1MRPA

Ferric-binding protein from haemophilus influenzae
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
309
structure length
309
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Haemophilus influenzae Fe(+3)-binding protein reveals convergent evolution within a superfamily.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Iron transport
molecule keywords FERRIC IRON BINDING PROTEIN
total genus 126
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 1997-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mrpA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mrpA01
5I56A 1QUIA 1HSEA 3L6HA 1QULA 4R2BA 3IB1A 4I62A 2DE4A 4MLVA 1H45A 1MXYA 4G4PA 4F3GA 1MDP1 2F6PA 1NNFA 3O6IA 2XXUA 2HXWA 3OO8A 4YU0A 4F22A 4KYEA 4EDPA 2O1MA 4YKPA 4NF5B 1PB7A 1B51A 1BKAA 2QS4A 2V25A 2O7IA 3PMXA 4TOZA 1USYE 3T9XB 1B5HA 1ATGA 1QW0A 2B3FA 2QS3A 3Q25A 4G68A 2HCAA 1LLSA 3KOSA 1LGBC 1RKMA 3MVZA 4R6HA 5CC2A 4MBPA 2YPNA 4O3CA 1IZ1A 4JBZA 3CVGA 2RC8A 3MC2A 1B32A 4N07A 5L9SA 1A7LA 3FJ7A 3H6TA 4Q30B 3OEKA 3VLVA 1J1NA 1XHYA 5CI5A 5H8QB 4UA8A 1SD3A 4OZ9A 2RF1A 1NNKA 3BFTA 2DE3A 2ZYNA 3IOVA 3FXQA 3FATA 2Y7RA 4JDFA 2RC7A 4O3BA 5FTHA 2Z8FA 1I6QA 2VD3A 2Y84A 3DELB 3KJ7A 3OO9A 4QSEA 3VXCA 4AQ4A 1IXHA 3OD7A 1IITA 1VFEA 4RY1A 4P11A 3PUWE 2UVHA 1US4A 2F7CA 3MZ1A 4U21A 3C4MA 3THIA 1N3WA 1OVBA 1IUDA 4PE5B 1B2HA 1I6AA 1UIVA 2DWAA 3HO7A 2HFBA 3R26A 4QFKA 1ELJA 1FCKA 1B7HA 2B3BA 3RGYA 3RN8A 3W9WA 3U92A 4YB5A 2Y7KA 4H5GA 4JSOA 3Q28A 1B3LA 4NF8A 3IX1A 3ODBA 1ZBMA 4EQ9A 3O6GA 2F7AA 4YMBA 4WXJA 4BDNA 2AIXA 4RPNA 5DYHA 1HSLA 2H9BA 4C1TA 2I4BA 5KZTA 4RPOA 5TPAB 4OEVA 4XKPA 1DMBA 5AA3A 1RYXA 3UA8A 2A5TB 3W15C 1NMUA 5DVJA 1MY3A 4IGRA 4RK2A 3KZGA 3T9UA 3DLNA 3KGCA 1N3XA 3RLFE 3IOUA 4WEPA 1LFGA 4Q8RA 3JZJA 1JNFA 1MXVA 3MZBA 3GBBA 2HQ0A 5CMCA 5K2XA 3R6UA 4Z0IA 3TZAA 3VVEA 2UVGA 4BDMA 2REJA 3H6WA 1ANFA 4OENA 4BLAA 4ND9A 1MPBA 3MWBA 1GV8A 3N6TA 2VD2A 4FE8A 4HCWA 2FYIA 3CG1A 1XOCA 1JW5A 5DT6A 5I59A 4KD5A 4R2FA 1MQDA 3B7DA 2I0BA 1FTMA 4U22A 5ELVA 2XHDA 2F6GA 3TTKA 2I3VA 1EH3A 2ESNA 3TCHA 3UP9A 4XKQA 2XXQA 3OSRA 3E4RA 4ELOA 4MLQA 3KEIA 4MF3A 4LA9A 2GHAA 1B3GA 4ESXA 4JSDA 1Y4TA 1YTVA 2NWJA 1BLFA 1B5IA 1ZLQA 4DXBA 2DYXA 2G29A 5H8NA 4BDOA 1Y1ZA 2CZLA 3Q27A 4X1DA 3RUMA 2X7PA 1UQWA 4TQUQ 4DXCA 5ICTA 2XX9A 2RCBA 4QSDA 4YKJA 3D4GA 5JK4A 5AA4A 3TEPA 1B4HA 2H25A 4OWDA 1CE2A 3B6TA 4L17A 2OLBA 3IR1A 1URGA 3T96B 3IOTA 3HPIA 1B3HA 1NH8A 3TCFA 4OXVA 1CB6A 1B0LA 1FQFA 3CG3A 3OSQA 3PUYE 4GFRA 4IY5A 3TCGA 4F39A 3FVGA 5KCJB 5HBCA 2AYSA 4GLIA 5H8SA 3FVNA 4ZS9A 4ZZAA 3H7MA 1A55A 2OCUA 4LONB 5AA1A 2F78A 4GIZA 5EHSA 3MW0A 3FZVA 1LFIA 4U4SA 4HW8A 1US5A 4LZ7A 4ZZEA 1QKBA 1SBPA 1TXFA 1USYH 2XX7A 1NH7A 2NXOA 5F1QA 1PEBA 2O7UA 4BDLA 4OHNA 5IAIA 5JEIA 3SESA 4HTGA 2GH9A 1EU8A 4KYSA 4JB7A 4OFOA 4EQ7A 1B1XA 1LB9A 4F1UA 1MQGA 1II5A 1NNPA 3LSFB 2V3QA 5IKBA 2Q9TA 2R71A 2DP8A 1N04A 3QIMA 1M5FA 4RJZA 3VFJA 4F1YA 4NWDA 4KCCA 2OBGA 3GLBA 3O28A 2ONKE 5EYFA 4C0RA 3WAEA 2VP1A 3BBRA 4DCYA 4BDRA 1D9YA 3TTRA 5I57B 3C33A 4ZEFA 2GHBA 1QJMA 2W7YA 3I6VA 3N26A 5DVFA 3UIFA 3USDA 4EF1A 1NFTA 2FNCA 2OWSA 3E9XA 3FD3A 1A8EA 1XC1A 2O69A 4FECA 3S9MC 2PBWA 2I3WA 4IB2A 3QSLA 4ZECA 2NVUB 2DQVA 3C9HA 5FHOA 3TAJA 3OO7A 3PMWA 3SERA 4C1UA 3IK6B 4YB7A 2Q89A 1Q35A 1N76A 3CI8A 3IAZA 3ONMA 3ZS6A 3LUYA 3KN3A 3PGFA 4IO2A 5EHMA 5TP9B 3TTNA 2NOOA 3JYRA 4U23A 3FGSA 4FAJA 3K4UA 5KDTA 1Z7ME 1UIUA 1Y3QA 3A3CA 1LCTA 2XXYA 2QMWA 3MP1A 3TKDA 2R6GE 3FJMA 3FV1A 5CMMA 3TTLA 5ITPA 1P1UA 3BKIB 1JVXA 1FTKA 2XXTA 4F3SA 1I69A 1MH3A 4QFOA 3K6VA 2QPQA 2DOJA 4FATA 3TFLA 1MXXA 4KFQA 3H6UA 3FXRA 4POXA 3G7WA 5I57A 1IXIA 3KBRA 1DTZA 5I2NA 2DWJA 3H4ZA 1MG1A 1WDNA 3C35A 2AL5A 1MM7A 2XXXA 4HCYA 3KSJA 5A5XA 2P1SA 2ZYKA 1MY1A 3IO6A 1GVCA 4F1VA 3IORA 4RYAA 4JXIA 1YCJA 3ECRA 4OQOA 2YLNA 4U1OA 1L5TA 2UYFA 1SVXB 2XXHA 4NWCA 4Q5TA 5AE4A 4KI0E 4POWA 1MXZA 3QUJA 5TP9A 3FVKA 4EXKA 4KCDA 3H06B 2ZNUA 5K2YA 2F7BA 3K1PA 1SI1A 3T9HB 3UK4A 1QUKA 5KCJA 3R7XA 4IO5A 3HCQA 1AH5A 1MS7A 2QL3A 2V3UA 1PDAA 5CRYA 3QK6A 3VVFA 4DE8A 4YZZA 5CMKA 3CR9A 4HS7A 4I9DA 5TPAA 4DXUA 1R1NA 3SETA 1XVYA 4ONYA 3I3VA 3P7IA 2DWHA 1YPNA 1LBCA 1URSA 1N7WA 3IL1B 2QJEA 4IO7A 3EHSA 3TMGA 1JW4A 1XT8A 3O66A 1HSJA 4LVQA 4NF6B 3MQ9A 5ITOA 5ISUA 3T9VA 3PUZE 5H8QA 1B7ZA 1SW2A 3CRBA 4GWOA 4YICA 3ILUB 3RNNA 3Q26A 4GF8A 1OLAA 3EF7A 3IJXB 2PMSA 2ZXTA 1B52A 4QFLA 5CMBA 1O63A 1VSOA 4QHQA 2Q88A 3M3LA 2DWIA 2B65A 2I48A 3MP8A 3TELA 4F2QA 4NTLA 4ELRA 5I59B 2H5YA 4QSCA 3OOAA 3HHGA 5BWJA 1Z7NE 3N6UA 1YAEA 1NL5A 4H67A 4NE4A 5L8DA 3O2AA 4ZE9A 5AA2B 3HSTA 1P1OA 1B40A 3PU5A 1EZ9A 5BUUA 3MVWA 1D4NA 3O97A 1POTA 3KJTA 3B6WA 2P0SA 3JV9A 4N13A 4G8MA 1LAGE 3DP4A 4LZ5A 1OLCA 1FTJA 5DVIA 4KQPA 3VE1B 4OFJA 3O9PA 1MXUA 1DTGA 2NUVA 4H65A 4RXLA 2HZKA 2V84A 3FASA 4KHZE 4M1VA 2Q8JA 4ELQA 4U1ZA 2DVZA 1M5EA 3N5LA 2QMXA 4QF9A 3FIRA 2O6AA 1ZIUA 1FQEA 1SI0A 2X7QA 4YMAA 4H1XA 2H4IA 1S7YA 3MAMA 3PPQA 3MVYA 4R6KA 5AA2D 3TPAA 2Q2AA 4QRZA 1PB8A 5I2NB 3A3UA 4X9TA 4OESA 1TWYA 3MPKA 4DDDA 2QSXA 1AIVA 5A5XB 1M5CA 2ZMBA 2UYEA 1P1NA 3C36A 4GL0A 5JTYB 1ZU0A 3V83A 4FJPA 3EN3A 1GTKA 1B5JA 3S2VA 1FTOA 2H99A 4ZDMA 3C34A 1IXGA 3QYTA 2LAOA 4LQ2A 2I49A 2F34A 3KN8A 4X1BA 1ZTYA 1Y20A 2F35A 2CMOA 2PYYA 4UACA 4LP2B 4XKNA 5I84A 2Z23A 4P0IA 3EPEA 2XD2A 3EQ1A 1ZMGA 1EZPA 5F7VA 4Q0CA 2REGA 2F8DA 3TYHA 3G3JA 2ANJA 2I0CA 1JQFA 3IB0A 4PETA 1WODA 2GRVA 5B70A 2HZLA 3C31A 2D3IA 1AL3A 1JEVA 4JWYA 3S9EA 1FTLA 3T22A 4GOTA 3S4UA 1FW0A 3K1MA 4H6DA 3GZGA 3K1NA 4WEDA 4DIGA 5HPQA 4NF6A 1M5BA 4ZEKA 4F2OA 5DTBA 2RINA 4JWXA 2V93A 4E0WA 1A40A 3ILTB 3K2DA 1I6BA 3IB2A 2Z8DA 4LUBA 1XS5A 4RA1A 2Y7IA 4X48A 1H76A 3ZKKA 2F36A 1SW1A 3VDFA 3CFLA 4PP0A 4IY6A 2ONRA 2O68A 4E0XA 4I8CA 3IJOB 4K3FA 2ONSA 4NF4B 1B0HA 4G8HA 4O3AA 4PFWA 4XTCQ 3KG2A 2PT1A 4THIA 1FQCA 1JVYA 4NF5A 1DSNA 1B7UA 2UVIA 5DEXB 1LAXA 2Z8EA 3L6GA 2YJPA 3MP6A 3K02A 2UVJA 4H8JA 2VGQA 4LATA 1JEUA 5AA2A 4OERA 2XXPA 2ZYOA 2FA7A 5HM4B 1KWHA 2QS1A 2OZZA 3TUSA 1IQ7A 3SDFA 2OJTA 3SKPA 4QFPA 2IEEA 2UXAA 1DPPA 2XD3A 1A54A 1B9JA 2ZYMA 1EZOA 4U4XA 4OTEA 5H8HA 4BDQA 4F18A 1MM6A 2DXYA 3LBSA 5I2KB 3RQTA 2VOZA 5L9MA 4ELPA 4R75A 3RT6B 3U93A 2DXRA 2F97A 3PPPA 5CBSA 1SW5A 4QFNA 1AMFA 1B3EA 1Y3PA 2M8CA 2ZNSA 3G3GA 3PUXE 3MBPA 1P1QA 1Y3NA 4LZ8A 3E3KA 4R74A 4GQOA 4OMBA 4ECFA 2F5XA 4XXUA 2THIA 3K01A 4YKIA 3LSLA 1P99A 5JTYA 3LC8A 4ESWA 1A8FA 2HAVA 3G3KA 1N84A 3MUQA 3C32A 3DP8A 3PPRA 3PV0E 2E0SA 1MPDA 3S9LC 3MVXA 3KFMA 3CIJA 4PQJA 3IO4A 3N94A 5H8FA 1SW4A 3FVOA 4IO6A 3TQWA 4H5FA 3U94A 5FHNA 1Q1KA 1LFHA 3W9VA 4DLDA 4XKRA 4GRKA 3RTFB 4IO4A 1DPEA 1UTHA 2R9JA 3KN7A 3SEXA 1MXWA 4GXAA 4PFYA 3SEVA 5CBRA 3D4CA 1SYHA 2I6EA 4R72A 3T66A 4RK9A 5FTIA 2BJJX 3FJGA 4M4GA 5LOMA 3OELA 1VE4A 5B7DA 2QS2A 4G2ZA 1B1HA 2RC9A 4ZEIA 4G68C 2PX1A 5TU0A 4DCXA 3M8UA 4NEDA 4I1DA 4EF2A 4Z7EA 3K6UA 3UORA 3PMVA 2XXVA 4PFUA 3TODA 3K00A 3K6WA 1TFAA 5J1DA 3OO6A 1IXCA 3PD9A 3LSXA 1LAHE 3AXFA 3H3GA 2DVCA 4H0WA 1NKXA 4MH5A 4YKKA 3RTWB 4F29A 2I58A 4FEDA 4IO3A 3A09A 4NF4A 3SEWA 5L9OA 2I4CA 3H6VA 3O29A 1ZKBA 1LAFE 3FXUA 2ZNTA 4H8IA 1B6HA 1N0TA 1UTHB 1LB8A 2P2AA 3SEUA 4FIMA 1PB9A 2DS9A 2XXRA 4R9FA 1MH4A 1R9QA 2GFEA 2X26A 3CFZA 3LR1A 4ZEDA 3K0VA 4ZE8A 3CSBA 3KSXA 4YAHX 1BIYA 1D9VA 2HAUA 4DZ1A 4R73A 5I58A 1OMPA 4EUOA 1P1WA 1AOVA 1QVSA 1JW1A 1IEJA 1DOTA 2XX8A 3GXAA 1A99A 4GD5A 1S9TA 3SEYA 2Y7PA 1MY0A 2O84X 2OWTA 3TDJA 2D21A 3OENA 3T93B 4TLLB 1BP5A 1MRPA 3VLUA 3S9NC 1MQIA 1SYIA 3CFXA 4G77A 1Y1MA 1QKAA 3HN0A 3LSWA 3EHTA 4KPTA 4GXSB 5FHMA 2O1LA 1B3FA 3F11A 2Q2CA 3RT8A 3PUVE 1SDXA 2XXIA 3PD8A 1R9LA 4XIGQ 3ZKLA 1VR5A 1B46A 3HV1A 4U2RA 3VXBA 4RNSA 3RPWA 4PFTA 1LCFA 4WKMA 4ISUA 5M2VA 3TTMA 3KOTA 2G93A 2PT2A 4AB6A 1VFDA 2D5WA 3GBAA 3OEMA 4OFLA 3VVDA 1PBPA 4IGTA 1OQGA 3FV2A 2E1SA 2H98A 5H8FB 4R9GA 2OK2A 1F9BA 3U72A 3VLWA 1O64A 3ZSFA 4KR5A 1MQJA 1N7XA 3DP6A 1MY2A 4G8NA 3U8QA 1FQBA 2ALUA 3B6QA 3MPLA 2HEUA 3OXNA 1B58A 1S50A 2RKMA 1POY1 1SQYA 1UTBA 1URDA 4ZEBA 4F31B 1GR2A 3M3FA 4LQ5A 3V89B 5ICQA 2QRYA 4F19A 3OMBA 3Q29A 3UN6A 1Y4CA 2Z22A 3V5AA 3VV5A 3IOWA 1MQHA 1RYOA 1LBBA 1T0KA 1H3DA 5H8NB 1LSTA 1OIBA 4FEBA 1H44A 2IA4A 3K6XA 4JWOA 1MY4A 1NNTA 2AL4A 3E13X 1R6ZA 3G3IA 4NMYA 1Y9UA 1B05A 2PVUA 2Y7WA 4YB6A 3G3HA 4GL8A 5DEXA 1PC3A 1JETA 5AA4B 2A5SA 2DSFA 4N6PA 4OETA 4TLMB 3DM0A 4EQBA 1BTJA 3EHUA 3HHFA 3PPNA 3QAXA 3MJNA 3MZ9A 3QUFA 4EXLA 3RY3A 5CM6A 5I56B 3H03A 3WAFA 3PPOA 1MPCA 1TT1A 2V3TA 1WVJA 4NF8B 1FQAA 1PBQA 2DE2A 2RCAA 5KDTB 4OYVA 3V8XB 3BFUA 5H8HB 1MDQA 4OVJA 1GGGA 3U1OA 1D3KA 1TFDA 4G68B 1FQDA 1OVTA 4F3PA 1QUJA 1UTBB 4AB5A 5I2KA 2ABHA 3O6HA 1M5DA 1XVXA 3I5OA 2XXWA 2A5TA 5I58B 4F3BA 1H43A 1B4ZA 3FUZA 4GVOA 2VHAA 4MFIA 1O7TA 3CSGA 3G3FA 4R6YA 2WKYA 1ZJLA 4KYDA 4P0GA 3UGWA 2KLFA 1IIWA 3M3KA 4FORA 4OEUA 3QXMA 3TQLA 1OQHA 2O51A
