2Q88A

Crystal structure of ehub in complex with ectoine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
257
structure length
257
Chain Sequence
RDENKLEELKEQGFARIAIANEPPFTAVGADGKVSGAAPDVAREIFKRLGVADVVASISEYGAMIPGLQAGRHDAITAGLFMKPERCAAVAYSQPILCDAEAFALKKGNPLGLKSYKDIADNPDAKIGAPGGGTEEKLALEAGVPRDRVIVVPDGQSGLKMLQDGRIDVYSLPVLSINDLVSKANDPNVEVLAPVEGAPVYCDGAAFRKGDEALRDAFDVELAKLKESGEFAKIIEPYGFSAKAAMSTTREKLCAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Putative ABC transporter amino acid-binding protein
publication title Crystal structure of the ligand-binding protein EhuB from Sinorhizobium meliloti reveals substrate recognition of the compatible solutes ectoine and hydroxyectoine.
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 81
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2007-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2q88A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2q88A02
3MUQA 1JVYA 1UIVA 2F97A 5ITPA 3G3KA 3FASA 2H9BA 3UN6A 5I2NB 3EHUA 4N6PA 5BWJA 4RPNA 4XKQA 1N76A 1FQFA 2Y7IA 4EXKA 2P2AA 2O84X 4F39A 1DTGA 3IOWA 3LUYA 1Z7ME 2V3UA 3Q25A 4QSDA 2DWHA 4NEDA 3CFXA 3IB0A 3IOUA 2RCBA 4Q5TA 4IGTA 3LSWA 1WVJA 2HZLA 4NF4B 1QKAA 2FNCA 4GVOA 1VR5A 3C9HA 1GR2A 4F3BA 1LFIA 1AIVA 2NXOA 3MVXA 2AL4A 5AA4A 5JK4A 2V3QA 2VD3A 1OIBA 4M4GA 3CR9A 1MS7A 2RC8A 3CG1A 4YB7A 2VGQA 1LAGE 4KQPA 1OQHA 4WXJA 4YKPA 5M2VA 2PYYA 2QS3A 2F7BA 2ZNUA 3RTWB 3UORA 2YLNA 1IZ1A 3T9HB 2XX7A 1SW1A 1B3HA 5I59B 3THIA 4R6YA 2AL5A 3HHGA 1B3LA 1SI0A 2DE3A 2ZYNA 2DSFA 3K2DA 3H06B 3TTKA 4GLIA 5TPAB 4EQ9A 2QL3A 4QF9A 3CG3A 3FJ7A 1D3KA 3R26A 2I0BA 3FVGA 4OYVA 3U72A 2O69A 5KCJB 2QS1A 3L6GA 1A8FA 1Y1ZA 2FYIA 3K6XA 5JTYB 1S9TA 4MH5A 1MQDA 4FEDA 3C34A 4RPOA 4R9GA 4HW8A 5BUUA 1A54A 3FATA 1QW0A 1P1UA 1ZU0A 2IEEA 2BJJX 2QRYA 1R9LA 5IKBA 4OWDA 4IO7A 4U4SA 4AB6A 3V8XB 4ZDMA 1LGBC 1JEUA 1VE4A 2RINA 4X48A 2RC9A 4EXLA 3TCFA 2ONKE 3SESA 4YB5A 4ZZEA 5DVFA 2OCUA 5ISUA 4N13A 4R73A 4HS7A 1SD3A 4YICA 4IO3A 2B3FA 4PE5B 1URGA 3VV5A 2F5XA 4RK2A 1M5DA 2H4IA 2H5YA 3FGSA 5ICQA 1QUJA 4U4XA 4F18A 4ELPA 4F29A 3GBAA 2X26A 3SEWA 4JSDA 4GXAA 3KZGA 5DYHA 4RY1A 1POTA 3TELA 2A5TA 4R2FA 2THIA 5JTYA 2Z23A 3H03A 2PT2A 1IIWA 3C36A 3S9MC 3TZAA 1MXYA 2XXVA 1LB8A 1PBPA 4P11A 1Y1MA 2UYEA 1LFGA 4OTEA 1SYIA 3N5LA 3UK4A 1Y3NA 1YPNA 3IAZA 4GD5A 2O7IA 4H6DA 1FQBA 1N84A 2I4CA 1Y20A 3KOTA 2Z8EA 3PUYE 4BLAA 4Z0IA 2DE2A 3CSGA 3WAEA 3MZ1A 1TXFA 2PT1A 1AOVA 1EU8A 5L9MA 1B9JA 5K2XA 2HCAA 4YKKA 2HAUA 3PD9A 1SVXB 3G3FA 4X1BA 3VDFA 4HCYA 2XXQA 1I6BA 3H6VA 3PMXA 2DVZA 3PUXE 4YKIA 1B0HA 2NOOA 2UVHA 4POXA 1B3EA 2Y7RA 4QFOA 3S4UA 1USYE 4U21A 3CI8A 3N94A 4IB2A 1B58A 1P1NA 5I57B 1B1HA 3ILUB 3G3IA 3N6UA 3HSTA 1YTVA 4BDLA 3LSFB 3KFMA 2NUVA 3RN8A 4OZ9A 4ISUA 1FTJA 1R9QA 1UIUA 4IO5A 1II5A 1MDQA 3IR1A 3KJ7A 4RXLA 1O63A 3KBRA 1ATGA 2H25A 1YAEA 2Q89A 1MXZA 5FHOA 4YU0A 1FCKA 3KN8A 3C32A 4WEPA 2R9JA 4PQJA 3RQTA 1B7UA 4U2RA 5L9OA 4H8JA 3HV1A 4R2BA 1O7TA 3VLWA 1DPPA 4ZEKA 3K0VA 1R1NA 1FTOA 5KDTB 1H43A 5A5XB 4KHZE 1DMBA 3PPPA 3B6QA 2ZXTA 1OMPA 2XHDA 3SETA 1SQYA 3RTFB 4M1VA 2XXPA 3OO8A 4NTLA 1ELJA 2F34A 3TTRA 2XXIA 5K2YA 3PPOA 4RNSA 3H7MA 3GLBA 4QSEA 3BBRA 3OO6A 5L9SA 1AMFA 2LAOA 5DEXA 4ELQA 3K1MA 3MPKA 4BDMA 4IY5A 1Q35A 4KCDA 3SKPA 4O3AA 1A99A 3MVYA 4WKMA 3D4CA 1M5EA 3KEIA 1I6QA 5CMMA 3U1OA 3UP9A 4YZZA 1MH3A 1NKXA 3SEUA 1PC3A 4F3GA 3FUZA 1N04A 4U1ZA 2QJEA 4Z7EA 3ODBA 4QFNA 4JWXA 4GRKA 1GVCA 1SW2A 3IJOB 2ZYMA 3EHTA 1RKMA 2O1MA 1JETA 2QS4A 4LVQA 2XD3A 3TTNA 5KDTA 3TUSA 1IUDA 3JV9A 3FVNA 1LBBA 2GHBA 3Q27A 4I8CA 3OSQA 4G2ZA 3HN0A 5HPQA 4NF6B 4P0IA 3FV2A 4ZEIA 3O9PA 3I3VA 4OVJA 3FXRA 1B4HA 1US5A 2DS9A 3S2VA 4C1TA 3RY3A 3TTLA 4FAJA 1NNTA 1FW0A 2XX8A 2QMWA 4OXVA 3LR1A 2XX9A 5I56B 3TTMA 2V3TA 4NF8B 3O29A 1BP5A 3EF7A 1BIYA 2REGA 3EHSA 3MP8A 1BTJA 1FQEA 2DYXA 5FHMA 3QUJA 4F1VA 4XKRA 1A7LA 3H6UA 4R6HA 3H6TA 3KG2A 1XVXA 4ZEBA 1I69A 3E9XA 4ZZAA 3H4ZA 4PETA 4QHQA 1OQGA 3IO6A 5DVIA 4MF3A 3V89B 4BDQA 4G77A 4KPTA 3F11A 3C33A 3PU5A 3U94A 4ONYA 4YAHX 2GRVA 1I6AA 4KD5A 4RA1A 5I2KB 3K6WA 4TQUQ 3V5AA 1NNPA 3DM0A 3OO7A 1HSLA 2OBGA 3R6UA 5H8SA 1NH8A 4QFKA 3H3GA 1LB9A 1ANFA 3T9XB 5I2NA 2RCAA 5I84A 2Q9TA 5AA2D 1LCFA 3JYRA 2HXWA 3G3GA 4POWA 2Z8DA 3SEXA 2ZNSA 1TT1A 3K00A 1MQGA 2I58A 4TOZA 4ESWA 5B7DA 3IB2A 4FE8A 4HCWA 1EH3A 1IITA 2HEUA 5I58B 4NWDA 2F7CA 3QSLA 4NF4A 1P1OA 3OMBA 3P7IA 1SW5A 1IEJA 2DWJA 1B40A 1XVYA 3B6TA 2Z22A 5DTBA 5CC2A 4R9FA 4JBZA 1ZJLA 4NF5B 2GH9A 5FHNA 2Q2AA 3O66A 4GOTA 4QFLA 3MJNA 3TEPA 3IB1A 3ZKLA 1PB7A 2I0CA 4H1XA 5AA1A 3E13X 4FATA 2WKYA 4DXBA 4KCCA 2F35A 2GHAA 3A3UA 1R6ZA 5I59A 1MQJA 3KSXA 2XXTA 3IOVA 1OVBA 3TAJA 5EHSA 1M5FA 5AA3A 3MVWA 2F8DA 2G29A 2VHAA 4KYDA 5TPAA 1LAFE 4DIGA 3MPLA 4JWOA 2X7QA 1B7ZA 3PUWE 1POY1 2M8CA 4OEUA 4ZEFA 1Z7NE 4OESA 1LBCA 1TWYA 5CRYA 1USYH 1L5TA 4QSCA 3O6HA 3ZSFA 1MY4A 4PFTA 5I58A 5H8QB 5KCJA 4XXUA 2DWIA 4JB7A 1J1NA 2O7UA 3M3FA 2FA7A 4F3PA 4KR5A 1UTBB 2HFBA 4AB5A 2DP8A 3MC2A 3SEYA 3O2AA 3U93A 3HCQA 4LATA 4OETA 3VLUA 4F19A 3Q28A 1VFEA 