4HS7A

2.6 angstrom structure of the extracellular solute-binding protein from staphylococcus aureus in complex with peg.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
376
structure length
376
Chain Sequence
KDKPNQLTMWVDGDKQMAFYKKITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEIKLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVEANAAKLTDSKKKQYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIHQLGLNSKHVVKNAERLQKWYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETFGKDLGVTTLPTDGGKPMKPFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEMSEITGRVDVKSSNPNLKVFEKQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNPKQALDEATNDITQNIKILHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Solute-binding protein
molecule keywords Bacterial extracellular solute-binding protein, putative
publication title 2.6 Angstrom Structure of the Extracellular Solute-binding Protein from Staphylococcus aureus in complex with PEG.
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 132
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4hs7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4hs7A02
1XVYA 3I6VA 4KYSA 4PE5B 1WVJA 4G8HA 5A5XA 2ZYMA 3MPLA 1ZKBA 1KWHA 1M5DA 3VFJA 5TPAB 1Y3PA 2XX7A 4R6HA 4OQOA 4QSCA 1WODA 3SEYA 4PP0A 3FXQA 4EQ9A 4POXA 3RUMA 2O7UA 1IXGA 3HN0A 3EHTA 1Z7NE 4R2FA 4MFIA 4I62A 4QFNA 2CMOA 1Q35A 3G3FA 3ZSFA 1UTHB 5IAIA 3LSWA 3CFLA 4HCYA 3OXNA 3UP9A 1USYE 3KOSA 4ZDMA 2UYFA 1H45A 4BLAA 4OVJA 1LAXA 2F78A 3W9WA 4NWCA 1I6BA 4ZZAA 4OFOA 4GOTA 1N3WA 3RPWA 4KD5A 4ZEBA 4LQ5A 2ESNA 5CMKA 3O28A 4X1BA 2XD3A 1B7ZA 5FTIA 1B4HA 3A3UA 5EHMA 2V25A 4OTEA 1TFDA 2M8CA 3E13X 3LC8A 1AIVA 1B5JA 1IXCA 5J1DA 1R9LA 5FHMA 2PBWA 1MXWA 3O6HA 3H6TA 1XVXA 4TQUQ 2NXOA 2V3UA 4OFLA 5H8NA 3PUXE 4H8IA 2H9BA 4ESXA 4QFLA 3H6WA 1MY1A 3ODBA 1II5A 1B51A 4BDNA 4BDLA 5LOMA 1RYXA 5H8HA 3TQWA 4FATA 1XHYA 1JEUA 5DEXA 4U23A 1A55A 1YCJA 4G68B 3C32A 3IO6A 1PBQA 2VGQA 5ITOA 1Y3NA 4P0GA 1I6AA 1URSA 2V84A 4DXBA 1AH5A 1ZBMA 2UVGA 2RC9A 4GL0A 1DTZA 3SEUA 4TOZA 4EF1A 3KBRA 3N26A 2DVZA 3OEKA 4RPNA 3H06B 1JEVA 3TQLA 1DMBA 1RYOA 5BWJA 2Z8EA 4R74A 2QMXA 1Y4TA 3S9NC 2IEEA 1PBPA 1SQYA 1H76A 1ZU0A 1XC1A 3U8QA 1HSLA 2H99A 4F1YA 3N6TA 1D3KA 3W9VA 4IGRA 1B3HA 3TAJA 4ELQA 4RK9A 1MDP1 1LAFE 2HZKA 1BTJA 3CR9A 1I6QA 1YAEA 5I59B 3M8UA 2XXPA 2YJPA 4OXVA 5ITPA 4QSEA 1LB9A 4YMAA 3B6QA 1USYH 4OYVA 1OIBA 4OMBA 1BP5A 2F8DA 5K2XA 4IO2A 3RN8A 2GHAA 3OO7A 3RTFB 4C1TA 3IB1A 3RNNA 5BUUA 3H6UA 4F2QA 3PU5A 2OBGA 1PB8A 3L6HA 5KDTB 4F3BA 2F34A 1L5TA 4FORA 5L9OA 1JW5A 4H65A 4U22A 2A5TB 2P2AA 2OZZA 4HS7A 5TU0A 1XT8A 2ALUA 3Q26A 5L9SA 4OZ9A 3MAMA 1LB8A 4ZEDA 3LUYA 4IO6A 2X7PA 4H6DA 3H7MA 2Y7WA 2F6PA 1POTA 4NF5A 4OEVA 3QUJA 4I8CA 4LA9A 1FTKA 1XS5A 3TTLA 2O1LA 1IITA 1M5EA 1N84A 1FQEA 3MVYA 4THIA 3KN8A 4H5GA 2Q88A 3CFZA 3H4ZA 4N6PA 4BDMA 4IY5A 3PUZE 1LLSA 4F18A 3IJOB 4YB7A 1SVXB 4ND9A 4ZE8A 3FVKA 4QFKA 3MPKA 4GLIA 5I84A 3CSBA 4DIGA 3Q28A 1MS7A 1N7WA 1MPBA 3HO7A 3VE1B 1LBBA 5TPAA 2OJTA 1SYIA 2Y7PA 2BJJX 4OERA 1NMUA 4XXUA 1B3EA 4EQ7A 5F1QA 4AB6A 3V8XB 3T96B 1IUDA 3IO4A 3U1OA 1AL3A 3GBBA 2ZYOA 1DSNA 2DWJA 5DEXB 1URGA 1VE4A 2P0SA 1PC3A 3HHGA 3OSQA 4YICA 1PDAA 1LAHE 3B7DA 1ZTYA 3Q25A 1OQGA 1UQWA 1ATGA 3TCFA 3TTNA 1P99A 5HM4B 1FCKA 4KPTA 1NNKA 2QS4A 4DXCA 2Z23A 3R7XA 3M3FA 3QUFA 2VD2A 3PUWE 2O51A 4NMYA 3O6GA 4F1UA 1QVSA 1IQ7A 2GRVA 5I57B 3CI8A 1A40A 3RGYA 2XX9A 3FV1A 2VP1A 4EXLA 3PPOA 2Z22A 3O29A 3RY3A 2O69A 4OHNA 2O68A 1NKXA 3T66A 3O9PA 4KYDA 1H3DA 5KZTA 1B9JA 2DOJA 1OLCA 2Y7IA 1LFGA 1SW2A 3TKDA 1Y20A 3FZVA 4YZZA 1B58A 3PD8A 1A7LA 3CG3A 4ZEKA 3S9EA 1FTMA 4XTCQ 3IOVA 2DE4A 2AL5A 4Z7EA 2XXYA 2HAVA 4WEPA 1MM6A 4AB5A 2F5XA 3B6TA 1LSTA 4IGTA 3TUSA 1M5CA 3ILUB 3JYRA 4E0WA 4F3SA 4R75A 3MJNA 5F7VA 3KN7A 4NF5B 2OWTA 1SW1A 1Y1MA 2AYSA 3TYHA 5EHSA 3IOWA 4K3FA 4LQ2A 4GIZA 1QKAA 4IB2A 4GL8A 1OMPA 4TLLB 4RA1A 4O3BA 1J1NA 3MP1A 2REJA 4L17A 3TPAA 5I59A 1Y4CA 4U4SA 4Q30B 4BDOA 2DYXA 3UGWA 4PETA 3GBAA 4XIGQ 1O63A 3O6IA 1R1NA 4ONYA 1FQDA 3VV5A 1B7UA 5ISUA 2I3VA 4XKPA 1OQHA 3K6VA 3SDFA 5KDTA 4KI0E 2KLFA 3TMGA 3VLUA 3KZGA 3EPEA 3SEVA 4F29A 3VLWA 3CSGA 2A5TA 3C34A 2PX1A 1P1NA 4LZ7A 5H8QB 3SEWA 4HW8A 3C35A 1M5FA 3E9XA 4OFJA 4ZS9A 3F11A 4KFQA 4O3CA 1SBPA 2V93A 1FQBA 2B65A 4U1OA 2YPNA 1B7HA 2I58A 4R6KA 4JSOA 4I1DA 4GFRA 1VFEA 2DXRA 4NTLA 3VVDA 1PEBA 3UK4A 1QUKA 4IO7A 3CRBA 1JVXA 4POWA 3C36A 2B3BA 3C33A 2B3FA 2PYYA 1DOTA 2V3QA 3PPPA 4OESA 5B7DA 1MY4A 2D21A 1XOCA 1JW1A 4ELPA 3UIFA 5FTHA 2HAUA 3M3LA 2R6GE 4MLVA 2Y7KA 1MQGA 4PQJA 4GVOA 5AA4B 4KHZE 1GV8A 5H8FB 3ZS6A 1ELJA 4HTGA 4ISUA 2DS9A 3N6UA 4LP2B 2H4IA 2UVJA 4H0WA 4MLQA 4NE4A 4EUOA 4P11A 2Q2AA 1FQAA 1B0HA 3KN3A 2HQ0A 2ZYNA 1DTGA 4NF4A 5CBSA 4JWYA 4YKIA 3RT6B 3TELA 1H43A 1YPNA 1LFIA 4BDRA 4YMBA 1UTBA 4GD5A 3OD7A 3IK6B 3P7IA 1B1HA 3HPIA 5DYHA 3RLFE 1US5A 4JWOA 3VVFA 1S9TA 2VOZA 3L6GA 1NNFA 3CFXA 3FXUA 3HHFA 2F97A 4OENA 2OLBA 1T0KA 3OSRA 2QS1A 4RY1A 5JK4A 4QFOA 1EH3A 4OEUA 2F7AA 2THIA 5I57A 3OMBA 4R73A 3C9HA 3PMVA 4YU0A 1P1QA 5IKBA 1URDA 3T9UA 5ICTA 1QUJA 4KYEA 1MQHA 2ONKE 1FW0A 3VXCA 3MC2A 2AIXA 1DPEA 2G93A 2PT1A 3KG2A 1VR5A 3VLVA 1D4NA 1Q1KA 3DM0A 4QF9A 3DP4A 3U92A 3KSJA 4FEDA 1LFHA 5L9MA 1HSJA 1MY2A 4ECFA 3WAEA 4FE8A 4O3AA 4GQOA 4XKQA 3T9HB 3OOAA 1MRPA 3I3VA 2DE2A 2XXIA 3HV1A 2HFBA 2D5WA 2I0CA 4H8JA 4F31B 3C4MA 5TP9B 2XXUA 2RCAA 4ELOA 2Y7RA 4C0RA 4IO4A 4C1UA 4U21A 3MP8A 3MW0A 2PVUA 3H6VA 3OO6A 2QS2A 1MQJA 1MXZA 4E0XA 2H25A 2ONSA 2XD2A 2QMWA 3VDFA 1GTKA 3THIA 3PPNA 5I58B 3KJ7A 3ONMA 3N5LA 5EYFA 3IORA 1B3GA 5CMMA 4DLDA 1B40A 4G77A 4WKMA 3PV0E 4OETA 3MP6A 3FIRA 1MH3A 3Q27A 1QKBA 2UVHA 4RJZA 3QAXA 4JBZA 2FNCA 5HPQA 1NNTA 1N04A 1CE2A 1TXFA 3RT8A 1Y1ZA 1YTVA 4IY6A 1D9VA 1MQIA 4U1ZA 3TCHA 4F1VA 1MY0A 1B05A 3GZGA 2X26A 3UORA 4PFUA 2VHAA 3SEXA 4NF8B 2F35A 1MPDA 3K1MA 3UN6A 4JDFA 4TLMB 5HBCA 5DT6A 1GR2A 4FJPA 3MZBA 3OO8A 4F3PA 5CM6A 1Z7ME 3TODA 1B2HA 1TFAA 3FJGA 5H8QA 1P1UA 2O6AA 2YLNA 5JTYA 2ONRA 1OLAA 5ICQA 2NVUB 3IB2A 4NF4B 3SKPA 3MUQA 2RC8A 4N07A 3IX1A 1ZMGA 5CBRA 1PB7A 1UTBB 2XXXA 3HCQA 3BFTA 1EZOA 2O7IA 1MM7A 2XXRA 3G3JA 4LUBA 3TTMA 5DVIA 2RCBA 3EHSA 1PB9A 4GWOA 3TZAA 4JB7A 3OELA 1B0LA 1GGGA 1JW4A 3MBPA 1O7TA 2F7CA 3MVXA 2PT2A 2D3IA 1R6ZA 3MZ9A 1Y9UA 3FATA 2I6EA 1MDQA 4GXAA 4YB6A 1B3LA 3DELB 3PMWA 2I3WA 5AA4A 4UA8A 4Q0CA 4AQ4A 3TFLA 3E4RA 3R26A 5H8FA 3IR1A 4FECA 2Q89A 2AL4A 3VVEA 4ZECA 3K6UA 4WXJA 1LGBC 4RPOA 4LVQA 3FVGA 4P0IA 3MWBA 4DZ1A 5I2NB 2QPQA 2G29A 2XXVA 1DPPA 2I49A 3BKIB 2DVCA 3TDJA 3QSLA 1A99A 1Y3QA 1QUIA 3K00A 1N76A 2XX8A 3VXBA 4Z0IA 1ZJLA 2GHBA 2Z8DA 5CMCA 4Q5TA 2Q8JA 3USDA 1MXVA 4ZE9A 3V5AA 3KEIA 1IXIA 3BFUA 5JEIA 3FUZA 1R9QA 1H44A 3LR1A 4YKKA 3LSFB 1EZPA 3EF7A 3QK6A 1N3XA 5L8DA 3Q29A 3U72A 2Z8FA 4IO5A 2ABHA 2RINA 1F9BA 5B70A 5AA2D 2R9JA 4RXLA 3O2AA 3RQTA 2REGA 1A8FA 5AA1A 3FGSA 2GH9A 2R71A 2I48A 1AOVA 5JTYB 3TCGA 4G8NA 1B46A 5TP9A 1MY3A 2QL3A 2H98A 3G3GA 5H8SA 3E3KA 4Q8RA 5KCJB 2LAOA 4RK2A 2QS3A 2O1MA 1ZIUA 3K02A 5I58A 2NUVA 4F2OA 1IZ1A 4EXKA 3K01A 4YKPA 1VSOA 4MBPA 2RKMA 3MZ1A 2HZLA 4ZEFA 3PUVE 2DWAA 4LZ8A 4F3GA 3BBRA 3ILTB 3FJ7A 2Y84A 3IAZA 1MQDA 1A8EA 3G3KA 1LBCA 3SESA 4NF8A 1OVBA 3KOTA 2RC7A 3V89B 2HEUA 3K4UA 2GFEA 3UA8A 3EHUA 4YAHX 2OWSA 4LZ5A 1UIUA 2H5YA 3S4UA 4M1VA 3FD3A 1BLFA 3O66A 3DLNA 3TTKA 2NOOA 4R9GA 1TWYA 4OWDA 3K6XA 3PMXA 4XKNA 3H3GA 1US4A 3K1PA 3M3KA 4XKRA 3HSTA 3U93A 1S7YA 1FQFA 3C31A 2DQVA 1B3FA 1CB6A 4KR5A 3LSXA 4UACA 5I2KB 5AA2A 2ZNSA 3IOTA 4IO3A 4F39A 1MXYA 4PFYA 4NF6B 2Q2CA 1AMFA 1M5BA 4U2RA 1SW4A 5M2VA 1JVYA 2ZMBA 4ELRA 1SW5A 3R6UA 4DE8A 4YKJA 3JV9A 3FVOA 3PUYE 3OEMA 2DXYA 2DP8A 4LONB 2F36A 5I56B 5FHOA 1QJMA 3K2DA 1GVCA 4QSDA 3T93B 3CIJA 1ANFA 2XXWA 4PFWA 1LCFA 3G3HA 1LAGE 5DVJA 3KJTA 5I2NA 3A09A 4JWXA 3QIMA 4NEDA 5A5XB 3DP8A 1JETA 3MQ9A 3V83A 5DTBA 2V3TA 2E0SA 2HXWA 4DCYA 3GXAA 5AA3A 3PPRA 3CVGA 1B5HA 1I69A 4FIMA 2P1SA 4DXUA 2F6GA 2FYIA 2DE3A 3ZKLA 2I4BA 1EZ9A 1SI1A 4X48A 2UYEA 1FQCA 5DVFA 1FTJA 3SETA 3H03A 4EDPA 1FTOA 1P1OA 3G3IA 3TTRA 2I4CA 3KFMA 3AXFA 4EQBA 2UVIA 2OCUA 3FXRA 2QJEA 3EQ1A 3JZJA 3D4GA 3ZKKA 4JSDA 1A54A 2VD3A 4FEBA 1EU8A 3B6WA 1TT1A 1FTLA 1SYHA 3LBSA 2ZYKA 3I5OA 4YB5A 2DSFA 4I9DA 4KQPA 3U94A 4H67A 4G2ZA 3EN3A 1MXXA 5K2YA 3SERA 1JQFA 3OO9A 1NNPA 3G7WA 5H8NB 3T9XB 5AE4A 3KSXA 2OK2A 1UIVA 1D9YA 4ZZEA 1MH4A 1RKMA 3O97A 4G4PA 4WEDA 1IIWA 2CZLA 3T22A 3FJMA 4LATA 4FAJA 3K0VA 2XXQA 3TEPA 2QSXA 4RNSA 5KCJA 3QYTA 4QRZA 5H8HB 3IJXB 2XHDA 1UTHA 4H5FA 4BDQA 5AA2B 3RTWB 4GF8A 2O84X 4DDDA 1BIYA 5CI5A 2XXHA 2RF1A 2XXTA 4R2BA 4R6YA 4F22A 1NL5A 3S9MC 2F7BA 2W7YA 4ESWA 4R9FA 4G8MA 3GLBA 1B6HA 3S2VA 1B5IA 2I0BA 1JNFA 3CG1A 4ZEIA 2IA4A 1P1WA 2PMSA 4NWDA 3W15C 3N94A 3MVZA 1B32A 4KCCA 1IEJA 1NH7A 1NH8A 4G68C 3PD9A 3K1NA 1B52A 1SDXA 4PFTA 3PPQA 3IOUA 2HCAA 2QRYA 4H1XA 1POY1 4N13A 4GRKA 2ZNTA 2DWIA 3QXMA 5CMBA 4QHQA 4X1DA 1NFTA 5CC2A 3PGFA 1MG1A 4GXSB 1SD3A 3K6WA 2FA7A 1SI0A 2X7QA 3LSLA 4X9TA 4KCDA 4HCWA 4EF2A 1QW0A 1IXHA 2WKYA 3A3CA 4G68A 1HSEA 5ELVA 5I2KA 2NWJA 2A5SA 3FV2A 1S50A 4QFPA 2DWHA 4RYAA 2ANJA 3FASA 4NF6A 2E1SA 4R72A 2Q9TA 1OVTA 1VFDA 1B1XA 3OENA 5FHNA 3KGCA 1MPCA 1LCTA 3MVWA 1N7XA 1QULA 3T9VA 3S9LC 3D4CA 5I56A 4MH5A 1O64A 3IB0A 1BKAA 4JXIA 3DP6A 3WAFA 3IL1B 1B4ZA 1N0TA 4DCXA 1MXUA 4U4XA 4F19A 1WDNA 1ZLQA 2UXAA 4M4GA 2ZNUA 4MF3A 5CRYA 2ZXTA 3FVNA 3ECRA
