1MRPA

Ferric-binding protein from haemophilus influenzae
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
309
structure length
309
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron transport
molecule keywords FERRIC IRON BINDING PROTEIN
publication title Structure of Haemophilus influenzae Fe(+3)-binding protein reveals convergent evolution within a superfamily.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 126
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 1997-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mrpA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mrpA01
4OHNA 2I3WA 3RT8A 2UYFA 1MXWA 3I5OA 3TYHA 1GGGA 3DM0A 4QHQA 4JWOA 1SW5A 4OFLA 2QSXA 4U1OA 3SEYA 3OO8A 2O7IA 3KZGA 2ABHA 4NF8B 2W7YA 1SDXA 1SW4A 3D4GA 2OLBA 1LCTA 5I84A 4FJPA 1TFDA 1ZMGA 5H8SA 1LBBA 5TPAB 3MVWA 3USDA 2FA7A 4RYAA 3K6XA 4NMYA 2GHAA 1POY1 1I6QA 3VVDA 4G8HA 3KEIA 4DCYA 2Z8FA 4F3GA 3G3IA 2AL5A 3H6TA 3ZKLA 4ZZEA 4YKKA 5ELVA 4NF4A 4DDDA 3IOVA 2I6EA 4HS7A 3Q26A 1MY2A 3G3GA 1MY1A 2A5TB 2VD3A 4GOTA 3T9UA 4FORA 3TKDA 2ANJA 5HM4B 4ND9A 4F1YA 2D5WA 1IXGA 5CMMA 2Y7WA 5TPAA 4WEPA 5I2KB 3MVZA 2DE3A 4TLLB 3TTMA 1H43A 3BKIB 2FYIA 1DOTA 2O1MA 3SEVA 5H8FA 1PDAA 3G7WA 1M5DA 3MC2A 2I0BA 3I3VA 3Q25A 3CFLA 1IITA 4FEDA 1H3DA 3MJNA 3EHSA 4XKQA 1LAGE 4NEDA 5CMKA 1LAHE 2UYEA 3Q28A 2XXTA 3M3FA 3B6TA 1NNKA 4YKIA 4NWDA 1OMPA 5CMCA 3LSFB 4RA1A 5I56B 4QF9A 4GL0A 3SKPA 4TQUQ 2CMOA 5F7VA 4Z7EA 4MBPA 4Q0CA 3VXCA 3RNNA 2Q9TA 5TP9B 4DZ1A 3MBPA 3RGYA 2QMWA 4FIMA 1SQYA 2OBGA 4R9GA 3OEMA 1B32A 3W9WA 4H8JA 3K6WA 3N6TA 4OQOA 1T0KA 3PUXE 5AA2B 3CI8A 1Y3QA 4KQPA 2RCAA 1D3KA 2OWSA 2E1SA 3FJ7A 3DP8A 4GIZA 4O3AA 3KJTA 5CI5A 1LCFA 5EHSA 1QUKA 2V3TA 5CMBA 3PU5A 2QPQA 1A55A 4U23A 5AA2D 1Z7ME 4EXLA 5BWJA 3S4UA 3FZVA 3TAJA 4O3BA 1B05A 3FV1A 4WXJA 4U22A 4U2RA 3QK6A 3EN3A 1L5TA 3VLWA 2V84A 3PPOA 4GRKA 4H5FA 5H8QA 4TOZA 2PT2A 3MAMA 3PPRA 4XIGQ 3IOUA 1Y3NA 5B70A 5DVFA 2ZYMA 1O7TA 1RYOA 3T22A 4G4PA 4ESWA 4MLQA 3AXFA 1B1XA 4BDMA 3I6VA 3HSTA 3O6GA 1YCJA 4RNSA 1YAEA 1NKXA 2IEEA 3QUJA 4GD5A 2ESNA 3QIMA 1M5EA 3FXQA 2V3QA 2XXUA 5I58B 4F19A 1EH3A 3U94A 4IO5A 3CFXA 5EHMA 2P2AA 4OETA 1N0TA 1LSTA 1F9BA 1Q1KA 2QS3A 1QVSA 4JBZA 1HSLA 2F7AA 2RC7A 3M3LA 4F1UA 1URGA 3TTKA 4ZE9A 5AA3A 5ICQA 1MS7A 5ISUA 3KSXA 1P1NA 3G3JA 2DVZA 3ONMA 1O64A 1B40A 1NNFA 1IXCA 4OVJA 4QRZA 3FXRA 2Q88A 1UTBB 1PB9A 1MXVA 4JSOA 1IUDA 2XXRA 1P1QA 3HO7A 4R6KA 4P0IA 1MDP1 3TMGA 1Y1MA 4G68C 2I49A 5AA1A 3RQTA 3LBSA 4MLVA 2O68A 4RK2A 1B3EA 2QS1A 3VLUA 5KDTA 3N6UA 2RCBA 1SYIA 5M2VA 5FHOA 1N04A 4DCXA 3ZS6A 1FQFA 4KD5A 4GXAA 3FVOA 4H0WA 3R7XA 1A8EA 3T9VA 4Z0IA 4BDNA 3OSRA 3SEXA 5JTYB 2RC9A 3B6QA 2I3VA 1QUIA 2IA4A 1QULA 2QJEA 3TDJA 4PP0A 1BIYA 2F8DA 1NNPA 3DLNA 3BFUA 4GF8A 5H8NB 3PUVE 1S9TA 3O6IA 5B7DA 2I58A 4JWYA 4QSEA 4KYDA 3G3HA 3ODBA 3VXBA 3MPKA 1DTZA 4PFUA 1S50A 4EQBA 3EPEA 4RPNA 1BLFA 4ONYA 1DTGA 3KFMA 1B1HA 1LFHA 4U21A 2NUVA 2Z8EA 2I4CA 4IGTA 3CG3A 3G3KA 2VD2A 3RT6B 4HCYA 4R74A 4NE4A 2RKMA 4GL8A 1SVXB 3K4UA 1ZIUA 2B65A 4Q5TA 3TEPA 2H5YA 4R6HA 2HXWA 1MQDA 3GBBA 1RYXA 1I6BA 4ZS9A 3TTLA 4YICA 2HQ0A 1DMBA 1SW1A 1Q35A 3K1PA 3GXAA 5TU0A 1LBCA 4DXBA 4QFOA 2DS9A 1PB7A 3K0VA 4Q30B 2I0CA 4R2FA 2GFEA 1B3HA 3OSQA 4G8NA 2DYXA 3KN7A 1SBPA 4KI0E 3FV2A 3FVNA 2RC8A 2NVUB 4ZECA 1OVBA 3PV0E 1EZ9A 4NF5A 1XVYA 3TELA 3U72A 1UIVA 3S9LC 4GFRA 1PBPA 4MH5A 3GZGA 4OERA 3B6WA 4G2ZA 1KWHA 1FTKA 5CBSA 2ZXTA 4NF4B 2Z8DA 3ZKKA 4BLAA 4PFTA 2X7QA 5I59A 3EHTA 3ILUB 2Z23A 3K2DA 1II5A 1XT8A 1OLCA 1ZTYA 1JQFA 2VGQA 2VOZA 1ANFA 1OVTA 4DXUA 3N5LA 1SD3A 1IXIA 4YKPA 3OEKA 2LAOA 4OWDA 5H8FB 3SESA 2DWIA 3LC8A 3MZ1A 1R9LA 2OCUA 4IY6A 1MPDA 1MDQA 3FVGA 4GLIA 1A7LA 3CG1A 1Y4TA 3LSWA 1B3GA 4JWXA 2UVIA 1MY4A 1NH7A 4BDLA 1XC1A 2ONRA 4R6YA 2XX7A 1B7UA 1B4ZA 1ZBMA 3BFTA 3MP8A 1EZPA 2H4IA 4KCDA 2XD2A 3OO9A 4LONB 5L9MA 1VE4A 3OD7A 2Y7IA 5DYHA 3U92A 3C32A 2OK2A 1AIVA 4BDOA 1NFTA 2H98A 3SDFA 3UIFA 1BTJA 3PUYE 1TXFA 1P99A 3H7MA 1UQWA 1MH3A 4R72A 3OO6A 2Z22A 1DSNA 3E4RA 3A3UA 1EZOA 1NL5A 4LZ5A 3RY3A 1B52A 3OMBA 3VVFA 4LP2B 1B0HA 2PT1A 3FVKA 3ILTB 5H8HA 4G8MA 3BBRA 1Y9UA 4DLDA 2REGA 2XX8A 2Q8JA 2F7CA 2GHBA 5K2YA 4C0RA 2BJJX 1UIUA 3KBRA 1OLAA 3IAZA 1SI1A 2HAUA 4YB5A 3PD8A 1BP5A 3PPQA 4LQ2A 3RTWB 3HV1A 2F78A 3V5AA 2R6GE 3KOSA 5HBCA 3TQLA 3JZJA 4F3BA 2F5XA 2QRYA 3IB2A 5H8QB 1R9QA 1MQIA 4R2BA 2AYSA 3C34A 4NTLA 3IL1B 4C1UA 1MG1A 4ESXA 3IO4A 2Y7PA 4F2QA 2RF1A 5JEIA 3O29A 3TPAA 2XXYA 3K6VA 3RLFE 1WVJA 3O2AA 2Q2AA 3M8UA 3CFZA 4X1DA 4QSCA 3MWBA 5JK4A 2QS4A 4RY1A 5FHNA 1B2HA 4QFNA 2Y7RA 3U8QA 3EF7A 2OZZA 1MRPA 4FE8A 4F22A 5DEXA 4G77A 4M1VA 2HEUA 4KYEA 4YZZA 1D9VA 1POTA 4RXLA 3K01A 3O97A 1MXZA 2DQVA 2HAVA 3TCHA 4U4XA 3SETA 3MVYA 2X7PA 4AQ4A 1GVCA 5ICTA 1FTLA 1XS5A 2ZYNA 2H9BA 3FATA 3IR1A 4UA8A 3K1NA 3IB0A 4E0XA 3OOAA 2KLFA 3IJXB 4U1ZA 1B9JA 5KDTB 2E0SA 3PGFA 3VE1B 1Z7NE 1LAFE 3H03A 2O51A 2F34A 3DP4A 5CRYA 3FJGA 4GWOA 4YB7A 1MY0A 2I4BA 1LLSA 1MM6A 4M4GA 2X26A 3TODA 2I48A 4QSDA 4XKPA 5I2NA 2DSFA 3H6UA 4QFKA 4OTEA 2ZYOA 4DXCA 2XXIA 3MUQA 4ELQA 3VDFA 3ZSFA 5A5XA 4F3SA 4YAHX 3RUMA 3U1OA 1QKAA 2O69A 1A8FA 3SERA 3JYRA 2REJA 1MPCA 3IJOB 1N3WA 2NWJA 4IO3A 2AIXA 3FXUA 4ISUA 5HPQA 2D3IA 5DVJA 1B46A 3PD9A 4OYVA 4RJZA 2DWAA 4YMBA 2XD3A 5DVIA 1N84A 1OIBA 4I1DA 1A40A 5CBRA 3K6UA 4YU0A 4F2OA 3IOWA 2O1LA 3HHGA 1BKAA 1DPPA 2XXQA 3TZAA 3E13X 4X48A 2YLNA 5L9OA 3LUYA 1Y3PA 2PX1A 2XXHA 4LUBA 1MH4A 2R9JA 3QXMA 5AA4A 4F31B 4FECA 1JW5A 4BDQA 3TUSA 1B51A 2WKYA 1DPEA 1MY3A 5CC2A 2GH9A 2XHDA 3WAFA 4K3FA 1TFAA 1S7YA 3CVGA 3CIJA 5I57A 3PMVA 4OZ9A 4QFPA 4ZZAA 3P7IA 3QUFA 4N6PA 1P1UA 2AL4A 1MXUA 1ZKBA 1YTVA 2DVCA 2XXVA 4NWCA 4NF5B 4XKRA 1JW4A 3LSXA 4EDPA 3KJ7A 3UN6A 3MP1A 2F6PA 3EQ1A 3RTFB 4GVOA 3TFLA 3RPWA 1JETA 4ZEIA 2NXOA 3MVXA 1GR2A 4GQOA 2H25A 4F1VA 1M5FA 3CRBA 3TTRA 3C36A 5I59B 3D4CA 2UVHA 3DELB 3EHUA 4G68A 4U4SA 1SYHA 4UACA 3FD3A 2PYYA 3GBAA 4KPTA 2RINA 2D21A 1J1NA 3A3CA 2VHAA 4KHZE 3PMWA 2DXYA 3GLBA 1FTOA 4N07A 3KG2A 4ZEBA 2V25A 1FQBA 3H3GA 3T66A 3FASA 1LB9A 4RK9A 4I62A 5L8DA 2P0SA 3V83A 2QMXA 1MXYA 4EF1A 1IQ7A 2DWJA 3TTNA 1MM7A 4F29A 1US5A 1EU8A 2ZNSA 3L6HA 4JSDA 1Y1ZA 1N7WA 4NF6A 1IXHA 1VFDA 3T9XB 1ZU0A 1UTHA 1JVXA 1HSEA 3HCQA 3WAEA 4Q8RA 5L9SA 1N7XA 2O7UA 3T96B 1LAXA 2XXPA 4WKMA 3UP9A 4BDRA 3PPNA 2HZKA 4ELOA 2Q89A 1XOCA 5K2XA 3SEUA 1JEVA 2UVGA 1B7HA 1B3FA 1URSA 4NF8A 1NNTA 3KOTA 4OESA 2NOOA 3HN0A 3PPPA 4H65A 1IEJA 1GTKA 1CE2A 5H8HB 4WEDA 1YPNA 3H06B 2F6GA 3KN3A 4DIGA 2HFBA 3VFJA 3FUZA 1AMFA 4LZ7A 3UGWA 4ZEDA 4FEBA 2OWTA 1H45A 3B7DA 3MZBA 1LB8A 3S9EA 3O6HA 1A54A 3K1MA 3MPLA 3S9NC 3IB1A 2A5TA 1IIWA 5EYFA 4ZDMA 3U93A 1ATGA 3ECRA 5I2KA 1CB6A 1P1OA 3OXNA 2Y84A 1FQDA 3MW0A 2XXXA 4ZEFA 3TCGA 4F3PA 1QKBA 2THIA 4AB6A 3DP6A 3C35A 3MP6A 1B4HA 2A5SA 4YMAA 1FQAA 4N13A 3VLVA 4KFQA 3IX1A 3PMXA 4XXUA 1AL3A 1LFIA 2M8CA 2ONKE 4LZ8A 3M3KA 4FATA 3VVEA 1VFEA 1NH8A 1H44A 3JV9A 2V93A 3QSLA 4DE8A 4QFLA 1I6AA 2Q2CA 1FQEA 2XXWA 2QS2A 5I56A 5DEXB 1SI0A 3W15C 1IZ1A 2PBWA 4MF3A 4ECFA 5FHMA 3IK6B 3MZ9A 3UK4A 2VP1A 1RKMA 2B3FA 4LATA 4HTGA 4OMBA 5TP9A 3S9MC 4FAJA 3KSJA 2B3BA 4P11A 1ZJLA 3L6GA 4HCWA 4EF2A 2V3UA 5AA2A 1OQGA 3CSGA 4IO7A 3G3FA 1M5CA 5DTBA 4IGRA 4F18A 4PE5B 3Q27A 4GXSB 4JXIA 3OO7A 1MPBA 5KZTA 1JEUA 2H99A 3PUZE 2ZMBA 1MQHA 1R1NA 2FNCA 2XX9A 4X1BA 4POWA 2O84X 3O66A 2CZLA 2DOJA 1B58A 4H1XA 1JNFA 4PQJA 1PC3A 3KGCA 1N76A 3QYTA 1XVXA 4JDFA 3PUWE 1I69A 2GRVA 2F36A 3E9XA 2DE2A 5I2NB 3V8XB 4TLMB 4EQ7A 5KCJB 1LFGA 3A09A 3S2VA 1B5IA 1NMUA 4O3CA 5A5XB 1PEBA 3HHFA 2Y7KA 1PBQA 2OJTA 1XHYA 1WDNA 1QW0A 4IO6A 4KYSA 2DP8A 3T9HB 4H67A 4OENA 2ZNTA 2ZNUA 1HSJA 2G29A 1R6ZA 5I58A 3FJMA 3C4MA 1P1WA 3IOTA 2HCAA 2QL3A 3C33A 3Q29A 4OFOA 5ITPA 1OQHA 2UXAA 1ELJA 5KCJA 2UVJA 4I8CA 4EQ9A 3FGSA 4EXKA 3FIRA 3N94A 3F11A 1GV8A 4ZEKA 3QAXA 3CSBA 1QJMA 1US4A 4R73A 4THIA 4HW8A 3KN8A 1FCKA 2G93A 4LVQA 3TCFA 2HZLA 3K00A 4I9DA 2DE4A 1ZLQA 5AA4B 5BUUA 1AH5A 1D4NA 1LGBC 4OFJA 3T93B 1UTBA 5LOMA 4EUOA 1B0LA 3HPIA 3IORA 4R75A 2F35A 1URDA 1QUJA 2DXRA 4YB6A 3K02A 2F7BA 4MFIA 3C31A 5I57B 5DT6A 3TQWA 5FTHA 1MQGA 3C9HA 4XTCQ 3THIA 4LQ5A 1N3XA 4YKJA 3E3KA 2YJPA 4P0GA 4F39A 4AB5A 5CM6A 3V89B 5FTIA 5IKBA 4POXA 2ONSA 1Y20A 4H8IA 1SW2A 3R26A 3LSLA 1JW1A 5JTYA 2ZYKA 4PFWA 3MQ9A 2DWHA 2O6AA 2R71A 1A99A 1JVYA 4R9FA 1M5BA 3O9PA 2ALUA 1B5JA 4RPOA 4JB7A 1USYE 1Y4CA 3H4ZA 4PETA 1PB8A 1D9YA 3OENA 5H8NA 3R6UA 5AE4A 4OEVA 4X9TA 3VV5A 4XKNA 3RN8A 2YPNA 3SEWA 4C1TA 3UORA 1AOVA 4G68B 4IY5A 4L17A 1VR5A 1B6HA 3H6VA 5IAIA 4KCCA 1TWYA 1O63A 4ELPA 1FTMA 5J1DA 3N26A 1B3LA 1B7ZA 1H76A 3UA8A 2F97A 4PFYA 1WODA 1FW0A 1MQJA 1B5HA 2PVUA 3IO6A 3LR1A 4ELRA 4IO4A 4ZE8A 1TT1A 4H5GA 5ITOA 1FTJA 4IB2A 3W9VA 1VSOA 2PMSA 4H6DA 3CR9A 1USYH 3H6WA 3OELA 4OXVA 4LA9A 2P1SA 4NF6B 3O28A 1MXXA 1UTHB 4OEUA 4E0WA 1FQCA 5F1QA 4KR5A 4IO2A
