I6VA 1OIBA 1UQWA 3OEKA 4RA1A 2ALUA 3S9EA 1DPPA 1ZU0A 4GX3A 4OVQA 1MH4A 3IJOB 5F7VA 4OESA 3LC8A 1YCJA 4QSDA 1B5IA 4QSCA 3V89B 2DDKA 3IJXB 2XX9A 5AA2D 4ELQA 3HCQA 1RYXA 2RINA 4FECA 3PMVA 1NL5A 2F36A 4O3BA 3RTFB 2XXKA 3MUQA 1FPBA 4FBPA 4P9KA 2DYXA 1B46A 5TPAA 3QYTA 1FPIA 3L6HA 1PB7A 4FIMA 3VVEA 1SD3A 3O28A 4R9FA 5FHMA 1NV2A 4PBQA 3HO7A 1DSNA 4RJZA 3O2AA 1WVJA 1FTKA 3H3GA 3M3FA 3OENA 4OHNA 4ISUA 3HFUA 4MMPA 2HZLA 5A5LA 4OERA 4DI4B 4KYEA 3FV2A 4NHBA 1MM6A 1LAHE 2XWOA 2DE3A 1M5EA 4GLIA 5TU0A 2KQZA 2AL5A 1DPEA 4NTLA 2WX9A 1LBWA 2WYKA 3FXQA 2R71A 3S4UA 3TTMA 4OVSA 1FQCA 4LA9A 1CE2A 2OX3A 2QS2A 2ZXTA 1MPBA 4XIGQ 1TFDA 3MZ9A 5M2VA 4JSDA 4GIZA 4KQPA 1SW1A 4NF6A 3TTKA 3EN3A 1LBBA 4JWYA 3OXNA 2OWZA 3MPLA 2ZNUA 5CC2A 4RNSA 1IXCA 5CBSA 4KHZE 4PDDA 3PUVE 5BWJA 1YAEA 1XI6A 2WBBA 3H6TA 4HW8A 3FBPA 1CB6A 4AS5A 5BUUA 1NUXA 4NX1A 5HBCA 3S2VA 3H4ZA 4EDPA 3ILUB 4F3BA 2H25A 1WODA 2H4IA 4PC9A 3MC2A 2OJTA 3Q26A 1EH3A 3O6GA 3ZSFA 1FQFA 2Q8MA 2V84A 5H8NA 1URGA 1H3DA 3SEYA 1B0HA 5HM4B 5CMBA 3L6GA 1QUKA 2DP8A 3FXRA 3MVYA 1CNQA 2BJIA 1NFTA 3FATA 4JWOA 3E9XA 4XXUA 2OK2A 2XWVA 3TTLA 3LR1A 3IFAA 2DWIA 3ZS6A 2THIA 4NE4A 3O6IA 5ITPA 3O66A 1MY0A 4JDFA 3H06B 3IOUA 2F8DA 1EYKA 5B7DA 4ZE8A 3FXUA 3ZKKA 5I84A 1ZBMA 4OXVA 2O1LA 1PDAA 1IXGA 4JVDA 2GFEA 4YZZA 1D4NA 3IOVA 5I3SA 4U1OA 2I3VA 2GH9A 1SI1A 1YPNA 3Q25A 5I2NB 2O1MA 2PVUA 2QMWA 1LBVA 4GL8A 3E79A 2DXYA 3MJNA 4DXUA 4FJPA 3UP9A 1LSTA 2I6EA 1BIYA 3N26A 1S9TA 3T0JA 3VXCA 4OYVA 4NG7A 4IGTA 2CZKA 2FIXA 4PBHA 4TLLB 5CI5A 3MZ1A 4OTEA 3W15C 5IZ3B 2PYYA 4OVTA 4PETA 4QFKA 3ILTB 4QRZA 1R9LA 1K9ZA 4MNPA 3VVFA 1IITA 4POWA 1B5HA 2HCAA 3VFJA 5IAIA 5KZTA 1TWYA 3GYYA 3N5LA 3FZVA 4X1BA 2F6GA 3K0VA 3WAEA 4PFYA 5L9MA 3RT6B 3KFMA 4EXKA 2Q2AA 3IAZA 1OVBA 2AYSA 1B4ZA 1Q9DA 4KCCA 1Y1MA 1POY1 2R8TA 1NH7A 2PBWA 3MPKA 3MZBA 2FYIA 3QIMA 3IFCA 1NNFA 1FBHA 3K6UA 4GQOA 3RPLB 4H8IA 4YMBA 4TLMB 2CMOA 3T96B 2XXYA 4H45A 3RY3A 2VGQA 4P56A 1VFEA 1GTKA 4MH5A 1SVXB 4G68B 4P47A 5L9OA 1MH3A 1VFDA 4Q5TA 2GQ1A 1B9JA 1IMDA 2X26A 2ZYNA 1B7ZA 1P1OA 1N84A 5EYGA 3TZAA 3TYHA 4GXSB 3CFXA 4NMYA 4GFRA 4KI0E 1P1UA 1NNPA 4QFPA 4QXDA 2P3VA 2Z22A 4I62A 1IMCA 3O9PA 2FIEA 1IQ7A 1I69A 2XXIA 2V3UA 3H7MA 1JW4A 3S9LC 4E0XA 3M3KA 1MXZA 3PMWA 3CIJA 3BBRA 3JV9A 3QUFA 4ZEIA 1NV6A 3QXMA 3UIFA 4GWUA 3B6WA 3V83A 2RF1A 2XD3A 3T22A 3EHTA 1FPLA 4NEDA 1JEUA 3E4RA 2QVRA 1B05A 4QBAA 2ZMBA 1Y1ZA 3IOTA 4RK9A 1MRPA 3D1RA 2O7UA 4P1EA 3VLVA 3LUYA 4BDQA 2DWJA 3F11A 4I8CA 3VVDA 5I2NA 1ZLQA 3HSTA 5I7IA 3VLUA 4PFUA 5H8FB 4GX4A 3OD7A 3FXBA 5DTBA 1OQGA 3SDFA 3FJ7A 5I58B 3UA8A 1BTJA 1Y4TA 2Z8FA 4X04A 1LCFA 5CMKA 2I4CA 2XXXA 4R6KA 3RQTA 4LVQA 2VHAA 4MEVA 1FBDA 3KZGA 1QKAA 4PGPA 1S50A 1LBYA 1EZOA 3K6VA 1LLSA 4ZEKA 1LAFE 4F18A 3KN3A 5IZ3A 4GWOA 4LQ5A 3A3CA 4H46A 2RCBA 4OEVA 3PU5A 4H65A 4JSOA 3VDFA 3CR9A 4DLDA 1FRPA 2KR0A 4IO5A 2Y7RA 1A55A 4O8MA 4L17A 5IZZA 5ITOA 1FBCA 2OWSA 3TEPA 1NV0A 4YB6A 4PF8A 1QJMA 4H67A 4KYSA 1SI0A 5DVJA 4H6DA 4R73A 4MNCA 4ELRA 1FW0A 1FTLA 4G68C 1IEJA 4I9DA 3UGWA 4N4UA 1AWBA 1B3HA 2QRYA 5KDTA 4MHFA 1MXWA 1T0KA 5IKBA 3C32A 2Y84A 3OO8A 1YZ0A 2DWHA 3RPLA 5EQ8A 3RLFE 3TCHA 3IO6A 3MYUA 3KSXA 4G4PA 4Q30B 2VP1A 1B51A 4PE5B 5LTCA 5L9SA 2P3NA 2B65A 4NAPA 3TUSA 4G68A 4BLAA 2DE4A 4RY1A 5JTYA 3MVZA 1DOTA 5CBRA 1TT1A 1OMPA 1F9BA 3LSFB 4X48A 2X7PA 1ZJLA 4O94A 3K02A 1G0IA 1SBPA 4GL0A 3R6UA 1I6BA 3U72A 1DTGA 4XKNA 2F35A 3G3HA 3S9NC 2HEUA 1QW0A 3DM0A 2WYPA 4N81A 5H8HA 3ECRA 3DP8A 3MP8A 2DWAA 1B1HA 5AA1A 1P1QA 3FJMA 1JP4A 2GRVA 4EQ7A 4DZ1A 1LGBC 1A99A 4OMBA 1SYHA 3TPAA 4EF1A 1LBXA 4LUBA 3UK4A 4F1YA 3IB2A 1YYZA 3M8UA 1GR2A 3PTYA 1B2HA 3E3KA 3R7XA 1XT8A 2HAUA 3MP1A 1IMEA 4Z0IA 2M8CA 1MS7A 1NH8A 4C0RA 3C35A 1USYE 3OOAA 4R2FA 3W9WA 2D5WA 3HPIA 4IO3A 2ZYMA 2F3BA 2R9JA 1ZIUA 3PPNA 4GD5A 3SEWA 3G3IA 4DIGA 1B58A 2VD2A 2P1SA 3SEVA 4EXLA 5I58A 4O3AA 3EHSA 1K9YA 4OA4A 4ZE9A 1MDQA 2Z23A 3T9VA 2Q74A 3RTWB 4NF4B 1A40A 2ZYKA 5ICTA 1HSEA 3GBAA 4U22A 1URDA 4MIJA 1AIVA 1O64A 2GHBA 3Q29A 4NQ8A 5EHMA 3PGFA 1MY1A 3PUYE 3Q28A 1FTMA 1MXVA 4OEUA 2IA4A 2ZYOA 3AXFA 1GV8A 2Q88A 1D3KA 3A29A 4N13A 2HHMA 3IORA 5IM2A 2H99A 4OVRA 1FBFA 2E1SA 4OFOA 3OELA 1MQIA 1QVSA 1MQJA 1SW4A 3V8XB 2OZZA 4GWWA 2HFBA 3DLNA 3SESA 3RGYA 2XWKA 5FTHA 4PGNA 2V3TA 3FASA 4R74A 5F1QA 2CZHA 1KWHA 4POXA 1FBGA 3DELB 3T66A 5ET6A 5AE4A 1M5FA 3FV1A 3FVGA 1TFAA 1IMAA 1NMUA 2YPNA 2VPNA 3PD8A 2QL3A 4OQOA 1BP5A 2XXWA 2FNCA 3ZKLA 3BFTA 4N8YA 3SERA 3MQ9A 3M3LA 4KPTA 4DDDA 4AB6A 4G2ZA 4JB7A 4AS4A 1MY4A 5L8DA 1DTZA 2UVHA 3H6VA 1II5A 2B4LA 2QJEA 3MVXA 5AA4B 1XOCA 1USYH 3CHGA 3W9VA 2RC7A 3DP4A 2DS9A 2ONKE 3HV1A 1NUZA 1NNTA 3TDJA 4O3CA 2Y7KA 5I56B 5ET7A 1LCTA 5JK4A 2I49A 1O63A 3D4CA 1B6HA 1P99A 1ATGA 1FPKA 4PFIA 4QHQA 1N7WA 4F1VA 4DI3D 4LATA 1AMFA 4RXLA 1QKBA 1BK4A 2H5YA 2Q8JA 3C31A 2R6GE 4MF3A 2B4MA 1Z7NE 1S7YA 5EQ9A 2QMXA 4LZ8A 1B7UA 1YXIA 1M5BA 4PDHA 1PBQA 5FBPA 3MVWA 1TXFA 2KLFA 1LAXA 1P1NA 3RT8A 1I6QA 4UA8A 4ZS9A 2H98A 1INPA 1DK4A 3B8BA 3KJTA 4GRKA 4NF4A 1NNKA 1NI9A 5LDZA 4GWXA 1XHYA 2HAVA 4BDMA 3CFLA 4THIA 3KSJA 4OETA 4N91A 4FEDA 2XX8A 2AL4A 3IB0A 3FJGA 1DCUA 4EUOA 4YICA 3C4MA 1AOVA 2Q2CA 4GXAA 1SW2A 2QS3A 2NOOA 2I3WA 2DOJA 4P0GA 4U1ZA 5EQAA 1US4A 2F3DA 5TP9B 3QMFA 3D4GA 2I58A 3ROJA 1LFHA 4F3PA 3K01A 2UYFA 4ZEFA 4XTCQ 4JXIA 2OCUA 4OFJA 4K3FA 4XEQA 2DXRA 1VR5A 3DP6A 4GX6A 3CG3A 4DXCA 1QUIA 1VSOA 3HN0A 1FQEA 3E13X 1UIVA 4U4SA 4X1DA 1R9QA 3CVGA 1P1WA 4NN3A 3TQLA 4Q0CA 3VV5A 2X7QA 4ZEDA 2F97A 3ONMA 1ZKBA 1ZMGA 1FPEA 2HQ0A 3GLBA 4M4GA 2DVCA 3OMBA 3K1NA 2XXVA 5JEIA 4BDRA 2V3QA 3G3KA 5AA2B 1RDXA 4HS7A 5EHSA 3PMXA 1NV3A 2REJA 3MWBA 2XX7A 1D9QA 1PB9A 3KBZA 2CEXA 5I57B 4G61A 4PE3A 3BKIB 4R6HA 2ABHA 3U93A 4O7MA 3OSRA 2PFZA 1FCKA 1RYOA 3KOSA 1FTOA 1XS5A 4U4XA 4KR5A 4LONB 2V25A 5H8SA 4UACA 4H0WA 4FORA 4RYAA 4NWDA 2XXQA 3IOWA 5ICQA 1Z7ME 4YAHX 2PX1A 1QGXA 1A8EA 2QS4A 1FSAA 1SW5A 2DVZA 1URSA 5FHNA 1JNFA 4ESWA 2V4CA 2RC8A 2LAOA 3U1OA 2REGA 1RDYA 1MPCA 4WEDA 4QFLA 2HPGA 3B7DA 1G0HA 4N8GA 4YMAA 2VT5A 4JVIA 2UXAA 2XXPA 3MAMA 1B5JA 3WAFA 2V93A 3ISPA 5DVIA 1B0LA 3U8QA 3TAJA 3HHFA 4PAFA 3TQWA 3R26A 3T9HB 2XXUA 1NV4A 4MJOA 2W7YA 5HPQA 2PT1A 1XVXA 3IO4A 3N6UA 1B3LA 1FJ9A 3RPWA 1OLAA 2VD3A 3EHUA 3SZPA 1MQDA 1N3XA 3SETA 4F39A 4F3GA 2YLNA 4G77A 5TP9A 4PF6A 4Q8RA 3H6UA 4AQ4A 1XC1A 3IL1B 4P0IA 1Y9UA 2Z8DA 1Y20A 4FEBA 4MCOA 3H6WA 3OO6A 3C9HA 4F31B 4PAIA 1UIUA 4R9GA 1BKAA 1Q1KA 4MLVA 2RKMA 3G3GA 3U94A 3TCFA 2NXOA 1B40A 1A8FA 3EQ1A 3LUZA 4QF9A 2G29A 3RUMA 3TELA 4HE0A 3PPOA 4F19A 3NOHA 1L5TA 3K00A 5I2KB 4XKRA 1MQGA 3PUXE 1IIWA 1SQYA 4H8JA 5H8NB 4MX6A 4H5FA 4O7IA 3HHGA 1JW1A 4F2OA 1N7XA 2XXTA 1MXUA 4IY5A 3KOTA 4X9TA 4GBWA 2I0CA 4KCDA 2Y7IA 3TMGA 5AA2A 2ZZXA 1I6AA 4IR8A 2ZZVA 2A5TB 4OZ9A 5A5XB 1MY3A 3PV0E 5IZ1A 2XA5A 4HCYA 3RN8A 4R72A 4PAKA 5I57A 4G8HA 3CSGA 3JZJA 1FBPA 4DXBA 2VOZA 5EQ7A 4FE8A 4ONYA 4U21A 2Q9TA 4TQUQ 3N6TA 1PB8A 2WBDA 1RKMA 3FGSA 3FIRA 3CG1A 5J1DA 1EYJA 3PUZE 4HTGA 4NF8B 1H44A 5H8FA 4OVPA 3EPEA 3OO7A 1A54A 2B3FA 3UORA 4F3SA 1EYIA 4N6DA 4C1UA 3H03A 4HCWA 2FVZA 