4P0GA 4EDPA 4X9TA 2O1LA 2UVIA 4IO6A 4TLLB 4EQBA 1GV8A 2ONSA 4OFOA 2AIXA 2O51A 4LA9A 4K3FA 2O68A 1JW5A 3D4GA 1D9YA 4PFYA 4JSOA 1MPCA 1Y4CA 3W9VA 3VXBA 2XXWA 2H99A 4DLDA 1T0KA 4DDDA 1MPBA 4GQOA 3OEKA 3FJMA 4Q0CA 1QUIA 3CRBA 2QSXA 3QYTA 5HM4B 1Y3PA 1ZTYA 4H5FA 2DQVA 4F1UA 1JEVA 1B7HA 4H0WA 3MWBA 1XT8A 1ZBMA 3QXMA 3OD7A 2F6GA 3GZGA 4ZECA 5F7VA 2UXAA 5B70A 4JDFA 3E3KA 1B0LA 3WAFA 4ESXA 4YMBA 4G68B 3T66A 1TFAA 4MLVA 3RT8A 4FEBA 4N07A 3IJXB 3RPWA 4BDNA 4EF2A 1JNFA 1BLFA 2F78A 3OEMA 2GFEA 2KLFA 4NWCA 3V83A 1CB6A 1N7WA 3OELA 4F2OA 2QS2A 1Q1KA 1B32A 1SW4A 1MDP1 4OMBA 2OZZA 1QJMA 1N3WA 4H8IA 1B5HA 2RF1A 3LC8A 3KN3A 2I49A 1PB8A 2RC7A 5ITOA 1OLCA 5ICTA 1LSTA 2A5SA 4G8MA 1B5JA 2W7YA 1HSEA 3MW0A 3RNNA 1SBPA 4O3CA 2D21A 2REJA 1A55A 4U23A 3T96B 4I1DA 3I6VA 3T22A 3AXFA 4TLMB 4IO4A 3SEVA 2XXYA 3IORA 3PMVA 4FIMA 5H8HB 4ELRA 4ZE9A 1MY0A 5H8FB 1MQIA 1DOTA 4DCXA 3O97A 4C1UA 3M3KA 4I62A 3K6VA 5I57A 1PDAA 3JZJA 3FV1A 3CFZA 3T9UA 3LSXA 4RJZA 4DXUA 1WDNA 4KYEA 1US4A 2D5WA 3MP6A 3OO9A 3KSJA 3RGYA 1URSA 1OLAA 2Y84A 3OENA 5CMCA 2E1SA 2DXRA 2D3IA 1ZKBA 4ZE8A 2VOZA 3DLNA 1SI1A 4O3BA 2ALUA 2VD2A 1KWHA 2NWJA 1IXIA 3MZ9A 3K01A 4NE4A 4LZ8A 1B5IA 1ZIUA 2X7PA 2F7AA 4E0WA 1UQWA 3U92A 1TFDA 1MPDA 1LLSA 3B6WA 2ZYOA 4G8NA 1DTZA 4IY6A 3VFJA 2Y7PA 3O6GA 5A5XA 1ZMGA 1YCJA 5AA4B 4PP0A 4DXCA 4R74A 3OOAA 1EZ9A 1SDXA 1Y3QA 1A40A 5L8DA 3B7DA 2OK2A 5H8FA 1AL3A 1MQHA 3TPAA 2HZKA 4ECFA 1AH5A 1XHYA 1FQCA 3S9NC 2XXXA 5AE4A 3BKIB 1N3XA 3TQWA 3VE1B 4KI0E 3N6TA 5H8NB 2AYSA 2I4BA 4ND9A 1JW1A 4LQ5A 1XC1A 3KGCA 4HTGA 2I6EA 4LONB 3UA8A 3ONMA 3DP8A 3BFTA 3T9VA 5CBSA 1P1WA 3FJGA 1VFDA 4YKJA 3O6IA 3Q29A 1H76A 1NNFA 4JXIA 3EPEA 4WEDA 4OERA 3KJTA 5CI5A 1MXXA 1NNKA 4R75A 2UVGA 2F6PA 3USDA 2Q88A 1O64A 2XD2A 3PPRA 3U8QA 1DPEA 1OVTA 2Y7KA 3M3LA 4GIZA 1PB9A 3FXQA 3MQ9A 4OENA 1DSNA 4NF6A 1HSJA 2YJPA 4I9DA 4R6KA 4EUOA 1UTHB 3DELB 1SYHA 4F22A 4H65A 3HPIA 1QULA 1D4NA 1MH4A 2PX1A 3SERA 5I56A 4NF8A 3K02A 5H8NA 4XIGQ 1MXUA 3PPQA 5JEIA 2CZLA 3PMWA 4KYSA 4Q8RA 1Y4TA 2Z8FA 2B65A 2V93A 1LFHA 3C4MA 3CVGA 2OLBA 1XOCA 2XXUA 1RYOA 3FVOA 4RK9A 5F1QA 4FECA 1B1XA 1H45A 2G93A 3TFLA 4RYAA 1GGGA 2DWAA 4OEVA 2PVUA 2A5TB 2P0SA 4X1DA 1LCTA 1Y9UA 1P1QA 4KFQA 3TCHA 3O28A 3FXUA 1QUKA 1FQDA 3TCGA 4FJPA 3DP6A 2QPQA 3M8UA 3PD8A 3TQLA 4ZEDA 2RKMA 4GL8A 5I2KA 4QFPA 3IK6B 4UA8A 3VVDA 1JQFA 3EN3A 1P99A 1UTHA 5EHMA 4ZS9A 2DVCA 2DE4A 3L6HA 4OQOA 5J1DA 1A8EA 1NMUA 4IGRA 2F36A 4XKNA 5TU0A 3UGWA 1JW4A 1BKAA 5FTHA 1NH7A 3ECRA 2R71A 1IQ7A 2OWSA 3G3HA 1MXVA 3IOTA 1NL5A 5ELVA 4EF1A 3MVZA 5HBCA 3IO4A 5CMBA 1B05A 4H67A 1N7XA 3DP4A 5DT6A 1IXHA 3RUMA 4BDRA 1FTMA 3VXCA 3ZS6A 4GF8A 4NF5A 4C0RA 4LQ2A 3OSRA 3QK6A 4G68C 2OJTA 1QKBA 3H6WA 5KZTA 4GFRA 3S9LC 2QMXA 3MBPA 2ABHA 1H44A 3W15C 1M5BA 4EQ7A 3A3CA 5EYFA 3QUFA 1EZOA 2V25A 1JVXA 4F31B 3CSBA 4H5GA 1MXWA 1B2HA 2HAVA 2V84A 1MM6A 5FTIA 1MY1A 1N0TA 3W9WA 3VVEA 5DVJA 2P1SA 2DOJA 2OWTA 3E4RA 4FORA 3GBBA 2ZMBA 1S50A 1D9VA 1QVSA 2E0SA 4GL0A 3HHFA 2Q8JA 4OFJA 3ILTB 3TMGA 3QIMA 2CMOA 3C35A 4GXSB 5H8QA 4G8HA 5CBRA 1LAXA 3K1NA 3C31A 2PBWA 4U22A 3VLVA 4IO2A 2I48A 4G4PA 1GTKA 1UTBA 3CFLA 3K4UA 3FD3A 5CM6A 4LP2B 3ZKKA 3SDFA 1FTLA 1B4ZA 1IXGA 4MFIA 1B51A 2IA4A 4R72A 3S9EA 2UYFA 1MG1A 2Y7WA 1LAHE 4OFLA 4PFWA 3Q26A 2R6GE 3K6UA 4PFUA 4XKPA 5DEXB 1B46A 2VP1A 5AA2B 3TKDA 1RYXA 2ONRA 3RLFE 1S7YA 3LBSA 4UACA 2ANJA 1H3DA 4AQ4A 3VVFA 3EQ1A 3PV0E 2YPNA 3A09A 4L17A 5CMKA 4OHNA 4DZ1A 2H98A 1FTKA 5TP9B 3PPNA 4MBPA 3TODA 4NMYA 3N26A 3FZVA 1PBQA 4G68A 3QAXA 3FIRA 3R7XA 3MAMA 1NFTA 4THIA 3G7WA 4F3SA 1F9BA 1PEBA 3OXNA 5IAIA 1MY2A 2O6AA 1MRPA 2Q2CA 2ZYKA 2UVJA 1B6HA 4JWYA 1XS5A 3T93B 2NVUB 3MP1A 1EZPA 3TYHA 4GWOA 3CIJA 4LZ7A 3K1PA 2PMSA 3HO7A 4LUBA 3UIFA 3G3JA 1ZLQA 3PGFA 1FQAA 4LZ5A 3I5OA 4F2QA 5AA2A 3PUVE 1WODA 4BDOA 4MLQA 1B3FA 1MY3A 3KOSA 4YMAA 1MM7A 1B52A 2XXRA 2HQ0A 4ELOA 5LOMA 4XTCQ 4U1OA 3GXAA 1M5CA 4YB6A 2ESNA 3BFUA 2B3BA 3TDJA 4DE8A 1VSOA 4Q30B 5TP9A 3PUZE 3IL1B 4DCYA 2DXYA 3LSLA 3RT6B 2I3WA 4E0XA 2XXHA 2I3VA 5H8HA 3KN7A 4QRZA 1IXCA 4F1YA 3FVKA 1CE2A 1URDA 2ZNTA 3MZBA 3IX1A 1B3GA
chains in the Genus database with same CATH superfamily
3MUQA 1JVYA 1UIVA 4O7MA 4XF5A 2F97A 5ITPA 1NV5A 3G3KA 1RDYA 3FASA 1FPGA 2H9BA 3UN6A 5I2NB 3EHUA 4N6PA 5BWJA 4RPNA 5ET7A 4XKQA 1N76A 1FQFA 2Y7IA 4EXKA 2P2AA 2O84X 4F39A 1DTGA 3IOWA 3LUYA 4PC9A 1Z7ME 2V3UA 3Q25A 4QSDA 1NUYA 2DWHA 4NEDA 4GBWA 3CFXA 4GBVA 3IB0A 4XEQA 3IOUA 2RCBA 4OA4A 4Q5TA 4IGTA 3LSWA 1WVJA 2BJIA 2HZLA 2CEXA 4NF4B 1QKAA 2FNCA 4GVOA 1VR5A 3C9HA 1GR2A 4F3BA 1LBYA 2HXRA 1LFIA 2XXKA 1AIVA 2NXOA 3MVXA 2AL4A 5AA4A 4HE2A 5JK4A 2V3QA 4JVCA 2XWIA 2VD3A 5F24A 1OIBA 4M4GA 4N8YA 2MKZA 3CR9A 1MS7A 2RC8A 3CG1A 4YB7A 2VGQA 1LAGE 4KQPA 1OQHA 4WXJA 2HPGA 4YKPA 5M2VA 2V4CA 2PYYA 2QS3A 2F7BA 3PTYA 2ZNUA 1LBVA 1FPIA 3RTWB 3UORA 2YLNA 1IZ1A 3T9HB 2XX7A 1SW1A 1B3HA 5I59B 3THIA 4R6YA 2AL5A 3HHGA 1B3LA 1SI0A 2DE3A 2ZYNA 2DSFA 3K2DA 3H06B 3TTKA 4GLIA 2JJKA 4XFEA 5TPAB 4EQ9A 2QL3A 4QF9A 3CG3A 3FJ7A 4GWWA 1D3KA 3R26A 2I0BA 3FVGA 4GWZA 4OYVA 