chains in the Genus database with same CATH superfamily
3IB1A 4I62A 1H45A 4HE2A 2F6PA 2PFZA 2XXUA 3OO8A 4EDPA 4YKPA 3T9XB 1USYE 3Q25A 2B3FA 4G68A 1IZ1A 4JBZA 3MC2A 3FJ7A 5H8QB 3BFTA 3FXQA 5FTHA 1VFEA 3PUWE 2F7CA 4PBHA 3THIA 1B2HA 2HFBA 4QFKA 2B3BA 1B7HA 3RGYA 2Y7KA 4H5GA 4NF8A 3KBZA 5DYHA 2H9BA 4C1TA 2I4BA 4OA4A 5TPAB 1RYXA 1IMFA 1MY3A 4RK2A 3MYUA 4Q8RA 3JZJA 3VVEA 5CMCA 3GBBA 3H6WA 4BLAA 3CG1A 5DT6A 4R2FA 4U22A 2XHDA 2F6GA 3TTKA 4XKQA 4ELOA 4MLQA 3KEIA 4LA9A 5H8NA 3RUMA 2X7PA 4DXCA 2RCBA 4LN5A 2H25A 4OWDA 1URGA 3IOTA 3TCFA 1B0LA 1FQFA 2AYSA 4GLIA 5H8SA 4PCDA 2F78A 5EHSA 3FZVA 4NX1A 4U4SA 1US5A 4LZ7A 1TXFA 2CZHA 1USYH 2NXOA 4JB7A 3ISPA 1LB9A 4F1UA 1MQGA 5IKBA 3VFJA 4F1YA 2OBGA 3GLBA 4DCYA 3BBRA 1QJMA 3USDA 4FECA 2O69A 1XC1A 5IZ1A 2NVUB 4C1UA 3ZS6A 1RDYA 3LUYA 3KN3A 3PGFA 3JYRA 3ROJA 5KDTA 1IMCA 3TTLA 3U8QA 3FJMA 1I69A 4FATA 1LBWA 3FXRA 1IXIA 2CEYA 3C35A 4HCYA 2P1SA 4F1VA 1GVCA 2YLNA 5AE4A 5TP9A 4KCDA 3R7XA 2PCRA 2V3UA 1PDAA 5TPAA 3SETA 1YPNA 4IO7A 3EHSA 1JW4A 4LVQA 2VPOA 1KA0A 1B7ZA 1B52A 1VSOA 2I48A 2H5YA 5BWJA 3N6UA 4H67A 5AA2B 1P1OA 4N6KA 4G8MA 5DVIA 4OFJA 1MXUA 1FBEA 2P3VA 4H65A 2V84A 1M5EA 1IMBA 1SI0A 2H4IA 3MAMA 3PPQA 3MVYA 5I2NB 3A3UA 4X9TA 4OESA 1TWYA 3MPKA 4DDDA 4DI3D 1AIVA 2ZMBA 4GL0A 1P1NA 3C36A 4FJPA 3EN3A 3S2VA 1IXGA 3QYTA 4LQ2A 4MNPA 4UACA 1Y20A 2PYYA 4XKNA 5I84A 2Z23A 4P0IA 2XD2A 1ZMGA 4N91A 4Q0CA 2REGA 2ANJA 5B70A 1WODA 2GRVA 2HZLA 3S9EA 4WEDA 1M5BA 5DTBA 4DI4B 2RINA 4XFEA 1A40A 1RDXA 4GWUA 2Y7IA 3ZKKA 4PP0A 4I8CA 5FBPA 3KG2A 2PT1A 4THIA 1DSNA 2VGQA 2ZYOA 2FA7A 5HM4B 3TUSA 1IQ7A 4QFPA 1DPPA 5IGAA 1EZOA 4U4XA 1Q9DA 2VOZA 3RT6B 2DXRA 5CBSA 4X1DA 1AMFA 1Y3PA 4O8MA 3LV0A 4LZ8A 4GQOA 2F5XA 3LSLA 4N6DA 5JTYA 3MUQA 4QXDA 3PPRA 3S9LC 1MPDA 5LTCA 4PQJA 1K9ZA 3W9VA 1DPEA 1NUXA 1MXWA 2QVUA 4GXAA 4OVSA 4R72A 3T66A 5FTIA 4KXPA 4ZEIA 2QVVA 4I1DA 2B4MA 3PMVA 2XXVA 3K00A 3AXFA 4YKKA 4H0WA 2I58A 3T0JA 5L9OA 3A09A 3H6VA 4H8IA 3U65A 1UTHB 1LB8A 1PB9A 2DS9A 1MH4A 3LR1A 4ZE8A 3KSXA 2OX3A 5I58A 4GD5A 1K9YA 1A99A 1MY0A 2OWTA 5EQ9A 2R8TA 1MQIA 3CFXA 1QKAA 3EHTA 5FHMA 2Q2CA 1FBFA 1SDXA 2XXIA 4XIGQ 3ZKLA 1VR5A 3HV1A 3TTMA 4H46A 4AB6A 1PBPA 4IGTA 1OQGA 3FV2A 2H98A 2OK2A 4XF5A 3ZSFA 1MQJA 1N7XA 2HEUA 3OXNA 3V89B 2QRYA 3UN6A 3V5AA 3IOWA 1LBBA 4NF0A 1LSTA 3CHGA 1R6ZA 4NMYA 2Y7WA 1PC3A 2DSFA 4OETA 4TLMB 3DM0A 4EQBA 1BTJA 3PPNA 4MAGA 5I56B 4N15A 3RY3A 2V3TA 1WVJA 1PBQA 5KDTB 1GGGA 4PC9A 4UABA 1TFDA 4G68B 5I5PA 4I3EA 4F3PA 1UTBB 3O6HA 1XVXA 4F3BA 1H43A 4GVOA 1B4ZA 3FUZA 4MFIA 3D1RA 2WKYA 3UGWA 2KLFA 2F3DA 1HSEA 1MXYA 4G4PA 1MDP1 2HXWA 4F22A 2O1MA 4Z7EA 4NF5B 1BKAA 2V25A 2QS4A 3PMXA 1QW0A 4PF6A 1LLSA 2CZKA 1A7LA 4X04A 5CI5A 2Y7RA 2RC7A 2Z8FA 3KJ7A 4AQ4A 2Y84A 5T3JA 4RY1A 5ESYA 1US4A 5A5LA 4U21A 1OVBA 4PE5B 1I6AA 1UIVA 2DWAA 3HO7A 4PTKA 3R26A 1ELJA 1FCKA 3U92A 2DDKA 1B3LA 3ODBA 1ZBMA 5IZ3A 3O6GA 3IFCA 4YMBA 2WBBA 4XKPA 1DMBA 3UA8A 3W15C 3RLFE 3HFUA 2HQ0A 5K2XA 4BDMA 1NV0A 1RDZA 4ND9A 3MWBA 1GV8A 3N6TA 5IZZA 1NV3A 4KD5A 3B7DA 1FTMA 5ELVA 3TCHA 1EH3A 2ESNA 4PAKA 3E4RA 4ESXA 1B3GA 2NWJA 1FBPA 1BLFA 4DXBA 2G29A 4GX3A 4BDOA 1SPIA 1Y1ZA 2XX9A 2MKZA 3TEPA 2Q8MA 5KCJB 3TCGA 2FHYA 4N17A 2KQZA 4ZZAA 5AA1A 1A55A 2OCUA 4LONB 1YZ0A 4HW8A 5BUUA 3MW0A 1LFIA 4ZZEA 4O7MA 1QKBA 1SBPA 5F1QA 5IAIA 4OHNA 3SESA 4HTGA 1EU8A 3LSFB 2V3QA 1IMDA 4JVDA 2Q9TA 1N04A 1NV2A 5EYFA 3O28A 3WAEA 4BDRA 1D9YA 3QMFA 4PAIA 3N26A 3UIFA 1FJ9A 2I3WA 5FHOA 3OO7A 3PMWA 3CI8A 5TP9B 5EHMA 3TTNA 4FAJA 2PFYA 1Y3QA 3TKDA 1FPBA 3BKIB 2XXTA 1FTKA 3TFLA 4P47A 3H6UA 1MG1A 1MM7A 2XXXA 5A5XA 3KSJA 3IO6A 3IORA 1YCJA 4U1OA 2XXHA 4POWA 1MXZA 3QUJA 3FVKA 4EXKA 3H06B 2ZNUA 5IZ3B 5K2YA 3UK4A 1SI1A 2QL3A 4MX6A 3T1BA 4PE3A 5CMKA 3CR9A 4HS7A 1XVYA 4ONYA 3P7IA 1URSA 3TMGA 4NF6B 1HSJA 5ISUA 3MQ9A 3T9VA 4GF8A 2WYPA 4QFLA 4MHFA 1O63A 4ELRA 4ZE9A 1NL5A 3O2AA 1B40A 1FPJA 1D4NA 1POTA 3KJTA 3JV9A 4N13A 1FTJA 4NG7A 4N81A 5EQ8A 2NUVA 4AS4A 2DVZA 1FBHA 2O6AA 4YMAA 1PB8A 3V83A 1FTOA 2H99A 2LAOA 3KN8A 1ZTYA 4P9KA 4HE1A 4LP2B 4MMPA 4P56A 2F8DA 3G3JA 1JQFA 4PETA 1AL3A 1JEVA 4JWYA 1FTLA 3T22A 3K1MA 4H6DA 3GZGA 3K1NA 2VPNA 4E0WA 1I6BA 3IB2A 1XS5A 4RA1A 4X48A 1H76A 4IY6A 4NF4B 4O3AA 1FQCA 4NF5A 4F2OA 1B7UA 3T96B 3MP6A 4H8JA 4N8YA 4PDHA 2XXPA 2QS1A 2OJTA 3SKPA 1A54A 4F18A 1FTAA 4OTEA 3RQTA 4ELPA 4R75A 1SW5A 4QFNA 1B3EA 2ZNSA 3KC1A 3MBPA 1P1QA 3E3KA 4R74A 4ECFA 2THIA 3K01A 4YKIA 4ESWA 4U23A 1A8FA 4PFIA 3PV0E 2P3NA 1SW4A 3TQWA 4DLDA 4GRKA 1UTHA 3BIGA 3SEXA 5CBRA 3SEVA 3E79A 1DK4A 2KR0A 3FXBA 4M4GA 5LOMA 3OELA 5B7DA 2QS2A 1KZ8A 1B1HA 2RC9A 2PX1A 5TU0A 3K6UA 4MNCA 5J1DA 1IXCA 4NN3A 3LSXA 1LAHE 3H3GA 4F29A 3SEWA 2I4CA 2ZNTA 1N0TA 2XXRA 1JP4A 1R9QA 2GFEA 4YAHX 1D9VA 2HAUA 3GXAA 3SEYA 3TDJA 4TLLB 3VLUA 3S9NC 4G77A 1YYZA 4P8BA 4N4UA 1R9LA 3VXBA 1NV6A 1LCFA 2G93A 3OEMA 5ET8A 5H8FB 1F9BA 3VLWA 4G8NA 1MY2A 3B6QA 2ALUA 2VT5A 1UTBA 1GR2A 4LQ5A 3OMBA 3VV5A 2Z22A 1MQHA 1RYOA 4GWYA 1Y9UA 4X8RA 1JETA 4N6PA 3QAXA 4PFRA 3WAFA 1TT1A 4NF8B 2L5VA 2DE2A 3V8XB 1MDQA 4P1EA 1FQDA 1QUJA 2ABHA 3I5OA 1FSAA 2VHAA 1O7TA 3G3FA 4KYDA 4P0GA 1IIWA 3M3KA 3QXMA 1OQHA 4OVTA 4MJOA 4R2BA 2DE4A 3IFAA 1NNFA 3O6IA 4YU0A 1DBZA 1PB7A 1B51A 2O7IA 1B5HA 1ATGA 2QS3A 2HCAA 5CC2A 3KOSA 1LGBC 1RKMA 3CVGA 2RC8A 3H6TA 3OEKA 3VLVA 1XHYA 4OZ9A 4PFBA 1NNKA 2DE3A 2ZYNA 1XI6A 4JDFA 3FATA 4PGNA 3DELB 4QSEA 3OO9A 3VXCA 1IITA 4P11A 2UVHA 2QFLA 3C4MA 1N3WA 2Y5KA 3FBPA 4YB5A 4JSOA 4RPNA 1HSLA 5KZTA 4RPOA 4FBPA 5DW8A 2A5TB 3KZGA 3DLNA 3KGCA 1N3XA 4WEPA 1LFGA 1MXVA 3R6UA 3TZAA 2UVGA 2REJA 4MEVA 1ANFA 1MPBA 4HCWA 1JW5A 3UP9A 2XXQA 3OSRA 1Y4TA 1YTVA 4AS5A 2DYXA 2BJIA 2XWKA 1UQWA 4TQUQ 3LUZA 1B4HA 3B6TA 4L17A 3IR1A 3HPIA 1NH8A 4OXVA 3PUYE 3OSQA 4F39A 4GFRA 3FVGA 5HBCA 3FVNA 1IMAA 3H7MA 3NOHA 4GIZA 4GWWA 1NH7A 1PEBA 4BDLA 2GH9A 4OFOA 4PDDA 2B4LA 1B1XA 1II5A 4N8GA 1FPDA 2DP8A 3QIMA 4NWDA 2ONKE 4C0RA 3TTRA 3C33A 2W7YA 3I6VA 1NFTA 2FNCA 2OWSA 3E9XA 1A8EA 3S9MC 2PBWA 2Y5LA 3QSLA 4ZECA 3C9HA 3SERA 3IK6B 3ONMA 3FGSA 3K4UA 1FBDA 1LCTA 3MP1A 2R6GE 5ITPA 1P1UA 2QPQA 1MXXA 1LEVA 4KFQA 5I57A 4POXA 3G7WA 3KBRA 5I2NA 2DWJA 5F24A 1WDNA 1MY1A 4MIJA 4RYAA 4JXIA 4H45A 4OQOA 1SVXB 4NWCA 3T9HB 1AWBA 3HCQA 1AH5A 3A29A 5CRYA 3QK6A 3VVFA 4DE8A 1R1NA 2DWHA 1N7WA 5IM2A 3O66A 5ITOA 2HHMA 4YICA 3CRBA 4GWOA 3ILUB 3RNNA 3Q26A 1OLAA 1G0HA 3IJXB 2ZXTA 2Q88A 3M3LA 2DWIA 2B65A 4F2QA 5EYGA 3OOAA 5L8DA 3HSTA 3PU5A 3DP4A 4LZ5A 4OVPA 4KQPA 3O9PA 1DTGA 4RXLA 4MNIA 2HZKA 3FASA 4M1VA 4U1ZA 2HPGA 3FIRA 1ZIUA 4H1XA 1S7YA 1FPGA 3TPAA 4QRZA 4OANA 1FPIA 5JTYB 1B5JA 2F35A 3EPEA 5F7VA 3TYHA 3IB0A 2OWZA 4GOTA 3S4UA 2WYKA 2XA5A 3GYYA 3ILTB 3K2DA 2Z8DA 1SW1A 3VDFA 4OVRA 2ONRA 2O68A 4E0XA 4K3FA 5J16A 1B0HA 4PFWA 4XTCQ 1LAXA 2Z8EA 2YJPA 3K02A 4NHBA 1FBGA 5AA2A 4OERA 4O7IA 1KWHA 2OZZA 1NV7A 2CEXA 2HXRA 2ZYMA 5H8HA 2DXYA 5I2KB 5L9MA 4XEQA 2F97A 3EKIA 3G3GA 2M8CA 1LBZA 1Y3NA 4OMBA 1P99A 2HAVA 1N84A 1EYKA 3C32A 3MVXA 3CIJA 3N94A 1FPFA 3FVOA 1IMEA 3U94A 5FHNA 1Q1KA 1LFHA 4XKRA 3RTFB 2R9JA 3KN7A 2FVZA 2V4CA 2ZZVA 4PFYA 1EYJA 2I6EA 4RK9A 1NUYA 3FJGA 4NGUA 3RYDA 4G2ZA 3M8UA 4NEDA 3UORA 5I7IA 3TODA 1TFAA 2Q74A 4MH5A 5I56A 4FEDA 4IO3A 1BK4A 4OVQA 1QGXA 1ZKBA 1FPKA 2P2AA 3SEUA 4R9FA 2X26A 3CSBA 1BIYA 4DZ1A 3MSTA 1QVSA 4GX6A 2O84X 2D21A 1BP5A 1LBVA 1SYIA 2O1LA 3RT8A 1FPEA 3PUVE 3PD8A 1LBXA 4WKMA 4ISUA 3KOTA 1VFDA 3GBAA 4R9GA 1INPA 5ET5A 1O64A 4P1LA 3DP6A 1FQBA 1B58A 1S50A 4ZEBA 3Q29A 1T0KA 3BIHA 1OIBA 4FEBA 2IA4A 3K6XA 4JWOA 1MY4A 1NNTA 3E13X 3G3IA 3G3HA 5AA4B 3EHUA 4EXLA 3MJNA 3MZ9A 5ET7A 3PPOA 2RCAA 3BFUA 5H8HB 4OVJA 1OVTA 5I2KA 4AB5A 5I58B 4GWZA 1NV5A 4GBWA 2FIXA 1ZJLA 4FORA 3TQLA 1QUIA 2XXKA 3L6HA 1QULA 2WEFA 4MLVA 4NQ8A 4F3GA 2ZZXA 4KYEA 4TOZA 3MVZA 4R6HA 4MBPA 5EYHA 2YPNA 4O3CA 1B32A 4N07A 5L9SA 4Q30B 1J1NA 4UA8A 1SD3A 2XWVA 2RF1A 3IOVA 5LDZA 4O3BA 1I6QA 2VD3A 1IXHA 3OD7A 3MZ1A 1IUDA 2FIEA 3W9WA 3Q28A 3IX1A 4EQ9A 2F7AA 4WXJA 4BDNA 2AIXA 4OEVA 5AA3A 1NMUA 5DVJA 4IGRA 3T9UA 1EYIA 3IOUA 