5CM6A 1IMBA 2O51A 3TFLA 4JVCA 4XF5A 3QAXA 1KA1A 3EF7A 1MG1A 1WDNA 3BIHA 2CEYA 1PBPA 1M5DA 2DQVA 3CFZA 4H5GA 3OEMA 1B52A 1UTBB 2P0SA 1Y3QA 4U23A 4UABA 2FBPA 2NWJA 1FPJA 1Y3NA 4WEPA 4ELPA 3S9MC 3RYDA 2MKZA 4DCYA 2XD2A 2Z8EA 2F78A 1MPDA 3LV0A 1LBCA 2QPQA 3FVKA 3C34A 1N76A 1PEBA 1B3FA 2NVUB 1FTAA 3Q27A 1HSLA 2UVJA 5DEXB 4ELOA 1UTHB 4IO4A 3PPPA 4DE8A 3K1MA 2I48A 3SKPA 2PCRA 4FAJA 3PUWE 3BFUA 1YTVA 3FVNA 1B3EA 4R75A 3LBSA 1NV7A 5I59B 1EU8A 1IZ1A 1NV1A 4H1XA 4I40A 2P2AA 2O68A 5KCJB 4ND9A 3O97A 4MNIA 3K1PA 2GHAA 4LP2B 1JVYA 2O84X 1FQAA 5I2KA 4F22A 3C33A 3LSLA 2NUVA 4LZ5A 1DBZA 3LSXA 1FPDA 4QFOA 2WEFA 1NUWA 2O6AA 4IO6A 4JBZA 5CMMA 1JEVA 4F29A 3VLWA 3B6QA 3KC1A 2QS1A 4YB7A 2VPOA 2Y7WA 3OSQA 2E0SA 3IR1A 2A5TA 4PCDA 5A5XA 4M1VA 3C36A 1J1NA 2XWIA 3BIGA 1MXYA 1FBEA 1LAGE 1ANFA 2RCAA 4IO2A 1OVTA 3KBRA 5ET8A 1FJ6A 1XVYA 4KXPA 4XFEA 2UVGA 4GOTA 3B6TA 1POTA 2WKYA 4Z7EA 1FTJA 5AA3A 2OLBA 4KFQA 4MAGA 3T93B 3ODBA 3RNNA 3MBPA 4PFRA 5H8QB 2D3IA 1KA0A 3A3UA 4LN5A 4N15A 4NF8A 4E0WA 4BDNA 1R1NA 4I3YA 4I1DA 1JVXA 1MY2A 4ZZAA 4P8BA 3E78A 2BJJX 1B3GA 1IXIA 2CZIA 4HE1A 3FVOA 1FQBA 1B4HA 1GVCA 3TKDA 3CI8A 3T9UA 1VE4A 4NF5B 3G7WA 2D21A
chains in the Genus database with same CATH topology
1UTBA 3VXBA 1R6ZA 4ECFA 1HSJA 3VE1B 4KD5A 3P7IA 5DT6A 1LFIA 3SEUA 4PFWA 4EQ9A 3KG2A 3SEXA 1N0TA 2QSXA 4N6PA 3V5AA 2F34A 3K6WA 3FUZA 2DSFA 4YB5A 2XXRA 2ZNTA 4R2BA 3PPQA 4G8MA 3G3FA 4C1TA 2F7AA 1LFGA 2HZKA 1H45A 5FHOA 5DEXA 1AL3A 5K2XA 1UTHA 2O69A 4BDLA 3GBBA 1DMBA 4RPNA 2RC9A 4TOZA 5KDTB 4PQJA 1EZ9A 3GZGA 4OWDA 4PP0A 1N3WA 4JWXA 5I59A 2B3BA 2FA7A 2OBGA 2Y7PA 2ZNSA 4N07A 4ZECA 5DYHA 1H43A 3IK6B 4MLQA 5KCJA 4ZEBA 4IB2A 1AH5A 5LOMA 4RPOA 5JTYB 1US5A 4PFTA 4GF8A 2I0BA 3TODA 1FQDA 3T9XB 2ESNA 4U2RA 5AA4A 2G93A 1GGGA 4QFNA 1IXHA 1Q35A 4YU0A 3KN8A 3QUJA 5H8HB 4P11A 5ISUA 1EZPA 3I3VA 5I56A 5DVFA 1SYIA 1O7TA 4YKJA 3K6XA 2OWTA 1MDP1 4IO7A 3CSBA 3JYRA 2DE2A 3KN7A 1MQHA 5CMCA 1OQHA 3IB1A 4WKMA 2YJPA 3MP6A 4OFLA 4MFIA 2PT2A 4IGRA 4OVJA 5CRYA 1IUDA 3UN6A 2XXHA 1LB8A 4LQ2A 5H8QA 3FD3A 3GXAA 4GVOA 2Q89A 1MM7A 4ESXA 4QSEA 5TPAB 3USDA 2CZLA 2F6PA 3KEIA 3PD9A 5FTIA 1M5CA 2H9BA 1BLFA 3TTNA 4F2QA 1A7LA 4AB5A 4DCXA 1B1XA 1JQFA 4EQBA 4FATA 4NF5A 2XHDA 3QSLA 2ANJA 4EF2A 4WXJA 1PC3A 3K2DA 3KJ7A 3TCGA 4RK2A 4YKKA 4NWCA 3TTRA 4G8NA 2UYEA 1H76A 1N04A 5B70A 4BDOA 1ZTYA 3QK6A 3A09A 4NF6B 4F1UA 1SDXA 2O7IA 2ONSA 4IY6A 3OO9A 2ONRA 3N94A 3G3JA 1Y3PA 2PMSA 3O29A 2F7CA 1NKXA 3O6HA 3IX1A 1ELJA 2I4BA 3CRBA 2HXWA 4LZ7A 3U92A 1JW5A 5EYFA 3I5OA 3PPRA 3K4UA 3THIA 2AIXA 4OENA 1B32A 1Y4CA 4R6YA 4YKPA 2A5SA 4XKQA 1D9YA 2F7BA 3KGCA 4YKIA 1QUJA 1MXXA 1B7HA 4ZZEA 1D9VA 2UVIA 2F5XA 4KYDA 3LSWA 1JETA 5K2YA 2IEEA 3MW0A 1OLCA 5ELVA 4ZDMA 1QULA 1LB9A 4XKPA 4MBPA 3I6VA 1OIBA 1UQWA 3OEKA 4RA1A 2ALUA 3S9EA 1DPPA 1ZU0A 1MH4A 3IJOB 5F7VA 4OESA 3LC8A 1YCJA 4QSDA 1B5IA 4QSCA 3V89B 3IJXB 2XX9A 5AA2D 4ELQA 3HCQA 1RYXA 2RINA 4FECA 3PMVA 1NL5A 2F36A 4O3BA 3RTFB 3MUQA 2DYXA 1B46A 5TPAA 3QYTA 3L6HA 1PB7A 4FIMA 3VVEA 1SD3A 3O28A 4R9FA 5FHMA 3HO7A 1DSNA 4RJZA 3O2AA 1WVJA 1FTKA 3H3GA 3M3FA 3OENA 4OHNA 4ISUA 2HZLA 4OERA 4KYEA 3FV2A 1MM6A 1LAHE 2DE3A 1M5EA 4GLIA 5TU0A 2AL5A 1DPEA 4NTLA 3FXQA 2R71A 3S4UA 3TTMA 1FQCA 4LA9A 1CE2A 2QS2A 2ZXTA 1MPBA 4XIGQ 1TFDA 3MZ9A 5M2VA 4JSDA 4GIZA 4KQPA 1SW1A 4NF6A 3TTKA 3EN3A 1LBBA 4JWYA 3OXNA 3MPLA 2ZNUA 5CC2A 4RNSA 1IXCA 5CBSA 4KHZE 3PUVE 5BWJA 1YAEA 3H6TA 4HW8A 1CB6A 5BUUA 5HBCA 3S2VA 3H4ZA 4EDPA 3ILUB 4F3BA 2H25A 1WODA 2H4IA 3MC2A 2OJTA 3Q26A 1EH3A 3O6GA 3ZSFA 1FQFA 2V84A 5H8NA 1URGA 1H3DA 3SEYA 1B0HA 5HM4B 5CMBA 3L6GA 1QUKA 2DP8A 3FXRA 3MVYA 1NFTA 3FATA 4JWOA 3E9XA 4XXUA 2OK2A 3TTLA 3LR1A 2DWIA 3ZS6A 2THIA 4NE4A 3O6IA 5ITPA 3O66A 1MY0A 4JDFA 3H06B 3IOUA 2F8DA 5B7DA 4ZE8A 3FXUA 3ZKKA 5I84A 1ZBMA 4OXVA 2O1LA 1PDAA 1IXGA 2GFEA 4YZZA 1D4NA 3IOVA 4U1OA 2I3VA 2GH9A 1SI1A 1YPNA 3Q25A 5I2NB 2O1MA 2PVUA 2QMWA 4GL8A 2DXYA 3MJNA 4DXUA 4FJPA 3UP9A 1LSTA 2I6EA 1BIYA 3N26A 1S9TA 3VXCA 4OYVA 4IGTA 4TLLB 5CI5A 3MZ1A 4OTEA 3W15C 2PYYA 4PETA 4QFKA 3ILTB 1R9LA 4QRZA 3VVFA 1IITA 4POWA 1B5HA 2HCAA 3VFJA 5IAIA 5KZTA 1TWYA 3N5LA 3FZVA 4X1BA 2F6GA 3K0VA 3WAEA 4PFYA 5L9MA 3RT6B 3KFMA 4EXKA 2Q2AA 3IAZA 1OVBA 2AYSA 1B4ZA 4KCCA 1Y1MA 1POY1 1NH7A 2PBWA 3MPKA 3MZBA 2FYIA 3QIMA 1NNFA 3K6UA 4GQOA 4H8IA 4YMBA 4TLMB 2CMOA 3T96B 2XXYA 3RY3A 2VGQA 1VFEA 1GTKA 4MH5A 1SVXB 4G68B 5L9OA 1MH3A 1VFDA 4Q5TA 1B9JA 2X26A 2ZYNA 1B7ZA 1P1OA 1N84A 3TZAA 3TYHA 4GXSB 3CFXA 4NMYA 4GFRA 4KI0E 1P1UA 1NNPA 4QFPA 2Z22A 4I62A 3O9PA 1IQ7A 1I69A 2XXIA 2V3UA 3H7MA 1JW4A 3S9LC 4E0XA 3M3KA 1MXZA 3PMWA 3CIJA 3BBRA 3JV9A 3QUFA 4ZEIA 3QXMA 3UIFA 3B6WA 3V83A 2RF1A 2XD3A 3T22A 3EHTA 4NEDA 1JEUA 3E4RA 1B05A 2ZMBA 1Y1ZA 3IOTA 4RK9A 1MRPA 2O7UA 3VLVA 3LUYA 4BDQA 2DWJA 3F11A 4I8CA 3VVDA 5I2NA 1ZLQA 3HSTA 3VLUA 4PFUA 5H8FB 3OD7A 5DTBA 1OQGA 3SDFA 3FJ7A 5I58B 3UA8A 1BTJA 1Y4TA 2Z8FA 1LCFA 5CMKA 2I4CA 2XXXA 4R6KA 3RQTA 4LVQA 2VHAA 3KZGA 1QKAA 1S50A 1EZOA 3K6VA 1LLSA 4ZEKA 1LAFE 4F18A 3KN3A 4GWOA 4LQ5A 3A3CA 2RCBA 4OEVA 3PU5A 4H65A 4JSOA 3VDFA 3CR9A 4DLDA 4IO5A 2Y7RA 1A55A 4L17A 5ITOA 2OWSA 3TEPA 4YB6A 1QJMA 4H67A 4KYSA 1SI0A 5DVJA 4H6DA 4R73A 4ELRA 1FW0A 1FTLA 4G68C 1IEJA 4I9DA 3UGWA 1B3HA 2QRYA 5KDTA 1MXWA 1T0KA 5IKBA 3C32A 2Y84A 3OO8A 2DWHA 3RLFE 3TCHA 3IO6A 3KSXA 4G4PA 4Q30B 2VP1A 1B51A 4PE5B 5L9SA 2B65A 3TUSA 4G68A 4BLAA 2DE4A 4RY1A 5JTYA 3MVZA 1DOTA 5CBRA 1TT1A 1OMPA 1F9BA 3LSFB 4X48A 2X7PA 1ZJLA 3K02A 1SBPA 4GL0A 3R6UA 1I6BA 3U72A 1DTGA 4XKNA 2F35A 3G3HA 3S9NC 2HEUA 1QW0A 3DM0A 5H8HA 3ECRA 3DP8A 3MP8A 2DWAA 1B1HA 5AA1A 1P1QA 3FJMA 2GRVA 4EQ7A 4DZ1A 1LGBC 1A99A 4OMBA 1SYHA 3TPAA 4EF1A 4LUBA 3UK4A 4F1YA 3IB2A 3M8UA 1GR2A 1B2HA 3E3KA 3R7XA 1XT8A 2HAUA 3MP1A 4Z0IA 2M8CA 1MS7A 1NH8A 4C0RA 3C35A 1USYE 3OOAA 4R2FA 3W9WA 2D5WA 3HPIA 4IO3A 2ZYMA 2R9JA 1ZIUA 3PPNA 4GD5A 3SEWA 3G3IA 4DIGA 1B58A 2VD2A 2P1SA 3SEVA 4EXLA 5I58A 4O3AA 3EHSA 4ZE9A 1MDQA 2Z23A 3T9VA 3RTWB 4NF4B 1A40A 2ZYKA 5ICTA 1HSEA 3GBAA 4U22A 1URDA 1AIVA 1O64A 2GHBA 3Q29A 5EHMA 3PGFA 1MY1A 3PUYE 3Q28A 1FTMA 1MXVA 4OEUA 2IA4A 2ZYOA 3AXFA 1GV8A 2Q88A 1D3KA 4N13A 3IORA 2H99A 2E1SA 4OFOA 3OELA 1MQIA 1QVSA 1MQJA 1SW4A 3V8XB 2OZZA 2HFBA 3DLNA 3SESA 3RGYA 5FTHA 2V3TA 3FASA 4R74A 5F1QA 1KWHA 4POXA 3DELB 3T66A 5AE4A 1M5FA 3FV1A 3FVGA 1TFAA 1NMUA 2YPNA 3PD8A 2QL3A 4OQOA 1BP5A 2XXWA 2FNCA 3ZKLA 3BFTA 3SERA 3MQ9A 3M3LA 4KPTA 4DDDA 4AB6A 4G2ZA 4JB7A 1MY4A 5L8DA 1DTZA 2UVHA 3H6VA 1II5A 2QJEA 5AA4B 3MVXA 1XOCA 1USYH 3W9VA 2RC7A 3DP4A 2DS9A 2ONKE 3HV1A 1NNTA 3TDJA 4O3CA 2Y7KA 5I56B 1LCTA 5JK4A 2I49A 1O63A 3D4CA 1B6HA 1P99A 1ATGA 4QHQA 1N7WA 4F1VA 4LATA 1AMFA 4RXLA 1QKBA 2H5YA 2Q8JA 3C31A 2R6GE 4MF3A 1Z7NE 1S7YA 2QMXA 4LZ8A 1B7UA 1M5BA 1PBQA 3MVWA 1TXFA 2KLFA 1LAXA 1P1NA 3RT8A 1I6QA 4UA8A 4ZS9A 2H98A 3KJTA 4GRKA 4NF4A 1NNKA 1XHYA 2HAVA 4BDMA 3CFLA 4THIA 3KSJA 4OETA 4FEDA 2XX8A 2AL4A 3IB0A 3FJGA 4EUOA 4YICA 3C4MA 1AOVA 2Q2CA 4GXAA 1SW2A 2QS3A 2NOOA 2I3WA 2DOJA 4P0GA 4U1ZA 1US4A 5TP9B 3D4GA 2I58A 1LFHA 4F3PA 3K01A 2UYFA 