chains in the Genus database with same CATH superfamily
4OHNA 2I3WA 3RT8A 2UYFA 1MXWA 3I5OA 3TYHA 1GGGA 3DM0A 4QHQA 4JWOA 1SW5A 4PAKA 1NV7A 4OFLA 2QSXA 4U1OA 3SEYA 3OO8A 2O7IA 3KZGA 4GX4A 1DCUA 2ABHA 4NF8B 2W7YA 1SDXA 2WBDA 1SW4A 3D4GA 2OLBA 1LCTA 5I84A 1NI9A 4FJPA 1TFDA 1ZMGA 5H8SA 1LBBA 5TPAB 3MVWA 3USDA 2FA7A 4RYAA 3K6XA 2FHYA 4FBPA 4NMYA 2GHAA 1POY1 1I6QA 3VVDA 4G8HA 3KEIA 2OX3A 4DCYA 2Z8FA 4F3GA 3G3IA 2AL5A 3H6TA 4GBWA 3ZKLA 4ZZEA 4H45A 4QXDA 4YKKA 5ELVA 4NF4A 4DDDA 3IOVA 2I6EA 4HS7A 3Q26A 4P47A 1MY2A 3G3GA 1MY1A 2A5TB 2VD3A 4GOTA 3T9UA 4FORA 3TKDA 2ANJA 5HM4B 4ND9A 4F1YA 2D5WA 1IXGA 5CMMA 2Y7WA 5TPAA 4WEPA 3ROJA 5I2KB 3MVZA 5EQ9A 4MHFA 2DE3A 4TLLB 3TTMA 1H43A 3BKIB 2FYIA 5IZ1A 1DOTA 3ISPA 2O1MA 3SEVA 5H8FA 1PDAA 3G7WA 4MAGA 2FVZA 1M5DA 3MC2A 2I0BA 3I3VA 1NV5A 3Q25A 1NUYA 3CFLA 1IITA 4FEDA 1H3DA 3MJNA 3EHSA 1IMEA 4XKQA 1LAGE 4P1LA 4NEDA 5CMKA 1LAHE 2UYEA 3Q28A 2XXTA 3M3FA 4PFBA 3B6TA 4GWWA 1NNKA 4YKIA 4NWDA 1OMPA 5CMCA 3LSFB 4RA1A 5I56B 4QF9A 4GL0A 3SKPA 4TQUQ 2QVRA 2CMOA 1YZ0A 5F7VA 4Z7EA 4MBPA 4Q0CA 3VXCA 3RNNA 2Q9TA 5TP9B 4DZ1A 3MBPA 3RGYA 2QMWA 4FIMA 4X8RA 1SQYA 2OBGA 4R9GA 3OEMA 1B32A 3MSTA 3W9WA 4H8JA 3K6WA 3N6TA 4OQOA 1T0KA 3PUXE 5AA2B 3CI8A 1Y3QA 4KQPA 2RCAA 1D3KA 2OWSA 2E1SA 3FJ7A 3DP8A 4GIZA 4O3AA 3KJTA 5CI5A 1LCFA 5EHSA 1QUKA 2V3TA 1KA0A 5CMBA 3PU5A 2QPQA 1A55A 4U23A 5AA2D 4GWZA 4MJOA 1Z7ME 2WBBA 4EXLA 5BWJA 3S4UA 4N8YA 3FZVA 3TAJA 4O3BA 1B05A 3FV1A 4WXJA 4U22A 4U2RA 3QK6A 1FPBA 3EN3A 1L5TA 3VLWA 2V84A 3PPOA 4GRKA 2V4CA 4H5FA 5H8QA 4TOZA 2PT2A 2CZIA 3MAMA 3PPRA 4XIGQ 3IOUA 1Y3NA 5B70A 5DVFA 2ZYMA 1O7TA 1RYOA 3T22A 4G4PA 4ESWA 4MLQA 3AXFA 1B1XA 4BDMA 4DI3D 3I6VA 3HSTA 3O6GA 1YCJA 4RNSA 1YAEA 1NKXA 2IEEA 3QUJA 4GD5A 2ESNA 3QIMA 1M5EA 1BK4A 3FXQA 2V3QA 2XXUA 5I58B 4F19A 4OVSA 4NG7A 1EH3A 3U94A 4IO5A 2PFYA 3CFXA 5EHMA 2P2AA 4OETA 1N0TA 1LSTA 2MKZA 1F9BA 1Q1KA 2QS3A 1QVSA 4JBZA 1HSLA 2F7AA 2RC7A 4P1EA 3M3LA 4F1UA 1URGA 1FBGA 3TTKA 4GWUA 4ZE9A 5AA3A 5ICQA 1MS7A 5ISUA 3KSXA 1P1NA 2VPNA 2Y5LA 3G3JA 2DVZA 4OVTA 3ONMA 1O64A 1B40A 1NNFA 1IXCA 4OVJA 4QRZA 3FXRA 2Q88A 1UTBB 1PB9A 4JVIA 2QFLA 1MXVA 4JSOA 1IUDA 2XXRA 1P1QA 3HO7A 4R6KA 4P0IA 1MDP1 5ESYA 3TMGA 1Y1MA 4G68C 2I49A 5AA1A 3RQTA 3MYUA 4GX6A 3LBSA 4MLVA 2O68A 5EQ7A 4RK2A 4P3LA 4GWXA 1B3EA 2QS1A 4NF0A 3VLUA 5KDTA 3N6UA 2RCBA 1SYIA 5M2VA 5FHOA 1N04A 4PFIA 4DCXA 3ZS6A 1FQFA 4KD5A 4NN3A 1SPIA 4GXAA 3FVOA 4H0WA 3R7XA 1A8EA 3T9VA 4Z0IA 4N91A 4BDNA 2R8TA 3OSRA 3SEXA 5JTYB 2RC9A 3B6QA 2I3VA 1QUIA 2IA4A 1QULA 2QJEA 3TDJA 4PP0A 2CEXA 1BIYA 2F8DA 3GYYA 1NNPA 3DLNA 4QBAA 3BFUA 4GF8A 5H8NB 3B8BA 3PUVE 1S9TA 1LBXA 3O6IA 5B7DA 2DDKA 2I58A 4JWYA 4QSEA 4KYDA 3G3HA 3ODBA 3VXBA 3MPKA 1DTZA 4PFUA 2XWIA 1S50A 2XWOA 4PBHA 4EQBA 2HXRA 3EPEA 4RPNA 1BLFA 1EYKA 4ONYA 1DTGA 3KFMA 1B1HA 1LFHA 4U21A 4UABA 2NUVA 2Z8EA 2I4CA 4IGTA 3CG3A 3G3KA 2VD2A 3RT6B 4HCYA 4H46A 4R74A 4NE4A 4PF8A 2RKMA 4GL8A 1SVXB 3K4UA 1ZIUA 4AS5A 2B65A 4OVQA 4Q5TA 2L5VA 3TEPA 2H5YA 4R6HA 5ET6A 2HXWA 1MQDA 3GBBA 5EQ8A 1RYXA 5LDZA 2XWVA 5ET7A 1I6BA 4ZS9A 3TTLA 4YICA 2HQ0A 1DMBA 2ZZWA 1SW1A 4PCDA 1Q35A 3K1PA 2XA5A 3GXAA 5TU0A 2QVUA 1LBCA 4DXBA 4QFOA 2DS9A 1PB7A 3K0VA 4Q30B 2I0CA 4R2FA 2GFEA 1B3HA 3OSQA 4GBVA 4G8NA 4MNIA 2DYXA 2ZZVA 4IR8A 3KN7A 1SBPA 4KI0E 3FV2A 3FVNA 2F3BA 1D9QA 2RC8A 1CNQA 2NVUB 4ZECA 1OVBA 3PV0E 1EZ9A 1NUXA 4NF5A 1XVYA 1IMBA 3TELA 3U72A 4MNCA 1UIVA 3S9LC 4GFRA 4NAPA 1FRPA 1PBPA 4MH5A 3GZGA 4OERA 3E78A 1NV2A 3B6WA 4G2ZA 1KWHA 1FTKA 5CBSA 2ZXTA 5IZ3A 4NF4B 2VT5A 2Z8DA 3ZKKA 4BLAA 4PFTA 2X7QA 5I59A 4HE1A 3EHTA 3ILUB 2Z23A 2Y5KA 1NV4A 3K2DA 1II5A 1XT8A 1OLCA 1ZTYA 1JQFA 2VGQA 2VOZA 1ANFA 1OVTA 1XI6A 4DXUA 3N5LA 1SD3A 1IXIA 4YKPA 3CHGA 3OEKA 1FPDA 2LAOA 4O94A 4OWDA 4PGPA 5H8FB 3SESA 2DWIA 3LC8A 3MZ1A 1R9LA 2OCUA 4IY6A 1MPDA 1MDQA 3FVGA 3QMFA 4GLIA 1A7LA 3CG1A 1Y4TA 3LSWA 1B3GA 1YXIA 4JWXA 2UVIA 4P56A 4GWYA 1MY4A 1NH7A 4BDLA 1FPEA 1XC1A 2ONRA 4R6YA 2XX7A 1B7UA 1B4ZA 1ZBMA 4DI4B 3BFTA 3MP8A 1EZPA 2H4IA 4KCDA 2XD2A 3OO9A 4I3EA 4LONB 5L9MA 1VE4A 2XXKA 3OD7A 2Y7IA 5DYHA 3U92A 3C32A 2OK2A 1AIVA 4BDOA 1NFTA 4N4UA 4P9KA 2H98A 3SDFA 3UIFA 1NV0A 1BTJA 3PUYE 1TXFA 1LEVA 1P99A 3H7MA 1UQWA 1MH3A 4R72A 3OO6A 4PF6A 5I3SA 2Z22A 1DSNA 3T1BA 3E4RA 3A3UA 1EZOA 1NL5A 4LZ5A 3RY3A 1B52A 3OMBA 5A5LA 2PFZA 3VVFA 2WYKA 4LP2B 1B0HA 2PT1A 3FVKA 3ILTB 5IM2A 5H8HA 4G8MA 3BBRA 1Y9UA 2JJKA 4DLDA 2REGA 1YYZA 2XX8A 2F7CA 2Q8JA 2GHBA 5K2YA 4C0RA 2BJJX 1UIUA 3KBRA 1OLAA 3E79A 3IAZA 1SI1A 2HAUA 4YB5A 3PD8A 1BP5A 3PPQA 4LQ2A 2B4MA 3RTWB 3HV1A 1K9ZA 4N6KA 2F78A 3V5AA 2R6GE 3KOSA 5HBCA 3TQLA 3JZJA 4F3BA 2F5XA 2QRYA 3IB2A 4GX3A 5H8QB 1R9QA 1FJ6A 1IMCA 1MQIA 4R2BA 2AYSA 3C34A 4I3YA 4NTLA 3IL1B 4C1UA 1MG1A 4ESXA 3IO4A 2Y7PA 2KR0A 4F2QA 1G0IA 2RF1A 1FPLA 2PCRA 5JEIA 3O29A 3TPAA 2XXYA 3K6VA 3RLFE 1WVJA 3O2AA 2Q2AA 3M8UA 3CFZA 4X1DA 4QSCA 3MWBA 5JK4A 2QS4A 4RY1A 5FHNA 4NX1A 1B2HA 4QFNA 2Y7RA 2QVVA 4N15A 3U8QA 3EF7A 2OZZA 1MRPA 4FE8A 4F22A 5DEXA 4G77A 4M1VA 2HEUA 4KYEA 4YZZA 1D9VA 1FBHA 1POTA 1G0HA 4RXLA 3K01A 3O97A 1MXZA 2DQVA 2HAVA 3TCHA 4U4XA 3SETA 4PFRA 3MVYA 2X7PA 4AQ4A 1GVCA 5ICTA 1FTLA 1XS5A 4NQ8A 2ZYNA 2H9BA 3FATA 2KQZA 3IR1A 4PDDA 4UA8A 3K1NA 3IB0A 4E0XA 3OOAA 2HHMA 2KLFA 3IJXB 4U1ZA 1B9JA 5KDTB 2E0SA 3PGFA 3VE1B 1Z7NE 1LAFE 3H03A 2O51A 1FTAA 2F34A 3DP4A 5CRYA 3FJGA 4GWOA 4YB7A 1MY0A 2I4BA 1LLSA 1MM6A 4M4GA 2X26A 3TODA 2I48A 4MIJA 4QSDA 4XKPA 5I2NA 2DSFA 3BIGA 3H6UA 4QFKA 4OTEA 2ZYOA 4DXCA 4I40A 2XXIA 3MUQA 4ELQA 5J16A 3VDFA 3ZSFA 2F3DA 5A5XA 4F3SA 2GQ1A 4YAHX 2FIXA 3RUMA 3U1OA 1QKAA 2O69A 1A8FA 3SERA 3JYRA 2REJA 4N81A 1MPCA 3HFUA 3IJOB 1N3WA 2CZHA 2NWJA 4IO3A 2AIXA 3FXUA 1K9YA 4ISUA 5HPQA 2D3IA 1IMDA 5DVJA 1B46A 4GWSA 3PD9A 4OYVA 1LBZA 4RJZA 2DWAA 4YMBA 2XD3A 5DVIA 1N84A 1OIBA 4MMPA 4I1DA 1A40A 5CBRA 5I5PA 3K6UA 4YU0A 4F2OA 4XF5A 3IOWA 5ET8A 1KA1A 2O1LA 3HHGA 1BKAA 5FBPA 1DPPA 3RYDA 2XXQA 4PE3A 3TZAA 1NUZA 3E13X 4X48A 2YLNA 5L9OA 3LUYA 1Y3PA 1JP4A 2PX1A 2XXHA 4LUBA 1MH4A 2R9JA 3QXMA 5AA4A 4F31B 4FECA 1JW5A 4BDQA 3TUSA 2HPGA 1B51A 2WKYA 1DPEA 1MY3A 5CC2A 2GH9A 4N6DA 2XHDA 3WAFA 4K3FA 1TFAA 1S7YA 3CVGA 3CIJA 5I57A 3PMVA 4OZ9A 4QFPA 4OVRA 5IZZA 4ZZAA 3P7IA 3QUFA 4N6PA 1P1UA 2AL4A 1MXUA 1ZKBA 1YTVA 2DVCA 4PGNA 2XXVA 4NWCA 4NF5B 4XKRA 1JW4A 3LSXA 4EDPA 3KJ7A 4X04A 3UN6A 3MP1A 2F6PA 3EQ1A 3RTFB 3B50A 2P3NA 4GVOA 3TFLA 3RPWA 1QGXA 1JETA 4ZEIA 2NXOA 4MCOA 3MVXA 1GR2A 4GQOA 2H25A 4N17A 5IZ3B 1M5FA 4F1VA 3BIHA 3CRBA 3TTRA 3C36A 5I59B 3D4CA 2UVHA 3KC1A 3DELB 3EHUA 4G68A 1FBDA 4U4SA 1SYHA 4UACA 3FD3A 2PYYA 3GBAA 4KPTA 2RINA 2D21A 1J1NA 2BJIA 3A3CA 5LTCA 2VHAA 3FXBA 5EQAA 4KHZE 3PMWA 2DXYA 3GLBA 1FTOA 4PC9A 4N07A 1LBVA 3KG2A 5I7IA 4O7IA 4ZEBA 2V25A 1FQBA 3H3GA 3T66A 3FASA 1LB9A 4RK9A 4I62A 5L8DA 2P0SA 3V83A 2QMXA 1MXYA 3LUZA 4EF1A 1IQ7A 2DWJA 3TTNA 1MM7A 4PBQA 4F29A 1US5A 1EU8A 2ZNSA 3L6HA 4JSDA 1Y1ZA 1N7WA 4NF6A 1IXHA 1VFDA 3T9XB 1VDWA 1ZU0A 1UTHA 4OVPA 1JVXA 1HSEA 3HCQA 3WAEA 4Q8RA 5L9SA 1N7XA 2O7UA 4PTKA 3RPLA 3T96B 1LAXA 2XXPA 4WKMA 3UP9A 4BDRA 3PPNA 2HZKA 1RDZA 4HE2A 4ELOA 2Q89A 2CZKA 1XOCA 5K2XA 1NV3A 1Q9DA 3SEUA 2XWKA 1JEVA 2UVGA 1B7HA 1B3FA 1URSA 4NF8A 1NNTA 3KOTA 4OESA 4KXPA 2NOOA 3HN0A 3PPPA 4H65A 1IEJA 1GTKA 1CE2A 5H8HB 4WEDA 1FPKA 1YPNA 3H06B 2F6GA 3KN3A 4DIGA 2HFBA 3VFJA 3FUZA 1AMFA 4LZ7A 3UGWA 4ZEDA 4FEBA 2OWTA 3IFAA 1H45A 3B7DA 3MZBA 1LB8A 3S9EA 3O6HA 1A54A 3K1MA 3MPLA 5ET5A 1FBPA 3S9NC 3IB1A 2A5TA 1IIWA 1NV6A 5EYFA 4ZDMA 4NHBA 3U93A 1ATGA 3ECRA 5I2KA 3FBPA 1CB6A 1P1OA 3OXNA 2Y84A 1FQDA 3MW0A 4N8GA 2XXXA 4ZEFA 3TCGA 4F3PA 3PTYA 1EYIA 1QKBA 2THIA 4AB6A 3DP6A 3C35A 1KZ8A 3MP6A 1B4HA 4O8MA 2A5SA 4YMAA 1FQAA 4N13A 3VLVA 4KFQA 3IX1A 3PMXA 4XXUA 1AL3A 4JVCA 1LFIA 2M8CA 2ONKE 4LZ8A 3M3KA 4FATA 3VVEA 1VFEA 1NH8A 1H44A 3JV9A 2V93A 3QSLA 4PAIA 2Q8MA 4DE8A 4QFLA 1I6AA 2Q2CA 1FQEA 1FPIA 2XXWA 2QS2A 5I56A 5DEXB 1SI0A 2FBPA 4PAFA 3W15C 1IZ1A 2PBWA 4MF3A 4O7MA 4ECFA 5FHMA 3IK6B 3MZ9A 