4I1DA

The crystal structure of an abc transporter substrate-binding protein from bradyrhizobium japonicum usda 110
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
322
structure length
322
Chain Sequence
NAQITFVSQGGAYQAAQTVAILDPSAKKLGITINQDSIPDAWPAIKTQVGSGKPIWDVVDTPTGYCLRGGEQGLIEKLDFSKIPNAAAMPEAYRSPYSVSYEFYSSVLAYSQKTFPKDAPNSWVDFWDVKKFPGRRALRNHPIATLEAALMADGVAPDKLYPLDVDRAFKKLEEIKPHITVWWTSGAQSAQLLNDGEVDMEMAWNGRVSAVAKEGAKVSFTYNQGILQSTSLCILKGAPNLETAVKFLNEAVDPVHQANLPLHIDYGPGNPKAFETNVIKPERAAQLPSEPANAAKQALMSYAWWSSPAGEAAEKRWASFMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter substrate-binding protein
publication title Structural and functional characterization of solute binding proteins for aromatic compounds derived from lignin: p-Coumaric acid and related aromatic acids.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 114
structure length 322
sequence length 322
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4i1dA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4i1dA01
4EUOA 3IOTA 1OVTA 3PGFA 1B46A 4OVJA 1BKAA 2OZZA 1MPDA 4FE8A 1DSNA 2I3VA 3PPNA 3Q25A 3OO9A 3OXNA 3ILTB 4F1VA 2DOJA 3JYRA 4RJZA 3ZSFA 2Y7PA 1AOVA 4H1XA 1N7XA 1LFHA 1VSOA 2ONKE 1MXVA 3IL1B 1FQEA 3MVYA 1LSTA 3TDJA 1EZ9A 4NF4B 2OK2A 1DTZA 5AA2A 1I69A 2A5TB 2F8DA 5TP9A 3TQLA 3K00A 4BDQA 3G3KA 3LSLA 4KYDA 2F6GA 4ELRA 4H6DA 1B9JA 1ELJA 1MDQA 3C34A 1Z7NE 1SW4A 2XXQA 1FTLA 2DVCA 4IY6A 1FQAA 3QAXA 3PD8A 4EXKA 2XXYA 5ICQA 1J1NA 5I58B 2I4CA 4DCXA 3DLNA 3TTRA 1JETA 4QFPA 3PUZE 4LQ5A 1Y3NA 5J1DA 5CMMA 5I59A 4X1DA 2HEUA 4DDDA 2R71A 4Q8RA 3W15C 4PFYA 1JVYA 4XKNA 4U4SA 1O7TA 2PYYA 2ZNTA 2HQ0A 1MXXA 2DP8A 4NTLA 5K2YA 1MY3A 4U1OA 4N6PA 2I4BA 1MY2A 2I58A 2F97A 1B4ZA 3FV2A 1QW0A 5H8HA 1PEBA 2H99A 5A5XB 1O63A 3H03A 3G7WA 1H44A 4DXUA 2H98A 3H6UA 3I6VA 3JV9A 4HS7A 3TCHA 1OVBA 4O3AA 1MXYA 2Z23A 4LUBA 5AA4B 2GH9A 3IOVA 2XXVA 5B70A 4R6HA 3S4UA 3PPRA 4H5FA 4F3PA 4YU0A 3T9UA 4ESWA 2F7AA 2NXOA 1I6AA 2O6AA 3FGSA 3KJ7A 4OFJA 2DWAA 3RPWA 4U21A 3WAFA 4DIGA 1XS5A 4PE5B 4QSCA 2QSXA 3USDA 4QHQA 1PB7A 3VVDA 1KWHA 5CMCA 4ECFA 4U22A 5KDTB 3PPQA 3ZS6A 5L9OA 2P1SA 3K6UA 3U8QA 4LVQA 3VV5A 2W7YA 4F3BA 1B0HA 1ZJLA 4JBZA 4F2QA 4R75A 1XVYA 2B65A 3QIMA 2XXWA 4BDRA 3VLUA 3FD3A 4KCCA 1N76A 3OEKA 4ZS9A 1S9TA 2ABHA 4RPNA 4MLQA 4LQ2A 4BDLA 5I84A 4MF3A 5FHMA 1TWYA 1MXWA 2OCUA 4YKKA 5LOMA 2A5TA 2A5SA 1XT8A 4KD5A 2VGQA 3LUYA 4BDNA 2RC8A 4NE4A 4ZEDA 3BFUA 4YKPA 4ZE9A 3U72A 5CC2A 3U94A 1UIVA 3A3UA 4RK9A 3S9EA 5CM6A 1D9YA 1POTA 4F1UA 2Q88A 1Y3PA 1B51A 2UYEA 4PFWA 2QS2A 3PPPA 3GBAA 3C36A 4FEBA 1N3WA 3K6XA 4R6YA 3GZGA 3DP4A 3KBRA 3P7IA 4OFLA 3OEMA 2UVJA 1Y9UA 3PD9A 1NH8A 3G3HA 1US5A 5DVIA 3CSGA 1FTKA 3MBPA 3FIRA 3D4GA 3FJMA 2RF1A 2VD2A 1B1XA 4QSDA 5F7VA 1P1QA 3GXAA 3O9PA 4QFLA 3MPLA 1LGBC 3VXCA 4DLDA 2V84A 1IITA 3T22A 1B3GA 4NMYA 4R72A 3N94A 1R6ZA 2DSFA 3DP6A 3TZAA 1ZKBA 2B3FA 1EZOA 4IO7A 5A5XA 4GD5A 4OESA 3H6TA 3L6GA 5CBRA 1FTOA 1Q1KA 3TUSA 1TT1A 3KN8A 1L5TA 4QF9A 3H6VA 3QYTA 3G3JA 3VDFA 5AA4A 4OTEA 5BUUA 4NEDA 4NF8B 1N84A 3UIFA 2ALUA 3TODA 1A54A 3S2VA 4MFIA 4WKMA 3H4ZA 3TKDA 1P99A 2XD3A 4UA8A 1IQ7A 3QSLA 4KR5A 4AB5A 3FATA 4GWOA 4R2BA 5IAIA 1SW5A 3B6TA 2Y7IA 5KDTA 1ZU0A 3VLVA 4OMBA 4FORA 5I57B 1MDP1 1FQFA 1XC1A 2VD3A 3FZVA 1A7LA 4ZEFA 3S9LC 2V93A 3TCGA 1URDA 1R1NA 2F6PA 3FVKA 2QPQA 4EF2A 4THIA 1SVXB 1MQDA 4F18A 4YB7A 3W9VA 4U1ZA 2O1LA 4NF5B 4IY5A 3SESA 4RYAA 3RLFE 4EF1A 3EPEA 1II5A 1B3EA 2DXYA 4ZEBA 2O1MA 3K0VA 3M8UA 4YMBA 4HW8A 1SBPA 5M2VA 4F19A 3TTMA 5H8NB 4TOZA 1N7WA 2Q2AA 5ISUA 2VP1A 1LBCA 2ANJA 2H9BA 5AA1A 4JWXA 3N6TA 2F7BA 3KZGA 1OMPA 3W9WA 3MJNA 4C0RA 2ZNUA 4IO6A 1R9QA 2Z8FA 1VE4A 1H76A 2F36A 3TEPA 1P1OA 2V3QA 1CB6A 2DQVA 2F78A 1QUIA 4GOTA 3BKIB 1IXHA 3PV0E 3K4UA 4FJPA 4N13A 3O6IA 2ZNSA 3SEWA 5I56B 5L8DA 2ONSA 3FXRA 3M3FA 3E13X 3I5OA 3HCQA 4IO2A 3OO8A 2WKYA 1IUDA 4I1DA 1Q35A 1B40A 4RY1A 4I9DA 2XXIA 3Q28A 2CZLA 4IO5A 2GHAA 2VOZA 2IA4A 3HV1A 4DXCA 1NMUA 1ATGA 4YB5A 1PDAA 5H8SA 4RNSA 2O7UA 3C35A 4XXUA 3KJTA 4NF8A 4C1UA 1RYXA 4EXLA 1FQBA 1M5EA 4ZECA 4YICA 3TYHA 2ESNA 1B5HA 1B6HA 1P1NA 3RT6B 2V3UA 4Q5TA 1JW1A 1AL3A 5FTHA 1PBQA 1B52A 5H8FB 2HAUA 3MQ9A 2I48A 3HSTA 1BLFA 2QMWA 2XHDA 3CFZA 3TAJA 4TQUQ 4JSOA 2X7QA 1DMBA 3IO6A 4POXA 3LSXA 5EHMA 4YB6A 1FW0A 3RNNA 2XXHA 4PQJA 3K01A 4XKRA 1UTBB 1I6QA 1B3HA 4H5GA 3CIJA 2GRVA 2G29A 1MXZA 4K3FA 3Q27A 3F11A 1QJMA 4ISUA 3CSBA 3N26A 3ECRA 4IO4A 2H4IA 5F1QA 5K2XA 5TU0A 5B7DA 2AL5A 3L6HA 3FVGA 4NF5A 4R9FA 1YTVA 1PB8A 3MPKA 5BWJA 2E1SA 2ZYNA 3O6HA 4DXBA 4MLVA 3UA8A 5AA3A 5KCJB 2UVGA 3PPOA 3UN6A 2YJPA 4C1TA 4HTGA 1B3LA 1FQDA 3K1MA 4GIZA 3TTKA 1LBBA 4BDMA 3LR1A 4ELPA 1A40A 3KSJA 1QVSA 1LAXA 4G2ZA 3VVEA 2NOOA 2UVIA 1B7HA 2HCAA 3QK6A 2QL3A 4GL8A 1NNTA 1MRPA 4POWA 5L9SA 2QS4A 2XXTA 2RC7A 3A3CA 3FVOA 4O3BA 2NVUB 3EQ1A 4MH5A 4KCDA 4ZZEA 1I6BA 5JTYB 3DELB 3QXMA 2FA7A 5ITPA 5DEXB 4HCWA 2O84X 1MXUA 4QRZA 3KEIA 5DYHA 2I49A 2Q9TA 3PUXE 3V83A 4EDPA 2FYIA 5JEIA 2UXAA 4H0WA 2Z8EA 5I56A 4X48A 1LFGA 1M5FA 1SI0A 3BBRA 1XHYA 2UYFA 1OLAA 1NNKA 4OWDA 4R2FA 4XKPA 5JK4A 4ZEKA 2KLFA 4FECA 1SDXA 3U93A 3PU5A 3Q29A 4RXLA 4KPTA 4NF4A 3SEUA 2HXWA 1US4A 3KFMA 1QKAA 2HZKA 3ZKKA 3HHGA 5ELVA 3VE1B 2DVZA 3DP8A 3OMBA 3E3KA 4F39A 1AMFA 3SDFA 4GF8A 1NKXA 4L17A 4LZ8A 4GVOA 3R7XA 1B7ZA 1OQGA 1WDNA 3WAEA 3EHSA 1T0KA 4ZEIA 2DWJA 4LA9A 1SI1A 1LCFA 1D3KA 3IOWA 1MM7A 1NH7A 4PETA 5I58A 4IB2A 3RGYA 3K1NA 2ZYKA 1RYOA 3VLWA 2F5XA 4I62A 4EQ7A 4X1BA 1A8FA 4P0IA 3C9HA 1LLSA 3MVWA 4G68C 1UTBA 5CRYA 1BP5A 2R9JA 1EU8A 2IEEA 1IXIA 1TFAA 3RQTA 1M5BA 2F7CA 4OHNA 3TFLA 4PFUA 3MP1A 4GQOA 1MY0A 1YPNA 3C31A 3SETA 1AH5A 3UGWA 4GRKA 1F9BA 4F31B 4U2RA 5ITOA 3U92A 3T9HB 1USYE 1JEVA 2DS9A 3C4MA 1ZBMA 1AIVA 4YKJA 1TFDA 5AE4A 4ZDMA 2ZYMA 4RPOA 4ELQA 4QFKA 1DPEA 4RA1A 3M3LA 5AA2B 3S9MC 4JWYA 3V89B 3GBBA 4IGRA 3HHFA 3V5AA 1HSLA 3TTNA 4QFOA 4G8HA 1NNFA 2UVHA 4X9TA 2REJA 4LP2B 3ZKLA 2VHAA 3O2AA 2PMSA 3K6VA 2R6GE 3FXUA 4ND9A 3IORA 2DYXA 1NL5A 4M4GA 5HBCA 4GFRA 3QUFA 4KFQA 4Z0IA 4Z7EA 1HSJA 4F2OA 3V8XB 5JTYA 3C32A 3B7DA 3I3VA 3MVZA 4FATA 3RY3A 3CG3A 2H5YA 1FTJA 3MZBA 4HCYA 3B6WA 4M1VA 4PP0A 4TLMB 1MPBA 4R73A 3K6WA 4ZE8A 2PT2A 5I59B 3RT8A 3E9XA 1GR2A 2XXPA 3TMGA 3MZ9A 1B2HA 4EQ9A 5KZTA 1QUJA 4LZ5A 3AXFA 4WEDA 3EF7A 3IB2A 3G3IA 1O64A 1MG1A 5H8QB 2Y7WA 3R26A 2E0SA 1B58A 1TXFA 3SEVA 1B32A 1YAEA 3OD7A 1Y3QA 3RTFB 4KYSA 3O66A 1LAGE 1MQHA 3OELA 1LAHE 1MH3A 2Y7RA 2DE3A 3ILUB 3JZJA 1UTHB 3FV1A 2H25A 1IXGA 3TPAA 2Z8DA 3PMWA 3OO7A 2GFEA 2HZLA 2QMXA 3O28A 1BIYA 4P11A 3VVFA 4LONB 1ZLQA 4EQBA 1SD3A 5I2NB 2DWHA 1LB8A 5FHOA 5TPAB 4YZZA 3CRBA 2AL4A 3TELA 1OQHA 4AB6A 5EHSA 2Z22A 3EN3A 4GXSB 1P1WA 4OEUA 3KOSA 1GVCA 3T96B 5HPQA 1Y4TA 3KGCA 2OJTA 2QRYA 4PFTA 1B4HA 2QS1A 2LAOA 3VXBA 4KI0E 5IKBA 2DXRA 2QJEA 1DOTA 2HFBA 3IAZA 1ZIUA 3Q26A 4XTCQ 4P0GA 3IJXB 3E4RA 2RCAA 1URGA 1GTKA 4BLAA 3H6WA 4LZ7A 4KQPA 1MM6A 4NWCA 1IEJA 4OXVA 1JQFA 2O68A 2RINA 1DTGA 2OBGA 3SKPA 3EHTA 1FQCA 2XX8A 1R9LA 3PMVA 4TLLB 1UIUA 3GLBA 4O3CA 4OFOA 2RKMA 3IB0A 2Y7KA 1LB9A 3O29A 1B05A 4E0WA 1JW5A 2YLNA 1RKMA 2P0SA 3K1PA 1N04A 1H45A 2RC9A 5I2KB 5I57A 3PMXA 3FUZA 1B7UA 3H3GA 3UK4A 4WEPA 3T9VA 3CG1A 1JNFA 3ODBA 1SQYA 1LFIA 3MC2A 4E0XA 3FVNA 4OENA 3OOAA 4R9GA 5DTBA 3PUVE 1JW4A 1JEUA 1LCTA 3UP9A 3HN0A 2G93A 2D3IA 2ZYOA 4G77A 2B3BA 5H8QA 3CFXA 3H06B 4WXJA 4BDOA 4DE8A 4H65A 1FCKA 3A09A 3IOUA 2I0CA 5H8NA 4FAJA 3O6GA 3SEYA 3CVGA 4NF6B 1ZTYA 3B6QA 1XOCA 4XIGQ 1B0LA 2V25A 2AYSA 4JB7A 2I6EA 1SYHA 3TCFA 2Q8JA 1VFEA 2F35A 1UTHA 4IO3A 4ELOA 4ONYA 3OENA 4F22A 3LSFB 4LATA 4G68B 2CMOA 1SYIA 1EZPA 3T9XB 5I2NA 1OLCA 5TPAA 1SW2A 2REGA 4IGTA 3MZ1A 1Y1MA 5EYFA 2Q89A 3PUYE 3T93B 2HAVA 3FJ7A 2BJJX 2F34A 5CI5A 3CI8A 4RK2A 4FIMA 2NUVA 4AQ4A 1A99A 1QULA 1VR5A 1N3XA 2DE4A 2O69A 2DE2A 2V3TA 2FNCA 2Y84A 3SERA 3OSRA 3OSQA 5FTIA 2PBWA 3MUQA 4GL0A 3ONMA 1QKBA 3G3FA 5L9MA 3RUMA 4Q0CA 4H8IA 4YKIA 1MQGA 1FTMA 2XX7A 1ANFA 1MPCA 4NWDA 3TQWA 3M3KA 2X7PA 1WVJA 2ONRA 4U4XA 4GXAA 3C33A 4FEDA 3KSXA 1GGGA 4JXIA 3MWBA 2XXUA 2O7IA 4YMAA 1IIWA 1NNPA 2OWSA 5H8FA 4U23A 4JSDA 3UORA 3RTWB 1N0TA 1WODA 1IZ1A 1SW1A 4OEVA 3DM0A 5DVJA 3SEXA 1B3FA 4OZ9A 5I2KA 3IJOB 5FHNA 4R74A 3FASA 5CMBA 2XXXA 1JVXA 4KHZE 1B1HA 4QFNA 2YPNA 3CFLA 3MP8A 3QUJA 1ZMGA 4G4PA 1PB9A 4ZZAA 3KN3A 1QUKA 2P2AA 2QS3A 3RN8A 4DCYA 3LSWA 2GHBA 1NFTA 3O97A 4H8JA 4YAHX 1M5DA 3R6UA 2Q2CA 3IR1A 3S9NC 4F1YA 3T66A 4F3SA 2I0BA 4Q30B 4OQOA 1D9VA 4I8CA 5KCJA 5DT6A 1B5JA 2ZMBA 3H7MA 4R6KA 4NF6A 3MP6A 1CE2A 5CMKA 1MY4A 1A55A 5TP9B 3IK6B 3IB1A 2NWJA 4G8NA 1HSEA 2XX9A 2ZXTA 1OIBA 4OYVA 3OO6A 1XVXA 1P1UA 1D4NA 4ESXA 2AIXA 1H43A 4G68A 3D4CA 3KN7A 1YCJA 3CR9A 4XKQA 3BFTA 4N07A 3VFJA 5DEXA 3PUWE 4UACA 1POY1 1GV8A 1H3DA 5CBSA 1PC3A 2PVUA 1MY1A 3MAMA 3N6UA 3U1OA 1BTJA 5ICTA 1S50A 3HO7A 5HM4B 3IX1A 3LBSA 2PT1A 5DVFA 2XXRA 4JDFA 1MQJA 2OWTA 3LC8A 1Y20A 2RCBA 2O51A 5H8HB 4H67A 3EHUA 2M8CA 2OLBA 3K2DA 2PX1A 3MW0A 1MQIA 1PBPA 2D5WA 3HPIA 2DWIA 4F3GA 1S7YA 1UQWA 3IO4A 4QSEA 3G3GA 3TTLA 1MS7A 4GLIA 2I3WA 1Y4CA 4F29A 3N5LA 1IXCA 4G8MA 4OETA 1MH4A 1M5CA 3KG2A 3KOTA 1USYH 3THIA 1URSA 2X26A 2D21A 3FJGA 2THIA 1VFDA 1LAFE 1A8EA 3FXQA 2XD2A 1DPPA 4KYEA 4MBPA 4DZ1A 1B5IA 1Z7ME 3K02A 1EH3A 3MVXA 4JWOA 1Y1ZA 4OERA 5AA2D