4ZEFA 4XTCQ 4JXIA 2OCUA 4OFJA 4K3FA 2DXRA 1VR5A 3DP6A 4DXCA 3CG3A 1QUIA 1VSOA 3HN0A 1FQEA 3E13X 1UIVA 4U4SA 4X1DA 1R9QA 3CVGA 1P1WA 3TQLA 4Q0CA 3VV5A 2X7QA 4ZEDA 2F97A 3ONMA 1ZKBA 1ZMGA 2HQ0A 3GLBA 4M4GA 2DVCA 3OMBA 3K1NA 2XXVA 5JEIA 4BDRA 2V3QA 3G3KA 5AA2B 4HS7A 5EHSA 3PMXA 2REJA 3MWBA 2XX7A 1PB9A 5I57B 3BKIB 4R6HA 2ABHA 3U93A 3OSRA 1FCKA 1RYOA 3KOSA 1FTOA 1XS5A 4U4XA 4KR5A 4LONB 2V25A 5H8SA 4UACA 4H0WA 4FORA 4RYAA 4NWDA 2XXQA 3IOWA 5ICQA 1Z7ME 4YAHX 2PX1A 1A8EA 2QS4A 1SW5A 2DVZA 1URSA 5FHNA 1JNFA 4ESWA 2RC8A 2LAOA 3U1OA 2REGA 1MPCA 4WEDA 4QFLA 3B7DA 4YMAA 2UXAA 2XXPA 3MAMA 1B5JA 3WAFA 2V93A 5DVIA 1B0LA 3U8QA 3TAJA 3HHFA 3TQWA 3R26A 3T9HB 2XXUA 2W7YA 5HPQA 2PT1A 1XVXA 3IO4A 3N6UA 1B3LA 3RPWA 1OLAA 2VD3A 3EHUA 1MQDA 1N3XA 3SETA 4F39A 4F3GA 2YLNA 4G77A 5TP9A 4Q8RA 3H6UA 4AQ4A 1XC1A 3IL1B 4P0IA 1Y9UA 2Z8DA 1Y20A 4FEBA 3H6WA 3OO6A 3C9HA 4F31B 1UIUA 4R9GA 1BKAA 1Q1KA 4MLVA 2RKMA 3G3GA 3U94A 3TCFA 2NXOA 1B40A 1A8FA 3EQ1A 4QF9A 2G29A 3RUMA 3TELA 3PPOA 4F19A 1L5TA 3K00A 5I2KB 4XKRA 1MQGA 3PUXE 1IIWA 1SQYA 4H8JA 5H8NB 4H5FA 3HHGA 1JW1A 4F2OA 1N7XA 2XXTA 1MXUA 4IY5A 3KOTA 4X9TA 2I0CA 4KCDA 2Y7IA 3TMGA 5AA2A 1I6AA 2A5TB 4OZ9A 5A5XB 1MY3A 3PV0E 4HCYA 3RN8A 4R72A 5I57A 4G8HA 3CSGA 3JZJA 4DXBA 2VOZA 4FE8A 4ONYA 4U21A 2Q9TA 4TQUQ 3N6TA 1PB8A 1RKMA 3FGSA 3FIRA 3CG1A 5J1DA 3PUZE 4HTGA 4NF8B 1H44A 5H8FA 3EPEA 3OO7A 1A54A 2B3FA 3UORA 4F3SA 4C1UA 3H03A 4HCWA 5CM6A 2O51A 3TFLA 3QAXA 3EF7A 1MG1A 1WDNA 1PBPA 1M5DA 2DQVA 3CFZA 4H5GA 3OEMA 1B52A 1UTBB 2P0SA 1Y3QA 4U23A 2NWJA 1Y3NA 4WEPA 4ELPA 3S9MC 4DCYA 2XD2A 2Z8EA 2F78A 1MPDA 1LBCA 2QPQA 3FVKA 3C34A 1N76A 1PEBA 1B3FA 2NVUB 3Q27A 1HSLA 2UVJA 5DEXB 4ELOA 1UTHB 4IO4A 3PPPA 4DE8A 3K1MA 2I48A 3SKPA 4FAJA 3PUWE 3BFUA 1YTVA 3FVNA 1B3EA 4R75A 3LBSA 5I59B 1EU8A 1IZ1A 4H1XA 2P2AA 2O68A 5KCJB 4ND9A 3O97A 3K1PA 2GHAA 4LP2B 1JVYA 2O84X 1FQAA 5I2KA 4F22A 3C33A 3LSLA 2NUVA 4LZ5A 3LSXA 4QFOA 2O6AA 4IO6A 4JBZA 5CMMA 1JEVA 4F29A 3VLWA 3B6QA 2QS1A 4YB7A 2Y7WA 3OSQA 2E0SA 3IR1A 2A5TA 5A5XA 4M1VA 3C36A 1J1NA 1MXYA 1LAGE 1ANFA 2RCAA 4IO2A 1OVTA 3KBRA 1XVYA 2UVGA 4GOTA 3B6TA 1POTA 2WKYA 4Z7EA 1FTJA 5AA3A 2OLBA 4KFQA 3T93B 3ODBA 3RNNA 3MBPA 5H8QB 2D3IA 3A3UA 4NF8A 4E0WA 4BDNA 1R1NA 4I1DA 1JVXA 1MY2A 4ZZAA 2BJJX 1B3GA 1IXIA 3FVOA 1FQBA 1B4HA 1GVCA 3TKDA 3CI8A 3T9UA 1VE4A 4NF5B 3G7WA 2D21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTB A;  3VXB A;  1R6Z A;  4ECF A;  1HSJ A;  3VE1 B;  4KD5 A;  3P7I A;  5DT6 A;  1LFI A;  3SEU A;  4PFW A;  4EQ9 A;  3KG2 A;  3SEX A;  1N0T A;  2QSX A;  4N6P A;  3V5A A;  2F34 A;  3K6W A;  3FUZ A;  2DSF A;  4YB5 A;  2XXR A;  2ZNT A;  4R2B A;  3PPQ A;  4G8M A;  3G3F A;  4C1T A;  2F7A A;  1LFG A;  2HZK A;  1H45 A;  5FHO A;  5DEX A;  1AL3 A;  5K2X A;  1UTH A;  2O69 A;  4BDL A;  3GBB A;  1DMB A;  4RPN A;  2RC9 A;  4TOZ A;  5KDT B;  4PQJ A;  1EZ9 A;  3GZG A;  4OWD A;  4PP0 A;  1N3W A;  4JWX A;  5I59 A;  2B3B A;  2FA7 A;  2OBG A;  2Y7P A;  2ZNS A;  4N07 A;  4ZEC A;  5DYH A;  1H43 A;  3IK6 B;  4MLQ A;  5KCJ A;  4ZEB A;  4IB2 A;  1AH5 A;  5LOM A;  4RPO A;  5JTY B;  1US5 A;  4PFT A;  4GF8 A;  2I0B A;  3TOD A;  1FQD A;  3T9X B;  2ESN A;  4U2R A;  5AA4 A;  2G93 A;  1GGG A;  4QFN A;  1IXH A;  1Q35 A;  4YU0 A;  3KN8 A;  3QUJ A;  5H8H B;  4P11 A;  5ISU A;  1EZP A;  3I3V A;  5I56 A;  5DVF A;  1SYI A;  1O7T A;  4YKJ A;  3K6X A;  2OWT A;  1MDP 1;  4IO7 A;  3CSB A;  3JYR A;  2DE2 A;  3KN7 A;  1MQH A;  5CMC A;  1OQH A;  3IB1 A;  4WKM A;  2YJP A;  3MP6 A;  4OFL A;  4MFI A;  2PT2 A;  4IGR A;  4OVJ A;  5CRY A;  1IUD A;  3UN6 A;  2XXH A;  1LB8 A;  4LQ2 A;  5H8Q A;  3FD3 A;  3GXA A;  4GVO A;  2Q89 A;  1MM7 A;  4ESX A;  4QSE A;  5TPA B;  3USD A;  2CZL A;  2F6P A;  3KEI A;  3PD9 A;  5FTI A;  1M5C A;  2H9B A;  1BLF A;  3TTN A;  4F2Q A;  1A7L A;  4AB5 A;  4DCX A;  1B1X A;  1JQF A;  4EQB A;  4FAT A;  4NF5 A;  2XHD A;  3QSL A;  2ANJ A;  4EF2 A;  4WXJ A;  1PC3 A;  3K2D A;  3KJ7 A;  3TCG A;  4RK2 A;  4YKK A;  4NWC A;  3TTR A;  4G8N A;  2UYE A;  1H76 A;  1N04 A;  5B70 A;  4BDO A;  1ZTY A;  3QK6 A;  3A09 A;  4NF6 B;  4F1U A;  1SDX A;  2O7I A;  2ONS A;  4IY6 A;  3OO9 A;  2ONR A;  3N94 A;  3G3J A;  1Y3P A;  2PMS A;  3O29 A;  2F7C A;  1NKX A;  3O6H A;  3IX1 A;  1ELJ A;  2I4B A;  3CRB A;  2HXW A;  4LZ7 A;  3U92 A;  1JW5 A;  5EYF A;  3I5O A;  3PPR A;  3K4U A;  3THI A;  2AIX A;  4OEN A;  1B32 A;  1Y4C A;  4R6Y A;  4YKP A;  2A5S A;  4XKQ A;  1D9Y A;  2F7B A;  3KGC A;  4YKI A;  1QUJ A;  1MXX A;  1B7H A;  4ZZE A;  1D9V A;  2UVI A;  2F5X A;  4KYD A;  3LSW A;  1JET A;  5K2Y A;  2IEE A;  3MW0 A;  1OLC A;  5ELV A;  4ZDM A;  1QUL A;  1LB9 A;  4XKP A;  4MBP A;  3I6V A;  1OIB A;  1UQW A;  3OEK A;  4RA1 A;  2ALU A;  3S9E A;  1DPP A;  1ZU0 A;  1MH4 A;  3IJO B;  5F7V A;  4OES A;  3LC8 A;  1YCJ A;  4QSD A;  1B5I A;  4QSC A;  3V89 B;  3IJX B;  2XX9 A;  5AA2 D;  4ELQ A;  3HCQ A;  1RYX A;  2RIN A;  4FEC A;  3PMV A;  1NL5 A;  2F36 A;  4O3B A;  3RTF B;  3MUQ A;  2DYX A;  1B46 A;  5TPA A;  3QYT A;  3L6H A;  1PB7 A;  4FIM A;  3VVE A;  1SD3 A;  3O28 A;  4R9F A;  5FHM A;  3HO7 A;  1DSN A;  4RJZ A;  3O2A A;  1WVJ A;  1FTK A;  3H3G A;  3M3F A;  3OEN A;  4OHN A;  4ISU A;  2HZL A;  4OER A;  4KYE A;  3FV2 A;  1MM6 A;  1LAH E;  2DE3 A;  1M5E A;  4GLI A;  5TU0 A;  2AL5 A;  1DPE A;  4NTL A;  3FXQ A;  2R71 A;  3S4U A;  3TTM A;  1FQC A;  4LA9 A;  1CE2 A;  2QS2 A;  2ZXT A;  1MPB A;  4XIG Q;  1TFD A;  3MZ9 A;  5M2V A;  4JSD A;  4GIZ A;  4KQP A;  1SW1 A;  4NF6 A;  3TTK A;  3EN3 A;  1LBB A;  4JWY A;  3OXN A;  3MPL A;  2ZNU A;  5CC2 A;  4RNS A;  1IXC A;  5CBS A;  4KHZ E;  3PUV E;  5BWJ A;  1YAE A;  3H6T A;  4HW8 A;  1CB6 A;  5BUU A;  5HBC A;  3S2V A;  3H4Z A;  4EDP A;  3ILU B;  4F3B A;  2H25 A;  1WOD A;  2H4I A;  3MC2 A;  2OJT A;  3Q26 A;  1EH3 A;  3O6G A;  3ZSF A;  1FQF A;  2V84 A;  5H8N A;  1URG A;  1H3D A;  3SEY A;  1B0H A;  5HM4 B;  5CMB A;  3L6G A;  1QUK A;  2DP8 A;  3FXR A;  3MVY A;  1NFT A;  3FAT A;  4JWO A;  3E9X A;  4XXU A;  2OK2 A;  3TTL A;  3LR1 A;  2DWI A;  3ZS6 A;  2THI A;  4NE4 A;  3O6I A;  5ITP A;  3O66 A;  1MY0 A;  4JDF A;  3H06 B;  3IOU A;  2F8D A;  5B7D A;  4ZE8 A;  3FXU A;  3ZKK A;  5I84 A;  1ZBM A;  4OXV A;  2O1L A;  1PDA A;  1IXG A;  2GFE A;  4YZZ A;  1D4N A;  3IOV A;  4U1O A;  2I3V A;  2GH9 A;  1SI1 A;  1YPN A;  3Q25 A;  5I2N B;  2O1M A;  2PVU A;  2QMW A;  4GL8 A;  2DXY A;  3MJN A;  4DXU A;  4FJP A;  3UP9 A;  1LST A;  2I6E A;  1BIY A;  3N26 A;  1S9T A;  3VXC A;  4OYV A;  4IGT A;  4TLL B;  5CI5 A;  3MZ1 A;  4OTE A;  3W15 C;  2PYY A;  4PET A;  4QFK A;  3ILT B;  1R9L A;  4QRZ A;  3VVF A;  1IIT A;  4POW A;  1B5H A;  2HCA A;  3VFJ A;  5IAI A;  5KZT A;  1TWY A;  3N5L A;  3FZV A;  4X1B A;  2F6G A;  3K0V A;  3WAE A;  4PFY A;  5L9M A;  3RT6 B;  3KFM A;  4EXK A;  2Q2A A;  3IAZ A;  1OVB A;  2AYS A;  1B4Z A;  4KCC A;  1Y1M A;  1POY 1;  1NH7 A;  2PBW A;  3MPK A;  3MZB A;  2FYI A;  3QIM A;  1NNF A;  3K6U A;  4GQO A;  4H8I A;  4YMB A;  