4JVCA 5I3SA 3MZBA 1JNFA 1FJ6A 4ELQA 3RPLA 3KC0A 4Z0IA 4OENA 1NUZA 2XWOA 2VD2A 4FE8A 2FYIA 1XOCA 5I59A 1MQDA 2I0BA 2GQ1A 2I3VA 4MF3A 2GHAA 4JSDA 5EQAA 1ZLQA 1B5IA 2CZLA 3Q27A 5ICTA 1NV1A 4QSDA 4YKJA 3D4GA 5JK4A 5AA4A 1CE2A 2OLBA 1G0IA 1B3HA 1CB6A 3CG3A 4IY5A 4MCOA 4ZS9A 2XX7A 2O7UA 5JEIA 4KYSA 4EQ7A 1NNPA 2R71A 1M5FA 4RJZA 4KCCA 2VP1A 5I57B 4ZEFA 2GHBA 4EF1A 5DVFA 1CNQA 3FD3A 1FRPA 4IB2A 3TAJA 2DQVA 4QBAA 2Q89A 1Q35A 1N76A 3IAZA 4YB7A 4IO2A 2NOOA 4GWXA 1Z7ME 1UIUA 3A3CA 2XXYA 2QMWA 3FV1A 5CMMA 1JVXA 2WBDA 1MH3A 4QFOA 3K6VA 2DOJA 1DTZA 1LBYA 3H4ZA 2AL5A 2ZYKA 1NUWA 3ECRA 1L5TA 2UYFA 4Q5TA 4KI0E 2XWIA 2F7BA 3K1PA 1QUKA 5KCJA 4IO5A 1MS7A 2WX9A 4YZZA 4I9DA 4DXUA 2F3BA 3I3VA 1LBCA 3IL1B 2QJEA 1XT8A 1FPLA 3PUZE 5H8QA 1SW2A 3EF7A 1D9QA 2PMSA 4HE0A 5CMBA 4QHQA 3TELA 2ZZWA 3MP8A 1VDWA 4NTLA 5I59B 4QSCA 3HHGA 1Z7NE 1YAEA 4NE4A 1EZ9A 3MVWA 3O97A 3B6WA 2P0SA 1LAGE 1OLCA 3VE1B 2Q8JA 4KHZE 3N5LA 2QMXA 4QF9A 3E78A 1FQEA 2X7QA 4PBQA 4R6KA 5AA2D 2Q2AA 2JJKA 2QSXA 5A5XB 1M5CA 2UYEA 1NI9A 1ZU0A 1GTKA 4ZDMA 3C34A 2I49A 2F34A 4X1BA 4PF8A 2CMOA 3EQ1A 1EZPA 2I0CA 1KA1A 4JVIA 3C31A 2D3IA 4DIGA 1FW0A 5HPQA 4NF6A 4ZEKA 4JWXA 2V93A 4P3LA 4LUBA 2F36A 3CFLA 4PGPA 3IJOB 2ONSA 4G8HA 1FBCA 1JVYA 2UVIA 5DEXB 3L6GA 4LATA 2UVJA 1JEUA 3SDFA 2IEEA 2UXAA 2XD3A 1B9JA 4BDQA 1MM6A 3LBSA 4IR8A 3U93A 3PPPA 3PUXE 4XXUA 2QVRA 3LC8A 3G3KA 3DP8A 2E0SA 3KFMA 3IO4A 5H8FA 4IO6A 4H5FA 4GWSA 4IO4A 1DCUA 3D4CA 1SYHA 2BJJX 4GBVA 1VE4A 4HXVA 4G68C 4DCXA 4EF2A 2CZIA 3RPLB 4PFUA 3K6WA 3OO6A 5ET6A 3PD9A 3RTWB 2DVCA 3SZPA 1NKXA 4NF4A 3O29A 1LAFE 3FXUA 1B6HA 4FIMA 3CFZA 4I3YA 4ZEDA 3K0VA 4R73A 1OMPA 4EUOA 1P1WA 1AOVA 1JW1A 1IEJA 1DOTA 2XX8A 1S9TA 2Y7PA 3OENA 3T93B 1MRPA 1Y1MA 3HN0A 3LSWA 4KPTA 4GXSB 1B3FA 3F11A 3PTYA 4U2RA 1B46A 4RNSA 3RPWA 4PFTA 5M2VA 2PT2A 4F3SA 2D5WA 4OFLA 3VVDA 2E1SA 4O94A 3U72A 3B8BA 4KR5A 3MPLA 5EQ7A 2RKMA 1POY1 1SQYA 4F31B 1URDA 3M3FA 5ICQA 4F19A 1Y4CA 1H3DA 5H8NB 1H44A 4G61A 2AL4A 2FBPA 4YB6A 5DEXA 1B05A 2PVUA 4GX4A 4GL8A 2A5SA 1YXIA 3HHFA 3QUFA 5CM6A 3H03A 1MPCA 1FQAA 4OYVA 3U1OA 1D3KA 4PAFA 1M5DA 4I40A 2XXWA 2A5TA 1NV4A 3B50A 3CSGA 4R6YA 4OEUA 3RN8A 2O51A 4NAPA
chains in the Genus database with same CATH topology
5I56A 1QUIA 1HSEA 3L6HA 1QULA 4R2BA 3IB1A 4I62A 2DE4A 4MLVA 1H45A 1MXYA 4G4PA 4F3GA 1MDP1 2F6PA 1NNFA 3O6IA 2XXUA 2HXWA 3OO8A 4YU0A 4F22A 4KYEA 4EDPA 2O1MA 4YKPA 4NF5B 1PB7A 1B51A 1BKAA 2QS4A 2V25A 2O7IA 3PMXA 4TOZA 1USYE 3T9XB 1B5HA 1ATGA 1QW0A 2B3FA 2QS3A 3Q25A 4G68A 2HCAA 1LLSA 3KOSA 1LGBC 1RKMA 3MVZA 4R6HA 5CC2A 4MBPA 2YPNA 4O3CA 1IZ1A 4JBZA 3CVGA 2RC8A 3MC2A 1B32A 4N07A 5L9SA 1A7LA 3FJ7A 3H6TA 4Q30B 3OEKA 3VLVA 1J1NA 1XHYA 5CI5A 5H8QB 4UA8A 1SD3A 4OZ9A 2RF1A 1NNKA 3BFTA 2DE3A 2ZYNA 3IOVA 3FXQA 3FATA 2Y7RA 4JDFA 2RC7A 4O3BA 5FTHA 2Z8FA 1I6QA 2VD3A 2Y84A 3DELB 3KJ7A 3OO9A 4QSEA 3VXCA 4AQ4A 1IXHA 3OD7A 1IITA 1VFEA 4RY1A 4P11A 3PUWE 2UVHA 1US4A 2F7CA 3MZ1A 4U21A 3C4MA 3THIA 1N3WA 1OVBA 1IUDA 4PE5B 1B2HA 1I6AA 1UIVA 2DWAA 3HO7A 2HFBA 3R26A 4QFKA 1ELJA 1FCKA 1B7HA 2B3BA 3RGYA 3RN8A 3W9WA 3U92A 4YB5A 2Y7KA 4H5GA 4JSOA 3Q28A 1B3LA 4NF8A 3IX1A 3ODBA 1ZBMA 4EQ9A 3O6GA 2F7AA 4YMBA 4WXJA 4BDNA 2AIXA 4RPNA 5DYHA 1HSLA 2H9BA 4C1TA 2I4BA 5KZTA 4RPOA 5TPAB 4OEVA 4XKPA 1DMBA 5AA3A 1RYXA 3UA8A 2A5TB 3W15C 1NMUA 5DVJA 1MY3A 4IGRA 4RK2A 3KZGA 3T9UA 3DLNA 3KGCA 1N3XA 3RLFE 3IOUA 4WEPA 1LFGA 4Q8RA 3JZJA 1JNFA 1MXVA 3MZBA 3GBBA 2HQ0A 5CMCA 5K2XA 3R6UA 4Z0IA 3TZAA 3VVEA 2UVGA 4BDMA 2REJA 3H6WA 1ANFA 4OENA 4BLAA 4ND9A 1MPBA 3MWBA 1GV8A 3N6TA 2VD2A 4FE8A 4HCWA 2FYIA 3CG1A 1XOCA 1JW5A 5DT6A 5I59A 4KD5A 4R2FA 1MQDA 3B7DA 2I0BA 1FTMA 4U22A 5ELVA 2XHDA 2F6GA 3TTKA 2I3VA 1EH3A 2ESNA 3TCHA 3UP9A 4XKQA 2XXQA 3OSRA 3E4RA 4ELOA 4MLQA 3KEIA 4MF3A 4LA9A 2GHAA 1B3GA 4ESXA 4JSDA 1Y4TA 1YTVA 2NWJA 1BLFA 1B5IA 1ZLQA 4DXBA 2DYXA 2G29A 5H8NA 4BDOA 1Y1ZA 2CZLA 3Q27A 4X1DA 3RUMA 2X7PA 1UQWA 4TQUQ 4DXCA 5ICTA 2XX9A 2RCBA 4QSDA 4YKJA 3D4GA 5JK4A 5AA4A 3TEPA 1B4HA 2H25A 4OWDA 1CE2A 3B6TA 4L17A 2OLBA 3IR1A 1URGA 3T96B 3IOTA 3HPIA 1B3HA 1NH8A 3TCFA 4OXVA 1CB6A 1B0LA 1FQFA 3CG3A 3OSQA 3PUYE 4GFRA 4IY5A 3TCGA 4F39A 3FVGA 5KCJB 5HBCA 2AYSA 4GLIA 5H8SA 3FVNA 4ZS9A 4ZZAA 3H7MA 1A55A 2OCUA 4LONB 5AA1A 2F78A 4GIZA 5EHSA 3MW0A 3FZVA 1LFIA 4U4SA 4HW8A 1US5A 4LZ7A 4ZZEA 1QKBA 1SBPA 1TXFA 1USYH 2XX7A 1NH7A 2NXOA 5F1QA 1PEBA 2O7UA 4BDLA 4OHNA 5IAIA 5JEIA 3SESA 4HTGA 2GH9A 1EU8A 4KYSA 4JB7A 4OFOA 4EQ7A 1B1XA 1LB9A 4F1UA 1MQGA 1II5A 1NNPA 3LSFB 2V3QA 5IKBA 2Q9TA 2R71A 2DP8A 1N04A 3QIMA 1M5FA 4RJZA 3VFJA 4F1YA 4NWDA 4KCCA 2OBGA 3GLBA 3O28A 2ONKE 5EYFA 4C0RA 3WAEA 2VP1A 3BBRA 4DCYA 4BDRA 1D9YA 3TTRA 5I57B 3C33A 4ZEFA 2GHBA 1QJMA 2W7YA 3I6VA 3N26A 5DVFA 3UIFA 3USDA 4EF1A 1NFTA 2FNCA 2OWSA 3E9XA 3FD3A 1A8EA 1XC1A 2O69A 4FECA 3S9MC 2PBWA 2I3WA 4IB2A 3QSLA 4ZECA 2NVUB 2DQVA 3C9HA 5FHOA 3TAJA 3OO7A 3PMWA 3SERA 4C1UA 3IK6B 4YB7A 2Q89A 1Q35A 1N76A 3CI8A 3IAZA 3ONMA 3ZS6A 3LUYA 3KN3A 3PGFA 4IO2A 5EHMA 5TP9B 3TTNA 2NOOA 3JYRA 4U23A 3FGSA 4FAJA 3K4UA 5KDTA 1Z7ME 1UIUA 1Y3QA 3A3CA 1LCTA 2XXYA 2QMWA 3MP1A 3TKDA 2R6GE 3FJMA 3FV1A 5CMMA 3TTLA 5ITPA 1P1UA 3BKIB 1JVXA 1FTKA 2XXTA 4F3SA 1I69A 1MH3A 4QFOA 3K6VA 2QPQA 2DOJA 4FATA 3TFLA 1MXXA 4KFQA 3H6UA 3FXRA 4POXA 3G7WA 5I57A 1IXIA 3KBRA 1DTZA 5I2NA 2DWJA 3H4ZA 1MG1A 1WDNA 3C35A 2AL5A 1MM7A 2XXXA 4HCYA 3KSJA 5A5XA 2P1SA 2ZYKA 1MY1A 3IO6A 1GVCA 4F1VA 3IORA 4RYAA 4JXIA 1YCJA 3ECRA 4OQOA 2YLNA 4U1OA 1L5TA 2UYFA 1SVXB 2XXHA 4NWCA 4Q5TA 5AE4A 4KI0E 4POWA 1MXZA 3QUJA 5TP9A 3FVKA 4EXKA 4KCDA 3H06B 2ZNUA 5K2YA 2F7BA 3K1PA 1SI1A 3T9HB 3UK4A 1QUKA 5KCJA 3R7XA 4IO5A 3HCQA 1AH5A 1MS7A 2QL3A 2V3UA 1PDAA 5CRYA 3QK6A 3VVFA 4DE8A 4YZZA 5CMKA 3CR9A 4HS7A 4I9DA 5TPAA 4DXUA 1R1NA 3SETA 1XVYA 4ONYA 3I3VA 3P7IA 2DWHA 1YPNA 1LBCA 1URSA 1N7WA 3IL1B 2QJEA 4IO7A 3EHSA 3TMGA 1JW4A 1XT8A 3O66A 1HSJA 4LVQA 4NF6B 3MQ9A 5ITOA 5ISUA 3T9VA 3PUZE 5H8QA 1B7ZA 1SW2A 3CRBA 4GWOA 4YICA 3ILUB 3RNNA 3Q26A 4GF8A 1OLAA 3EF7A 3IJXB 2PMSA 2ZXTA 1B52A 4QFLA 5CMBA 1O63A 1VSOA 4QHQA 2Q88A 3M3LA 2DWIA 2B65A 2I48A 3MP8A 3TELA 4F2QA 4NTLA 4ELRA 5I59B 2H5YA 4QSCA 3OOAA 3HHGA 5BWJA 1Z7NE 3N6UA 1YAEA 1NL5A 4H67A 4NE4A 5L8DA 3O2AA 4ZE9A 5AA2B 3HSTA 1P1OA 1B40A 3PU5A 1EZ9A 5BUUA 3MVWA 1D4NA 3O97A 1POTA 3KJTA 3B6WA 2P0SA 3JV9A 4N13A 4G8MA 1LAGE 3DP4A 4LZ5A 1OLCA 1FTJA 5DVIA 4KQPA 3VE1B 4OFJA 3O9PA 1MXUA 1DTGA 2NUVA 4H65A 4RXLA 2HZKA 2V84A 3FASA 4KHZE 4M1VA 2Q8JA 4ELQA 4U1ZA 2DVZA 1M5EA 3N5LA 2QMXA 4QF9A 3FIRA 2O6AA 1ZIUA 1FQEA 1SI0A 2X7QA 4YMAA 4H1XA 2H4IA 1S7YA 3MAMA 3PPQA 3MVYA 4R6KA 5AA2D 3TPAA 2Q2AA 4QRZA 1PB8A 5I2NB 3A3UA 4X9TA 4OESA 1TWYA 3MPKA 4DDDA 2QSXA 1AIVA 5A5XB 1M5CA 2ZMBA 2UYEA 1P1NA 3C36A 4GL0A 5JTYB 1ZU0A 3V83A 4FJPA 3EN3A 1GTKA 1B5JA 3S2VA 1FTOA 2H99A 4ZDMA 3C34A 1IXGA 3QYTA 2LAOA 4LQ2A 2I49A 2F34A 3KN8A 4X1BA 1ZTYA 1Y20A 2F35A 2CMOA 2PYYA 4UACA 4LP2B 4XKNA 5I84A 2Z23A 4P0IA 3EPEA 2XD2A 3EQ1A 1ZMGA 1EZPA 5F7VA 4Q0CA 2REGA 2F8DA 3TYHA 3G3JA 2ANJA 2I0CA 1JQFA 3IB0A 4PETA 1WODA 2GRVA 5B70A 2HZLA 3C31A 2D3IA 1AL3A 1JEVA 4JWYA 3S9EA 1FTLA 3T22A 4GOTA 3S4UA 1FW0A 3K1MA 4H6DA 3GZGA 3K1NA 4WEDA 4DIGA 5HPQA 4NF6A 1M5BA 4ZEKA 4F2OA 5DTBA 2RINA 4JWXA 2V93A 4E0WA 1A40A 3ILTB 3K2DA 1I6BA 3IB2A 2Z8DA 4LUBA 1XS5A 4RA1A 2Y7IA 4X48A 1H76A 3ZKKA 2F36A 1SW1A 3VDFA 3CFLA 4PP0A 4IY6A 2ONRA 2O68A 4E0XA 4I8CA 3IJOB 4K3FA 2ONSA 4NF4B 1B0HA 4G8HA 4O3AA 4PFWA 4XTCQ 3KG2A 2PT1A 4THIA 1FQCA 1JVYA 4NF5A 1DSNA 1B7UA 2UVIA 5DEXB 1LAXA 2Z8EA 3L6GA 2YJPA 3MP6A 3K02A 2UVJA 4H8JA 2VGQA 4LATA 1JEUA 5AA2A 4OERA 2XXPA 2ZYOA 2FA7A 5HM4B 1KWHA 2QS1A 2OZZA 3TUSA 1IQ7A 3SDFA 2OJTA 3SKPA 4QFPA 2IEEA 2UXAA 1DPPA 2XD3A 1A54A 1B9JA 2ZYMA 1EZOA 4U4XA 4OTEA 5H8HA 4BDQA 4F18A 1MM6A 2DXYA 3LBSA 5I2KB 3RQTA 2VOZA 5L9MA 4ELPA 4R75A 3RT6B 3U93A 2DXRA 2F97A 3PPPA 5CBSA 1SW5A 4QFNA 1AMFA 1B3EA 1Y3PA 2M8CA 2ZNSA 3G3GA 3PUXE 3MBPA 1P1QA 1Y3NA 4LZ8A 3E3KA 4R74A 4GQOA 4OMBA 4ECFA 2F5XA 4XXUA 2THIA 3K01A 4YKIA 3LSLA 1P99A 5JTYA 3LC8A 4ESWA 1A8FA 2HAVA 3G3KA 1N84A 3MUQA 3C32A 3DP8A 3PPRA 3PV0E 2E0SA 1MPDA 3S9LC 3MVXA 3KFMA 3CIJA 4PQJA 3IO4A 3N94A 5H8FA 1SW4A 3FVOA 4IO6A 3TQWA 4H5FA 3U94A 5FHNA 1Q1KA 1LFHA 3W9VA 4DLDA 4XKRA 4GRKA 3RTFB 4IO4A 1DPEA 1UTHA 2R9JA 3KN7A 3SEXA 1MXWA 4GXAA 4PFYA 3SEVA 5CBRA 3D4CA 1SYHA 2I6EA 4R72A 3T66A 4RK9A 5FTIA 2BJJX 3FJGA 4M4GA 5LOMA 3OELA 1VE4A 5B7DA 2QS2A 4G2ZA 