3U72A 2O69A 5KCJB 4PAFA 2QS1A 2FIEA 3L6GA 5J16A 1A8FA 1Y1ZA 5FBPA 1FPLA 4MNPA 2FYIA 3K6XA 5JTYB 1S9TA 4MH5A 1EYIA 1MQDA 4FEDA 4NGUA 3C34A 4RPOA 4R9GA 4HW8A 5BUUA 1A54A 3FATA 1Q9DA 1QW0A 1P1UA 1ZU0A 2IEEA 2BJJX 2QRYA 1R9LA 5IKBA 4OWDA 4IO7A 4U4SA 4AB6A 1SPIA 3V8XB 4ZDMA 2OX3A 3D1RA 1LGBC 3ISPA 1JEUA 1VE4A 2RINA 2QFLA 4X48A 2RC9A 4EXLA 3TCFA 2ONKE 3SESA 5IZ3B 4YB5A 4ZZEA 5DVFA 2OCUA 5ISUA 4N13A 4R73A 4MNCA 4HS7A 1SD3A 4YICA 4PGNA 4IO3A 2B3FA 4PE5B 1URGA 3VV5A 2F5XA 4RK2A 4I3EA 1M5DA 2KR0A 2H4IA 2H5YA 3FGSA 5ICQA 1EYKA 3A29A 1QUJA 4U4XA 4F18A 1VDWA 4ELPA 4F29A 3GBAA 2X26A 2Y5KA 3SEWA 4JSDA 4GXAA 3CHGA 1RDXA 3KZGA 5DYHA 4RY1A 2ZZVA 1POTA 3QMFA 3TELA 2A5TA 2FBPA 4R2FA 2THIA 5JTYA 2Z23A 5ET6A 3H03A 2PT2A 1IIWA 3C36A 3S9MC 3TZAA 5LDZA 2FIXA 1MXYA 2XXVA 1LB8A 1PBPA 5EQ9A 4P11A 1Y1MA 2UYEA 1INPA 1LFGA 4OTEA 1NV1A 1SYIA 3N5LA 3UK4A 1Y3NA 1YPNA 3IAZA 4GD5A 2Y5LA 2O7IA 4H6DA 1FQBA 1N84A 2I4CA 1Y20A 5IZ3A 4DI4B 3KOTA 2Z8EA 3PUYE 4BLAA 4AS4A 4Z0IA 5EQAA 2DE2A 3CSGA 3WAEA 3MZ1A 1TXFA 2PT1A 3T0JA 1AOVA 1EU8A 5L9MA 1B9JA 1NUWA 5K2XA 2ZZWA 1IMBA 2HCAA 4YKKA 2HAUA 3PD9A 4IR8A 1SVXB 3G3FA 4X1BA 3VDFA 4HCYA 2WYPA 3SZPA 2XXQA 1I6BA 4NQ8A 2WEFA 3H6VA 3PMXA 2DVZA 5LTCA 1RDZA 3PUXE 4YKIA 1B0HA 2NOOA 2UVHA 4POXA 1B3EA 2Y7RA 4QFOA 3S4UA 1USYE 4U21A 4LN5A 3CI8A 4P9KA 5ET8A 3N94A 4IB2A 1B58A 4G61A 1P1NA 5I57B 4N8GA 1B1HA 3ILUB 3G3IA 3N6UA 4MEVA 3HFUA 3HSTA 4PFBA 1YTVA 4BDLA 3LSFB 4P8BA 3KFMA 2NUVA 3RN8A 4OZ9A 4ISUA 1FTJA 1R9QA 1UIUA 4PDDA 4HE0A 4IO5A 1IMDA 4P3LA 1II5A 1FPJA 1MDQA 2QVUA 3IR1A 3KJ7A 4RXLA 1O63A 3KBRA 4OVPA 1ATGA 2H25A 5ESYA 1YAEA 1NV0A 2Q89A 1MXZA 5FHOA 4YU0A 1FCKA 3KN8A 3C32A 4WEPA 2R9JA 1NUXA 4PQJA 3RQTA 1B7UA 4U2RA 5L9OA 4H8JA 3HV1A 1QGXA 3IFCA 4R2BA 1O7TA 3VLWA 1DPPA 4ZEKA 3K0VA 3BIHA 2P3VA 1R1NA 1FTOA 5KDTB 1H43A 5A5XB 4KHZE 5I3SA 1DMBA 5EYGA 3PPPA 3B6QA 2ZXTA 1OMPA 2XHDA 2PCRA 3E79A 3SETA 1SQYA 3RTFB 4M1VA 2XXPA 3OO8A 4NTLA 1ELJA 2F34A 3TTRA 2XXIA 4JVDA 5K2YA 3PPOA 4NN3A 4RNSA 3H7MA 3GLBA 4QSEA 3BBRA 3OO6A 5L9SA 4PTKA 1AMFA 2LAOA 5DEXA 4ELQA 3K1MA 3MPKA 4BDMA 4IY5A 5IM2A 1Q35A 1CNQA 4KCDA 3SKPA 4O3AA 1A99A 3MVYA 4WKMA 4MAGA 3D4CA 1M5EA 3KEIA 1I6QA 5CMMA 1FJ9A 3U1OA 3UP9A 4YZZA 4NG7A 1MH3A 1NKXA 1PC3A 3SEUA 4F3GA 3FUZA 1N04A 4U1ZA 2QJEA 2FVZA 4Z7EA 4PF6A 3ODBA 4QFNA 4JWXA 4GRKA 1GVCA 1SW2A 3IJOB 2ZYMA 3EHTA 1RKMA 2O1MA 1JETA 4X04A 2QS4A 4LVQA 2CZKA 2XD3A 5EYHA 3TTNA 5KDTA 3TUSA 1IUDA 3JV9A 3FVNA 3FXBA 1LBBA 2GHBA 3Q27A 4I8CA 3RPLA 3OSQA 1NV4A 4G2ZA 3HN0A 5HPQA 4NF6B 4P0IA 3FV2A 4ZEIA 3O9PA 3I3VA 5EQ8A 1YYZA 4OVJA 4GX6A 3FXRA 1B4HA 1US5A 2DS9A 3S2VA 4C1TA 3RY3A 3TTLA 4FAJA 1NNTA 1FW0A 2XX8A 2QMWA 4OXVA 3LR1A 2XX9A 5I56B 3TTMA 2V3TA 4NF8B 3O29A 1BP5A 3EF7A 1BIYA 2REGA 4GWUA 3EHSA 3MP8A 1BTJA 1FQEA 2DYXA 5FHMA 3QUJA 5I5PA 3NOHA 4F1VA 4XKRA 1A7LA 3H6UA 4R6HA 3H6TA 3KG2A 4OANA 1XVXA 4ZEBA 1I69A 3E9XA 4ZZAA 3H4ZA 4PETA 4QHQA 1OQGA 3IO6A 5DVIA 4MF3A 3V89B 4BDQA 4G77A 4KPTA 3F11A 4JVIA 3C33A 1KA0A 3MSTA 3PU5A 3U94A 4ONYA 4HXVA 4YAHX 2GRVA 1I6AA 4KD5A 4RA1A 5I2KB 3K6WA 4N15A 4TQUQ 3V5AA 1NNPA 3DM0A 1NV3A 3OO7A 1HSLA 2OBGA 3R6UA 5H8SA 1NH8A 4QFKA 4NHBA 3H3GA 1IMCA 1LB9A 1ANFA 3T9XB 5I2NA 4GWXA 3EKIA 2RCAA 5I84A 2Q9TA 2VT5A 5AA2D 1LCFA 3JYRA 2HXWA 3G3GA 4POWA 2Z8DA 3SEXA 2ZNSA 1TT1A 3K00A 1MQGA 2I58A 4TOZA 4ESWA 5B7DA 3IB2A 4FE8A 4HCWA 1EH3A 1IITA 2HEUA 5I58B 4NWDA 2F7CA 3QSLA 4NF4A 1P1OA 3OMBA 3P7IA 1SW5A 1IEJA 2DWJA 1B40A 1XVYA 3B6TA 4NAPA 2Z22A 3KC0A 2L5VA 5DTBA 5CC2A 4R9FA 4JBZA 3BIGA 1ZJLA 4NF5B 2GH9A 4PFRA 1FTAA 5FHNA 1NV2A 2Q2AA 3O66A 4GOTA 4QFLA 1YZ0A 3MJNA 3TEPA 3IB1A 3ZKLA 1PB7A 2I0CA 4H1XA 5AA1A 3E13X 4I40A 4FATA 2WKYA 1FBPA 4DXBA 4KCCA 2F35A 2GHAA 3A3UA 1R6ZA 1G0HA 5I59A 1MQJA 3KSXA 2XXTA 3IOVA 1OVBA 3TAJA 5EHSA 2CZIA 1M5FA 5AA3A 3MVWA 2F8DA 4QXDA 2G29A 2VHAA 4KYDA 5TPAA 1LAFE 4DIGA 3MPLA 4JWOA 2X7QA 1B7ZA 3PUWE 1POY1 3B8BA 2M8CA 3ROJA 1G0IA 4OEUA 4ZEFA 1Z7NE 5T3JA 2KQZA 2VPOA 4OESA 1LBCA 1TWYA 5CRYA 1USYH 1L5TA 5ET5A 4QSCA 3O6HA 3ZSFA 1MY4A 4PFTA 5I58A 5H8QB 5KCJA 4XXUA 2DWIA 4JB7A 1J1NA 2O7UA 3M3FA 2FA7A 4F3PA 4KR5A 1UTBB 2HFBA 4AB5A 2DP8A 3MC2A 3SEYA 3O2AA 3U93A 3HCQA 4LATA 4OETA 3VLUA 2FHYA 4F19A 3Q28A 1VFEA 4P0GA 3IFAA 4OVTA 4EDPA 4N4UA 4X9TA 2O1LA 2UVIA 2Q74A 4IO6A 2R8TA 4TLLB 4EQBA 1GV8A 2ONSA 4OFOA 2AIXA 2GQ1A 2O51A 4LA9A 4K3FA 4PBHA 2O68A 1JW5A 3D4GA 1D9YA 4PFYA 4JSOA 1FPBA 1MPCA 1Y4CA 3W9VA 4OVRA 2WYKA 3VXBA 2XXWA 3B50A 2H99A 4DLDA 1T0KA 4DDDA 1MPBA 4GQOA 3OEKA 3FJMA 4Q0CA 2PFZA 1QUIA 1LBZA 3CRBA 2QSXA 3QYTA 5HM4B 1Y3PA 1ZTYA 4H5FA 2DQVA 4F1UA 1JEVA 1B7HA 4H0WA 3MWBA 5IZZA 1FBFA 1XT8A 1ZBMA 3QXMA 3OD7A 2F6GA 3GZGA 4ZECA 4O7IA 5F7VA 2UXAA 1NV6A 4MMPA 5B70A 1FBCA 4JDFA 4KXPA 3E3KA 1B0LA 3WAFA 4ESXA 4YMBA 4O94A 4G68B 3T66A 1NI9A 1TFAA 4MLVA 3RT8A 4FEBA 4N07A 3IJXB 3RPWA 4PF8A 4BDNA 4EF2A 1JNFA 1BLFA 2F78A 4PCDA 4PBQA 3OEMA 2GFEA 2KLFA 4NWCA 3V83A 1CB6A 4OVSA 1N7WA 3OELA 4F2OA 2QS2A 1Q1KA 1B32A 1SW4A 1LEVA 1MDP1 4OMBA 2OZZA 1QJMA 1N3WA 4H8IA 1B5HA 2RF1A 1DCUA 3KN3A 2OWZA 