4TLM B;  2CMO A;  3T96 B;  2XXY A;  3RY3 A;  2VGQ A;  1VFE A;  1GTK A;  4MH5 A;  1SVX B;  4G68 B;  5L9O A;  1MH3 A;  1VFD A;  4Q5T A;  1B9J A;  2X26 A;  2ZYN A;  1B7Z A;  1P1O A;  1N84 A;  3TZA A;  3TYH A;  4GXS B;  3CFX A;  4NMY A;  4GFR A;  4KI0 E;  1P1U A;  1NNP A;  4QFP A;  2Z22 A;  4I62 A;  3O9P A;  1IQ7 A;  1I69 A;  2XXI A;  2V3U A;  3H7M A;  1JW4 A;  3S9L C;  4E0X A;  3M3K A;  1MXZ A;  3PMW A;  3CIJ A;  3BBR A;  3JV9 A;  3QUF A;  4ZEI A;  3QXM A;  3UIF A;  3B6W A;  3V83 A;  2RF1 A;  2XD3 A;  3T22 A;  3EHT A;  4NED A;  1JEU A;  3E4R A;  1B05 A;  2ZMB A;  1Y1Z A;  3IOT A;  4RK9 A;  1MRP A;  2O7U A;  3VLV A;  3LUY A;  4BDQ A;  2DWJ A;  3F11 A;  4I8C A;  3VVD A;  5I2N A;  1ZLQ A;  3HST A;  3VLU A;  4PFU A;  5H8F B;  3OD7 A;  5DTB A;  1OQG A;  3SDF A;  3FJ7 A;  5I58 B;  3UA8 A;  1BTJ A;  1Y4T A;  2Z8F A;  1LCF A;  5CMK A;  2I4C A;  2XXX A;  4R6K A;  3RQT A;  4LVQ A;  2VHA A;  3KZG A;  1QKA A;  1S50 A;  1EZO A;  3K6V A;  1LLS A;  4ZEK A;  1LAF E;  4F18 A;  3KN3 A;  4GWO A;  4LQ5 A;  3A3C A;  2RCB A;  4OEV A;  3PU5 A;  4H65 A;  4JSO A;  3VDF A;  3CR9 A;  4DLD A;  4IO5 A;  2Y7R A;  1A55 A;  4L17 A;  5ITO A;  2OWS A;  3TEP A;  4YB6 A;  1QJM A;  4H67 A;  4KYS A;  1SI0 A;  5DVJ A;  4H6D A;  4R73 A;  4ELR A;  1FW0 A;  1FTL A;  4G68 C;  1IEJ A;  4I9D A;  3UGW A;  1B3H A;  2QRY A;  5KDT A;  1MXW A;  1T0K A;  5IKB A;  3C32 A;  2Y84 A;  3OO8 A;  2DWH A;  3RLF E;  3TCH A;  3IO6 A;  3KSX A;  4G4P A;  4Q30 B;  2VP1 A;  1B51 A;  4PE5 B;  5L9S A;  2B65 A;  3TUS A;  4G68 A;  4BLA A;  2DE4 A;  4RY1 A;  5JTY A;  3MVZ A;  1DOT A;  5CBR A;  1TT1 A;  1OMP A;  1F9B A;  3LSF B;  4X48 A;  2X7P A;  1ZJL A;  3K02 A;  1SBP A;  4GL0 A;  3R6U A;  1I6B A;  3U72 A;  1DTG A;  4XKN A;  2F35 A;  3G3H A;  3S9N C;  2HEU A;  1QW0 A;  3DM0 A;  5H8H A;  3ECR A;  3DP8 A;  3MP8 A;  2DWA A;  1B1H A;  5AA1 A;  1P1Q A;  3FJM A;  2GRV A;  4EQ7 A;  4DZ1 A;  1LGB C;  1A99 A;  4OMB A;  1SYH A;  3TPA A;  4EF1 A;  4LUB A;  3UK4 A;  4F1Y A;  3IB2 A;  3M8U A;  1GR2 A;  1B2H A;  3E3K A;  3R7X A;  1XT8 A;  2HAU A;  3MP1 A;  4Z0I A;  2M8C A;  1MS7 A;  1NH8 A;  4C0R A;  3C35 A;  1USY E;  3OOA A;  4R2F A;  3W9W A;  2D5W A;  3HPI A;  4IO3 A;  2ZYM A;  2R9J A;  1ZIU A;  3PPN A;  4GD5 A;  3SEW A;  3G3I A;  4DIG A;  1B58 A;  2VD2 A;  2P1S A;  3SEV A;  4EXL A;  5I58 A;  4O3A A;  3EHS A;  4ZE9 A;  1MDQ A;  2Z23 A;  3T9V A;  3RTW B;  4NF4 B;  1A40 A;  2ZYK A;  5ICT A;  1HSE A;  3GBA A;  4U22 A;  1URD A;  1AIV A;  1O64 A;  2GHB A;  3Q29 A;  5EHM A;  3PGF A;  1MY1 A;  3PUY E;  3Q28 A;  1FTM A;  1MXV A;  4OEU A;  2IA4 A;  2ZYO A;  3AXF A;  1GV8 A;  2Q88 A;  1D3K A;  4N13 A;  3IOR A;  2H99 A;  2E1S A;  4OFO A;  3OEL A;  1MQI A;  1QVS A;  1MQJ A;  1SW4 A;  3V8X B;  2OZZ A;  2HFB A;  3DLN A;  3SES A;  3RGY A;  5FTH A;  2V3T A;  3FAS A;  4R74 A;  5F1Q A;  1KWH A;  4POX A;  3DEL B;  3T66 A;  5AE4 A;  1M5F A;  3FV1 A;  3FVG A;  1TFA A;  1NMU A;  2YPN A;  3PD8 A;  2QL3 A;  4OQO A;  1BP5 A;  2XXW A;  2FNC A;  3ZKL A;  3BFT A;  3SER A;  3MQ9 A;  3M3L A;  4KPT A;  4DDD A;  4AB6 A;  4G2Z A;  4JB7 A;  1MY4 A;  5L8D A;  1DTZ A;  2UVH A;  3H6V A;  1II5 A;  2QJE A;  5AA4 B;  3MVX A;  1XOC A;  1USY H;  3W9V A;  2RC7 A;  3DP4 A;  2DS9 A;  2ONK E;  3HV1 A;  1NNT A;  3TDJ A;  4O3C A;  2Y7K A;  5I56 B;  1LCT A;  5JK4 A;  2I49 A;  1O63 A;  3D4C A;  1B6H A;  1P99 A;  1ATG A;  4QHQ A;  1N7W A;  4F1V A;  4LAT A;  1AMF A;  4RXL A;  1QKB A;  2H5Y A;  2Q8J A;  3C31 A;  2R6G E;  4MF3 A;  1Z7N E;  1S7Y A;  2QMX A;  4LZ8 A;  1B7U A;  1M5B A;  1PBQ A;  3MVW A;  1TXF A;  2KLF A;  1LAX A;  1P1N A;  3RT8 A;  1I6Q A;  4UA8 A;  4ZS9 A;  2H98 A;  3KJT A;  4GRK A;  4NF4 A;  1NNK A;  1XHY A;  2HAV A;  4BDM A;  3CFL A;  4THI A;  3KSJ A;  4OET A;  4FED A;  2XX8 A;  2AL4 A;  3IB0 A;  3FJG A;  4EUO A;  4YIC A;  3C4M A;  1AOV A;  2Q2C A;  4GXA A;  1SW2 A;  2QS3 A;  2NOO A;  2I3W A;  2DOJ A;  4P0G A;  4U1Z A;  1US4 A;  5TP9 B;  3D4G A;  2I58 A;  1LFH A;  4F3P A;  3K01 A;  2UYF A;  4ZEF A;  4XTC Q;  4JXI A;  2OCU A;  4OFJ A;  4K3F A;  2DXR A;  1VR5 A;  3DP6 A;  4DXC A;  3CG3 A;  1QUI A;  1VSO A;  3HN0 A;  1FQE A;  3E13 X;  1UIV A;  4U4S A;  4X1D A;  1R9Q A;  3CVG A;  1P1W A;  3TQL A;  4Q0C A;  3VV5 A;  2X7Q A;  4ZED A;  2F97 A;  3ONM A;  1ZKB A;  1ZMG A;  2HQ0 A;  3GLB A;  4M4G A;  2DVC A;  3OMB A;  3K1N A;  2XXV A;  5JEI A;  4BDR A;  2V3Q A;  3G3K A;  5AA2 B;  4HS7 A;  5EHS A;  3PMX A;  2REJ A;  3MWB A;  2XX7 A;  1PB9 A;  5I57 B;  3BKI B;  4R6H A;  2ABH A;  3U93 A;  3OSR A;  1FCK A;  1RYO A;  3KOS A;  1FTO A;  1XS5 A;  4U4X A;  4KR5 A;  4LON B;  2V25 A;  5H8S A;  4UAC A;  4H0W A;  4FOR A;  4RYA A;  4NWD A;  2XXQ A;  3IOW A;  5ICQ A;  1Z7M E;  4YAH X;  2PX1 A;  1A8E A;  2QS4 A;  1SW5 A;  2DVZ A;  1URS A;  5FHN A;  1JNF A;  4ESW A;  2RC8 A;  2LAO A;  3U1O A;  2REG A;  1MPC A;  4WED A;  4QFL A;  3B7D A;  4YMA A;  2UXA A;  2XXP A;  3MAM A;  1B5J A;  3WAF A;  2V93 A;  5DVI A;  1B0L A;  3U8Q A;  3TAJ A;  3HHF A;  3TQW A;  3R26 A;  3T9H B;  2XXU A;  2W7Y A;  5HPQ A;  2PT1 A;  1XVX A;  3IO4 A;  3N6U A;  1B3L A;  3RPW A;  1OLA A;  2VD3 A;  3EHU A;  1MQD A;  1N3X A;  3SET A;  4F39 A;  4F3G A;  2YLN A;  4G77 A;  5TP9 A;  4Q8R A;  3H6U A;  4AQ4 A;  1XC1 A;  3IL1 B;  4P0I A;  1Y9U A;  2Z8D A;  1Y20 A;  4FEB A;  3H6W A;  3OO6 A;  3C9H A;  4F31 B;  1UIU A;  4R9G A;  1BKA A;  1Q1K A;  4MLV A;  2RKM A;  3G3G A;  3U94 A;  3TCF A;  2NXO A;  1B40 A;  1A8F A;  3EQ1 A;  4QF9 A;  2G29 A;  3RUM A;  3TEL A;  3PPO A;  4F19 A;  1L5T A;  3K00 A;  5I2K B;  4XKR A;  1MQG A;  3PUX E;  1IIW A;  1SQY A;  4H8J A;  5H8N B;  4H5F A;  3HHG A;  1JW1 A;  4F2O A;  1N7X A;  2XXT A;  1MXU A;  4IY5 A;  3KOT A;  4X9T A;  2I0C A;  4KCD A;  2Y7I A;  3TMG A;  5AA2 A;  1I6A A;  2A5T B;  4OZ9 A;  5A5X B;  1MY3 A;  3PV0 E;  4HCY A;  3RN8 A;  4R72 A;  5I57 A;  4G8H A;  3CSG A;  3JZJ A;  4DXB A;  2VOZ A;  4FE8 A;  4ONY A;  4U21 A;  2Q9T A;  4TQU Q;  3N6T A;  1PB8 A;  1RKM A;  3FGS A;  3FIR A;  3CG1 A;  5J1D A;  3PUZ E;  4HTG A;  4NF8 B;  1H44 A;  5H8F A;  3EPE A;  3OO7 A;  1A54 A;  2B3F A;  3UOR A;  4F3S A;  4C1U A;  3H03 A;  4HCW A;  5CM6 A;  2O51 A;  3TFL A;  3QAX A;  3EF7 A;  1MG1 A;  1WDN A;  1PBP A;  1M5D A;  2DQV A;  3CFZ A;  4H5G A;  3OEM A;  1B52 A;  1UTB B;  2P0S A;  1Y3Q A;  4U23 A;  2NWJ A;  1Y3N A;  4WEP A;  4ELP A;  3S9M C;  4DCY A;  2XD2 A;  2Z8E A;  2F78 A;  1MPD A;  1LBC A;  2QPQ A;  3FVK A;  3C34 A;  1N76 A;  1PEB A;  1B3F A;  2NVU B;  3Q27 A;  1HSL A;  2UVJ A;  5DEX B;  4ELO A;  1UTH B;  4IO4 A;  3PPP A;  4DE8 A;  3K1M A;  2I48 A;  3SKP A;  4FAJ A;  3PUW E;  3BFU A;  1YTV A;  3FVN A;  1B3E A;  4R75 A;  3LBS A;  5I59 B;  1EU8 A;  1IZ1 A;  4H1X A;  2P2A A;  2O68 A;  5KCJ B;  4ND9 A;  3O97 A;  3K1P A;  2GHA A;  4LP2 B;  1JVY A;  2O84 X;  1FQA A;  5I2K A;  4F22 A;  3C33 A;  3LSL A;  2NUV A;  4LZ5 A;  3LSX A;  4QFO A;  2O6A A;  4IO6 A;  4JBZ A;  5CMM A;  1JEV A;  4F29 A;  3VLW A;  3B6Q A;  2QS1 A;  4YB7 A;  2Y7W A;  3OSQ A;  2E0S A;  3IR1 A;  2A5T A;  5A5X A;  4M1V A;  3C36 A;  1J1N A;  1MXY A;  1LAG E;  1ANF A;  2RCA A;  4IO2 A;  1OVT A;  3KBR A;  1XVY A;  2UVG A;  4GOT A;  3B6T A;  1POT A;  2WKY A;  4Z7E A;  1FTJ A;  5AA3 A;  2OLB A;  4KFQ A;  3T93 B;  3ODB A;  3RNN A;  3MBP A;  5H8Q B;  2D3I A;  3A3U A;  4NF8 A;  4E0W A;  4BDN A;  1R1N A;  4I1D A;  1JVX A;  1MY2 A;  4ZZA A;  2BJJ X;  1B3G A;  1IXI A;  3FVO A;  1FQB A;  1B4H A;  1GVC A;  3TKD A;  3CI8 A;  3T9U A;  1VE4 A;  4NF5 B;  3G7W A;  2D21 A; 