chains in the Genus database with same CATH superfamily
1XVYA 3I6VA 4KYSA 4PE5B 1WVJA 4G8HA 5A5XA 2ZYMA 3MPLA 1ZKBA 1KWHA 1M5DA 3VFJA 5TPAB 1Y3PA 2XX7A 4R6HA 4OQOA 4QSCA 1WODA 3SEYA 4PP0A 3FXQA 4EQ9A 4POXA 3RUMA 2O7UA 4P8BA 2CEXA 1IXGA 2P3NA 2CEYA 3HN0A 3EHTA 1Z7NE 4R2FA 4MFIA 4I62A 3MYUA 4QFNA 2CMOA 1Q35A 3G3FA 1IMAA 3ZSFA 1UTHB 5IAIA 3LSWA 3CFLA 4HCYA 3SZPA 3OXNA 3UP9A 1USYE 3KOSA 4ZDMA 2UYFA 1H45A 4BLAA 4OVJA 1LAXA 4GWSA 2F78A 3W9WA 4NWCA 1I6BA 4ZZAA 4OFOA 4PAKA 3RPLB 1FPLA 4GOTA 1N3WA 3RPWA 4KD5A 1FTAA 4ZEBA 4LQ5A 2ESNA 5CMKA 3O28A 4X1BA 2XD3A 1B7ZA 5FTIA 4MMPA 1B4HA 3A3UA 5EHMA 2V25A 5EQ8A 4PAFA 4OTEA 1TFDA 5ET8A 2WX9A 2M8CA 3E13X 3LC8A 1AIVA 5T3JA 1B5JA 1IXCA 5J1DA 1R9LA 1NUWA 5FHMA 2PBWA 1MXWA 3O6HA 3H6TA 5ET6A 1XVXA 4TQUQ 2NXOA 2V3UA 4GX6A 1NUYA 4OFLA 5H8NA 3PUXE 4H8IA 2H9BA 4ESXA 4QFLA 3H6WA 1MY1A 5IGAA 2FVZA 3ODBA 1NV7A 3KC0A 1II5A 1B51A 4BDNA 4BDLA 5LOMA 1KA1A 1RYXA 5H8HA 3TQWA 4FATA 1XHYA 1JEUA 5DEXA 4U23A 1A55A 1YCJA 4G68B 3C32A 3IO6A 1PBQA 2VGQA 5ITOA 1Y3NA 4P0GA 1I6AA 1URSA 2V84A 4DXBA 1AH5A 1ZBMA 1QGXA 2UVGA 2RC9A 4GL0A 5IZ3B 1DTZA 3SEUA 4TOZA 2VT5A 1FRPA 4EF1A 3KBRA 3N26A 4MNCA 1FPFA 2DVZA 3E79A 3OEKA 4RPNA 3H06B 1JEVA 3TQLA 1DMBA 1RYOA 5BWJA 2Z8EA 4R74A 2QMXA 1Y4TA 4AS4A 4GWXA 3S9NC 2IEEA 1PBPA 4PGNA 1SQYA 1H76A 1ZU0A 1XC1A 3U8QA 1HSLA 2HXRA 2H99A 4F1YA 3N6TA 4PBQA 1D3KA 3W9VA 4PFRA 4IGRA 1B3HA 3TAJA 4ELQA 1VDWA 1MDP1 1LAFE 4RK9A 2HZKA 1BTJA 3CR9A 1I6QA 1YAEA 5I59B 3M8UA 2XXPA 2YJPA 4OXVA 5ITPA 4QSEA 1LB9A 4YMAA 3B6QA 1USYH 4OYVA 1OIBA 4OMBA 1BP5A 2F8DA 5K2XA 1FPJA 4IO2A 3RN8A 1DK4A 2GHAA 3OO7A 1YXIA 3RTFB 4C1TA 3IB1A 3RNNA 5BUUA 3H6UA 4F2QA 3PU5A 2OBGA 1PB8A 3L6HA 5KDTB 4F3BA 2F34A 1L5TA 4FORA 5L9OA 4H65A 1JW5A 4U22A 4OVTA 1NUXA 2A5TB 2P2AA 2OZZA 4HS7A 5TU0A 1XT8A 2ALUA 2XWIA 1G0IA 3Q26A 4QXDA 5L9SA 4OZ9A 3MAMA 1LB8A 4ZEDA 3LUYA 4IO6A 2X7PA 2V4CA 4H6DA 3H7MA 2Y7WA 2F6PA 1POTA 4NF5A 4OEVA 3QUJA 4I8CA 4LA9A 1SPIA 1FTKA 1XS5A 3TTLA 2O1LA 1IITA 4X04A 1M5EA 1N84A 1FQEA 3MVYA 4THIA 3T1BA 3KN8A 4H5GA 2Q88A 3CFZA 3H4ZA 4N6PA 4BDMA 3IFCA 3FXBA 4IY5A 3PUZE 1LLSA 4F18A 2PCRA 3IJOB 4YB7A 1SVXB 4ND9A 2MKZA 4ZE8A 3FVKA 4QFKA 3MPKA 1KZ8A 4GLIA 5I84A 3CSBA 4DIGA 3Q28A 1MS7A 1N7WA 5I5PA 1MPBA 3HO7A 3VE1B 1LBBA 5TPAA 2OJTA 1SYIA 2Y7PA 4H45A 2BJJX 4OERA 1NMUA 4XXUA 1B3EA 4EQ7A 4NGUA 4QBAA 5F1QA 4AB6A 3V8XB 4XEQA 3T96B 1IUDA 5IM2A 3IO4A 3U1OA 1AL3A 2B4MA 3GBBA 2ZYOA 1DSNA 2DWJA 4PDHA 5DEXB 3B50A 1URGA 1VE4A 2P0SA 1PC3A 3HHGA 5EQ7A 3OSQA 4YICA 1PDAA 2Y5LA 1LAHE 3B7DA 1ZTYA 3Q25A 1OQGA 3U65A 1UQWA 1ATGA 4JVIA 3TCFA 3TTNA 1P99A 5HM4B 1FCKA 4KPTA 1NNKA 2QS4A 4DXCA 1DBZA 2Z23A 3R7XA 3M3FA 3QUFA 1RDYA 5J16A 2VD2A 3PUWE 2O51A 4MJOA 4NMYA 3O6GA 4F1UA 1QVSA 1IQ7A 2GRVA 5I57B 3CI8A 1A40A 3RGYA 2XX9A 4NX1A 3FV1A 2VP1A 4EXLA 3PPOA 2Z22A 3O29A 3RY3A 2O69A 4OHNA 2O68A 1LBWA 1NKXA 3T66A 3O9PA 4KYDA 1H3DA 4DI3D 5KZTA 1YZ0A 1B9JA 2DOJA 1OLCA 2XWOA 2Y7IA 1IMCA 4MCOA 1LFGA 1SW2A 3TKDA 1Y20A 3FZVA 4YZZA 1B58A 3PD8A 1A7LA 3CG3A 4ZEKA 3S9EA 1FTMA 4XTCQ 4N6DA 3IOVA 2DE4A 2AL5A 3KC1A 4Z7EA 2XXYA 2HAVA 4WEPA 5IZ3A 1MM6A 4AB5A 2F5XA 3B6TA 1LSTA 4IGTA 3TUSA 1M5CA 3ILUB 3JYRA 4E0WA 4F3SA 4R75A 3MJNA 5F7VA 3KN7A 4NF5B 2OWTA 1SW1A 1Y1MA 2AYSA 3TYHA 5EHSA 3IOWA 4K3FA 5F24A 4LQ2A 4GIZA 1QKAA 4IB2A 4GL8A 1OMPA 4O7MA 4TLLB 4RA1A 4O3BA 4HE2A 2ZZXA 1J1NA 3MP1A 2REJA 4L17A 4HE0A 3TPAA 5I59A 1Y4CA 4U4SA 4Q30B 4BDOA 2DYXA 3UGWA 2FIXA 4PETA 3GBAA 4XIGQ 1O63A 3O6IA 1R1NA 4ONYA 1FQDA 3VV5A 1B7UA 5ISUA 2I3VA 4XKPA 1OQHA 3K6VA 1LBXA 3SDFA 4I3YA 5KDTA 4KI0E 3PTYA 2KLFA 3TMGA 3VLUA 1NUZA 1JP4A 3KZGA 3EPEA 3SEVA 4F29A 3VLWA 3CSGA 2A5TA 3C34A 2PX1A 1P1NA 4LZ7A 1FBFA 5H8QB 3SEWA 4HW8A 1CNQA 3C35A 4GX4A 1M5FA 3E9XA 4OFJA 2FBPA 1FPGA 4ZS9A 3F11A 4KFQA 4O3CA 1SBPA 2V93A 1FBGA 1FQBA 2B65A 4MIJA 1LBZA 4U1OA 2YPNA 1B7HA 2I58A 4R6KA 4JSOA 4I1DA 4GFRA 1VFEA 2DXRA 4NTLA 3VVDA 1PEBA 3UK4A 2OWZA 1QUKA 4N81A 4IO7A 3CRBA 1JVXA 4POWA 3C36A 2B3BA 1RDZA 3C33A 2B3FA 2PYYA 4IR8A 3GYYA 1DOTA 2V3QA 3PPPA 4OESA 5B7DA 1MY4A 2D21A 1XOCA 1JW1A 4ELPA 3UIFA 5FTHA 2HAUA 3M3LA 1FBCA 2R6GE 4MLVA 2Y7KA 1MQGA 4PQJA 4NF0A 4GVOA 5AA4B 4XF5A 4KHZE 1GV8A 4LN5A 5H8FB 2B4LA 3ZS6A 1ELJA 4HTGA 4ISUA 2DS9A 4PAIA 3N6UA 4LP2B 2WBDA 2H4IA 2UVJA 3EKIA 4H0WA 4MLQA 4NE4A 4EUOA 4P11A 2Q2AA 1FQAA 1B0HA 3KN3A 2HQ0A 1FPBA 2ZYNA 1DTGA 4NF4A 5CBSA 4JWYA 4YKIA 4P1LA 3RT6B 3TELA 1H43A 1YPNA 1LFIA 4BDRA 4YMBA 1UTBA 2BJIA 4GD5A 3OD7A 3IK6B 3P7IA 1B1HA 2ZZWA 3HPIA 5DYHA 3RLFE 2P3VA 1US5A 4JWOA 3VVFA 1S9TA 2VOZA 3L6GA 4N17A 1NNFA 4N4UA 3CFXA 3FXUA 3HHFA 2F97A 4OENA 2OLBA 1T0KA 3OSRA 2QS1A 4RY1A 5JK4A 4QFOA 4OVRA 4PF8A 1EH3A 4OEUA 2F7AA 2THIA 5I57A 3OMBA 4R73A 3C9HA 3PMVA 4YU0A 2QFLA 1P1QA 5IKBA 1URDA 3BIHA 4NAPA 3T9UA 5ICTA 1QUJA 4N8GA 4PDDA 4KYEA 1MQHA 4P47A 2ONKE 2CZKA 4GX3A 1FW0A 3D1RA 3VXCA 3MC2A 2AIXA 1DPEA 2G93A 2PT1A 2QVRA 3KG2A 1VR5A 3VLVA 1D4NA 1Q1KA 3DM0A 4QF9A 3DP4A 3U92A 5LDZA 3KSJA 4FEDA 1LFHA 5L9MA 1HSJA 1MY2A 3BIGA 4ECFA 3WAEA 2VPOA 4FE8A 4O3AA 4GQOA 4XKQA 3T9HB 3OOAA 4N15A 1MRPA 3I3VA 1K9ZA 2DE2A 2XXIA 1NV5A 3HV1A 2HFBA 4PFBA 2D5WA 2I0CA 4H8JA 2KR0A 3C4MA 4F31B 5TP9B 2XXUA 2RCAA 4P3LA 4ELOA 2Y7RA 4C0RA 4IO4A 5FBPA 4MX6A 5I7IA 5ET7A 4C1UA 4U21A 3MP8A 3MW0A 2PVUA 3H6VA 3OO6A 2QS2A 1MQJA 1MXZA 4E0XA 2H25A 2ONSA 2XD2A 2QMWA 3VDFA 1GTKA 3THIA 3PPNA 1INPA 5I58B 3KJ7A 3ONMA 3N5LA 4N8YA 5EYFA 3IORA 4O8MA 1B3GA 5CMMA 5ET5A 4DLDA 1B40A 4G77A 4WKMA 3PV0E 4OETA 3MP6A 3FIRA 1MH3A 1Q9DA 3Q27A 1QKBA 2UVHA 4RJZA 3QAXA 4JBZA 2FNCA 5HPQA 4NG7A 1NNTA 1N04A 1CE2A 1TXFA 3RT8A 1Y1ZA 1YTVA 4IY6A 1D9VA 1MQIA 4U1ZA 3TCHA 4F1VA 1MY0A 1B05A 3GZGA 3CHGA 2X26A 3UORA 4PFUA 2VHAA 3SEXA 4NF8B 5IZ1A 2F35A 4OANA 1MPDA 3K1MA 3UN6A 4JDFA 4TLMB 1G0HA 5HBCA 5DT6A 1GR2A 2FHYA 4GWYA 4FJPA 3MZBA 3OO8A 4FBPA 4F3PA 5CM6A 1NI9A 1Z7ME 3TODA 1B2HA 1TFAA 5IZZA 3FJGA 5H8QA 1P1UA 2O6AA 2YLNA 5JTYA 2ONRA 1OLAA 5ICQA 2NVUB 3IB2A 4NF4B 3SKPA 3MUQA 2RC8A 4N07A 3IX1A 1ZMGA 5CBRA 3B8BA 1PB7A 1UTBB 2XXXA 4JVCA 3HCQA 3BFTA 1EZOA 2O7IA 1MM7A 2XXRA 3G3JA 4LUBA 3TTMA 2XWKA 5DVIA 2RCBA 3EHSA 1PB9A 4GWOA 3TZAA 4JB7A 3OELA 4P1EA 4MHFA 1B0LA 1GGGA 1JW4A 3MBPA 1O7TA 2F7CA 2F3BA 3MVXA 2PT2A 4HE1A 2WYPA 2HPGA 2D3IA 1R6ZA 3MZ9A 1Y9UA 3FATA 2I6EA 1MDQA 4GXAA 4YB6A 1B3LA 3DELB 1D9QA 3PMWA 3RYDA 2I3WA 5AA4A 4UA8A 4MNPA 4Q0CA 3TFLA 4AQ4A 3E4RA 3R26A 5H8FA 3IR1A 4FECA 2Q89A 2AL4A 4OVSA 3VVEA 4ZECA 3K6UA 4I40A 4WXJA 1LGBC 4RPOA 1RDXA 4LVQA 4GBVA 3FVGA 4PE3A 1FJ6A 3LUZA 4P0IA 3MWBA 3KBZA 4GWUA 4DZ1A 5I2NB 2QPQA 2G29A 3LV0A 2XXVA 1DPPA 2I49A 2FIEA 3BKIB 2DVCA 3TDJA 3QSLA 1A99A 1Y3QA 1QUIA 3K00A 1N76A 1IMFA 2XX8A 3VXBA 4Z0IA 1ZJLA 3IFAA 2OX3A 2GHBA 4PGPA 1FJ9A 3T0JA 2Z8DA 5CMCA 4Q5TA 4MAGA 5EQAA 4GWZA 2Q8JA 3USDA 1MXVA 4ZE9A 3V5AA 1EYIA 1IMBA 1NV0A 2WEFA 3KEIA 1IXIA 3BFUA 5JEIA 3FUZA 1R9QA 1H44A 3NOHA 3LR1A 4YKKA 3LSFB 1EZPA 3EF7A 3QK6A 4XFEA 4HXVA 1N3XA 5L8DA 3Q29A 4GWWA 3U72A 2Z8FA 4IO5A 2ABHA 2RINA 1F9BA 5B70A 5AA2D 2R9JA 4RXLA 1FPKA 3O2AA 3RQTA 2REGA 5DW8A 1A8FA 5AA1A 3FGSA 2GH9A 2R71A 2I48A 1AOVA 5JTYB 3TCGA 2WBBA 4PBHA 4G8NA 1B46A 1AWBA 5TP9A 1MY3A 2QL3A 2H98A 4OVPA 4NN3A 3ISPA 5EYHA 3G3GA 5H8SA 2PFZA 3E3KA 4Q8RA 4NQ8A 5KCJB 2LAOA 4PC9A 1LBYA 4RK2A 2QS3A 2O1MA 1ZIUA 2KQZA 3K02A 5I58A 2NUVA 4F2OA 1IZ1A 4EXKA 3K01A 4YKPA 3A29A 1VSOA 4G61A 4MBPA 2RKMA 2ZZVA 3MZ1A 2HZLA 4ZEFA 2F3DA 3PUVE 4N91A 2DWAA 4LZ8A 4F3GA 3BBRA 4PFIA 3ILTB 3FJ7A 2Y84A 4KXPA 3IAZA 1MQDA 1A8EA 3G3KA 1LBCA 3SESA 4NF8A 1OVBA 1YYZA 3KOTA 2RC7A 4N6KA 3V89B 2HEUA 