4LN5A 3UK4A 2VP1A 1RKMA 2B3FA 4LATA 4HTGA 4OMBA 5TP9A 4NGUA 4MX6A 5T3JA 3S9MC 4FAJA 3KSJA 2B3BA 4P11A 1RDXA 3EKIA 1ZJLA 3L6GA 4HCWA 4EF2A 2V3UA 5AA2A 1OQGA 3CSGA 4IO7A 3G3FA 1M5CA 5DTBA 4IGRA 4F18A 4PE5B 3Q27A 4GXSB 4JXIA 3OO7A 1MPBA 4P8BA 5KZTA 1JEUA 2H99A 3PUZE 2ZMBA 1MQHA 1R1NA 1FPFA 2FNCA 2XX9A 4X1BA 4POWA 1AWBA 2O84X 3O66A 2CZLA 2DOJA 3KC0A 1B58A 4H1XA 1JNFA 4PQJA 4JVDA 1PC3A 3KGCA 1N76A 3QYTA 1XVXA 4JDFA 3PUWE 1I69A 2GRVA 2F36A 1DK4A 3E9XA 2DE2A 5I2NB 3V8XB 4TLMB 1LBYA 4EQ7A 5KCJB 1LFGA 3A09A 3S2VA 1B5IA 1NMUA 4O3CA 4MNPA 2VPOA 5A5XB 1PEBA 3HHFA 2Y7KA 1PBQA 2OJTA 1XHYA 1WDNA 1QW0A 4IO6A 4KYSA 2DP8A 3T9HB 4H67A 4OENA 4PDHA 2ZNTA 1FPGA 2ZNUA 1HSJA 2G29A 1R6ZA 5I58A 3FJMA 3C4MA 1P1WA 3IOTA 2HCAA 2QL3A 3C33A 4G61A 3Q29A 4OFOA 5ITPA 1OQHA 2UXAA 1ELJA 3IFCA 5KCJA 2UVJA 4I8CA 4EQ9A 3FGSA 3U65A 1FPJA 4EXKA 3FIRA 5EYGA 3N94A 3F11A 1GV8A 4ZEKA 3QAXA 2WYPA 3CSBA 1QJMA 1US4A 4HE0A 4R73A 4THIA 4HW8A 1FBFA 3KN8A 4LVQA 1FCKA 2G93A 3TCFA 2HZLA 3K00A 5EYHA 3A29A 4I9DA 2DE4A 1ZLQA 5AA4B 5BUUA 1AH5A 1D4NA 1LGBC 4OFJA 3T93B 1UTBA 5LOMA 4EUOA 5DW8A 1B0LA 3HPIA 3IORA 3LV0A 4R75A 2F35A 1URDA 1QUJA 2DXRA 4YB6A 2Q74A 3K02A 2F7BA 1IMFA 4MFIA 3C31A 5I57B 5DT6A 2OWZA 3TQWA 5FTHA 1MQGA 3C9HA 2WX9A 4XTCQ 3THIA 4AS4A 4LQ5A 1N3XA 4YKJA 1NV1A 2WEFA 3E3KA 2YJPA 4P0GA 2CEYA 4F39A 1FBCA 4AB5A 5CM6A 3V89B 2P3VA 5FTIA 5IKBA 4POXA 4XFEA 2ONSA 1Y20A 4H8IA 1INPA 1SW2A 3KBZA 3R26A 3LSLA 1JW1A 5JTYA 2ZYKA 4PFWA 3MQ9A 3D1RA 2DWHA 3NOHA 2O6AA 2R71A 1A99A 1JVYA 4R9FA 1M5BA 3O9PA 2ALUA 1B5JA 4RPOA 4JB7A 1USYE 1Y4CA 1FJ9A 3H4ZA 4PETA 1PB8A 1D9YA 3OENA 5H8NA 3R6UA 5AE4A 4OEVA 4X9TA 3VV5A 4XKNA 3RN8A 2YPNA 3SEWA 4C1TA 3UORA 1AOVA 4G68B 4IY5A 4L17A 1VR5A 1B6HA 3H6VA 1NUWA 5IAIA 4KCCA 1TWYA 1O63A 1FBEA 4XEQA 1EYJA 4ELPA 1FTMA 5J1DA 3N26A 1B3LA 1B7ZA 1H76A 3UA8A 1IMAA 2F97A 4PFYA 1WODA 1FW0A 5F24A 1MQJA 1B5HA 2PVUA 2B4LA 2FIEA 3IO6A 4OANA 3LR1A 4ELRA 2ZZXA 4OA4A 4IO4A 4ZE8A 1TT1A 4H5GA 5ITOA 1FTJA 4IB2A 3W9VA 1VSOA 2PMSA 1FSAA 4H6DA 3CR9A 1USYH 3H6WA 3OELA 4OXVA 4LA9A 2P1SA 4NF6B 4HXVA 1RDYA 3O28A 1MXXA 1UTHB 4OEUA 4E0WA 4MEVA 1FQCA 3T0JA 3SZPA 1DBZA 5F1QA 4KR5A 1LBWA 4IO2A 5IGAA 3RPLB
chains in the Genus database with same CATH topology
4OHNA 2I3WA 3RT8A 2UYFA 1MXWA 3I5OA 3TYHA 1GGGA 3DM0A 4QHQA 4JWOA 1SW5A 4OFLA 2QSXA 4U1OA 3SEYA 3OO8A 2O7IA 3KZGA 2ABHA 4NF8B 2W7YA 1SDXA 1SW4A 3D4GA 2OLBA 1LCTA 5I84A 4FJPA 1TFDA 1ZMGA 5H8SA 1LBBA 5TPAB 3MVWA 3USDA 2FA7A 4RYAA 3K6XA 4NMYA 2GHAA 1POY1 1I6QA 3VVDA 4G8HA 3KEIA 4DCYA 2Z8FA 4F3GA 3G3IA 2AL5A 3H6TA 3ZKLA 4ZZEA 4YKKA 5ELVA 4NF4A 4DDDA 3IOVA 2I6EA 4HS7A 3Q26A 1MY2A 3G3GA 1MY1A 2A5TB 2VD3A 4GOTA 3T9UA 4FORA 3TKDA 2ANJA 5HM4B 4ND9A 4F1YA 2D5WA 1IXGA 5CMMA 2Y7WA 5TPAA 4WEPA 5I2KB 3MVZA 2DE3A 4TLLB 3TTMA 1H43A 3BKIB 2FYIA 1DOTA 2O1MA 3SEVA 5H8FA 1PDAA 3G7WA 1M5DA 3MC2A 2I0BA 3I3VA 3Q25A 3CFLA 1IITA 4FEDA 1H3DA 3MJNA 3EHSA 4XKQA 1LAGE 4NEDA 5CMKA 1LAHE 2UYEA 3Q28A 2XXTA 3M3FA 3B6TA 1NNKA 4YKIA 4NWDA 1OMPA 5CMCA 3LSFB 4RA1A 5I56B 4QF9A 4GL0A 3SKPA 4TQUQ 2CMOA 5F7VA 4Z7EA 4MBPA 4Q0CA 3VXCA 3RNNA 2Q9TA 5TP9B 4DZ1A 3MBPA 3RGYA 2QMWA 4FIMA 1SQYA 2OBGA 4R9GA 3OEMA 1B32A 3W9WA 4H8JA 3K6WA 3N6TA 4OQOA 1T0KA 3PUXE 5AA2B 3CI8A 1Y3QA 4KQPA 2RCAA 1D3KA 2OWSA 2E1SA 3FJ7A 3DP8A 4GIZA 4O3AA 3KJTA 5CI5A 1LCFA 5EHSA 1QUKA 2V3TA 5CMBA 3PU5A 2QPQA 1A55A 4U23A 5AA2D 1Z7ME 4EXLA 5BWJA 3S4UA 3FZVA 3TAJA 4O3BA 1B05A 3FV1A 4WXJA 4U22A 4U2RA 3QK6A 3EN3A 1L5TA 3VLWA 2V84A 3PPOA 4GRKA 4H5FA 5H8QA 4TOZA 2PT2A 3MAMA 3PPRA 4XIGQ 3IOUA 1Y3NA 5B70A 5DVFA 2ZYMA 1O7TA 1RYOA 3T22A 4G4PA 4ESWA 4MLQA 3AXFA 1B1XA 4BDMA 3I6VA 3HSTA 3O6GA 1YCJA 4RNSA 1YAEA 1NKXA 2IEEA 3QUJA 4GD5A 2ESNA 3QIMA 1M5EA 3FXQA 2V3QA 2XXUA 5I58B 4F19A 1EH3A 3U94A 4IO5A 3CFXA 5EHMA 2P2AA 4OETA 1N0TA 1LSTA 1F9BA 1Q1KA 2QS3A 1QVSA 4JBZA 1HSLA 2F7AA 2RC7A 3M3LA 4F1UA 1URGA 3TTKA 4ZE9A 5AA3A 5ICQA 1MS7A 5ISUA 3KSXA 1P1NA 3G3JA 2DVZA 3ONMA 1O64A 1B40A 1NNFA 1IXCA 4OVJA 4QRZA 3FXRA 2Q88A 1UTBB 1PB9A 1MXVA 4JSOA 1IUDA 2XXRA 1P1QA 3HO7A 4R6KA 4P0IA 1MDP1 3TMGA 1Y1MA 4G68C 2I49A 5AA1A 3RQTA 3LBSA 4MLVA 2O68A 4RK2A 1B3EA 2QS1A 3VLUA 5KDTA 3N6UA 2RCBA 1SYIA 5M2VA 5FHOA 1N04A 4DCXA 3ZS6A 1FQFA 4KD5A 4GXAA 3FVOA 4H0WA 3R7XA 1A8EA 3T9VA 4Z0IA 4BDNA 3OSRA 3SEXA 5JTYB 2RC9A 3B6QA 2I3VA 1QUIA 2IA4A 1QULA 2QJEA 3TDJA 4PP0A 1BIYA 2F8DA 1NNPA 3DLNA 3BFUA 4GF8A 5H8NB 3PUVE 1S9TA 3O6IA 5B7DA 2I58A 4JWYA 4QSEA 4KYDA 3G3HA 3ODBA 3VXBA 3MPKA 1DTZA 4PFUA 1S50A 4EQBA 3EPEA 4RPNA 1BLFA 4ONYA 1DTGA 3KFMA 1B1HA 1LFHA 4U21A 2NUVA 2Z8EA 2I4CA 4IGTA 3CG3A 3G3KA 2VD2A 3RT6B 4HCYA 4R74A 4NE4A 2RKMA 4GL8A 1SVXB 3K4UA 1ZIUA 2B65A 4Q5TA 3TEPA 2H5YA 4R6HA 2HXWA 1MQDA 3GBBA 1RYXA 1I6BA 4ZS9A 3TTLA 4YICA 2HQ0A 1DMBA 1SW1A 1Q35A 3K1PA 3GXAA 5TU0A 1LBCA 4DXBA 4QFOA 2DS9A 1PB7A 3K0VA 4Q30B 2I0CA 4R2FA 2GFEA 1B3HA 3OSQA 4G8NA 2DYXA 3KN7A 1SBPA 4KI0E 3FV2A 3FVNA 2RC8A 2NVUB 4ZECA 1OVBA 3PV0E 1EZ9A 4NF5A 1XVYA 3TELA 3U72A 1UIVA 3S9LC 4GFRA 1PBPA 4MH5A 3GZGA 4OERA 3B6WA 4G2ZA 1KWHA 1FTKA 5CBSA 2ZXTA 4NF4B 2Z8DA 3ZKKA 4BLAA 4PFTA 2X7QA 5I59A 3EHTA 3ILUB 2Z23A 3K2DA 1II5A 1XT8A 1OLCA 1ZTYA 1JQFA 2VGQA 2VOZA 1ANFA 1OVTA 4DXUA 3N5LA 1SD3A 1IXIA 4YKPA 3OEKA 2LAOA 4OWDA 5H8FB 3SESA 2DWIA 3LC8A 3MZ1A 1R9LA 2OCUA 4IY6A 1MPDA 1MDQA 3FVGA 4GLIA 1A7LA 3CG1A 1Y4TA 3LSWA 1B3GA 4JWXA 2UVIA 1MY4A 1NH7A 4BDLA 1XC1A 2ONRA 4R6YA 2XX7A 1B7UA 1B4ZA 1ZBMA 3BFTA 3MP8A 1EZPA 2H4IA 4KCDA 2XD2A 3OO9A 4LONB 5L9MA 1VE4A 3OD7A 2Y7IA 5DYHA 3U92A 3C32A 2OK2A 1AIVA 4BDOA 1NFTA 2H98A 3SDFA 3UIFA 1BTJA 3PUYE 1TXFA 1P99A 3H7MA 1UQWA 1MH3A 4R72A 3OO6A 2Z22A 1DSNA 3E4RA 3A3UA 1EZOA 1NL5A 4LZ5A 3RY3A 1B52A 3OMBA 3VVFA 4LP2B 1B0HA 2PT1A 3FVKA 3ILTB 5H8HA 4G8MA 3BBRA 1Y9UA 4DLDA 2REGA 2XX8A 2Q8JA 2F7CA 2GHBA 5K2YA 4C0RA 2BJJX 1UIUA 3KBRA 1OLAA 3IAZA 1SI1A 2HAUA 4YB5A 3PD8A 1BP5A 3PPQA 4LQ2A 3RTWB 3HV1A 2F78A 3V5AA 2R6GE 3KOSA 5HBCA 3TQLA 3JZJA 4F3BA 2F5XA 2QRYA 3IB2A 5H8QB 1R9QA 1MQIA 4R2BA 2AYSA 3C34A 4NTLA 3IL1B 4C1UA 1MG1A 4ESXA 3IO4A 2Y7PA 4F2QA 2RF1A 5JEIA 3O29A 3TPAA 2XXYA 3K6VA 3RLFE 1WVJA 3O2AA 2Q2AA 3M8UA 3CFZA 4X1DA 4QSCA 3MWBA 5JK4A 2QS4A 4RY1A 5FHNA 1B2HA 4QFNA 2Y7RA 3U8QA 3EF7A 2OZZA 1MRPA 4FE8A 4F22A 5DEXA 4G77A 4M1VA 2HEUA 4KYEA 4YZZA 1D9VA 1POTA 4RXLA 3K01A 3O97A 1MXZA 2DQVA 2HAVA 3TCHA 4U4XA 3SETA 3MVYA 2X7PA 4AQ4A 1GVCA 5ICTA 1FTLA 1XS5A 2ZYNA 2H9BA 3FATA 3IR1A 4UA8A 3K1NA 3IB0A 4E0XA 3OOAA 2KLFA 3IJXB 4U1ZA 1B9JA 5KDTB 2E0SA 3PGFA 3VE1B 1Z7NE 1LAFE 3H03A 2O51A 2F34A 3DP4A 5CRYA 3FJGA 4GWOA 4YB7A 1MY0A 2I4BA 1LLSA 1MM6A 4M4GA 2X26A 3TODA 2I48A 4QSDA 4XKPA 5I2NA 2DSFA 3H6UA 4QFKA 4OTEA 2ZYOA 4DXCA 2XXIA 3MUQA 4ELQA 3VDFA 3ZSFA 5A5XA 4F3SA 4YAHX 3RUMA 3U1OA 1QKAA 2O69A 1A8FA 3SERA 3JYRA 2REJA 1MPCA 3IJOB 1N3WA 2NWJA 4IO3A 2AIXA 3FXUA 4ISUA 5HPQA 2D3IA 5DVJA 1B46A 3PD9A 4OYVA 4RJZA 2DWAA 4YMBA 2XD3A 5DVIA 1N84A 1OIBA 4I1DA 1A40A 5CBRA 3K6UA 4YU0A 4F2OA 3IOWA 2O1LA 3HHGA 1BKAA 1DPPA 2XXQA 3TZAA 3E13X 4X48A 2YLNA 5L9OA 3LUYA 1Y3PA 2PX1A 2XXHA 4LUBA 1MH4A 2R9JA 3QXMA 5AA4A 4F31B 4FECA 1JW5A 4BDQA 3TUSA 1B51A 2WKYA 1DPEA 1MY3A 5CC2A 2GH9A 2XHDA 3WAFA 4K3FA 1TFAA 1S7YA 3CVGA 3CIJA 5I57A 3PMVA 4OZ9A 4QFPA 4ZZAA 3P7IA 3QUFA 4N6PA 1P1UA 2AL4A 1MXUA 1ZKBA 1YTVA 2DVCA 2XXVA 4NWCA 4NF5B 4XKRA 1JW4A 3LSXA 4EDPA 3KJ7A 3UN6A 3MP1A 2F6PA 3EQ1A 3RTFB 4GVOA 3TFLA 3RPWA 1JETA 4ZEIA 2NXOA 3MVXA 1GR2A 4GQOA 2H25A 4F1VA 1M5FA 3CRBA 3TTRA 3C36A 5I59B 3D4CA 2UVHA 3DELB 3EHUA 4G68A 4U4SA 1SYHA 4UACA 3FD3A 2PYYA 3GBAA 4KPTA 2RINA 2D21A 1J1NA 3A3CA 2VHAA 4KHZE 3PMWA 2DXYA 3GLBA 1FTOA 4N07A 3KG2A 4ZEBA 2V25A 1FQBA 3H3GA 3T66A 3FASA 1LB9A 4RK9A 4I62A 5L8DA 2P0SA 3V83A 2QMXA 1MXYA 4EF1A 1IQ7A 2DWJA 3TTNA 1MM7A 4F29A 1US5A 1EU8A 2ZNSA 3L6HA 4JSDA 1Y1ZA 1N7WA 4NF6A 1IXHA 1VFDA 3T9XB 1ZU0A 1UTHA 1JVXA 1HSEA 3HCQA 3WAEA 4Q8RA 5L9SA 1N7XA 2O7UA 3T96B 1LAXA 2XXPA 4WKMA 3UP9A 4BDRA 3PPNA 2HZKA 4ELOA 2Q89A 1XOCA 5K2XA 3SEUA 1JEVA 2UVGA 1B7HA 1B3FA 1URSA 4NF8A 1NNTA 3KOTA 4OESA 2NOOA 3HN0A 3PPPA 4H65A 1IEJA 1GTKA 1CE2A 5H8HB 4WEDA 1YPNA 3H06B 2F6GA 3KN3A 4DIGA 2HFBA 3VFJA 3FUZA 1AMFA 4LZ7A 3UGWA 4ZEDA 4FEBA 2OWTA 1H45A 3B7DA 3MZBA 1LB8A 3S9EA 3O6HA 1A54A 3K1MA 3MPLA 3S9NC 3IB1A 2A5TA 1IIWA 5EYFA 4ZDMA 3U93A 1ATGA 3ECRA 5I2KA 1CB6A 1P1OA 3OXNA 2Y84A 1FQDA 3MW0A 2XXXA 4ZEFA 3TCGA 4F3PA 1QKBA 2THIA 4AB6A 3DP6A 3C35A 3MP6A 1B4HA 