2I49A 3LC8A 1PB8A 2RC7A 5ITOA 4MJOA 1OLCA 3LV0A 5ICTA 1LSTA 2A5SA 1LBWA 1B5JA 4G8MA 2W7YA 1HSEA 3MW0A 1FPDA 3RNNA 1SBPA 4O3CA 2D21A 2REJA 1A55A 4U23A 3T96B 4I1DA 3I6VA 3T22A 4P56A 2XWKA 3AXFA 4TLMB 4IO4A 3SEVA 2XXYA 3IORA 3PMVA 4FIMA 1EYJA 5H8HB 4ELRA 4ZE9A 1MY0A 5H8FB 1MQIA 1DOTA 4DCXA 3O97A 4C1UA 3M3KA 4I62A 3K6VA 5I57A 1PDAA 3JZJA 3FV1A 3CFZA 3T9UA 3LSXA 4MCOA 4RJZA 4DXUA 1WDNA 4KYEA 1US4A 2D5WA 3MP6A 1IMFA 3OO9A 3KSJA 3RGYA 4N6KA 1URSA 1OLAA 2Y84A 3OENA 4N81A 5IZ1A 5CMCA 2E1SA 4AS5A 2DXRA 2D3IA 1ZKBA 4ZE8A 2VOZA 3DLNA 1SI1A 4O3BA 2ALUA 2VD2A 3RYDA 1KWHA 2NWJA 1IXIA 3MZ9A 3K01A 4NE4A 4O8MA 4LZ8A 1B5IA 1ZIUA 2X7PA 2F7AA 4E0WA 1UQWA 3U92A 1TFDA 1MPDA 1KA1A 1LLSA 3B6WA 2ZYOA 4G8NA 1DTZA 4IY6A 3VFJA 2Y7PA 3O6GA 5A5XA 1ZMGA 1YCJA 5AA4B 4PP0A 4DXCA 4R74A 3OOAA 1EZ9A 1SDXA 1Y3QA 3T1BA 1A40A 5L8DA 3B7DA 2OK2A 5H8FA 1AL3A 1FBGA 1MQHA 3TPAA 2HZKA 3GYYA 4ECFA 1AH5A 1XHYA 1FQCA 3S9NC 2XXXA 3BKIB 5AE4A 1N3XA 4OVQA 3TQWA 4P47A 3VE1B 4KI0E 3N6TA 5H8NB 2AYSA 2I4BA 4ND9A 1JW1A 4LQ5A 1XC1A 3KGCA 4HTGA 2I6EA 4LONB 4I3YA 4PAIA 3UA8A 2HHMA 3ONMA 3DP8A 3BFTA 3T9VA 1DK4A 5CBSA 1P1WA 3FJGA 1VFDA 4YKJA 3O6IA 4PFIA 3Q29A 1H76A 1NNFA 4JXIA 3EPEA 4GWSA 2QVVA 4WEDA 4OERA 3KJTA 5CI5A 1FBEA 1MXXA 1NNKA 4R75A 2UVGA 5I7IA 2F6PA 3USDA 2Q88A 1O64A 3E78A 2XD2A 3PPRA 3U8QA 1DPEA 1OVTA 2Y7KA 3M3LA 4MIJA 1FPFA 4GIZA 1PB9A 3FXQA 3MQ9A 4OENA 1DSNA 4NF6A 1HSJA 2YJPA 4I9DA 1NV7A 4R6KA 4EUOA 1UTHB 3DELB 1SYHA 4HE1A 4F22A 4H65A 3HPIA 1QULA 1K9ZA 1D4NA 1MH4A 2PX1A 3SERA 5I56A 4NF8A 3K02A 5H8NA 4XIGQ 1MXUA 3PPQA 3KBZA 5JEIA 3PMWA 2CZLA 4KYSA 4Q8RA 1Y4TA 2Z8FA 2B65A 2V93A 1LFHA 3C4MA 3CVGA 4P1LA 2OLBA 1XOCA 2XXUA 1RYOA 3FVOA 4RK9A 5F1QA 4FECA 1B1XA 1H45A 2B4LA 2G93A 3KC1A 4MHFA 3TFLA 4RYAA 1GGGA 2DWAA 1K9YA 4OEVA 2WBDA 2PVUA 2A5TB 2P0SA 4X1DA 1LCTA 1Y9UA 1P1QA 4KFQA 3TCHA 3O28A 2XWOA 3FXUA 1QUKA 1FQDA 3TCGA 4FJPA 3DP6A 4N6DA 2QPQA 3M8UA 3PD8A 3TQLA 4ZEDA 2RKMA 4GL8A 5I2KA 1FBDA 3LUZA 4QFPA 3IK6B 4H46A 4UA8A 3VVDA 1JQFA 3EN3A 1P99A 1UTHA 5EHMA 4ZS9A 2DVCA 2DE4A 4NF0A 3L6HA 4OQOA 5J1DA 1A8EA 1NMUA 4IGRA 1FPEA 2F36A 4XKNA 5TU0A 1JP4A 1JW4A 3UGWA 4N17A 1BKAA 5FTHA 1NH7A 3ECRA 2XA5A 2R71A 1IQ7A 2OWSA 3G3HA 1MXVA 1XI6A 3IOTA 1NL5A 5ELVA 4EF1A 3MVZA 5HBCA 3IO4A 5CMBA 5A5LA 1B05A 4FBPA 5EQ7A 4H67A 1N7XA 3DP4A 5DT6A 1IXHA 3RUMA 4BDRA 1FTMA 2VPNA 3VXCA 3ZS6A 2WBBA 4GF8A 4GX3A 4NF5A 4C0RA 4LQ2A 3OSRA 3QK6A 4G68C 2OJTA 1QKBA 3H6WA 5KZTA 1D9QA 4GFRA 3S9LC 2QMXA 3MBPA 2ABHA 1H44A 3W15C 1M5BA 4EQ7A 3A3CA 4N91A 5EYFA 3QUFA 1EZOA 2V25A 1JVXA 4F31B 3CSBA 4H5GA 1MXWA 1B2HA 1AWBA 2B4MA 2HAVA 4MNIA 2V84A 1MM6A 5FTIA 2F3BA 1MY1A 1N0TA 3W9WA 2DDKA 3VVEA 5DVJA 1FJ6A 2P1SA 2DOJA 2QVRA 2OWTA 4H45A 3E4RA 4DI3D 2F3DA 4FORA 3MYUA 3GBBA 2ZMBA 1S50A 1D9VA 1QVSA 2E0SA 4GL0A 3HHFA 2Q8JA 4OFJA 4GX4A 3ILTB 4P1EA 2ZZXA 3TMGA 3QIMA 2CMOA 3C35A 4GXSB 5H8QA 4G8HA 1IMEA 5CBRA 1LAXA 3K1NA 3C31A 2PBWA 4U22A 4MX6A 3VLVA 4IO2A 2I48A 4G4PA 1GTKA 1DBZA 4UABA 1UTBA 3CFLA 3K4UA 3FD3A 5CM6A 4LP2B 3ZKKA 3SDFA 1FTLA 2CEYA 1B4ZA 1IXGA 4MFIA 1B51A 2P3NA 2IA4A 4R72A 3S9EA 2UYFA 1MG1A 2Y7WA 1LAHE 4OFLA 4PFWA 3Q26A 2R6GE 1YXIA 3K6UA 4PFUA 4XKPA 5DEXB 1B46A 1LBXA 2VP1A 5AA2B 3TKDA 1RYXA 2ONRA 3RLFE 1S7YA 3LBSA 4UACA 2ANJA 1KZ8A 1H3DA 4AQ4A 3VVFA 3EQ1A 3PV0E 2YPNA 3A09A 4L17A 5CMKA 4OHNA 4DZ1A 2H98A 1FRPA 1FTKA 5TP9B 3PPNA 4MBPA 3TODA 4NMYA 3N26A 3FZVA 1BK4A 1PBQA 4G68A 3QAXA 3FIRA 3R7XA 3MAMA 1NFTA 4THIA 1IMAA 3RPLB 2PFYA 3G7WA 4F3SA 1F9BA 1PEBA 3OXNA 5IAIA 1MY2A 2O6AA 1MRPA 2Q2CA 2ZYKA 1FBHA 1NUZA 2UVJA 1B6HA 4PGPA 4JWYA 1XS5A 3T93B 2NVUB 4QBAA 3MP1A 1EZPA 3TYHA 4GWOA 3CIJA 4LZ7A 3K1PA 3U65A 2PMSA 1FSAA 3HO7A 3FBPA 4LUBA 3UIFA 3G3JA 1ZLQA 3PGFA 1FQAA 4LZ5A 3I5OA 4F2QA 5AA2A 3PUVE 4GWYA 1WODA 4PAKA 4BDOA 4MLQA 5DW8A 1B3FA 1MY3A 3KOSA 5IGAA 4YMAA 1MM7A 1B52A 2XXRA 2HQ0A 4ELOA 5LOMA 4XTCQ 4NX1A 4U1OA 3GXAA 2WX9A 1M5CA 4YB6A 2ESNA 3BFUA 2B3BA 3TDJA 4DE8A 1VSOA 4Q30B 5TP9A 3PUZE 3IL1B 4DCYA 2DXYA 3LSLA 1FPKA 3RT6B 2I3WA 4E0XA 2XXHA 2I3VA 5H8HA 2CZHA 2XWVA 3KN7A 4QRZA 1IXCA 4F1YA 3FVKA 4PDHA 1CE2A 2Q8MA 4PE3A 1URDA 2ZNTA 3MZBA 4X8RA 3IX1A 1B3GA
chains in the Genus database with same CATH topology
3MUQA 1JVYA 1UIVA 2F97A 5ITPA 3G3KA 3FASA 2H9BA 3UN6A 5I2NB 3EHUA 4N6PA 5BWJA 4RPNA 4XKQA 1N76A 1FQFA 2Y7IA 4EXKA 2P2AA 2O84X 4F39A 1DTGA 3IOWA 3LUYA 1Z7ME 2V3UA 3Q25A 4QSDA 2DWHA 4NEDA 3CFXA 3IB0A 3IOUA 2RCBA 4Q5TA 4IGTA 3LSWA 1WVJA 2HZLA 4NF4B 1QKAA 2FNCA 4GVOA 1VR5A 3C9HA 1GR2A 4F3BA 1LFIA 1AIVA 2NXOA 3MVXA 2AL4A 5AA4A 5JK4A 2V3QA 2VD3A 1OIBA 4M4GA 3CR9A 1MS7A 2RC8A 3CG1A 4YB7A 2VGQA 1LAGE 4KQPA 1OQHA 4WXJA 4YKPA 5M2VA 2PYYA 2QS3A 2F7BA 2ZNUA 3RTWB 3UORA 2YLNA 1IZ1A 3T9HB 2XX7A 1SW1A 1B3HA 5I59B 3THIA 4R6YA 2AL5A 3HHGA 1B3LA 1SI0A 2DE3A 2ZYNA 2DSFA 3K2DA 3H06B 3TTKA 4GLIA 5TPAB 4EQ9A 2QL3A 4QF9A 3CG3A 3FJ7A 1D3KA 3R26A 2I0BA 3FVGA 4OYVA 3U72A 2O69A 5KCJB 2QS1A 3L6GA 1A8FA 1Y1ZA 2FYIA 3K6XA 5JTYB 1S9TA 4MH5A 1MQDA 4FEDA 3C34A 4RPOA 4R9GA 4HW8A 5BUUA 1A54A 3FATA 1QW0A 1P1UA 1ZU0A 2IEEA 