#chains in the Genus database with same CATH topology
 1UTB A;  3VXB A;  1R6Z A;  4ECF A;  1HSJ A;  3VE1 B;  4KD5 A;  3P7I A;  5DT6 A;  1LFI A;  3SEU A;  4PFW A;  4EQ9 A;  3KG2 A;  3SEX A;  1N0T A;  2QSX A;  4N6P A;  2QVU A;  3V5A A;  2F34 A;  3U65 A;  3K6W A;  1SPI A;  2FHY A;  3FUZ A;  2DSF A;  4YB5 A;  2XXR A;  2ZNT A;  4R2B A;  3PPQ A;  4G8M A;  3G3F A;  4C1T A;  2F7A A;  1LFG A;  2HZK A;  4PFB A;  1H45 A;  2L5V A;  5FHO A;  5DEX A;  1AL3 A;  5K2X A;  1UTH A;  2O69 A;  4BDL A;  3GBB A;  1DMB A;  4RPN A;  2RC9 A;  4TOZ A;  5KDT B;  4PQJ A;  1EZ9 A;  3GZG A;  4OWD A;  4PP0 A;  5F24 A;  1N3W A;  4JWX A;  5I59 A;  2B3B A;  2FA7 A;  2OBG A;  2Y7P A;  2ZNS A;  4N07 A;  4ZEC A;  5DYH A;  1H43 A;  3IK6 B;  4OAN A;  4MLQ A;  5KCJ A;  4ZEB A;  4IB2 A;  1AH5 A;  5LOM A;  4RPO A;  5JTY B;  1US5 A;  4PFT A;  4GF8 A;  2I0B A;  3TOD A;  4NGU A;  4P3L A;  1FQD A;  3T9X B;  2ESN A;  4U2R A;  5AA4 A;  2G93 A;  2HXR A;  1GGG A;  3EKI A;  4QFN A;  1LBZ A;  1IXH A;  1Q35 A;  4YU0 A;  3KN8 A;  3QUJ A;  5H8H B;  4HE2 A;  4P11 A;  5ET5 A;  5ESY A;  5ISU A;  1EZP A;  3I3V A;  5I56 A;  5DVF A;  1SYI A;  1RDZ A;  1O7T A;  4YKJ A;  5I5P A;  3K6X A;  2OWT A;  1MDP 1;  4GWY A;  4IO7 A;  3CSB A;  3JYR A;  2DE2 A;  3KN7 A;  1MQH A;  5CMC A;  1OQH A;  3IB1 A;  4WKM A;  2YJP A;  3MP6 A;  4OFL A;  4MFI A;  2JJK A;  2PT2 A;  4IGR A;  4OVJ A;  5CRY A;  1IUD A;  3UN6 A;  2XXH A;  1FPF A;  1VDW A;  2QFL A;  4X8R A;  1LB8 A;  1FPG A;  1NV5 A;  3KC0 A;  4LQ2 A;  5H8Q A;  3FD3 A;  3GXA A;  4GVO A;  3B50 A;  2Q89 A;  1MM7 A;  4ESX A;  4QSE A;  5TPA B;  3USD A;  2Y5L A;  2CZL A;  2F6P A;  3KEI A;  3PD9 A;  5FTI A;  1M5C A;  2QVV A;  2H9B A;  1BLF A;  3TTN A;  4F2Q A;  1A7L A;  2Y5K A;  4AB5 A;  4DCX A;  1B1X A;  1JQF A;  4EQB A;  4GWZ A;  4FAT A;  4NF5 A;  2XHD A;  3QSL A;  2ANJ A;  4EF2 A;  4WXJ A;  1PC3 A;  3K2D A;  5IGA A;  3KJ7 A;  3TCG A;  4I3E A;  4RK2 A;  4YKK A;  4NWC A;  3TTR A;  4PTK A;  2ZZW A;  2PFY A;  4G8N A;  2UYE A;  1NUY A;  5DW8 A;  1H76 A;  1N04 A;  4HXV A;  5B70 A;  4BDO A;  1ZTY A;  3QK6 A;  3A09 A;  1IMF A;  4NF6 B;  4F1U A;  3T1B A;  1SDX A;  2O7I A;  2ONS A;  4IY6 A;  3OO9 A;  2ONR A;  3N94 A;  3G3J A;  1Y3P A;  2PMS A;  3O29 A;  2F7C A;  1NKX A;  3O6H A;  3IX1 A;  1ELJ A;  2I4B A;  3CRB A;  2HXW A;  4LZ7 A;  3U92 A;  1JW5 A;  4NF0 A;  5EYF A;  3I5O A;  3PPR A;  3K4U A;  3MST A;  3THI A;  2AIX A;  4OEN A;  1B32 A;  1Y4C A;  4R6Y A;  4YKP A;  2A5S A;  4XKQ A;  1D9Y A;  2F7B A;  3KGC A;  4YKI A;  1QUJ A;  1MXX A;  4P1L A;  5EYH A;  1B7H A;  4ZZE A;  4GBV A;  4GWS A;  1D9V A;  2UVI A;  2F5X A;  4KYD A;  3LSW A;  1JET A;  5K2Y A;  4N6K A;  2IEE A;  3MW0 A;  1OLC A;  4N17 A;  5ELV A;  5J16 A;  1KZ8 A;  4ZDM A;  1QUL A;  1LB9 A;  1LEV A;  4XKP A;  4MBP A;  5T3J A;  3I6V A;  1OIB A;  1UQW A;  3OEK A;  4RA1 A;  2ALU A;  3S9E A;  1DPP A;  1ZU0 A;  4GX3 A;  4OVQ A;  1MH4 A;  3IJO B;  5F7V A;  4OES A;  3LC8 A;  1YCJ A;  4QSD A;  1B5I A;  4QSC A;  3V89 B;  2DDK A;  3IJX B;  2XX9 A;  5AA2 D;  4ELQ A;  3HCQ A;  1RYX A;  2RIN A;  4FEC A;  3PMV A;  1NL5 A;  2F36 A;  4O3B A;  3RTF B;  2XXK A;  3MUQ A;  1FPB A;  4FBP A;  4P9K A;  2DYX A;  1B46 A;  5TPA A;  3QYT A;  1FPI A;  3L6H A;  1PB7 A;  4FIM A;  3VVE A;  1SD3 A;  3O28 A;  4R9F A;  5FHM A;  1NV2 A;  4PBQ A;  3HO7 A;  1DSN A;  4RJZ A;  3O2A A;  1WVJ A;  1FTK A;  3H3G A;  3M3F A;  3OEN A;  4OHN A;  4ISU A;  3HFU A;  4MMP A;  2HZL A;  5A5L A;  4OER A;  4DI4 B;  4KYE A;  3FV2 A;  4NHB A;  1MM6 A;  1LAH E;  2XWO A;  2DE3 A;  1M5E A;  4GLI A;  5TU0 A;  2KQZ A;  2AL5 A;  1DPE A;  4NTL A;  2WX9 A;  1LBW A;  2WYK A;  3FXQ A;  2R71 A;  3S4U A;  3TTM A;  4OVS A;  1FQC A;  4LA9 A;  1CE2 A;  2OX3 A;  2QS2 A;  2ZXT A;  1MPB A;  4XIG Q;  1TFD A;  3MZ9 A;  5M2V A;  4JSD A;  4GIZ A;  4KQP A;  1SW1 A;  4NF6 A;  3TTK A;  3EN3 A;  1LBB A;  4JWY A;  3OXN A;  2OWZ A;  3MPL A;  2ZNU A;  5CC2 A;  4RNS A;  1IXC A;  5CBS A;  4KHZ E;  4PDD A;  3PUV E;  5BWJ A;  1YAE A;  1XI6 A;  2WBB A;  3H6T A;  4HW8 A;  3FBP A;  1CB6 A;  4AS5 A;  5BUU A;  1NUX A;  4NX1 A;  5HBC A;  3S2V A;  3H4Z A;  4EDP A;  3ILU B;  4F3B A;  2H25 A;  1WOD A;  2H4I A;  4PC9 A;  3MC2 A;  2OJT A;  3Q26 A;  1EH3 A;  3O6G A;  3ZSF A;  1FQF A;  2Q8M A;  2V84 A;  5H8N A;  1URG A;  1H3D A;  3SEY A;  1B0H A;  5HM4 B;  5CMB A;  3L6G A;  1QUK A;  2DP8 A;  3FXR A;  3MVY A;  1CNQ A;  2BJI A;  1NFT A;  3FAT A;  4JWO A;  3E9X A;  4XXU A;  2OK2 A;  2XWV A;  3TTL A;  3LR1 A;  3IFA A;  2DWI A;  3ZS6 A;  2THI A;  4NE4 A;  3O6I A;  5ITP A;  3O66 A;  1MY0 A;  4JDF A;  3H06 B;  3IOU A;  2F8D A;  1EYK A;  5B7D A;  4ZE8 A;  3FXU A;  3ZKK A;  5I84 A;  1ZBM A;  4OXV A;  2O1L A;  1PDA A;  1IXG A;  4JVD A;  2GFE A;  4YZZ A;  1D4N A;  3IOV A;  5I3S A;  4U1O A;  2I3V A;  2GH9 A;  1SI1 A;  1YPN A;  3Q25 A;  5I2N B;  2O1M A;  2PVU A;  2QMW A;  1LBV A;  4GL8 A;  3E79 A;  2DXY A;  3MJN A;  4DXU A;  4FJP A;  3UP9 A;  1LST A;  2I6E A;  1BIY A;  3N26 A;  1S9T A;  3T0J A;  3VXC A;  4OYV A;  4NG7 A;  4IGT A;  2CZK A;  2FIX A;  4PBH A;  4TLL B;  5CI5 A;  3MZ1 A;  4OTE A;  3W15 C;  5IZ3 B;  2PYY A;  4OVT A;  4PET A;  4QFK A;  3ILT B;  4QRZ A;  1R9L A;  1K9Z A;  4MNP A;  3VVF A;  1IIT A;  4POW A;  1B5H A;  2HCA A;  3VFJ A;  5IAI A;  5KZT A;  1TWY A;  3GYY A;  3N5L A;  3FZV A;  4X1B A;  2F6G A;  3K0V A;  3WAE A;  4PFY A;  5L9M A;  3RT6 B;  3KFM A;  4EXK A;  2Q2A A;  3IAZ A;  1OVB A;  2AYS A;  1B4Z A;  1Q9D A;  4KCC A;  1Y1M A;  1POY 1;  2R8T A;  1NH7 A;  2PBW A;  3MPK A;  3MZB A;  2FYI A;  3QIM A;  3IFC A;  1NNF A;  1FBH A;  3K6U A;  4GQO A;  3RPL B;  4H8I A;  4YMB A;  4TLM B;  2CMO A;  3T96 B;  2XXY A;  4H45 A;  3RY3 A;  2VGQ A;  4P56 A;  1VFE A;  1GTK A;  4MH5 A;  1SVX B;  4G68 B;  4P47 A;  5L9O A;  1MH3 A;  1VFD A;  4Q5T A;  2GQ1 A;  1B9J A;  1IMD A;  2X26 A;  2ZYN A;  1B7Z A;  1P1O A;  1N84 A;  5EYG A;  3TZA A;  3TYH A;  4GXS B;  3CFX A;  4NMY A;  4GFR A;  4KI0 E;  1P1U A;  1NNP A;  4QFP A;  4QXD A;  2P3V A;  2Z22 A;  4I62 A;  1IMC A;  3O9P A;  2FIE A;  1IQ7 A;  1I69 A;  2XXI A;  2V3U A;  3H7M A;  1JW4 A;  3S9L C;  4E0X A;  3M3K A;  1MXZ A;  3PMW A;  3CIJ A;  3BBR A;  3JV9 A;  3QUF A;  4ZEI A;  1NV6 A;  3QXM A;  3UIF A;  4GWU A;  3B6W A;  3V83 A;  2RF1 A;  2XD3 A;  3T22 A;  3EHT A;  1FPL A;  4NED A;  1JEU A;  3E4R A;  2QVR A;  1B05 