2A5SA 4YMAA 1FQAA 4N13A 3VLVA 4KFQA 3IX1A 3PMXA 4XXUA 1AL3A 1LFIA 2M8CA 2ONKE 4LZ8A 3M3KA 4FATA 3VVEA 1VFEA 1NH8A 1H44A 3JV9A 2V93A 3QSLA 4DE8A 4QFLA 1I6AA 2Q2CA 1FQEA 2XXWA 2QS2A 5I56A 5DEXB 1SI0A 3W15C 1IZ1A 2PBWA 4MF3A 4ECFA 5FHMA 3IK6B 3MZ9A 3UK4A 2VP1A 1RKMA 2B3FA 4LATA 4HTGA 4OMBA 5TP9A 3S9MC 4FAJA 3KSJA 2B3BA 4P11A 1ZJLA 3L6GA 4HCWA 4EF2A 2V3UA 5AA2A 1OQGA 3CSGA 4IO7A 3G3FA 1M5CA 5DTBA 4IGRA 4F18A 4PE5B 3Q27A 4GXSB 4JXIA 3OO7A 1MPBA 5KZTA 1JEUA 2H99A 3PUZE 2ZMBA 1MQHA 1R1NA 2FNCA 2XX9A 4X1BA 4POWA 2O84X 3O66A 2CZLA 2DOJA 1B58A 4H1XA 1JNFA 4PQJA 1PC3A 3KGCA 1N76A 3QYTA 1XVXA 4JDFA 3PUWE 1I69A 2GRVA 2F36A 3E9XA 2DE2A 5I2NB 3V8XB 4TLMB 4EQ7A 5KCJB 1LFGA 3A09A 3S2VA 1B5IA 1NMUA 4O3CA 5A5XB 1PEBA 3HHFA 2Y7KA 1PBQA 2OJTA 1XHYA 1WDNA 1QW0A 4IO6A 4KYSA 2DP8A 3T9HB 4H67A 4OENA 2ZNTA 2ZNUA 1HSJA 2G29A 1R6ZA 5I58A 3FJMA 3C4MA 1P1WA 3IOTA 2HCAA 2QL3A 3C33A 3Q29A 4OFOA 5ITPA 1OQHA 2UXAA 1ELJA 5KCJA 2UVJA 4I8CA 4EQ9A 3FGSA 4EXKA 3FIRA 3N94A 3F11A 1GV8A 4ZEKA 3QAXA 3CSBA 1QJMA 1US4A 4R73A 4THIA 4HW8A 3KN8A 1FCKA 2G93A 4LVQA 3TCFA 2HZLA 3K00A 4I9DA 2DE4A 1ZLQA 5AA4B 5BUUA 1AH5A 1D4NA 1LGBC 4OFJA 3T93B 1UTBA 5LOMA 4EUOA 1B0LA 3HPIA 3IORA 4R75A 2F35A 1URDA 1QUJA 2DXRA 4YB6A 3K02A 2F7BA 4MFIA 3C31A 5I57B 5DT6A 3TQWA 5FTHA 1MQGA 3C9HA 4XTCQ 3THIA 4LQ5A 1N3XA 4YKJA 3E3KA 2YJPA 4P0GA 4F39A 4AB5A 5CM6A 3V89B 5FTIA 5IKBA 4POXA 2ONSA 1Y20A 4H8IA 1SW2A 3R26A 3LSLA 1JW1A 5JTYA 2ZYKA 4PFWA 3MQ9A 2DWHA 2O6AA 2R71A 1A99A 1JVYA 4R9FA 1M5BA 3O9PA 2ALUA 1B5JA 4RPOA 4JB7A 1USYE 1Y4CA 3H4ZA 4PETA 1PB8A 1D9YA 3OENA 5H8NA 3R6UA 5AE4A 4OEVA 4X9TA 3VV5A 4XKNA 3RN8A 2YPNA 3SEWA 4C1TA 3UORA 1AOVA 4G68B 4IY5A 4L17A 1VR5A 1B6HA 3H6VA 5IAIA 4KCCA 1TWYA 1O63A 4ELPA 1FTMA 5J1DA 3N26A 1B3LA 1B7ZA 1H76A 3UA8A 2F97A 4PFYA 1WODA 1FW0A 1MQJA 1B5HA 2PVUA 3IO6A 3LR1A 4ELRA 4IO4A 4ZE8A 1TT1A 4H5GA 5ITOA 1FTJA 4IB2A 3W9VA 1VSOA 2PMSA 4H6DA 3CR9A 1USYH 3H6WA 3OELA 4OXVA 4LA9A 2P1SA 4NF6B 3O28A 1MXXA 1UTHB 4OEUA 4E0WA 1FQCA 5F1QA 4KR5A 4IO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OHN A;  2I3W A;  3RT8 A;  2UYF A;  1MXW A;  3I5O A;  3TYH A;  1GGG A;  3DM0 A;  4QHQ A;  4JWO A;  1SW5 A;  4OFL A;  2QSX A;  4U1O A;  3SEY A;  3OO8 A;  2O7I A;  3KZG A;  2ABH A;  4NF8 B;  2W7Y A;  1SDX A;  1SW4 A;  3D4G A;  2OLB A;  1LCT A;  5I84 A;  4FJP A;  1TFD A;  1ZMG A;  5H8S A;  1LBB A;  5TPA B;  3MVW A;  3USD A;  2FA7 A;  4RYA A;  3K6X A;  4NMY A;  2GHA A;  1POY 1;  1I6Q A;  3VVD A;  4G8H A;  3KEI A;  4DCY A;  2Z8F A;  4F3G A;  3G3I A;  2AL5 A;  3H6T A;  3ZKL A;  4ZZE A;  4YKK A;  5ELV A;  4NF4 A;  4DDD A;  3IOV A;  2I6E A;  4HS7 A;  3Q26 A;  1MY2 A;  3G3G A;  1MY1 A;  2A5T B;  2VD3 A;  4GOT A;  3T9U A;  4FOR A;  3TKD A;  2ANJ A;  5HM4 B;  4ND9 A;  4F1Y A;  2D5W A;  1IXG A;  5CMM A;  2Y7W A;  5TPA A;  4WEP A;  5I2K B;  3MVZ A;  2DE3 A;  4TLL B;  3TTM A;  1H43 A;  3BKI B;  2FYI A;  1DOT A;  2O1M A;  3SEV A;  5H8F A;  1PDA A;  3G7W A;  1M5D A;  3MC2 A;  2I0B A;  3I3V A;  3Q25 A;  3CFL A;  1IIT A;  4FED A;  1H3D A;  3MJN A;  3EHS A;  4XKQ A;  1LAG E;  4NED A;  5CMK A;  1LAH E;  2UYE A;  3Q28 A;  2XXT A;  3M3F A;  3B6T A;  1NNK A;  4YKI A;  4NWD A;  1OMP A;  5CMC A;  3LSF B;  4RA1 A;  5I56 B;  4QF9 A;  4GL0 A;  3SKP A;  4TQU Q;  2CMO A;  5F7V A;  4Z7E A;  4MBP A;  4Q0C A;  3VXC A;  3RNN A;  2Q9T A;  5TP9 B;  4DZ1 A;  3MBP A;  3RGY A;  2QMW A;  4FIM A;  1SQY A;  2OBG A;  4R9G A;  3OEM A;  1B32 A;  3W9W A;  4H8J A;  3K6W A;  3N6T A;  4OQO A;  1T0K A;  3PUX E;  5AA2 B;  3CI8 A;  1Y3Q A;  4KQP A;  2RCA A;  1D3K A;  2OWS A;  2E1S A;  3FJ7 A;  3DP8 A;  4GIZ A;  4O3A A;  3KJT A;  5CI5 A;  1LCF A;  5EHS A;  1QUK A;  2V3T A;  5CMB A;  3PU5 A;  2QPQ A;  1A55 A;  4U23 A;  5AA2 D;  1Z7M E;  4EXL A;  5BWJ A;  3S4U A;  3FZV A;  3TAJ A;  4O3B A;  1B05 A;  3FV1 A;  4WXJ A;  4U22 A;  4U2R A;  3QK6 A;  3EN3 A;  1L5T A;  3VLW A;  2V84 A;  3PPO A;  4GRK A;  4H5F A;  5H8Q A;  4TOZ A;  2PT2 A;  3MAM A;  3PPR A;  4XIG Q;  3IOU A;  1Y3N A;  5B70 A;  5DVF A;  2ZYM A;  1O7T A;  1RYO A;  3T22 A;  4G4P A;  4ESW A;  4MLQ A;  3AXF A;  1B1X A;  4BDM A;  3I6V A;  3HST A;  3O6G A;  1YCJ A;  4RNS A;  1YAE A;  1NKX A;  2IEE A;  3QUJ A;  4GD5 A;  2ESN A;  3QIM A;  1M5E A;  3FXQ A;  2V3Q A;  2XXU A;  5I58 B;  4F19 A;  1EH3 A;  3U94 A;  4IO5 A;  3CFX A;  5EHM A;  2P2A A;  4OET A;  1N0T A;  1LST A;  1F9B A;  1Q1K A;  2QS3 A;  1QVS A;  4JBZ A;  1HSL A;  2F7A A;  2RC7 A;  3M3L A;  4F1U A;  1URG A;  3TTK A;  4ZE9 A;  5AA3 A;  5ICQ A;  1MS7 A;  5ISU A;  3KSX A;  1P1N A;  3G3J A;  2DVZ A;  3ONM A;  1O64 A;  1B40 A;  1NNF A;  1IXC A;  4OVJ A;  4QRZ A;  3FXR A;  2Q88 A;  1UTB B;  1PB9 A;  1MXV A;  4JSO A;  1IUD A;  2XXR A;  1P1Q A;  3HO7 A;  4R6K A;  4P0I A;  1MDP 1;  3TMG A;  1Y1M A;  4G68 C;  2I49 A;  5AA1 A;  3RQT A;  3LBS A;  4MLV A;  2O68 A;  4RK2 A;  1B3E A;  2QS1 A;  3VLU A;  5KDT A;  3N6U A;  2RCB A;  1SYI A;  5M2V A;  5FHO A;  1N04 A;  4DCX A;  3ZS6 A;  1FQF A;  4KD5 A;  4GXA A;  3FVO A;  4H0W A;  3R7X A;  1A8E A;  3T9V A;  4Z0I A;  4BDN A;  3OSR A;  3SEX A;  5JTY B;  2RC9 A;  3B6Q A;  2I3V A;  1QUI A;  2IA4 A;  1QUL A;  2QJE A;  3TDJ A;  4PP0 A;  1BIY A;  2F8D A;  1NNP A;  3DLN A;  3BFU A;  4GF8 A;  5H8N B;  3PUV E;  1S9T A;  3O6I A;  5B7D A;  2I58 A;  4JWY A;  4QSE A;  4KYD A;  3G3H A;  3ODB A;  3VXB A;  3MPK A;  1DTZ A;  4PFU A;  1S50 A;  4EQB A;  3EPE A;  4RPN A;  1BLF A;  4ONY A;  1DTG A;  3KFM A;  1B1H A;  1LFH A;  4U21 A;  2NUV A;  2Z8E A;  2I4C A;  4IGT A;  3CG3 A;  3G3K A;  2VD2 A;  3RT6 B;  4HCY A;  4R74 A;  4NE4 A;  2RKM A;  4GL8 A;  1SVX B;  3K4U A;  1ZIU A;  2B65 A;  4Q5T A;  3TEP A;  2H5Y A;  4R6H A;  2HXW A;  1MQD A;  3GBB A;  1RYX A;  1I6B A;  4ZS9 A;  3TTL A;  4YIC A;  2HQ0 A;  1DMB A;  1SW1 A;  1Q35 A;  3K1P A;  3GXA A;  5TU0 A;  1LBC A;  4DXB A;  4QFO A;  2DS9 A;  1PB7 A;  3K0V A;  4Q30 B;  2I0C A;  4R2F A;  2GFE A;  1B3H A;  3OSQ A;  4G8N A;  2DYX A;  3KN7 A;  1SBP A;  4KI0 E;  3FV2 A;  3FVN A;  2RC8 A;  2NVU B;  4ZEC A;  1OVB A;  3PV0 E;  1EZ9 A;  4NF5 A;  1XVY A;  3TEL A;  3U72 A;  1UIV A;  3S9L C;  4GFR A;  1PBP A;  4MH5 A;  3GZG A;  4OER A;  3B6W A;  4G2Z A;  1KWH A;  1FTK A;  5CBS A;  2ZXT A;  4NF4 B;  2Z8D A;  3ZKK A;  4BLA A;  4PFT A;  2X7Q A;  5I59 A;  3EHT A;  3ILU B;  2Z23 A;  3K2D A;  1II5 A;  1XT8 A;  1OLC A;  1ZTY A;  1JQF A;  2VGQ A;  2VOZ A;  1ANF A;  1OVT A;  4DXU A;  3N5L A;  1SD3 A;  1IXI A;  4YKP A;  3OEK A;  2LAO A;  4OWD A;  5H8F B;  3SES A;  2DWI A;  3LC8 A;  3MZ1 A;  1R9L A;  2OCU A;  4IY6 A;  1MPD A;  1MDQ A;  3FVG A;  4GLI A;  1A7L A;  3CG1 A;  1Y4T A;  3LSW A;  1B3G A;  4JWX A;  2UVI A;  1MY4 A;  1NH7 A;  4BDL A;  1XC1 A;  2ONR A;  4R6Y A;  2XX7 A;  1B7U A;  1B4Z A;  1ZBM A;  3BFT A;  3MP8 A;  1EZP A;  2H4I A;  4KCD A;  2XD2 A;  3OO9 A;  4LON B;  5L9M A;  1VE4 A;  3OD7 A;  2Y7I A;  5DYH A;  3U92 A;  3C32 A;  2OK2 A;  1AIV A;  4BDO A;  1NFT A;  2H98 A;  3SDF A;  3UIF A;  1BTJ A;  3PUY E;  1TXF A;  1P99 A;  3H7M A;  1UQW A;  1MH3 A;  4R72 A;  3OO6 A;  2Z22 A;  1DSN A;  3E4R A;  3A3U A;  1EZO A;  1NL5 A;  4LZ5 A;  3RY3 A;  1B52 A;  3OMB A;  3VVF A;  4LP2 B;  1B0H A;  2PT1 A;  3FVK A;  3ILT B;  5H8H A;  4G8M A;  3BBR A;  1Y9U A;  4DLD A;  2REG A;  2XX8 A;  2Q8J A;  2F7C A;  2GHB A;  5K2Y A;  4C0R A;  2BJJ X;  1UIU A;  3KBR A;  1OLA A;  3IAZ A;  1SI1 A;  2HAU A;  4YB5 A;  3PD8 A;  1BP5 A;  3PPQ A;  4LQ2 A;  3RTW B;  3HV1 A;  2F78 A;  3V5A A;  2R6G E;  3KOS A;  5HBC A;  3TQL A;  3JZJ A;  4F3B A;  2F5X A;  2QRY A;  3IB2 A;  5H8Q B;  1R9Q A;  1MQI A;  4R2B A;  2AYS A;  3C34 A;  4NTL A;  3IL1 B;  4C1U A;  1MG1 A;  4ESX A;  3IO4 A;  2Y7P A;  4F2Q A;  2RF1 A;  5JEI A;  3O29 A;  3TPA A;  2XXY A;  3K6V A;  3RLF E;  1WVJ A;  3O2A A;  2Q2A A;  3M8U A;  3CFZ A;  4X1D A;  4QSC A;  3MWB A;  5JK4 A;  2QS4 A;  4RY1 A;  5FHN A;  1B2H A;  4QFN A;  2Y7R A;  3U8Q A;  3EF7 A;  2OZZ A;  1MRP A;  4FE8 A;  4F22 A;  5DEX A;  4G77 A;  4M1V A;  2HEU A;  4KYE A;  4YZZ A;  1D9V A;  1POT A;  4RXL A;  3K01 A;  3O97 A;  1MXZ A;  2DQV A;  2HAV A;  3TCH A;  4U4X A;  3SET A;  3MVY A;  2X7P A;  4AQ4 A;  1GVC A;  5ICT A;  1FTL A;  1XS5 A;  2ZYN A;  2H9B A;  3FAT A;  3IR1 A;  4UA8 A;  3K1N A;  3IB0 A;  4E0X A;  3OOA A;  2KLF A;  3IJX