2BJJX 2QRYA 1R9LA 5IKBA 4OWDA 4IO7A 4U4SA 4AB6A 3V8XB 4ZDMA 1LGBC 1JEUA 1VE4A 2RINA 4X48A 2RC9A 4EXLA 3TCFA 2ONKE 3SESA 4YB5A 4ZZEA 5DVFA 2OCUA 5ISUA 4N13A 4R73A 4HS7A 1SD3A 4YICA 4IO3A 2B3FA 4PE5B 1URGA 3VV5A 2F5XA 4RK2A 1M5DA 2H4IA 2H5YA 3FGSA 5ICQA 1QUJA 4U4XA 4F18A 4ELPA 4F29A 3GBAA 2X26A 3SEWA 4JSDA 4GXAA 3KZGA 5DYHA 4RY1A 1POTA 3TELA 2A5TA 4R2FA 2THIA 5JTYA 2Z23A 3H03A 2PT2A 1IIWA 3C36A 3S9MC 3TZAA 1MXYA 2XXVA 1LB8A 1PBPA 4P11A 1Y1MA 2UYEA 1LFGA 4OTEA 1SYIA 3N5LA 3UK4A 1Y3NA 1YPNA 3IAZA 4GD5A 2O7IA 4H6DA 1FQBA 1N84A 2I4CA 1Y20A 3KOTA 2Z8EA 3PUYE 4BLAA 4Z0IA 2DE2A 3CSGA 3WAEA 3MZ1A 1TXFA 2PT1A 1AOVA 1EU8A 5L9MA 1B9JA 5K2XA 2HCAA 4YKKA 2HAUA 3PD9A 1SVXB 3G3FA 4X1BA 3VDFA 4HCYA 2XXQA 1I6BA 3H6VA 3PMXA 2DVZA 3PUXE 4YKIA 1B0HA 2NOOA 2UVHA 4POXA 1B3EA 2Y7RA 4QFOA 3S4UA 1USYE 4U21A 3CI8A 3N94A 4IB2A 1B58A 1P1NA 5I57B 1B1HA 3ILUB 3G3IA 3N6UA 3HSTA 1YTVA 4BDLA 3LSFB 3KFMA 2NUVA 3RN8A 4OZ9A 4ISUA 1FTJA 1R9QA 1UIUA 4IO5A 1II5A 1MDQA 3IR1A 3KJ7A 4RXLA 1O63A 3KBRA 1ATGA 2H25A 1YAEA 2Q89A 1MXZA 5FHOA 4YU0A 1FCKA 3KN8A 3C32A 4WEPA 2R9JA 4PQJA 3RQTA 1B7UA 4U2RA 5L9OA 4H8JA 3HV1A 4R2BA 1O7TA 3VLWA 1DPPA 4ZEKA 3K0VA 1R1NA 1FTOA 5KDTB 1H43A 5A5XB 4KHZE 1DMBA 3PPPA 3B6QA 2ZXTA 1OMPA 2XHDA 3SETA 1SQYA 3RTFB 4M1VA 2XXPA 3OO8A 4NTLA 1ELJA 2F34A 3TTRA 2XXIA 5K2YA 3PPOA 4RNSA 3H7MA 3GLBA 4QSEA 3BBRA 3OO6A 5L9SA 1AMFA 2LAOA 5DEXA 4ELQA 3K1MA 3MPKA 4BDMA 4IY5A 1Q35A 4KCDA 3SKPA 4O3AA 1A99A 3MVYA 4WKMA 3D4CA 1M5EA 3KEIA 1I6QA 5CMMA 3U1OA 3UP9A 4YZZA 1MH3A 1NKXA 3SEUA 1PC3A 4F3GA 3FUZA 1N04A 4U1ZA 2QJEA 4Z7EA 3ODBA 4QFNA 4JWXA 4GRKA 1GVCA 1SW2A 3IJOB 2ZYMA 3EHTA 1RKMA 2O1MA 1JETA 2QS4A 4LVQA 2XD3A 3TTNA 5KDTA 3TUSA 1IUDA 3JV9A 3FVNA 1LBBA 2GHBA 3Q27A 4I8CA 3OSQA 4G2ZA 3HN0A 5HPQA 4NF6B 4P0IA 3FV2A 4ZEIA 3O9PA 3I3VA 4OVJA 3FXRA 1B4HA 1US5A 2DS9A 3S2VA 4C1TA 3RY3A 3TTLA 4FAJA 1NNTA 1FW0A 2XX8A 2QMWA 4OXVA 3LR1A 2XX9A 5I56B 3TTMA 2V3TA 4NF8B 3O29A 1BP5A 3EF7A 1BIYA 2REGA 3EHSA 3MP8A 1BTJA 1FQEA 2DYXA 5FHMA 3QUJA 4F1VA 4XKRA 1A7LA 3H6UA 4R6HA 3H6TA 3KG2A 1XVXA 4ZEBA 1I69A 3E9XA 4ZZAA 3H4ZA 4PETA 4QHQA 1OQGA 3IO6A 5DVIA 4MF3A 3V89B 4BDQA 4G77A 4KPTA 3F11A 3C33A 3PU5A 3U94A 4ONYA 4YAHX 2GRVA 1I6AA 4KD5A 4RA1A 5I2KB 3K6WA 4TQUQ 3V5AA 1NNPA 3DM0A 3OO7A 1HSLA 2OBGA 3R6UA 5H8SA 1NH8A 4QFKA 3H3GA 1LB9A 1ANFA 3T9XB 5I2NA 2RCAA 5I84A 2Q9TA 5AA2D 1LCFA 3JYRA 2HXWA 3G3GA 4POWA 2Z8DA 3SEXA 2ZNSA 1TT1A 3K00A 1MQGA 2I58A 4TOZA 4ESWA 5B7DA 3IB2A 4FE8A 4HCWA 1EH3A 1IITA 2HEUA 5I58B 4NWDA 2F7CA 3QSLA 4NF4A 1P1OA 3OMBA 3P7IA 1SW5A 1IEJA 2DWJA 1B40A 1XVYA 3B6TA 2Z22A 5DTBA 5CC2A 4R9FA 4JBZA 1ZJLA 4NF5B 2GH9A 5FHNA 2Q2AA 3O66A 4GOTA 4QFLA 3MJNA 3TEPA 3IB1A 3ZKLA 1PB7A 2I0CA 4H1XA 5AA1A 3E13X 4FATA 2WKYA 4DXBA 4KCCA 2F35A 2GHAA 3A3UA 1R6ZA 5I59A 1MQJA 3KSXA 2XXTA 3IOVA 1OVBA 3TAJA 5EHSA 1M5FA 5AA3A 3MVWA 2F8DA 2G29A 2VHAA 4KYDA 5TPAA 1LAFE 4DIGA 3MPLA 4JWOA 2X7QA 1B7ZA 3PUWE 1POY1 2M8CA 4OEUA 4ZEFA 1Z7NE 4OESA 1LBCA 1TWYA 5CRYA 1USYH 1L5TA 4QSCA 3O6HA 3ZSFA 1MY4A 4PFTA 5I58A 5H8QB 5KCJA 4XXUA 2DWIA 4JB7A 1J1NA 2O7UA 3M3FA 2FA7A 4F3PA 4KR5A 1UTBB 2HFBA 4AB5A 2DP8A 3MC2A 3SEYA 3O2AA 3U93A 3HCQA 4LATA 4OETA 3VLUA 4F19A 3Q28A 1VFEA 4P0GA 4EDPA 4X9TA 2O1LA 2UVIA 4IO6A 4TLLB 4EQBA 1GV8A 2ONSA 4OFOA 2AIXA 2O51A 4LA9A 4K3FA 2O68A 1JW5A 3D4GA 1D9YA 4PFYA 4JSOA 1MPCA 1Y4CA 3W9VA 3VXBA 2XXWA 2H99A 4DLDA 1T0KA 4DDDA 1MPBA 4GQOA 3OEKA 3FJMA 4Q0CA 1QUIA 3CRBA 2QSXA 3QYTA 5HM4B 1Y3PA 1ZTYA 4H5FA 2DQVA 4F1UA 1JEVA 1B7HA 4H0WA 3MWBA 1XT8A 1ZBMA 3QXMA 3OD7A 2F6GA 3GZGA 4ZECA 5F7VA 2UXAA 5B70A 4JDFA 3E3KA 1B0LA 3WAFA 4ESXA 4YMBA 4G68B 3T66A 1TFAA 4MLVA 3RT8A 4FEBA 4N07A 3IJXB 3RPWA 4BDNA 4EF2A 1JNFA 1BLFA 2F78A 3OEMA 2GFEA 2KLFA 4NWCA 3V83A 1CB6A 1N7WA 3OELA 4F2OA 2QS2A 1Q1KA 1B32A 1SW4A 1MDP1 4OMBA 2OZZA 1QJMA 1N3WA 4H8IA 1B5HA 2RF1A 3LC8A 3KN3A 2I49A 1PB8A 2RC7A 5ITOA 1OLCA 5ICTA 1LSTA 2A5SA 4G8MA 1B5JA 2W7YA 1HSEA 3MW0A 3RNNA 1SBPA 4O3CA 2D21A 2REJA 1A55A 4U23A 3T96B 4I1DA 3I6VA 3T22A 3AXFA 4TLMB 4IO4A 3SEVA 2XXYA 3IORA 3PMVA 4FIMA 5H8HB 4ELRA 4ZE9A 1MY0A 5H8FB 1MQIA 1DOTA 4DCXA 3O97A 4C1UA 3M3KA 4I62A 3K6VA 5I57A 1PDAA 3JZJA 3FV1A 3CFZA 3T9UA 3LSXA 4RJZA 4DXUA 1WDNA 4KYEA 1US4A 2D5WA 3MP6A 3OO9A 3KSJA 3RGYA 1URSA 1OLAA 2Y84A 3OENA 5CMCA 2E1SA 2DXRA 2D3IA 1ZKBA 4ZE8A 2VOZA 3DLNA 1SI1A 4O3BA 2ALUA 2VD2A 1KWHA 2NWJA 1IXIA 3MZ9A 3K01A 4NE4A 4LZ8A 1B5IA 1ZIUA 2X7PA 2F7AA 4E0WA 1UQWA 3U92A 1TFDA 1MPDA 1LLSA 3B6WA 2ZYOA 4G8NA 1DTZA 4IY6A 3VFJA 2Y7PA 3O6GA 5A5XA 1ZMGA 1YCJA 5AA4B 4PP0A 4DXCA 4R74A 3OOAA 1EZ9A 1SDXA 1Y3QA 1A40A 5L8DA 3B7DA 2OK2A 5H8FA 1AL3A 1MQHA 3TPAA 2HZKA 4ECFA 1AH5A 1XHYA 1FQCA 3S9NC 2XXXA 5AE4A 3BKIB 1N3XA 3TQWA 3VE1B 4KI0E 3N6TA 5H8NB 2AYSA 2I4BA 4ND9A 1JW1A 4LQ5A 1XC1A 3KGCA 4HTGA 2I6EA 4LONB 3UA8A 3ONMA 3DP8A 3BFTA 3T9VA 5CBSA 1P1WA 3FJGA 1VFDA 4YKJA 3O6IA 3Q29A 1H76A 1NNFA 4JXIA 3EPEA 4WEDA 4OERA 3KJTA 5CI5A 1MXXA 1NNKA 4R75A 2UVGA 2F6PA 3USDA 2Q88A 1O64A 2XD2A 3PPRA 3U8QA 1DPEA 1OVTA 2Y7KA 3M3LA 4GIZA 1PB9A 3FXQA 