1B1HA 2RC9A 4ZEIA 4G68C 2PX1A 5TU0A 4DCXA 3M8UA 4NEDA 4I1DA 4EF2A 4Z7EA 3K6UA 3UORA 3PMVA 2XXVA 4PFUA 3TODA 3K00A 3K6WA 1TFAA 5J1DA 3OO6A 1IXCA 3PD9A 3LSXA 1LAHE 3AXFA 3H3GA 2DVCA 4H0WA 1NKXA 4MH5A 4YKKA 3RTWB 4F29A 2I58A 4FEDA 4IO3A 3A09A 4NF4A 3SEWA 5L9OA 2I4CA 3H6VA 3O29A 1ZKBA 1LAFE 3FXUA 2ZNTA 4H8IA 1B6HA 1N0TA 1UTHB 1LB8A 2P2AA 3SEUA 4FIMA 1PB9A 2DS9A 2XXRA 4R9FA 1MH4A 1R9QA 2GFEA 2X26A 3CFZA 3LR1A 4ZEDA 3K0VA 4ZE8A 3CSBA 3KSXA 4YAHX 1BIYA 1D9VA 2HAUA 4DZ1A 4R73A 5I58A 1OMPA 4EUOA 1P1WA 1AOVA 1QVSA 1JW1A 1IEJA 1DOTA 2XX8A 3GXAA 1A99A 4GD5A 1S9TA 3SEYA 2Y7PA 1MY0A 2O84X 2OWTA 3TDJA 2D21A 3OENA 3T93B 4TLLB 1BP5A 1MRPA 3VLUA 3S9NC 1MQIA 1SYIA 3CFXA 4G77A 1Y1MA 1QKAA 3HN0A 3LSWA 3EHTA 4KPTA 4GXSB 5FHMA 2O1LA 1B3FA 3F11A 2Q2CA 3RT8A 3PUVE 1SDXA 2XXIA 3PD8A 1R9LA 4XIGQ 3ZKLA 1VR5A 1B46A 3HV1A 4U2RA 3VXBA 4RNSA 3RPWA 4PFTA 1LCFA 4WKMA 4ISUA 5M2VA 3TTMA 3KOTA 2G93A 2PT2A 4AB6A 1VFDA 2D5WA 3GBAA 3OEMA 4OFLA 3VVDA 1PBPA 4IGTA 1OQGA 3FV2A 2E1SA 2H98A 5H8FB 4R9GA 2OK2A 1F9BA 3U72A 3VLWA 1O64A 3ZSFA 4KR5A 1MQJA 1N7XA 3DP6A 1MY2A 4G8NA 3U8QA 1FQBA 2ALUA 3B6QA 3MPLA 2HEUA 3OXNA 1B58A 1S50A 2RKMA 1POY1 1SQYA 1UTBA 1URDA 4ZEBA 4F31B 1GR2A 3M3FA 4LQ5A 3V89B 5ICQA 2QRYA 4F19A 3OMBA 3Q29A 3UN6A 1Y4CA 2Z22A 3V5AA 3VV5A 3IOWA 1MQHA 1RYOA 1LBBA 1T0KA 1H3DA 5H8NB 1LSTA 1OIBA 4FEBA 1H44A 2IA4A 3K6XA 4JWOA 1MY4A 1NNTA 2AL4A 3E13X 1R6ZA 3G3IA 4NMYA 1Y9UA 1B05A 2PVUA 2Y7WA 4YB6A 3G3HA 4GL8A 5DEXA 1PC3A 1JETA 5AA4B 2A5SA 2DSFA 4N6PA 4OETA 4TLMB 3DM0A 4EQBA 1BTJA 3EHUA 3HHFA 3PPNA 3QAXA 3MJNA 3MZ9A 3QUFA 4EXLA 3RY3A 5CM6A 5I56B 3H03A 3WAFA 3PPOA 1MPCA 1TT1A 2V3TA 1WVJA 4NF8B 1FQAA 1PBQA 2DE2A 2RCAA 5KDTB 4OYVA 3V8XB 3BFUA 5H8HB 1MDQA 4OVJA 1GGGA 3U1OA 1D3KA 1TFDA 4G68B 1FQDA 1OVTA 4F3PA 1QUJA 1UTBB 4AB5A 5I2KA 2ABHA 3O6HA 1M5DA 1XVXA 3I5OA 2XXWA 2A5TA 5I58B 4F3BA 1H43A 1B4ZA 3FUZA 4GVOA 2VHAA 4MFIA 1O7TA 3CSGA 3G3FA 4R6YA 2WKYA 1ZJLA 4KYDA 4P0GA 3UGWA 2KLFA 1IIWA 3M3KA 4FORA 4OEUA 3QXMA 3TQLA 1OQHA 2O51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I56 A;  1QUI A;  1HSE A;  3L6H A;  1QUL A;  4R2B A;  3IB1 A;  4I62 A;  2DE4 A;  4MLV A;  1H45 A;  1MXY A;  4G4P A;  4F3G A;  1MDP 1;  2F6P A;  1NNF A;  3O6I A;  2XXU A;  2HXW A;  3OO8 A;  4YU0 A;  4F22 A;  4KYE A;  4EDP A;  2O1M A;  4YKP A;  4NF5 B;  1PB7 A;  1B51 A;  1BKA A;  2QS4 A;  2V25 A;  2O7I A;  3PMX A;  4TOZ A;  1USY E;  3T9X B;  1B5H A;  1ATG A;  1QW0 A;  2B3F A;  2QS3 A;  3Q25 A;  4G68 A;  2HCA A;  1LLS A;  3KOS A;  1LGB C;  1RKM A;  3MVZ A;  4R6H A;  5CC2 A;  4MBP A;  2YPN A;  4O3C A;  1IZ1 A;  4JBZ A;  3CVG A;  2RC8 A;  3MC2 A;  1B32 A;  4N07 A;  5L9S A;  1A7L A;  3FJ7 A;  3H6T A;  4Q30 B;  3OEK A;  3VLV A;  1J1N A;  1XHY A;  5CI5 A;  5H8Q B;  4UA8 A;  1SD3 A;  4OZ9 A;  2RF1 A;  1NNK A;  3BFT A;  2DE3 A;  2ZYN A;  3IOV A;  3FXQ A;  3FAT A;  2Y7R A;  4JDF A;  2RC7 A;  4O3B A;  5FTH A;  2Z8F A;  1I6Q A;  2VD3 A;  2Y84 A;  3DEL B;  3KJ7 A;  3OO9 A;  4QSE A;  3VXC A;  4AQ4 A;  1IXH A;  3OD7 A;  1IIT A;  1VFE A;  4RY1 A;  4P11 A;  3PUW E;  2UVH A;  1US4 A;  2F7C A;  3MZ1 A;  4U21 A;  3C4M A;  3THI A;  1N3W A;  1OVB A;  1IUD A;  4PE5 B;  1B2H A;  1I6A A;  1UIV A;  2DWA A;  3HO7 A;  2HFB A;  3R26 A;  4QFK A;  1ELJ A;  1FCK A;  1B7H A;  2B3B A;  3RGY A;  3RN8 A;  3W9W A;  3U92 A;  4YB5 A;  2Y7K A;  4H5G A;  4JSO A;  3Q28 A;  1B3L A;  4NF8 A;  3IX1 A;  3ODB A;  1ZBM A;  4EQ9 A;  3O6G A;  2F7A A;  4YMB A;  4WXJ A;  4BDN A;  2AIX A;  4RPN A;  5DYH A;  1HSL A;  2H9B A;  4C1T A;  2I4B A;  5KZT A;  4RPO A;  5TPA B;  4OEV A;  4XKP A;  1DMB A;  5AA3 A;  1RYX A;  3UA8 A;  2A5T B;  3W15 C;  1NMU A;  5DVJ A;  1MY3 A;  4IGR A;  4RK2 A;  3KZG A;  3T9U A;  3DLN A;  3KGC A;  1N3X A;  3RLF E;  3IOU A;  4WEP A;  1LFG A;  4Q8R A;  3JZJ A;  1JNF A;  1MXV A;  3MZB A;  3GBB A;  2HQ0 A;  5CMC A;  5K2X A;  3R6U A;  4Z0I A;  3TZA A;  3VVE A;  2UVG A;  4BDM A;  2REJ A;  3H6W A;  1ANF A;  4OEN A;  4BLA A;  4ND9 A;  1MPB A;  3MWB A;  1GV8 A;  3N6T A;  2VD2 A;  4FE8 A;  4HCW A;  2FYI A;  3CG1 A;  1XOC A;  1JW5 A;  5DT6 A;  5I59 A;  4KD5 A;  4R2F A;  1MQD A;  3B7D A;  2I0B A;  1FTM A;  4U22 A;  5ELV A;  2XHD A;  2F6G A;  3TTK A;  2I3V A;  1EH3 A;  2ESN A;  3TCH A;  3UP9 A;  4XKQ A;  2XXQ A;  3OSR A;  3E4R A;  4ELO A;  4MLQ A;  3KEI A;  4MF3 A;  4LA9 A;  2GHA A;  1B3G A;  4ESX A;  4JSD A;  1Y4T A;  1YTV A;  2NWJ A;  1BLF A;  1B5I A;  1ZLQ A;  4DXB A;  2DYX A;  2G29 A;  5H8N A;  4BDO A;  1Y1Z A;  2CZL A;  3Q27 A;  4X1D A;  3RUM A;  2X7P A;  1UQW A;  4TQU Q;  4DXC A;  5ICT A;  2XX9 A;  2RCB A;  4QSD A;  4YKJ A;  3D4G A;  5JK4 A;  5AA4 A;  3TEP A;  1B4H A;  2H25 A;  4OWD A;  1CE2 A;  3B6T A;  4L17 A;  2OLB A;  3IR1 A;  1URG A;  3T96 B;  3IOT A;  3HPI A;  1B3H A;  1NH8 A;  3TCF A;  4OXV A;  1CB6 A;  1B0L A;  1FQF A;  3CG3 A;  3OSQ A;  3PUY E;  4GFR A;  4IY5 A;  3TCG A;  4F39 A;  3FVG A;  5KCJ B;  5HBC A;  2AYS A;  4GLI A;  5H8S A;  3FVN A;  4ZS9 A;  4ZZA A;  3H7M A;  1A55 A;  2OCU A;  4LON B;  5AA1 A;  2F78 A;  4GIZ A;  5EHS A;  3MW0 A;  3FZV A;  1LFI A;  4U4S A;  4HW8 A;  1US5 A;  4LZ7 A;  4ZZE A;  1QKB A;  1SBP A;  1TXF A;  1USY H;  2XX7 A;  1NH7 A;  2NXO A;  5F1Q A;  1PEB A;  2O7U A;  4BDL A;  4OHN A;  5IAI A;  5JEI A;  3SES A;  4HTG A;  2GH9 A;  1EU8 A;  4KYS A;  4JB7 A;  4OFO A;  4EQ7 A;  1B1X A;  1LB9 A;  4F1U A;  1MQG A;  1II5 A;  1NNP A;  3LSF B;  2V3Q A;  5IKB A;  2Q9T A;  2R71 A;  2DP8 A;  1N04 A;  3QIM A;  1M5F A;  4RJZ A;  3VFJ A;  4F1Y A;  4NWD A;  4KCC A;  2OBG A;  3GLB A;  3O28 A;  2ONK E;  5EYF A;  4C0R A;  3WAE A;  2VP1 A;  3BBR A;  4DCY A;  4BDR A;  1D9Y A;  3TTR A;  5I57 B;  3C33 A;  4ZEF A;  2GHB A;  1QJM A;  2W7Y A;  3I6V A;  3N26 A;  5DVF A;  3UIF A;  3USD A;  4EF1 A;  1NFT A;  2FNC A;  2OWS A;  3E9X A;  3FD3 A;  1A8E A;  1XC1 A;  2O69 A;  4FEC A;  3S9M C;  2PBW A;  2I3W A;  4IB2 A;  3QSL A;  4ZEC A;  2NVU B;  2DQV A;  3C9H A;  5FHO A;  3TAJ A;  3OO7 A;  3PMW A;  3SER A;  4C1U A;  3IK6 B;  4YB7 A;  2Q89 A;  1Q35 A;  1N76 A;  3CI8 A;  3IAZ A;  3ONM A;  3ZS6 A;  3LUY A;  3KN3 A;  3PGF A;  4IO2 A;  5EHM A;  5TP9 B;  3TTN A;  2NOO A;  3JYR A;  4U23 A;  3FGS A;  4FAJ A;  3K4U A;  5KDT A;  1Z7M E;  1UIU A;  1Y3Q A;  3A3C A;  1LCT A;  2XXY A;  2QMW A;  3MP1 A;  3TKD A;  2R6G E;  3FJM A;  3FV1 A;  5CMM A;  3TTL A;  5ITP A;  1P1U A;  3BKI B;  1JVX A;  1FTK A;  2XXT A;  4F3S A;  1I69 A;  1MH3 A;  4QFO A;  3K6V A;  2QPQ A;  2DOJ A;  4FAT A;  3TFL A;  1MXX A;  4KFQ A;  3H6U A;  3FXR A;  4POX A;  3G7W A;  5I57 A;  1IXI A;  3KBR A;  1DTZ A;  5I2N A;  2DWJ A;  3H4Z A;  1MG1 A;  1WDN A;  3C35 A;  2AL5 A;  1MM7 A;  2XXX A;  4HCY A;  3KSJ A;  5A5X A;  2P1S A;  2ZYK A;  1MY1 A;  3IO6 A;  1GVC A;  4F1V A;  3IOR A;  4RYA A;  4JXI A;  1YCJ A;  3ECR A;  4OQO A;  2YLN A;  4U1O A;  1L5T A;  2UYF A;  1SVX B;  2XXH A;  4NWC A;  4Q5T A;  5AE4 A;  4KI0 E;  4POW A;  1MXZ A;  3QUJ A;  5TP9 A;  3FVK A;  4EXK A;  4KCD A;  3H06 B;  2ZNU A;  5K2Y A;  2F7B A;  3K1P A;  1SI1 A;  3T9H B;  3UK4 A;  1QUK A;  5KCJ A;  3R7X A;  4IO5 A;  3HCQ A;  1AH5 A;  1MS7 A;  2QL3 A;  2V3U A;  1PDA A;  5CRY A;  3QK6 A;  3VVF A;  4DE8 A;  4YZZ A;  5CMK A;  3CR9 A;  4HS7 A;  4I9D A;  5TPA A;  4DXU A;  1R1N A;  3SET A;  1XVY A;  4ONY A;  3I3V A;  3P7I A;  2DWH A;  1YPN A;  1LBC A;  1URS A;  1N7W A;  3IL1 B;  2QJE A;  4IO7 A;  3EHS A;  3TMG A;  1JW4 A;  1XT8 A;  3O66 A;  1HSJ A;  4LVQ A;  4NF6 B;  3MQ9 A;  5ITO A;  5ISU A;  3T9V A;  3PUZ E;  5H8Q A;  1B7Z A;  1SW2 A;  3CRB A;  4GWO A;  4YIC A;  3ILU B;  3RNN A;  3Q26 A;  4GF8 A;  1OLA A;  3EF7 A;  3IJX B;  2PMS A;  2ZXT A;  1B52 A;  4QFL A;  5CMB A;  1O63 A;  1VSO A;  4QHQ A;  2Q88 A;  3M3L A;  2DWI A;  2B65 A;  2I48 A;  3MP8 A;  3TEL A;  4F2Q A;  4NTL A;  4ELR A;  5I59 B;  2H5Y A;  4QSC A;  3OOA A;  3HHG A;  5BWJ A;  1Z7N E;  3N6U A;  1YAE A;  1NL5 A;  4H67 A;  4NE4 A;  5L8D A;  3O2A A;  4ZE9 A;  5AA2 B;  3HST A;  1P1O A;  1B40 A;  3PU5 A;  1EZ9 A;  5BUU A;  3MVW A;  1D4N A;  3O97 A;  1POT A;  3KJT A;  3B6W A;  2P0S A;  3JV9 A;  4N13 A;  4G8M A;  1LAG E;  3DP4 A;  4LZ5 A;  1OLC A;  1FTJ A;  5DVI A;  4KQP A;  3VE1 B;  4OFJ A;  3O9P A;  1MXU A;  1DTG A;  2NUV A;  4H65 A;  4RXL A;  2HZK A;  2V84 A;  3FAS A;  4KHZ E;  4M1V A;  2Q8J