B;  4U1Z A;  1B9J A;  5KDT B;  2E0S A;  3PGF A;  3VE1 B;  1Z7N E;  1LAF E;  3H03 A;  2O51 A;  2F34 A;  3DP4 A;  5CRY A;  3FJG A;  4GWO A;  4YB7 A;  1MY0 A;  2I4B A;  1LLS A;  1MM6 A;  4M4G A;  2X26 A;  3TOD A;  2I48 A;  4QSD A;  4XKP A;  5I2N A;  2DSF A;  3H6U A;  4QFK A;  4OTE A;  2ZYO A;  4DXC A;  2XXI A;  3MUQ A;  4ELQ A;  3VDF A;  3ZSF A;  5A5X A;  4F3S A;  4YAH X;  3RUM A;  3U1O A;  1QKA A;  2O69 A;  1A8F A;  3SER A;  3JYR A;  2REJ A;  1MPC A;  3IJO B;  1N3W A;  2NWJ A;  4IO3 A;  2AIX A;  3FXU A;  4ISU A;  5HPQ A;  2D3I A;  5DVJ A;  1B46 A;  3PD9 A;  4OYV A;  4RJZ A;  2DWA A;  4YMB A;  2XD3 A;  5DVI A;  1N84 A;  1OIB A;  4I1D A;  1A40 A;  5CBR A;  3K6U A;  4YU0 A;  4F2O A;  3IOW A;  2O1L A;  3HHG A;  1BKA A;  1DPP A;  2XXQ A;  3TZA A;  3E13 X;  4X48 A;  2YLN A;  5L9O A;  3LUY A;  1Y3P A;  2PX1 A;  2XXH A;  4LUB A;  1MH4 A;  2R9J A;  3QXM A;  5AA4 A;  4F31 B;  4FEC A;  1JW5 A;  4BDQ A;  3TUS A;  1B51 A;  2WKY A;  1DPE A;  1MY3 A;  5CC2 A;  2GH9 A;  2XHD A;  3WAF A;  4K3F A;  1TFA A;  1S7Y A;  3CVG A;  3CIJ A;  5I57 A;  3PMV A;  4OZ9 A;  4QFP A;  4ZZA A;  3P7I A;  3QUF A;  4N6P A;  1P1U A;  2AL4 A;  1MXU A;  1ZKB A;  1YTV A;  2DVC A;  2XXV A;  4NWC A;  4NF5 B;  4XKR A;  1JW4 A;  3LSX A;  4EDP A;  3KJ7 A;  3UN6 A;  3MP1 A;  2F6P A;  3EQ1 A;  3RTF B;  4GVO A;  3TFL A;  3RPW A;  1JET A;  4ZEI A;  2NXO A;  3MVX A;  1GR2 A;  4GQO A;  2H25 A;  4F1V A;  1M5F A;  3CRB A;  3TTR A;  3C36 A;  5I59 B;  3D4C A;  2UVH A;  3DEL B;  3EHU A;  4G68 A;  4U4S A;  1SYH A;  4UAC A;  3FD3 A;  2PYY A;  3GBA A;  4KPT A;  2RIN A;  2D21 A;  1J1N A;  3A3C A;  2VHA A;  4KHZ E;  3PMW A;  2DXY A;  3GLB A;  1FTO A;  4N07 A;  3KG2 A;  4ZEB A;  2V25 A;  1FQB A;  3H3G A;  3T66 A;  3FAS A;  1LB9 A;  4RK9 A;  4I62 A;  5L8D A;  2P0S A;  3V83 A;  2QMX A;  1MXY A;  4EF1 A;  1IQ7 A;  2DWJ A;  3TTN A;  1MM7 A;  4F29 A;  1US5 A;  1EU8 A;  2ZNS A;  3L6H A;  4JSD A;  1Y1Z A;  1N7W A;  4NF6 A;  1IXH A;  1VFD A;  3T9X B;  1ZU0 A;  1UTH A;  1JVX A;  1HSE A;  3HCQ A;  3WAE A;  4Q8R A;  5L9S A;  1N7X A;  2O7U A;  3T96 B;  1LAX A;  2XXP A;  4WKM A;  3UP9 A;  4BDR A;  3PPN A;  2HZK A;  4ELO A;  2Q89 A;  1XOC A;  5K2X A;  3SEU A;  1JEV A;  2UVG A;  1B7H A;  1B3F A;  1URS A;  4NF8 A;  1NNT A;  3KOT A;  4OES A;  2NOO A;  3HN0 A;  3PPP A;  4H65 A;  1IEJ A;  1GTK A;  1CE2 A;  5H8H B;  4WED A;  1YPN A;  3H06 B;  2F6G A;  3KN3 A;  4DIG A;  2HFB A;  3VFJ A;  3FUZ A;  1AMF A;  4LZ7 A;  3UGW A;  4ZED A;  4FEB A;  2OWT A;  1H45 A;  3B7D A;  3MZB A;  1LB8 A;  3S9E A;  3O6H A;  1A54 A;  3K1M A;  3MPL A;  3S9N C;  3IB1 A;  2A5T A;  1IIW A;  5EYF A;  4ZDM A;  3U93 A;  1ATG A;  3ECR A;  5I2K A;  1CB6 A;  1P1O A;  3OXN A;  2Y84 A;  1FQD A;  3MW0 A;  2XXX A;  4ZEF A;  3TCG A;  4F3P A;  1QKB A;  2THI A;  4AB6 A;  3DP6 A;  3C35 A;  3MP6 A;  1B4H A;  2A5S A;  4YMA A;  1FQA A;  4N13 A;  3VLV A;  4KFQ A;  3IX1 A;  3PMX A;  4XXU A;  1AL3 A;  1LFI A;  2M8C A;  2ONK E;  4LZ8 A;  3M3K A;  4FAT A;  3VVE A;  1VFE A;  1NH8 A;  1H44 A;  3JV9 A;  2V93 A;  3QSL A;  4DE8 A;  4QFL A;  1I6A A;  2Q2C A;  1FQE A;  2XXW A;  2QS2 A;  5I56 A;  5DEX B;  1SI0 A;  3W15 C;  1IZ1 A;  2PBW A;  4MF3 A;  4ECF A;  5FHM A;  3IK6 B;  3MZ9 A;  3UK4 A;  2VP1 A;  1RKM A;  2B3F A;  4LAT A;  4HTG A;  4OMB A;  5TP9 A;  3S9M C;  4FAJ A;  3KSJ A;  2B3B A;  4P11 A;  1ZJL A;  3L6G A;  4HCW A;  4EF2 A;  2V3U A;  5AA2 A;  1OQG A;  3CSG A;  4IO7 A;  3G3F A;  1M5C A;  5DTB A;  4IGR A;  4F18 A;  4PE5 B;  3Q27 A;  4GXS B;  4JXI A;  3OO7 A;  1MPB A;  5KZT A;  1JEU A;  2H99 A;  3PUZ E;  2ZMB A;  1MQH A;  1R1N A;  2FNC A;  2XX9 A;  4X1B A;  4POW A;  2O84 X;  3O66 A;  2CZL A;  2DOJ A;  1B58 A;  4H1X A;  1JNF A;  4PQJ A;  1PC3 A;  3KGC A;  1N76 A;  3QYT A;  1XVX A;  4JDF A;  3PUW E;  1I69 A;  2GRV A;  2F36 A;  3E9X A;  2DE2 A;  5I2N B;  3V8X B;  4TLM B;  4EQ7 A;  5KCJ B;  1LFG A;  3A09 A;  3S2V A;  1B5I A;  1NMU A;  4O3C A;  5A5X B;  1PEB A;  3HHF A;  2Y7K A;  1PBQ A;  2OJT A;  1XHY A;  1WDN A;  1QW0 A;  4IO6 A;  4KYS A;  2DP8 A;  3T9H B;  4H67 A;  4OEN A;  2ZNT A;  2ZNU A;  1HSJ A;  2G29 A;  1R6Z A;  5I58 A;  3FJM A;  3C4M A;  1P1W A;  3IOT A;  2HCA A;  2QL3 A;  3C33 A;  3Q29 A;  4OFO A;  5ITP A;  1OQH A;  2UXA A;  1ELJ A;  5KCJ A;  2UVJ A;  4I8C A;  4EQ9 A;  3FGS A;  4EXK A;  3FIR A;  3N94 A;  3F11 A;  1GV8 A;  4ZEK A;  3QAX A;  3CSB A;  1QJM A;  1US4 A;  4R73 A;  4THI A;  4HW8 A;  3KN8 A;  1FCK A;  2G93 A;  4LVQ A;  3TCF A;  2HZL A;  3K00 A;  4I9D A;  2DE4 A;  1ZLQ A;  5AA4 B;  5BUU A;  1AH5 A;  1D4N A;  1LGB C;  4OFJ A;  3T93 B;  1UTB A;  5LOM A;  4EUO A;  1B0L A;  3HPI A;  3IOR A;  4R75 A;  2F35 A;  1URD A;  1QUJ A;  2DXR A;  4YB6 A;  3K02 A;  2F7B A;  4MFI A;  3C31 A;  5I57 B;  5DT6 A;  3TQW A;  5FTH A;  1MQG A;  3C9H A;  4XTC Q;  3THI A;  4LQ5 A;  1N3X A;  4YKJ A;  3E3K A;  2YJP A;  4P0G A;  4F39 A;  4AB5 A;  5CM6 A;  3V89 B;  5FTI A;  5IKB A;  4POX A;  2ONS A;  1Y20 A;  4H8I A;  1SW2 A;  3R26 A;  3LSL A;  1JW1 A;  5JTY A;  2ZYK A;  4PFW A;  3MQ9 A;  2DWH A;  2O6A A;  2R71 A;  1A99 A;  1JVY A;  4R9F A;  1M5B A;  3O9P A;  2ALU A;  1B5J A;  4RPO A;  4JB7 A;  1USY E;  1Y4C A;  3H4Z A;  4PET A;  1PB8 A;  1D9Y A;  3OEN A;  5H8N A;  3R6U A;  5AE4 A;  4OEV A;  4X9T A;  3VV5 A;  4XKN A;  3RN8 A;  2YPN A;  3SEW A;  4C1T A;  3UOR A;  1AOV A;  4G68 B;  4IY5 A;  4L17 A;  1VR5 A;  1B6H A;  3H6V A;  5IAI A;  4KCC A;  1TWY A;  1O63 A;  4ELP A;  1FTM A;  5J1D A;  3N26 A;  1B3L A;  1B7Z A;  1H76 A;  3UA8 A;  2F97 A;  4PFY A;  1WOD A;  1FW0 A;  1MQJ A;  1B5H A;  2PVU A;  3IO6 A;  3LR1 A;  4ELR A;  4IO4 A;  4ZE8 A;  1TT1 A;  4H5G A;  5ITO A;  1FTJ A;  4IB2 A;  3W9V A;  1VSO A;  2PMS A;  4H6D A;  3CR9 A;  1USY H;  3H6W A;  3OEL A;  4OXV A;  4LA9 A;  2P1S A;  4NF6 B;  3O28 A;  1MXX A;  1UTH B;  4OEU A;  4E0W A;  1FQC A;  5F1Q A;  4KR5 A;  4IO2 A; 
#chains in the Genus database with same CATH topology
 4OHN A;  2I3W A;  3RT8 A;  2UYF A;  1MXW A;  3I5O A;  3TYH A;  1GGG A;  3DM0 A;  4QHQ A;  4JWO A;  1SW5 A;  4PAK A;  1NV7 A;  4OFL A;  2QSX A;  4U1O A;  3SEY A;  3OO8 A;  2O7I A;  3KZG A;  4GX4 A;  1DCU A;  2ABH A;  4NF8 B;  2W7Y A;  1SDX A;  2WBD A;  1SW4 A;  3D4G A;  2OLB A;  1LCT A;  5I84 A;  1NI9 A;  4FJP A;  1TFD A;  1ZMG A;  5H8S A;  1LBB A;  5TPA B;  3MVW A;  3USD A;  2FA7 A;  4RYA A;  3K6X A;  2FHY A;  4FBP A;  4NMY A;  2GHA A;  1POY 1;  1I6Q A;  3VVD A;  4G8H A;  3KEI A;  2OX3 A;  4DCY A;  2Z8F A;  4F3G A;  3G3I A;  2AL5 A;  3H6T A;  4GBW A;  3ZKL A;  4ZZE A;  4H45 A;  4QXD A;  4YKK A;  5ELV A;  4NF4 A;  4DDD A;  3IOV A;  2I6E A;  4HS7 A;  3Q26 A;  4P47 A;  1MY2 A;  3G3G A;  1MY1 A;  2A5T B;  2VD3 A;  4GOT A;  3T9U A;  4FOR A;  3TKD A;  2ANJ A;  5HM4 B;  4ND9 A;  4F1Y A;  2D5W A;  1IXG A;  5CMM A;  2Y7W A;  5TPA A;  4WEP A;  3ROJ A;  5I2K B;  3MVZ A;  5EQ9 A;  4MHF A;  2DE3 A;  4TLL B;  3TTM A;  1H43 A;  3BKI B;  2FYI A;  5IZ1 A;  1DOT A;  3ISP A;  2O1M A;  3SEV A;  5H8F A;  1PDA A;  3G7W A;  4MAG A;  2FVZ A;  1M5D A;  3MC2 A;  2I0B A;  3I3V A;  1NV5 A;  3Q25 A;  1NUY A;  3CFL A;  1IIT A;  4FED A;  1H3D A;  3MJN A;  3EHS A;  1IME A;  4XKQ A;  1LAG E;  4P1L A;  4NED A;  5CMK A;  1LAH E;  2UYE A;  3Q28 A;  2XXT A;  3M3F A;  4PFB A;  3B6T A;  4GWW A;  1NNK A;  4YKI A;  4NWD A;  1OMP A;  5CMC A;  3LSF B;  4RA1 A;  5I56 B;  4QF9 A;  4GL0 A;  3SKP A;  4TQU Q;  2QVR A;  2CMO A;  1YZ0 A;  5F7V A;  4Z7E A;  4MBP A;  4Q0C A;  3VXC A;  3RNN A;  2Q9T A;  5TP9 B;  4DZ1 A;  3MBP A;  3RGY A;  2QMW A;  4FIM A;  4X8R A;  1SQY A;  2OBG A;  4R9G A;  3OEM A;  1B32 A;  3MST A;  3W9W A;  4H8J A;  3K6W A;  3N6T A;  4OQO A;  1T0K A;  3PUX E;  5AA2 B;  3CI8 A;  1Y3Q A;  4KQP A;  2RCA A;  1D3K A;  2OWS A;  2E1S A;  3FJ7 A;  3DP8 A;  4GIZ A;  4O3A A;  3KJT A;  5CI5 A;  1LCF A;  5EHS A;  1QUK A;  2V3T A;  1KA0 A;  5CMB A;  3PU5 A;  2QPQ A;  1A55 A;  4U23 A;  5AA2 D;  4GWZ A;  4MJO A;  1Z7M E;  2WBB A;  4EXL A;  5BWJ A;  3S4U A;  4N8Y A;  3FZV A;  3TAJ A;  4O3B A;  1B05 A;  3FV1 A;  4WXJ A;  4U22 A;  4U2R A;  3QK6 A;  1FPB A;  3EN3 A;  1L5T A;  3VLW A;  2V84 A;  3PPO A;  4GRK A;  2V4C A;  4H5F A;  5H8Q A;  4TOZ A;  2PT2 A;  2CZI A;  3MAM A;  3PPR A;  4XIG Q;  3IOU A;  1Y3N A;  5B70 A;  5DVF A;  2ZYM A;  