3MQ9A 4OENA 1DSNA 4NF6A 1HSJA 2YJPA 4I9DA 4R6KA 4EUOA 1UTHB 3DELB 1SYHA 4F22A 4H65A 3HPIA 1QULA 1D4NA 1MH4A 2PX1A 3SERA 5I56A 4NF8A 3K02A 5H8NA 4XIGQ 1MXUA 3PPQA 5JEIA 2CZLA 3PMWA 4KYSA 4Q8RA 1Y4TA 2Z8FA 2B65A 2V93A 1LFHA 3C4MA 3CVGA 2OLBA 1XOCA 2XXUA 1RYOA 3FVOA 4RK9A 5F1QA 4FECA 1B1XA 1H45A 2G93A 3TFLA 4RYAA 1GGGA 2DWAA 4OEVA 2PVUA 2A5TB 2P0SA 4X1DA 1LCTA 1Y9UA 1P1QA 4KFQA 3TCHA 3O28A 3FXUA 1QUKA 1FQDA 3TCGA 4FJPA 3DP6A 2QPQA 3M8UA 3PD8A 3TQLA 4ZEDA 2RKMA 4GL8A 5I2KA 4QFPA 3IK6B 4UA8A 3VVDA 1JQFA 3EN3A 1P99A 1UTHA 5EHMA 4ZS9A 2DVCA 2DE4A 3L6HA 4OQOA 5J1DA 1A8EA 1NMUA 4IGRA 2F36A 4XKNA 5TU0A 3UGWA 1JW4A 1BKAA 5FTHA 1NH7A 3ECRA 2R71A 1IQ7A 2OWSA 3G3HA 1MXVA 3IOTA 1NL5A 5ELVA 4EF1A 3MVZA 5HBCA 3IO4A 5CMBA 1B05A 4H67A 1N7XA 3DP4A 5DT6A 1IXHA 3RUMA 4BDRA 1FTMA 3VXCA 3ZS6A 4GF8A 4NF5A 4C0RA 4LQ2A 3OSRA 3QK6A 4G68C 2OJTA 1QKBA 3H6WA 5KZTA 4GFRA 3S9LC 2QMXA 3MBPA 2ABHA 1H44A 3W15C 1M5BA 4EQ7A 3A3CA 5EYFA 3QUFA 1EZOA 2V25A 1JVXA 4F31B 3CSBA 4H5GA 1MXWA 1B2HA 2HAVA 2V84A 1MM6A 5FTIA 1MY1A 1N0TA 3W9WA 3VVEA 5DVJA 2P1SA 2DOJA 2OWTA 3E4RA 4FORA 3GBBA 2ZMBA 1S50A 1D9VA 1QVSA 2E0SA 4GL0A 3HHFA 2Q8JA 4OFJA 3ILTB 3TMGA 3QIMA 2CMOA 3C35A 4GXSB 5H8QA 4G8HA 5CBRA 1LAXA 3K1NA 3C31A 2PBWA 4U22A 3VLVA 4IO2A 2I48A 4G4PA 1GTKA 1UTBA 3CFLA 3K4UA 3FD3A 5CM6A 4LP2B 3ZKKA 3SDFA 1FTLA 1B4ZA 1IXGA 4MFIA 1B51A 2IA4A 4R72A 3S9EA 2UYFA 1MG1A 2Y7WA 1LAHE 4OFLA 4PFWA 3Q26A 2R6GE 3K6UA 4PFUA 4XKPA 5DEXB 1B46A 2VP1A 5AA2B 3TKDA 1RYXA 2ONRA 3RLFE 1S7YA 3LBSA 4UACA 2ANJA 1H3DA 4AQ4A 3VVFA 3EQ1A 3PV0E 2YPNA 3A09A 4L17A 5CMKA 4OHNA 4DZ1A 2H98A 1FTKA 5TP9B 3PPNA 4MBPA 3TODA 4NMYA 3N26A 3FZVA 1PBQA 4G68A 3QAXA 3FIRA 3R7XA 3MAMA 1NFTA 4THIA 3G7WA 4F3SA 1F9BA 1PEBA 3OXNA 5IAIA 1MY2A 2O6AA 1MRPA 2Q2CA 2ZYKA 2UVJA 1B6HA 4JWYA 1XS5A 3T93B 2NVUB 3MP1A 1EZPA 3TYHA 4GWOA 3CIJA 4LZ7A 3K1PA 2PMSA 3HO7A 4LUBA 3UIFA 3G3JA 1ZLQA 3PGFA 1FQAA 4LZ5A 3I5OA 4F2QA 5AA2A 3PUVE 1WODA 4BDOA 4MLQA 1B3FA 1MY3A 3KOSA 4YMAA 1MM7A 1B52A 2XXRA 2HQ0A 4ELOA 5LOMA 4XTCQ 4U1OA 3GXAA 1M5CA 4YB6A 2ESNA 3BFUA 2B3BA 3TDJA 4DE8A 1VSOA 4Q30B 5TP9A 3PUZE 3IL1B 4DCYA 2DXYA 3LSLA 3RT6B 2I3WA 4E0XA 2XXHA 2I3VA 5H8HA 3KN7A 4QRZA 1IXCA 4F1YA 3FVKA 1CE2A 1URDA 2ZNTA 3MZBA 3IX1A 1B3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MUQ A;  1JVY A;  1UIV A;  2F97 A;  5ITP A;  3G3K A;  3FAS A;  2H9B A;  3UN6 A;  5I2N B;  3EHU A;  4N6P A;  5BWJ A;  4RPN A;  4XKQ A;  1N76 A;  1FQF A;  2Y7I A;  4EXK A;  2P2A A;  2O84 X;  4F39 A;  1DTG A;  3IOW A;  3LUY A;  1Z7M E;  2V3U A;  3Q25 A;  4QSD A;  2DWH A;  4NED A;  3CFX A;  3IB0 A;  3IOU A;  2RCB A;  4Q5T A;  4IGT A;  3LSW A;  1WVJ A;  2HZL A;  4NF4 B;  1QKA A;  2FNC A;  4GVO A;  1VR5 A;  3C9H A;  1GR2 A;  4F3B A;  1LFI A;  1AIV A;  2NXO A;  3MVX A;  2AL4 A;  5AA4 A;  5JK4 A;  2V3Q A;  2VD3 A;  1OIB A;  4M4G A;  3CR9 A;  1MS7 A;  2RC8 A;  3CG1 A;  4YB7 A;  2VGQ A;  1LAG E;  4KQP A;  1OQH A;  4WXJ A;  4YKP A;  5M2V A;  2PYY A;  2QS3 A;  2F7B A;  2ZNU A;  3RTW B;  3UOR A;  2YLN A;  1IZ1 A;  3T9H B;  2XX7 A;  1SW1 A;  1B3H A;  5I59 B;  3THI A;  4R6Y A;  2AL5 A;  3HHG A;  1B3L A;  1SI0 A;  2DE3 A;  2ZYN A;  2DSF A;  3K2D A;  3H06 B;  3TTK A;  4GLI A;  5TPA B;  4EQ9 A;  2QL3 A;  4QF9 A;  3CG3 A;  3FJ7 A;  1D3K A;  3R26 A;  2I0B A;  3FVG A;  4OYV A;  3U72 A;  2O69 A;  5KCJ B;  2QS1 A;  3L6G A;  1A8F A;  1Y1Z A;  2FYI A;  3K6X A;  5JTY B;  1S9T A;  4MH5 A;  1MQD A;  4FED A;  3C34 A;  4RPO A;  4R9G A;  4HW8 A;  5BUU A;  1A54 A;  3FAT A;  1QW0 A;  1P1U A;  1ZU0 A;  2IEE A;  2BJJ X;  2QRY A;  1R9L A;  5IKB A;  4OWD A;  4IO7 A;  4U4S A;  4AB6 A;  3V8X B;  4ZDM A;  1LGB C;  1JEU A;  1VE4 A;  2RIN A;  4X48 A;  2RC9 A;  4EXL A;  3TCF A;  2ONK E;  3SES A;  4YB5 A;  4ZZE A;  5DVF A;  2OCU A;  5ISU A;  4N13 A;  4R73 A;  4HS7 A;  1SD3 A;  4YIC A;  4IO3 A;  2B3F A;  4PE5 B;  1URG A;  3VV5 A;  2F5X A;  4RK2 A;  1M5D A;  2H4I A;  2H5Y A;  3FGS A;  5ICQ A;  1QUJ A;  4U4X A;  4F18 A;  4ELP A;  4F29 A;  3GBA A;  2X26 A;  3SEW A;  4JSD A;  4GXA A;  3KZG A;  5DYH A;  4RY1 A;  1POT A;  3TEL A;  2A5T A;  4R2F A;  2THI A;  5JTY A;  2Z23 A;  3H03 A;  2PT2 A;  1IIW A;  3C36 A;  3S9M C;  3TZA A;  1MXY A;  2XXV A;  1LB8 A;  1PBP A;  4P11 A;  1Y1M A;  2UYE A;  1LFG A;  4OTE A;  1SYI A;  3N5L A;  3UK4 A;  1Y3N A;  1YPN A;  3IAZ A;  4GD5 A;  2O7I A;  4H6D A;  1FQB A;  1N84 A;  2I4C A;  1Y20 A;  3KOT A;  2Z8E A;  3PUY E;  4BLA A;  4Z0I A;  2DE2 A;  3CSG A;  3WAE A;  3MZ1 A;  1TXF A;  2PT1 A;  1AOV A;  1EU8 A;  5L9M A;  1B9J A;  5K2X A;  2HCA A;  4YKK A;  2HAU A;  3PD9 A;  1SVX B;  3G3F A;  4X1B A;  3VDF A;  4HCY A;  2XXQ A;  1I6B A;  3H6V A;  3PMX A;  2DVZ A;  3PUX E;  4YKI A;  1B0H A;  2NOO A;  2UVH A;  4POX A;  1B3E A;  2Y7R A;  4QFO A;  3S4U A;  1USY E;  4U21 A;  3CI8 A;  3N94 A;  4IB2 A;  1B58 A;  1P1N A;  5I57 B;  1B1H A;  3ILU B;  3G3I A;  3N6U A;  3HST A;  1YTV A;  4BDL A;  3LSF B;  3KFM A;  2NUV A;  3RN8 A;  4OZ9 A;  4ISU A;  1FTJ A;  1R9Q