A;  4ELQ A;  4U1Z A;  2DVZ A;  1M5E A;  3N5L A;  2QMX A;  4QF9 A;  3FIR A;  2O6A A;  1ZIU A;  1FQE A;  1SI0 A;  2X7Q A;  4YMA A;  4H1X A;  2H4I A;  1S7Y A;  3MAM A;  3PPQ A;  3MVY A;  4R6K A;  5AA2 D;  3TPA A;  2Q2A A;  4QRZ A;  1PB8 A;  5I2N B;  3A3U A;  4X9T A;  4OES A;  1TWY A;  3MPK A;  4DDD A;  2QSX A;  1AIV A;  5A5X B;  1M5C A;  2ZMB A;  2UYE A;  1P1N A;  3C36 A;  4GL0 A;  5JTY B;  1ZU0 A;  3V83 A;  4FJP A;  3EN3 A;  1GTK A;  1B5J A;  3S2V A;  1FTO A;  2H99 A;  4ZDM A;  3C34 A;  1IXG A;  3QYT A;  2LAO A;  4LQ2 A;  2I49 A;  2F34 A;  3KN8 A;  4X1B A;  1ZTY A;  1Y20 A;  2F35 A;  2CMO A;  2PYY A;  4UAC A;  4LP2 B;  4XKN A;  5I84 A;  2Z23 A;  4P0I A;  3EPE A;  2XD2 A;  3EQ1 A;  1ZMG A;  1EZP A;  5F7V A;  4Q0C A;  2REG A;  2F8D A;  3TYH A;  3G3J A;  2ANJ A;  2I0C A;  1JQF A;  3IB0 A;  4PET A;  1WOD A;  2GRV A;  5B70 A;  2HZL A;  3C31 A;  2D3I A;  1AL3 A;  1JEV A;  4JWY A;  3S9E A;  1FTL A;  3T22 A;  4GOT A;  3S4U A;  1FW0 A;  3K1M A;  4H6D A;  3GZG A;  3K1N A;  4WED A;  4DIG A;  5HPQ A;  4NF6 A;  1M5B A;  4ZEK A;  4F2O A;  5DTB A;  2RIN A;  4JWX A;  2V93 A;  4E0W A;  1A40 A;  3ILT B;  3K2D A;  1I6B A;  3IB2 A;  2Z8D A;  4LUB A;  1XS5 A;  4RA1 A;  2Y7I A;  4X48 A;  1H76 A;  3ZKK A;  2F36 A;  1SW1 A;  3VDF A;  3CFL A;  4PP0 A;  4IY6 A;  2ONR A;  2O68 A;  4E0X A;  4I8C A;  3IJO B;  4K3F A;  2ONS A;  4NF4 B;  1B0H A;  4G8H A;  4O3A A;  4PFW A;  4XTC Q;  3KG2 A;  2PT1 A;  4THI A;  1FQC A;  1JVY A;  4NF5 A;  1DSN A;  1B7U A;  2UVI A;  5DEX B;  1LAX A;  2Z8E A;  3L6G A;  2YJP A;  3MP6 A;  3K02 A;  2UVJ A;  4H8J A;  2VGQ A;  4LAT A;  1JEU A;  5AA2 A;  4OER A;  2XXP A;  2ZYO A;  2FA7 A;  5HM4 B;  1KWH A;  2QS1 A;  2OZZ A;  3TUS A;  1IQ7 A;  3SDF A;  2OJT A;  3SKP A;  4QFP A;  2IEE A;  2UXA A;  1DPP A;  2XD3 A;  1A54 A;  1B9J A;  2ZYM A;  1EZO A;  4U4X A;  4OTE A;  5H8H A;  4BDQ A;  4F18 A;  1MM6 A;  2DXY A;  3LBS A;  5I2K B;  3RQT A;  2VOZ A;  5L9M A;  4ELP A;  4R75 A;  3RT6 B;  3U93 A;  2DXR A;  2F97 A;  3PPP A;  5CBS A;  1SW5 A;  4QFN A;  1AMF A;  1B3E A;  1Y3P A;  2M8C A;  2ZNS A;  3G3G A;  3PUX E;  3MBP A;  1P1Q A;  1Y3N A;  4LZ8 A;  3E3K A;  4R74 A;  4GQO A;  4OMB A;  4ECF A;  2F5X A;  4XXU A;  2THI A;  3K01 A;  4YKI A;  3LSL A;  1P99 A;  5JTY A;  3LC8 A;  4ESW A;  1A8F A;  2HAV A;  3G3K A;  1N84 A;  3MUQ A;  3C32 A;  3DP8 A;  3PPR A;  3PV0 E;  2E0S A;  1MPD A;  3S9L C;  3MVX A;  3KFM A;  3CIJ A;  4PQJ A;  3IO4 A;  3N94 A;  5H8F A;  1SW4 A;  3FVO A;  4IO6 A;  3TQW A;  4H5F A;  3U94 A;  5FHN A;  1Q1K A;  1LFH A;  3W9V A;  4DLD A;  4XKR A;  4GRK A;  3RTF B;  4IO4 A;  1DPE A;  1UTH A;  2R9J A;  3KN7 A;  3SEX A;  1MXW A;  4GXA A;  4PFY A;  3SEV A;  5CBR A;  3D4C A;  1SYH A;  2I6E A;  4R72 A;  3T66 A;  4RK9 A;  5FTI A;  2BJJ X;  3FJG A;  4M4G A;  5LOM A;  3OEL A;  1VE4 A;  5B7D A;  2QS2 A;  4G2Z A;  1B1H A;  2RC9 A;  4ZEI A;  4G68 C;  2PX1 A;  5TU0 A;  4DCX A;  3M8U A;  4NED A;  4I1D A;  4EF2 A;  4Z7E A;  3K6U A;  3UOR A;  3PMV A;  2XXV A;  4PFU A;  3TOD A;  3K00 A;  3K6W A;  1TFA A;  5J1D A;  3OO6 A;  1IXC A;  3PD9 A;  3LSX A;  1LAH E;  3AXF A;  3H3G A;  2DVC A;  4H0W A;  1NKX A;  4MH5 A;  4YKK A;  3RTW B;  4F29 A;  2I58 A;  4FED A;  4IO3 A;  3A09 A;  4NF4 A;  3SEW A;  5L9O A;  2I4C A;  3H6V A;  3O29 A;  1ZKB A;  1LAF E;  3FXU A;  2ZNT A;  4H8I A;  1B6H A;  1N0T A;  1UTH B;  1LB8 A;  2P2A A;  3SEU A;  4FIM A;  1PB9 A;  2DS9 A;  2XXR A;  4R9F A;  1MH4 A;  1R9Q A;  2GFE A;  2X26 A;  3CFZ A;  3LR1 A;  4ZED A;  3K0V A;  4ZE8 A;  3CSB A;  3KSX A;  4YAH X;  1BIY A;  1D9V A;  2HAU A;  4DZ1 A;  4R73 A;  5I58 A;  1OMP A;  4EUO A;  1P1W A;  1AOV A;  1QVS A;  1JW1 A;  1IEJ A;  1DOT A;  2XX8 A;  3GXA A;  1A99 A;  4GD5 A;  1S9T A;  3SEY A;  2Y7P A;  1MY0 A;  2O84 X;  2OWT A;  3TDJ A;  2D21 A;  3OEN A;  3T93 B;  4TLL B;  1BP5 A;  1MRP A;  3VLU A;  3S9N C;  1MQI A;  1SYI A;  3CFX A;  4G77 A;  1Y1M A;  1QKA A;  3HN0 A;  3LSW A;  3EHT A;  4KPT A;  4GXS B;  5FHM A;  2O1L A;  1B3F A;  3F11 A;  2Q2C A;  3RT8 A;  3PUV E;  1SDX A;  2XXI A;  3PD8 A;  1R9L A;  4XIG Q;  3ZKL A;  1VR5 A;  1B46 A;  3HV1 A;  4U2R A;  3VXB A;  4RNS A;  3RPW A;  4PFT A;  1LCF A;  4WKM A;  4ISU A;  5M2V A;  3TTM A;  3KOT A;  2G93 A;  2PT2 A;  4AB6 A;  1VFD A;  2D5W A;  3GBA A;  3OEM A;  4OFL A;  3VVD A;  1PBP A;  4IGT A;  1OQG A;  3FV2 A;  2E1S A;  2H98 A;  5H8F B;  4R9G A;  2OK2 A;  1F9B A;  3U72 A;  3VLW A;  1O64 A;  3ZSF A;  4KR5 A;  1MQJ A;  1N7X A;  3DP6 A;  1MY2 A;  4G8N A;  3U8Q A;  1FQB A;  2ALU A;  3B6Q A;  3MPL A;  2HEU A;  3OXN A;  1B58 A;  1S50 A;  2RKM A;  1POY 1;  1SQY A;  1UTB A;  1URD A;  4ZEB A;  4F31 B;  1GR2 A;  3M3F A;  4LQ5 A;  3V89 B;  5ICQ A;  2QRY A;  4F19 A;  3OMB A;  3Q29 A;  3UN6 A;  1Y4C A;  2Z22 A;  3V5A A;  3VV5 A;  3IOW A;  1MQH A;  1RYO A;  1LBB A;  1T0K A;  1H3D A;  5H8N B;  1LST A;  1OIB A;  4FEB A;  1H44 A;  2IA4 A;  3K6X A;  4JWO A;  1MY4 A;  1NNT A;  2AL4 A;  3E13 X;  1R6Z A;  3G3I A;  4NMY A;  1Y9U A;  1B05 A;  2PVU A;  2Y7W A;  4YB6 A;  3G3H A;  4GL8 A;  5DEX A;  1PC3 A;  1JET A;  5AA4 B;  2A5S A;  2DSF A;  4N6P A;  4OET A;  4TLM B;  3DM0 A;  4EQB A;  1BTJ A;  3EHU A;  3HHF A;  3PPN A;  3QAX A;  3MJN A;  3MZ9 A;  3QUF A;  4EXL A;  3RY3 A;  5CM6 A;  5I56 B;  3H03 A;  3WAF A;  3PPO A;  1MPC A;  1TT1 A;  2V3T A;  1WVJ A;  4NF8 B;  1FQA A;  1PBQ A;  2DE2 A;  2RCA A;  5KDT B;  4OYV A;  3V8X B;  3BFU A;  5H8H B;  1MDQ A;  4OVJ A;  1GGG A;  3U1O A;  1D3K A;  1TFD A;  4G68 B;  1FQD A;  1OVT A;  4F3P A;  1QUJ A;  1UTB B;  4AB5 A;  5I2K A;  2ABH A;  3O6H A;  1M5D A;  1XVX A;  3I5O A;  2XXW A;  2A5T A;  5I58 B;  4F3B A;  1H43 A;  1B4Z A;  3FUZ A;  4GVO A;  2VHA A;  4MFI A;  1O7T A;  3CSG A;  3G3F A;  4R6Y A;  2WKY A;  1ZJL A;  4KYD A;  4P0G A;  3UGW A;  2KLF A;  1IIW A;  3M3K A;  4FOR A;  4OEU A;  3QXM A;  3TQL A;  1OQH A;  2O51 A; 
#chains in the Genus database with same CATH topology
 3IB1 A;  4I62 A;  1H45 A;  4HE2 A;  2F6P A;  2PFZ A;  2XXU A;  3OO8 A;  4EDP A;  4YKP A;  3T9X B;  1USY E;  3Q25 A;  2B3F A;  4G68 A;  1IZ1 A;  4JBZ A;  3MC2 A;  3FJ7 A;  5H8Q B;  3BFT A;  3FXQ A;  5FTH A;  1VFE A;  3PUW E;  2F7C A;  4PBH A;  3THI A;  1B2H A;  2HFB A;  4QFK A;  2B3B A;  1B7H A;  3RGY A;  2Y7K A;  4H5G A;  4NF8 A;  3KBZ A;  5DYH A;  2H9B A;  4C1T A;  2I4B A;  4OA4 A;  5TPA B;  1RYX A;  1IMF A;  1MY3 A;  4RK2 A;  3MYU A;  4Q8R A;  3JZJ A;  3VVE A;  5CMC A;  3GBB A;  3H6W A;  4BLA A;  3CG1 A;  5DT6 A;  4R2F A;  4U22 A;  2XHD A;  2F6G A;  3TTK A;  4XKQ A;  4ELO A;  4MLQ A;  3KEI A;  4LA9 A;  5H8N A;  3RUM A;  2X7P A;  4DXC A;  2RCB A;  4LN5 A;  2H25 A;  4OWD A;  1URG A;  3IOT A;  3TCF A;  1B0L A;  1FQF A;  2AYS A;  4GLI A;  5H8S A;  4PCD A;  2F78 A;  5EHS A;  3FZV A;  4NX1 A;  4U4S A;  1US5 A;  4LZ7 A;  1TXF A;  2CZH A;  1USY H;  2NXO A;  4JB7 A;  3ISP A;  1LB9 A;  4F1U A;  1MQG A;  5IKB A;  3VFJ A;  4F1Y A;  2OBG A;  3GLB A;  4DCY A;  3BBR A;  1QJM A;  3USD A;  4FEC A;  2O69 A;  1XC1 A;  5IZ1 A;  2NVU B;  4C1U A;  3ZS6 A;  1RDY A;  3LUY A;  3KN3 A;  3PGF A;  3JYR A;  3ROJ A;  5KDT A;  1IMC A;  3TTL A;  3U8Q A;  3FJM A;  1I69 A;  4FAT A;  1LBW A;  3FXR A;  1IXI A;  2CEY A;  3C35 A;  4HCY A;  2P1S A;  4F1V A;  1GVC A;  2YLN A;  5AE4 A;  5TP9 A;  4KCD A;  3R7X A;  2PCR A;  2V3U A;  1PDA A;  5TPA A;  3SET A;  1YPN A;  4IO7 A;  3EHS A;  1JW4 A;  4LVQ A;  2VPO A;  1KA0 A;  1B7Z A;  1B52 A;  1VSO A;  2I48 A;  2H5Y A;  5BWJ A;  3N6U A;  4H67 A;  5AA2 B;  1P1O A;  4N6K A;  4G8M A;  5DVI A;  4OFJ A;  1MXU A;  1FBE A;  2P3V A;  4H65 A;  2V84 A;  1M5E A;  1IMB A;  1SI0 A;  2H4I A;  3MAM A;  3PPQ A;  3MVY A;  5I2N B;  3A3U A;  4X9T A;  4OES A;  1TWY A;  3MPK A;  4DDD A;  4DI3 D;  1AIV A;  2ZMB A;  4GL0 A;  1P1N A;  3C36 A;  4FJP A;  3EN3 A;  3S2V A;  1IXG A;  3QYT A;  4LQ2 A;  4MNP A;  4UAC A;  1Y20 A;  2PYY A;  4XKN A;  5I84 A;  2Z23 A;  4P0I A;  2XD2 A;  1ZMG A;  4N91 A;  4Q0C A;  2REG A;  2ANJ A;  5B70 A;  1WOD A;  2GRV A;  2HZL A;  3S9E A;  4WED A;  1M5B A;  5DTB A;  4DI4 B;  2RIN A;  4XFE A;  1A40 A;  1RDX A;  4GWU A;  2Y7I A;  3ZKK A;  4PP0 A;  4I8C A;  5FBP A;  3KG2 A;  2PT1 A;  4THI A;  1DSN A;  2VGQ A;  2ZYO A;  2FA7 A;  5HM4 B;  3TUS A;  1IQ7 A;  4QFP A;  1DPP A;  5IGA A;  1EZO