chains in the Genus database with same CATH superfamily
4EUOA 3IOTA 1OVTA 3PGFA 1B46A 4OVJA 1BKAA 2OZZA 1MPDA 4FE8A 1DSNA 2I3VA 3KBZA 3PPNA 3PTYA 3Q25A 3OO9A 3OXNA 3ILTB 3MYUA 4F1VA 2DOJA 5LTCA 3JYRA 2FVZA 4RJZA 3ZSFA 2Y7PA 1AOVA 4H1XA 1N7XA 2WBDA 1LFHA 1VSOA 2ONKE 1MXVA 3IL1B 1FQEA 3MVYA 1LSTA 3TDJA 1EZ9A 4NF4B 2OK2A 1DTZA 5AA2A 1I69A 2A5TB 2F8DA 5TP9A 3TQLA 3K00A 4BDQA 1KA1A 3G3KA 3LSLA 4KYDA 2F6GA 5IM2A 4ELRA 4H6DA 1B9JA 1ELJA 1MDQA 4NX1A 2KR0A 3C34A 1Z7NE 1SW4A 1K9ZA 2XXQA 1FTLA 2DVCA 4IY6A 4NQ8A 1FQAA 3QAXA 3PD8A 4EXKA 2XXYA 5ICQA 1J1NA 5I58B 2I4CA 4DCXA 3DLNA 3TTRA 1JETA 4QFPA 3PUZE 5A5LA 4LQ5A 1Y3NA 5J1DA 5CMMA 5I59A 4X1DA 2HEUA 4DDDA 2R71A 4Q8RA 3W15C 4PFYA 1JVYA 4XKNA 4U4SA 1O7TA 2PYYA 2ZNTA 2HQ0A 1MXXA 4PE3A 2DP8A 4NTLA 4NAPA 5K2YA 1D9QA 1MY3A 2HHMA 4U1OA 4N6PA 2XWVA 2I4BA 1MY2A 4P9KA 2I58A 4I3YA 2F97A 1B4ZA 3FV2A 1QW0A 1LBZA 5H8HA 1PEBA 2H99A 5A5XB 1O63A 4N15A 3H03A 3G7WA 1YYZA 4N17A 1H44A 4DXUA 1FBEA 5LDZA 4PDDA 2H98A 3H6UA 3I6VA 3JV9A 4OVTA 4HS7A 3TCHA 1OVBA 4O3AA 1MXYA 2Z23A 4LUBA 5AA4B 3T0JA 2GH9A 5EQ9A 3IOVA 2XXVA 5B70A 4R6HA 3S4UA 3PPRA 4PBHA 4H5FA 4F3PA 2R8TA 4YU0A 2PCRA 3T9UA 4ESWA 2F7AA 1LBWA 2NXOA 1I6AA 2O6AA 3FGSA 3LUZA 3KJ7A 4OFJA 2DWAA 3RPWA 4U21A 3WAFA 4DIGA 1XS5A 4PE5B 4QSCA 2QSXA 3SZPA 3USDA 4QHQA 1PB7A 3VVDA 1KWHA 5CMCA 4ECFA 1FBPA 3IFAA 4U22A 5KDTB 3PPQA 3ZS6A 5L9OA 2P1SA 3K6UA 3U8QA 4LVQA 3VV5A 4PF6A 2W7YA 4F3BA 1B0HA 1ZJLA 4JBZA 4F2QA 4R75A 1XVYA 4NGUA 2B65A 2B4LA 3QIMA 4JVDA 2XXWA 5DW8A 4BDRA 3VLUA 3FD3A 4KCCA 1N76A 3OEKA 4ZS9A 4NHBA 1S9TA 2ABHA 1NV1A 4RPNA 4MLQA 1NUYA 4LQ2A 4BDLA 5I84A 2Q74A 1NV3A 4MF3A 5FHMA 1TWYA 1MXWA 2OCUA 1YZ0A 4PFBA 4YKKA 5LOMA 2A5TA 2A5SA 1XT8A 4KD5A 2VGQA 3LUYA 4BDNA 2RC8A 4NE4A 4ZEDA 3BFUA 4YKPA 4O7IA 4ZE9A 3U72A 3A29A 1CNQA 5CC2A 3U94A 1UIVA 3A3UA 4RK9A 3S9EA 5CM6A 1D9YA 1POTA 4F1UA 2Q88A 1Y3PA 1B51A 2UYEA 4PFWA 2QS2A 3PPPA 1Q9DA 3GBAA 3C36A 4FEBA 1N3WA 3K6XA 1EYKA 4R6YA 4O8MA 3GZGA 3DP4A 3KBRA 1NV7A 3P7IA 4OFLA 3OEMA 5F24A 2UVJA 1Y9UA 3PD9A 1NH8A 3G3HA 2HXRA 1US5A 2FIEA 5DVIA 3CSGA 1FTKA 3MBPA 2OWZA 3FIRA 3D4GA 3FJMA 2RF1A 2VD2A 4JVCA 3IFCA 1B1XA 2QVVA 4QSDA 5F7VA 1P1QA 3GXAA 3O9PA 4QFLA 4NF0A 3MPLA 4OVRA 1LGBC 3VXCA 4DLDA 5IZ1A 2V84A 1IITA 1B3GA 4NMYA 3T22A 4R72A 1FPGA 3N94A 1R6ZA 2DSFA 3RPLB 3DP6A 3TZAA 1ZKBA 2B3FA 1EZOA 4IO7A 3E79A 5A5XA 4GD5A 4OESA 3H6TA 3L6GA 5CBRA 1FTOA 1Q1KA 3TUSA 1TT1A 5I7IA 3KN8A 1L5TA 1YXIA 4QF9A 4PAIA 3H6VA 3QYTA 3G3JA 3VDFA 5AA4A 1G0HA 3E78A 4OTEA 5BUUA 4NEDA 4NF8B 1N84A 3UIFA 2ALUA 3TODA 1A54A 3S2VA 4MFIA 4WKMA 3H4ZA 5IZ3A 3TKDA 1P99A 2XD3A 4UA8A 1IQ7A 3QSLA 1FBDA 1FPJA 4MIJA 4KR5A 4AB5A 3ISPA 3BIGA 3FATA 4GWOA 4R2BA 5IAIA 2HPGA 1SW5A 4PFRA 3B6TA 2Y7IA 4N8YA 5KDTA 1ZU0A 3VLVA 4OMBA 4P47A 4FORA 5I57B 1MDP1 1FQFA 1XC1A 2VD3A 3FZVA 1A7LA 2Y5LA 3FXBA 1FRPA 1JP4A 4ZEFA 3S9LC 2V93A 3TCGA 1URDA 1R1NA 2F6PA 3FVKA 2QPQA 4EF2A 4DI3D 4THIA 1SVXB 1MQDA 4F18A 4YB7A 3W9VA 4U1ZA 2O1LA 4NF5B 2L5VA 5EQAA 4IY5A 3SESA 4RYAA 3RLFE 4EF1A 3EPEA 1II5A 1B3EA 1LEVA 2DXYA 4ZEBA 2O1MA 3K0VA 1XI6A 2CEYA 3M8UA 4YMBA 4HW8A 1SBPA 5M2VA 4F19A 3TTMA 5H8NB 4TOZA 1N7WA 2Q2AA 5ISUA 2VP1A 1LBCA 4PDHA 2ANJA 2H9BA 4OVPA 5AA1A 4JWXA 3N6TA 2F7BA 3KZGA 1OMPA 3W9WA 3MJNA 4C0RA 4GWYA 2ZNUA 4IO6A 1R9QA 2Z8FA 1VE4A 1H76A 3FBPA 2F36A 3TEPA 1P1OA 4HXVA 2V3QA 1CB6A 2DQVA 2F78A 1QUIA 4GOTA 3BKIB 4PTKA 1IXHA 3PV0E 1NV0A 3K4UA 2WX9A 4FJPA 3KC0A 4N13A 3O6IA 2ZNSA 3SEWA 2BJIA 5I56B 5L8DA 1NUXA 2ONSA 4GX4A 3FXRA 3M3FA 3E13X 3I5OA 4N8GA 3HCQA 3RPLA 1BK4A 4IO2A 3OO8A 2WKYA 1IUDA 4I1DA 4LN5A 1Q35A 4GX3A 2F3BA 1B40A 4G61A 4RY1A 4I9DA 3CHGA 2XXIA 3Q28A 2CZLA 4IO5A 2PFYA 2GHAA 2VOZA 2IA4A 1FPKA 3HV1A 4DXCA 4IR8A 1NMUA 1ATGA 4YB5A 1PDAA 5H8SA 4RNSA 2O7UA 2VPNA 3C35A 4XXUA 3KJTA 4NF8A 4C1UA 1RYXA 4EXLA 1FQBA 1M5EA 4ZECA 4YICA 3TYHA 2ESNA 4I40A 4UABA 1B5HA 1B6HA 1P1NA 3RT6B 2V3UA 4Q5TA 1JW1A 1AL3A 5FTHA 1PBQA 2KQZA 1B52A 5H8FB 2HAUA 3MQ9A 2WYPA 2I48A 3HSTA 1BLFA 2QMWA 2XHDA 3CFZA 3TAJA 4TQUQ 4JSOA 2X7QA 1DMBA 3IO6A 4POXA 3LSXA 5EHMA 2XWOA 4PAKA 4YB6A 1FW0A 3RNNA 2XXHA 4PQJA 3K01A 4XKRA 1IMAA 1UTBB 2XA5A 1I6QA 1B3HA 4GWXA 4H5GA 3CIJA 2GRVA 2G29A 1MXZA 1FPBA 1NUWA 4K3FA 3Q27A 3F11A 1QJMA 4ISUA 3CSBA 3N26A 3ECRA 4IO4A 4GX6A 2H4IA 5F1QA 1NV2A 5K2XA 5TU0A 5B7DA 2F3DA 2Q8MA 2AL5A 2XXKA 3L6HA 3FVGA 4NF5A 4R9FA 1YTVA 1KA0A 1PB8A 1NI9A 3MPKA 1NUZA 5BWJA 2E1SA 5ET8A 2ZYNA 3O6HA 4OANA 1K9YA 4DXBA 4MLVA 3UA8A 5AA3A 5KCJB 2UVGA 3PPOA 3UN6A 2YJPA 2GQ1A 4C1TA 4HTGA 1B3LA 1FQDA 3K1MA 4GIZA 3TTKA 1LBBA 4BDMA 3LR1A 4ELPA 1A40A 3KSJA 1QVSA 1LAXA 4G2ZA 3VVEA 2NOOA 2UVIA 1B7HA 2HCAA 3QK6A 2QL3A 1IMBA 4GL8A 1NNTA 1MRPA 1LBXA 4POWA 3RYDA 5L9SA 2QS4A 2XXTA 2RC7A 3A3CA 1FPDA 3FVOA 4O3BA 3EQ1A 4MH5A 2NVUB 4KCDA 5I5PA 4ZZEA 1I6BA 5JTYB 2B4MA 3DELB 3QXMA 2FA7A 4KXPA 2WYKA 1FPLA 5ITPA 5DEXB 4HCWA 2O84X 1MXUA 2MKZA 4QRZA 3B50A 4X8RA 3KEIA 1EYIA 5DYHA 2I49A 2Q9TA 3PUXE 3V83A 4EDPA 2FYIA 5JEIA 2UXAA 4H0WA 2Z8EA 5I56A 4X48A 1LFGA 1M5FA 1SI0A 3BBRA 1XHYA 2UYFA 1OLAA 5EQ8A 1NNKA 4OWDA 4R2FA 4XKPA 3T1BA 5JK4A 4ZEKA 2KLFA 4FECA 1SDXA 3U93A 3U65A 3PU5A 3Q29A 4RXLA 4KPTA 4NF4A 3SEUA 2HXWA 1US4A 3KFMA 1QKAA 2HZKA 4QXDA 3ZKKA 3HHGA 5ELVA 3VE1B 1EYJA 1SPIA 2DVZA 3DP8A 1FTAA 3OMBA 3E3KA 4F39A 1AMFA 2OX3A 3SDFA 4GF8A 1NV4A 1NKXA 4L17A 4LZ8A 4GVOA 3R7XA 1B7ZA 1OQGA 1WDNA 3WAEA 3EHSA 1T0KA 4ZEIA 2DWJA 4HE1A 4LA9A 1SI1A 1LCFA 2XWIA 1D3KA 3IOWA 1MM7A 1NH7A 4PETA 5I58A 4IB2A 2QVRA 3RGYA 3K1NA 2ZYKA 1RYOA 3VLWA 2F5XA 4I62A 4MEVA 4EQ7A 4X1BA 1A8FA 4PBQA 4P0IA 3C9HA 4GBVA 1LLSA 5ET5A 3MVWA 4G68C 1UTBA 5CRYA 1BP5A 2R9JA 1EU8A 2IEEA 1IXIA 1TFAA 1FBHA 3RQTA 5J16A 2CZHA 1M5BA 2F7CA 4OHNA 3TFLA 4PFUA 2P3VA 2VT5A 3MP1A 4GQOA 1MY0A 1YPNA 1IMEA 3C31A 3SETA 1AH5A 3UGWA 4GRKA 1F9BA 4F31B 4U2RA 5ITOA 3U92A 3T9HB 1USYE 1JEVA 2DS9A 3C4MA 1ZBMA 1AIVA 4YKJA 1TFDA 5AE4A 4ZDMA 2ZYMA 4GWWA 4RPOA 4ELQA 4QFKA 1DPEA 2FIXA 4N91A 4RA1A 3M3LA 5AA2B 3S9MC 4PCDA 4JWYA 3V89B 3GBBA 4IGRA 3HHFA 3V5AA 1HSLA 3TTNA 4QFOA 4G8HA 1NNFA 2UVHA 4X9TA 2REJA 1FPEA 4LP2B 3ZKLA 2VHAA 3O2AA 2PMSA 3K6VA 4FBPA 2R6GE 3FXUA 4ND9A 3IORA 2DYXA 1NL5A 4M4GA 5HBCA 2FBPA 4GFRA 3QUFA 4KFQA 4Z0IA 4Z7EA 1HSJA 4F2OA 3V8XB 5JTYA 3C32A 3B7DA 3I3VA 3MVZA 4FATA 4PC9A 3RY3A 3CG3A 2H5YA 1FTJA 3MZBA 4HCYA 3B6WA 4M1VA 4PP0A 4TLMB 1MPBA 4R73A 3K6WA 4ZE8A 2PT2A 5I59B 3RT8A 3E9XA 1GR2A 2XXPA 3TMGA 3MZ9A 3LV0A 1B2HA 4P1EA 4EQ9A 5KZTA 1QUJA 2JJKA 4LZ5A 3AXFA 4WEDA 3EF7A 3IB2A 3G3IA 1O64A 1MG1A 5H8QB 4GWUA 2Y7WA 2ZZXA 3R26A 5EQ7A 2E0SA 1B58A 4XFEA 1TXFA 3SEVA 1B32A 1YAEA 3OD7A 1Y3QA 3RTFB 4KYSA 4N81A 1IMDA 1LAGE 1MQHA 3O66A 3OELA 1LAHE 1MH3A 2Y7RA 2DE3A 3ILUB 3JZJA 1UTHB 3FV1A 2H25A 1IXGA 3TPAA 2Z8DA 3PMWA 3OO7A 2GFEA 2HZLA 2QMXA 3O28A 1BIYA 4P11A 2CZIA 3VVFA 2FHYA 4LONB 1ZLQA 4EQBA 1SD3A 5I2NB 2DWHA 1LB8A 1KZ8A 5FHOA 5TPAB 5IZZA 4YZZA 3CRBA 2AL4A 3TELA 1OQHA 4MMPA 4AB6A 5EHSA 2Z22A 3EN3A 4GXSB 1P1WA 4OEUA 3KOSA 2CEXA 1GVCA 3T96B 4NG7A 5HPQA 1Y4TA 3KGCA 2OJTA 2QRYA 4PFTA 1RDXA 3QMFA 1B4HA 2QS1A 2LAOA 3VXBA 4KI0E 5IKBA 2DXRA 2QJEA 1DOTA 2HFBA 3IAZA 1ZIUA 2WBBA 3Q26A 4XTCQ 2ZZWA 4P0GA 3IJXB 3B8BA 3E4RA 2RCAA 1URGA 1NV5A 1GTKA 4BLAA 3H6WA 1IMFA 4LZ7A 4KQPA 3ROJA 1MM6A 4NWCA 1IEJA 4OXVA 1JQFA 2O68A 2RINA 4OVSA 1DTGA 2OBGA 3SKPA 5ET7A 3EHTA 1FQCA 2XX8A 1R9LA 1DBZA 3PMVA 4TLLB 1UIUA 3GLBA 4P8BA 4HE2A 4O3CA 4JVIA 4OFOA 2RKMA 3IB0A 1LBVA 4GBWA 4N6DA 2Y7KA 1LB9A 3O29A 1B05A 4E0WA 1JW5A 1FPFA 2YLNA 4OVQA 1RKMA 4MHFA 2P0SA 3BIHA 1N04A 1H45A 3K1PA 4MNCA 2RC9A 5I2KB 5I57A 1NV6A 3PMXA 3FUZA 1B7UA 5ET6A 3H3GA 3UK4A 4WEPA 3T9VA 3CG1A 1JNFA 3ODBA 1SQYA 1LFIA 4P56A 