A;  1UIU A;  4IO5 A;  1II5 A;  1MDQ A;  3IR1 A;  3KJ7 A;  4RXL A;  1O63 A;  3KBR A;  1ATG A;  2H25 A;  1YAE A;  2Q89 A;  1MXZ A;  5FHO A;  4YU0 A;  1FCK A;  3KN8 A;  3C32 A;  4WEP A;  2R9J A;  4PQJ A;  3RQT A;  1B7U A;  4U2R A;  5L9O A;  4H8J A;  3HV1 A;  4R2B A;  1O7T A;  3VLW A;  1DPP A;  4ZEK A;  3K0V A;  1R1N A;  1FTO A;  5KDT B;  1H43 A;  5A5X B;  4KHZ E;  1DMB A;  3PPP A;  3B6Q A;  2ZXT A;  1OMP A;  2XHD A;  3SET A;  1SQY A;  3RTF B;  4M1V A;  2XXP A;  3OO8 A;  4NTL A;  1ELJ A;  2F34 A;  3TTR A;  2XXI A;  5K2Y A;  3PPO A;  4RNS A;  3H7M A;  3GLB A;  4QSE A;  3BBR A;  3OO6 A;  5L9S A;  1AMF A;  2LAO A;  5DEX A;  4ELQ A;  3K1M A;  3MPK A;  4BDM A;  4IY5 A;  1Q35 A;  4KCD A;  3SKP A;  4O3A A;  1A99 A;  3MVY A;  4WKM A;  3D4C A;  1M5E A;  3KEI A;  1I6Q A;  5CMM A;  3U1O A;  3UP9 A;  4YZZ A;  1MH3 A;  1NKX A;  3SEU A;  1PC3 A;  4F3G A;  3FUZ A;  1N04 A;  4U1Z A;  2QJE A;  4Z7E A;  3ODB A;  4QFN A;  4JWX A;  4GRK A;  1GVC A;  1SW2 A;  3IJO B;  2ZYM A;  3EHT A;  1RKM A;  2O1M A;  1JET A;  2QS4 A;  4LVQ A;  2XD3 A;  3TTN A;  5KDT A;  3TUS A;  1IUD A;  3JV9 A;  3FVN A;  1LBB A;  2GHB A;  3Q27 A;  4I8C A;  3OSQ A;  4G2Z A;  3HN0 A;  5HPQ A;  4NF6 B;  4P0I A;  3FV2 A;  4ZEI A;  3O9P A;  3I3V A;  4OVJ A;  3FXR A;  1B4H A;  1US5 A;  2DS9 A;  3S2V A;  4C1T A;  3RY3 A;  3TTL A;  4FAJ A;  1NNT A;  1FW0 A;  2XX8 A;  2QMW A;  4OXV A;  3LR1 A;  2XX9 A;  5I56 B;  3TTM A;  2V3T A;  4NF8 B;  3O29 A;  1BP5 A;  3EF7 A;  1BIY A;  2REG A;  3EHS A;  3MP8 A;  1BTJ A;  1FQE A;  2DYX A;  5FHM A;  3QUJ A;  4F1V A;  4XKR A;  1A7L A;  3H6U A;  4R6H A;  3H6T A;  3KG2 A;  1XVX A;  4ZEB A;  1I69 A;  3E9X A;  4ZZA A;  3H4Z A;  4PET A;  4QHQ A;  1OQG A;  3IO6 A;  5DVI A;  4MF3 A;  3V89 B;  4BDQ A;  4G77 A;  4KPT A;  3F11 A;  3C33 A;  3PU5 A;  3U94 A;  4ONY A;  4YAH X;  2GRV A;  1I6A A;  4KD5 A;  4RA1 A;  5I2K B;  3K6W A;  4TQU Q;  3V5A A;  1NNP A;  3DM0 A;  3OO7 A;  1HSL A;  2OBG A;  3R6U A;  5H8S A;  1NH8 A;  4QFK A;  3H3G A;  1LB9 A;  1ANF A;  3T9X B;  5I2N A;  2RCA A;  5I84 A;  2Q9T A;  5AA2 D;  1LCF A;  3JYR A;  2HXW A;  3G3G A;  4POW A;  2Z8D A;  3SEX A;  2ZNS A;  1TT1 A;  3K00 A;  1MQG A;  2I58 A;  4TOZ A;  4ESW A;  5B7D A;  3IB2 A;  4FE8 A;  4HCW A;  1EH3 A;  1IIT A;  2HEU A;  5I58 B;  4NWD A;  2F7C A;  3QSL A;  4NF4 A;  1P1O A;  3OMB A;  3P7I A;  1SW5 A;  1IEJ A;  2DWJ A;  1B40 A;  1XVY A;  3B6T A;  2Z22 A;  5DTB A;  5CC2 A;  4R9F A;  4JBZ A;  1ZJL A;  4NF5 B;  2GH9 A;  5FHN A;  2Q2A A;  3O66 A;  4GOT A;  4QFL A;  3MJN A;  3TEP A;  3IB1 A;  3ZKL A;  1PB7 A;  2I0C A;  4H1X A;  5AA1 A;  3E13 X;  4FAT A;  2WKY A;  4DXB A;  4KCC A;  2F35 A;  2GHA A;  3A3U A;  1R6Z A;  5I59 A;  1MQJ A;  3KSX A;  2XXT A;  3IOV A;  1OVB A;  3TAJ A;  5EHS A;  1M5F A;  5AA3 A;  3MVW A;  2F8D A;  2G29 A;  2VHA A;  4KYD A;  5TPA A;  1LAF E;  4DIG A;  3MPL A;  4JWO A;  2X7Q A;  1B7Z A;  3PUW E;  1POY 1;  2M8C A;  4OEU A;  4ZEF A;  1Z7N E;  4OES A;  1LBC A;  1TWY A;  5CRY A;  1USY H;  1L5T A;  4QSC A;  3O6H A;  3ZSF A;  1MY4 A;  4PFT A;  5I58 A;  5H8Q B;  5KCJ A;  4XXU A;  2DWI A;  4JB7 A;  1J1N A;  2O7U A;  3M3F A;  2FA7 A;  4F3P A;  4KR5 A;  1UTB B;  2HFB A;  4AB5 A;  2DP8 A;  3MC2 A;  3SEY A;  3O2A A;  3U93 A;  3HCQ A;  4LAT A;  4OET A;  3VLU A;  4F19 A;  3Q28 A;  1VFE A;  4P0G A;  4EDP A;  4X9T A;  2O1L A;  2UVI A;  4IO6 A;  4TLL B;  4EQB A;  1GV8 A;  2ONS A;  4OFO A;  2AIX A;  2O51 A;  4LA9 A;  4K3F A;  2O68 A;  1JW5 A;  3D4G A;  1D9Y A;  4PFY A;  4JSO A;  1MPC A;  1Y4C A;  3W9V A;  3VXB A;  2XXW A;  2H99 A;  4DLD A;  1T0K A;  4DDD A;  1MPB A;  4GQO A;  3OEK A;  3FJM A;  4Q0C A;  1QUI A;  3CRB A;  2QSX A;  3QYT A;  5HM4 B;  1Y3P A;  1ZTY A;  4H5F A;  2DQV A;  4F1U A;  1JEV A;  1B7H A;  4H0W A;  3MWB A;  1XT8 A;  1ZBM A;  3QXM A;  3OD7 A;  2F6G A;  3GZG A;  4ZEC A;  5F7V A;  2UXA A;  5B70 A;  4JDF A;  3E3K A;  1B0L A;  3WAF A;  4ESX A;  4YMB A;  4G68 B;  3T66 A;  1TFA A;  4MLV A;  3RT8 A;  4FEB A;  4N07 A;  3IJX B;  3RPW A;  4BDN A;  4EF2 A;  1JNF A;  1BLF A;  2F78 A;  3OEM A;  2GFE A;  2KLF A;  4NWC A;  3V83 A;  1CB6 A;  1N7W A;  3OEL A;  4F2O A;  2QS2 A;  1Q1K A;  1B32 A;  1SW4 A;  1MDP 1;  4OMB A;  2OZZ A;  1QJM A;  1N3W A;  4H8I A;  1B5H A;  2RF1 A;  3LC8 A;  3KN3 A;  2I49 A;  1PB8 A;  2RC7 A;  5ITO A;  1OLC A;  5ICT A;  1LST A;  2A5S A;  4G8M A;  1B5J A;  2W7Y A;  1HSE A;  3MW0 A;  3RNN A;  1SBP A;  4O3C A;  2D21 A;  2REJ A;  1A55 A;  4U23 A;  3T96 B;  4I1D A;  3I6V A;  3T22 A;  3AXF A;  4TLM B;  4IO4 A;  3SEV A;  2XXY A;  3IOR A;  3PMV A;  4FIM A;  5H8H B;  4ELR A;  4ZE9 A;  1MY0 A;  5H8F B;  1MQI A;  1DOT A;  4DCX A;  3O97 A;  4C1U A;  3M3K A;  4I62 A;  3K6V A;  5I57 A;  1PDA A;  3JZJ A;  3FV1 A;  3CFZ A;  3T9U A;  3LSX A;  4RJZ A;  4DXU A;  1WDN A;  4KYE A;  1US4 A;  2D5W A;  3MP6 A;  3OO9 A;  3KSJ A;  3RGY A;  1URS A;  1OLA A;  2Y84 A;  3OEN A;  5CMC A;  2E1S A;  2DXR A;  2D3I A;  1ZKB A;  4ZE8 A;  2VOZ A;  3DLN