3K4UA 2GFEA 3UA8A 1NV4A 3EHUA 4YAHX 2OWSA 4LZ5A 1UIUA 2H5YA 3S4UA 4M1VA 3FD3A 1BLFA 3O66A 1FPIA 3DLNA 1NV2A 3TTKA 2NOOA 4R9GA 1TWYA 4OWDA 3K6XA 3PMXA 4XKNA 4MEVA 2CZHA 3H3GA 1DCUA 1US4A 3K1PA 3M3KA 4XKRA 3HSTA 3U93A 1S7YA 1FQFA 3C31A 2DQVA 1B3FA 1CB6A 4KR5A 3LSXA 4UACA 5I2KB 5AA2A 2ZNSA 3IOTA 4IO3A 4F39A 1MXYA 4PFYA 4X8RA 4NF6B 2Q2CA 1AMFA 2QVVA 1M5BA 4U2RA 1SW4A 5M2VA 1JVYA 4P9KA 2ZMBA 4ELRA 1FBDA 1SW5A 3R6UA 4DE8A 4YKJA 3JV9A 4I3EA 3FVOA 3PUYE 2CZIA 1FPDA 3OEMA 2DXYA 2DP8A 1EYKA 4LONB 2F36A 5I56B 5FHOA 1QJMA 3K2DA 1GVCA 4QSDA 3T93B 3CIJA 1ANFA 2XXWA 4PFWA 1LCFA 1FBHA 3G3HA 1LAGE 5DVJA 3KJTA 5I2NA 3A09A 4H46A 4JWXA 3QIMA 4NEDA 2GQ1A 5A5XB 3DP8A 1JETA 3MSTA 3MQ9A 3V83A 5DTBA 3E78A 2V3TA 2E0SA 4AS5A 2HXWA 4DCYA 3GXAA 5AA3A 3PPRA 3CVGA 1B5HA 1I69A 4FIMA 2P1SA 4DXUA 4PCDA 2F6GA 2FYIA 1XI6A 5LTCA 2L5VA 2DE3A 3FBPA 3ZKLA 2I4BA 1SI1A 4X48A 2VPNA 2UYEA 2Q74A 1FQCA 5DVFA 1FTJA 3SETA 1FPEA 3H03A 4EDPA 1FTOA 1P1OA 1EYJA 3G3IA 3TTRA 2I4CA 3KFMA 3AXFA 4EQBA 2UVIA 2OCUA 3FXRA 2QJEA 3EQ1A 3JZJA 4PF6A 3D4GA 3ZKKA 4JSDA 1A54A 2VD3A 4FEBA 1EU8A 3B6WA 1TT1A 3HFUA 1FTLA 1SYHA 3LBSA 2ZYKA 3I5OA 4YB5A 2DSFA 4I9DA 4KQPA 3U94A 4H67A 4G2ZA 3EN3A 2XA5A 1MXXA 1FBPA 5K2YA 3SERA 1JQFA 3OO9A 1NNPA 3G7WA 5H8NB 3T9XB 2PFYA 4OVQA 5AE4A 3KSXA 2OK2A 1UIVA 1D9YA 4ZZEA 1MH4A 2DDKA 1RKMA 2R8TA 3O97A 4G4PA 4WEDA 1IIWA 2CZLA 3T22A 3FJMA 4LATA 4FAJA 4JVDA 3K0VA 2XXQA 1BK4A 3TEPA 1KA0A 2QSXA 4RNSA 5KCJA 3QYTA 4QRZA 5H8HB 3IJXB 2XHDA 1UTHA 2HHMA 2WYKA 4H5FA 4BDQA 3ROJA 5AA2B 3RTWB 2QVUA 4GF8A 2O84X 4DDDA 1BIYA 1LBVA 5CI5A 2XXHA 1IMDA 2RF1A 2XXTA 2XWVA 4R2BA 4R6YA 1IMEA 3QMFA 4MNIA 4F22A 3RPLA 1NL5A 3S9MC 2F7BA 2W7YA 4ESWA 4R9FA 4G8MA 3GLBA 1B6HA 3S2VA 1B5IA 2I0BA 4PTKA 2Y5KA 1JNFA 3CG1A 4P56A 4ZEIA 2IA4A 1P1WA 2PMSA 5A5LA 4NWDA 3W15C 3N94A 3MVZA 1NV3A 1B32A 4KCCA 1IEJA 1NH7A 1NH8A 1K9YA 4GBWA 4G68C 3PD9A 3K1NA 1B52A 1SDXA 4PFTA 3PPQA 3IOUA 2HCAA 2QRYA 4H1XA 1POY1 4N13A 4GRKA 2ZNTA 2DWIA 3QXMA 5CMBA 4QHQA 4X1DA 4UABA 1NFTA 5CC2A 3PGFA 1MG1A 4GXSB 1SD3A 3K6WA 2FA7A 1SI0A 2X7QA 3LSLA 4X9TA 4KCDA 4HCWA 2Q8MA 2JJKA 4EF2A 4OA4A 1QW0A 1IXHA 2WKYA 3A3CA 4G68A 1HSEA 5ELVA 5EYGA 5I2KA 2NWJA 2A5SA 3FV2A 1S50A 4QFPA 2DWHA 4NHBA 4RYAA 2ANJA 3FASA 4NF6A 2E1SA 4R72A 2Q9TA 1OVTA 1VFDA 1B1XA 1FBEA 3OENA 5FHNA 3KGCA 1MPCA 1LCTA 5I3SA 3MVWA 1N7XA 4DI4B 1QULA 3T9VA 3S9LC 1LEVA 3D4CA 5I56A 4MH5A 1O64A 5ESYA 2XXKA 3IB0A 1BKAA 4JXIA 3DP6A 5EQ9A 1NV6A 3WAFA 3IL1B 1NV1A 1B4ZA 1FSAA 4O94A 1N0TA 4DCXA 3FVNA 1MXUA 4U4XA 4F19A 1WDNA 1ZLQA 2UXAA 4M4GA 2ZNUA 4MF3A 5CRYA 2ZXTA 1EZ9A 4O7IA 3ECRA
chains in the Genus database with same CATH topology
1XVYA 3I6VA 4KYSA 4PE5B 1WVJA 4G8HA 5A5XA 2ZYMA 3MPLA 1ZKBA 1KWHA 1M5DA 3VFJA 5TPAB 1Y3PA 2XX7A 4R6HA 4OQOA 4QSCA 1WODA 3SEYA 4PP0A 3FXQA 4EQ9A 4POXA 3RUMA 2O7UA 1IXGA 3HN0A 3EHTA 1Z7NE 4R2FA 4MFIA 4I62A 4QFNA 2CMOA 1Q35A 3G3FA 3ZSFA 1UTHB 5IAIA 3LSWA 3CFLA 4HCYA 3OXNA 3UP9A 1USYE 3KOSA 4ZDMA 2UYFA 1H45A 4BLAA 4OVJA 1LAXA 2F78A 3W9WA 4NWCA 1I6BA 4ZZAA 4OFOA 4GOTA 1N3WA 3RPWA 4KD5A 4ZEBA 4LQ5A 2ESNA 5CMKA 3O28A 4X1BA 2XD3A 1B7ZA 5FTIA 1B4HA 3A3UA 5EHMA 2V25A 4OTEA 1TFDA 2M8CA 3E13X 3LC8A 1AIVA 1B5JA 1IXCA 5J1DA 1R9LA 5FHMA 2PBWA 1MXWA 3O6HA 3H6TA 1XVXA 4TQUQ 2NXOA 2V3UA 4OFLA 5H8NA 3PUXE 4H8IA 2H9BA 4ESXA 4QFLA 3H6WA 1MY1A 3ODBA 1II5A 1B51A 4BDNA 4BDLA 5LOMA 1RYXA 5H8HA 3TQWA 4FATA 1XHYA 1JEUA 5DEXA 4U23A 1A55A 1YCJA 4G68B 3C32A 3IO6A 1PBQA 2VGQA 5ITOA 1Y3NA 4P0GA 1I6AA 1URSA 2V84A 4DXBA 1AH5A 1ZBMA 2UVGA 2RC9A 4GL0A 1DTZA 3SEUA 4TOZA 4EF1A 3KBRA 3N26A 2DVZA 3OEKA 4RPNA 3H06B 1JEVA 3TQLA 1DMBA 1RYOA 5BWJA 2Z8EA 4R74A 2QMXA 1Y4TA 3S9NC 2IEEA 1PBPA 1SQYA 1H76A 1ZU0A 1XC1A 3U8QA 1HSLA 2H99A 4F1YA 3N6TA 1D3KA 3W9VA 4IGRA 1B3HA 3TAJA 4ELQA 4RK9A 1MDP1 1LAFE 2HZKA 1BTJA 3CR9A 1I6QA 1YAEA 5I59B 3M8UA 2XXPA 2YJPA 4OXVA 5ITPA 4QSEA 1LB9A 4YMAA 3B6QA 1USYH 4OYVA 1OIBA 4OMBA 1BP5A 2F8DA 5K2XA 4IO2A 3RN8A 2GHAA 3OO7A 3RTFB 4C1TA 3IB1A 3RNNA 5BUUA 3H6UA 4F2QA 3PU5A 2OBGA 1PB8A 3L6HA 5KDTB 4F3BA 2F34A 1L5TA 4FORA 5L9OA 1JW5A 4H65A 4U22A 2A5TB 2P2AA 2OZZA 4HS7A 5TU0A 1XT8A 2ALUA 3Q26A 5L9SA 4OZ9A 3MAMA 1LB8A 4ZEDA 3LUYA 4IO6A 2X7PA 4H6DA 3H7MA 2Y7WA 2F6PA 1POTA 4NF5A 4OEVA 3QUJA 4I8CA 4LA9A 1FTKA 1XS5A 3TTLA 2O1LA 1IITA 1M5EA 1N84A 1FQEA 3MVYA 4THIA 3KN8A 4H5GA 2Q88A 3CFZA 3H4ZA 4N6PA 4BDMA 4IY5A 3PUZE 1LLSA 4F18A 3IJOB 4YB7A 1SVXB 4ND9A 4ZE8A 3FVKA 4QFKA 3MPKA 4GLIA 5I84A 3CSBA 4DIGA 3Q28A 1MS7A 1N7WA 1MPBA 3HO7A 3VE1B 1LBBA 5TPAA 2OJTA 1SYIA 2Y7PA 2BJJX 4OERA 1NMUA 4XXUA 1B3EA 4EQ7A 5F1QA 4AB6A 3V8XB 3T96B 1IUDA 3IO4A 3U1OA 1AL3A 3GBBA 2ZYOA 1DSNA 2DWJA 5DEXB 1URGA 1VE4A 2P0SA 1PC3A 3HHGA 3OSQA 4YICA 1PDAA 1LAHE 3B7DA 1ZTYA 3Q25A 1OQGA 1UQWA 1ATGA 3TCFA 3TTNA 1P99A 5HM4B 1FCKA 4KPTA 1NNKA 2QS4A 4DXCA 2Z23A 3R7XA 3M3FA 3QUFA 2VD2A 3PUWE 2O51A 4NMYA 3O6GA 4F1UA 1QVSA 1IQ7A 2GRVA 5I57B 3CI8A 1A40A 3RGYA 2XX9A 3FV1A 2VP1A 4EXLA 3PPOA 2Z22A 3O29A 3RY3A 2O69A 4OHNA 2O68A 1NKXA 3T66A 3O9PA 4KYDA 1H3DA 5KZTA 1B9JA 2DOJA 1OLCA 2Y7IA 1LFGA 1SW2A 3TKDA 1Y20A 3FZVA 4YZZA 1B58A 3PD8A 1A7LA 3CG3A 4ZEKA 3S9EA 1FTMA 4XTCQ 3IOVA 2DE4A 2AL5A 4Z7EA 2XXYA 2HAVA 4WEPA 1MM6A 4AB5A 2F5XA 3B6TA 1LSTA 4IGTA 3TUSA 1M5CA 3ILUB 3JYRA 4E0WA 4F3SA 4R75A 3MJNA 5F7VA 3KN7A 4NF5B 2OWTA 1SW1A 1Y1MA 2AYSA 3TYHA 5EHSA 3IOWA 4K3FA 4LQ2A 4GIZA 1QKAA 4IB2A 4GL8A 1OMPA 4TLLB 4RA1A 4O3BA 1J1NA 3MP1A 2REJA 4L17A 3TPAA 5I59A 1Y4CA 4U4SA 4Q30B 4BDOA 2DYXA 3UGWA 4PETA 3GBAA 4XIGQ 1O63A 3O6IA 1R1NA 4ONYA 1FQDA 3VV5A 1B7UA 5ISUA 2I3VA 4XKPA 1OQHA 3K6VA 3SDFA 5KDTA 4KI0E 2KLFA 3TMGA 3VLUA 3KZGA 3EPEA 3SEVA 4F29A 3VLWA 3CSGA 2A5TA 3C34A 2PX1A 1P1NA 4LZ7A 5H8QB 3SEWA 4HW8A 3C35A 1M5FA 3E9XA 4OFJA 4ZS9A 3F11A 4KFQA 4O3CA 1SBPA 2V93A 1FQBA 2B65A 4U1OA 2YPNA 1B7HA 2I58A 4R6KA 4JSOA 4I1DA 4GFRA 1VFEA 2DXRA 4NTLA 3VVDA 1PEBA 3UK4A 1QUKA 4IO7A 3CRBA 1JVXA 4POWA 3C36A 2B3BA 3C33A 2B3FA 2PYYA 1DOTA 2V3QA 3PPPA 4OESA 5B7DA 1MY4A 2D21A 1XOCA 1JW1A 4ELPA 3UIFA 5FTHA 2HAUA 3M3LA 2R6GE 4MLVA 2Y7KA 1MQGA 4PQJA 4GVOA 5AA4B 4KHZE 1GV8A 5H8FB 3ZS6A 1ELJA 4HTGA 4ISUA 2DS9A 3N6UA 4LP2B 2H4IA 2UVJA 4H0WA 4MLQA 4NE4A 4EUOA 4P11A 2Q2AA 1FQAA 1B0HA 3KN3A 2HQ0A 2ZYNA 1DTGA 4NF4A 5CBSA 4JWYA 4YKIA 3RT6B 3TELA 1H43A 1YPNA 1LFIA 4BDRA 4YMBA 1UTBA 4GD5A 3OD7A 3IK6B 3P7IA 1B1HA 3HPIA 5DYHA 3RLFE 1US5A 4JWOA 3VVFA 1S9TA 2VOZA 3L6GA 1NNFA 3CFXA 3FXUA 3HHFA 2F97A 4OENA 2OLBA 1T0KA 3OSRA 2QS1A 4RY1A 5JK4A 4QFOA 1EH3A 4OEUA 2F7AA 2THIA 5I57A 3OMBA 4R73A 3C9HA 3PMVA 4YU0A 1P1QA 5IKBA 1URDA 3T9UA 5ICTA 1QUJA 4KYEA 1MQHA 2ONKE 1FW0A 3VXCA 3MC2A 2AIXA 1DPEA 2G93A 2PT1A 3KG2A 1VR5A 3VLVA 1D4NA 1Q1KA 3DM0A 4QF9A 3DP4A 3U92A 3KSJA 4FEDA 1LFHA 5L9MA 1HSJA 1MY2A 4ECFA 3WAEA 4FE8A 4O3AA 4GQOA 4XKQA 3T9HB 3OOAA 1MRPA 3I3VA 2DE2A 2XXIA 3HV1A 2HFBA 2D5WA 2I0CA 4H8JA 4F31B 3C4MA 5TP9B 2XXUA 2RCAA 4ELOA 2Y7RA 4C0RA 4IO4A 4C1UA 4U21A 3MP8A 3MW0A 2PVUA 3H6VA 3OO6A 2QS2A 1MQJA 1MXZA 4E0XA 2H25A 2ONSA 2XD2A 2QMWA 3VDFA 1GTKA 3THIA 3PPNA 5I58B 3KJ7A 3ONMA 3N5LA 5EYFA 3IORA 1B3GA 5CMMA 4DLDA 1B40A 4G77A 4WKMA 3PV0E 4OETA 3MP6A 3FIRA 1MH3A 3Q27A 1QKBA 2UVHA 4RJZA 3QAXA 4JBZA 2FNCA 5HPQA 1NNTA 1N04A 1CE2A 1TXFA 3RT8A 1Y1ZA 1YTVA 4IY6A 1D9VA 1MQIA 4U1ZA 3TCHA 4F1VA 1MY0A 1B05A 3GZGA 2X26A 3UORA 4PFUA 2VHAA 3SEXA 4NF8B 2F35A 1MPDA 3K1MA 3UN6A 4JDFA 4TLMB 5HBCA 5DT6A 1GR2A 4FJPA 3MZBA 3OO8A 4F3PA 5CM6A 1Z7ME 3TODA 1B2HA 1TFAA 3FJGA 5H8QA 1P1UA 2O6AA 2YLNA 5JTYA 2ONRA 1OLAA 5ICQA 2NVUB 3IB2A 4NF4B 3SKPA 3MUQA 2RC8A 4N07A 3IX1A 1ZMGA 5CBRA 1PB7A 1UTBB 2XXXA 3HCQA 3BFTA 1EZOA 2O7IA 1MM7A 2XXRA 3G3JA 4LUBA 3TTMA 5DVIA 2RCBA 3EHSA 1PB9A 4GWOA 3TZAA 4JB7A 3OELA 1B0LA 1GGGA 1JW4A 3MBPA 1O7TA 2F7CA 3MVXA 2PT2A 2D3IA 1R6ZA 3MZ9A 1Y9UA 3FATA 2I6EA 1MDQA 4GXAA 4YB6A 1B3LA 3DELB 3PMWA 2I3WA 5AA4A 4UA8A 4Q0CA 4AQ4A 3TFLA 3E4RA 3R26A 5H8FA 3IR1A 4FECA 2Q89A 2AL4A 3VVEA 4ZECA 3K6UA 4WXJA 1LGBC 4RPOA 4LVQA 3FVGA 4P0IA 3MWBA 4DZ1A 5I2NB 2QPQA 2G29A 2XXVA 1DPPA 2I49A 3BKIB 2DVCA 3TDJA 3QSLA 1A99A 1Y3QA 1QUIA 3K00A 1N76A 2XX8A 3VXBA 4Z0IA 1ZJLA 2GHBA 2Z8DA 5CMCA 4Q5TA 2Q8JA 3USDA 1MXVA 4ZE9A 3V5AA 3KEIA 1IXIA 3BFUA 5JEIA 3FUZA 1R9QA 1H44A 3LR1A 4YKKA 3LSFB 1EZPA 3EF7A 3QK6A 1N3XA 5L8DA 3Q29A 3U72A 2Z8FA 4IO5A 2ABHA 2RINA 1F9BA 5B70A 5AA2D 2R9JA 4RXLA 3O2AA 3RQTA 2REGA 1A8FA 5AA1A 3FGSA 2GH9A 2R71A 2I48A 1AOVA 5JTYB 3TCGA 4G8NA 1B46A 5TP9A 1MY3A 2QL3A 2H98A 3G3GA 5H8SA 3E3KA 4Q8RA 