1O7T A;  1RYO A;  3T22 A;  4G4P A;  4ESW A;  4MLQ A;  3AXF A;  1B1X A;  4BDM A;  4DI3 D;  3I6V A;  3HST A;  3O6G A;  1YCJ A;  4RNS A;  1YAE A;  1NKX A;  2IEE A;  3QUJ A;  4GD5 A;  2ESN A;  3QIM A;  1M5E A;  1BK4 A;  3FXQ A;  2V3Q A;  2XXU A;  5I58 B;  4F19 A;  4OVS A;  4NG7 A;  1EH3 A;  3U94 A;  4IO5 A;  2PFY A;  3CFX A;  5EHM A;  2P2A A;  4OET A;  1N0T A;  1LST A;  2MKZ A;  1F9B A;  1Q1K A;  2QS3 A;  1QVS A;  4JBZ A;  1HSL A;  2F7A A;  2RC7 A;  4P1E A;  3M3L A;  4F1U A;  1URG A;  1FBG A;  3TTK A;  4GWU A;  4ZE9 A;  5AA3 A;  5ICQ A;  1MS7 A;  5ISU A;  3KSX A;  1P1N A;  2VPN A;  2Y5L A;  3G3J A;  2DVZ A;  4OVT A;  3ONM A;  1O64 A;  1B40 A;  1NNF A;  1IXC A;  4OVJ A;  4QRZ A;  3FXR A;  2Q88 A;  1UTB B;  1PB9 A;  4JVI A;  2QFL A;  1MXV A;  4JSO A;  1IUD A;  2XXR A;  1P1Q A;  3HO7 A;  4R6K A;  4P0I A;  1MDP 1;  5ESY A;  3TMG A;  1Y1M A;  4G68 C;  2I49 A;  5AA1 A;  3RQT A;  3MYU A;  4GX6 A;  3LBS A;  4MLV A;  2O68 A;  5EQ7 A;  4RK2 A;  4P3L A;  4GWX A;  1B3E A;  2QS1 A;  4NF0 A;  3VLU A;  5KDT A;  3N6U A;  2RCB A;  1SYI A;  5M2V A;  5FHO A;  1N04 A;  4PFI A;  4DCX A;  3ZS6 A;  1FQF A;  4KD5 A;  4NN3 A;  1SPI A;  4GXA A;  3FVO A;  4H0W A;  3R7X A;  1A8E A;  3T9V A;  4Z0I A;  4N91 A;  4BDN A;  2R8T A;  3OSR A;  3SEX A;  5JTY B;  2RC9 A;  3B6Q A;  2I3V A;  1QUI A;  2IA4 A;  1QUL A;  2QJE A;  3TDJ A;  4PP0 A;  2CEX A;  1BIY A;  2F8D A;  3GYY A;  1NNP A;  3DLN A;  4QBA A;  3BFU A;  4GF8 A;  5H8N B;  3B8B A;  3PUV E;  1S9T A;  1LBX A;  3O6I A;  5B7D A;  2DDK A;  2I58 A;  4JWY A;  4QSE A;  4KYD A;  3G3H A;  3ODB A;  3VXB A;  3MPK A;  1DTZ A;  4PFU A;  2XWI A;  1S50 A;  2XWO A;  4PBH A;  4EQB A;  2HXR A;  3EPE A;  4RPN A;  1BLF A;  1EYK A;  4ONY A;  1DTG A;  3KFM A;  1B1H A;  1LFH A;  4U21 A;  4UAB A;  2NUV A;  2Z8E A;  2I4C A;  4IGT A;  3CG3 A;  3G3K A;  2VD2 A;  3RT6 B;  4HCY A;  4H46 A;  4R74 A;  4NE4 A;  4PF8 A;  2RKM A;  4GL8 A;  1SVX B;  3K4U A;  1ZIU A;  4AS5 A;  2B65 A;  4OVQ A;  4Q5T A;  2L5V A;  3TEP A;  2H5Y A;  4R6H A;  5ET6 A;  2HXW A;  1MQD A;  3GBB A;  5EQ8 A;  1RYX A;  5LDZ A;  2XWV A;  5ET7 A;  1I6B A;  4ZS9 A;  3TTL A;  4YIC A;  2HQ0 A;  1DMB A;  2ZZW A;  1SW1 A;  4PCD A;  1Q35 A;  3K1P A;  2XA5 A;  3GXA A;  5TU0 A;  2QVU A;  1LBC A;  4DXB A;  4QFO A;  2DS9 A;  1PB7 A;  3K0V A;  4Q30 B;  2I0C A;  4R2F A;  2GFE A;  1B3H A;  3OSQ A;  4GBV A;  4G8N A;  4MNI A;  2DYX A;  2ZZV A;  4IR8 A;  3KN7 A;  1SBP A;  4KI0 E;  3FV2 A;  3FVN A;  2F3B A;  1D9Q A;  2RC8 A;  1CNQ A;  2NVU B;  4ZEC A;  1OVB A;  3PV0 E;  1EZ9 A;  1NUX A;  4NF5 A;  1XVY A;  1IMB A;  3TEL A;  3U72 A;  4MNC A;  1UIV A;  3S9L C;  4GFR A;  4NAP A;  1FRP A;  1PBP A;  4MH5 A;  3GZG A;  4OER A;  3E78 A;  1NV2 A;  3B6W A;  4G2Z A;  1KWH A;  1FTK A;  5CBS A;  2ZXT A;  5IZ3 A;  4NF4 B;  2VT5 A;  2Z8D A;  3ZKK A;  4BLA A;  4PFT A;  2X7Q A;  5I59 A;  4HE1 A;  3EHT A;  3ILU B;  2Z23 A;  2Y5K A;  1NV4 A;  3K2D A;  1II5 A;  1XT8 A;  1OLC A;  1ZTY A;  1JQF A;  2VGQ A;  2VOZ A;  1ANF A;  1OVT A;  1XI6 A;  4DXU A;  3N5L A;  1SD3 A;  1IXI A;  4YKP A;  3CHG A;  3OEK A;  1FPD A;  2LAO A;  4O94 A;  4OWD A;  4PGP A;  5H8F B;  3SES A;  2DWI A;  3LC8 A;  3MZ1 A;  1R9L A;  2OCU A;  4IY6 A;  1MPD A;  1MDQ A;  3FVG A;  3QMF A;  4GLI A;  1A7L A;  3CG1 A;  1Y4T A;  3LSW A;  1B3G A;  1YXI A;  4JWX A;  2UVI A;  4P56 A;  4GWY A;  1MY4 A;  1NH7 A;  4BDL A;  1FPE A;  1XC1 A;  2ONR A;  4R6Y A;  2XX7 A;  1B7U A;  1B4Z A;  1ZBM A;  4DI4 B;  3BFT A;  3MP8 A;  1EZP A;  2H4I A;  4KCD A;  2XD2 A;  3OO9 A;  4I3E A;  4LON B;  5L9M A;  1VE4 A;  2XXK A;  3OD7 A;  2Y7I A;  5DYH A;  3U92 A;  3C32 A;  2OK2 A;  1AIV A;  4BDO A;  1NFT A;  4N4U A;  4P9K A;  2H98 A;  3SDF A;  3UIF A;  1NV0 A;  1BTJ A;  3PUY E;  1TXF A;  1LEV A;  1P99 A;  3H7M A;  1UQW A;  1MH3 A;  4R72 A;  3OO6 A;  4PF6 A;  5I3S A;  2Z22 A;  1DSN A;  3T1B A;  3E4R A;  3A3U A;  1EZO A;  1NL5 A;  4LZ5 A;  3RY3 A;  1B52 A;  3OMB A;  5A5L A;  2PFZ A;  3VVF A;  2WYK A;  4LP2 B;  1B0H A;  2PT1 A;  3FVK A;  3ILT B;  5IM2 A;  5H8H A;  4G8M A;  3BBR A;  1Y9U A;  2JJK A;  4DLD A;  2REG A;  1YYZ A;  2XX8 A;  2F7C A;  2Q8J A;  2GHB A;  5K2Y A;  4C0R A;  2BJJ X;  1UIU A;  3KBR A;  1OLA A;  3E79 A;  3IAZ A;  1SI1 A;  2HAU A;  4YB5 A;  3PD8 A;  1BP5 A;  3PPQ A;  4LQ2 A;  2B4M A;  3RTW B;  3HV1 A;  1K9Z A;  4N6K A;  2F78 A;  3V5A A;  2R6G E;  3KOS A;  5HBC A;  3TQL A;  3JZJ A;  4F3B A;  2F5X A;  2QRY A;  3IB2 A;  4GX3 A;  5H8Q B;  1R9Q A;  1FJ6 A;  1IMC A;  1MQI A;  4R2B A;  2AYS A;  3C34 A;  4I3Y A;  4NTL A;  3IL1 B;  4C1U A;  1MG1 A;  4ESX A;  3IO4 A;  2Y7P A;  2KR0 A;  4F2Q A;  1G0I A;  2RF1 A;  1FPL A;  2PCR A;  5JEI A;  3O29 A;  3TPA A;  2XXY A;  3K6V A;  3RLF E;  1WVJ A;  3O2A A;  2Q2A A;  3M8U A;  3CFZ A;  4X1D A;  4QSC A;  3MWB A;  5JK4 A;  2QS4 A;  4RY1 A;  5FHN A;  4NX1 A;  1B2H A;  4QFN A;  2Y7R A;  2QVV A;  4N15 A;  3U8Q A;  3EF7 A;  2OZZ A;  1MRP A;  4FE8 A;  4F22 A;  5DEX A;  4G77 A;  4M1V A;  2HEU A;  4KYE A;  4YZZ A;  1D9V A;  1FBH A;  1POT A;  1G0H A;  4RXL A;  3K01 A;  3O97 A;  1MXZ A;  2DQV A;  2HAV A;  3TCH A;  4U4X A;  3SET A;  4PFR A;  3MVY A;  2X7P A;  4AQ4 A;  1GVC A;  5ICT A;  1FTL A;  1XS5 A;  4NQ8 A;  2ZYN A;  2H9B A;  3FAT A;  2KQZ A;  3IR1 A;  4PDD A;  4UA8 A;  3K1N A;  3IB0 A;  4E0X A;  3OOA A;  2HHM A;  2KLF A;  3IJX B;  4U1Z A;  1B9J A;  5KDT B;  2E0S A;  3PGF A;  3VE1 B;  1Z7N E;  1LAF E;  3H03 A;  2O51 A;  1FTA A;  2F34 A;  3DP4 A;  5CRY A;  3FJG A;  4GWO A;  4YB7 A;  1MY0 A;  2I4B A;  1LLS A;  1MM6 A;  4M4G A;  2X26 A;  3TOD A;  2I48 A;  4MIJ A;  4QSD A;  4XKP A;  5I2N A;  2DSF A;  3BIG A;  3H6U A;  4QFK A;  4OTE A;  2ZYO A;  4DXC A;  4I40 A;  2XXI A;  3MUQ A;  4ELQ A;  5J16 A;  3VDF A;  3ZSF A;  2F3D A;  5A5X A;  4F3S A;  2GQ1 A;  4YAH X;  2FIX A;  3RUM A;  3U1O A;  1QKA A;  2O69 A;  1A8F A;  3SER A;  3JYR A;  2REJ A;  4N81 A;  1MPC A;  3HFU A;  3IJO B;  1N3W A;  2CZH A;  2NWJ A;  4IO3 A;  2AIX A;  3FXU A;  1K9Y A;  4ISU A;  5HPQ A;  2D3I A;  1IMD A;  5DVJ A;  1B46 A;  4GWS A;  3PD9 A;  4OYV A;  1LBZ A;  4RJZ A;  2DWA A;  4YMB A;  2XD3 A;  5DVI A;  1N84 A;  1OIB A;  4MMP A;  4I1D A;  1A40 A;  5CBR A;  5I5P A;  3K6U A;  4YU0 A;  4F2O A;  4XF5 A;  3IOW A;  5ET8 A;  1KA1 A;  2O1L A;  3HHG A;  1BKA A;  5FBP A;  1DPP A;  3RYD A;  2XXQ A;  4PE3 A;  3TZA A;  1NUZ A;  3E13 X;  4X48 A;  2YLN A;  5L9O A;  3LUY A;  1Y3P A;  1JP4 A;  2PX1 A;  2XXH A;  4LUB A;  1MH4 A;  2R9J A;  3QXM A;  5AA4 A;  4F31 B;  4FEC A;  1JW5 A;  4BDQ A;  3TUS A;  2HPG A;  1B51 A;  2WKY A;  1DPE A;  1MY3 A;  5CC2 A;  2GH9 A;  4N6D A;  2XHD A;  3WAF A;  4K3F A;  1TFA A;  1S7Y A;  3CVG A;  3CIJ A;  5I57 A;  3PMV A;  4OZ9 A;  4QFP A;  4OVR A;  5IZZ A;  4ZZA A;  3P7I A;  3QUF A;  4N6P A;  1P1U A;  2AL4 A;  1MXU A;  1ZKB A;  1YTV A;  2DVC A;  4PGN A;  2XXV A;  4NWC A;  4NF5 B;  4XKR A;  1JW4 A;  3LSX A;  4EDP A;  3KJ7 A;  4X04 A;  3UN6 A;  3MP1 A;  2F6P A;  3EQ1 A;  3RTF B;  3B50 A;  2P3N A;  4GVO A;  3TFL A;  3RPW A;  1QGX A;  1JET A;  4ZEI A;  2NXO A;  4MCO A;  3MVX A;  1GR2 A;  4GQO A;  2H25 A;  4N17 A;  5IZ3 B;  1M5F A;  4F1V A;  3BIH A;  3CRB A;  3TTR A;  3C36 A;  5I59 B;  3D4C A;  2UVH A;  3KC1 A;  3DEL B;  3EHU A;  4G68 A;  1FBD A;  4U4S A;  1SYH A;  4UAC A;  3FD3 A;  2PYY A;  3GBA A;  4KPT A;  2RIN A;  2D21 A;  1J1N A;  2BJI A;  3A3C A;  5LTC A;  2VHA A;  3FXB A;  5EQA A;  4KHZ E;  3PMW A;  2DXY A;  3GLB A;  1FTO A;  4PC9 A;  4N07 A;  1LBV A;  3KG2 A;  5I7I A;  4O7I A;  4ZEB A;  2V25 A;  1FQB A;  3H3G A;  3T66 A;  3FAS A;  1LB9 A;  4RK9 A;  4I62 A;  5L8D A;  2P0S A;  3V83 A;  2QMX A;  1MXY A;  3LUZ A;  4EF1 A;  1IQ7 A;  2DWJ A;  3TTN A;  1MM7 A;  4PBQ A;  4F29 A;  1US5 A;  1EU8 A;  2ZNS A;  3L6H A;  4JSD A;  1Y1Z A;  1N7W A;  4NF6 A;  1IXH A;  1VFD A;  3T9X B;  1VDW A;  1ZU0 A;  1UTH A;  4OVP A;  1JVX A;  1HSE A;  3HCQ A;  3WAE A;  4Q8R A;  5L9S A;  1N7X A;  2O7U A;  4PTK A;  3RPL A;  3T96 B;  1LAX A;  2XXP A;  4WKM A;  3UP9 A;  4BDR A;  3PPN A;  2HZK A;  1RDZ A;  4HE2 A;  4ELO A;  2Q89 A;  2CZK A;  1XOC A;  5K2X A;  1NV3 A;  1Q9D A;  3SEU A;  2XWK A;  1JEV A;  2UVG A;  1B7H A;  1B3F A;  1URS A;  4NF8 A;  1NNT A;  3KOT A;  4OES A;  4KXP A;  2NOO A;  3HN0 A;  3PPP A;  4H65 A;  