4MJOA 4PGNA 5FBPA 1VDWA 1FBGA 3MC2A 4E0XA 3FVNA 4OENA 1DCUA 2CZKA 3OOAA 4R9GA 5DTBA 4PAFA 3PUVE 1JW4A 1JEUA 1LCTA 3UP9A 3HN0A 2G93A 2D3IA 2ZYOA 4G77A 2B3BA 5H8QA 3CFXA 3H06B 5T3JA 4N6KA 4WXJA 4BDOA 4DE8A 4H65A 1FCKA 3A09A 3IOUA 2I0CA 5H8NA 4FAJA 3O6GA 3SEYA 3CVGA 4NF6B 1ZTYA 3B6QA 1DK4A 1XOCA 4XIGQ 1B0LA 2V25A 2AYSA 4JB7A 2I6EA 4H45A 1SYHA 3TCFA 2Q8JA 4NN3A 1VFEA 2F35A 1UTHA 4IO3A 4ELOA 4ONYA 1FBCA 5IGAA 4X04A 3OENA 3D1RA 4F22A 2V4CA 3LSFB 1INPA 5IZ3B 4LATA 4G68B 2CMOA 1SYIA 1EZPA 3T9XB 4I3EA 5I2NA 1OLCA 5TPAA 1SW2A 2REGA 2Y5KA 1FJ9A 4IGTA 5I3SA 2WEFA 3MZ1A 1Y1MA 5EYFA 2Q89A 3PUYE 3T93B 4PGPA 2HAVA 3FJ7A 3NOHA 2BJJX 1QGXA 2F34A 5CI5A 3CI8A 4MCOA 4RK2A 4FIMA 2NUVA 4AQ4A 1A99A 1QULA 1VR5A 1N3XA 2DE4A 3GYYA 2O69A 2DE2A 2V3TA 2FNCA 4MX6A 2Y84A 3SERA 4P3LA 2P3NA 3OSRA 3OSQA 5FTIA 2PBWA 3MUQA 4GL0A 3ONMA 1QKBA 3G3FA 5L9MA 3RUMA 4Q0CA 4H8IA 4YKIA 1MQGA 1FTMA 2XX7A 1ANFA 1MPCA 4NWDA 4DI4B 3TQWA 3M3KA 2X7PA 1WVJA 2ONRA 4U4XA 4GXAA 3C33A 4FEDA 3KSXA 1GGGA 4AS4A 4JXIA 3MWBA 2XXUA 2O7IA 4YMAA 1IIWA 1NNPA 2OWSA 5H8FA 4U23A 4JSDA 3UORA 3RTWB 1N0TA 1WODA 1IZ1A 1SW1A 4OEVA 1G0IA 3DM0A 5DVJA 3SEXA 1B3FA 4OZ9A 5I2KA 3IJOB 2VPOA 5FHNA 4R74A 3FASA 5CMBA 2XXXA 1JVXA 4KHZE 1B1HA 4QFNA 2YPNA 3CFLA 3MP8A 3QUJA 1ZMGA 4G4PA 1PB9A 4ZZAA 3KN3A 1QUKA 2P2AA 3EKIA 2QS3A 5ESYA 3RN8A 4DCYA 3LSWA 2GHBA 1NFTA 4HE0A 3O97A 4H8JA 4YAHX 1M5DA 1FSAA 3R6UA 2Q2CA 3IR1A 3S9NC 4GWZA 4F1YA 3T66A 4XEQA 4F3SA 4O94A 2I0BA 1FJ6A 4Q30B 4OQOA 1D9VA 4N4UA 4I8CA 4MNPA 5KCJA 4MNIA 5DT6A 2PFZA 1B5JA 2ZMBA 3H7MA 4R6KA 4NF6A 3MP6A 1CE2A 5CMKA 4AS5A 1MY4A 1A55A 5TP9B 3IK6B 3IB1A 2NWJA 4G8NA 1HSEA 2XX9A 2ZXTA 1OIBA 1LBYA 4OYVA 4O7MA 3OO6A 1XVXA 1P1UA 1RDYA 1D4NA 4ESXA 2AIXA 1H43A 4G68A 4MAGA 3D4CA 3KN7A 1YCJA 3CR9A 4XKQA 3BFTA 4N07A 3MSTA 3VFJA 5DEXA 3PUWE 4UACA 1POY1 1GV8A 1AWBA 1H3DA 5CBSA 1PC3A 2PVUA 1MY1A 3MAMA 3N6UA 3U1OA 1BTJA 5ICTA 1S50A 3HO7A 5HM4B 3IX1A 3LBSA 2PT1A 5EYHA 2XWKA 5DVFA 4XF5A 2XXRA 4JDFA 1MQJA 2OWTA 3HFUA 4H46A 3LC8A 1Y20A 3KC1A 2RCBA 2O51A 5H8HB 4H67A 3EHUA 2M8CA 2OLBA 2QVUA 3K2DA 2PX1A 3MW0A 1MQIA 1PBPA 2D5WA 4OA4A 4P1LA 4PF8A 3HPIA 2DWIA 4F3GA 1S7YA 1RDZA 1UQWA 3IO4A 4QSEA 3G3GA 3TTLA 1MS7A 4GLIA 2I3WA 1Y4CA 4F29A 3N5LA 4G8MA 1IXCA 4OETA 1MH4A 1FBFA 1M5CA 3KG2A 3KOTA 1USYH 3THIA 1URSA 2X26A 2D21A 3FJGA 2THIA 1VFDA 2QFLA 1LAFE 1A8EA 3FXQA 2XD2A 4GWSA 1DPPA 4PFIA 4KYEA 4MBPA 2DDKA 1FPIA 4DZ1A 4QBAA 1B5IA 1Z7ME 3K02A 1EH3A 3MVXA 4JWOA 1Y1ZA 1IMCA 5EYGA 4OERA 5AA2D 2ZZVA
chains in the Genus database with same CATH topology
4EUOA 3IOTA 1OVTA 3PGFA 1B46A 4OVJA 1BKAA 2OZZA 1MPDA 4FE8A 1DSNA 2I3VA 3PPNA 3Q25A 3OO9A 3OXNA 3ILTB 4F1VA 2DOJA 3JYRA 4RJZA 3ZSFA 2Y7PA 1AOVA 4H1XA 1N7XA 1LFHA 1VSOA 2ONKE 1MXVA 3IL1B 1FQEA 3MVYA 1LSTA 3TDJA 1EZ9A 4NF4B 2OK2A 1DTZA 5AA2A 1I69A 2A5TB 2F8DA 5TP9A 3TQLA 3K00A 4BDQA 3G3KA 3LSLA 4KYDA 2F6GA 4ELRA 4H6DA 1B9JA 1ELJA 1MDQA 3C34A 1Z7NE 1SW4A 2XXQA 1FTLA 2DVCA 4IY6A 1FQAA 3QAXA 3PD8A 4EXKA 2XXYA 5ICQA 1J1NA 5I58B 2I4CA 4DCXA 3DLNA 3TTRA 1JETA 4QFPA 3PUZE 4LQ5A 1Y3NA 5J1DA 5CMMA 5I59A 4X1DA 2HEUA 4DDDA 2R71A 4Q8RA 3W15C 4PFYA 1JVYA 4XKNA 4U4SA 1O7TA 2PYYA 2ZNTA 2HQ0A 1MXXA 2DP8A 4NTLA 5K2YA 1MY3A 4U1OA 4N6PA 2I4BA 1MY2A 2I58A 2F97A 1B4ZA 3FV2A 1QW0A 5H8HA 1PEBA 2H99A 5A5XB 1O63A 3H03A 3G7WA 1H44A 4DXUA 2H98A 3H6UA 3I6VA 3JV9A 4HS7A 3TCHA 1OVBA 4O3AA 1MXYA 2Z23A 4LUBA 5AA4B 2GH9A 3IOVA 2XXVA 5B70A 4R6HA 3S4UA 3PPRA 4H5FA 4F3PA 4YU0A 3T9UA 4ESWA 2F7AA 2NXOA 1I6AA 2O6AA 3FGSA 3KJ7A 4OFJA 2DWAA 3RPWA 4U21A 3WAFA 4DIGA 1XS5A 4PE5B 4QSCA 2QSXA 3USDA 4QHQA 1PB7A 3VVDA 1KWHA 5CMCA 4ECFA 4U22A 5KDTB 3PPQA 3ZS6A 5L9OA 2P1SA 3K6UA 3U8QA 4LVQA 3VV5A 2W7YA 4F3BA 1B0HA 1ZJLA 4JBZA 4F2QA 4R75A 1XVYA 2B65A 3QIMA 2XXWA 4BDRA 3VLUA 3FD3A 4KCCA 1N76A 3OEKA 4ZS9A 1S9TA 2ABHA 4RPNA 4MLQA 4LQ2A 4BDLA 5I84A 4MF3A 5FHMA 1TWYA 1MXWA 2OCUA 4YKKA 5LOMA 2A5TA 2A5SA 1XT8A 4KD5A 2VGQA 3LUYA 4BDNA 2RC8A 4NE4A 4ZEDA 3BFUA 4YKPA 4ZE9A 3U72A 5CC2A 3U94A 1UIVA 3A3UA 4RK9A 3S9EA 5CM6A 1D9YA 1POTA 4F1UA 2Q88A 1Y3PA 1B51A 2UYEA 4PFWA 2QS2A 3PPPA 3GBAA 3C36A 4FEBA 1N3WA 3K6XA 4R6YA 3GZGA 3DP4A 3KBRA 3P7IA 4OFLA 3OEMA 2UVJA 1Y9UA 3PD9A 1NH8A 3G3HA 1US5A 5DVIA 3CSGA 1FTKA 3MBPA 3FIRA 3D4GA 3FJMA 2RF1A 2VD2A 1B1XA 4QSDA 5F7VA 1P1QA 3GXAA 3O9PA 4QFLA 3MPLA 1LGBC 3VXCA 4DLDA 2V84A 1IITA 3T22A 1B3GA 4NMYA 4R72A 3N94A 1R6ZA 2DSFA 3DP6A 3TZAA 1ZKBA 2B3FA 1EZOA 4IO7A 5A5XA 4GD5A 4OESA 3H6TA 3L6GA 5CBRA 1FTOA 1Q1KA 3TUSA 1TT1A 3KN8A 1L5TA 4QF9A 3H6VA 3QYTA 3G3JA 3VDFA 5AA4A 4OTEA 5BUUA 4NEDA 4NF8B 1N84A 3UIFA 2ALUA 3TODA 1A54A 3S2VA 4MFIA 4WKMA 3H4ZA 3TKDA 1P99A 2XD3A 4UA8A 1IQ7A 3QSLA 4KR5A 4AB5A 3FATA 4GWOA 4R2BA 5IAIA 1SW5A 3B6TA 2Y7IA 5KDTA 1ZU0A 3VLVA 4OMBA 4FORA 5I57B 1MDP1 1FQFA 1XC1A 2VD3A 3FZVA 1A7LA 4ZEFA 3S9LC 2V93A 3TCGA 1URDA 1R1NA 2F6PA 3FVKA 2QPQA 4EF2A 4THIA 1SVXB 1MQDA 4F18A 4YB7A 3W9VA 4U1ZA 2O1LA 4NF5B 4IY5A 3SESA 4RYAA 3RLFE 4EF1A 3EPEA 1II5A 1B3EA 2DXYA 4ZEBA 2O1MA 3K0VA 3M8UA 4YMBA 4HW8A 1SBPA 5M2VA 4F19A 3TTMA 5H8NB 4TOZA 1N7WA 2Q2AA 5ISUA 2VP1A 1LBCA 2ANJA 2H9BA 5AA1A 4JWXA 3N6TA 2F7BA 3KZGA 1OMPA 3W9WA 3MJNA 4C0RA 2ZNUA 4IO6A 1R9QA 2Z8FA 1VE4A 1H76A 2F36A 3TEPA 1P1OA 2V3QA 1CB6A 2DQVA 2F78A 1QUIA 4GOTA 3BKIB 1IXHA 3PV0E 3K4UA 4FJPA 4N13A 3O6IA 2ZNSA 3SEWA 5I56B 5L8DA 2ONSA 3FXRA 3M3FA 3E13X 3I5OA 3HCQA 4IO2A 3OO8A 2WKYA 1IUDA 4I1DA 1Q35A 1B40A 4RY1A 4I9DA 2XXIA 3Q28A 2CZLA 4IO5A 2GHAA 2VOZA 2IA4A 3HV1A 4DXCA 1NMUA 1ATGA 4YB5A 1PDAA 5H8SA 4RNSA 2O7UA 3C35A 4XXUA 3KJTA 4NF8A 4C1UA 1RYXA 4EXLA 1FQBA 1M5EA 4ZECA 4YICA 3TYHA 2ESNA 1B5HA 1B6HA 1P1NA 3RT6B 2V3UA 4Q5TA 1JW1A 1AL3A 5FTHA 1PBQA 1B52A 5H8FB 2HAUA 3MQ9A 2I48A 3HSTA 1BLFA 2QMWA 2XHDA 3CFZA 3TAJA 4TQUQ 4JSOA 2X7QA 1DMBA 3IO6A 4POXA 3LSXA 5EHMA 4YB6A 1FW0A 3RNNA 2XXHA 4PQJA 3K01A 4XKRA 1UTBB 1I6QA 1B3HA 4H5GA 3CIJA 2GRVA 2G29A 1MXZA 4K3FA 3Q27A 3F11A 1QJMA 4ISUA 3CSBA 3N26A 3ECRA 4IO4A 2H4IA 5F1QA 5K2XA 5TU0A 5B7DA 2AL5A 3L6HA 3FVGA 4NF5A 4R9FA 1YTVA 1PB8A 3MPKA 5BWJA 2E1SA 2ZYNA 3O6HA 4DXBA 4MLVA 3UA8A 5AA3A 5KCJB 2UVGA 3PPOA 3UN6A 2YJPA 4C1TA 4HTGA 1B3LA 1FQDA 3K1MA 4GIZA 3TTKA 1LBBA 4BDMA 3LR1A 4ELPA 1A40A 3KSJA 1QVSA 1LAXA 4G2ZA 3VVEA 2NOOA 2UVIA 1B7HA 2HCAA 3QK6A 2QL3A 4GL8A 1NNTA 1MRPA 4POWA 5L9SA 2QS4A 2XXTA 2RC7A 3A3CA 3FVOA 4O3BA 2NVUB 3EQ1A 4MH5A 4KCDA 4ZZEA 1I6BA 5JTYB 3DELB 3QXMA 2FA7A 5ITPA 5DEXB 4HCWA 2O84X 1MXUA 4QRZA 3KEIA 5DYHA 2I49A 2Q9TA 3PUXE 3V83A 4EDPA 2FYIA 5JEIA 2UXAA 4H0WA 2Z8EA 5I56A 4X48A 1LFGA 1M5FA 1SI0A 3BBRA 1XHYA 2UYFA 1OLAA 1NNKA 4OWDA 4R2FA 4XKPA 5JK4A 4ZEKA 2KLFA 4FECA 1SDXA 3U93A 3PU5A 3Q29A 4RXLA 4KPTA 4NF4A 3SEUA 2HXWA 1US4A 3KFMA 1QKAA 2HZKA 3ZKKA 3HHGA 5ELVA 3VE1B 2DVZA 3DP8A 3OMBA 3E3KA 4F39A 1AMFA 3SDFA 4GF8A 1NKXA 4L17A 4LZ8A 4GVOA 3R7XA 1B7ZA 1OQGA 1WDNA 3WAEA 3EHSA 1T0KA 4ZEIA 2DWJA 4LA9A 1SI1A 1LCFA 1D3KA 3IOWA 1MM7A 1NH7A 4PETA 5I58A 4IB2A 3RGYA 3K1NA 2ZYKA 1RYOA 3VLWA 2F5XA 4I62A 4EQ7A 4X1BA 1A8FA 4P0IA 3C9HA 1LLSA 3MVWA 4G68C 1UTBA 5CRYA 1BP5A 2R9JA 1EU8A 2IEEA 1IXIA 1TFAA 3RQTA 1M5BA 2F7CA 4OHNA 3TFLA 4PFUA 3MP1A 4GQOA 1MY0A 1YPNA 3C31A 3SETA 1AH5A 3UGWA 4GRKA 1F9BA 4F31B 4U2RA 5ITOA 3U92A 3T9HB 1USYE 1JEVA 2DS9A 3C4MA 1ZBMA 1AIVA 4YKJA 1TFDA 5AE4A 4ZDMA 2ZYMA 4RPOA 4ELQA 4QFKA 1DPEA 4RA1A 3M3LA 5AA2B 3S9MC 4JWYA 3V89B 3GBBA 4IGRA 3HHFA 3V5AA 1HSLA 3TTNA 4QFOA 4G8HA 1NNFA 2UVHA 4X9TA 2REJA 4LP2B 3ZKLA 2VHAA 3O2AA 2PMSA 3K6VA 2R6GE 3FXUA 4ND9A 3IORA 2DYXA 1NL5A 4M4GA 5HBCA 4GFRA 3QUFA 4KFQA 4Z0IA 4Z7EA 1HSJA 4F2OA 3V8XB 5JTYA 3C32A 3B7DA 3I3VA 3MVZA 4FATA 3RY3A 3CG3A 2H5YA 1FTJA 3MZBA 4HCYA 3B6WA 4M1VA 4PP0A 4TLMB 1MPBA 4R73A 3K6WA 4ZE8A 2PT2A 5I59B 3RT8A 3E9XA 1GR2A 2XXPA 3TMGA 3MZ9A 1B2HA 4EQ9A 5KZTA 1QUJA 4LZ5A 3AXFA 4WEDA 3EF7A 3IB2A 3G3IA 1O64A 1MG1A 5H8QB 2Y7WA 3R26A 2E0SA 1B58A 1TXFA 3SEVA 1B32A 1YAEA 3OD7A 1Y3QA 3RTFB 4KYSA 3O66A 1LAGE 1MQHA 3OELA 1LAHE 1MH3A 2Y7RA 2DE3A 3ILUB 3JZJA 1UTHB 3FV1A 2H25A 1IXGA 3TPAA 2Z8DA 3PMWA 3OO7A 2GFEA 2HZLA 2QMXA 3O28A 1BIYA 4P11A 3VVFA 4LONB 1ZLQA 4EQBA 1SD3A 5I2NB 2DWHA 1LB8A 5FHOA 5TPAB 4YZZA 3CRBA 2AL4A 3TELA 1OQHA 4AB6A 5EHSA 2Z22A 3EN3A 4GXSB 1P1WA 4OEUA 3KOSA 1GVCA 3T96B 5HPQA 1Y4TA 3KGCA 2OJTA 2QRYA 4PFTA 1B4HA 2QS1A 2LAOA 3VXBA 4KI0E 5IKBA 2DXRA 2QJEA 1DOTA 2HFBA 3IAZA 1ZIUA 3Q26A 4XTCQ 4P0GA 3IJXB 3E4RA 2RCAA 1URGA 1GTKA 4BLAA 3H6WA 4LZ7A 4KQPA 1MM6A 4NWCA 1IEJA 4OXVA 1JQFA 2O68A 