A;  4QBA A;  2ZMB A;  1Y1Z A;  3IOT A;  4RK9 A;  1MRP A;  3D1R A;  2O7U A;  4P1E A;  3VLV A;  3LUY A;  4BDQ A;  2DWJ A;  3F11 A;  4I8C A;  3VVD A;  5I2N A;  1ZLQ A;  3HST A;  5I7I A;  3VLU A;  4PFU A;  5H8F B;  4GX4 A;  3OD7 A;  3FXB A;  5DTB A;  1OQG A;  3SDF A;  3FJ7 A;  5I58 B;  3UA8 A;  1BTJ A;  1Y4T A;  2Z8F A;  4X04 A;  1LCF A;  5CMK A;  2I4C A;  2XXX A;  4R6K A;  3RQT A;  4LVQ A;  2VHA A;  4MEV A;  1FBD A;  3KZG A;  1QKA A;  4PGP A;  1S50 A;  1LBY A;  1EZO A;  3K6V A;  1LLS A;  4ZEK A;  1LAF E;  4F18 A;  3KN3 A;  5IZ3 A;  4GWO A;  4LQ5 A;  3A3C A;  4H46 A;  2RCB A;  4OEV A;  3PU5 A;  4H65 A;  4JSO A;  3VDF A;  3CR9 A;  4DLD A;  1FRP A;  2KR0 A;  4IO5 A;  2Y7R A;  1A55 A;  4O8M A;  4L17 A;  5IZZ A;  5ITO A;  1FBC A;  2OWS A;  3TEP A;  1NV0 A;  4YB6 A;  4PF8 A;  1QJM A;  4H67 A;  4KYS A;  1SI0 A;  5DVJ A;  4H6D A;  4R73 A;  4MNC A;  4ELR A;  1FW0 A;  1FTL A;  4G68 C;  1IEJ A;  4I9D A;  3UGW A;  4N4U A;  1AWB A;  1B3H A;  2QRY A;  5KDT A;  4MHF A;  1MXW A;  1T0K A;  5IKB A;  3C32 A;  2Y84 A;  3OO8 A;  1YZ0 A;  2DWH A;  3RPL A;  5EQ8 A;  3RLF E;  3TCH A;  3IO6 A;  3MYU A;  3KSX A;  4G4P A;  4Q30 B;  2VP1 A;  1B51 A;  4PE5 B;  5LTC A;  5L9S A;  2P3N A;  2B65 A;  4NAP A;  3TUS A;  4G68 A;  4BLA A;  2DE4 A;  4RY1 A;  5JTY A;  3MVZ A;  1DOT A;  5CBR A;  1TT1 A;  1OMP A;  1F9B A;  3LSF B;  4X48 A;  2X7P A;  1ZJL A;  4O94 A;  3K02 A;  1G0I A;  1SBP A;  4GL0 A;  3R6U A;  1I6B A;  3U72 A;  1DTG A;  4XKN A;  2F35 A;  3G3H A;  3S9N C;  2HEU A;  1QW0 A;  3DM0 A;  2WYP A;  4N81 A;  5H8H A;  3ECR A;  3DP8 A;  3MP8 A;  2DWA A;  1B1H A;  5AA1 A;  1P1Q A;  3FJM A;  1JP4 A;  2GRV A;  4EQ7 A;  4DZ1 A;  1LGB C;  1A99 A;  4OMB A;  1SYH A;  3TPA A;  4EF1 A;  1LBX A;  4LUB A;  3UK4 A;  4F1Y A;  3IB2 A;  1YYZ A;  3M8U A;  1GR2 A;  3PTY A;  1B2H A;  3E3K A;  3R7X A;  1XT8 A;  2HAU A;  3MP1 A;  1IME A;  4Z0I A;  2M8C A;  1MS7 A;  1NH8 A;  4C0R A;  3C35 A;  1USY E;  3OOA A;  4R2F A;  3W9W A;  2D5W A;  3HPI A;  4IO3 A;  2ZYM A;  2F3B A;  2R9J A;  1ZIU A;  3PPN A;  4GD5 A;  3SEW A;  3G3I A;  4DIG A;  1B58 A;  2VD2 A;  2P1S A;  3SEV A;  4EXL A;  5I58 A;  4O3A A;  3EHS A;  1K9Y A;  4OA4 A;  4ZE9 A;  1MDQ A;  2Z23 A;  3T9V A;  2Q74 A;  3RTW B;  4NF4 B;  1A40 A;  2ZYK A;  5ICT A;  1HSE A;  3GBA A;  4U22 A;  1URD A;  4MIJ A;  1AIV A;  1O64 A;  2GHB A;  3Q29 A;  4NQ8 A;  5EHM A;  3PGF A;  1MY1 A;  3PUY E;  3Q28 A;  1FTM A;  1MXV A;  4OEU A;  2IA4 A;  2ZYO A;  3AXF A;  1GV8 A;  2Q88 A;  1D3K A;  3A29 A;  4N13 A;  2HHM A;  3IOR A;  5IM2 A;  2H99 A;  4OVR A;  1FBF A;  2E1S A;  4OFO A;  3OEL A;  1MQI A;  1QVS A;  1MQJ A;  1SW4 A;  3V8X B;  2OZZ A;  4GWW A;  2HFB A;  3DLN A;  3SES A;  3RGY A;  2XWK A;  5FTH A;  4PGN A;  2V3T A;  3FAS A;  4R74 A;  5F1Q A;  2CZH A;  1KWH A;  4POX A;  1FBG A;  3DEL B;  3T66 A;  5ET6 A;  5AE4 A;  1M5F A;  3FV1 A;  3FVG A;  1TFA A;  1IMA A;  1NMU A;  2YPN A;  2VPN A;  3PD8 A;  2QL3 A;  4OQO A;  1BP5 A;  2XXW A;  2FNC A;  3ZKL A;  3BFT A;  4N8Y A;  3SER A;  3MQ9 A;  3M3L A;  4KPT A;  4DDD A;  4AB6 A;  4G2Z A;  4JB7 A;  4AS4 A;  1MY4 A;  5L8D A;  1DTZ A;  2UVH A;  3H6V A;  1II5 A;  2B4L A;  2QJE A;  3MVX A;  5AA4 B;  1XOC A;  1USY H;  3CHG A;  3W9V A;  2RC7 A;  3DP4 A;  2DS9 A;  2ONK E;  3HV1 A;  1NUZ A;  1NNT A;  3TDJ A;  4O3C A;  2Y7K A;  5I56 B;  5ET7 A;  1LCT A;  5JK4 A;  2I49 A;  1O63 A;  3D4C A;  1B6H A;  1P99 A;  1ATG A;  1FPK A;  4PFI A;  4QHQ A;  1N7W A;  4F1V A;  4DI3 D;  4LAT A;  1AMF A;  4RXL A;  1QKB A;  1BK4 A;  2H5Y A;  2Q8J A;  3C31 A;  2R6G E;  4MF3 A;  2B4M A;  1Z7N E;  1S7Y A;  5EQ9 A;  2QMX A;  4LZ8 A;  1B7U A;  1YXI A;  1M5B A;  4PDH A;  1PBQ A;  5FBP A;  3MVW A;  1TXF A;  2KLF A;  1LAX A;  1P1N A;  3RT8 A;  1I6Q A;  4UA8 A;  4ZS9 A;  2H98 A;  1INP A;  1DK4 A;  3B8B A;  3KJT A;  4GRK A;  4NF4 A;  1NNK A;  1NI9 A;  5LDZ A;  4GWX A;  1XHY A;  2HAV A;  4BDM A;  3CFL A;  4THI A;  3KSJ A;  4OET A;  4N91 A;  4FED A;  2XX8 A;  2AL4 A;  3IB0 A;  3FJG A;  1DCU A;  4EUO A;  4YIC A;  3C4M A;  1AOV A;  2Q2C A;  4GXA A;  1SW2 A;  2QS3 A;  2NOO A;  2I3W A;  2DOJ A;  4P0G A;  4U1Z A;  5EQA A;  1US4 A;  2F3D A;  5TP9 B;  3QMF A;  3D4G A;  2I58 A;  3ROJ A;  1LFH A;  4F3P A;  3K01 A;  2UYF A;  4ZEF A;  4XTC Q;  4JXI A;  2OCU A;  4OFJ A;  4K3F A;  4XEQ A;  2DXR A;  1VR5 A;  3DP6 A;  4GX6 A;  3CG3 A;  4DXC A;  1QUI A;  1VSO A;  3HN0 A;  1FQE A;  3E13 X;  1UIV A;  4U4S A;  4X1D A;  1R9Q A;  3CVG A;  1P1W A;  4NN3 A;  3TQL A;  4Q0C A;  3VV5 A;  2X7Q A;  4ZED A;  2F97 A;  3ONM A;  1ZKB A;  1ZMG A;  1FPE A;  2HQ0 A;  3GLB A;  4M4G A;  2DVC A;  3OMB A;  3K1N A;  2XXV A;  5JEI A;  4BDR A;  2V3Q A;  3G3K A;  5AA2 B;  1RDX A;  4HS7 A;  5EHS A;  3PMX A;  1NV3 A;  2REJ A;  3MWB A;  2XX7 A;  1D9Q A;  1PB9 A;  3KBZ A;  2CEX A;  5I57 B;  4G61 A;  4PE3 A;  3BKI B;  4R6H A;  2ABH A;  3U93 A;  4O7M A;  3OSR A;  2PFZ A;  1FCK A;  1RYO A;  3KOS A;  1FTO A;  1XS5 A;  4U4X A;  4KR5 A;  4LON B;  2V25 A;  5H8S A;  4UAC A;  4H0W A;  4FOR A;  4RYA A;  4NWD A;  2XXQ A;  3IOW A;  5ICQ A;  1Z7M E;  4YAH X;  2PX1 A;  1QGX A;  1A8E A;  2QS4 A;  1FSA A;  1SW5 A;  2DVZ A;  1URS A;  5FHN A;  1JNF A;  4ESW A;  2V4C A;  2RC8 A;  2LAO A;  3U1O A;  2REG A;  1RDY A;  1MPC A;  4WED A;  4QFL A;  2HPG A;  3B7D A;  1G0H A;  4N8G A;  4YMA A;  2VT5 A;  4JVI A;  2UXA A;  2XXP A;  3MAM A;  1B5J A;  3WAF A;  2V93 A;  3ISP A;  5DVI A;  1B0L A;  3U8Q A;  3TAJ A;  3HHF A;  4PAF A;  3TQW A;  3R26 A;  3T9H B;  2XXU A;  1NV4 A;  4MJO A;  2W7Y A;  5HPQ A;  2PT1 A;  1XVX A;  3IO4 A;  3N6U A;  1B3L A;  1FJ9 A;  3RPW A;  1OLA A;  2VD3 A;  3EHU A;  3SZP A;  1MQD A;  1N3X A;  3SET A;  4F39 A;  4F3G A;  2YLN A;  4G77 A;  5TP9 A;  4PF6 A;  4Q8R A;  3H6U A;  4AQ4 A;  1XC1 A;  3IL1 B;  4P0I A;  1Y9U A;  2Z8D A;  1Y20 A;  4FEB A;  4MCO A;  3H6W A;  3OO6 A;  3C9H A;  4F31 B;  4PAI A;  1UIU A;  4R9G A;  1BKA A;  1Q1K A;  4MLV A;  2RKM A;  3G3G A;  3U94 A;  3TCF A;  2NXO A;  1B40 A;  1A8F A;  3EQ1 A;  3LUZ A;  4QF9 A;  2G29 A;  3RUM A;  3TEL A;  4HE0 A;  3PPO A;  4F19 A;  3NOH A;  1L5T A;  3K00 A;  5I2K B;  4XKR A;  1MQG A;  3PUX E;  1IIW A;  1SQY A;  4H8J A;  5H8N B;  4MX6 A;  4H5F A;  4O7I A;  3HHG A;  1JW1 A;  4F2O A;  1N7X A;  2XXT A;  1MXU A;  4IY5 A;  3KOT A;  4X9T A;  4GBW A;  2I0C A;  4KCD A;  2Y7I A;  3TMG A;  5AA2 A;  2ZZX A;  1I6A A;  4IR8 A;  2ZZV A;  2A5T B;  4OZ9 A;  5A5X B;  1MY3 A;  3PV0 E;  5IZ1 A;  2XA5 A;  4HCY A;  3RN8 A;  4R72 A;  4PAK A;  5I57 A;  4G8H A;  3CSG A;  3JZJ A;  1FBP A;  4DXB A;  2VOZ A;  5EQ7 A;  4FE8 A;  4ONY A;  4U21 A;  2Q9T A;  4TQU Q;  3N6T A;  1PB8 A;  2WBD A;  1RKM A;  3FGS A;  3FIR A;  3CG1 A;  5J1D A;  1EYJ A;  3PUZ E;  4HTG A;  4NF8 B;  1H44 A;  5H8F A;  4OVP A;  3EPE A;  3OO7 A;  1A54 A;  2B3F A;  3UOR A;  4F3S A;  1EYI A;  4N6D A;  4C1U A;  3H03 A;  4HCW A;  2FVZ A;  5CM6 A;  1IMB A;  2O51 A;  3TFL A;  4JVC A;  4XF5 A;  3QAX A;  