1IEJ A;  1GTK A;  1CE2 A;  5H8H B;  4WED A;  1FPK A;  1YPN A;  3H06 B;  2F6G A;  3KN3 A;  4DIG A;  2HFB A;  3VFJ A;  3FUZ A;  1AMF A;  4LZ7 A;  3UGW A;  4ZED A;  4FEB A;  2OWT A;  3IFA A;  1H45 A;  3B7D A;  3MZB A;  1LB8 A;  3S9E A;  3O6H A;  1A54 A;  3K1M A;  3MPL A;  5ET5 A;  1FBP A;  3S9N C;  3IB1 A;  2A5T A;  1IIW A;  1NV6 A;  5EYF A;  4ZDM A;  4NHB A;  3U93 A;  1ATG A;  3ECR A;  5I2K A;  3FBP A;  1CB6 A;  1P1O A;  3OXN A;  2Y84 A;  1FQD A;  3MW0 A;  4N8G A;  2XXX A;  4ZEF A;  3TCG A;  4F3P A;  3PTY A;  1EYI A;  1QKB A;  2THI A;  4AB6 A;  3DP6 A;  3C35 A;  1KZ8 A;  3MP6 A;  1B4H A;  4O8M A;  2A5S A;  4YMA A;  1FQA A;  4N13 A;  3VLV A;  4KFQ A;  3IX1 A;  3PMX A;  4XXU A;  1AL3 A;  4JVC A;  1LFI A;  2M8C A;  2ONK E;  4LZ8 A;  3M3K A;  4FAT A;  3VVE A;  1VFE A;  1NH8 A;  1H44 A;  3JV9 A;  2V93 A;  3QSL A;  4PAI A;  2Q8M A;  4DE8 A;  4QFL A;  1I6A A;  2Q2C A;  1FQE A;  1FPI A;  2XXW A;  2QS2 A;  5I56 A;  5DEX B;  1SI0 A;  2FBP A;  4PAF A;  3W15 C;  1IZ1 A;  2PBW A;  4MF3 A;  4O7M A;  4ECF A;  5FHM A;  3IK6 B;  3MZ9 A;  4LN5 A;  3UK4 A;  2VP1 A;  1RKM A;  2B3F A;  4LAT A;  4HTG A;  4OMB A;  5TP9 A;  4NGU A;  4MX6 A;  5T3J A;  3S9M C;  4FAJ A;  3KSJ A;  2B3B A;  4P11 A;  1RDX A;  3EKI A;  1ZJL A;  3L6G A;  4HCW A;  4EF2 A;  2V3U A;  5AA2 A;  1OQG A;  3CSG A;  4IO7 A;  3G3F A;  1M5C A;  5DTB A;  4IGR A;  4F18 A;  4PE5 B;  3Q27 A;  4GXS B;  4JXI A;  3OO7 A;  1MPB A;  4P8B A;  5KZT A;  1JEU A;  2H99 A;  3PUZ E;  2ZMB A;  1MQH A;  1R1N A;  1FPF A;  2FNC A;  2XX9 A;  4X1B A;  4POW A;  1AWB A;  2O84 X;  3O66 A;  2CZL A;  2DOJ A;  3KC0 A;  1B58 A;  4H1X A;  1JNF A;  4PQJ A;  4JVD A;  1PC3 A;  3KGC A;  1N76 A;  3QYT A;  1XVX A;  4JDF A;  3PUW E;  1I69 A;  2GRV A;  2F36 A;  1DK4 A;  3E9X A;  2DE2 A;  5I2N B;  3V8X B;  4TLM B;  1LBY A;  4EQ7 A;  5KCJ B;  1LFG A;  3A09 A;  3S2V A;  1B5I A;  1NMU A;  4O3C A;  4MNP A;  2VPO A;  5A5X B;  1PEB A;  3HHF A;  2Y7K A;  1PBQ A;  2OJT A;  1XHY A;  1WDN A;  1QW0 A;  4IO6 A;  4KYS A;  2DP8 A;  3T9H B;  4H67 A;  4OEN A;  4PDH A;  2ZNT A;  1FPG A;  2ZNU A;  1HSJ A;  2G29 A;  1R6Z A;  5I58 A;  3FJM A;  3C4M A;  1P1W A;  3IOT A;  2HCA A;  2QL3 A;  3C33 A;  4G61 A;  3Q29 A;  4OFO A;  5ITP A;  1OQH A;  2UXA A;  1ELJ A;  3IFC A;  5KCJ A;  2UVJ A;  4I8C A;  4EQ9 A;  3FGS A;  3U65 A;  1FPJ A;  4EXK A;  3FIR A;  5EYG A;  3N94 A;  3F11 A;  1GV8 A;  4ZEK A;  3QAX A;  2WYP A;  3CSB A;  1QJM A;  1US4 A;  4HE0 A;  4R73 A;  4THI A;  4HW8 A;  1FBF A;  3KN8 A;  4LVQ A;  1FCK A;  2G93 A;  3TCF A;  2HZL A;  3K00 A;  5EYH A;  3A29 A;  4I9D A;  2DE4 A;  1ZLQ A;  5AA4 B;  5BUU A;  1AH5 A;  1D4N A;  1LGB C;  4OFJ A;  3T93 B;  1UTB A;  5LOM A;  4EUO A;  5DW8 A;  1B0L A;  3HPI A;  3IOR A;  3LV0 A;  4R75 A;  2F35 A;  1URD A;  1QUJ A;  2DXR A;  4YB6 A;  2Q74 A;  3K02 A;  2F7B A;  1IMF A;  4MFI A;  3C31 A;  5I57 B;  5DT6 A;  2OWZ A;  3TQW A;  5FTH A;  1MQG A;  3C9H A;  2WX9 A;  4XTC Q;  3THI A;  4AS4 A;  4LQ5 A;  1N3X A;  4YKJ A;  1NV1 A;  2WEF A;  3E3K A;  2YJP A;  4P0G A;  2CEY A;  4F39 A;  1FBC A;  4AB5 A;  5CM6 A;  3V89 B;  2P3V A;  5FTI A;  5IKB A;  4POX A;  4XFE A;  2ONS A;  1Y20 A;  4H8I A;  1INP A;  1SW2 A;  3KBZ A;  3R26 A;  3LSL A;  1JW1 A;  5JTY A;  2ZYK A;  4PFW A;  3MQ9 A;  3D1R A;  2DWH A;  3NOH A;  2O6A A;  2R71 A;  1A99 A;  1JVY A;  4R9F A;  1M5B A;  3O9P A;  2ALU A;  1B5J A;  4RPO A;  4JB7 A;  1USY E;  1Y4C A;  1FJ9 A;  3H4Z A;  4PET A;  1PB8 A;  1D9Y A;  3OEN A;  5H8N A;  3R6U A;  5AE4 A;  4OEV A;  4X9T A;  3VV5 A;  4XKN A;  3RN8 A;  2YPN A;  3SEW A;  4C1T A;  3UOR A;  1AOV A;  4G68 B;  4IY5 A;  4L17 A;  1VR5 A;  1B6H A;  3H6V A;  1NUW A;  5IAI A;  4KCC A;  1TWY A;  1O63 A;  1FBE A;  4XEQ A;  1EYJ A;  4ELP A;  1FTM A;  5J1D A;  3N26 A;  1B3L A;  1B7Z A;  1H76 A;  3UA8 A;  1IMA A;  2F97 A;  4PFY A;  1WOD A;  1FW0 A;  5F24 A;  1MQJ A;  1B5H A;  2PVU A;  2B4L A;  2FIE A;  3IO6 A;  4OAN A;  3LR1 A;  4ELR A;  2ZZX A;  4OA4 A;  4IO4 A;  4ZE8 A;  1TT1 A;  4H5G A;  5ITO A;  1FTJ A;  4IB2 A;  3W9V A;  1VSO A;  2PMS A;  1FSA A;  4H6D A;  3CR9 A;  1USY H;  3H6W A;  3OEL A;  4OXV A;  4LA9 A;  2P1S A;  4NF6 B;  4HXV A;  1RDY A;  3O28 A;  1MXX A;  1UTH B;  4OEU A;  4E0W A;  4MEV A;  1FQC A;  3T0J A;  3SZP A;  1DBZ A;  5F1Q A;  4KR5 A;  1LBW A;  4IO2 A;  5IGA A;  3RPL B; 
#chains in the Genus database with same CATH homology
 4OHN A;  2I3W A;  3RT8 A;  2UYF A;  1MXW A;  3I5O A;  3TYH A;  1GGG A;  3DM0 A;  4QHQ A;  4JWO A;  1SW5 A;  4OFL A;  2QSX A;  4U1O A;  3SEY A;  3OO8 A;  2O7I A;  3KZG A;  2ABH A;  4NF8 B;  2W7Y A;  1SDX A;  1SW4 A;  3D4G A;  2OLB A;  1LCT A;  5I84 A;  4FJP A;  1TFD A;  1ZMG A;  5H8S A;  1LBB A;  5TPA B;  3MVW A;  3USD A;  2FA7 A;  4RYA A;  3K6X A;  4NMY A;  2GHA A;  1POY 1;  1I6Q A;  3VVD A;  4G8H A;  3KEI A;  4DCY A;  2Z8F A;  4F3G A;  3G3I A;  2AL5 A;  3H6T A;  3ZKL A;  4ZZE A;  4YKK A;  5ELV A;  4NF4 A;  4DDD A;  3IOV A;  2I6E A;  4HS7 A;  3Q26 A;  1MY2 A;  3G3G A;  1MY1 A;  2A5T B;  2VD3 A;  4GOT A;  3T9U A;  4FOR A;  3TKD A;  2ANJ A;  5HM4 B;  4ND9 A;  4F1Y A;  2D5W A;  1IXG A;  5CMM A;  2Y7W A;  5TPA A;  4WEP A;  5I2K B;  3MVZ A;  2DE3 A;  4TLL B;  3TTM A;  1H43 A;  3BKI B;  2FYI A;  1DOT A;  2O1M A;  3SEV A;  5H8F A;  1PDA A;  3G7W A;  1M5D A;  3MC2 A;  2I0B A;  3I3V A;  3Q25 A;  3CFL A;  1IIT A;  4FED A;  1H3D A;  3MJN A;  3EHS A;  4XKQ A;  1LAG E;  4NED A;  5CMK A;  1LAH E;  2UYE A;  3Q28 A;  2XXT A;  3M3F A;  3B6T A;  1NNK A;  4YKI A;  4NWD A;  1OMP A;  5CMC A;  3LSF B;  4RA1 A;  5I56 B;  4QF9 A;  4GL0 A;  3SKP A;  4TQU Q;  2CMO A;  5F7V A;  4Z7E A;  4MBP A;  4Q0C A;  3VXC A;  3RNN A;  2Q9T A;  5TP9 B;  4DZ1 A;  3MBP A;  3RGY A;  2QMW A;  4FIM A;  1SQY A;  2OBG A;  4R9G A;  3OEM A;  1B32 A;  3W9W A;  4H8J A;  3K6W A;  3N6T A;  4OQO A;  1T0K A;  3PUX E;  5AA2 B;  3CI8 A;  1Y3Q A;  4KQP A;  2RCA A;  1D3K A;  2OWS A;  2E1S A;  3FJ7 A;  3DP8 A;  4GIZ A;  4O3A A;  3KJT A;  5CI5 A;  1LCF A;  5EHS A;  1QUK A;  2V3T A;  5CMB A;  3PU5 A;  2QPQ A;  1A55 A;  4U23 A;  5AA2 D;  1Z7M E;  4EXL A;  5BWJ A;  3S4U A;  3FZV A;  3TAJ A;  4O3B A;  1B05 A;  3FV1 A;  4WXJ A;  4U22 A;  4U2R A;  3QK6 A;  3EN3 A;  1L5T A;  3VLW A;  2V84 A;  3PPO A;  4GRK A;  4H5F A;  5H8Q A;  4TOZ A;  2PT2 A;  3MAM A;  3PPR A;  4XIG Q;  3IOU A;  1Y3N A;  5B70 A;  5DVF A;  2ZYM A;  1O7T A;  1RYO A;  3T22 A;  4G4P A;  4ESW A;  4MLQ A;  3AXF A;  1B1X A;  4BDM A;  3I6V A;  3HST A;  3O6G A;  1YCJ A;  4RNS A;  1YAE A;  1NKX A;  2IEE A;  3QUJ A;  4GD5 A;  2ESN A;  3QIM A;  1M5E A;  3FXQ A;  2V3Q A;  2XXU A;  5I58 B;  4F19 A;  1EH3 A;  3U94 A;  4IO5 A;  3CFX A;  5EHM A;  2P2A A;  4OET A;  1N0T A;  1LST A;  1F9B A;  1Q1K A;  2QS3 A;  1QVS A;  4JBZ A;  1HSL A;  2F7A A;  2RC7 A;  3M3L A;  4F1U A;  1URG A;  3TTK A;  4ZE9 A;  5AA3 A;  5ICQ A;  1MS7 A;  5ISU A;  3KSX A;  1P1N A;  3G3J A;  2DVZ A;  3ONM A;  1O64 A;  1B40 A;  1NNF A;  1IXC A;  4OVJ A;  4QRZ A;  3FXR A;  2Q88 A;  1UTB B;  1PB9 A;  1MXV A;  4JSO A;  1IUD A;  2XXR A;  1P1Q A;  3HO7 A;  4R6K A;  4P0I A;  1MDP 1;  3TMG A;  1Y1M A;  4G68 C;  2I49 A;  5AA1 A;  3RQT A;  3LBS A;  4MLV A;  2O68 A;  4RK2 A;  1B3E A;  2QS1 A;  3VLU A;  5KDT A;  3N6U A;  2RCB A;  1SYI A;  5M2V A;  5FHO A;  1N04 A;  4DCX A;  3ZS6 A;  1FQF A;  4KD5 A;  4GXA A;  3FVO A;  4H0W A;  3R7X A;  1A8E A;  3T9V A;  4Z0I A;  4BDN A;  3OSR A;  3SEX A;  5JTY B;  2RC9 A;  3B6Q A;  2I3V A;  1QUI A;  2IA4 A;  1QUL A;  2QJE A;  3TDJ A;  4PP0 A;  1BIY A;  2F8D A;  1NNP A;  3DLN A;  3BFU A;  4GF8 A;  5H8N B;  3PUV E;  1S9T A;  3O6I A;  5B7D A;  2I58 A;  4JWY A;  4QSE A;  4KYD A;  3G3H A;  3ODB A;  3VXB A;  3MPK A;  1DTZ A;  4PFU A;  1S50 A;  4EQB A;  3EPE A;  4RPN A;  1BLF A;  4ONY A;  1DTG A;  3KFM A;  1B1H A;  1LFH A;  4U21 A;  2NUV A;  2Z8E A;  2I4C A;  4IGT A;  3CG3 A;  3G3K A;  2VD2 A;  3RT6 B;  4HCY A;  4R74 A;  4NE4 A;  2RKM A;  4GL8 A;  1SVX B;  3K4U A;  1ZIU A;  2B65 A;  4Q5T A;  3TEP A;  2H5Y A;  4R6H A;  2HXW A;  1MQD A;  3GBB A;  1RYX A;  1I6B A;  4ZS9 A;  3TTL A;  4YIC A;  2HQ0 A;  1DMB A;  1SW1 A;  1Q35 A;  3K1P A;  3GXA A;  5TU0 A;  1LBC A;  4DXB A;  4QFO A;  2DS9 A;  1PB7 A;  3K0V A;  4Q30 B;  2I0C A;  4R2F A;  2GFE A;  1B3H A;  3OSQ A;  