2RINA 1DTGA 2OBGA 3SKPA 3EHTA 1FQCA 2XX8A 1R9LA 3PMVA 4TLLB 1UIUA 3GLBA 4O3CA 4OFOA 2RKMA 3IB0A 2Y7KA 1LB9A 3O29A 1B05A 4E0WA 1JW5A 2YLNA 1RKMA 2P0SA 3K1PA 1N04A 1H45A 2RC9A 5I2KB 5I57A 3PMXA 3FUZA 1B7UA 3H3GA 3UK4A 4WEPA 3T9VA 3CG1A 1JNFA 3ODBA 1SQYA 1LFIA 3MC2A 4E0XA 3FVNA 4OENA 3OOAA 4R9GA 5DTBA 3PUVE 1JW4A 1JEUA 1LCTA 3UP9A 3HN0A 2G93A 2D3IA 2ZYOA 4G77A 2B3BA 5H8QA 3CFXA 3H06B 4WXJA 4BDOA 4DE8A 4H65A 1FCKA 3A09A 3IOUA 2I0CA 5H8NA 4FAJA 3O6GA 3SEYA 3CVGA 4NF6B 1ZTYA 3B6QA 1XOCA 4XIGQ 1B0LA 2V25A 2AYSA 4JB7A 2I6EA 1SYHA 3TCFA 2Q8JA 1VFEA 2F35A 1UTHA 4IO3A 4ELOA 4ONYA 3OENA 4F22A 3LSFB 4LATA 4G68B 2CMOA 1SYIA 1EZPA 3T9XB 5I2NA 1OLCA 5TPAA 1SW2A 2REGA 4IGTA 3MZ1A 1Y1MA 5EYFA 2Q89A 3PUYE 3T93B 2HAVA 3FJ7A 2BJJX 2F34A 5CI5A 3CI8A 4RK2A 4FIMA 2NUVA 4AQ4A 1A99A 1QULA 1VR5A 1N3XA 2DE4A 2O69A 2DE2A 2V3TA 2FNCA 2Y84A 3SERA 3OSRA 3OSQA 5FTIA 2PBWA 3MUQA 4GL0A 3ONMA 1QKBA 3G3FA 5L9MA 3RUMA 4Q0CA 4H8IA 4YKIA 1MQGA 1FTMA 2XX7A 1ANFA 1MPCA 4NWDA 3TQWA 3M3KA 2X7PA 1WVJA 2ONRA 4U4XA 4GXAA 3C33A 4FEDA 3KSXA 1GGGA 4JXIA 3MWBA 2XXUA 2O7IA 4YMAA 1IIWA 1NNPA 2OWSA 5H8FA 4U23A 4JSDA 3UORA 3RTWB 1N0TA 1WODA 1IZ1A 1SW1A 4OEVA 3DM0A 5DVJA 3SEXA 1B3FA 4OZ9A 5I2KA 3IJOB 5FHNA 4R74A 3FASA 5CMBA 2XXXA 1JVXA 4KHZE 1B1HA 4QFNA 2YPNA 3CFLA 3MP8A 3QUJA 1ZMGA 4G4PA 1PB9A 4ZZAA 3KN3A 1QUKA 2P2AA 2QS3A 3RN8A 4DCYA 3LSWA 2GHBA 1NFTA 3O97A 4H8JA 4YAHX 1M5DA 3R6UA 2Q2CA 3IR1A 3S9NC 4F1YA 3T66A 4F3SA 2I0BA 4Q30B 4OQOA 1D9VA 4I8CA 5KCJA 5DT6A 1B5JA 2ZMBA 3H7MA 4R6KA 4NF6A 3MP6A 1CE2A 5CMKA 1MY4A 1A55A 5TP9B 3IK6B 3IB1A 2NWJA 4G8NA 1HSEA 2XX9A 2ZXTA 1OIBA 4OYVA 3OO6A 1XVXA 1P1UA 1D4NA 4ESXA 2AIXA 1H43A 4G68A 3D4CA 3KN7A 1YCJA 3CR9A 4XKQA 3BFTA 4N07A 3VFJA 5DEXA 3PUWE 4UACA 1POY1 1GV8A 1H3DA 5CBSA 1PC3A 2PVUA 1MY1A 3MAMA 3N6UA 3U1OA 1BTJA 5ICTA 1S50A 3HO7A 5HM4B 3IX1A 3LBSA 2PT1A 5DVFA 2XXRA 4JDFA 1MQJA 2OWTA 3LC8A 1Y20A 2RCBA 2O51A 5H8HB 4H67A 3EHUA 2M8CA 2OLBA 3K2DA 2PX1A 3MW0A 1MQIA 1PBPA 2D5WA 3HPIA 2DWIA 4F3GA 1S7YA 1UQWA 3IO4A 4QSEA 3G3GA 3TTLA 1MS7A 4GLIA 2I3WA 1Y4CA 4F29A 3N5LA 1IXCA 4G8MA 4OETA 1MH4A 1M5CA 3KG2A 3KOTA 1USYH 3THIA 1URSA 2X26A 2D21A 3FJGA 2THIA 1VFDA 1LAFE 1A8EA 3FXQA 2XD2A 1DPPA 4KYEA 4MBPA 4DZ1A 1B5IA 1Z7ME 3K02A 1EH3A 3MVXA 4JWOA 1Y1ZA 4OERA 5AA2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EUO A;  3IOT A;  1OVT A;  3PGF A;  1B46 A;  4OVJ A;  1BKA A;  2OZZ A;  1MPD A;  4FE8 A;  1DSN A;  2I3V A;  3PPN A;  3Q25 A;  3OO9 A;  3OXN A;  3ILT B;  4F1V A;  2DOJ A;  3JYR A;  4RJZ A;  3ZSF A;  2Y7P A;  1AOV A;  4H1X A;  1N7X A;  1LFH A;  1VSO A;  2ONK E;  1MXV A;  3IL1 B;  1FQE A;  3MVY A;  1LST A;  3TDJ A;  1EZ9 A;  4NF4 B;  2OK2 A;  1DTZ A;  5AA2 A;  1I69 A;  2A5T B;  2F8D A;  5TP9 A;  3TQL A;  3K00 A;  4BDQ A;  3G3K A;  3LSL A;  4KYD A;  2F6G A;  4ELR A;  4H6D A;  1B9J A;  1ELJ A;  1MDQ A;  3C34 A;  1Z7N E;  1SW4 A;  2XXQ A;  1FTL A;  2DVC A;  4IY6 A;  1FQA A;  3QAX A;  3PD8 A;  4EXK A;  2XXY A;  5ICQ A;  1J1N A;  5I58 B;  2I4C A;  4DCX A;  3DLN A;  3TTR A;  1JET A;  4QFP A;  3PUZ E;  4LQ5 A;  1Y3N A;  5J1D A;  5CMM A;  5I59 A;  4X1D A;  2HEU A;  4DDD A;  2R71 A;  4Q8R A;  3W15 C;  4PFY A;  1JVY A;  4XKN A;  4U4S A;  1O7T A;  2PYY A;  2ZNT A;  2HQ0 A;  1MXX A;  2DP8 A;  4NTL A;  5K2Y A;  1MY3 A;  4U1O A;  4N6P A;  2I4B A;  1MY2 A;  2I58 A;  2F97 A;  1B4Z A;  3FV2 A;  1QW0 A;  5H8H A;  1PEB A;  2H99 A;  5A5X B;  1O63 A;  3H03 A;  3G7W A;  1H44 A;  4DXU A;  2H98 A;  3H6U A;  3I6V A;  3JV9 A;  4HS7 A;  3TCH A;  1OVB A;  4O3A A;  1MXY A;  2Z23 A;  4LUB A;  5AA4 B;  2GH9 A;  3IOV A;  2XXV A;  5B70 A;  4R6H A;  3S4U A;  3PPR A;  4H5F A;  4F3P A;  4YU0 A;  3T9U A;  4ESW A;  2F7A A;  2NXO A;  1I6A A;  2O6A A;  3FGS A;  3KJ7 A;  4OFJ A;  2DWA A;  3RPW A;  4U21 A;  3WAF A;  4DIG A;  1XS5 A;  4PE5 B;  4QSC A;  2QSX A;  3USD A;  4QHQ A;  1PB7 A;  3VVD A;  1KWH A;  5CMC A;  4ECF A;  4U22 A;  5KDT B;  3PPQ A;  3ZS6 A;  5L9O A;  2P1S A;  3K6U A;  3U8Q A;  4LVQ A;  3VV5 A;  2W7Y A;  4F3B A;  1B0H A;  1ZJL A;  4JBZ A;  4F2Q A;  4R75 A;  1XVY A;  2B65 A;  3QIM A;  2XXW A;  4BDR A;  3VLU A;  3FD3 A;  4KCC A;  1N76 A;  3OEK A;  4ZS9 A;  1S9T A;  2ABH A;  4RPN A;  4MLQ A;  4LQ2 A;  4BDL A;  5I84 A;  4MF3 A;  5FHM A;  1TWY A;  1MXW A;  2OCU A;  4YKK A;  5LOM A;  2A5T A;  2A5S A;  1XT8 A;  4KD5 A;  2VGQ A;  3LUY A;  4BDN A;  2RC8 A;  4NE4 A;  4ZED A;  3BFU A;  4YKP A;  4ZE9 A;  3U72 A;  5CC2 A;  3U94 A;  1UIV A;  3A3U A;  4RK9 A;  3S9E A;  5CM6 A;  1D9Y A;  1POT A;  4F1U A;  2Q88 A;  1Y3P A;  1B51 A;  2UYE A;  4PFW A;  2QS2 A;  3PPP A;  3GBA A;  3C36 A;  4FEB A;  1N3W A;  3K6X A;  4R6Y A;  3GZG A;  3DP4 A;  3KBR A;  3P7I A;  4OFL A;  3OEM A;  2UVJ A;  1Y9U A;  3PD9 A;  1NH8 A;  3G3H A;  1US5 A;  5DVI A;  3CSG A;  1FTK A;  3MBP A;  3FIR A;  3D4G A;  3FJM A;  2RF1 A;  2VD2 A;  1B1X A;  4QSD A;  5F7V A;  1P1Q A;  3GXA A;  3O9P A;  4QFL A;  3MPL A;  1LGB C;  3VXC A;  4DLD A;  2V84 A;  1IIT A;  3T22 A;  1B3G A;  4NMY A;  4R72 A;  3N94 A;  1R6Z A;  2DSF A;  3DP6 A;  3TZA A;  1ZKB A;  2B3F A;  1EZO A;  4IO7 A;  5A5X A;  4GD5 A;  4OES A;  3H6T A;  3L6G A;  5CBR A;  1FTO A;  1Q1K A;  3TUS A;  1TT1 A;  3KN8 A;  1L5T A;  4QF9 A;  3H6V A;  3QYT A;  3G3J A;  3VDF A;  5AA4 A;  4OTE A;  5BUU A;  4NED A;  4NF8 B;  1N84 A;  3UIF A;  2ALU A;  3TOD A;  1A54 A;  3S2V A;  4MFI A;  4WKM A;  3H4Z A;  3TKD A;  1P99 A;  2XD3 A;  4UA8 A;  1IQ7 A;  3QSL A;  4KR5 A;  4AB5 A;  3FAT A;  4GWO A;  4R2B A;  5IAI A;  1SW5 A;  3B6T A;  2Y7I A;  5KDT A;  1ZU0 A;  3VLV A;  4OMB A;  4FOR A;  5I57 B;  1MDP 1;  1FQF A;  1XC1 A;  2VD3 A;  3FZV A;  1A7L A;  4ZEF A;  3S9L C;  2V93 A;  3TCG A;  1URD A;  1R1N A;  2F6P A;  3FVK A;  2QPQ A;  4EF2 A;  4THI A;  1SVX B;  1MQD A;  4F18 A;  4YB7 A;  3W9V A;  4U1Z A;  2O1L A;  4NF5 B;  4IY5 A;  3SES A;  4RYA A;  3RLF E;  4EF1 A;  3EPE A;  1II5 A;  1B3E A;  2DXY A;  4ZEB A;  2O1M A;  3K0V A;  3M8U A;  4YMB A;  4HW8 A;  1SBP A;  5M2V A;  4F19 A;  3TTM A;  5H8N B;  4TOZ A;  1N7W A;  2Q2A A;  5ISU A;  2VP1 A;  1LBC A;  2ANJ A;  2H9B A;  5AA1 A;  4JWX A;  3N6T A;  2F7B A;  3KZG A;  1OMP A;  3W9W A;  3MJN A;  4C0R A;  2ZNU A;  4IO6 A;  1R9Q A;  2Z8F A;  1VE4 A;  1H76 A;  2F36 A;  3TEP A;  1P1O A;  2V3Q A;  1CB6 A;  2DQV A;  2F78 A;  1QUI A;  4GOT A;  3BKI B;  1IXH A;  3PV0 E;  3K4U A;  4FJP A;  4N13 A;  3O6I A;  2ZNS A;  3SEW A;  5I56 B;  5L8D A;  2ONS A;  3FXR A;  3M3F A;  3E13 X;  3I5O A;  3HCQ A;  4IO2 A;  3OO8 A;  2WKY A;  1IUD A;  4I1D A;  1Q35 A;  1B40 A;  4RY1 A;  4I9D A;  2XXI A;  3Q28 A;  2CZL A;  4IO5 A;  2GHA A;  2VOZ A;  2IA4 A;  3HV1 A;  4DXC A;  1NMU A;  1ATG A;  4YB5 A;  1PDA A;  5H8S A;  4RNS A;  2O7U A;  3C35 A;  4XXU A;  3KJT A;  4NF8 A;  4C1U A;  1RYX A;  4EXL A;  1FQB A;  1M5E A;  4ZEC A;  4YIC A;  3TYH A;  2ESN A;  1B5H A;  1B6H A;  1P1N A;  3RT6 B;  2V3U A;  4Q5T A;  1JW1 A;  1AL3 A;  5FTH A;  1PBQ A;  1B52 A;  5H8F B;  2HAU A;  3MQ9 A;  2I48 A;  3HST A;  1BLF A;  2QMW A;  2XHD A;  3CFZ A;  3TAJ A;  4TQU Q;  4JSO A;  2X7Q A;  1DMB A;  3IO6 A;  4POX A;  3LSX A;  5EHM A;  4YB6 A;  1FW0 A;  3RNN A;  2XXH A;  4PQJ A;  3K01 A;  4XKR A;  1UTB B;  1I6Q A;  1B3H A;  4H5G A;  3CIJ A;  2GRV A;  2G29 A;  1MXZ A;  4K3F A;  3Q27 A;  3F11 A;  1QJM A;  4ISU A;  3CSB A;  3N26 A;  3ECR A;  4IO4 A;  2H4I A;  5F1Q A;  5K2X A;  5TU0 A;  5B7D A;  2AL5 A;  3L6H A;  3FVG A;  4NF5 A;  4R9F A;  1YTV A;  1PB8 A;  3MPK A;  5BWJ A;  2E1S A;  2ZYN A;  3O6H A;  4DXB A;  4MLV A;  3UA8 A;  5AA3 A;  5KCJ B;  2UVG A;  3PPO A;  3UN6 A;  2YJP A;  4C1T A;  4HTG A;  1B3L A;  1FQD A;  3K1M A;  4GIZ A;  3TTK A;  1LBB A;  4BDM A;  3LR1 A;  4ELP A;  1A40 A;  3KSJ A;  1QVS A;  1LAX A;  4G2Z A;  3VVE A;  2NOO A;  2UVI A;  1B7H A;  2HCA A;  3QK6 A;  2QL3 A;  4GL8 A;  1NNT A;  1MRP A;  4POW A;  5L9S A;  2QS4 A;  2XXT A;  2RC7 A;  3A3C A;  3FVO A;  4O3B A;  2NVU B;  3EQ1 A;  4MH5 A;  4KCD A;  4ZZE A;  1I6B A;  5JTY B;  3DEL B;  3QXM A;  2FA7 A;  5ITP A;  5DEX B;  4HCW A;  2O84 X;  1MXU A;  4QRZ A;  3KEI A;  5DYH A;  2I49 A;  2Q9T A;  3PUX E;  3V83 A;  4EDP A;  2FYI A;  5JEI A;  2UXA A;  4H0W A;  2Z8E A;  5I56 A;  4X48 A;  1LFG A;  1M5F A;  1SI0 A;  3BBR A;  1XHY A;  2UYF A;  1OLA A;  1NNK A;  4OWD A;  4R2F A;  4XKP A;  5JK4 A;  4ZEK A;  2KLF A;  4FEC A;  1SDX