5KCJB 2LAOA 4RK2A 2QS3A 2O1MA 1ZIUA 3K02A 5I58A 2NUVA 4F2OA 1IZ1A 4EXKA 3K01A 4YKPA 1VSOA 4MBPA 2RKMA 3MZ1A 2HZLA 4ZEFA 3PUVE 2DWAA 4LZ8A 4F3GA 3BBRA 3ILTB 3FJ7A 2Y84A 3IAZA 1MQDA 1A8EA 3G3KA 1LBCA 3SESA 4NF8A 1OVBA 3KOTA 2RC7A 3V89B 2HEUA 3K4UA 2GFEA 3UA8A 3EHUA 4YAHX 2OWSA 4LZ5A 1UIUA 2H5YA 3S4UA 4M1VA 3FD3A 1BLFA 3O66A 3DLNA 3TTKA 2NOOA 4R9GA 1TWYA 4OWDA 3K6XA 3PMXA 4XKNA 3H3GA 1US4A 3K1PA 3M3KA 4XKRA 3HSTA 3U93A 1S7YA 1FQFA 3C31A 2DQVA 1B3FA 1CB6A 4KR5A 3LSXA 4UACA 5I2KB 5AA2A 2ZNSA 3IOTA 4IO3A 4F39A 1MXYA 4PFYA 4NF6B 2Q2CA 1AMFA 1M5BA 4U2RA 1SW4A 5M2VA 1JVYA 2ZMBA 4ELRA 1SW5A 3R6UA 4DE8A 4YKJA 3JV9A 3FVOA 3PUYE 3OEMA 2DXYA 2DP8A 4LONB 2F36A 5I56B 5FHOA 1QJMA 3K2DA 1GVCA 4QSDA 3T93B 3CIJA 1ANFA 2XXWA 4PFWA 1LCFA 3G3HA 1LAGE 5DVJA 3KJTA 5I2NA 3A09A 4JWXA 3QIMA 4NEDA 5A5XB 3DP8A 1JETA 3MQ9A 3V83A 5DTBA 2V3TA 2E0SA 2HXWA 4DCYA 3GXAA 5AA3A 3PPRA 3CVGA 1B5HA 1I69A 4FIMA 2P1SA 4DXUA 2F6GA 2FYIA 2DE3A 3ZKLA 2I4BA 1EZ9A 1SI1A 4X48A 2UYEA 1FQCA 5DVFA 1FTJA 3SETA 3H03A 4EDPA 1FTOA 1P1OA 3G3IA 3TTRA 2I4CA 3KFMA 3AXFA 4EQBA 2UVIA 2OCUA 3FXRA 2QJEA 3EQ1A 3JZJA 3D4GA 3ZKKA 4JSDA 1A54A 2VD3A 4FEBA 1EU8A 3B6WA 1TT1A 1FTLA 1SYHA 3LBSA 2ZYKA 3I5OA 4YB5A 2DSFA 4I9DA 4KQPA 3U94A 4H67A 4G2ZA 3EN3A 1MXXA 5K2YA 3SERA 1JQFA 3OO9A 1NNPA 3G7WA 5H8NB 3T9XB 5AE4A 3KSXA 2OK2A 1UIVA 1D9YA 4ZZEA 1MH4A 1RKMA 3O97A 4G4PA 4WEDA 1IIWA 2CZLA 3T22A 3FJMA 4LATA 4FAJA 3K0VA 2XXQA 3TEPA 2QSXA 4RNSA 5KCJA 3QYTA 4QRZA 5H8HB 3IJXB 2XHDA 1UTHA 4H5FA 4BDQA 5AA2B 3RTWB 4GF8A 2O84X 4DDDA 1BIYA 5CI5A 2XXHA 2RF1A 2XXTA 4R2BA 4R6YA 4F22A 1NL5A 3S9MC 2F7BA 2W7YA 4ESWA 4R9FA 4G8MA 3GLBA 1B6HA 3S2VA 1B5IA 2I0BA 1JNFA 3CG1A 4ZEIA 2IA4A 1P1WA 2PMSA 4NWDA 3W15C 3N94A 3MVZA 1B32A 4KCCA 1IEJA 1NH7A 1NH8A 4G68C 3PD9A 3K1NA 1B52A 1SDXA 4PFTA 3PPQA 3IOUA 2HCAA 2QRYA 4H1XA 1POY1 4N13A 4GRKA 2ZNTA 2DWIA 3QXMA 5CMBA 4QHQA 4X1DA 1NFTA 5CC2A 3PGFA 1MG1A 4GXSB 1SD3A 3K6WA 2FA7A 1SI0A 2X7QA 3LSLA 4X9TA 4KCDA 4HCWA 4EF2A 1QW0A 1IXHA 2WKYA 3A3CA 4G68A 1HSEA 5ELVA 5I2KA 2NWJA 2A5SA 3FV2A 1S50A 4QFPA 2DWHA 4RYAA 2ANJA 3FASA 4NF6A 2E1SA 4R72A 2Q9TA 1OVTA 1VFDA 1B1XA 3OENA 5FHNA 3KGCA 1MPCA 1LCTA 3MVWA 1N7XA 1QULA 3T9VA 3S9LC 3D4CA 5I56A 4MH5A 1O64A 3IB0A 1BKAA 4JXIA 3DP6A 3WAFA 3IL1B 1B4ZA 1N0TA 4DCXA 1MXUA 4U4XA 4F19A 1WDNA 1ZLQA 2UXAA 4M4GA 2ZNUA 4MF3A 5CRYA 2ZXTA 3FVNA 3ECRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVY A;  3I6V A;  4KYS A;  4PE5 B;  1WVJ A;  4G8H A;  5A5X A;  2ZYM A;  3MPL A;  1ZKB A;  1KWH A;  1M5D A;  3VFJ A;  5TPA B;  1Y3P A;  2XX7 A;  4R6H A;  4OQO A;  4QSC A;  1WOD A;  3SEY A;  4PP0 A;  3FXQ A;  4EQ9 A;  4POX A;  3RUM A;  2O7U A;  1IXG A;  3HN0 A;  3EHT A;  1Z7N E;  4R2F A;  4MFI A;  4I62 A;  4QFN A;  2CMO A;  1Q35 A;  3G3F A;  3ZSF A;  1UTH B;  5IAI A;  3LSW A;  3CFL A;  4HCY A;  3OXN A;  3UP9 A;  1USY E;  3KOS A;  4ZDM A;  2UYF A;  1H45 A;  4BLA A;  4OVJ A;  1LAX A;  2F78 A;  3W9W A;  4NWC A;  1I6B A;  4ZZA A;  4OFO A;  4GOT A;  1N3W A;  3RPW A;  4KD5 A;  4ZEB A;  4LQ5 A;  2ESN A;  5CMK A;  3O28 A;  4X1B A;  2XD3 A;  1B7Z A;  5FTI A;  1B4H A;  3A3U A;  5EHM A;  2V25 A;  4OTE A;  1TFD A;  2M8C A;  3E13 X;  3LC8 A;  1AIV A;  1B5J A;  1IXC A;  5J1D A;  1R9L A;  5FHM A;  2PBW A;  1MXW A;  3O6H A;  3H6T A;  1XVX A;  4TQU Q;  2NXO A;  2V3U A;  4OFL A;  5H8N A;  3PUX E;  4H8I A;  2H9B A;  4ESX A;  4QFL A;  3H6W A;  1MY1 A;  3ODB A;  1II5 A;  1B51 A;  4BDN A;  4BDL A;  5LOM A;  1RYX A;  5H8H A;  3TQW A;  4FAT A;  1XHY A;  1JEU A;  5DEX A;  4U23 A;  1A55 A;  1YCJ A;  4G68 B;  3C32 A;  3IO6 A;  1PBQ A;  2VGQ A;  5ITO A;  1Y3N A;  4P0G A;  1I6A A;  1URS A;  2V84 A;  4DXB A;  1AH5 A;  1ZBM A;  2UVG A;  2RC9 A;  4GL0 A;  1DTZ A;  3SEU A;  4TOZ A;  4EF1 A;  3KBR A;  3N26 A;  2DVZ A;  3OEK A;  4RPN A;  3H06 B;  1JEV A;  3TQL A;  1DMB A;  1RYO A;  5BWJ A;  2Z8E A;  4R74 A;  2QMX A;  1Y4T A;  3S9N C;  2IEE A;  1PBP A;  1SQY A;  1H76 A;  1ZU0 A;  1XC1 A;  3U8Q A;  1HSL A;  2H99 A;  4F1Y A;  3N6T A;  1D3K A;  3W9V A;  4IGR A;  1B3H A;  3TAJ A;  4ELQ A;  4RK9 A;  1MDP 1;  1LAF E;  2HZK A;  1BTJ A;  3CR9 A;  1I6Q A;  1YAE A;  5I59 B;  3M8U A;  2XXP A;  2YJP A;  4OXV A;  5ITP A;  4QSE A;  1LB9 A;  4YMA A;  3B6Q A;  1USY H;  4OYV A;  1OIB A;  4OMB A;  1BP5 A;  2F8D A;  5K2X A;  4IO2 A;  3RN8 A;  2GHA A;  3OO7 A;  3RTF B;  4C1T A;  3IB1 A;  3RNN A;  5BUU A;  3H6U A;  4F2Q A;  3PU5 A;  2OBG A;  1PB8 A;  3L6H A;  5KDT B;  4F3B A;  2F34 A;  1L5T A;  4FOR A;  5L9O A;  1JW5 A;  4H65 A;  4U22 A;  2A5T B;  2P2A A;  2OZZ A;  4HS7 A;  5TU0 A;  1XT8 A;  2ALU A;  3Q26 A;  5L9S A;  4OZ9 A;  3MAM A;  1LB8 A;  4ZED A;  3LUY A;  4IO6 A;  2X7P A;  4H6D A;  3H7M A;  2Y7W A;  2F6P A;  1POT A;  4NF5 A;  4OEV A;  3QUJ A;  4I8C A;  4LA9 A;  1FTK A;  1XS5 A;  3TTL A;  2O1L A;  1IIT A;  1M5E A;  1N84 A;  1FQE A;  3MVY A;  4THI A;  3KN8 A;  4H5G A;  2Q88 A;  3CFZ A;  3H4Z A;  4N6P A;  4BDM A;  4IY5 A;  3PUZ E;  1LLS A;  4F18 A;  3IJO B;  4YB7 A;  1SVX B;  4ND9 A;  4ZE8 A;  3FVK A;  4QFK A;  3MPK A;  4GLI A;  5I84 A;  3CSB A;  4DIG A;  3Q28 A;  1MS7 A;  1N7W A;  1MPB A;  3HO7 A;  3VE1 B;  1LBB A;  5TPA A;  2OJT A;  1SYI A;  2Y7P A;  2BJJ X;  4OER A;  1NMU A;  4XXU A;  1B3E A;  4EQ7 A;  5F1Q A;  4AB6 A;  3V8X B;  3T96 B;  1IUD A;  3IO4 A;  3U1O A;  1AL3 A;  3GBB A;  2ZYO A;  1DSN A;  2DWJ A;  5DEX B;  1URG A;  1VE4 A;  2P0S A;  1PC3 A;  3HHG A;  3OSQ A;  4YIC A;  1PDA A;  1LAH E;  3B7D A;  1ZTY A;  3Q25 A;  1OQG A;  1UQW A;  1ATG A;  3TCF A;  3TTN A;  1P99 A;  5HM4 B;  1FCK A;  4KPT A;  1NNK A;  2QS4 A;  4DXC A;  2Z23 A;  3R7X A;  3M3F A;  3QUF A;  2VD2 A;  3PUW E;  2O51 A;  4NMY A;  3O6G A;  4F1U A;  1QVS A;  1IQ7 A;  2GRV A;  5I57 B;  3CI8 A;  1A40 A;  3RGY A;  2XX9 A;  3FV1 A;  2VP1 A;  4EXL A;  3PPO A;  2Z22 A;  3O29 A;  3RY3 A;  2O69 A;  4OHN A;  2O68 A;  1NKX A;  3T66 A;  3O9P A;  4KYD A;  1H3D A;  5KZT A;  1B9J A;  2DOJ A;  1OLC A;  2Y7I A;  1LFG A;  1SW2 A;  3TKD A;  1Y20 A;  3FZV A;  4YZZ A;  1B58 A;  3PD8 A;  1A7L A;  3CG3 A;  4ZEK A;  3S9E A;  1FTM A;  4XTC Q;  3IOV A;  2DE4 A;  2AL5 A;  4Z7E A;  2XXY A;  2HAV A;  4WEP A;  1MM6 A;  4AB5 A;  2F5X A;  3B6T A;  1LST A;  4IGT A;  3TUS A;  1M5C A;  3ILU B;  3JYR A;  4E0W A;  4F3S A;  4R75 A;  3MJN A;  5F7V A;  3KN7 A;  4NF5 B;  2OWT A;  1SW1 A;  1Y1M A;  2AYS A;  3TYH A;  5EHS A;  3IOW A;  4K3F A;  4LQ2 A;  4GIZ A;  1QKA A;  4IB2 A;  4GL8 A;  1OMP A;  4TLL B;  4RA1 A;  4O3B A;  1J1N A;  3MP1 A;  2REJ A;  4L17 A;  3TPA A;  5I59 A;  1Y4C A;  4U4S A;  4Q30 B;  4BDO A;  2DYX A;  3UGW A;  4PET A;  3GBA A;  4XIG Q;  1O63 A;  3O6I A;  1R1N A;  4ONY A;  1FQD A;  3VV5 A;  1B7U A;  5ISU A;  2I3V A;  4XKP A;  1OQH A;  3K6V A;  3SDF A;  5KDT A;  4KI0 E;  2KLF A;  3TMG A;  3VLU A;  3KZG A;  3EPE A;  3SEV A;  4F29 A;  3VLW A;  3CSG A;  2A5T A;  3C34 A;  2PX1 A;  1P1N A;  4LZ7 A;  5H8Q B;  3SEW A;  4HW8 A;  3C35 A;  1M5F A;  3E9X A;  4OFJ A;  4ZS9 A;  3F11 A;  4KFQ A;  4O3C A;  1SBP A;  2V93 A;  1FQB A;  2B65 A;  4U1O A;  2YPN A;  1B7H A;  2I58 A;  4R6K A;  4JSO A;  4I1D A;  4GFR A;  1VFE A;  2DXR A;  4NTL A;  3VVD A;  1PEB A;  3UK4 A;  1QUK A;  4IO7 A;  3CRB A;  1JVX A;  4POW A;  3C36 A;  2B3B A;  3C33 A;  2B3F A;  2PYY A;  1DOT A;  2V3Q A;  3PPP A;  4OES A;  5B7D A;  1MY4 A;  2D21 A;  1XOC A;  1JW1 A;  4ELP A;  3UIF A;  5FTH A;  2HAU A;  3M3L A;  2R6G E;  4MLV A;  2Y7K A;  1MQG A;  4PQJ A;  4GVO A;  5AA4 B;  4KHZ E;  1GV8 A;  5H8F B;  3ZS6 A;  1ELJ A;  4HTG A;  4ISU A;  2DS9 A;  3N6U A;  4LP2 B;  2H4I A;  2UVJ A;  4H0W A;  4MLQ A;  4NE4 A;  4EUO A;  4P11 A;  2Q2A A;  1FQA A;  1B0H A;  3KN3 A;  2HQ0 A;  2ZYN A;  1DTG A;  4NF4 A;  5CBS A;  4JWY A;  4YKI A;  3RT6 B;  3TEL A;  1H43 A;  1YPN A;  1LFI A;  4BDR A;  4YMB A;  1UTB A;  4GD5 A;  3OD7 A;  3IK6 B;  3P7I A;  1B1H A;  3HPI A;  5DYH A;  3RLF E;  1US5 A;  4JWO A;  3VVF A;  1S9T A;  2VOZ A;  3L6G A;  1NNF A;  3CFX A;  3FXU A;  3HHF A;  2F97 A;  4OEN A;  2OLB A;  1T0K A;  3OSR A;  2QS1 A;  4RY1 A;  5JK4 A;  4QFO A;  1EH3 A;  4OEU A;  2F7A A;  2THI A;  5I57 A;  3OMB A;  4R73 A;  3C9H A;  3PMV A;  4YU0 A;  1P1Q A;  5IKB A;  1URD A;  3T9U A;  5ICT A;  1QUJ A;  4KYE A;  1MQH A;  2ONK E;  1FW0 A;  3VXC A;  3MC2 A;  2AIX A;  1DPE A;  2G93 A;  2PT1 A;  3KG2 A;  1VR5 A;  3VLV A;  1D4N A;  1Q1K A;  3DM0 A;  