1KA1 A;  3EF7 A;  1MG1 A;  1WDN A;  3BIH A;  2CEY A;  1PBP A;  1M5D A;  2DQV A;  3CFZ A;  4H5G A;  3OEM A;  1B52 A;  1UTB B;  2P0S A;  1Y3Q A;  4U23 A;  4UAB A;  2FBP A;  2NWJ A;  1FPJ A;  1Y3N A;  4WEP A;  4ELP A;  3S9M C;  3RYD A;  2MKZ A;  4DCY A;  2XD2 A;  2Z8E A;  2F78 A;  1MPD A;  3LV0 A;  1LBC A;  2QPQ A;  3FVK A;  3C34 A;  1N76 A;  1PEB A;  1B3F A;  2NVU B;  1FTA A;  3Q27 A;  1HSL A;  2UVJ A;  5DEX B;  4ELO A;  1UTH B;  4IO4 A;  3PPP A;  4DE8 A;  3K1M A;  2I48 A;  3SKP A;  2PCR A;  4FAJ A;  3PUW E;  3BFU A;  1YTV A;  3FVN A;  1B3E A;  4R75 A;  3LBS A;  1NV7 A;  5I59 B;  1EU8 A;  1IZ1 A;  1NV1 A;  4H1X A;  4I40 A;  2P2A A;  2O68 A;  5KCJ B;  4ND9 A;  3O97 A;  4MNI A;  3K1P A;  2GHA A;  4LP2 B;  1JVY A;  2O84 X;  1FQA A;  5I2K A;  4F22 A;  3C33 A;  3LSL A;  2NUV A;  4LZ5 A;  1DBZ A;  3LSX A;  1FPD A;  4QFO A;  2WEF A;  1NUW A;  2O6A A;  4IO6 A;  4JBZ A;  5CMM A;  1JEV A;  4F29 A;  3VLW A;  3B6Q A;  3KC1 A;  2QS1 A;  4YB7 A;  2VPO A;  2Y7W A;  3OSQ A;  2E0S A;  3IR1 A;  2A5T A;  4PCD A;  5A5X A;  4M1V A;  3C36 A;  1J1N A;  2XWI A;  3BIG A;  1MXY A;  1FBE A;  1LAG E;  1ANF A;  2RCA A;  4IO2 A;  1OVT A;  3KBR A;  5ET8 A;  1FJ6 A;  1XVY A;  4KXP A;  4XFE A;  2UVG A;  4GOT A;  3B6T A;  1POT A;  2WKY A;  4Z7E A;  1FTJ A;  5AA3 A;  2OLB A;  4KFQ A;  4MAG A;  3T93 B;  3ODB A;  3RNN A;  3MBP A;  4PFR A;  5H8Q B;  2D3I A;  1KA0 A;  3A3U A;  4LN5 A;  4N15 A;  4NF8 A;  4E0W A;  4BDN A;  1R1N A;  4I3Y A;  4I1D A;  1JVX A;  1MY2 A;  4ZZA A;  4P8B A;  3E78 A;  2BJJ X;  1B3G A;  1IXI A;  2CZI A;  4HE1 A;  3FVO A;  1FQB A;  1B4H A;  1GVC A;  3TKD A;  3CI8 A;  3T9U A;  1VE4 A;  4NF5 B;  3G7W A;  2D21 A; 
#chains in the Genus database with same CATH homology
 1UTB A;  3VXB A;  1R6Z A;  4ECF A;  1HSJ A;  3VE1 B;  4KD5 A;  3P7I A;  5DT6 A;  1LFI A;  3SEU A;  4PFW A;  4EQ9 A;  3KG2 A;  3SEX A;  1N0T A;  2QSX A;  4N6P A;  3V5A A;  2F34 A;  3K6W A;  3FUZ A;  2DSF A;  4YB5 A;  2XXR A;  2ZNT A;  4R2B A;  3PPQ A;  4G8M A;  3G3F A;  4C1T A;  2F7A A;  1LFG A;  2HZK A;  1H45 A;  5FHO A;  5DEX A;  1AL3 A;  5K2X A;  1UTH A;  2O69 A;  4BDL A;  3GBB A;  1DMB A;  4RPN A;  2RC9 A;  4TOZ A;  5KDT B;  4PQJ A;  1EZ9 A;  3GZG A;  4OWD A;  4PP0 A;  1N3W A;  4JWX A;  5I59 A;  2B3B A;  2FA7 A;  2OBG A;  2Y7P A;  2ZNS A;  4N07 A;  4ZEC A;  5DYH A;  1H43 A;  3IK6 B;  4MLQ A;  5KCJ A;  4ZEB A;  4IB2 A;  1AH5 A;  5LOM A;  4RPO A;  5JTY B;  1US5 A;  4PFT A;  4GF8 A;  2I0B A;  3TOD A;  1FQD A;  3T9X B;  2ESN A;  4U2R A;  5AA4 A;  2G93 A;  1GGG A;  4QFN A;  1IXH A;  1Q35 A;  4YU0 A;  3KN8 A;  3QUJ A;  5H8H B;  4P11 A;  5ISU A;  1EZP A;  3I3V A;  5I56 A;  5DVF A;  1SYI A;  1O7T A;  4YKJ A;  3K6X A;  2OWT A;  1MDP 1;  4IO7 A;  3CSB A;  3JYR A;  2DE2 A;  3KN7 A;  1MQH A;  5CMC A;  1OQH A;  3IB1 A;  4WKM A;  2YJP A;  3MP6 A;  4OFL A;  4MFI A;  2PT2 A;  4IGR A;  4OVJ A;  5CRY A;  1IUD A;  3UN6 A;  2XXH A;  1LB8 A;  4LQ2 A;  5H8Q A;  3FD3 A;  3GXA A;  4GVO A;  2Q89 A;  1MM7 A;  4ESX A;  4QSE A;  5TPA B;  3USD A;  2CZL A;  2F6P A;  3KEI A;  3PD9 A;  5FTI A;  1M5C A;  2H9B A;  1BLF A;  3TTN A;  4F2Q A;  1A7L A;  4AB5 A;  4DCX A;  1B1X A;  1JQF A;  4EQB A;  4FAT A;  4NF5 A;  2XHD A;  3QSL A;  2ANJ A;  4EF2 A;  4WXJ A;  1PC3 A;  3K2D A;  3KJ7 A;  3TCG A;  4RK2 A;  4YKK A;  4NWC A;  3TTR A;  4G8N A;  2UYE A;  1H76 A;  1N04 A;  5B70 A;  4BDO A;  1ZTY A;  3QK6 A;  3A09 A;  4NF6 B;  4F1U A;  1SDX A;  2O7I A;  2ONS A;  4IY6 A;  3OO9 A;  2ONR A;  3N94 A;  3G3J A;  1Y3P A;  2PMS A;  3O29 A;  2F7C A;  1NKX A;  3O6H A;  3IX1 A;  1ELJ A;  2I4B A;  3CRB A;  2HXW A;  4LZ7 A;  3U92 A;  1JW5 A;  5EYF A;  3I5O A;  3PPR A;  3K4U A;  3THI A;  2AIX A;  4OEN A;  1B32 A;  1Y4C A;  4R6Y A;  4YKP A;  2A5S A;  4XKQ A;  1D9Y A;  2F7B A;  3KGC A;  4YKI A;  1QUJ A;  1MXX A;  1B7H A;  4ZZE A;  1D9V A;  2UVI A;  2F5X A;  4KYD A;  3LSW A;  1JET A;  5K2Y A;  2IEE A;  3MW0 A;  1OLC A;  5ELV A;  4ZDM A;  1QUL A;  1LB9 A;  4XKP A;  4MBP A;  3I6V A;  1OIB A;  1UQW A;  3OEK A;  4RA1 A;  2ALU A;  3S9E A;  1DPP A;  1ZU0 A;  1MH4 A;  3IJO B;  5F7V A;  4OES A;  3LC8 A;  1YCJ A;  4QSD A;  1B5I A;  4QSC A;  3V89 B;  3IJX B;  2XX9 A;  5AA2 D;  4ELQ A;  3HCQ A;  1RYX A;  2RIN A;  4FEC A;  3PMV A;  1NL5 A;  2F36 A;  4O3B A;  3RTF B;  3MUQ A;  2DYX A;  1B46 A;  5TPA A;  3QYT A;  3L6H A;  1PB7 A;  4FIM A;  3VVE A;  1SD3 A;  3O28 A;  4R9F A;  5FHM A;  3HO7 A;  1DSN A;  4RJZ A;  3O2A A;  1WVJ A;  1FTK A;  3H3G A;  3M3F A;  3OEN A;  4OHN A;  4ISU A;  2HZL A;  4OER A;  4KYE A;  3FV2 A;  1MM6 A;  1LAH E;  2DE3 A;  1M5E A;  4GLI A;  5TU0 A;  2AL5 A;  1DPE A;  4NTL A;  3FXQ A;  2R71 A;  3S4U A;  3TTM A;  1FQC A;  4LA9 A;  1CE2 A;  2QS2 A;  2ZXT A;  1MPB A;  4XIG Q;  1TFD A;  3MZ9 A;  5M2V A;  4JSD A;  4GIZ A;  4KQP A;  1SW1 A;  4NF6 A;  3TTK A;  3EN3 A;  1LBB A;  4JWY A;  3OXN A;  3MPL A;  2ZNU A;  5CC2 A;  4RNS A;  1IXC A;  5CBS A;  4KHZ E;  3PUV E;  5BWJ A;  1YAE A;  3H6T A;  4HW8 A;  1CB6 A;  5BUU A;  5HBC A;  3S2V A;  3H4Z A;  4EDP A;  3ILU B;  4F3B A;  2H25 A;  1WOD A;  2H4I A;  3MC2 A;  2OJT A;  3Q26 A;  1EH3 A;  3O6G A;  3ZSF A;  1FQF A;  2V84 A;  5H8N A;  1URG A;  1H3D A;  3SEY A;  1B0H A;  5HM4 B;  5CMB A;  3L6G A;  1QUK A;  2DP8 A;  3FXR A;  3MVY A;  1NFT A;  3FAT A;  4JWO A;  3E9X A;  4XXU A;  2OK2 A;  3TTL A;  3LR1 A;  2DWI A;  3ZS6 A;  2THI A;  4NE4 A;  3O6I A;  5ITP A;  3O66 A;  1MY0 A;  4JDF A;  3H06 B;  3IOU A;  2F8D A;  5B7D A;  4ZE8 A;  3FXU A;  3ZKK A;  5I84 A;  1ZBM A;  4OXV A;  2O1L A;  1PDA A;  1IXG A;  2GFE A;  4YZZ A;  1D4N A;  3IOV A;  4U1O A;  2I3V A;  2GH9 A;  1SI1 A;  1YPN A;  3Q25 A;  5I2N B;  2O1M A;  2PVU A;  2QMW A;  4GL8 A;  2DXY A;  3MJN A;  4DXU A;  4FJP A;  3UP9 A;  1LST A;  2I6E A;  1BIY A;  3N26 A;  1S9T A;  3VXC A;  4OYV A;  4IGT A;  4TLL B;  5CI5 A;  3MZ1 A;  4OTE A;  3W15 C;  2PYY A;  4PET A;  4QFK A;  3ILT B;  1R9L A;  4QRZ A;  3VVF A;  1IIT A;  4POW A;  1B5H A;  2HCA A;  3VFJ A;  5IAI A;  5KZT A;  1TWY A;  3N5L A;  3FZV A;  4X1B A;  2F6G A;  3K0V A;  3WAE A;  4PFY A;  5L9M A;  3RT6 B;  3KFM A;  4EXK A;  2Q2A A;  3IAZ A;  1OVB A;  2AYS A;  1B4Z A;  4KCC A;  1Y1M A;  1POY 1;  1NH7 A;  2PBW A;  3MPK A;  3MZB A;  2FYI A;  3QIM A;  1NNF A;  3K6U A;  4GQO A;  4H8I A;  4YMB A;  4TLM B;  2CMO A;  3T96 B;  2XXY A;  3RY3 A;  2VGQ A;  1VFE A;  1GTK A;  4MH5 A;  1SVX B;  4G68 B;  5L9O A;  1MH3 A;  1VFD A;  4Q5T A;  1B9J A;  2X26 A;  2ZYN A;  1B7Z A;  1P1O A;  1N84 A;  3TZA A;  3TYH A;  4GXS B;  3CFX A;  4NMY A;  4GFR A;  4KI0 E;  1P1U A;  1NNP A;  4QFP A;  2Z22 A;  4I62 A;  3O9P A;  1IQ7 A;  1I69 A;  2XXI A;  2V3U A;  3H7M A;  1JW4 A;  3S9L C;  4E0X A;  3M3K A;  1MXZ A;  3PMW A;  3CIJ A;  3BBR A;  3JV9 A;  3QUF A;  4ZEI A;  3QXM A;  3UIF A;  3B6W A;  3V83 A;  2RF1 A;  2XD3 A;  3T22 A;  3EHT A;  4NED A;  1JEU A;  3E4R A;  1B05 A;  2ZMB A;  1Y1Z A;  3IOT A;  4RK9 A;  1MRP A;  2O7U A;  