A;  4U4X A;  1Q9D A;  2VOZ A;  3RT6 B;  2DXR A;  5CBS A;  4X1D A;  1AMF A;  1Y3P A;  4O8M A;  3LV0 A;  4LZ8 A;  4GQO A;  2F5X A;  3LSL A;  4N6D A;  5JTY A;  3MUQ A;  4QXD A;  3PPR A;  3S9L C;  1MPD A;  5LTC A;  4PQJ A;  1K9Z A;  3W9V A;  1DPE A;  1NUX A;  1MXW A;  2QVU A;  4GXA A;  4OVS A;  4R72 A;  3T66 A;  5FTI A;  4KXP A;  4ZEI A;  2QVV A;  4I1D A;  2B4M A;  3PMV A;  2XXV A;  3K00 A;  3AXF A;  4YKK A;  4H0W A;  2I58 A;  3T0J A;  5L9O A;  3A09 A;  3H6V A;  4H8I A;  3U65 A;  1UTH B;  1LB8 A;  1PB9 A;  2DS9 A;  1MH4 A;  3LR1 A;  4ZE8 A;  3KSX A;  2OX3 A;  5I58 A;  4GD5 A;  1K9Y A;  1A99 A;  1MY0 A;  2OWT A;  5EQ9 A;  2R8T A;  1MQI A;  3CFX A;  1QKA A;  3EHT A;  5FHM A;  2Q2C A;  1FBF A;  1SDX A;  2XXI A;  4XIG Q;  3ZKL A;  1VR5 A;  3HV1 A;  3TTM A;  4H46 A;  4AB6 A;  1PBP A;  4IGT A;  1OQG A;  3FV2 A;  2H98 A;  2OK2 A;  4XF5 A;  3ZSF A;  1MQJ A;  1N7X A;  2HEU A;  3OXN A;  3V89 B;  2QRY A;  3UN6 A;  3V5A A;  3IOW A;  1LBB A;  4NF0 A;  1LST A;  3CHG A;  1R6Z A;  4NMY A;  2Y7W A;  1PC3 A;  2DSF A;  4OET A;  4TLM B;  3DM0 A;  4EQB A;  1BTJ A;  3PPN A;  4MAG A;  5I56 B;  4N15 A;  3RY3 A;  2V3T A;  1WVJ A;  1PBQ A;  5KDT B;  1GGG A;  4PC9 A;  4UAB A;  1TFD A;  4G68 B;  5I5P A;  4I3E A;  4F3P A;  1UTB B;  3O6H A;  1XVX A;  4F3B A;  1H43 A;  4GVO A;  1B4Z A;  3FUZ A;  4MFI A;  3D1R A;  2WKY A;  3UGW A;  2KLF A;  2F3D A;  1HSE A;  1MXY A;  4G4P A;  1MDP 1;  2HXW A;  4F22 A;  2O1M A;  4Z7E A;  4NF5 B;  1BKA A;  2V25 A;  2QS4 A;  3PMX A;  1QW0 A;  4PF6 A;  1LLS A;  2CZK A;  1A7L A;  4X04 A;  5CI5 A;  2Y7R A;  2RC7 A;  2Z8F A;  3KJ7 A;  4AQ4 A;  2Y84 A;  5T3J A;  4RY1 A;  5ESY A;  1US4 A;  5A5L A;  4U21 A;  1OVB A;  4PE5 B;  1I6A A;  1UIV A;  2DWA A;  3HO7 A;  4PTK A;  3R26 A;  1ELJ A;  1FCK A;  3U92 A;  2DDK A;  1B3L A;  3ODB A;  1ZBM A;  5IZ3 A;  3O6G A;  3IFC A;  4YMB A;  2WBB A;  4XKP A;  1DMB A;  3UA8 A;  3W15 C;  3RLF E;  3HFU A;  2HQ0 A;  5K2X A;  4BDM A;  1NV0 A;  1RDZ A;  4ND9 A;  3MWB A;  1GV8 A;  3N6T A;  5IZZ A;  1NV3 A;  4KD5 A;  3B7D A;  1FTM A;  5ELV A;  3TCH A;  1EH3 A;  2ESN A;  4PAK A;  3E4R A;  4ESX A;  1B3G A;  2NWJ A;  1FBP A;  1BLF A;  4DXB A;  2G29 A;  4GX3 A;  4BDO A;  1SPI A;  1Y1Z A;  2XX9 A;  2MKZ A;  3TEP A;  2Q8M A;  5KCJ B;  3TCG A;  2FHY A;  4N17 A;  2KQZ A;  4ZZA A;  5AA1 A;  1A55 A;  2OCU A;  4LON B;  1YZ0 A;  4HW8 A;  5BUU A;  3MW0 A;  1LFI A;  4ZZE A;  4O7M A;  1QKB A;  1SBP A;  5F1Q A;  5IAI A;  4OHN A;  3SES A;  4HTG A;  1EU8 A;  3LSF B;  2V3Q A;  1IMD A;  4JVD A;  2Q9T A;  1N04 A;  1NV2 A;  5EYF A;  3O28 A;  3WAE A;  4BDR A;  1D9Y A;  3QMF A;  4PAI A;  3N26 A;  3UIF A;  1FJ9 A;  2I3W A;  5FHO A;  3OO7 A;  3PMW A;  3CI8 A;  5TP9 B;  5EHM A;  3TTN A;  4FAJ A;  2PFY A;  1Y3Q A;  3TKD A;  1FPB A;  3BKI B;  2XXT A;  1FTK A;  3TFL A;  4P47 A;  3H6U A;  1MG1 A;  1MM7 A;  2XXX A;  5A5X A;  3KSJ A;  3IO6 A;  3IOR A;  1YCJ A;  4U1O A;  2XXH A;  4POW A;  1MXZ A;  3QUJ A;  3FVK A;  4EXK A;  3H06 B;  2ZNU A;  5IZ3 B;  5K2Y A;  3UK4 A;  1SI1 A;  2QL3 A;  4MX6 A;  3T1B A;  4PE3 A;  5CMK A;  3CR9 A;  4HS7 A;  1XVY A;  4ONY A;  3P7I A;  1URS A;  3TMG A;  4NF6 B;  1HSJ A;  5ISU A;  3MQ9 A;  3T9V A;  4GF8 A;  2WYP A;  4QFL A;  4MHF A;  1O63 A;  4ELR A;  4ZE9 A;  1NL5 A;  3O2A A;  1B40 A;  1FPJ A;  1D4N A;  1POT A;  3KJT A;  3JV9 A;  4N13 A;  1FTJ A;  4NG7 A;  4N81 A;  5EQ8 A;  2NUV A;  4AS4 A;  2DVZ A;  1FBH A;  2O6A A;  4YMA A;  1PB8 A;  3V83 A;  1FTO A;  2H99 A;  2LAO A;  3KN8 A;  1ZTY A;  4P9K A;  4HE1 A;  4LP2 B;  4MMP A;  4P56 A;  2F8D A;  3G3J A;  1JQF A;  4PET A;  1AL3 A;  1JEV A;  4JWY A;  1FTL A;  3T22 A;  3K1M A;  4H6D A;  3GZG A;  3K1N A;  2VPN A;  4E0W A;  1I6B A;  3IB2 A;  1XS5 A;  4RA1 A;  4X48 A;  1H76 A;  4IY6 A;  4NF4 B;  4O3A A;  1FQC A;  4NF5 A;  4F2O A;  1B7U A;  3T96 B;  3MP6 A;  4H8J A;  4N8Y A;  4PDH A;  2XXP A;  2QS1 A;  2OJT A;  3SKP A;  1A54 A;  4F18 A;  1FTA A;  4OTE A;  3RQT A;  4ELP A;  4R75 A;  1SW5 A;  4QFN A;  1B3E A;  2ZNS A;  3KC1 A;  3MBP A;  1P1Q A;  3E3K A;  4R74 A;  4ECF A;  2THI A;  3K01 A;  4YKI A;  4ESW A;  4U23 A;  1A8F A;  4PFI A;  3PV0 E;  2P3N A;  1SW4 A;  3TQW A;  4DLD A;  4GRK A;  1UTH A;  3BIG A;  3SEX A;  5CBR A;  3SEV A;  3E79 A;  1DK4 A;  2KR0 A;  3FXB A;  4M4G A;  5LOM A;  3OEL A;  5B7D A;  2QS2 A;  1KZ8 A;  1B1H A;  2RC9 A;  2PX1 A;  5TU0 A;  3K6U A;  4MNC A;  5J1D A;  1IXC A;  4NN3 A;  3LSX A;  1LAH E;  3H3G A;  4F29 A;  3SEW A;  2I4C A;  2ZNT A;  1N0T A;  2XXR A;  1JP4 A;  1R9Q A;  2GFE A;  4YAH X;  1D9V A;  2HAU A;  3GXA A;  3SEY A;  3TDJ A;  4TLL B;  3VLU A;  3S9N C;  4G77 A;  1YYZ A;  4P8B A;  4N4U A;  1R9L A;  3VXB A;  1NV6 A;  1LCF A;  2G93 A;  3OEM A;  5ET8 A;  5H8F B;  1F9B A;  3VLW A;  4G8N A;  1MY2 A;  3B6Q A;  2ALU A;  2VT5 A;  1UTB A;  1GR2 A;  4LQ5 A;  3OMB A;  3VV5 A;  2Z22 A;  1MQH A;  1RYO A;  4GWY A;  1Y9U A;  4X8R A;  1JET A;  4N6P A;  3QAX A;  4PFR A;  3WAF A;  1TT1 A;  4NF8 B;  2L5V A;  2DE2 A;  3V8X B;  1MDQ A;  4P1E A;  1FQD A;  1QUJ A;  2ABH A;  3I5O A;  1FSA A;  2VHA A;  1O7T A;  3G3F A;  4KYD A;  4P0G A;  1IIW A;  3M3K A;  3QXM A;  1OQH A;  4OVT A;  4MJO A;  4R2B A;  2DE4 A;  3IFA A;  1NNF A;  3O6I A;  4YU0 A;  1DBZ A;  1PB7 A;  1B51 A;  2O7I A;  1B5H A;  1ATG A;  2QS3 A;  2HCA A;  5CC2 A;  3KOS A;  1LGB C;  1RKM A;  3CVG A;  2RC8 A;  3H6T A;  3OEK A;  3VLV A;  1XHY A;  4OZ9 A;  4PFB A;  1NNK A;  2DE3 A;  2ZYN A;  1XI6 A;  4JDF A;  3FAT A;  4PGN A;  3DEL B;  4QSE A;  3OO9 A;  3VXC A;  1IIT A;  4P11 A;  2UVH A;  2QFL A;  3C4M A;  1N3W A;  2Y5K A;  3FBP A;  4YB5 A;  4JSO A;  4RPN A;  1HSL A;  5KZT A;  4RPO A;  4FBP A;  5DW8 A;  2A5T B;  3KZG A;  3DLN A;  3KGC A;  1N3X A;  4WEP A;  1LFG A;  1MXV A;  3R6U A;  3TZA A;  2UVG A;  2REJ A;  4MEV A;  1ANF A;  1MPB A;  4HCW A;  1JW5 A;  3UP9 A;  2XXQ A;  3OSR A;  1Y4T A;  1YTV A;  4AS5 A;  2DYX A;  2BJI A;  2XWK A;  1UQW A;  4TQU Q;  3LUZ A;  1B4H A;  3B6T A;  4L17 A;  3IR1 A;  3HPI A;  1NH8 A;  4OXV A;  3PUY E;  3OSQ A;  4F39 A;  4GFR A;  3FVG A;  5HBC A;  3FVN A;  1IMA A;  3H7M A;  3NOH A;  4GIZ A;  4GWW A;  1NH7 A;  1PEB A;  4BDL A;  2GH9 A;  4OFO A;  4PDD A;  2B4L A;  1B1X A;  1II5 A;  4N8G A;  1FPD A;  2DP8 A;  3QIM A;  4NWD A;  2ONK E;  4C0R A;  3TTR A;  3C33 A;  2W7Y A;  3I6V A;  1NFT A;  2FNC A;  2OWS A;  3E9X A;  1A8E A;  3S9M C;  2PBW A;  2Y5L A;  3QSL A;  4ZEC A;  3C9H A;  3SER A;  3IK6 B;  3ONM A;  3FGS A;  3K4U A;  1FBD A;  1LCT A;  3MP1 A;  2R6G E;  5ITP A;  1P1U A;  2QPQ A;  1MXX A;  1LEV A;  4KFQ A;  5I57 A;  4POX A;  3G7W A;  3KBR A;  5I2N A;  2DWJ A;  5F24 A;  1WDN A;  1MY1 A;  4MIJ A;  4RYA A;  4JXI A;  4H45 A;  4OQO A;  1SVX B;  4NWC A;  3T9H B;  1AWB A;  3HCQ A;  1AH5 A;  3A29 A;  5CRY A;  3QK6 A;  3VVF A;  4DE8 A;  1R1N A;  2DWH A;  1N7W A;  5IM2 A;  3O66 A;  5ITO A;  2HHM A;  4YIC A;  3CRB A;  4GWO A;  3ILU B;  3RNN A;  3Q26 A;  1OLA A;  1G0H A;  3IJX B;  2ZXT A;  2Q88 A;  3M3L A;  2DWI A;  2B65 A;  4F2Q A;  5EYG A;  3OOA A;  5L8D A;  3HST A;  3PU5 A;  3DP4 A;  4LZ5 A;  4OVP A;  4KQP A;  3O9P A;  1DTG A;  4RXL A;  4MNI A;  2HZK A;  3FAS A;  4M1V A;  4U1Z A;  2HPG A;  3FIR A;  1ZIU A;  4H1X A;  1S7Y A;  1FPG A;  3TPA A;  4QRZ A;  4OAN A;  1FPI A;  5JTY B;  1B5J A;  2F35 A;  3EPE A;  5F7V A;  3TYH A;  3IB0 A;  2OWZ A;  4GOT A;  3S4U A;  2WYK A;  2XA5 A;  3GYY A;  3ILT B;  3K2D A;  2Z8D A;  1SW1 A;  3VDF A;  4OVR A;  2ONR A;  2O68 A;  4E0X A;  4K3F A;  5J16 A;  1B0H A;  4PFW A;  4XTC Q;  1LAX A;  2Z8E A;  2YJP A;  3K02 A;  4NHB A;  1FBG A;  5AA2 A;  4OER A;  4O7I A;  1KWH A;  2OZZ A;  1NV7 A;  2CEX A;  2HXR A;  2ZYM A;  5H8H A;  2DXY A;  5I2K B;  5L9M A;  4XEQ A;  2F97 A;  3EKI A;  3G3G A;  2M8C A;  1LBZ A;  1Y3N A;  4OMB A;  1P99 A;  2HAV A;  1N84 A;  1EYK A;  3C32 A;  3MVX A;  3CIJ A;  3N94 A;  1FPF A;  3FVO A;  1IME A;  3U94 A;  5FHN A;  1Q1K A;  1LFH A;  4XKR A;  3RTF B;  2R9J A;  3KN7 A;  2FVZ A;  2V4C A;  2ZZV A;  4PFY A;  1EYJ A;  2I6E A;  4RK9 A;  1NUY A;  3FJG A;  4NGU A;  3RYD A;  4G2Z A;  3M8U A;  4NED A;  3UOR A;  5I7I A;  3TOD A;  1TFA A;  2Q74 A;  4MH5 A;  5I56 A;  4FED A;  4IO3 A;  1BK4 A;  4OVQ A;  1QGX A;  1ZKB A;  1FPK A;  2P2A A;  3SEU A;  4R9F A;  2X26 A;  3CSB A;  1BIY A;  4DZ1 