4QF9 A;  3DP4 A;  3U92 A;  3KSJ A;  4FED A;  1LFH A;  5L9M A;  1HSJ A;  1MY2 A;  4ECF A;  3WAE A;  4FE8 A;  4O3A A;  4GQO A;  4XKQ A;  3T9H B;  3OOA A;  1MRP A;  3I3V A;  2DE2 A;  2XXI A;  3HV1 A;  2HFB A;  2D5W A;  2I0C A;  4H8J A;  4F31 B;  3C4M A;  5TP9 B;  2XXU A;  2RCA A;  4ELO A;  2Y7R A;  4C0R A;  4IO4 A;  4C1U A;  4U21 A;  3MP8 A;  3MW0 A;  2PVU A;  3H6V A;  3OO6 A;  2QS2 A;  1MQJ A;  1MXZ A;  4E0X A;  2H25 A;  2ONS A;  2XD2 A;  2QMW A;  3VDF A;  1GTK A;  3THI A;  3PPN A;  5I58 B;  3KJ7 A;  3ONM A;  3N5L A;  5EYF A;  3IOR A;  1B3G A;  5CMM A;  4DLD A;  1B40 A;  4G77 A;  4WKM A;  3PV0 E;  4OET A;  3MP6 A;  3FIR A;  1MH3 A;  3Q27 A;  1QKB A;  2UVH A;  4RJZ A;  3QAX A;  4JBZ A;  2FNC A;  5HPQ A;  1NNT A;  1N04 A;  1CE2 A;  1TXF A;  3RT8 A;  1Y1Z A;  1YTV A;  4IY6 A;  1D9V A;  1MQI A;  4U1Z A;  3TCH A;  4F1V A;  1MY0 A;  1B05 A;  3GZG A;  2X26 A;  3UOR A;  4PFU A;  2VHA A;  3SEX A;  4NF8 B;  2F35 A;  1MPD A;  3K1M A;  3UN6 A;  4JDF A;  4TLM B;  5HBC A;  5DT6 A;  1GR2 A;  4FJP A;  3MZB A;  3OO8 A;  4F3P A;  5CM6 A;  1Z7M E;  3TOD A;  1B2H A;  1TFA A;  3FJG A;  5H8Q A;  1P1U A;  2O6A A;  2YLN A;  5JTY A;  2ONR A;  1OLA A;  5ICQ A;  2NVU B;  3IB2 A;  4NF4 B;  3SKP A;  3MUQ A;  2RC8 A;  4N07 A;  3IX1 A;  1ZMG A;  5CBR A;  1PB7 A;  1UTB B;  2XXX A;  3HCQ A;  3BFT A;  1EZO A;  2O7I A;  1MM7 A;  2XXR A;  3G3J A;  4LUB A;  3TTM A;  5DVI A;  2RCB A;  3EHS A;  1PB9 A;  4GWO A;  3TZA A;  4JB7 A;  3OEL A;  1B0L A;  1GGG A;  1JW4 A;  3MBP A;  1O7T A;  2F7C A;  3MVX A;  2PT2 A;  2D3I A;  1R6Z A;  3MZ9 A;  1Y9U A;  3FAT A;  2I6E A;  1MDQ A;  4GXA A;  4YB6 A;  1B3L A;  3DEL B;  3PMW A;  2I3W A;  5AA4 A;  4UA8 A;  4Q0C A;  4AQ4 A;  3TFL A;  3E4R A;  3R26 A;  5H8F A;  3IR1 A;  4FEC A;  2Q89 A;  2AL4 A;  3VVE A;  4ZEC A;  3K6U A;  4WXJ A;  1LGB C;  4RPO A;  4LVQ A;  3FVG A;  4P0I A;  3MWB A;  4DZ1 A;  5I2N B;  2QPQ A;  2G29 A;  2XXV A;  1DPP A;  2I49 A;  3BKI B;  2DVC A;  3TDJ A;  3QSL A;  1A99 A;  1Y3Q A;  1QUI A;  3K00 A;  1N76 A;  2XX8 A;  3VXB A;  4Z0I A;  1ZJL A;  2GHB A;  2Z8D A;  5CMC A;  4Q5T A;  2Q8J A;  3USD A;  1MXV A;  4ZE9 A;  3V5A A;  3KEI A;  1IXI A;  3BFU A;  5JEI A;  3FUZ A;  1R9Q A;  1H44 A;  3LR1 A;  4YKK A;  3LSF B;  1EZP A;  3EF7 A;  3QK6 A;  1N3X A;  5L8D A;  3Q29 A;  3U72 A;  2Z8F A;  4IO5 A;  2ABH A;  2RIN A;  1F9B A;  5B70 A;  5AA2 D;  2R9J A;  4RXL A;  3O2A A;  3RQT A;  2REG A;  1A8F A;  5AA1 A;  3FGS A;  2GH9 A;  2R71 A;  2I48 A;  1AOV A;  5JTY B;  3TCG A;  4G8N A;  1B46 A;  5TP9 A;  1MY3 A;  2QL3 A;  2H98 A;  3G3G A;  5H8S A;  3E3K A;  4Q8R A;  5KCJ B;  2LAO A;  4RK2 A;  2QS3 A;  2O1M A;  1ZIU A;  3K02 A;  5I58 A;  2NUV A;  4F2O A;  1IZ1 A;  4EXK A;  3K01 A;  4YKP A;  1VSO A;  4MBP A;  2RKM A;  3MZ1 A;  2HZL A;  4ZEF A;  3PUV E;  2DWA A;  4LZ8 A;  4F3G A;  3BBR A;  3ILT B;  3FJ7 A;  2Y84 A;  3IAZ A;  1MQD A;  1A8E A;  3G3K A;  1LBC A;  3SES A;  4NF8 A;  1OVB A;  3KOT A;  2RC7 A;  3V89 B;  2HEU A;  3K4U A;  2GFE A;  3UA8 A;  3EHU A;  4YAH X;  2OWS A;  4LZ5 A;  1UIU A;  2H5Y A;  3S4U A;  4M1V A;  3FD3 A;  1BLF A;  3O66 A;  3DLN A;  3TTK A;  2NOO A;  4R9G A;  1TWY A;  4OWD A;  3K6X A;  3PMX A;  4XKN A;  3H3G A;  1US4 A;  3K1P A;  3M3K A;  4XKR A;  3HST A;  3U93 A;  1S7Y A;  1FQF A;  3C31 A;  2DQV A;  1B3F A;  1CB6 A;  4KR5 A;  3LSX A;  4UAC A;  5I2K B;  5AA2 A;  2ZNS A;  3IOT A;  4IO3 A;  4F39 A;  1MXY A;  4PFY A;  4NF6 B;  2Q2C A;  1AMF A;  1M5B A;  4U2R A;  1SW4 A;  5M2V A;  1JVY A;  2ZMB A;  4ELR A;  1SW5 A;  3R6U A;  4DE8 A;  4YKJ A;  3JV9 A;  3FVO A;  3PUY E;  3OEM A;  2DXY A;  2DP8 A;  4LON B;  2F36 A;  5I56 B;  5FHO A;  1QJM A;  3K2D A;  1GVC A;  4QSD A;  3T93 B;  3CIJ A;  1ANF A;  2XXW A;  4PFW A;  1LCF A;  3G3H A;  1LAG E;  5DVJ A;  3KJT A;  5I2N A;  3A09 A;  4JWX A;  3QIM A;  4NED A;  5A5X B;  3DP8 A;  1JET A;  3MQ9 A;  3V83 A;  5DTB A;  2V3T A;  2E0S A;  2HXW A;  4DCY A;  3GXA A;  5AA3 A;  3PPR A;  3CVG A;  1B5H A;  1I69 A;  4FIM A;  2P1S A;  4DXU A;  2F6G A;  2FYI A;  2DE3 A;  3ZKL A;  2I4B A;  1EZ9 A;  1SI1 A;  4X48 A;  2UYE A;  1FQC A;  5DVF A;  1FTJ A;  3SET A;  3H03 A;  4EDP A;  1FTO A;  1P1O A;  3G3I A;  3TTR A;  2I4C A;  3KFM A;  3AXF A;  4EQB A;  2UVI A;  2OCU A;  3FXR A;  2QJE A;  3EQ1 A;  3JZJ A;  3D4G A;  3ZKK A;  4JSD A;  1A54 A;  2VD3 A;  4FEB A;  1EU8 A;  3B6W A;  1TT1 A;  1FTL A;  1SYH A;  3LBS A;  2ZYK A;  3I5O A;  4YB5 A;  2DSF A;  4I9D A;  4KQP A;  3U94 A;  4H67 A;  4G2Z A;  3EN3 A;  1MXX A;  5K2Y A;  3SER A;  1JQF A;  3OO9 A;  1NNP A;  3G7W A;  5H8N B;  3T9X B;  5AE4 A;  3KSX A;  2OK2 A;  1UIV A;  1D9Y A;  4ZZE A;  1MH4 A;  1RKM A;  3O97 A;  4G4P A;  4WED A;  1IIW A;  2CZL A;  3T22 A;  3FJM A;  4LAT A;  4FAJ A;  3K0V A;  2XXQ A;  3TEP A;  2QSX A;  4RNS A;  5KCJ A;  3QYT A;  4QRZ A;  5H8H B;  3IJX B;  2XHD A;  1UTH A;  4H5F A;  4BDQ A;  5AA2 B;  3RTW B;  4GF8 A;  2O84 X;  4DDD A;  1BIY A;  5CI5 A;  2XXH A;  2RF1 A;  2XXT A;  4R2B A;  4R6Y A;  4F22 A;  1NL5 A;  3S9M C;  2F7B A;  2W7Y A;  4ESW A;  4R9F A;  4G8M A;  3GLB A;  1B6H A;  3S2V A;  1B5I A;  2I0B A;  1JNF A;  3CG1 A;  4ZEI A;  2IA4 A;  1P1W A;  2PMS A;  4NWD A;  3W15 C;  3N94 A;  3MVZ A;  1B32 A;  4KCC A;  1IEJ A;  1NH7 A;  1NH8 A;  4G68 C;  3PD9 A;  3K1N A;  1B52 A;  1SDX A;  4PFT A;  3PPQ A;  3IOU A;  2HCA A;  2QRY A;  4H1X A;  1POY 1;  4N13 A;  4GRK A;  2ZNT A;  2DWI A;  3QXM A;  5CMB A;  4QHQ A;  4X1D A;  1NFT A;  5CC2 A;  3PGF A;  1MG1 A;  4GXS B;  1SD3 A;  3K6W A;  2FA7 A;  1SI0 A;  2X7Q A;  3LSL A;  4X9T A;  4KCD A;  4HCW A;  4EF2 A;  1QW0 A;  1IXH A;  2WKY A;  3A3C A;  4G68 A;  1HSE A;  5ELV A;  5I2K A;  2NWJ A;  2A5S A;  3FV2 A;  1S50 A;  4QFP A;  2DWH A;  4RYA A;  2ANJ A;  3FAS A;  4NF6 A;  2E1S A;  4R72 A;  2Q9T A;  1OVT A;  1VFD A;  1B1X A;  3OEN A;  5FHN A;  3KGC A;  1MPC A;  1LCT A;  3MVW A;  1N7X A;  1QUL A;  3T9V A;  3S9L C;  3D4C A;  5I56 A;  4MH5 A;  1O64 A;  3IB0 A;  1BKA A;  4JXI A;  3DP6 A;  3WAF A;  3IL1 B;  1B4Z A;  1N0T A;  4DCX A;  1MXU A;  4U4X A;  4F19 A;  1WDN A;  1ZLQ A;  2UXA A;  4M4G A;  2ZNU A;  4MF3 A;  5CRY A;  2ZXT A;  3FVN A;  3ECR A; 
#chains in the Genus database with same CATH topology
 1XVY A;  3I6V A;  4KYS A;  4PE5 B;  1WVJ A;  4G8H A;  5A5X A;  2ZYM A;  3MPL A;  1ZKB A;  1KWH A;  1M5D A;  3VFJ A;  5TPA B;  1Y3P A;  2XX7 A;  4R6H A;  4OQO A;  4QSC A;  1WOD A;  3SEY A;  4PP0 A;  3FXQ A;  4EQ9 A;  4POX A;  3RUM A;  2O7U A;  4P8B A;  2CEX A;  1IXG A;  2P3N A;  2CEY A;  3HN0 A;  3EHT A;  1Z7N E;  4R2F A;  4MFI A;  4I62 A;  3MYU A;  4QFN A;  2CMO A;  1Q35 A;  3G3F A;  1IMA A;  3ZSF A;  1UTH B;  5IAI A;  3LSW A;  3CFL A;  4HCY A;  3SZP A;  3OXN A;  3UP9 A;  1USY E;  3KOS A;  4ZDM A;  2UYF A;  1H45 A;  4BLA A;  4OVJ A;  1LAX A;  4GWS A;  2F78 A;  3W9W A;  4NWC A;  1I6B A;  4ZZA A;  4OFO A;  4PAK A;  3RPL B;  1FPL A;  4GOT A;  1N3W A;  3RPW A;  4KD5 A;  1FTA A;  4ZEB A;  4LQ5 A;  2ESN A;  5CMK A;  3O28 A;  4X1B A;  2XD3 A;  1B7Z A;  5FTI A;  4MMP A;  1B4H A;  3A3U A;  5EHM A;  2V25 A;  5EQ8 A;  4PAF A;  4OTE A;  1TFD A;  5ET8 A;  2WX9 A;  2M8C A;  3E13 X;  3LC8 A;  1AIV A;  5T3J A;  1B5J A;  1IXC A;  5J1D A;  1R9L A;  1NUW A;  5FHM A;  2PBW A;  1MXW A;  3O6H A;  3H6T A;  5ET6 A;  1XVX A;  4TQU Q;  2NXO A;  2V3U A;  4GX6 A;  1NUY A;  4OFL A;  5H8N A;  3PUX E;  4H8I A;  2H9B A;  4ESX A;  4QFL A;  3H6W A;  1MY1 A;  5IGA A;  2FVZ A;  3ODB A;  1NV7 A;  3KC0 A;  1II5 A;  1B51 A;  4BDN A;  4BDL A;  5LOM A;  1KA1 A;  1RYX A;  5H8H A;  3TQW A;  4FAT A;  1XHY A;  1JEU A;  5DEX A;  4U23 A;  1A55 A;  1YCJ A;  4G68 B;  3C32 A;  3IO6 A;  1PBQ A;  2VGQ A;  5ITO A;  1Y3N A;  4P0G A;  1I6A A;  1URS A;  2V84 A;  4DXB A;  1AH5 A;  1ZBM A;  1QGX A;  2UVG A;  2RC9 A;  4GL0 A;  5IZ3 B;  1DTZ A;  3SEU A;  4TOZ A;  2VT5 A;  1FRP A;  4EF1 A;  3KBR A;  3N26 A;  4MNC A;  1FPF A;  2DVZ A;  3E79 A;  3OEK A;  4RPN A;  3H06 B;  1JEV A;  3TQL A;  1DMB A;  1RYO A;  5BWJ A;  2Z8E A;  4R74 A;  2QMX A;  1Y4T A;  4AS4 A;  4GWX A;  3S9N C;  2IEE A;  1PBP A;  4PGN A;  1SQY A;  1H76 A;  1ZU0 A;  1XC1 A;  3U8Q A;  1HSL A;  2HXR A;  2H99 A;  4F1Y A;  3N6T A;  4PBQ A;  1D3K A;  3W9V A;  4PFR A;  4IGR A;  1B3H A;  3TAJ A;  4ELQ A;  1VDW A;  1MDP 1;  1LAF E;  4RK9 A;  2HZK A;  1BTJ A;  3CR9 A;  1I6Q A;  1YAE A;  5I59 B;  3M8U