A;  3U93 A;  3PU5 A;  3Q29 A;  4RXL A;  4KPT A;  4NF4 A;  3SEU A;  2HXW A;  1US4 A;  3KFM A;  1QKA A;  2HZK A;  3ZKK A;  3HHG A;  5ELV A;  3VE1 B;  2DVZ A;  3DP8 A;  3OMB A;  3E3K A;  4F39 A;  1AMF A;  3SDF A;  4GF8 A;  1NKX A;  4L17 A;  4LZ8 A;  4GVO A;  3R7X A;  1B7Z A;  1OQG A;  1WDN A;  3WAE A;  3EHS A;  1T0K A;  4ZEI A;  2DWJ A;  4LA9 A;  1SI1 A;  1LCF A;  1D3K A;  3IOW A;  1MM7 A;  1NH7 A;  4PET A;  5I58 A;  4IB2 A;  3RGY A;  3K1N A;  2ZYK A;  1RYO A;  3VLW A;  2F5X A;  4I62 A;  4EQ7 A;  4X1B A;  1A8F A;  4P0I A;  3C9H A;  1LLS A;  3MVW A;  4G68 C;  1UTB A;  5CRY A;  1BP5 A;  2R9J A;  1EU8 A;  2IEE A;  1IXI A;  1TFA A;  3RQT A;  1M5B A;  2F7C A;  4OHN A;  3TFL A;  4PFU A;  3MP1 A;  4GQO A;  1MY0 A;  1YPN A;  3C31 A;  3SET A;  1AH5 A;  3UGW A;  4GRK A;  1F9B A;  4F31 B;  4U2R A;  5ITO A;  3U92 A;  3T9H B;  1USY E;  1JEV A;  2DS9 A;  3C4M A;  1ZBM A;  1AIV A;  4YKJ A;  1TFD A;  5AE4 A;  4ZDM A;  2ZYM A;  4RPO A;  4ELQ A;  4QFK A;  1DPE A;  4RA1 A;  3M3L A;  5AA2 B;  3S9M C;  4JWY A;  3V89 B;  3GBB A;  4IGR A;  3HHF A;  3V5A A;  1HSL A;  3TTN A;  4QFO A;  4G8H A;  1NNF A;  2UVH A;  4X9T A;  2REJ A;  4LP2 B;  3ZKL A;  2VHA A;  3O2A A;  2PMS A;  3K6V A;  2R6G E;  3FXU A;  4ND9 A;  3IOR A;  2DYX A;  1NL5 A;  4M4G A;  5HBC A;  4GFR A;  3QUF A;  4KFQ A;  4Z0I A;  4Z7E A;  1HSJ A;  4F2O A;  3V8X B;  5JTY A;  3C32 A;  3B7D A;  3I3V A;  3MVZ A;  4FAT A;  3RY3 A;  3CG3 A;  2H5Y A;  1FTJ A;  3MZB A;  4HCY A;  3B6W A;  4M1V A;  4PP0 A;  4TLM B;  1MPB A;  4R73 A;  3K6W A;  4ZE8 A;  2PT2 A;  5I59 B;  3RT8 A;  3E9X A;  1GR2 A;  2XXP A;  3TMG A;  3MZ9 A;  1B2H A;  4EQ9 A;  5KZT A;  1QUJ A;  4LZ5 A;  3AXF A;  4WED A;  3EF7 A;  3IB2 A;  3G3I A;  1O64 A;  1MG1 A;  5H8Q B;  2Y7W A;  3R26 A;  2E0S A;  1B58 A;  1TXF A;  3SEV A;  1B32 A;  1YAE A;  3OD7 A;  1Y3Q A;  3RTF B;  4KYS A;  3O66 A;  1LAG E;  1MQH A;  3OEL A;  1LAH E;  1MH3 A;  2Y7R A;  2DE3 A;  3ILU B;  3JZJ A;  1UTH B;  3FV1 A;  2H25 A;  1IXG A;  3TPA A;  2Z8D A;  3PMW A;  3OO7 A;  2GFE A;  2HZL A;  2QMX A;  3O28 A;  1BIY A;  4P11 A;  3VVF A;  4LON B;  1ZLQ A;  4EQB A;  1SD3 A;  5I2N B;  2DWH A;  1LB8 A;  5FHO A;  5TPA B;  4YZZ A;  3CRB A;  2AL4 A;  3TEL A;  1OQH A;  4AB6 A;  5EHS A;  2Z22 A;  3EN3 A;  4GXS B;  1P1W A;  4OEU A;  3KOS A;  1GVC A;  3T96 B;  5HPQ A;  1Y4T A;  3KGC A;  2OJT A;  2QRY A;  4PFT A;  1B4H A;  2QS1 A;  2LAO A;  3VXB A;  4KI0 E;  5IKB A;  2DXR A;  2QJE A;  1DOT A;  2HFB A;  3IAZ A;  1ZIU A;  3Q26 A;  4XTC Q;  4P0G A;  3IJX B;  3E4R A;  2RCA A;  1URG A;  1GTK A;  4BLA A;  3H6W A;  4LZ7 A;  4KQP A;  1MM6 A;  4NWC A;  1IEJ A;  4OXV A;  1JQF A;  2O68 A;  2RIN A;  1DTG A;  2OBG A;  3SKP A;  3EHT A;  1FQC A;  2XX8 A;  1R9L A;  3PMV A;  4TLL B;  1UIU A;  3GLB A;  4O3C A;  4OFO A;  2RKM A;  3IB0 A;  2Y7K A;  1LB9 A;  3O29 A;  1B05 A;  4E0W A;  1JW5 A;  2YLN A;  1RKM A;  2P0S A;  3K1P A;  1N04 A;  1H45 A;  2RC9 A;  5I2K B;  5I57 A;  3PMX A;  3FUZ A;  1B7U A;  3H3G A;  3UK4 A;  4WEP A;  3T9V A;  3CG1 A;  1JNF A;  3ODB A;  1SQY A;  1LFI A;  3MC2 A;  4E0X A;  3FVN A;  4OEN A;  3OOA A;  4R9G A;  5DTB A;  3PUV E;  1JW4 A;  1JEU A;  1LCT A;  3UP9 A;  3HN0 A;  2G93 A;  2D3I A;  2ZYO A;  4G77 A;  2B3B A;  5H8Q A;  3CFX A;  3H06 B;  4WXJ A;  4BDO A;  4DE8 A;  4H65 A;  1FCK A;  3A09 A;  3IOU A;  2I0C A;  5H8N A;  4FAJ A;  3O6G A;  3SEY A;  3CVG A;  4NF6 B;  1ZTY A;  3B6Q A;  1XOC A;  4XIG Q;  1B0L A;  2V25 A;  2AYS A;  4JB7 A;  2I6E A;  1SYH A;  3TCF A;  2Q8J A;  1VFE A;  2F35 A;  1UTH A;  4IO3 A;  4ELO A;  4ONY A;  3OEN A;  4F22 A;  3LSF B;  4LAT A;  4G68 B;  2CMO A;  1SYI A;  1EZP A;  3T9X B;  5I2N A;  1OLC A;  5TPA A;  1SW2 A;  2REG A;  4IGT A;  3MZ1 A;  1Y1M A;  5EYF A;  2Q89 A;  3PUY E;  3T93 B;  2HAV A;  3FJ7 A;  2BJJ X;  2F34 A;  5CI5 A;  3CI8 A;  4RK2 A;  4FIM A;  2NUV A;  4AQ4 A;  1A99 A;  1QUL A;  1VR5 A;  1N3X A;  2DE4 A;  2O69 A;  2DE2 A;  2V3T A;  2FNC A;  2Y84 A;  3SER A;  3OSR A;  3OSQ A;  5FTI A;  2PBW A;  3MUQ A;  4GL0 A;  3ONM A;  1QKB A;  3G3F A;  5L9M A;  3RUM A;  4Q0C A;  4H8I A;  4YKI A;  1MQG A;  1FTM A;  2XX7 A;  1ANF A;  1MPC A;  4NWD A;  3TQW A;  3M3K A;  2X7P A;  1WVJ A;  2ONR A;  4U4X A;  4GXA A;  3C33 A;  4FED A;  3KSX A;  1GGG A;  4JXI A;  3MWB A;  2XXU A;  2O7I A;  4YMA A;  1IIW A;  1NNP A;  2OWS A;  5H8F A;  4U23 A;  4JSD A;  3UOR A;  3RTW B;  1N0T A;  1WOD A;  1IZ1 A;  1SW1 A;  4OEV A;  3DM0 A;  5DVJ A;  3SEX A;  1B3F A;  4OZ9 A;  5I2K A;  3IJO B;  5FHN A;  4R74 A;  3FAS A;  5CMB A;  2XXX A;  1JVX A;  4KHZ E;  1B1H A;  4QFN A;  2YPN A;  3CFL A;  3MP8 A;  3QUJ A;  1ZMG A;  4G4P A;  1PB9 A;  4ZZA A;  3KN3 A;  1QUK A;  2P2A A;  2QS3 A;  3RN8 A;  4DCY A;  3LSW A;  2GHB A;  1NFT A;  3O97 A;  4H8J A;  4YAH X;  1M5D A;  3R6U A;  2Q2C A;  3IR1 A;  3S9N C;  4F1Y A;  3T66 A;  4F3S A;  2I0B A;  4Q30 B;  4OQO A;  1D9V A;  4I8C A;  5KCJ A;  5DT6 A;  1B5J A;  2ZMB A;  3H7M A;  4R6K A;  4NF6 A;  3MP6 A;  1CE2 A;  5CMK A;  1MY4 A;  1A55 A;  5TP9 B;  3IK6 B;  3IB1 A;  2NWJ A;  4G8N A;  1HSE A;  2XX9 A;  2ZXT A;  1OIB A;  4OYV A;  3OO6 A;  1XVX A;  1P1U A;  1D4N A;  4ESX A;  2AIX A;  1H43 A;  4G68 A;  3D4C A;  3KN7 A;  1YCJ A;  3CR9 A;  4XKQ A;  3BFT A;  4N07 A;  3VFJ A;  5DEX A;  3PUW E;  4UAC A;  1POY 1;  1GV8 A;  1H3D A;  5CBS A;  1PC3 A;  2PVU A;  1MY1 A;  3MAM A;  3N6U A;  3U1O A;  1BTJ A;  5ICT A;  1S50 A;  3HO7 A;  5HM4 B;  3IX1 A;  3LBS A;  2PT1 A;  5DVF A;  2XXR A;  4JDF A;  1MQJ A;  2OWT A;  3LC8 A;  1Y20 A;  2RCB A;  2O51 A;  5H8H B;  4H67 A;  3EHU A;  2M8C A;  2OLB A;  3K2D A;  2PX1 A;  3MW0 A;  1MQI A;  1PBP A;  2D5W A;  3HPI A;  2DWI A;  4F3G A;  1S7Y A;  1UQW A;  3IO4 A;  4QSE A;  3G3G A;  3TTL A;  1MS7 A;  4GLI A;  2I3W A;  1Y4C A;  4F29 A;  3N5L A;  1IXC A;  4G8M A;  4OET A;  1MH4 A;  1M5C A;  3KG2 A;  3KOT A;  1USY H;  3THI A;  1URS A;  2X26 A;  2D21 A;  3FJG A;  2THI A;  1VFD A;  1LAF E;  1A8E A;  3FXQ A;  2XD2 A;  1DPP A;  4KYE A;  4MBP A;  4DZ1 A;  1B5I A;  1Z7M E;  3K02 A;  1EH3 A;  3MVX A;  4JWO A;  1Y1Z A;  4OER A;  5AA2 D; 
#chains in the Genus database with same CATH topology
 4EUO A;  3IOT A;  1OVT A;  3PGF A;  1B46 A;  4OVJ A;  1BKA A;  2OZZ A;  1MPD A;  4FE8 A;  1DSN A;  2I3V A;  3KBZ A;  3PPN A;  3PTY A;  3Q25 A;  3OO9 A;  3OXN A;  3ILT B;  3MYU A;  4F1V A;  2DOJ A;  5LTC A;  3JYR A;  2FVZ A;  4RJZ A;  3ZSF A;  2Y7P A;  1AOV A;  4H1X A;  1N7X A;  2WBD A;  1LFH A;  1VSO A;  2ONK E;  1MXV A;  3IL1 B;  1FQE A;  3MVY A;  1LST A;  3TDJ A;  1EZ9 A;  4NF4 B;  2OK2 A;  1DTZ A;  5AA2 A;  1I69 A;  2A5T B;  2F8D A;  5TP9 A;  3TQL A;  3K00 A;  4BDQ A;  1KA1 A;  3G3K A;  3LSL A;  4KYD A;  2F6G A;  5IM2 A;  4ELR A;  4H6D A;  1B9J A;  1ELJ A;  1MDQ A;  4NX1 A;  2KR0 A;  3C34 A;  1Z7N E;  1SW4 A;  1K9Z A;  2XXQ A;  1FTL A;  2DVC A;  4IY6 A;  4NQ8 A;  1FQA A;  3QAX A;  3PD8 A;  4EXK A;  2XXY A;  5ICQ A;  1J1N A;  5I58 B;  2I4C A;  4DCX A;  3DLN A;  3TTR A;  1JET A;  4QFP A;  3PUZ E;  5A5L A;  4LQ5 A;  1Y3N A;  5J1D A;  5CMM A;  5I59 A;  4X1D A;  2HEU A;  4DDD A;  2R71 A;  4Q8R A;  3W15 C;  4PFY A;  1JVY A;  4XKN A;  4U4S A;  1O7T A;  2PYY A;  2ZNT A;  2HQ0 A;  1MXX A;  4PE3 A;  2DP8 A;  4NTL A;  4NAP A;  5K2Y A;  1D9Q A;  1MY3 A;  2HHM A;  4U1O A;  4N6P A;  2XWV A;  2I4B A;  1MY2 A;  4P9K A;  2I58 A;  4I3Y A;  2F97 A;  1B4Z A;  3FV2 A;  1QW0 A;  1LBZ A;  5H8H A;  1PEB A;  2H99 A;  5A5X B;  1O63 A;  4N15 A;  3H03 A;  3G7W A;  1YYZ A;  4N17 A;  1H44 A;  4DXU A;  1FBE A;  5LDZ A;  4PDD A;  2H98 A;  3H6U A;  3I6V A;  3JV9 A;  4OVT A;  4HS7 A;  3TCH A;  1OVB A;  4O3A A;  1MXY A;  2Z23 A;  4LUB A;  5AA4 B;  3T0J A;  2GH9 A;  5EQ9 A;  3IOV A;  2XXV A;  5B70 A;  4R6H A;  3S4U A;  3PPR A;  4PBH A;  4H5F A;  4F3P A;  2R8T A;  4YU0 A;  2PCR A;  3T9U A;  4ESW A;  2F7A A;  1LBW A;  2NXO A;  1I6A A;  2O6A A;  3FGS A;  3LUZ A;  3KJ7 A;  4OFJ A;  2DWA A;  3RPW A;  4U21 A;  3WAF A;  4DIG A;  1XS5 A;  4PE5 B;  4QSC A;  2QSX A;  3SZP A;  3USD A;  4QHQ A;  1PB7 A;  3VVD A;  1KWH A;  5CMC A;  4ECF A;  1FBP A;  3IFA A;  4U22 A;  5KDT B;  3PPQ A;  3ZS6 A;  5L9O A;  2P1S A;  3K6U A;  3U8Q A;  4LVQ A;  3VV5 A;  4PF6 A;  2W7Y A;  4F3B A;  1B0H A;  1ZJL A;  4JBZ A;  4F2Q A;  4R75 A;  1XVY A;  4NGU A;  2B65 A;  2B4L A;  3QIM A;  4JVD A;  2XXW A;  5DW8 