3VLV A;  3LUY A;  4BDQ A;  2DWJ A;  3F11 A;  4I8C A;  3VVD A;  5I2N A;  1ZLQ A;  3HST A;  3VLU A;  4PFU A;  5H8F B;  3OD7 A;  5DTB A;  1OQG A;  3SDF A;  3FJ7 A;  5I58 B;  3UA8 A;  1BTJ A;  1Y4T A;  2Z8F A;  1LCF A;  5CMK A;  2I4C A;  2XXX A;  4R6K A;  3RQT A;  4LVQ A;  2VHA A;  3KZG A;  1QKA A;  1S50 A;  1EZO A;  3K6V A;  1LLS A;  4ZEK A;  1LAF E;  4F18 A;  3KN3 A;  4GWO A;  4LQ5 A;  3A3C A;  2RCB A;  4OEV A;  3PU5 A;  4H65 A;  4JSO A;  3VDF A;  3CR9 A;  4DLD A;  4IO5 A;  2Y7R A;  1A55 A;  4L17 A;  5ITO A;  2OWS A;  3TEP A;  4YB6 A;  1QJM A;  4H67 A;  4KYS A;  1SI0 A;  5DVJ A;  4H6D A;  4R73 A;  4ELR A;  1FW0 A;  1FTL A;  4G68 C;  1IEJ A;  4I9D A;  3UGW A;  1B3H A;  2QRY A;  5KDT A;  1MXW A;  1T0K A;  5IKB A;  3C32 A;  2Y84 A;  3OO8 A;  2DWH A;  3RLF E;  3TCH A;  3IO6 A;  3KSX A;  4G4P A;  4Q30 B;  2VP1 A;  1B51 A;  4PE5 B;  5L9S A;  2B65 A;  3TUS A;  4G68 A;  4BLA A;  2DE4 A;  4RY1 A;  5JTY A;  3MVZ A;  1DOT A;  5CBR A;  1TT1 A;  1OMP A;  1F9B A;  3LSF B;  4X48 A;  2X7P A;  1ZJL A;  3K02 A;  1SBP A;  4GL0 A;  3R6U A;  1I6B A;  3U72 A;  1DTG A;  4XKN A;  2F35 A;  3G3H A;  3S9N C;  2HEU A;  1QW0 A;  3DM0 A;  5H8H A;  3ECR A;  3DP8 A;  3MP8 A;  2DWA A;  1B1H A;  5AA1 A;  1P1Q A;  3FJM A;  2GRV A;  4EQ7 A;  4DZ1 A;  1LGB C;  1A99 A;  4OMB A;  1SYH A;  3TPA A;  4EF1 A;  4LUB A;  3UK4 A;  4F1Y A;  3IB2 A;  3M8U A;  1GR2 A;  1B2H A;  3E3K A;  3R7X A;  1XT8 A;  2HAU A;  3MP1 A;  4Z0I A;  2M8C A;  1MS7 A;  1NH8 A;  4C0R A;  3C35 A;  1USY E;  3OOA A;  4R2F A;  3W9W A;  2D5W A;  3HPI A;  4IO3 A;  2ZYM A;  2R9J A;  1ZIU A;  3PPN A;  4GD5 A;  3SEW A;  3G3I A;  4DIG A;  1B58 A;  2VD2 A;  2P1S A;  3SEV A;  4EXL A;  5I58 A;  4O3A A;  3EHS A;  4ZE9 A;  1MDQ A;  2Z23 A;  3T9V A;  3RTW B;  4NF4 B;  1A40 A;  2ZYK A;  5ICT A;  1HSE A;  3GBA A;  4U22 A;  1URD A;  1AIV A;  1O64 A;  2GHB A;  3Q29 A;  5EHM A;  3PGF A;  1MY1 A;  3PUY E;  3Q28 A;  1FTM A;  1MXV A;  4OEU A;  2IA4 A;  2ZYO A;  3AXF A;  1GV8 A;  2Q88 A;  1D3K A;  4N13 A;  3IOR A;  2H99 A;  2E1S A;  4OFO A;  3OEL A;  1MQI A;  1QVS A;  1MQJ A;  1SW4 A;  3V8X B;  2OZZ A;  2HFB A;  3DLN A;  3SES A;  3RGY A;  5FTH A;  2V3T A;  3FAS A;  4R74 A;  5F1Q A;  1KWH A;  4POX A;  3DEL B;  3T66 A;  5AE4 A;  1M5F A;  3FV1 A;  3FVG A;  1TFA A;  1NMU A;  2YPN A;  3PD8 A;  2QL3 A;  4OQO A;  1BP5 A;  2XXW A;  2FNC A;  3ZKL A;  3BFT A;  3SER A;  3MQ9 A;  3M3L A;  4KPT A;  4DDD A;  4AB6 A;  4G2Z A;  4JB7 A;  1MY4 A;  5L8D A;  1DTZ A;  2UVH A;  3H6V A;  1II5 A;  2QJE A;  5AA4 B;  3MVX A;  1XOC A;  1USY H;  3W9V A;  2RC7 A;  3DP4 A;  2DS9 A;  2ONK E;  3HV1 A;  1NNT A;  3TDJ A;  4O3C A;  2Y7K A;  5I56 B;  1LCT A;  5JK4 A;  2I49 A;  1O63 A;  3D4C A;  1B6H A;  1P99 A;  1ATG A;  4QHQ A;  1N7W A;  4F1V A;  4LAT A;  1AMF A;  4RXL A;  1QKB A;  2H5Y A;  2Q8J A;  3C31 A;  2R6G E;  4MF3 A;  1Z7N E;  1S7Y A;  2QMX A;  4LZ8 A;  1B7U A;  1M5B A;  1PBQ A;  3MVW A;  1TXF A;  2KLF A;  1LAX A;  1P1N A;  3RT8 A;  1I6Q A;  4UA8 A;  4ZS9 A;  2H98 A;  3KJT A;  4GRK A;  4NF4 A;  1NNK A;  1XHY A;  2HAV A;  4BDM A;  3CFL A;  4THI A;  3KSJ A;  4OET A;  4FED A;  2XX8 A;  2AL4 A;  3IB0 A;  3FJG A;  4EUO A;  4YIC A;  3C4M A;  1AOV A;  2Q2C A;  4GXA A;  1SW2 A;  2QS3 A;  2NOO A;  2I3W A;  2DOJ A;  4P0G A;  4U1Z A;  1US4 A;  5TP9 B;  3D4G A;  2I58 A;  1LFH A;  4F3P A;  3K01 A;  2UYF A;  4ZEF A;  4XTC Q;  4JXI A;  2OCU A;  4OFJ A;  4K3F A;  2DXR A;  1VR5 A;  3DP6 A;  4DXC A;  3CG3 A;  1QUI A;  1VSO A;  3HN0 A;  1FQE A;  3E13 X;  1UIV A;  4U4S A;  4X1D A;  1R9Q A;  3CVG A;  1P1W A;  3TQL A;  4Q0C A;  3VV5 A;  2X7Q A;  4ZED A;  2F97 A;  3ONM A;  1ZKB A;  1ZMG A;  2HQ0 A;  3GLB A;  4M4G A;  2DVC A;  3OMB A;  3K1N A;  2XXV A;  5JEI A;  4BDR A;  2V3Q A;  3G3K A;  5AA2 B;  4HS7 A;  5EHS A;  3PMX A;  2REJ A;  3MWB A;  2XX7 A;  1PB9 A;  5I57 B;  3BKI B;  4R6H A;  2ABH A;  3U93 A;  3OSR A;  1FCK A;  1RYO A;  3KOS A;  1FTO A;  1XS5 A;  4U4X A;  4KR5 A;  4LON B;  2V25 A;  5H8S A;  4UAC A;  4H0W A;  4FOR A;  4RYA A;  4NWD A;  2XXQ A;  3IOW A;  5ICQ A;  1Z7M E;  4YAH X;  2PX1 A;  1A8E A;  2QS4 A;  1SW5 A;  2DVZ A;  1URS A;  5FHN A;  1JNF A;  4ESW A;  2RC8 A;  2LAO A;  3U1O A;  2REG A;  1MPC A;  4WED A;  4QFL A;  3B7D A;  4YMA A;  2UXA A;  2XXP A;  3MAM A;  1B5J A;  3WAF A;  2V93 A;  5DVI A;  1B0L A;  3U8Q A;  3TAJ A;  3HHF A;  3TQW A;  3R26 A;  3T9H B;  2XXU A;  2W7Y A;  5HPQ A;  2PT1 A;  1XVX A;  3IO4 A;  3N6U A;  1B3L A;  3RPW A;  1OLA A;  2VD3 A;  3EHU A;  1MQD A;  1N3X A;  3SET A;  4F39 A;  4F3G A;  2YLN A;  4G77 A;  5TP9 A;  4Q8R A;  3H6U A;  4AQ4 A;  1XC1 A;  3IL1 B;  4P0I A;  1Y9U A;  2Z8D A;  1Y20 A;  4FEB A;  3H6W A;  3OO6 A;  3C9H A;  4F31 B;  1UIU A;  4R9G A;  1BKA A;  1Q1K A;  4MLV A;  2RKM A;  3G3G A;  3U94 A;  3TCF A;  2NXO A;  1B40 A;  1A8F A;  3EQ1 A;  4QF9 A;  2G29 A;  3RUM A;  3TEL A;  3PPO A;  4F19 A;  1L5T A;  3K00 A;  5I2K B;  4XKR A;  1MQG A;  3PUX E;  1IIW A;  1SQY A;  4H8J A;  5H8N B;  4H5F A;  3HHG A;  1JW1 A;  4F2O A;  1N7X A;  2XXT A;  1MXU A;  4IY5 A;  3KOT A;  4X9T A;  2I0C A;  4KCD A;  2Y7I A;  3TMG A;  5AA2 A;  1I6A A;  2A5T B;  4OZ9 A;  5A5X B;  1MY3 A;  3PV0 E;  4HCY A;  3RN8 A;  4R72 A;  5I57 A;  4G8H A;  3CSG A;  3JZJ A;  4DXB A;  2VOZ A;  4FE8 A;  4ONY A;  4U21 A;  2Q9T A;  4TQU Q;  3N6T A;  1PB8 A;  1RKM A;  3FGS A;  3FIR A;  3CG1 A;  5J1D A;  3PUZ E;  4HTG A;  4NF8 B;  1H44 A;  5H8F A;  3EPE A;  3OO7 A;  1A54 A;  2B3F A;  3UOR A;  4F3S A;  4C1U A;  3H03 A;  4HCW A;  5CM6 A;  2O51 A;  3TFL A;  3QAX A;  3EF7 A;  1MG1 A;  1WDN A;  1PBP A;  1M5D A;  2DQV A;  3CFZ A;  4H5G A;  3OEM A;  1B52 A;  1UTB B;  2P0S A;  1Y3Q A;  4U23 A;  2NWJ A;  1Y3N A;  4WEP A;  4ELP A;  3S9M C;  4DCY A;  2XD2 A;  2Z8E A;  2F78 A;  1MPD A;  1LBC A;  2QPQ A;  3FVK A;  3C34 A;  1N76 A;  1PEB A;  1B3F A;  2NVU B;  3Q27 A;  1HSL A;  2UVJ A;  5DEX B;  4ELO A;  1UTH B;  4IO4 A;  3PPP A;  4DE8 A;  3K1M A;  2I48 A;  3SKP A;  4FAJ A;  3PUW E;  3BFU A;  1YTV A;  3FVN A;  1B3E A;  4R75 A;  3LBS A;  5I59 B;  1EU8 A;  1IZ1 A;  4H1X A;  2P2A A;  2O68 A;  5KCJ B;  4ND9 A;  3O97 A;  3K1P A;  2GHA A;  4LP2 B;  1JVY A;  2O84 X;  1FQA A;  5I2K A;  4F22 A;  3C33 A;  3LSL A;  2NUV A;  4LZ5 A;  3LSX A;  4QFO A;  2O6A A;  4IO6 A;  4JBZ A;  5CMM A;  1JEV A;  4F29 A;  3VLW A;  3B6Q A;  2QS1 A;  4YB7 A;  2Y7W A;  3OSQ A;  2E0S A;  3IR1 A;  2A5T A;  5A5X A;  4M1V A;  3C36 A;  1J1N A;  1MXY A;  1LAG E;  1ANF A;  2RCA A;  4IO2 A;  1OVT A;  3KBR A;  1XVY A;  2UVG A;  4GOT A;  3B6T A;  1POT A;  2WKY A;  4Z7E A;  1FTJ A;  5AA3 A;  2OLB A;  4KFQ A;  3T93 B;  3ODB A;  3RNN A;  3MBP A;  5H8Q B;  2D3I A;  3A3U A;  4NF8 A;  4E0W A;  4BDN A;  1R1N A;  4I1D A;  1JVX A;  1MY2 A;  4ZZA A;  2BJJ X;  1B3G A;  1IXI A;  3FVO A;  1FQB A;  1B4H A;  1GVC A;  3TKD A;  3CI8 A;  3T9U A;  1VE4 A;  4NF5 B;  3G7W A;  2D21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...