A;  3MST A;  1QVS A;  4GX6 A;  2O84 X;  2D21 A;  1BP5 A;  1LBV A;  1SYI A;  2O1L A;  3RT8 A;  1FPE A;  3PUV E;  3PD8 A;  1LBX A;  4WKM A;  4ISU A;  3KOT A;  1VFD A;  3GBA A;  4R9G A;  1INP A;  5ET5 A;  1O64 A;  4P1L A;  3DP6 A;  1FQB A;  1B58 A;  1S50 A;  4ZEB A;  3Q29 A;  1T0K A;  3BIH A;  1OIB A;  4FEB A;  2IA4 A;  3K6X A;  4JWO A;  1MY4 A;  1NNT A;  3E13 X;  3G3I A;  3G3H A;  5AA4 B;  3EHU A;  4EXL A;  3MJN A;  3MZ9 A;  5ET7 A;  3PPO A;  2RCA A;  3BFU A;  5H8H B;  4OVJ A;  1OVT A;  5I2K A;  4AB5 A;  5I58 B;  4GWZ A;  1NV5 A;  4GBW A;  2FIX A;  1ZJL A;  4FOR A;  3TQL A;  1QUI A;  2XXK A;  3L6H A;  1QUL A;  2WEF A;  4MLV A;  4NQ8 A;  4F3G A;  2ZZX A;  4KYE A;  4TOZ A;  3MVZ A;  4R6H A;  4MBP A;  5EYH A;  2YPN A;  4O3C A;  1B32 A;  4N07 A;  5L9S A;  4Q30 B;  1J1N A;  4UA8 A;  1SD3 A;  2XWV A;  2RF1 A;  3IOV A;  5LDZ A;  4O3B A;  1I6Q A;  2VD3 A;  1IXH A;  3OD7 A;  3MZ1 A;  1IUD A;  2FIE A;  3W9W A;  3Q28 A;  3IX1 A;  4EQ9 A;  2F7A A;  4WXJ A;  4BDN A;  2AIX A;  4OEV A;  5AA3 A;  1NMU A;  5DVJ A;  4IGR A;  3T9U A;  1EYI A;  3IOU A;  4JVC A;  5I3S A;  3MZB A;  1JNF A;  1FJ6 A;  4ELQ A;  3RPL A;  3KC0 A;  4Z0I A;  4OEN A;  1NUZ A;  2XWO A;  2VD2 A;  4FE8 A;  2FYI A;  1XOC A;  5I59 A;  1MQD A;  2I0B A;  2GQ1 A;  2I3V A;  4MF3 A;  2GHA A;  4JSD A;  5EQA A;  1ZLQ A;  1B5I A;  2CZL A;  3Q27 A;  5ICT A;  1NV1 A;  4QSD A;  4YKJ A;  3D4G A;  5JK4 A;  5AA4 A;  1CE2 A;  2OLB A;  1G0I A;  1B3H A;  1CB6 A;  3CG3 A;  4IY5 A;  4MCO A;  4ZS9 A;  2XX7 A;  2O7U A;  5JEI A;  4KYS A;  4EQ7 A;  1NNP A;  2R71 A;  1M5F A;  4RJZ A;  4KCC A;  2VP1 A;  5I57 B;  4ZEF A;  2GHB A;  4EF1 A;  5DVF A;  1CNQ A;  3FD3 A;  1FRP A;  4IB2 A;  3TAJ A;  2DQV A;  4QBA A;  2Q89 A;  1Q35 A;  1N76 A;  3IAZ A;  4YB7 A;  4IO2 A;  2NOO A;  4GWX A;  1Z7M E;  1UIU A;  3A3C A;  2XXY A;  2QMW A;  3FV1 A;  5CMM A;  1JVX A;  2WBD A;  1MH3 A;  4QFO A;  3K6V A;  2DOJ A;  1DTZ A;  1LBY A;  3H4Z A;  2AL5 A;  2ZYK A;  1NUW A;  3ECR A;  1L5T A;  2UYF A;  4Q5T A;  4KI0 E;  2XWI A;  2F7B A;  3K1P A;  1QUK A;  5KCJ A;  4IO5 A;  1MS7 A;  2WX9 A;  4YZZ A;  4I9D A;  4DXU A;  2F3B A;  3I3V A;  1LBC A;  3IL1 B;  2QJE A;  1XT8 A;  1FPL A;  3PUZ E;  5H8Q A;  1SW2 A;  3EF7 A;  1D9Q A;  2PMS A;  4HE0 A;  5CMB A;  4QHQ A;  3TEL A;  2ZZW A;  3MP8 A;  1VDW A;  4NTL A;  5I59 B;  4QSC A;  3HHG A;  1Z7N E;  1YAE A;  4NE4 A;  1EZ9 A;  3MVW A;  3O97 A;  3B6W A;  2P0S A;  1LAG E;  1OLC A;  3VE1 B;  2Q8J A;  4KHZ E;  3N5L A;  2QMX A;  4QF9 A;  3E78 A;  1FQE A;  2X7Q A;  4PBQ A;  4R6K A;  5AA2 D;  2Q2A A;  2JJK A;  2QSX A;  5A5X B;  1M5C A;  2UYE A;  1NI9 A;  1ZU0 A;  1GTK A;  4ZDM A;  3C34 A;  2I49 A;  2F34 A;  4X1B A;  4PF8 A;  2CMO A;  3EQ1 A;  1EZP A;  2I0C A;  1KA1 A;  4JVI A;  3C31 A;  2D3I A;  4DIG A;  1FW0 A;  5HPQ A;  4NF6 A;  4ZEK A;  4JWX A;  2V93 A;  4P3L A;  4LUB A;  2F36 A;  3CFL A;  4PGP A;  3IJO B;  2ONS A;  4G8H A;  1FBC A;  1JVY A;  2UVI A;  5DEX B;  3L6G A;  4LAT A;  2UVJ A;  1JEU A;  3SDF A;  2IEE A;  2UXA A;  2XD3 A;  1B9J A;  4BDQ A;  1MM6 A;  3LBS A;  4IR8 A;  3U93 A;  3PPP A;  3PUX E;  4XXU A;  2QVR A;  3LC8 A;  3G3K A;  3DP8 A;  2E0S A;  3KFM A;  3IO4 A;  5H8F A;  4IO6 A;  4H5F A;  4GWS A;  4IO4 A;  1DCU A;  3D4C A;  1SYH A;  2BJJ X;  4GBV A;  1VE4 A;  4HXV A;  4G68 C;  4DCX A;  4EF2 A;  2CZI A;  3RPL B;  4PFU A;  3K6W A;  3OO6 A;  5ET6 A;  3PD9 A;  3RTW B;  2DVC A;  3SZP A;  1NKX A;  4NF4 A;  3O29 A;  1LAF E;  3FXU A;  1B6H A;  4FIM A;  3CFZ A;  4I3Y A;  4ZED A;  3K0V A;  4R73 A;  1OMP A;  4EUO A;  1P1W A;  1AOV A;  1JW1 A;  1IEJ A;  1DOT A;  2XX8 A;  1S9T A;  2Y7P A;  3OEN A;  3T93 B;  1MRP A;  1Y1M A;  3HN0 A;  3LSW A;  4KPT A;  4GXS B;  1B3F A;  3F11 A;  3PTY A;  4U2R A;  1B46 A;  4RNS A;  3RPW A;  4PFT A;  5M2V A;  2PT2 A;  4F3S A;  2D5W A;  4OFL A;  3VVD A;  2E1S A;  4O94 A;  3U72 A;  3B8B A;  4KR5 A;  3MPL A;  5EQ7 A;  2RKM A;  1POY 1;  1SQY A;  4F31 B;  1URD A;  3M3F A;  5ICQ A;  4F19 A;  1Y4C A;  1H3D A;  5H8N B;  1H44 A;  4G61 A;  2AL4 A;  2FBP A;  4YB6 A;  5DEX A;  1B05 A;  2PVU A;  4GX4 A;  4GL8 A;  2A5S A;  1YXI A;  3HHF A;  3QUF A;  5CM6 A;  3H03 A;  1MPC A;  1FQA A;  4OYV A;  3U1O A;  1D3K A;  4PAF A;  1M5D A;  4I40 A;  2XXW A;  2A5T A;  1NV4 A;  3B50 A;  3CSG A;  4R6Y A;  4OEU A;  3RN8 A;  2O51 A;  4NAP A; 
#chains in the Genus database with same CATH homology
 5I56 A;  1QUI A;  1HSE A;  3L6H A;  1QUL A;  4R2B A;  3IB1 A;  4I62 A;  2DE4 A;  4MLV A;  1H45 A;  1MXY A;  4G4P A;  4F3G A;  1MDP 1;  2F6P A;  1NNF A;  3O6I A;  2XXU A;  2HXW A;  3OO8 A;  4YU0 A;  4F22 A;  4KYE A;  4EDP A;  2O1M A;  4YKP A;  4NF5 B;  1PB7 A;  1B51 A;  1BKA A;  2QS4 A;  2V25 A;  2O7I A;  3PMX A;  4TOZ A;  1USY E;  3T9X B;  1B5H A;  1ATG A;  1QW0 A;  2B3F A;  2QS3 A;  3Q25 A;  4G68 A;  2HCA A;  1LLS A;  3KOS A;  1LGB C;  1RKM A;  3MVZ A;  4R6H A;  5CC2 A;  4MBP A;  2YPN A;  4O3C A;  1IZ1 A;  4JBZ A;  3CVG A;  2RC8 A;  3MC2 A;  1B32 A;  4N07 A;  5L9S A;  1A7L A;  3FJ7 A;  3H6T A;  4Q30 B;  3OEK A;  3VLV A;  1J1N A;  1XHY A;  5CI5 A;  5H8Q B;  4UA8 A;  1SD3 A;  4OZ9 A;  2RF1 A;  1NNK A;  3BFT A;  2DE3 A;  2ZYN A;  3IOV A;  3FXQ A;  3FAT A;  2Y7R A;  4JDF A;  2RC7 A;  4O3B A;  5FTH A;  2Z8F A;  1I6Q A;  2VD3 A;  2Y84 A;  3DEL B;  3KJ7 A;  3OO9 A;  4QSE A;  3VXC A;  4AQ4 A;  1IXH A;  3OD7 A;  1IIT A;  1VFE A;  4RY1 A;  4P11 A;  3PUW E;  2UVH A;  1US4 A;  2F7C A;  3MZ1 A;  4U21 A;  3C4M A;  3THI A;  1N3W A;  1OVB A;  1IUD A;  4PE5 B;  1B2H A;  1I6A A;  1UIV A;  2DWA A;  3HO7 A;  2HFB A;  3R26 A;  4QFK A;  1ELJ A;  1FCK A;  1B7H A;  2B3B A;  3RGY A;  3RN8 A;  3W9W A;  3U92 A;  4YB5 A;  2Y7K A;  4H5G A;  4JSO A;  3Q28 A;  1B3L A;  4NF8 A;  3IX1 A;  3ODB A;  1ZBM A;  4EQ9 A;  3O6G A;  2F7A A;  4YMB A;  4WXJ A;  4BDN A;  2AIX A;  4RPN A;  5DYH A;  1HSL A;  2H9B A;  4C1T A;  2I4B A;  5KZT A;  4RPO A;  5TPA B;  4OEV A;  4XKP A;  1DMB A;  5AA3 A;  1RYX A;  3UA8 A;  2A5T B;  3W15 C;  1NMU A;  5DVJ A;  1MY3 A;  4IGR A;  4RK2 A;  3KZG A;  3T9U A;  3DLN A;  3KGC A;  1N3X A;  3RLF E;  3IOU A;  4WEP A;  1LFG A;  4Q8R A;  3JZJ A;  1JNF A;  1MXV A;  3MZB A;  3GBB A;  2HQ0 A;  5CMC A;  5K2X A;  3R6U A;  4Z0I A;  3TZA A;  3VVE A;  2UVG A;  4BDM A;  2REJ A;  3H6W A;  1ANF A;  4OEN A;  4BLA A;  4ND9 A;  1MPB A;  3MWB A;  1GV8 A;  3N6T A;  2VD2 A;  4FE8 A;  4HCW A;  2FYI A;  3CG1 A;  1XOC A;  1JW5 A;  5DT6 A;  5I59 A;  4KD5 A;  4R2F A;  1MQD A;  3B7D A;  2I0B A;  1FTM A;  4U22 A;  5ELV A;  2XHD A;  2F6G A;  3TTK A;  2I3V A;  1EH3 A;  2ESN A;  3TCH A;  3UP9 A;  4XKQ A;  2XXQ A;  3OSR A;  3E4R A;  4ELO A;  4MLQ A;  3KEI A;  4MF3 A;  4LA9 A;  2GHA A;  1B3G A;  4ESX A;  4JSD A;  1Y4T A;  1YTV A;  2NWJ A;  1BLF A;  1B5I A;  1ZLQ A;  4DXB A;  2DYX A;  2G29 A;  5H8N A;  4BDO A;  1Y1Z A;  2CZL A;  3Q27 A;  4X1D A;  3RUM A;  2X7P A;  1UQW A;  4TQU Q;  4DXC A;  5ICT A;  2XX9 A;  2RCB A;  4QSD A;  4YKJ A;  3D4G A;  5JK4 A;  5AA4 A;  3TEP A;  1B4H A;  2H25 A;  4OWD A;  1CE2 A;  3B6T A;  4L17 A;  2OLB A;  3IR1 A;  1URG A;  3T96 B;  3IOT A;  3HPI A;  1B3H A;  1NH8 A;  3TCF A;  4OXV A;  1CB6 A;  1B0L A;  1FQF A;  3CG3 A;  3OSQ A;  3PUY E;  4GFR A;  4IY5 A;  3TCG A;  4F39 A;  3FVG A;  5KCJ B;  5HBC A;  2AYS A;  4GLI A;  5H8S A;  3FVN A;  4ZS9 A;  4ZZA A;  3H7M A;  1A55 A;  2OCU A;  4LON B;  5AA1 A;  2F78 A;  4GIZ A;  5EHS A;  3MW0 A;  3FZV A;  1LFI A;  4U4S A;  4HW8 A;  1US5 A;  4LZ7 A;  4ZZE A;  1QKB A;  1SBP A;  1TXF A;  1USY H;  2XX7 A;  1NH7 A;  2NXO A;  5F1Q A;  1PEB A;  2O7U A;  4BDL A;  4OHN A;  5IAI A;  5JEI A;  3SES A;  4HTG A;  2GH9 A;  1EU8 A;  4KYS A;  4JB7 A;  4OFO A;  4EQ7 A;  1B1X A;  1LB9 A;  4F1U A;  1MQG A;  1II5 A;  1NNP A;  3LSF B;  2V3Q A;  5IKB A;  2Q9T A;  2R71 A;  2DP8 A;  1N04 A;  3QIM A;  1M5F A;  4RJZ A;  3VFJ A;  4F1Y A;  4NWD A;  4KCC A;  2OBG A;  3GLB A;  3O28 A;  2ONK E;  5EYF A;  4C0R A;  3WAE A;  2VP1 A;  3BBR A;  4DCY A;  4BDR A;  1D9Y A;  3TTR A;  5I57 B;  3C33 A;  4ZEF A;  2GHB A;  1QJM A;  2W7Y A;  3I6V A;  3N26 A;  5DVF A;  3UIF A;  3USD A;  4EF1 A;  1NFT A;  2FNC A;  2OWS A;  3E9X A;  3FD3 A;  1A8E A;  1XC1 A;  2O69 A;  4FEC A;  3S9M C;  2PBW A;  2I3W A;  4IB2 A;  3QSL A;  4ZEC A;  2NVU B;  2DQV A;  3C9H A;  5FHO