A;  4BDR A;  3VLU A;  3FD3 A;  4KCC A;  1N76 A;  3OEK A;  4ZS9 A;  4NHB A;  1S9T A;  2ABH A;  1NV1 A;  4RPN A;  4MLQ A;  1NUY A;  4LQ2 A;  4BDL A;  5I84 A;  2Q74 A;  1NV3 A;  4MF3 A;  5FHM A;  1TWY A;  1MXW A;  2OCU A;  1YZ0 A;  4PFB A;  4YKK A;  5LOM A;  2A5T A;  2A5S A;  1XT8 A;  4KD5 A;  2VGQ A;  3LUY A;  4BDN A;  2RC8 A;  4NE4 A;  4ZED A;  3BFU A;  4YKP A;  4O7I A;  4ZE9 A;  3U72 A;  3A29 A;  1CNQ A;  5CC2 A;  3U94 A;  1UIV A;  3A3U A;  4RK9 A;  3S9E A;  5CM6 A;  1D9Y A;  1POT A;  4F1U A;  2Q88 A;  1Y3P A;  1B51 A;  2UYE A;  4PFW A;  2QS2 A;  3PPP A;  1Q9D A;  3GBA A;  3C36 A;  4FEB A;  1N3W A;  3K6X A;  1EYK A;  4R6Y A;  4O8M A;  3GZG A;  3DP4 A;  3KBR A;  1NV7 A;  3P7I A;  4OFL A;  3OEM A;  5F24 A;  2UVJ A;  1Y9U A;  3PD9 A;  1NH8 A;  3G3H A;  2HXR A;  1US5 A;  2FIE A;  5DVI A;  3CSG A;  1FTK A;  3MBP A;  2OWZ A;  3FIR A;  3D4G A;  3FJM A;  2RF1 A;  2VD2 A;  4JVC A;  3IFC A;  1B1X A;  2QVV A;  4QSD A;  5F7V A;  1P1Q A;  3GXA A;  3O9P A;  4QFL A;  4NF0 A;  3MPL A;  4OVR A;  1LGB C;  3VXC A;  4DLD A;  5IZ1 A;  2V84 A;  1IIT A;  1B3G A;  4NMY A;  3T22 A;  4R72 A;  1FPG A;  3N94 A;  1R6Z A;  2DSF A;  3RPL B;  3DP6 A;  3TZA A;  1ZKB A;  2B3F A;  1EZO A;  4IO7 A;  3E79 A;  5A5X A;  4GD5 A;  4OES A;  3H6T A;  3L6G A;  5CBR A;  1FTO A;  1Q1K A;  3TUS A;  1TT1 A;  5I7I A;  3KN8 A;  1L5T A;  1YXI A;  4QF9 A;  4PAI A;  3H6V A;  3QYT A;  3G3J A;  3VDF A;  5AA4 A;  1G0H A;  3E78 A;  4OTE A;  5BUU A;  4NED A;  4NF8 B;  1N84 A;  3UIF A;  2ALU A;  3TOD A;  1A54 A;  3S2V A;  4MFI A;  4WKM A;  3H4Z A;  5IZ3 A;  3TKD A;  1P99 A;  2XD3 A;  4UA8 A;  1IQ7 A;  3QSL A;  1FBD A;  1FPJ A;  4MIJ A;  4KR5 A;  4AB5 A;  3ISP A;  3BIG A;  3FAT A;  4GWO A;  4R2B A;  5IAI A;  2HPG A;  1SW5 A;  4PFR A;  3B6T A;  2Y7I A;  4N8Y A;  5KDT A;  1ZU0 A;  3VLV A;  4OMB A;  4P47 A;  4FOR A;  5I57 B;  1MDP 1;  1FQF A;  1XC1 A;  2VD3 A;  3FZV A;  1A7L A;  2Y5L A;  3FXB A;  1FRP A;  1JP4 A;  4ZEF A;  3S9L C;  2V93 A;  3TCG A;  1URD A;  1R1N A;  2F6P A;  3FVK A;  2QPQ A;  4EF2 A;  4DI3 D;  4THI A;  1SVX B;  1MQD A;  4F18 A;  4YB7 A;  3W9V A;  4U1Z A;  2O1L A;  4NF5 B;  2L5V A;  5EQA A;  4IY5 A;  3SES A;  4RYA A;  3RLF E;  4EF1 A;  3EPE A;  1II5 A;  1B3E A;  1LEV A;  2DXY A;  4ZEB A;  2O1M A;  3K0V A;  1XI6 A;  2CEY A;  3M8U A;  4YMB A;  4HW8 A;  1SBP A;  5M2V A;  4F19 A;  3TTM A;  5H8N B;  4TOZ A;  1N7W A;  2Q2A A;  5ISU A;  2VP1 A;  1LBC A;  4PDH A;  2ANJ A;  2H9B A;  4OVP A;  5AA1 A;  4JWX A;  3N6T A;  2F7B A;  3KZG A;  1OMP A;  3W9W A;  3MJN A;  4C0R A;  4GWY A;  2ZNU A;  4IO6 A;  1R9Q A;  2Z8F A;  1VE4 A;  1H76 A;  3FBP A;  2F36 A;  3TEP A;  1P1O A;  4HXV A;  2V3Q A;  1CB6 A;  2DQV A;  2F78 A;  1QUI A;  4GOT A;  3BKI B;  4PTK A;  1IXH A;  3PV0 E;  1NV0 A;  3K4U A;  2WX9 A;  4FJP A;  3KC0 A;  4N13 A;  3O6I A;  2ZNS A;  3SEW A;  2BJI A;  5I56 B;  5L8D A;  1NUX A;  2ONS A;  4GX4 A;  3FXR A;  3M3F A;  3E13 X;  3I5O A;  4N8G A;  3HCQ A;  3RPL A;  1BK4 A;  4IO2 A;  3OO8 A;  2WKY A;  1IUD A;  4I1D A;  4LN5 A;  1Q35 A;  4GX3 A;  2F3B A;  1B40 A;  4G61 A;  4RY1 A;  4I9D A;  3CHG A;  2XXI A;  3Q28 A;  2CZL A;  4IO5 A;  2PFY A;  2GHA A;  2VOZ A;  2IA4 A;  1FPK A;  3HV1 A;  4DXC A;  4IR8 A;  1NMU A;  1ATG A;  4YB5 A;  1PDA A;  5H8S A;  4RNS A;  2O7U A;  2VPN A;  3C35 A;  4XXU A;  3KJT A;  4NF8 A;  4C1U A;  1RYX A;  4EXL A;  1FQB A;  1M5E A;  4ZEC A;  4YIC A;  3TYH A;  2ESN A;  4I40 A;  4UAB A;  1B5H A;  1B6H A;  1P1N A;  3RT6 B;  2V3U A;  4Q5T A;  1JW1 A;  1AL3 A;  5FTH A;  1PBQ A;  2KQZ A;  1B52 A;  5H8F B;  2HAU A;  3MQ9 A;  2WYP A;  2I48 A;  3HST A;  1BLF A;  2QMW A;  2XHD A;  3CFZ A;  3TAJ A;  4TQU Q;  4JSO A;  2X7Q A;  1DMB A;  3IO6 A;  4POX A;  3LSX A;  5EHM A;  2XWO A;  4PAK A;  4YB6 A;  1FW0 A;  3RNN A;  2XXH A;  4PQJ A;  3K01 A;  4XKR A;  1IMA A;  1UTB B;  2XA5 A;  1I6Q A;  1B3H A;  4GWX A;  4H5G A;  3CIJ A;  2GRV A;  2G29 A;  1MXZ A;  1FPB A;  1NUW A;  4K3F A;  3Q27 A;  3F11 A;  1QJM A;  4ISU A;  3CSB A;  3N26 A;  3ECR A;  4IO4 A;  4GX6 A;  2H4I A;  5F1Q A;  1NV2 A;  5K2X A;  5TU0 A;  5B7D A;  2F3D A;  2Q8M A;  2AL5 A;  2XXK A;  3L6H A;  3FVG A;  4NF5 A;  4R9F A;  1YTV A;  1KA0 A;  1PB8 A;  1NI9 A;  3MPK A;  1NUZ A;  5BWJ A;  2E1S A;  5ET8 A;  2ZYN A;  3O6H A;  4OAN A;  1K9Y A;  4DXB A;  4MLV A;  3UA8 A;  5AA3 A;  5KCJ B;  2UVG A;  3PPO A;  3UN6 A;  2YJP A;  2GQ1 A;  4C1T A;  4HTG A;  1B3L A;  1FQD A;  3K1M A;  4GIZ A;  3TTK A;  1LBB A;  4BDM A;  3LR1 A;  4ELP A;  1A40 A;  3KSJ A;  1QVS A;  1LAX A;  4G2Z A;  3VVE A;  2NOO A;  2UVI A;  1B7H A;  2HCA A;  3QK6 A;  2QL3 A;  1IMB A;  4GL8 A;  1NNT A;  1MRP A;  1LBX A;  4POW A;  3RYD A;  5L9S A;  2QS4 A;  2XXT A;  2RC7 A;  3A3C A;  1FPD A;  3FVO A;  4O3B A;  3EQ1 A;  4MH5 A;  2NVU B;  4KCD A;  5I5P A;  4ZZE A;  1I6B A;  5JTY B;  2B4M A;  3DEL B;  3QXM A;  2FA7 A;  4KXP A;  2WYK A;  1FPL A;  5ITP A;  5DEX B;  4HCW A;  2O84 X;  1MXU A;  2MKZ A;  4QRZ A;  3B50 A;  4X8R A;  3KEI A;  1EYI A;  5DYH A;  2I49 A;  2Q9T A;  3PUX E;  3V83 A;  4EDP A;  2FYI A;  5JEI A;  2UXA A;  4H0W A;  2Z8E A;  5I56 A;  4X48 A;  1LFG A;  1M5F A;  1SI0 A;  3BBR A;  1XHY A;  2UYF A;  1OLA A;  5EQ8 A;  1NNK A;  4OWD A;  4R2F A;  4XKP A;  3T1B A;  5JK4 A;  4ZEK A;  2KLF A;  4FEC A;  1SDX A;  3U93 A;  3U65 A;  3PU5 A;  3Q29 A;  4RXL A;  4KPT A;  4NF4 A;  3SEU A;  2HXW A;  1US4 A;  3KFM A;  1QKA A;  2HZK A;  4QXD A;  3ZKK A;  3HHG A;  5ELV A;  3VE1 B;  1EYJ A;  1SPI A;  2DVZ A;  3DP8 A;  1FTA A;  3OMB A;  3E3K A;  4F39 A;  1AMF A;  2OX3 A;  3SDF A;  4GF8 A;  1NV4 A;  1NKX A;  4L17 A;  4LZ8 A;  4GVO A;  3R7X A;  1B7Z A;  1OQG A;  1WDN A;  3WAE A;  3EHS A;  1T0K A;  4ZEI A;  2DWJ A;  4HE1 A;  4LA9 A;  1SI1 A;  1LCF A;  2XWI A;  1D3K A;  3IOW A;  1MM7 A;  1NH7 A;  4PET A;  5I58 A;  4IB2 A;  2QVR A;  3RGY A;  3K1N A;  2ZYK A;  1RYO A;  3VLW A;  2F5X A;  4I62 A;  4MEV A;  4EQ7 A;  4X1B A;  1A8F A;  4PBQ A;  4P0I A;  3C9H A;  4GBV A;  1LLS A;  5ET5 A;  3MVW A;  4G68 C;  1UTB A;  5CRY A;  1BP5 A;  2R9J A;  1EU8 A;  2IEE A;  1IXI A;  1TFA A;  1FBH A;  3RQT A;  5J16 A;  2CZH A;  1M5B A;  2F7C A;  4OHN A;  3TFL A;  4PFU A;  2P3V A;  2VT5 A;  3MP1 A;  4GQO A;  1MY0 A;  1YPN A;  1IME A;  3C31 A;  3SET A;  1AH5 A;  3UGW A;  4GRK A;  1F9B A;  4F31 B;  4U2R A;  5ITO A;  3U92 A;  3T9H B;  1USY E;  1JEV A;  2DS9 A;  3C4M A;  1ZBM A;  1AIV A;  4YKJ A;  1TFD A;  5AE4 A;  4ZDM A;  2ZYM A;  4GWW A;  4RPO A;  4ELQ A;  4QFK A;  1DPE A;  2FIX A;  4N91 A;  4RA1 A;  3M3L A;  5AA2 B;  3S9M C;  4PCD A;  4JWY A;  3V89 B;  3GBB A;  4IGR A;  3HHF A;  3V5A A;  1HSL A;  3TTN A;  4QFO A;  4G8H A;  1NNF A;  2UVH A;  4X9T A;  2REJ A;  1FPE A;  4LP2 B;  3ZKL A;  2VHA A;  3O2A A;  2PMS A;  3K6V A;  4FBP A;  2R6G E;  3FXU A;  4ND9 A;  3IOR A;  2DYX A;  1NL5 A;  4M4G A;  5HBC A;  2FBP A;  4GFR A;  3QUF A;  4KFQ A;  4Z0I A;  4Z7E A;  1HSJ A;  4F2O A;  3V8X B;  5JTY A;  3C32 A;  3B7D A;  3I3V A;  3MVZ A;  4FAT A;  4PC9 A;  3RY3 A;  3CG3 A;  2H5Y A;  1FTJ A;  3MZB A;  4HCY A;  3B6W A;  4M1V A;  4PP0 A;  4TLM B;  1MPB A;  4R73 A;  3K6W A;  4ZE8 A;  2PT2 A;  5I59 B;  3RT8 A;  3E9X A;  1GR2 A;  2XXP A;  3TMG A;  3MZ9 A;  3LV0 A;  1B2H A;  4P1E A;  4EQ9 A;  5KZT A;  1QUJ A;  2JJK A;  4LZ5 A;  3AXF A;  4WED A;  3EF7 A;  3IB2 A;  3G3I A;  1O64 A;  1MG1 A;  5H8Q B;  4GWU A;  2Y7W A;  2ZZX A;  3R26 A;  5EQ7 A;  2E0S A;  1B58 A;  4XFE A;  1TXF A;  3SEV A;  1B32 A;  1YAE A;  3OD7 A;  1Y3Q A;  3RTF B;  4KYS A;  4N81 A;  1IMD A;  1LAG E;  1MQH A;  3O66 A;  3OEL A;  1LAH E;  1MH3 A;  2Y7R A;  2DE3 A;  3ILU B;  3JZJ A;  1UTH B;  3FV1 A;  2H25 A;  1IXG A;  3TPA A;  2Z8D A;  3PMW A;  3OO7 A;  2GFE A;  2HZL A;  2QMX A;  3O28 A;  1BIY A;  4P11 A;  2CZI A;  3VVF A;  2FHY A;  4LON B;  1ZLQ A;  4EQB A;  1SD3 A;  5I2N B;  2DWH A;  1LB8 A;  1KZ8 A;  5FHO A;  5TPA B;  5IZZ A;  4YZZ A;  3CRB A;  2AL4 A;  3TEL A;  1OQH A;  4MMP A;  4AB6 A;  5EHS A;  2Z22 A;  3EN3 A;  4GXS B;  1P1W A;  4OEU A;  3KOS A;  2CEX A;  1GVC A;  3T96 B;  4NG7 A;  5HPQ A;  1Y4T A;  3KGC A;  2OJT A;  2QRY A;  4PFT A;  1RDX A;  3QMF A;  1B4H A;  2QS1 A;  2LAO A;  3VXB A;  4KI0 E;  5IKB A;  2DXR A;  2QJE A;  1DOT A;  2HFB A;  3IAZ A;  1ZIU A;  2WBB A;  3Q26 A;  4XTC Q;  2ZZW A;  4P0G A;  3IJX B;  3B8B A;  3E4R A;  