A;  2XXP A;  2YJP A;  4OXV A;  5ITP A;  4QSE A;  1LB9 A;  4YMA A;  3B6Q A;  1USY H;  4OYV A;  1OIB A;  4OMB A;  1BP5 A;  2F8D A;  5K2X A;  1FPJ A;  4IO2 A;  3RN8 A;  1DK4 A;  2GHA A;  3OO7 A;  1YXI A;  3RTF B;  4C1T A;  3IB1 A;  3RNN A;  5BUU A;  3H6U A;  4F2Q A;  3PU5 A;  2OBG A;  1PB8 A;  3L6H A;  5KDT B;  4F3B A;  2F34 A;  1L5T A;  4FOR A;  5L9O A;  4H65 A;  1JW5 A;  4U22 A;  4OVT A;  1NUX A;  2A5T B;  2P2A A;  2OZZ A;  4HS7 A;  5TU0 A;  1XT8 A;  2ALU A;  2XWI A;  1G0I A;  3Q26 A;  4QXD A;  5L9S A;  4OZ9 A;  3MAM A;  1LB8 A;  4ZED A;  3LUY A;  4IO6 A;  2X7P A;  2V4C A;  4H6D A;  3H7M A;  2Y7W A;  2F6P A;  1POT A;  4NF5 A;  4OEV A;  3QUJ A;  4I8C A;  4LA9 A;  1SPI A;  1FTK A;  1XS5 A;  3TTL A;  2O1L A;  1IIT A;  4X04 A;  1M5E A;  1N84 A;  1FQE A;  3MVY A;  4THI A;  3T1B A;  3KN8 A;  4H5G A;  2Q88 A;  3CFZ A;  3H4Z A;  4N6P A;  4BDM A;  3IFC A;  3FXB A;  4IY5 A;  3PUZ E;  1LLS A;  4F18 A;  2PCR A;  3IJO B;  4YB7 A;  1SVX B;  4ND9 A;  2MKZ A;  4ZE8 A;  3FVK A;  4QFK A;  3MPK A;  1KZ8 A;  4GLI A;  5I84 A;  3CSB A;  4DIG A;  3Q28 A;  1MS7 A;  1N7W A;  5I5P A;  1MPB A;  3HO7 A;  3VE1 B;  1LBB A;  5TPA A;  2OJT A;  1SYI A;  2Y7P A;  4H45 A;  2BJJ X;  4OER A;  1NMU A;  4XXU A;  1B3E A;  4EQ7 A;  4NGU A;  4QBA A;  5F1Q A;  4AB6 A;  3V8X B;  4XEQ A;  3T96 B;  1IUD A;  5IM2 A;  3IO4 A;  3U1O A;  1AL3 A;  2B4M A;  3GBB A;  2ZYO A;  1DSN A;  2DWJ A;  4PDH A;  5DEX B;  3B50 A;  1URG A;  1VE4 A;  2P0S A;  1PC3 A;  3HHG A;  5EQ7 A;  3OSQ A;  4YIC A;  1PDA A;  2Y5L A;  1LAH E;  3B7D A;  1ZTY A;  3Q25 A;  1OQG A;  3U65 A;  1UQW A;  1ATG A;  4JVI A;  3TCF A;  3TTN A;  1P99 A;  5HM4 B;  1FCK A;  4KPT A;  1NNK A;  2QS4 A;  4DXC A;  1DBZ A;  2Z23 A;  3R7X A;  3M3F A;  3QUF A;  1RDY A;  5J16 A;  2VD2 A;  3PUW E;  2O51 A;  4MJO A;  4NMY A;  3O6G A;  4F1U A;  1QVS A;  1IQ7 A;  2GRV A;  5I57 B;  3CI8 A;  1A40 A;  3RGY A;  2XX9 A;  4NX1 A;  3FV1 A;  2VP1 A;  4EXL A;  3PPO A;  2Z22 A;  3O29 A;  3RY3 A;  2O69 A;  4OHN A;  2O68 A;  1LBW A;  1NKX A;  3T66 A;  3O9P A;  4KYD A;  1H3D A;  4DI3 D;  5KZT A;  1YZ0 A;  1B9J A;  2DOJ A;  1OLC A;  2XWO A;  2Y7I A;  1IMC A;  4MCO A;  1LFG A;  1SW2 A;  3TKD A;  1Y20 A;  3FZV A;  4YZZ A;  1B58 A;  3PD8 A;  1A7L A;  3CG3 A;  4ZEK A;  3S9E A;  1FTM A;  4XTC Q;  4N6D A;  3IOV A;  2DE4 A;  2AL5 A;  3KC1 A;  4Z7E A;  2XXY A;  2HAV A;  4WEP A;  5IZ3 A;  1MM6 A;  4AB5 A;  2F5X A;  3B6T A;  1LST A;  4IGT A;  3TUS A;  1M5C A;  3ILU B;  3JYR A;  4E0W A;  4F3S A;  4R75 A;  3MJN A;  5F7V A;  3KN7 A;  4NF5 B;  2OWT A;  1SW1 A;  1Y1M A;  2AYS A;  3TYH A;  5EHS A;  3IOW A;  4K3F A;  5F24 A;  4LQ2 A;  4GIZ A;  1QKA A;  4IB2 A;  4GL8 A;  1OMP A;  4O7M A;  4TLL B;  4RA1 A;  4O3B A;  4HE2 A;  2ZZX A;  1J1N A;  3MP1 A;  2REJ A;  4L17 A;  4HE0 A;  3TPA A;  5I59 A;  1Y4C A;  4U4S A;  4Q30 B;  4BDO A;  2DYX A;  3UGW A;  2FIX A;  4PET A;  3GBA A;  4XIG Q;  1O63 A;  3O6I A;  1R1N A;  4ONY A;  1FQD A;  3VV5 A;  1B7U A;  5ISU A;  2I3V A;  4XKP A;  1OQH A;  3K6V A;  1LBX A;  3SDF A;  4I3Y A;  5KDT A;  4KI0 E;  3PTY A;  2KLF A;  3TMG A;  3VLU A;  1NUZ A;  1JP4 A;  3KZG A;  3EPE A;  3SEV A;  4F29 A;  3VLW A;  3CSG A;  2A5T A;  3C34 A;  2PX1 A;  1P1N A;  4LZ7 A;  1FBF A;  5H8Q B;  3SEW A;  4HW8 A;  1CNQ A;  3C35 A;  4GX4 A;  1M5F A;  3E9X A;  4OFJ A;  2FBP A;  1FPG A;  4ZS9 A;  3F11 A;  4KFQ A;  4O3C A;  1SBP A;  2V93 A;  1FBG A;  1FQB A;  2B65 A;  4MIJ A;  1LBZ A;  4U1O A;  2YPN A;  1B7H A;  2I58 A;  4R6K A;  4JSO A;  4I1D A;  4GFR A;  1VFE A;  2DXR A;  4NTL A;  3VVD A;  1PEB A;  3UK4 A;  2OWZ A;  1QUK A;  4N81 A;  4IO7 A;  3CRB A;  1JVX A;  4POW A;  3C36 A;  2B3B A;  1RDZ A;  3C33 A;  2B3F A;  2PYY A;  4IR8 A;  3GYY A;  1DOT A;  2V3Q A;  3PPP A;  4OES A;  5B7D A;  1MY4 A;  2D21 A;  1XOC A;  1JW1 A;  4ELP A;  3UIF A;  5FTH A;  2HAU A;  3M3L A;  1FBC A;  2R6G E;  4MLV A;  2Y7K A;  1MQG A;  4PQJ A;  4NF0 A;  4GVO A;  5AA4 B;  4XF5 A;  4KHZ E;  1GV8 A;  4LN5 A;  5H8F B;  2B4L A;  3ZS6 A;  1ELJ A;  4HTG A;  4ISU A;  2DS9 A;  4PAI A;  3N6U A;  4LP2 B;  2WBD A;  2H4I A;  2UVJ A;  3EKI A;  4H0W A;  4MLQ A;  4NE4 A;  4EUO A;  4P11 A;  2Q2A A;  1FQA A;  1B0H A;  3KN3 A;  2HQ0 A;  1FPB A;  2ZYN A;  1DTG A;  4NF4 A;  5CBS A;  4JWY A;  4YKI A;  4P1L A;  3RT6 B;  3TEL A;  1H43 A;  1YPN A;  1LFI A;  4BDR A;  4YMB A;  1UTB A;  2BJI A;  4GD5 A;  3OD7 A;  3IK6 B;  3P7I A;  1B1H A;  2ZZW A;  3HPI A;  5DYH A;  3RLF E;  2P3V A;  1US5 A;  4JWO A;  3VVF A;  1S9T A;  2VOZ A;  3L6G A;  4N17 A;  1NNF A;  4N4U A;  3CFX A;  3FXU A;  3HHF A;  2F97 A;  4OEN A;  2OLB A;  1T0K A;  3OSR A;  2QS1 A;  4RY1 A;  5JK4 A;  4QFO A;  4OVR A;  4PF8 A;  1EH3 A;  4OEU A;  2F7A A;  2THI A;  5I57 A;  3OMB A;  4R73 A;  3C9H A;  3PMV A;  4YU0 A;  2QFL A;  1P1Q A;  5IKB A;  1URD A;  3BIH A;  4NAP A;  3T9U A;  5ICT A;  1QUJ A;  4N8G A;  4PDD A;  4KYE A;  1MQH A;  4P47 A;  2ONK E;  2CZK A;  4GX3 A;  1FW0 A;  3D1R A;  3VXC A;  3MC2 A;  2AIX A;  1DPE A;  2G93 A;  2PT1 A;  2QVR A;  3KG2 A;  1VR5 A;  3VLV A;  1D4N A;  1Q1K A;  3DM0 A;  4QF9 A;  3DP4 A;  3U92 A;  5LDZ A;  3KSJ A;  4FED A;  1LFH A;  5L9M A;  1HSJ A;  1MY2 A;  3BIG A;  4ECF A;  3WAE A;  2VPO A;  4FE8 A;  4O3A A;  4GQO A;  4XKQ A;  3T9H B;  3OOA A;  4N15 A;  1MRP A;  3I3V A;  1K9Z A;  2DE2 A;  2XXI A;  1NV5 A;  3HV1 A;  2HFB A;  4PFB A;  2D5W A;  2I0C A;  4H8J A;  2KR0 A;  3C4M A;  4F31 B;  5TP9 B;  2XXU A;  2RCA A;  4P3L A;  4ELO A;  2Y7R A;  4C0R A;  4IO4 A;  5FBP A;  4MX6 A;  5I7I A;  5ET7 A;  4C1U A;  4U21 A;  3MP8 A;  3MW0 A;  2PVU A;  3H6V A;  3OO6 A;  2QS2 A;  1MQJ A;  1MXZ A;  4E0X A;  2H25 A;  2ONS A;  2XD2 A;  2QMW A;  3VDF A;  1GTK A;  3THI A;  3PPN A;  1INP A;  5I58 B;  3KJ7 A;  3ONM A;  3N5L A;  4N8Y A;  5EYF A;  3IOR A;  4O8M A;  1B3G A;  5CMM A;  5ET5 A;  4DLD A;  1B40 A;  4G77 A;  4WKM A;  3PV0 E;  4OET A;  3MP6 A;  3FIR A;  1MH3 A;  1Q9D A;  3Q27 A;  1QKB A;  2UVH A;  4RJZ A;  3QAX A;  4JBZ A;  2FNC A;  5HPQ A;  4NG7 A;  1NNT A;  1N04 A;  1CE2 A;  1TXF A;  3RT8 A;  1Y1Z A;  1YTV A;  4IY6 A;  1D9V A;  1MQI A;  4U1Z A;  3TCH A;  4F1V A;  1MY0 A;  1B05 A;  3GZG A;  3CHG A;  2X26 A;  3UOR A;  4PFU A;  2VHA A;  3SEX A;  4NF8 B;  5IZ1 A;  2F35 A;  4OAN A;  1MPD A;  3K1M A;  3UN6 A;  4JDF A;  4TLM B;  1G0H A;  5HBC A;  5DT6 A;  1GR2 A;  2FHY A;  4GWY A;  4FJP A;  3MZB A;  3OO8 A;  4FBP A;  4F3P A;  5CM6 A;  1NI9 A;  1Z7M E;  3TOD A;  1B2H A;  1TFA A;  5IZZ A;  3FJG A;  5H8Q A;  1P1U A;  2O6A A;  2YLN A;  5JTY A;  2ONR A;  1OLA A;  5ICQ A;  2NVU B;  3IB2 A;  4NF4 B;  3SKP A;  3MUQ A;  2RC8 A;  4N07 A;  3IX1 A;  1ZMG A;  5CBR A;  3B8B A;  1PB7 A;  1UTB B;  2XXX A;  4JVC A;  3HCQ A;  3BFT A;  1EZO A;  2O7I A;  1MM7 A;  2XXR A;  3G3J A;  4LUB A;  3TTM A;  2XWK A;  5DVI A;  2RCB A;  3EHS A;  1PB9 A;  4GWO A;  3TZA A;  4JB7 A;  3OEL A;  4P1E A;  4MHF A;  1B0L A;  1GGG A;  1JW4 A;  3MBP A;  1O7T A;  2F7C A;  2F3B A;  3MVX A;  2PT2 A;  4HE1 A;  2WYP A;  2HPG A;  2D3I A;  1R6Z A;  3MZ9 A;  1Y9U A;  3FAT A;  2I6E A;  1MDQ A;  4GXA A;  4YB6 A;  1B3L A;  3DEL B;  1D9Q A;  3PMW A;  3RYD A;  2I3W A;  5AA4 A;  4UA8 A;  4MNP A;  4Q0C A;  3TFL A;  4AQ4 A;  3E4R A;  3R26 A;  5H8F A;  3IR1 A;  4FEC A;  2Q89 A;  2AL4 A;  4OVS A;  3VVE A;  4ZEC A;  3K6U A;  4I40 A;  4WXJ A;  1LGB C;  4RPO A;  1RDX A;  4LVQ A;  4GBV A;  3FVG A;  4PE3 A;  1FJ6 A;  3LUZ A;  4P0I A;  3MWB A;  3KBZ A;  4GWU A;  4DZ1 A;  5I2N B;  2QPQ A;  2G29 A;  3LV0 A;  2XXV A;  1DPP A;  2I49 A;  2FIE A;  3BKI B;  2DVC A;  3TDJ A;  3QSL A;  1A99 A;  1Y3Q A;  1QUI A;  3K00 A;  1N76 A;  1IMF A;  2XX8 A;  3VXB A;  4Z0I A;  1ZJL A;  3IFA A;  2OX3 A;  2GHB A;  4PGP A;  1FJ9 A;  3T0J A;  2Z8D A;  5CMC A;  4Q5T A;  4MAG A;  5EQA A;  4GWZ A;  2Q8J A;  3USD A;  1MXV A;  4ZE9 A;  3V5A A;  1EYI A;  1IMB A;  1NV0 A;  2WEF A;  3KEI A;  1IXI A;  3BFU A;  5JEI A;  3FUZ A;  1R9Q A;  1H44 A;  3NOH A;  3LR1 A;  4YKK A;  3LSF B;  1EZP A;  3EF7 A;  3QK6 A;  4XFE A;  4HXV A;  1N3X A;  5L8D A;  3Q29 A;  4GWW A;  3U72 A;  2Z8F A;  4IO5 A;  2ABH A;  2RIN A;  1F9B A;  5B70 A;  5AA2 D;  2R9J A;  4RXL A;  1FPK A;  3O2A A;  3RQT A;  2REG A;  5DW8 A;  1A8F A;  5AA1 A;  3FGS A;  2GH9 A;  2R71 A;  2I48 A;  1AOV A;  5JTY B;  3TCG A;  2WBB A;  4PBH A;  4G8N A;  1B46 A;  1AWB A;  5TP9 A;  1MY3 A;  