A;  3TAJ A;  3OO7 A;  3PMW A;  3SER A;  4C1U A;  3IK6 B;  4YB7 A;  2Q89 A;  1Q35 A;  1N76 A;  3CI8 A;  3IAZ A;  3ONM A;  3ZS6 A;  3LUY A;  3KN3 A;  3PGF A;  4IO2 A;  5EHM A;  5TP9 B;  3TTN A;  2NOO A;  3JYR A;  4U23 A;  3FGS A;  4FAJ A;  3K4U A;  5KDT A;  1Z7M E;  1UIU A;  1Y3Q A;  3A3C A;  1LCT A;  2XXY A;  2QMW A;  3MP1 A;  3TKD A;  2R6G E;  3FJM A;  3FV1 A;  5CMM A;  3TTL A;  5ITP A;  1P1U A;  3BKI B;  1JVX A;  1FTK A;  2XXT A;  4F3S A;  1I69 A;  1MH3 A;  4QFO A;  3K6V A;  2QPQ A;  2DOJ A;  4FAT A;  3TFL A;  1MXX A;  4KFQ A;  3H6U A;  3FXR A;  4POX A;  3G7W A;  5I57 A;  1IXI A;  3KBR A;  1DTZ A;  5I2N A;  2DWJ A;  3H4Z A;  1MG1 A;  1WDN A;  3C35 A;  2AL5 A;  1MM7 A;  2XXX A;  4HCY A;  3KSJ A;  5A5X A;  2P1S A;  2ZYK A;  1MY1 A;  3IO6 A;  1GVC A;  4F1V A;  3IOR A;  4RYA A;  4JXI A;  1YCJ A;  3ECR A;  4OQO A;  2YLN A;  4U1O A;  1L5T A;  2UYF A;  1SVX B;  2XXH A;  4NWC A;  4Q5T A;  5AE4 A;  4KI0 E;  4POW A;  1MXZ A;  3QUJ A;  5TP9 A;  3FVK A;  4EXK A;  4KCD A;  3H06 B;  2ZNU A;  5K2Y A;  2F7B A;  3K1P A;  1SI1 A;  3T9H B;  3UK4 A;  1QUK A;  5KCJ A;  3R7X A;  4IO5 A;  3HCQ A;  1AH5 A;  1MS7 A;  2QL3 A;  2V3U A;  1PDA A;  5CRY A;  3QK6 A;  3VVF A;  4DE8 A;  4YZZ A;  5CMK A;  3CR9 A;  4HS7 A;  4I9D A;  5TPA A;  4DXU A;  1R1N A;  3SET A;  1XVY A;  4ONY A;  3I3V A;  3P7I A;  2DWH A;  1YPN A;  1LBC A;  1URS A;  1N7W A;  3IL1 B;  2QJE A;  4IO7 A;  3EHS A;  3TMG A;  1JW4 A;  1XT8 A;  3O66 A;  1HSJ A;  4LVQ A;  4NF6 B;  3MQ9 A;  5ITO A;  5ISU A;  3T9V A;  3PUZ E;  5H8Q A;  1B7Z A;  1SW2 A;  3CRB A;  4GWO A;  4YIC A;  3ILU B;  3RNN A;  3Q26 A;  4GF8 A;  1OLA A;  3EF7 A;  3IJX B;  2PMS A;  2ZXT A;  1B52 A;  4QFL A;  5CMB A;  1O63 A;  1VSO A;  4QHQ A;  2Q88 A;  3M3L A;  2DWI A;  2B65 A;  2I48 A;  3MP8 A;  3TEL A;  4F2Q A;  4NTL A;  4ELR A;  5I59 B;  2H5Y A;  4QSC A;  3OOA A;  3HHG A;  5BWJ A;  1Z7N E;  3N6U A;  1YAE A;  1NL5 A;  4H67 A;  4NE4 A;  5L8D A;  3O2A A;  4ZE9 A;  5AA2 B;  3HST A;  1P1O A;  1B40 A;  3PU5 A;  1EZ9 A;  5BUU A;  3MVW A;  1D4N A;  3O97 A;  1POT A;  3KJT A;  3B6W A;  2P0S A;  3JV9 A;  4N13 A;  4G8M A;  1LAG E;  3DP4 A;  4LZ5 A;  1OLC A;  1FTJ A;  5DVI A;  4KQP A;  3VE1 B;  4OFJ A;  3O9P A;  1MXU A;  1DTG A;  2NUV A;  4H65 A;  4RXL A;  2HZK A;  2V84 A;  3FAS A;  4KHZ E;  4M1V A;  2Q8J A;  4ELQ A;  4U1Z A;  2DVZ A;  1M5E A;  3N5L A;  2QMX A;  4QF9 A;  3FIR A;  2O6A A;  1ZIU A;  1FQE A;  1SI0 A;  2X7Q A;  4YMA A;  4H1X A;  2H4I A;  1S7Y A;  3MAM A;  3PPQ A;  3MVY A;  4R6K A;  5AA2 D;  3TPA A;  2Q2A A;  4QRZ A;  1PB8 A;  5I2N B;  3A3U A;  4X9T A;  4OES A;  1TWY A;  3MPK A;  4DDD A;  2QSX A;  1AIV A;  5A5X B;  1M5C A;  2ZMB A;  2UYE A;  1P1N A;  3C36 A;  4GL0 A;  5JTY B;  1ZU0 A;  3V83 A;  4FJP A;  3EN3 A;  1GTK A;  1B5J A;  3S2V A;  1FTO A;  2H99 A;  4ZDM A;  3C34 A;  1IXG A;  3QYT A;  2LAO A;  4LQ2 A;  2I49 A;  2F34 A;  3KN8 A;  4X1B A;  1ZTY A;  1Y20 A;  2F35 A;  2CMO A;  2PYY A;  4UAC A;  4LP2 B;  4XKN A;  5I84 A;  2Z23 A;  4P0I A;  3EPE A;  2XD2 A;  3EQ1 A;  1ZMG A;  1EZP A;  5F7V A;  4Q0C A;  2REG A;  2F8D A;  3TYH A;  3G3J A;  2ANJ A;  2I0C A;  1JQF A;  3IB0 A;  4PET A;  1WOD A;  2GRV A;  5B70 A;  2HZL A;  3C31 A;  2D3I A;  1AL3 A;  1JEV A;  4JWY A;  3S9E A;  1FTL A;  3T22 A;  4GOT A;  3S4U A;  1FW0 A;  3K1M A;  4H6D A;  3GZG A;  3K1N A;  4WED A;  4DIG A;  5HPQ A;  4NF6 A;  1M5B A;  4ZEK A;  4F2O A;  5DTB A;  2RIN A;  4JWX A;  2V93 A;  4E0W A;  1A40 A;  3ILT B;  3K2D A;  1I6B A;  3IB2 A;  2Z8D A;  4LUB A;  1XS5 A;  4RA1 A;  2Y7I A;  4X48 A;  1H76 A;  3ZKK A;  2F36 A;  1SW1 A;  3VDF A;  3CFL A;  4PP0 A;  4IY6 A;  2ONR A;  2O68 A;  4E0X A;  4I8C A;  3IJO B;  4K3F A;  2ONS A;  4NF4 B;  1B0H A;  4G8H A;  4O3A A;  4PFW A;  4XTC Q;  3KG2 A;  2PT1 A;  4THI A;  1FQC A;  1JVY A;  4NF5 A;  1DSN A;  1B7U A;  2UVI A;  5DEX B;  1LAX A;  2Z8E A;  3L6G A;  2YJP A;  3MP6 A;  3K02 A;  2UVJ A;  4H8J A;  2VGQ A;  4LAT A;  1JEU A;  5AA2 A;  4OER A;  2XXP A;  2ZYO A;  2FA7 A;  5HM4 B;  1KWH A;  2QS1 A;  2OZZ A;  3TUS A;  1IQ7 A;  3SDF A;  2OJT A;  3SKP A;  4QFP A;  2IEE A;  2UXA A;  1DPP A;  2XD3 A;  1A54 A;  1B9J A;  2ZYM A;  1EZO A;  4U4X A;  4OTE A;  5H8H A;  4BDQ A;  4F18 A;  1MM6 A;  2DXY A;  3LBS A;  5I2K B;  3RQT A;  2VOZ A;  5L9M A;  4ELP A;  4R75 A;  3RT6 B;  3U93 A;  2DXR A;  2F97 A;  3PPP A;  5CBS A;  1SW5 A;  4QFN A;  1AMF A;  1B3E A;  1Y3P A;  2M8C A;  2ZNS A;  3G3G A;  3PUX E;  3MBP A;  1P1Q A;  1Y3N A;  4LZ8 A;  3E3K A;  4R74 A;  4GQO A;  4OMB A;  4ECF A;  2F5X A;  4XXU A;  2THI A;  3K01 A;  4YKI A;  3LSL A;  1P99 A;  5JTY A;  3LC8 A;  4ESW A;  1A8F A;  2HAV A;  3G3K A;  1N84 A;  3MUQ A;  3C32 A;  3DP8 A;  3PPR A;  3PV0 E;  2E0S A;  1MPD A;  3S9L C;  3MVX A;  3KFM A;  3CIJ A;  4PQJ A;  3IO4 A;  3N94 A;  5H8F A;  1SW4 A;  3FVO A;  4IO6 A;  3TQW A;  4H5F A;  3U94 A;  5FHN A;  1Q1K A;  1LFH A;  3W9V A;  4DLD A;  4XKR A;  4GRK A;  3RTF B;  4IO4 A;  1DPE A;  1UTH A;  2R9J A;  3KN7 A;  3SEX A;  1MXW A;  4GXA A;  4PFY A;  3SEV A;  5CBR A;  3D4C A;  1SYH A;  2I6E A;  4R72 A;  3T66 A;  4RK9 A;  5FTI A;  2BJJ X;  3FJG A;  4M4G A;  5LOM A;  3OEL A;  1VE4 A;  5B7D A;  2QS2 A;  4G2Z A;  1B1H A;  2RC9 A;  4ZEI A;  4G68 C;  2PX1 A;  5TU0 A;  4DCX A;  3M8U A;  4NED A;  4I1D A;  4EF2 A;  4Z7E A;  3K6U A;  3UOR A;  3PMV A;  2XXV A;  4PFU A;  3TOD A;  3K00 A;  3K6W A;  1TFA A;  5J1D A;  3OO6 A;  1IXC A;  3PD9 A;  3LSX A;  1LAH E;  3AXF A;  3H3G A;  2DVC A;  4H0W A;  1NKX A;  4MH5 A;  4YKK A;  3RTW B;  4F29 A;  2I58 A;  4FED A;  4IO3 A;  3A09 A;  4NF4 A;  3SEW A;  5L9O A;  2I4C A;  3H6V A;  3O29 A;  1ZKB A;  1LAF E;  3FXU A;  2ZNT A;  4H8I A;  1B6H A;  1N0T A;  1UTH B;  1LB8 A;  2P2A A;  3SEU A;  4FIM A;  1PB9 A;  2DS9 A;  2XXR A;  4R9F A;  1MH4 A;  1R9Q A;  2GFE A;  2X26 A;  3CFZ A;  3LR1 A;  4ZED A;  3K0V A;  4ZE8 A;  3CSB A;  3KSX A;  4YAH X;  1BIY A;  1D9V A;  2HAU A;  4DZ1 A;  4R73 A;  5I58 A;  1OMP A;  4EUO A;  1P1W A;  1AOV A;  1QVS A;  1JW1 A;  1IEJ A;  1DOT A;  2XX8 A;  3GXA A;  1A99 A;  4GD5 A;  1S9T A;  3SEY A;  2Y7P A;  1MY0 A;  2O84 X;  2OWT A;  3TDJ A;  2D21 A;  3OEN A;  3T93 B;  4TLL B;  1BP5 A;  1MRP A;  3VLU A;  3S9N C;  1MQI A;  1SYI A;  3CFX A;  4G77 A;  1Y1M A;  1QKA A;  3HN0 A;  3LSW A;  3EHT A;  4KPT A;  4GXS B;  5FHM A;  2O1L A;  1B3F A;  3F11 A;  2Q2C A;  3RT8 A;  3PUV E;  1SDX A;  2XXI A;  3PD8 A;  1R9L A;  4XIG Q;  3ZKL A;  1VR5 A;  1B46 A;  3HV1 A;  4U2R A;  3VXB A;  4RNS A;  3RPW A;  4PFT A;  1LCF A;  4WKM A;  4ISU A;  5M2V A;  3TTM A;  3KOT A;  2G93 A;  2PT2 A;  4AB6 A;  1VFD A;  2D5W A;  3GBA A;  3OEM A;  4OFL A;  3VVD A;  1PBP A;  4IGT A;  1OQG A;  3FV2 A;  2E1S A;  2H98 A;  5H8F B;  4R9G A;  2OK2 A;  1F9B A;  3U72 A;  3VLW A;  1O64 A;  3ZSF A;  4KR5 A;  1MQJ A;  1N7X A;  3DP6 A;  1MY2 A;  4G8N A;  3U8Q A;  1FQB A;  2ALU A;  3B6Q A;  3MPL A;  2HEU A;  3OXN A;  1B58 A;  1S50 A;  2RKM A;  1POY 1;  1SQY A;  1UTB A;  1URD A;  4ZEB A;  4F31 B;  1GR2 A;  3M3F A;  4LQ5 A;  3V89 B;  5ICQ A;  2QRY A;  4F19 A;  3OMB A;  3Q29 A;  3UN6 A;  1Y4C A;  2Z22 A;  3V5A A;  3VV5 A;  3IOW A;  1MQH A;  1RYO A;  1LBB A;  1T0K A;  1H3D A;  5H8N B;  1LST A;  1OIB A;  4FEB A;  1H44 A;  2IA4 A;  3K6X A;  4JWO A;  1MY4 A;  1NNT A;  2AL4 A;  3E13 X;  1R6Z A;  3G3I A;  4NMY A;  1Y9U A;  1B05 A;  2PVU A;  2Y7W A;  4YB6 A;  3G3H A;  4GL8 A;  5DEX A;  1PC3 A;  1JET A;  5AA4 B;  2A5S A;  2DSF A;  4N6P A;  4OET A;  4TLM B;  3DM0 A;  4EQB A;  1BTJ A;  3EHU A;  3HHF A;  3PPN A;  3QAX A;  3MJN A;  3MZ9 A;  3QUF A;  4EXL A;  3RY3 A;  5CM6 A;  5I56 B;  3H03 A;  3WAF A;  3PPO A;  1MPC A;  1TT1 A;  2V3T A;  1WVJ A;  4NF8 B;  1FQA A;  1PBQ A;  2DE2 A;  2RCA A;  5KDT B;  4OYV A;  3V8X B;  3BFU A;  5H8H B;  1MDQ A;  4OVJ A;  1GGG A;  3U1O A;  1D3K A;  1TFD A;  4G68 B;  1FQD A;  1OVT A;  4F3P A;  1QUJ A;  1UTB B;  4AB5 A;  5I2K A;  2ABH A;  3O6H A;  1M5D A;  1XVX A;  3I5O A;  2XXW A;  2A5T A;  5I58 B;  4F3B A;  1H43 A;  1B4Z A;  3FUZ A;  4GVO A;  2VHA A;  4MFI A;  1O7T A;  3CSG A;  3G3F A;  4R6Y A;  2WKY A;  1ZJL A;  4KYD A;  4P0G A;  3UGW A;  2KLF A;  1IIW A;  3M3K A;  4FOR A;  4OEU A;  3QXM A;  3TQL A;  1OQH A;  2O51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...