4G8N A;  2DYX A;  3KN7 A;  1SBP A;  4KI0 E;  3FV2 A;  3FVN A;  2RC8 A;  2NVU B;  4ZEC A;  1OVB A;  3PV0 E;  1EZ9 A;  4NF5 A;  1XVY A;  3TEL A;  3U72 A;  1UIV A;  3S9L C;  4GFR A;  1PBP A;  4MH5 A;  3GZG A;  4OER A;  3B6W A;  4G2Z A;  1KWH A;  1FTK A;  5CBS A;  2ZXT A;  4NF4 B;  2Z8D A;  3ZKK A;  4BLA A;  4PFT A;  2X7Q A;  5I59 A;  3EHT A;  3ILU B;  2Z23 A;  3K2D A;  1II5 A;  1XT8 A;  1OLC A;  1ZTY A;  1JQF A;  2VGQ A;  2VOZ A;  1ANF A;  1OVT A;  4DXU A;  3N5L A;  1SD3 A;  1IXI A;  4YKP A;  3OEK A;  2LAO A;  4OWD A;  5H8F B;  3SES A;  2DWI A;  3LC8 A;  3MZ1 A;  1R9L A;  2OCU A;  4IY6 A;  1MPD A;  1MDQ A;  3FVG A;  4GLI A;  1A7L A;  3CG1 A;  1Y4T A;  3LSW A;  1B3G A;  4JWX A;  2UVI A;  1MY4 A;  1NH7 A;  4BDL A;  1XC1 A;  2ONR A;  4R6Y A;  2XX7 A;  1B7U A;  1B4Z A;  1ZBM A;  3BFT A;  3MP8 A;  1EZP A;  2H4I A;  4KCD A;  2XD2 A;  3OO9 A;  4LON B;  5L9M A;  1VE4 A;  3OD7 A;  2Y7I A;  5DYH A;  3U92 A;  3C32 A;  2OK2 A;  1AIV A;  4BDO A;  1NFT A;  2H98 A;  3SDF A;  3UIF A;  1BTJ A;  3PUY E;  1TXF A;  1P99 A;  3H7M A;  1UQW A;  1MH3 A;  4R72 A;  3OO6 A;  2Z22 A;  1DSN A;  3E4R A;  3A3U A;  1EZO A;  1NL5 A;  4LZ5 A;  3RY3 A;  1B52 A;  3OMB A;  3VVF A;  4LP2 B;  1B0H A;  2PT1 A;  3FVK A;  3ILT B;  5H8H A;  4G8M A;  3BBR A;  1Y9U A;  4DLD A;  2REG A;  2XX8 A;  2Q8J A;  2F7C A;  2GHB A;  5K2Y A;  4C0R A;  2BJJ X;  1UIU A;  3KBR A;  1OLA A;  3IAZ A;  1SI1 A;  2HAU A;  4YB5 A;  3PD8 A;  1BP5 A;  3PPQ A;  4LQ2 A;  3RTW B;  3HV1 A;  2F78 A;  3V5A A;  2R6G E;  3KOS A;  5HBC A;  3TQL A;  3JZJ A;  4F3B A;  2F5X A;  2QRY A;  3IB2 A;  5H8Q B;  1R9Q A;  1MQI A;  4R2B A;  2AYS A;  3C34 A;  4NTL A;  3IL1 B;  4C1U A;  1MG1 A;  4ESX A;  3IO4 A;  2Y7P A;  4F2Q A;  2RF1 A;  5JEI A;  3O29 A;  3TPA A;  2XXY A;  3K6V A;  3RLF E;  1WVJ A;  3O2A A;  2Q2A A;  3M8U A;  3CFZ A;  4X1D A;  4QSC A;  3MWB A;  5JK4 A;  2QS4 A;  4RY1 A;  5FHN A;  1B2H A;  4QFN A;  2Y7R A;  3U8Q A;  3EF7 A;  2OZZ A;  1MRP A;  4FE8 A;  4F22 A;  5DEX A;  4G77 A;  4M1V A;  2HEU A;  4KYE A;  4YZZ A;  1D9V A;  1POT A;  4RXL A;  3K01 A;  3O97 A;  1MXZ A;  2DQV A;  2HAV A;  3TCH A;  4U4X A;  3SET A;  3MVY A;  2X7P A;  4AQ4 A;  1GVC A;  5ICT A;  1FTL A;  1XS5 A;  2ZYN A;  2H9B A;  3FAT A;  3IR1 A;  4UA8 A;  3K1N A;  3IB0 A;  4E0X A;  3OOA A;  2KLF A;  3IJX B;  4U1Z A;  1B9J A;  5KDT B;  2E0S A;  3PGF A;  3VE1 B;  1Z7N E;  1LAF E;  3H03 A;  2O51 A;  2F34 A;  3DP4 A;  5CRY A;  3FJG A;  4GWO A;  4YB7 A;  1MY0 A;  2I4B A;  1LLS A;  1MM6 A;  4M4G A;  2X26 A;  3TOD A;  2I48 A;  4QSD A;  4XKP A;  5I2N A;  2DSF A;  3H6U A;  4QFK A;  4OTE A;  2ZYO A;  4DXC A;  2XXI A;  3MUQ A;  4ELQ A;  3VDF A;  3ZSF A;  5A5X A;  4F3S A;  4YAH X;  3RUM A;  3U1O A;  1QKA A;  2O69 A;  1A8F A;  3SER A;  3JYR A;  2REJ A;  1MPC A;  3IJO B;  1N3W A;  2NWJ A;  4IO3 A;  2AIX A;  3FXU A;  4ISU A;  5HPQ A;  2D3I A;  5DVJ A;  1B46 A;  3PD9 A;  4OYV A;  4RJZ A;  2DWA A;  4YMB A;  2XD3 A;  5DVI A;  1N84 A;  1OIB A;  4I1D A;  1A40 A;  5CBR A;  3K6U A;  4YU0 A;  4F2O A;  3IOW A;  2O1L A;  3HHG A;  1BKA A;  1DPP A;  2XXQ A;  3TZA A;  3E13 X;  4X48 A;  2YLN A;  5L9O A;  3LUY A;  1Y3P A;  2PX1 A;  2XXH A;  4LUB A;  1MH4 A;  2R9J A;  3QXM A;  5AA4 A;  4F31 B;  4FEC A;  1JW5 A;  4BDQ A;  3TUS A;  1B51 A;  2WKY A;  1DPE A;  1MY3 A;  5CC2 A;  2GH9 A;  2XHD A;  3WAF A;  4K3F A;  1TFA A;  1S7Y A;  3CVG A;  3CIJ A;  5I57 A;  3PMV A;  4OZ9 A;  4QFP A;  4ZZA A;  3P7I A;  3QUF A;  4N6P A;  1P1U A;  2AL4 A;  1MXU A;  1ZKB A;  1YTV A;  2DVC A;  2XXV A;  4NWC A;  4NF5 B;  4XKR A;  1JW4 A;  3LSX A;  4EDP A;  3KJ7 A;  3UN6 A;  3MP1 A;  2F6P A;  3EQ1 A;  3RTF B;  4GVO A;  3TFL A;  3RPW A;  1JET A;  4ZEI A;  2NXO A;  3MVX A;  1GR2 A;  4GQO A;  2H25 A;  4F1V A;  1M5F A;  3CRB A;  3TTR A;  3C36 A;  5I59 B;  3D4C A;  2UVH A;  3DEL B;  3EHU A;  4G68 A;  4U4S A;  1SYH A;  4UAC A;  3FD3 A;  2PYY A;  3GBA A;  4KPT A;  2RIN A;  2D21 A;  1J1N A;  3A3C A;  2VHA A;  4KHZ E;  3PMW A;  2DXY A;  3GLB A;  1FTO A;  4N07 A;  3KG2 A;  4ZEB A;  2V25 A;  1FQB A;  3H3G A;  3T66 A;  3FAS A;  1LB9 A;  4RK9 A;  4I62 A;  5L8D A;  2P0S A;  3V83 A;  2QMX A;  1MXY A;  4EF1 A;  1IQ7 A;  2DWJ A;  3TTN A;  1MM7 A;  4F29 A;  1US5 A;  1EU8 A;  2ZNS A;  3L6H A;  4JSD A;  1Y1Z A;  1N7W A;  4NF6 A;  1IXH A;  1VFD A;  3T9X B;  1ZU0 A;  1UTH A;  1JVX A;  1HSE A;  3HCQ A;  3WAE A;  4Q8R A;  5L9S A;  1N7X A;  2O7U A;  3T96 B;  1LAX A;  2XXP A;  4WKM A;  3UP9 A;  4BDR A;  3PPN A;  2HZK A;  4ELO A;  2Q89 A;  1XOC A;  5K2X A;  3SEU A;  1JEV A;  2UVG A;  1B7H A;  1B3F A;  1URS A;  4NF8 A;  1NNT A;  3KOT A;  4OES A;  2NOO A;  3HN0 A;  3PPP A;  4H65 A;  1IEJ A;  1GTK A;  1CE2 A;  5H8H B;  4WED A;  1YPN A;  3H06 B;  2F6G A;  3KN3 A;  4DIG A;  2HFB A;  3VFJ A;  3FUZ A;  1AMF A;  4LZ7 A;  3UGW A;  4ZED A;  4FEB A;  2OWT A;  1H45 A;  3B7D A;  3MZB A;  1LB8 A;  3S9E A;  3O6H A;  1A54 A;  3K1M A;  3MPL A;  3S9N C;  3IB1 A;  2A5T A;  1IIW A;  5EYF A;  4ZDM A;  3U93 A;  1ATG A;  3ECR A;  5I2K A;  1CB6 A;  1P1O A;  3OXN A;  2Y84 A;  1FQD A;  3MW0 A;  2XXX A;  4ZEF A;  3TCG A;  4F3P A;  1QKB A;  2THI A;  4AB6 A;  3DP6 A;  3C35 A;  3MP6 A;  1B4H A;  2A5S A;  4YMA A;  1FQA A;  4N13 A;  3VLV A;  4KFQ A;  3IX1 A;  3PMX A;  4XXU A;  1AL3 A;  1LFI A;  2M8C A;  2ONK E;  4LZ8 A;  3M3K A;  4FAT A;  3VVE A;  1VFE A;  1NH8 A;  1H44 A;  3JV9 A;  2V93 A;  3QSL A;  4DE8 A;  4QFL A;  1I6A A;  2Q2C A;  1FQE A;  2XXW A;  2QS2 A;  5I56 A;  5DEX B;  1SI0 A;  3W15 C;  1IZ1 A;  2PBW A;  4MF3 A;  4ECF A;  5FHM A;  3IK6 B;  3MZ9 A;  3UK4 A;  2VP1 A;  1RKM A;  2B3F A;  4LAT A;  4HTG A;  4OMB A;  5TP9 A;  3S9M C;  4FAJ A;  3KSJ A;  2B3B A;  4P11 A;  1ZJL A;  3L6G A;  4HCW A;  4EF2 A;  2V3U A;  5AA2 A;  1OQG A;  3CSG A;  4IO7 A;  3G3F A;  1M5C A;  5DTB A;  4IGR A;  4F18 A;  4PE5 B;  3Q27 A;  4GXS B;  4JXI A;  3OO7 A;  1MPB A;  5KZT A;  1JEU A;  2H99 A;  3PUZ E;  2ZMB A;  1MQH A;  1R1N A;  2FNC A;  2XX9 A;  4X1B A;  4POW A;  2O84 X;  3O66 A;  2CZL A;  2DOJ A;  1B58 A;  4H1X A;  1JNF A;  4PQJ A;  1PC3 A;  3KGC A;  1N76 A;  3QYT A;  1XVX A;  4JDF A;  3PUW E;  1I69 A;  2GRV A;  2F36 A;  3E9X A;  2DE2 A;  5I2N B;  3V8X B;  4TLM B;  4EQ7 A;  5KCJ B;  1LFG A;  3A09 A;  3S2V A;  1B5I A;  1NMU A;  4O3C A;  5A5X B;  1PEB A;  3HHF A;  2Y7K A;  1PBQ A;  2OJT A;  1XHY A;  1WDN A;  1QW0 A;  4IO6 A;  4KYS A;  2DP8 A;  3T9H B;  4H67 A;  4OEN A;  2ZNT A;  2ZNU A;  1HSJ A;  2G29 A;  1R6Z A;  5I58 A;  3FJM A;  3C4M A;  1P1W A;  3IOT A;  2HCA A;  2QL3 A;  3C33 A;  3Q29 A;  4OFO A;  5ITP A;  1OQH A;  2UXA A;  1ELJ A;  5KCJ A;  2UVJ A;  4I8C A;  4EQ9 A;  3FGS A;  4EXK A;  3FIR A;  3N94 A;  3F11 A;  1GV8 A;  4ZEK A;  3QAX A;  3CSB A;  1QJM A;  1US4 A;  4R73 A;  4THI A;  4HW8 A;  3KN8 A;  1FCK A;  2G93 A;  4LVQ A;  3TCF A;  2HZL A;  3K00 A;  4I9D A;  2DE4 A;  1ZLQ A;  5AA4 B;  5BUU A;  1AH5 A;  1D4N A;  1LGB C;  4OFJ A;  3T93 B;  1UTB A;  5LOM A;  4EUO A;  1B0L A;  3HPI A;  3IOR A;  4R75 A;  2F35 A;  1URD A;  1QUJ A;  2DXR A;  4YB6 A;  3K02 A;  2F7B A;  4MFI A;  3C31 A;  5I57 B;  5DT6 A;  3TQW A;  5FTH A;  1MQG A;  3C9H A;  4XTC Q;  3THI A;  4LQ5 A;  1N3X A;  4YKJ A;  3E3K A;  2YJP A;  4P0G A;  4F39 A;  4AB5 A;  5CM6 A;  3V89 B;  5FTI A;  5IKB A;  4POX A;  2ONS A;  1Y20 A;  4H8I A;  1SW2 A;  3R26 A;  3LSL A;  1JW1 A;  5JTY A;  2ZYK A;  4PFW A;  3MQ9 A;  2DWH A;  2O6A A;  2R71 A;  1A99 A;  1JVY A;  4R9F A;  1M5B A;  3O9P A;  2ALU A;  1B5J A;  4RPO A;  4JB7 A;  1USY E;  1Y4C A;  3H4Z A;  4PET A;  1PB8 A;  1D9Y A;  3OEN A;  5H8N A;  3R6U A;  5AE4 A;  4OEV A;  4X9T A;  3VV5 A;  4XKN A;  3RN8 A;  2YPN A;  3SEW A;  4C1T A;  3UOR A;  1AOV A;  4G68 B;  4IY5 A;  4L17 A;  1VR5 A;  1B6H A;  3H6V A;  5IAI A;  4KCC A;  1TWY A;  1O63 A;  4ELP A;  1FTM A;  5J1D A;  3N26 A;  1B3L A;  1B7Z A;  1H76 A;  3UA8 A;  2F97 A;  4PFY A;  1WOD A;  1FW0 A;  1MQJ A;  1B5H A;  2PVU A;  3IO6 A;  3LR1 A;  4ELR A;  4IO4 A;  4ZE8 A;  1TT1 A;  4H5G A;  5ITO A;  1FTJ A;  4IB2 A;  3W9V A;  1VSO A;  2PMS A;  4H6D A;  3CR9 A;  1USY H;  3H6W A;  3OEL A;  4OXV A;  4LA9 A;  2P1S A;  4NF6 B;  3O28 A;  1MXX A;  1UTH B;  4OEU A;  4E0W A;  1FQC A;  5F1Q A;  4KR5 A;  4IO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...