2QL3 A;  2H98 A;  4OVP A;  4NN3 A;  3ISP A;  5EYH A;  3G3G A;  5H8S A;  2PFZ A;  3E3K A;  4Q8R A;  4NQ8 A;  5KCJ B;  2LAO A;  4PC9 A;  1LBY A;  4RK2 A;  2QS3 A;  2O1M A;  1ZIU A;  2KQZ A;  3K02 A;  5I58 A;  2NUV A;  4F2O A;  1IZ1 A;  4EXK A;  3K01 A;  4YKP A;  3A29 A;  1VSO A;  4G61 A;  4MBP A;  2RKM A;  2ZZV A;  3MZ1 A;  2HZL A;  4ZEF A;  2F3D A;  3PUV E;  4N91 A;  2DWA A;  4LZ8 A;  4F3G A;  3BBR A;  4PFI A;  3ILT B;  3FJ7 A;  2Y84 A;  4KXP A;  3IAZ A;  1MQD A;  1A8E A;  3G3K A;  1LBC A;  3SES A;  4NF8 A;  1OVB A;  1YYZ A;  3KOT A;  2RC7 A;  4N6K A;  3V89 B;  2HEU A;  3K4U A;  2GFE A;  3UA8 A;  1NV4 A;  3EHU A;  4YAH X;  2OWS A;  4LZ5 A;  1UIU A;  2H5Y A;  3S4U A;  4M1V A;  3FD3 A;  1BLF A;  3O66 A;  1FPI A;  3DLN A;  1NV2 A;  3TTK A;  2NOO A;  4R9G A;  1TWY A;  4OWD A;  3K6X A;  3PMX A;  4XKN A;  4MEV A;  2CZH A;  3H3G A;  1DCU A;  1US4 A;  3K1P A;  3M3K A;  4XKR A;  3HST A;  3U93 A;  1S7Y A;  1FQF A;  3C31 A;  2DQV A;  1B3F A;  1CB6 A;  4KR5 A;  3LSX A;  4UAC A;  5I2K B;  5AA2 A;  2ZNS A;  3IOT A;  4IO3 A;  4F39 A;  1MXY A;  4PFY A;  4X8R A;  4NF6 B;  2Q2C A;  1AMF A;  2QVV A;  1M5B A;  4U2R A;  1SW4 A;  5M2V A;  1JVY A;  4P9K A;  2ZMB A;  4ELR A;  1FBD A;  1SW5 A;  3R6U A;  4DE8 A;  4YKJ A;  3JV9 A;  4I3E A;  3FVO A;  3PUY E;  2CZI A;  1FPD A;  3OEM A;  2DXY A;  2DP8 A;  1EYK A;  4LON B;  2F36 A;  5I56 B;  5FHO A;  1QJM A;  3K2D A;  1GVC A;  4QSD A;  3T93 B;  3CIJ A;  1ANF A;  2XXW A;  4PFW A;  1LCF A;  1FBH A;  3G3H A;  1LAG E;  5DVJ A;  3KJT A;  5I2N A;  3A09 A;  4H46 A;  4JWX A;  3QIM A;  4NED A;  2GQ1 A;  5A5X B;  3DP8 A;  1JET A;  3MST A;  3MQ9 A;  3V83 A;  5DTB A;  3E78 A;  2V3T A;  2E0S A;  4AS5 A;  2HXW A;  4DCY A;  3GXA A;  5AA3 A;  3PPR A;  3CVG A;  1B5H A;  1I69 A;  4FIM A;  2P1S A;  4DXU A;  4PCD A;  2F6G A;  2FYI A;  1XI6 A;  5LTC A;  2L5V A;  2DE3 A;  3FBP A;  3ZKL A;  2I4B A;  1SI1 A;  4X48 A;  2VPN A;  2UYE A;  2Q74 A;  1FQC A;  5DVF A;  1FTJ A;  3SET A;  1FPE A;  3H03 A;  4EDP A;  1FTO A;  1P1O A;  1EYJ A;  3G3I A;  3TTR A;  2I4C A;  3KFM A;  3AXF A;  4EQB A;  2UVI A;  2OCU A;  3FXR A;  2QJE A;  3EQ1 A;  3JZJ A;  4PF6 A;  3D4G A;  3ZKK A;  4JSD A;  1A54 A;  2VD3 A;  4FEB A;  1EU8 A;  3B6W A;  1TT1 A;  3HFU A;  1FTL A;  1SYH A;  3LBS A;  2ZYK A;  3I5O A;  4YB5 A;  2DSF A;  4I9D A;  4KQP A;  3U94 A;  4H67 A;  4G2Z A;  3EN3 A;  2XA5 A;  1MXX A;  1FBP A;  5K2Y A;  3SER A;  1JQF A;  3OO9 A;  1NNP A;  3G7W A;  5H8N B;  3T9X B;  2PFY A;  4OVQ A;  5AE4 A;  3KSX A;  2OK2 A;  1UIV A;  1D9Y A;  4ZZE A;  1MH4 A;  2DDK A;  1RKM A;  2R8T A;  3O97 A;  4G4P A;  4WED A;  1IIW A;  2CZL A;  3T22 A;  3FJM A;  4LAT A;  4FAJ A;  4JVD A;  3K0V A;  2XXQ A;  1BK4 A;  3TEP A;  1KA0 A;  2QSX A;  4RNS A;  5KCJ A;  3QYT A;  4QRZ A;  5H8H B;  3IJX B;  2XHD A;  1UTH A;  2HHM A;  2WYK A;  4H5F A;  4BDQ A;  3ROJ A;  5AA2 B;  3RTW B;  2QVU A;  4GF8 A;  2O84 X;  4DDD A;  1BIY A;  1LBV A;  5CI5 A;  2XXH A;  1IMD A;  2RF1 A;  2XXT A;  2XWV A;  4R2B A;  4R6Y A;  1IME A;  3QMF A;  4MNI A;  4F22 A;  3RPL A;  1NL5 A;  3S9M C;  2F7B A;  2W7Y A;  4ESW A;  4R9F A;  4G8M A;  3GLB A;  1B6H A;  3S2V A;  1B5I A;  2I0B A;  4PTK A;  2Y5K A;  1JNF A;  3CG1 A;  4P56 A;  4ZEI A;  2IA4 A;  1P1W A;  2PMS A;  5A5L A;  4NWD A;  3W15 C;  3N94 A;  3MVZ A;  1NV3 A;  1B32 A;  4KCC A;  1IEJ A;  1NH7 A;  1NH8 A;  1K9Y A;  4GBW A;  4G68 C;  3PD9 A;  3K1N A;  1B52 A;  1SDX A;  4PFT A;  3PPQ A;  3IOU A;  2HCA A;  2QRY A;  4H1X A;  1POY 1;  4N13 A;  4GRK A;  2ZNT A;  2DWI A;  3QXM A;  5CMB A;  4QHQ A;  4X1D A;  4UAB A;  1NFT A;  5CC2 A;  3PGF A;  1MG1 A;  4GXS B;  1SD3 A;  3K6W A;  2FA7 A;  1SI0 A;  2X7Q A;  3LSL A;  4X9T A;  4KCD A;  4HCW A;  2Q8M A;  2JJK A;  4EF2 A;  4OA4 A;  1QW0 A;  1IXH A;  2WKY A;  3A3C A;  4G68 A;  1HSE A;  5ELV A;  5EYG A;  5I2K A;  2NWJ A;  2A5S A;  3FV2 A;  1S50 A;  4QFP A;  2DWH A;  4NHB A;  4RYA A;  2ANJ A;  3FAS A;  4NF6 A;  2E1S A;  4R72 A;  2Q9T A;  1OVT A;  1VFD A;  1B1X A;  1FBE A;  3OEN A;  5FHN A;  3KGC A;  1MPC A;  1LCT A;  5I3S A;  3MVW A;  1N7X A;  4DI4 B;  1QUL A;  3T9V A;  3S9L C;  1LEV A;  3D4C A;  5I56 A;  4MH5 A;  1O64 A;  5ESY A;  2XXK A;  3IB0 A;  1BKA A;  4JXI A;  3DP6 A;  5EQ9 A;  1NV6 A;  3WAF A;  3IL1 B;  1NV1 A;  1B4Z A;  1FSA A;  4O94 A;  1N0T A;  4DCX A;  3FVN A;  1MXU A;  4U4X A;  4F19 A;  1WDN A;  1ZLQ A;  2UXA A;  4M4G A;  2ZNU A;  4MF3 A;  5CRY A;  2ZXT A;  1EZ9 A;  4O7I A;  3ECR A; 
#chains in the Genus database with same CATH homology
 1XVY A;  3I6V A;  4KYS A;  4PE5 B;  1WVJ A;  4G8H A;  5A5X A;  2ZYM A;  3MPL A;  1ZKB A;  1KWH A;  1M5D A;  3VFJ A;  5TPA B;  1Y3P A;  2XX7 A;  4R6H A;  4OQO A;  4QSC A;  1WOD A;  3SEY A;  4PP0 A;  3FXQ A;  4EQ9 A;  4POX A;  3RUM A;  2O7U A;  1IXG A;  3HN0 A;  3EHT A;  1Z7N E;  4R2F A;  4MFI A;  4I62 A;  4QFN A;  2CMO A;  1Q35 A;  3G3F A;  3ZSF A;  1UTH B;  5IAI A;  3LSW A;  3CFL A;  4HCY A;  3OXN A;  3UP9 A;  1USY E;  3KOS A;  4ZDM A;  2UYF A;  1H45 A;  4BLA A;  4OVJ A;  1LAX A;  2F78 A;  3W9W A;  4NWC A;  1I6B A;  4ZZA A;  4OFO A;  4GOT A;  1N3W A;  3RPW A;  4KD5 A;  4ZEB A;  4LQ5 A;  2ESN A;  5CMK A;  3O28 A;  4X1B A;  2XD3 A;  1B7Z A;  5FTI A;  1B4H A;  3A3U A;  5EHM A;  2V25 A;  4OTE A;  1TFD A;  2M8C A;  3E13 X;  3LC8 A;  1AIV A;  1B5J A;  1IXC A;  5J1D A;  1R9L A;  5FHM A;  2PBW A;  1MXW A;  3O6H A;  3H6T A;  1XVX A;  4TQU Q;  2NXO A;  2V3U A;  4OFL A;  5H8N A;  3PUX E;  4H8I A;  2H9B A;  4ESX A;  4QFL A;  3H6W A;  1MY1 A;  3ODB A;  1II5 A;  1B51 A;  4BDN A;  4BDL A;  5LOM A;  1RYX A;  5H8H A;  3TQW A;  4FAT A;  1XHY A;  1JEU A;  5DEX A;  4U23 A;  1A55 A;  1YCJ A;  4G68 B;  3C32 A;  3IO6 A;  1PBQ A;  2VGQ A;  5ITO A;  1Y3N A;  4P0G A;  1I6A A;  1URS A;  2V84 A;  4DXB A;  1AH5 A;  1ZBM A;  2UVG A;  2RC9 A;  4GL0 A;  1DTZ A;  3SEU A;  4TOZ A;  4EF1 A;  3KBR A;  3N26 A;  2DVZ A;  3OEK A;  4RPN A;  3H06 B;  1JEV A;  3TQL A;  1DMB A;  1RYO A;  5BWJ A;  2Z8E A;  4R74 A;  2QMX A;  1Y4T A;  3S9N C;  2IEE A;  1PBP A;  1SQY A;  1H76 A;  1ZU0 A;  1XC1 A;  3U8Q A;  1HSL A;  2H99 A;  4F1Y A;  3N6T A;  1D3K A;  3W9V A;  4IGR A;  1B3H A;  3TAJ A;  4ELQ A;  4RK9 A;  1MDP 1;  1LAF E;  2HZK A;  1BTJ A;  3CR9 A;  1I6Q A;  1YAE A;  5I59 B;  3M8U A;  2XXP A;  2YJP A;  4OXV A;  5ITP A;  4QSE A;  1LB9 A;  4YMA A;  3B6Q A;  1USY H;  4OYV A;  1OIB A;  4OMB A;  1BP5 A;  2F8D A;  5K2X A;  4IO2 A;  3RN8 A;  2GHA A;  3OO7 A;  3RTF B;  4C1T A;  3IB1 A;  3RNN A;  5BUU A;  3H6U A;  4F2Q A;  3PU5 A;  2OBG A;  1PB8 A;  3L6H A;  5KDT B;  4F3B A;  2F34 A;  1L5T A;  4FOR A;  5L9O A;  1JW5 A;  4H65 A;  4U22 A;  2A5T B;  2P2A A;  2OZZ A;  4HS7 A;  5TU0 A;  1XT8 A;  2ALU A;  3Q26 A;  5L9S A;  4OZ9 A;  3MAM A;  1LB8 A;  4ZED A;  3LUY A;  4IO6 A;  2X7P A;  4H6D A;  3H7M A;  2Y7W A;  2F6P A;  1POT A;  4NF5 A;  4OEV A;  3QUJ A;  4I8C A;  4LA9 A;  1FTK A;  1XS5 A;  3TTL A;  2O1L A;  1IIT A;  1M5E A;  1N84 A;  1FQE A;  3MVY A;  4THI A;  3KN8 A;  4H5G A;  2Q88 A;  3CFZ A;  3H4Z A;  4N6P A;  4BDM A;  4IY5 A;  3PUZ E;  1LLS A;  4F18 A;  3IJO B;  4YB7 A;  1SVX B;  4ND9 A;  4ZE8 A;  3FVK A;  4QFK A;  3MPK A;  4GLI A;  5I84 A;  3CSB A;  4DIG A;  3Q28 A;  1MS7 A;  1N7W A;  1MPB A;  3HO7 A;  3VE1 B;  1LBB A;  5TPA A;  2OJT A;  1SYI A;  2Y7P A;  2BJJ X;  4OER A;  1NMU A;  4XXU A;  1B3E A;  4EQ7 A;  5F1Q A;  4AB6 A;  3V8X B;  3T96 B;  1IUD A;  3IO4 A;  3U1O A;  1AL3 A;  3GBB A;  2ZYO A;  1DSN A;  2DWJ A;  5DEX B;  1URG A;  1VE4 A;  2P0S A;  1PC3 A;  3HHG A;  3OSQ A;  4YIC A;  1PDA A;  1LAH E;  3B7D A;  1ZTY A;  3Q25 A;  1OQG A;  1UQW A;  1ATG A;  3TCF A;  3TTN A;  1P99 A;  5HM4 B;  1FCK A;  4KPT A;  1NNK A;  2QS4 A;  4DXC A;  2Z23 A;  3R7X A;  3M3F A;  3QUF A;  2VD2 A;  3PUW E;  2O51 A;  4NMY A;  3O6G A;  4F1U A;  1QVS A;  1IQ7 A;  2GRV A;  5I57 B;  3CI8 A;  1A40 A;  3RGY A;  2XX9 A;  3FV1 A;  2VP1 A;  4EXL A;  3PPO A;  2Z22 A;  3O29 A;  3RY3 A;  2O69 A;  4OHN A;  2O68 A;  1NKX A;  3T66 A;  3O9P A;  4KYD A;  1H3D A;  5KZT A;  1B9J A;  2DOJ A;  1OLC A;  2Y7I A;  1LFG A;  1SW2 A;  3TKD A;  1Y20 A;  3FZV A;  4YZZ A;  1B58 A;  3PD8 A;  1A7L A;  3CG3 A;  4ZEK A;  3S9E A;  1FTM A;  4XTC Q;  3IOV A;  2DE4 A;  2AL5 A;  4Z7E A;  2XXY A;  2HAV A;  4WEP A;  1MM6 A;  4AB5 A;  2F5X A;  3B6T A;  1LST A;  4IGT A;  3TUS A;  