2RCA A;  1URG A;  1NV5 A;  1GTK A;  4BLA A;  3H6W A;  1IMF A;  4LZ7 A;  4KQP A;  3ROJ A;  1MM6 A;  4NWC A;  1IEJ A;  4OXV A;  1JQF A;  2O68 A;  2RIN A;  4OVS A;  1DTG A;  2OBG A;  3SKP A;  5ET7 A;  3EHT A;  1FQC A;  2XX8 A;  1R9L A;  1DBZ A;  3PMV A;  4TLL B;  1UIU A;  3GLB A;  4P8B A;  4HE2 A;  4O3C A;  4JVI A;  4OFO A;  2RKM A;  3IB0 A;  1LBV A;  4GBW A;  4N6D A;  2Y7K A;  1LB9 A;  3O29 A;  1B05 A;  4E0W A;  1JW5 A;  1FPF A;  2YLN A;  4OVQ A;  1RKM A;  4MHF A;  2P0S A;  3BIH A;  1N04 A;  1H45 A;  3K1P A;  4MNC A;  2RC9 A;  5I2K B;  5I57 A;  1NV6 A;  3PMX A;  3FUZ A;  1B7U A;  5ET6 A;  3H3G A;  3UK4 A;  4WEP A;  3T9V A;  3CG1 A;  1JNF A;  3ODB A;  1SQY A;  1LFI A;  4P56 A;  4MJO A;  4PGN A;  5FBP A;  1VDW A;  1FBG A;  3MC2 A;  4E0X A;  3FVN A;  4OEN A;  1DCU A;  2CZK A;  3OOA A;  4R9G A;  5DTB A;  4PAF A;  3PUV E;  1JW4 A;  1JEU A;  1LCT A;  3UP9 A;  3HN0 A;  2G93 A;  2D3I A;  2ZYO A;  4G77 A;  2B3B A;  5H8Q A;  3CFX A;  3H06 B;  5T3J A;  4N6K A;  4WXJ A;  4BDO A;  4DE8 A;  4H65 A;  1FCK A;  3A09 A;  3IOU A;  2I0C A;  5H8N A;  4FAJ A;  3O6G A;  3SEY A;  3CVG A;  4NF6 B;  1ZTY A;  3B6Q A;  1DK4 A;  1XOC A;  4XIG Q;  1B0L A;  2V25 A;  2AYS A;  4JB7 A;  2I6E A;  4H45 A;  1SYH A;  3TCF A;  2Q8J A;  4NN3 A;  1VFE A;  2F35 A;  1UTH A;  4IO3 A;  4ELO A;  4ONY A;  1FBC A;  5IGA A;  4X04 A;  3OEN A;  3D1R A;  4F22 A;  2V4C A;  3LSF B;  1INP A;  5IZ3 B;  4LAT A;  4G68 B;  2CMO A;  1SYI A;  1EZP A;  3T9X B;  4I3E A;  5I2N A;  1OLC A;  5TPA A;  1SW2 A;  2REG A;  2Y5K A;  1FJ9 A;  4IGT A;  5I3S A;  2WEF A;  3MZ1 A;  1Y1M A;  5EYF A;  2Q89 A;  3PUY E;  3T93 B;  4PGP A;  2HAV A;  3FJ7 A;  3NOH A;  2BJJ X;  1QGX A;  2F34 A;  5CI5 A;  3CI8 A;  4MCO A;  4RK2 A;  4FIM A;  2NUV A;  4AQ4 A;  1A99 A;  1QUL A;  1VR5 A;  1N3X A;  2DE4 A;  3GYY A;  2O69 A;  2DE2 A;  2V3T A;  2FNC A;  4MX6 A;  2Y84 A;  3SER A;  4P3L A;  2P3N A;  3OSR A;  3OSQ A;  5FTI A;  2PBW A;  3MUQ A;  4GL0 A;  3ONM A;  1QKB A;  3G3F A;  5L9M A;  3RUM A;  4Q0C A;  4H8I A;  4YKI A;  1MQG A;  1FTM A;  2XX7 A;  1ANF A;  1MPC A;  4NWD A;  4DI4 B;  3TQW A;  3M3K A;  2X7P A;  1WVJ A;  2ONR A;  4U4X A;  4GXA A;  3C33 A;  4FED A;  3KSX A;  1GGG A;  4AS4 A;  4JXI A;  3MWB A;  2XXU A;  2O7I A;  4YMA A;  1IIW A;  1NNP A;  2OWS A;  5H8F A;  4U23 A;  4JSD A;  3UOR A;  3RTW B;  1N0T A;  1WOD A;  1IZ1 A;  1SW1 A;  4OEV A;  1G0I A;  3DM0 A;  5DVJ A;  3SEX A;  1B3F A;  4OZ9 A;  5I2K A;  3IJO B;  2VPO A;  5FHN A;  4R74 A;  3FAS A;  5CMB A;  2XXX A;  1JVX A;  4KHZ E;  1B1H A;  4QFN A;  2YPN A;  3CFL A;  3MP8 A;  3QUJ A;  1ZMG A;  4G4P A;  1PB9 A;  4ZZA A;  3KN3 A;  1QUK A;  2P2A A;  3EKI A;  2QS3 A;  5ESY A;  3RN8 A;  4DCY A;  3LSW A;  2GHB A;  1NFT A;  4HE0 A;  3O97 A;  4H8J A;  4YAH X;  1M5D A;  1FSA A;  3R6U A;  2Q2C A;  3IR1 A;  3S9N C;  4GWZ A;  4F1Y A;  3T66 A;  4XEQ A;  4F3S A;  4O94 A;  2I0B A;  1FJ6 A;  4Q30 B;  4OQO A;  1D9V A;  4N4U A;  4I8C A;  4MNP A;  5KCJ A;  4MNI A;  5DT6 A;  2PFZ A;  1B5J A;  2ZMB A;  3H7M A;  4R6K A;  4NF6 A;  3MP6 A;  1CE2 A;  5CMK A;  4AS5 A;  1MY4 A;  1A55 A;  5TP9 B;  3IK6 B;  3IB1 A;  2NWJ A;  4G8N A;  1HSE A;  2XX9 A;  2ZXT A;  1OIB A;  1LBY A;  4OYV A;  4O7M A;  3OO6 A;  1XVX A;  1P1U A;  1RDY A;  1D4N A;  4ESX A;  2AIX A;  1H43 A;  4G68 A;  4MAG A;  3D4C A;  3KN7 A;  1YCJ A;  3CR9 A;  4XKQ A;  3BFT A;  4N07 A;  3MST A;  3VFJ A;  5DEX A;  3PUW E;  4UAC A;  1POY 1;  1GV8 A;  1AWB A;  1H3D A;  5CBS A;  1PC3 A;  2PVU A;  1MY1 A;  3MAM A;  3N6U A;  3U1O A;  1BTJ A;  5ICT A;  1S50 A;  3HO7 A;  5HM4 B;  3IX1 A;  3LBS A;  2PT1 A;  5EYH A;  2XWK A;  5DVF A;  4XF5 A;  2XXR A;  4JDF A;  1MQJ A;  2OWT A;  3HFU A;  4H46 A;  3LC8 A;  1Y20 A;  3KC1 A;  2RCB A;  2O51 A;  5H8H B;  4H67 A;  3EHU A;  2M8C A;  2OLB A;  2QVU A;  3K2D A;  2PX1 A;  3MW0 A;  1MQI A;  1PBP A;  2D5W A;  4OA4 A;  4P1L A;  4PF8 A;  3HPI A;  2DWI A;  4F3G A;  1S7Y A;  1RDZ A;  1UQW A;  3IO4 A;  4QSE A;  3G3G A;  3TTL A;  1MS7 A;  4GLI A;  2I3W A;  1Y4C A;  4F29 A;  3N5L A;  4G8M A;  1IXC A;  4OET A;  1MH4 A;  1FBF A;  1M5C A;  3KG2 A;  3KOT A;  1USY H;  3THI A;  1URS A;  2X26 A;  2D21 A;  3FJG A;  2THI A;  1VFD A;  2QFL A;  1LAF E;  1A8E A;  3FXQ A;  2XD2 A;  4GWS A;  1DPP A;  4PFI A;  4KYE A;  4MBP A;  2DDK A;  1FPI A;  4DZ1 A;  4QBA A;  1B5I A;  1Z7M E;  3K02 A;  1EH3 A;  3MVX A;  4JWO A;  1Y1Z A;  1IMC A;  5EYG A;  4OER A;  5AA2 D;  2ZZV A; 
#chains in the Genus database with same CATH homology
 4EUO A;  3IOT A;  1OVT A;  3PGF A;  1B46 A;  4OVJ A;  1BKA A;  2OZZ A;  1MPD A;  4FE8 A;  1DSN A;  2I3V A;  3PPN A;  3Q25 A;  3OO9 A;  3OXN A;  3ILT B;  4F1V A;  2DOJ A;  3JYR A;  4RJZ A;  3ZSF A;  2Y7P A;  1AOV A;  4H1X A;  1N7X A;  1LFH A;  1VSO A;  2ONK E;  1MXV A;  3IL1 B;  1FQE A;  3MVY A;  1LST A;  3TDJ A;  1EZ9 A;  4NF4 B;  2OK2 A;  1DTZ A;  5AA2 A;  1I69 A;  2A5T B;  2F8D A;  5TP9 A;  3TQL A;  3K00 A;  4BDQ A;  3G3K A;  3LSL A;  4KYD A;  2F6G A;  4ELR A;  4H6D A;  1B9J A;  1ELJ A;  1MDQ A;  3C34 A;  1Z7N E;  1SW4 A;  2XXQ A;  1FTL A;  2DVC A;  4IY6 A;  1FQA A;  3QAX A;  3PD8 A;  4EXK A;  2XXY A;  5ICQ A;  1J1N A;  5I58 B;  2I4C A;  4DCX A;  3DLN A;  3TTR A;  1JET A;  4QFP A;  3PUZ E;  4LQ5 A;  1Y3N A;  5J1D A;  5CMM A;  5I59 A;  4X1D A;  2HEU A;  4DDD A;  2R71 A;  4Q8R A;  3W15 C;  4PFY A;  1JVY A;  4XKN A;  4U4S A;  1O7T A;  2PYY A;  2ZNT A;  2HQ0 A;  1MXX A;  2DP8 A;  4NTL A;  5K2Y A;  1MY3 A;  4U1O A;  4N6P A;  2I4B A;  1MY2 A;  2I58 A;  2F97 A;  1B4Z A;  3FV2 A;  1QW0 A;  5H8H A;  1PEB A;  2H99 A;  5A5X B;  1O63 A;  3H03 A;  3G7W A;  1H44 A;  4DXU A;  2H98 A;  3H6U A;  3I6V A;  3JV9 A;  4HS7 A;  3TCH A;  1OVB A;  4O3A A;  1MXY A;  2Z23 A;  4LUB A;  5AA4 B;  2GH9 A;  3IOV A;  2XXV A;  5B70 A;  4R6H A;  3S4U A;  3PPR A;  4H5F A;  4F3P A;  4YU0 A;  3T9U A;  4ESW A;  2F7A A;  2NXO A;  1I6A A;  2O6A A;  3FGS A;  3KJ7 A;  4OFJ A;  2DWA A;  3RPW A;  4U21 A;  3WAF A;  4DIG A;  1XS5 A;  4PE5 B;  4QSC A;  2QSX A;  3USD A;  4QHQ A;  1PB7 A;  3VVD A;  1KWH A;  5CMC A;  4ECF A;  4U22 A;  5KDT B;  3PPQ A;  3ZS6 A;  5L9O A;  2P1S A;  3K6U A;  3U8Q A;  4LVQ A;  3VV5 A;  2W7Y A;  4F3B A;  1B0H A;  1ZJL A;  4JBZ A;  4F2Q A;  4R75 A;  1XVY A;  2B65 A;  3QIM A;  2XXW A;  4BDR A;  3VLU A;  3FD3 A;  4KCC A;  1N76 A;  3OEK A;  4ZS9 A;  1S9T A;  2ABH A;  4RPN A;  4MLQ A;  4LQ2 A;  4BDL A;  5I84 A;  4MF3 A;  5FHM A;  1TWY A;  1MXW A;  2OCU A;  4YKK A;  5LOM A;  2A5T A;  2A5S A;  1XT8 A;  4KD5 A;  2VGQ A;  3LUY A;  4BDN A;  2RC8 A;  4NE4 A;  4ZED A;  3BFU A;  4YKP A;  4ZE9 A;  3U72 A;  5CC2 A;  3U94 A;  1UIV A;  3A3U A;  4RK9 A;  3S9E A;  5CM6 A;  1D9Y A;  1POT A;  4F1U A;  2Q88 A;  1Y3P A;  1B51 A;  2UYE A;  4PFW A;  2QS2 A;  3PPP A;  3GBA A;  3C36 A;  4FEB A;  1N3W A;  3K6X A;  4R6Y A;  3GZG A;  3DP4 A;  3KBR A;  3P7I A;  4OFL A;  3OEM A;  2UVJ A;  1Y9U A;  3PD9 A;  1NH8 A;  3G3H A;  1US5 A;  5DVI A;  3CSG A;  1FTK A;  3MBP A;  3FIR A;  3D4G A;  3FJM A;  2RF1 A;  2VD2 A;  1B1X A;  4QSD A;  5F7V A;  1P1Q A;  3GXA A;  3O9P A;  4QFL A;  3MPL A;  1LGB C;  3VXC A;  4DLD A;  2V84 A;  1IIT A;  3T22 A;  1B3G A;  4NMY A;  4R72 A;  3N94 A;  1R6Z A;  2DSF A;  3DP6 A;  3TZA A;  1ZKB A;  2B3F A;  1EZO A;  4IO7 A;  5A5X A;  4GD5 A;  4OES A;  3H6T A;  3L6G A;  5CBR A;  1FTO A;  1Q1K A;  3TUS A;  1TT1 A;  3KN8 A;  1L5T A;  4QF9 A;  3H6V A;  3QYT A;  3G3J A;  3VDF A;  5AA4 A;  4OTE A;  5BUU A;  4NED A;  4NF8 B;  1N84 A;  3UIF A;  2ALU A;  3TOD A;  1A54 A;  3S2V A;  4MFI A;  4WKM A;  3H4Z A;  3TKD A;  1P99 A;  2XD3 A;  4UA8 A;  1IQ7 A;  3QSL A;  4KR5 A;  4AB5 A;  3FAT A;  4GWO A;  4R2B A;  5IAI A;  1SW5 A;  3B6T A;  2Y7I A;  5KDT A;  1ZU0 A;  3VLV A;  4OMB A;  4FOR A;  5I57 B;  1MDP 1;  1FQF A;  1XC1 A;  2VD3 A;  3FZV A;  1A7L A;  4ZEF A;  3S9L C;  2V93 A;  3TCG A;  1URD A;  1R1N A;  2F6P A;  3FVK A;  2QPQ A;  4EF2 A;  4THI A;  1SVX B;  1MQD A;  4F18 A;  4YB7 A;  3W9V A;  4U1Z A;  2O1L A;  4NF5 B;  4IY5 A;  3SES A;  4RYA A;  3RLF E;  4EF1 A;  3EPE A;  1II5 A;  1B3E A;  2DXY A;  4ZEB A;  2O1M A;  3K0V A;  3M8U A;  4YMB A;  4HW8 A;  1SBP A;  5M2V A;  4F19 A;  3TTM A;  5H8N B;  4TOZ A;  1N7W A;  2Q2A A;  5ISU A;  2VP1 A;  1LBC A;  2ANJ A;  2H9B A;  5AA1 A;  4JWX A;  3N6T A;  2F7B A;  3KZG A;  1OMP A;  3W9W A;  3MJN A;  4C0R A;  2ZNU A;  4IO6 A;  1R9Q A;  2Z8F A;  1VE4 A;  1H76 A;  2F36 A;  3TEP A;  1P1O A;  2V3Q A;  1CB6 A;  2DQV A;  2F78 A;  1QUI A;  4GOT A;  3BKI B;  1IXH A;  3PV0 E;  3K4U A;  4FJP A;  4N13 A;  3O6I A;  2ZNS A;  3SEW A;  5I56 B;  5L8D A;  2ONS A;  3FXR A;  3M3F A;  3E13 X;  3I5O A;  3HCQ A;  4IO2 A;  3OO8 A;  2WKY A;  1IUD A;  4I1D A;  1Q35 A;  1B40 A;  4RY1 A;  4I9D A;  2XXI A;  3Q28 A;  2CZL A;  4IO5 A;  2GHA A;  2VOZ A;  2IA4 A;  3HV1 A;  4DXC A;  1NMU A;  1ATG A;  4YB5 A;  1PDA A;  5H8S A;  4RNS A;  2O7U A;  3C35 A;  4XXU A;  3KJT A;  4NF8 A;  4C1U A;  1RYX A;  4EXL A;  1FQB A;  1M5E A;  4ZEC A;  4YIC A;  3TYH A;  2ESN A;  1B5H A;  1B6H A;  1P1N A;  3RT6 B;  2V3U A;  4Q5T A;  1JW1 A;  1AL3 A;  5FTH A;  1PBQ A;  1B52 A;  5H8F B;  2HAU A;  3MQ9 A;  2I48 A;  3HST A;  1BLF A;  2QMW A;  2XHD A;  3CFZ A;  3TAJ A;  4TQU Q;  4JSO A;  2X7Q A;  1DMB A;  3IO6 A;  4POX A;  3LSX A;  5EHM A;  4YB6 A;  1FW0 A;  3RNN A;  2XXH A;  4PQJ A;  3K01 A;  4XKR A;  1UTB B;  1I6Q A;  1B3H A;  4H5G A;  3CIJ A;  2GRV A;  2G29 A;  1MXZ A;  4K3F A;  3Q27 A;  3F11 A;  1QJM A;  4ISU A;  3CSB A;  3N26 A;  3ECR A;  4IO4 A;  2H4I A;  5F1Q A;  5K2X A;  5TU0 A;  5B7D A;  2AL5 A;  3L6H A;  3FVG A;  4NF5 A;  4R9F A;  1YTV A;  1PB8 A;  3MPK A;  5BWJ A;  2E1S A;  2ZYN A;  3O6H A;  4DXB A;  4MLV A;  3UA8 A;  5AA3 A;  5KCJ B;  2UVG A;  3PPO A;  3UN6 A;  2YJP A;  4C1T A;  4HTG A;  1B3L A;  1FQD A;  3K1M A;  4GIZ A;  3TTK A;  1LBB A;  4BDM A;  3LR1 A;  4ELP A;  1A40 A;  3KSJ A;  1QVS A;  1LAX A;  4G2Z A;  3VVE A;  2NOO A;  2UVI A;  1B7H A;  2HCA A;  3QK6 A;  2QL3 A;  4GL8 A;  1NNT A;  1MRP A;  4POW A;  5L9S A;  2QS4 A;  2XXT A;  2RC7 A;  3A3C A;  3FVO A;  4O3B A;  2NVU B;  3EQ1 A;  4MH5 A;  4KCD A;  4ZZE A;  1I6B A;  5JTY B;  3DEL B;  3QXM A;  2FA7 A;  5ITP A;  5DEX B;  4HCW A;  2O84 X;  1MXU A;  4QRZ A;  3KEI A;  5DYH A;  2I49 A;  2Q9T A;  3PUX E;  3V83 A;  4EDP A;  2FYI A;  5JEI A;  2UXA A;  4H0W A;  2Z8E A;  5I56 A;  4X48 A;  1LFG A;  1M5F A;  1SI0 A;  3BBR A;  1XHY A;  2UYF A;  1OLA A;  1NNK A;  4OWD A;  4R2F A;  4XKP A;  5JK4 A;  4ZEK A;  2KLF A;  4FEC A;  1SDX A;  3U93 A;  3PU5 A;  3Q29 A;  4RXL A;  4KPT A;  4NF4 A;  3SEU A;  2HXW A;  1US4 A;  3KFM A;  1QKA A;  2HZK A;  3ZKK A;  3HHG A;  5ELV A;  3VE1 B;  2DVZ A;  3DP8 A;  3OMB A;  3E3K A;  4F39 A;  1AMF A;  3SDF A;  4GF8 A;  1NKX A;  4L17 A;  4LZ8 A;  4GVO A;  3R7X A;  1B7Z A;  1OQG A;  1WDN A;  3WAE A;  3EHS A;  1T0K A;  4ZEI A;  2DWJ A;  4LA9 A;  1SI1 A;  1LCF A;  1D3K A;  3IOW A;  1MM7 A;  1NH7 A;  4PET A;  5I58 A;  4IB2 A;  3RGY A;  3K1N A;  2ZYK A;  1RYO A;  3VLW A;  2F5X A;  4I62 A;  4EQ7 A;  4X1B A;  1A8F A;  4P0I A;  3C9H A;  1LLS A;  3MVW A;  4G68 C;  1UTB A;  5CRY A;  1BP5 A;  2R9J A;  1EU8 A;  2IEE A;  1IXI A;  1TFA A;  3RQT A;  1M5B A;  2F7C A;  4OHN A;  3TFL A;  4PFU A;  3MP1 A;  4GQO A;  1MY0 A;  1YPN A;  3C31 A;  3SET A;  1AH5 A;  3UGW A;  4GRK A;  1F9B A;  4F31 B;  4U2R A;  5ITO A;  3U92 A;  3T9H B;  1USY E;  1JEV A;  2DS9 A;  3C4M A;  1ZBM A;  1AIV A;  4YKJ A;  1TFD A;  5AE4 A;  4ZDM A;  2ZYM A;  4RPO A;  4ELQ A;  4QFK A;  1DPE A;  4RA1 A;  3M3L A;  5AA2 B;  3S9M C;  4JWY A;  3V89 B;  3GBB A;  4IGR A;  3HHF A;  3V5A A;  1HSL A;  3TTN A;  4QFO A;  4G8H A;  1NNF A;  2UVH A;  4X9T A;  2REJ A;  4LP2 B;  3ZKL A;  2VHA A;  3O2A A;  2PMS A;  3K6V A;  2R6G E;  3FXU A;  4ND9 A;  3IOR A;  2DYX A;  1NL5 A;  4M4G A;  5HBC A;  4GFR A;  3QUF A;  4KFQ A;  4Z0I A;  4Z7E A;  1HSJ A;  4F2O A;  3V8X B;  5JTY A;  3C32 A;  3B7D A;  3I3V A;  3MVZ A;  4FAT A;  3RY3 A;  3CG3 A;  2H5Y A;  1FTJ A;  3MZB A;  4HCY A;  3B6W A;  4M1V A;  4PP0 A;  4TLM B;  1MPB A;  4R73 A;  3K6W A;  4ZE8 A;  2PT2 A;  5I59 B;  3RT8 A;  3E9X A;  1GR2 A;  2XXP A;  3TMG A;  3MZ9 A;  1B2H A;  4EQ9 A;  5KZT A;  1QUJ A;  4LZ5 A;  3AXF A;  4WED A;  3EF7 A;  3IB2 A;  3G3I A;  1O64 A;  1MG1 A;  5H8Q B;  2Y7W A;  3R26 A;  2E0S A;  1B58 A;  1TXF A;  3SEV A;  1B32 A;  1YAE A;  3OD7 A;  1Y3Q A;  3RTF B;  4KYS A;  3O66 A;  1LAG E;  1MQH A;  3OEL A;  1LAH E;  1MH3 A;  2Y7R A;  2DE3 A;  3ILU B;  3JZJ A;  1UTH B;  3FV1 A;  2H25 A;  1IXG A;  3TPA A;  2Z8D A;  3PMW A;  3OO7 A;  2GFE A;  2HZL A;  2QMX A;  3O28 A;  1BIY A;  4P11 A;  3VVF A;  4LON B;  1ZLQ A;  4EQB A;  1SD3 A;  5I2N B;  2DWH A;  1LB8 A;  5FHO A;  5TPA B;  4YZZ A;  3CRB A;  2AL4 A;  3TEL A;  1OQH A;  4AB6 A;  5EHS A;  2Z22 A;  3EN3 A;  4GXS B;  1P1W A;  4OEU A;  3KOS A;  1GVC A;  3T96 B;  5HPQ A;  1Y4T A;  3KGC A;  2OJT A;  2QRY A;  4PFT A;  1B4H A;  2QS1 A;  2LAO A;  3VXB A;  4KI0 E;  5IKB A;  2DXR A;  2QJE A;  1DOT A;  2HFB A;  3IAZ A;  1ZIU A;  3Q26 A;  4XTC Q;  4P0G A;  3IJX B;  3E4R A;  2RCA A;  1URG A;  1GTK A;  4BLA A;  3H6W A;  4LZ7 A;  4KQP A;  1MM6 A;  4NWC A;  1IEJ A;  4OXV A;  1JQF A;  2O68 A;  2RIN A;  1DTG A;  2OBG A;  3SKP A;  3EHT A;  1FQC A;  2XX8 A;  1R9L A;  3PMV A;  4TLL B;  1UIU A;  3GLB A;  4O3C A;  4OFO A;  2RKM A;  3IB0 A;  2Y7K A;  1LB9 A;  3O29 A;  1B05 A;  4E0W A;  1JW5 A;  2YLN A;  1RKM A;  2P0S A;  3K1P A;  1N04 A;  1H45 A;  2RC9 A;  5I2K B;  5I57 A;  3PMX A;  3FUZ A;  1B7U A;  3H3G A;  3UK4 A;  4WEP A;  3T9V A;  3CG1 A;  1JNF A;  3ODB A;  1SQY A;  1LFI A;  3MC2 A;  4E0X A;  3FVN A;  4OEN A;  3OOA A;  4R9G A;  5DTB A;  3PUV E;  1JW4 A;  1JEU A;  1LCT A;  3UP9 A;  3HN0 A;  2G93 A;  2D3I A;  2ZYO A;  4G77 A;  2B3B A;  5H8Q A;  3CFX A;  3H06 B;  4WXJ A;  4BDO A;  4DE8 A;  4H65 A;  1FCK A;  3A09 A;  3IOU A;  2I0C A;  5H8N A;  4FAJ A;  3O6G A;  3SEY A;  3CVG A;  4NF6 B;  1ZTY A;  3B6Q A;  1XOC A;  4XIG Q;  1B0L A;  2V25 A;  2AYS A;  4JB7 A;  2I6E A;  1SYH A;  3TCF A;  2Q8J A;  1VFE A;  2F35 A;  1UTH A;  4IO3 A;  4ELO A;  4ONY A;  3OEN A;  4F22 A;  3LSF B;  4LAT A;  4G68 B;  2CMO A;  1SYI A;  1EZP A;  3T9X B;  5I2N A;  1OLC A;  5TPA A;  1SW2 A;  2REG A;  4IGT A;  3MZ1 A;  1Y1M A;  5EYF A;  2Q89 A;  3PUY E;  3T93 B;  2HAV A;  3FJ7 A;  2BJJ X;  2F34 A;  5CI5 A;  3CI8 A;  4RK2 A;  4FIM A;  2NUV A;  4AQ4 A;  1A99 A;  1QUL A;  1VR5 A;  1N3X A;  2DE4 A;  2O69 A;  2DE2 A;  2V3T A;  2FNC A;  2Y84 A;  3SER A;  3OSR A;  3OSQ A;  5FTI A;  2PBW A;  3MUQ A;  4GL0 A;  3ONM A;  1QKB A;  3G3F A;  5L9M A;  3RUM A;  4Q0C A;  4H8I A;  4YKI A;  1MQG A;  1FTM A;  2XX7 A;  1ANF A;  1MPC A;  4NWD A;  3TQW A;  3M3K A;  2X7P A;  1WVJ A;  2ONR A;  4U4X A;  4GXA A;  3C33 A;  4FED A;  3KSX A;  1GGG A;  4JXI A;  3MWB A;  2XXU A;  2O7I A;  4YMA A;  1IIW A;  1NNP A;  2OWS A;  5H8F A;  4U23 A;  4JSD A;  3UOR A;  3RTW B;  1N0T A;  1WOD A;  1IZ1 A;  1SW1 A;  4OEV A;  3DM0 A;  5DVJ A;  3SEX A;  1B3F A;  4OZ9 A;  5I2K A;  3IJO B;  5FHN A;  4R74 A;  3FAS A;  5CMB A;  2XXX A;  1JVX A;  4KHZ E;  1B1H A;  4QFN A;  2YPN A;  3CFL A;  3MP8 A;  3QUJ A;  1ZMG A;  4G4P A;  1PB9 A;  4ZZA A;  3KN3 A;  1QUK A;  2P2A A;  2QS3 A;  3RN8 A;  4DCY A;  3LSW A;  2GHB A;  1NFT A;  3O97 A;  4H8J A;  4YAH X;  1M5D A;  3R6U A;  2Q2C A;  3IR1 A;  3S9N C;  4F1Y A;  3T66 A;  4F3S A;  2I0B A;  4Q30 B;  4OQO A;  1D9V A;  4I8C A;  5KCJ A;  5DT6 A;  1B5J A;  2ZMB A;  3H7M A;  4R6K A;  4NF6 A;  3MP6 A;  1CE2 A;  5CMK A;  1MY4 A;  1A55 A;  5TP9 B;  3IK6 B;  3IB1 A;  2NWJ A;  4G8N A;  1HSE A;  2XX9 A;  2ZXT A;  1OIB A;  4OYV A;  3OO6 A;  1XVX A;  1P1U A;  1D4N A;  4ESX A;  2AIX A;  1H43 A;  4G68 A;  3D4C A;  3KN7 A;  1YCJ A;  3CR9 A;  4XKQ A;  3BFT A;  4N07 A;  3VFJ A;  5DEX A;  3PUW E;  4UAC A;  1POY 1;  1GV8 A;  1H3D A;  5CBS A;  1PC3 A;  2PVU A;  1MY1 A;  3MAM A;  3N6U A;  3U1O A;  1BTJ A;  5ICT A;  1S50 A;  3HO7 A;  5HM4 B;  3IX1 A;  3LBS A;  2PT1 A;  5DVF A;  2XXR A;  4JDF A;  1MQJ A;  2OWT A;  3LC8 A;  1Y20 A;  2RCB A;  2O51 A;  5H8H B;  4H67 A;  3EHU A;  2M8C A;  2OLB A;  3K2D A;  2PX1 A;  3MW0 A;  1MQI A;  1PBP A;  2D5W A;  3HPI A;  2DWI A;  4F3G A;  1S7Y A;  1UQW A;  3IO4 A;  4QSE A;  3G3G A;  3TTL A;  1MS7 A;  4GLI A;  2I3W A;  1Y4C A;  4F29 A;  3N5L A;  1IXC A;  4G8M A;  4OET A;  1MH4 A;  1M5C A;  3KG2 A;  3KOT A;  1USY H;  3THI A;  1URS A;  2X26 A;  2D21 A;  3FJG A;  2THI A;  1VFD A;  1LAF E;  1A8E A;  3FXQ A;  2XD2 A;  1DPP A;  4KYE A;  4MBP A;  4DZ1 A;  1B5I A;  1Z7M E;  3K02 A;  1EH3 A;  3MVX A;  4JWO A;  1Y1Z A;  4OER A;  5AA2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...