1M5C A;  3ILU B;  3JYR A;  4E0W A;  4F3S A;  4R75 A;  3MJN A;  5F7V A;  3KN7 A;  4NF5 B;  2OWT A;  1SW1 A;  1Y1M A;  2AYS A;  3TYH A;  5EHS A;  3IOW A;  4K3F A;  4LQ2 A;  4GIZ A;  1QKA A;  4IB2 A;  4GL8 A;  1OMP A;  4TLL B;  4RA1 A;  4O3B A;  1J1N A;  3MP1 A;  2REJ A;  4L17 A;  3TPA A;  5I59 A;  1Y4C A;  4U4S A;  4Q30 B;  4BDO A;  2DYX A;  3UGW A;  4PET A;  3GBA A;  4XIG Q;  1O63 A;  3O6I A;  1R1N A;  4ONY A;  1FQD A;  3VV5 A;  1B7U A;  5ISU A;  2I3V A;  4XKP A;  1OQH A;  3K6V A;  3SDF A;  5KDT A;  4KI0 E;  2KLF A;  3TMG A;  3VLU A;  3KZG A;  3EPE A;  3SEV A;  4F29 A;  3VLW A;  3CSG A;  2A5T A;  3C34 A;  2PX1 A;  1P1N A;  4LZ7 A;  5H8Q B;  3SEW A;  4HW8 A;  3C35 A;  1M5F A;  3E9X A;  4OFJ A;  4ZS9 A;  3F11 A;  4KFQ A;  4O3C A;  1SBP A;  2V93 A;  1FQB A;  2B65 A;  4U1O A;  2YPN A;  1B7H A;  2I58 A;  4R6K A;  4JSO A;  4I1D A;  4GFR A;  1VFE A;  2DXR A;  4NTL A;  3VVD A;  1PEB A;  3UK4 A;  1QUK A;  4IO7 A;  3CRB A;  1JVX A;  4POW A;  3C36 A;  2B3B A;  3C33 A;  2B3F A;  2PYY A;  1DOT A;  2V3Q A;  3PPP A;  4OES A;  5B7D A;  1MY4 A;  2D21 A;  1XOC A;  1JW1 A;  4ELP A;  3UIF A;  5FTH A;  2HAU A;  3M3L A;  2R6G E;  4MLV A;  2Y7K A;  1MQG A;  4PQJ A;  4GVO A;  5AA4 B;  4KHZ E;  1GV8 A;  5H8F B;  3ZS6 A;  1ELJ A;  4HTG A;  4ISU A;  2DS9 A;  3N6U A;  4LP2 B;  2H4I A;  2UVJ A;  4H0W A;  4MLQ A;  4NE4 A;  4EUO A;  4P11 A;  2Q2A A;  1FQA A;  1B0H A;  3KN3 A;  2HQ0 A;  2ZYN A;  1DTG A;  4NF4 A;  5CBS A;  4JWY A;  4YKI A;  3RT6 B;  3TEL A;  1H43 A;  1YPN A;  1LFI A;  4BDR A;  4YMB A;  1UTB A;  4GD5 A;  3OD7 A;  3IK6 B;  3P7I A;  1B1H A;  3HPI A;  5DYH A;  3RLF E;  1US5 A;  4JWO A;  3VVF A;  1S9T A;  2VOZ A;  3L6G A;  1NNF A;  3CFX A;  3FXU A;  3HHF A;  2F97 A;  4OEN A;  2OLB A;  1T0K A;  3OSR A;  2QS1 A;  4RY1 A;  5JK4 A;  4QFO A;  1EH3 A;  4OEU A;  2F7A A;  2THI A;  5I57 A;  3OMB A;  4R73 A;  3C9H A;  3PMV A;  4YU0 A;  1P1Q A;  5IKB A;  1URD A;  3T9U A;  5ICT A;  1QUJ A;  4KYE A;  1MQH A;  2ONK E;  1FW0 A;  3VXC A;  3MC2 A;  2AIX A;  1DPE A;  2G93 A;  2PT1 A;  3KG2 A;  1VR5 A;  3VLV A;  1D4N A;  1Q1K A;  3DM0 A;  4QF9 A;  3DP4 A;  3U92 A;  3KSJ A;  4FED A;  1LFH A;  5L9M A;  1HSJ A;  1MY2 A;  4ECF A;  3WAE A;  4FE8 A;  4O3A A;  4GQO A;  4XKQ A;  3T9H B;  3OOA A;  1MRP A;  3I3V A;  2DE2 A;  2XXI A;  3HV1 A;  2HFB A;  2D5W A;  2I0C A;  4H8J A;  4F31 B;  3C4M A;  5TP9 B;  2XXU A;  2RCA A;  4ELO A;  2Y7R A;  4C0R A;  4IO4 A;  4C1U A;  4U21 A;  3MP8 A;  3MW0 A;  2PVU A;  3H6V A;  3OO6 A;  2QS2 A;  1MQJ A;  1MXZ A;  4E0X A;  2H25 A;  2ONS A;  2XD2 A;  2QMW A;  3VDF A;  1GTK A;  3THI A;  3PPN A;  5I58 B;  3KJ7 A;  3ONM A;  3N5L A;  5EYF A;  3IOR A;  1B3G A;  5CMM A;  4DLD A;  1B40 A;  4G77 A;  4WKM A;  3PV0 E;  4OET A;  3MP6 A;  3FIR A;  1MH3 A;  3Q27 A;  1QKB A;  2UVH A;  4RJZ A;  3QAX A;  4JBZ A;  2FNC A;  5HPQ A;  1NNT A;  1N04 A;  1CE2 A;  1TXF A;  3RT8 A;  1Y1Z A;  1YTV A;  4IY6 A;  1D9V A;  1MQI A;  4U1Z A;  3TCH A;  4F1V A;  1MY0 A;  1B05 A;  3GZG A;  2X26 A;  3UOR A;  4PFU A;  2VHA A;  3SEX A;  4NF8 B;  2F35 A;  1MPD A;  3K1M A;  3UN6 A;  4JDF A;  4TLM B;  5HBC A;  5DT6 A;  1GR2 A;  4FJP A;  3MZB A;  3OO8 A;  4F3P A;  5CM6 A;  1Z7M E;  3TOD A;  1B2H A;  1TFA A;  3FJG A;  5H8Q A;  1P1U A;  2O6A A;  2YLN A;  5JTY A;  2ONR A;  1OLA A;  5ICQ A;  2NVU B;  3IB2 A;  4NF4 B;  3SKP A;  3MUQ A;  2RC8 A;  4N07 A;  3IX1 A;  1ZMG A;  5CBR A;  1PB7 A;  1UTB B;  2XXX A;  3HCQ A;  3BFT A;  1EZO A;  2O7I A;  1MM7 A;  2XXR A;  3G3J A;  4LUB A;  3TTM A;  5DVI A;  2RCB A;  3EHS A;  1PB9 A;  4GWO A;  3TZA A;  4JB7 A;  3OEL A;  1B0L A;  1GGG A;  1JW4 A;  3MBP A;  1O7T A;  2F7C A;  3MVX A;  2PT2 A;  2D3I A;  1R6Z A;  3MZ9 A;  1Y9U A;  3FAT A;  2I6E A;  1MDQ A;  4GXA A;  4YB6 A;  1B3L A;  3DEL B;  3PMW A;  2I3W A;  5AA4 A;  4UA8 A;  4Q0C A;  4AQ4 A;  3TFL A;  3E4R A;  3R26 A;  5H8F A;  3IR1 A;  4FEC A;  2Q89 A;  2AL4 A;  3VVE A;  4ZEC A;  3K6U A;  4WXJ A;  1LGB C;  4RPO A;  4LVQ A;  3FVG A;  4P0I A;  3MWB A;  4DZ1 A;  5I2N B;  2QPQ A;  2G29 A;  2XXV A;  1DPP A;  2I49 A;  3BKI B;  2DVC A;  3TDJ A;  3QSL A;  1A99 A;  1Y3Q A;  1QUI A;  3K00 A;  1N76 A;  2XX8 A;  3VXB A;  4Z0I A;  1ZJL A;  2GHB A;  2Z8D A;  5CMC A;  4Q5T A;  2Q8J A;  3USD A;  1MXV A;  4ZE9 A;  3V5A A;  3KEI A;  1IXI A;  3BFU A;  5JEI A;  3FUZ A;  1R9Q A;  1H44 A;  3LR1 A;  4YKK A;  3LSF B;  1EZP A;  3EF7 A;  3QK6 A;  1N3X A;  5L8D A;  3Q29 A;  3U72 A;  2Z8F A;  4IO5 A;  2ABH A;  2RIN A;  1F9B A;  5B70 A;  5AA2 D;  2R9J A;  4RXL A;  3O2A A;  3RQT A;  2REG A;  1A8F A;  5AA1 A;  3FGS A;  2GH9 A;  2R71 A;  2I48 A;  1AOV A;  5JTY B;  3TCG A;  4G8N A;  1B46 A;  5TP9 A;  1MY3 A;  2QL3 A;  2H98 A;  3G3G A;  5H8S A;  3E3K A;  4Q8R A;  5KCJ B;  2LAO A;  4RK2 A;  2QS3 A;  2O1M A;  1ZIU A;  3K02 A;  5I58 A;  2NUV A;  4F2O A;  1IZ1 A;  4EXK A;  3K01 A;  4YKP A;  1VSO A;  4MBP A;  2RKM A;  3MZ1 A;  2HZL A;  4ZEF A;  3PUV E;  2DWA A;  4LZ8 A;  4F3G A;  3BBR A;  3ILT B;  3FJ7 A;  2Y84 A;  3IAZ A;  1MQD A;  1A8E A;  3G3K A;  1LBC A;  3SES A;  4NF8 A;  1OVB A;  3KOT A;  2RC7 A;  3V89 B;  2HEU A;  3K4U A;  2GFE A;  3UA8 A;  3EHU A;  4YAH X;  2OWS A;  4LZ5 A;  1UIU A;  2H5Y A;  3S4U A;  4M1V A;  3FD3 A;  1BLF A;  3O66 A;  3DLN A;  3TTK A;  2NOO A;  4R9G A;  1TWY A;  4OWD A;  3K6X A;  3PMX A;  4XKN A;  3H3G A;  1US4 A;  3K1P A;  3M3K A;  4XKR A;  3HST A;  3U93 A;  1S7Y A;  1FQF A;  3C31 A;  2DQV A;  1B3F A;  1CB6 A;  4KR5 A;  3LSX A;  4UAC A;  5I2K B;  5AA2 A;  2ZNS A;  3IOT A;  4IO3 A;  4F39 A;  1MXY A;  4PFY A;  4NF6 B;  2Q2C A;  1AMF A;  1M5B A;  4U2R A;  1SW4 A;  5M2V A;  1JVY A;  2ZMB A;  4ELR A;  1SW5 A;  3R6U A;  4DE8 A;  4YKJ A;  3JV9 A;  3FVO A;  3PUY E;  3OEM A;  2DXY A;  2DP8 A;  4LON B;  2F36 A;  5I56 B;  5FHO A;  1QJM A;  3K2D A;  1GVC A;  4QSD A;  3T93 B;  3CIJ A;  1ANF A;  2XXW A;  4PFW A;  1LCF A;  3G3H A;  1LAG E;  5DVJ A;  3KJT A;  5I2N A;  3A09 A;  4JWX A;  3QIM A;  4NED A;  5A5X B;  3DP8 A;  1JET A;  3MQ9 A;  3V83 A;  5DTB A;  2V3T A;  2E0S A;  2HXW A;  4DCY A;  3GXA A;  5AA3 A;  3PPR A;  3CVG A;  1B5H A;  1I69 A;  4FIM A;  2P1S A;  4DXU A;  2F6G A;  2FYI A;  2DE3 A;  3ZKL A;  2I4B A;  1EZ9 A;  1SI1 A;  4X48 A;  2UYE A;  1FQC A;  5DVF A;  1FTJ A;  3SET A;  3H03 A;  4EDP A;  1FTO A;  1P1O A;  3G3I A;  3TTR A;  2I4C A;  3KFM A;  3AXF A;  4EQB A;  2UVI A;  2OCU A;  3FXR A;  2QJE A;  3EQ1 A;  3JZJ A;  3D4G A;  3ZKK A;  4JSD A;  1A54 A;  2VD3 A;  4FEB A;  1EU8 A;  3B6W A;  1TT1 A;  1FTL A;  1SYH A;  3LBS A;  2ZYK A;  3I5O A;  4YB5 A;  2DSF A;  4I9D A;  4KQP A;  3U94 A;  4H67 A;  4G2Z A;  3EN3 A;  1MXX A;  5K2Y A;  3SER A;  1JQF A;  3OO9 A;  1NNP A;  3G7W A;  5H8N B;  3T9X B;  5AE4 A;  3KSX A;  2OK2 A;  1UIV A;  1D9Y A;  4ZZE A;  1MH4 A;  1RKM A;  3O97 A;  4G4P A;  4WED A;  1IIW A;  2CZL A;  3T22 A;  3FJM A;  4LAT A;  4FAJ A;  3K0V A;  2XXQ A;  3TEP A;  2QSX A;  4RNS A;  5KCJ A;  3QYT A;  4QRZ A;  5H8H B;  3IJX B;  2XHD A;  1UTH A;  4H5F A;  4BDQ A;  5AA2 B;  3RTW B;  4GF8 A;  2O84 X;  4DDD A;  1BIY A;  5CI5 A;  2XXH A;  2RF1 A;  2XXT A;  4R2B A;  4R6Y A;  4F22 A;  1NL5 A;  3S9M C;  2F7B A;  2W7Y A;  4ESW A;  4R9F A;  4G8M A;  3GLB A;  1B6H A;  3S2V A;  1B5I A;  2I0B A;  1JNF A;  3CG1 A;  4ZEI A;  2IA4 A;  1P1W A;  2PMS A;  4NWD A;  3W15 C;  3N94 A;  3MVZ A;  1B32 A;  4KCC A;  1IEJ A;  1NH7 A;  1NH8 A;  4G68 C;  3PD9 A;  3K1N A;  1B52 A;  1SDX A;  4PFT A;  3PPQ A;  3IOU A;  2HCA A;  2QRY A;  4H1X A;  1POY 1;  4N13 A;  4GRK A;  2ZNT A;  2DWI A;  3QXM A;  5CMB A;  4QHQ A;  4X1D A;  1NFT A;  5CC2 A;  3PGF A;  1MG1 A;  4GXS B;  1SD3 A;  3K6W A;  2FA7 A;  1SI0 A;  2X7Q A;  3LSL A;  4X9T A;  4KCD A;  4HCW A;  4EF2 A;  1QW0 A;  1IXH A;  2WKY A;  3A3C A;  4G68 A;  1HSE A;  5ELV A;  5I2K A;  2NWJ A;  2A5S A;  3FV2 A;  1S50 A;  4QFP A;  2DWH A;  4RYA A;  2ANJ A;  3FAS A;  4NF6 A;  2E1S A;  4R72 A;  2Q9T A;  1OVT A;  1VFD A;  1B1X A;  3OEN A;  5FHN A;  3KGC A;  1MPC A;  1LCT A;  3MVW A;  1N7X A;  1QUL A;  3T9V A;  3S9L C;  3D4C A;  5I56 A;  4MH5 A;  1O64 A;  3IB0 A;  1BKA A;  4JXI A;  3DP6 A;  3WAF A;  3IL1 B;  1B4Z A;  1N0T A;  4DCX A;  1MXU A;  4U4X A;  4F19 A;  1WDN A;  1ZLQ A;  2UXA A;  4M4G A;  2ZNU A;  4MF3 A;  5CRY A;  2ZXT A;  3FVN A;  3ECR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...