A;  1SI1 A;  4O3B A;  2ALU A;  2VD2 A;  1KWH A;  2NWJ A;  1IXI A;  3MZ9 A;  3K01 A;  4NE4 A;  4LZ8 A;  1B5I A;  1ZIU A;  2X7P A;  2F7A A;  4E0W A;  1UQW A;  3U92 A;  1TFD A;  1MPD A;  1LLS A;  3B6W A;  2ZYO A;  4G8N A;  1DTZ A;  4IY6 A;  3VFJ A;  2Y7P A;  3O6G A;  5A5X A;  1ZMG A;  1YCJ A;  5AA4 B;  4PP0 A;  4DXC A;  4R74 A;  3OOA A;  1EZ9 A;  1SDX A;  1Y3Q A;  1A40 A;  5L8D A;  3B7D A;  2OK2 A;  5H8F A;  1AL3 A;  1MQH A;  3TPA A;  2HZK A;  4ECF A;  1AH5 A;  1XHY A;  1FQC A;  3S9N C;  2XXX A;  5AE4 A;  3BKI B;  1N3X A;  3TQW A;  3VE1 B;  4KI0 E;  3N6T A;  5H8N B;  2AYS A;  2I4B A;  4ND9 A;  1JW1 A;  4LQ5 A;  1XC1 A;  3KGC A;  4HTG A;  2I6E A;  4LON B;  3UA8 A;  3ONM A;  3DP8 A;  3BFT A;  3T9V A;  5CBS A;  1P1W A;  3FJG A;  1VFD A;  4YKJ A;  3O6I A;  3Q29 A;  1H76 A;  1NNF A;  4JXI A;  3EPE A;  4WED A;  4OER A;  3KJT A;  5CI5 A;  1MXX A;  1NNK A;  4R75 A;  2UVG A;  2F6P A;  3USD A;  2Q88 A;  1O64 A;  2XD2 A;  3PPR A;  3U8Q A;  1DPE A;  1OVT A;  2Y7K A;  3M3L A;  4GIZ A;  1PB9 A;  3FXQ A;  3MQ9 A;  4OEN A;  1DSN A;  4NF6 A;  1HSJ A;  2YJP A;  4I9D A;  4R6K A;  4EUO A;  1UTH B;  3DEL B;  1SYH A;  4F22 A;  4H65 A;  3HPI A;  1QUL A;  1D4N A;  1MH4 A;  2PX1 A;  3SER A;  5I56 A;  4NF8 A;  3K02 A;  5H8N A;  4XIG Q;  1MXU A;  3PPQ A;  5JEI A;  2CZL A;  3PMW A;  4KYS A;  4Q8R A;  1Y4T A;  2Z8F A;  2B65 A;  2V93 A;  1LFH A;  3C4M A;  3CVG A;  2OLB A;  1XOC A;  2XXU A;  1RYO A;  3FVO A;  4RK9 A;  5F1Q A;  4FEC A;  1B1X A;  1H45 A;  2G93 A;  3TFL A;  4RYA A;  1GGG A;  2DWA A;  4OEV A;  2PVU A;  2A5T B;  2P0S A;  4X1D A;  1LCT A;  1Y9U A;  1P1Q A;  4KFQ A;  3TCH A;  3O28 A;  3FXU A;  1QUK A;  1FQD A;  3TCG A;  4FJP A;  3DP6 A;  2QPQ A;  3M8U A;  3PD8 A;  3TQL A;  4ZED A;  2RKM A;  4GL8 A;  5I2K A;  4QFP A;  3IK6 B;  4UA8 A;  3VVD A;  1JQF A;  3EN3 A;  1P99 A;  1UTH A;  5EHM A;  4ZS9 A;  2DVC A;  2DE4 A;  3L6H A;  4OQO A;  5J1D A;  1A8E A;  1NMU A;  4IGR A;  2F36 A;  4XKN A;  5TU0 A;  3UGW A;  1JW4 A;  1BKA A;  5FTH A;  1NH7 A;  3ECR A;  2R71 A;  1IQ7 A;  2OWS A;  3G3H A;  1MXV A;  3IOT A;  1NL5 A;  5ELV A;  4EF1 A;  3MVZ A;  5HBC A;  3IO4 A;  5CMB A;  1B05 A;  4H67 A;  1N7X A;  3DP4 A;  5DT6 A;  1IXH A;  3RUM A;  4BDR A;  1FTM A;  3VXC A;  3ZS6 A;  4GF8 A;  4NF5 A;  4C0R A;  4LQ2 A;  3OSR A;  3QK6 A;  4G68 C;  2OJT A;  1QKB A;  3H6W A;  5KZT A;  4GFR A;  3S9L C;  2QMX A;  3MBP A;  2ABH A;  1H44 A;  3W15 C;  1M5B A;  4EQ7 A;  3A3C A;  5EYF A;  3QUF A;  1EZO A;  2V25 A;  1JVX A;  4F31 B;  3CSB A;  4H5G A;  1MXW A;  1B2H A;  2HAV A;  2V84 A;  1MM6 A;  5FTI A;  1MY1 A;  1N0T A;  3W9W A;  3VVE A;  5DVJ A;  2P1S A;  2DOJ A;  2OWT A;  3E4R A;  4FOR A;  3GBB A;  2ZMB A;  1S50 A;  1D9V A;  1QVS A;  2E0S A;  4GL0 A;  3HHF A;  2Q8J A;  4OFJ A;  3ILT B;  3TMG A;  3QIM A;  2CMO A;  3C35 A;  4GXS B;  5H8Q A;  4G8H A;  5CBR A;  1LAX A;  3K1N A;  3C31 A;  2PBW A;  4U22 A;  3VLV A;  4IO2 A;  2I48 A;  4G4P A;  1GTK A;  1UTB A;  3CFL A;  3K4U A;  3FD3 A;  5CM6 A;  4LP2 B;  3ZKK A;  3SDF A;  1FTL A;  1B4Z A;  1IXG A;  4MFI A;  1B51 A;  2IA4 A;  4R72 A;  3S9E A;  2UYF A;  1MG1 A;  2Y7W A;  1LAH E;  4OFL A;  4PFW A;  3Q26 A;  2R6G E;  3K6U A;  4PFU A;  4XKP A;  5DEX B;  1B46 A;  2VP1 A;  5AA2 B;  3TKD A;  1RYX A;  2ONR A;  3RLF E;  1S7Y A;  3LBS A;  4UAC A;  2ANJ A;  1H3D A;  4AQ4 A;  3VVF A;  3EQ1 A;  3PV0 E;  2YPN A;  3A09 A;  4L17 A;  5CMK A;  4OHN A;  4DZ1 A;  2H98 A;  1FTK A;  5TP9 B;  3PPN A;  4MBP A;  3TOD A;  4NMY A;  3N26 A;  3FZV A;  1PBQ A;  4G68 A;  3QAX A;  3FIR A;  3R7X A;  3MAM A;  1NFT A;  4THI A;  3G7W A;  4F3S A;  1F9B A;  1PEB A;  3OXN A;  5IAI A;  1MY2 A;  2O6A A;  1MRP A;  2Q2C A;  2ZYK A;  2UVJ A;  1B6H A;  4JWY A;  1XS5 A;  3T93 B;  2NVU B;  3MP1 A;  1EZP A;  3TYH A;  4GWO A;  3CIJ A;  4LZ7 A;  3K1P A;  2PMS A;  3HO7 A;  4LUB A;  3UIF A;  3G3J A;  1ZLQ A;  3PGF A;  1FQA A;  4LZ5 A;  3I5O A;  4F2Q A;  5AA2 A;  3PUV E;  1WOD A;  4BDO A;  4MLQ A;  1B3F A;  1MY3 A;  3KOS A;  4YMA A;  1MM7 A;  1B52 A;  2XXR A;  2HQ0 A;  4ELO A;  5LOM A;  4XTC Q;  4U1O A;  3GXA A;  1M5C A;  4YB6 A;  2ESN A;  3BFU A;  2B3B A;  3TDJ A;  4DE8 A;  1VSO A;  4Q30 B;  5TP9 A;  3PUZ E;  3IL1 B;  4DCY A;  2DXY A;  3LSL A;  3RT6 B;  2I3W A;  4E0X A;  2XXH A;  2I3V A;  5H8H A;  3KN7 A;  4QRZ A;  1IXC A;  4F1Y A;  3FVK A;  1CE2 A;  1URD A;  2ZNT A;  3MZB A;  3IX1 A;  1B3G A; 
#chains in the Genus database with same CATH topology
 3MUQ A;  1JVY A;  1UIV A;  4O7M A;  4XF5 A;  2F97 A;  5ITP A;  1NV5 A;  3G3K A;  1RDY A;  3FAS A;  1FPG A;  2H9B A;  3UN6 A;  5I2N B;  3EHU A;  4N6P A;  5BWJ A;  4RPN A;  5ET7 A;  4XKQ A;  1N76 A;  1FQF A;  2Y7I A;  4EXK A;  2P2A A;  2O84 X;  4F39 A;  1DTG A;  3IOW A;  3LUY A;  4PC9 A;  1Z7M E;  2V3U A;  3Q25 A;  4QSD A;  1NUY A;  2DWH A;  4NED A;  4GBW A;  3CFX A;  4GBV A;  3IB0 A;  4XEQ A;  3IOU A;  2RCB A;  4OA4 A;  4Q5T A;  4IGT A;  3LSW A;  1WVJ A;  2BJI A;  2HZL A;  2CEX A;  4NF4 B;  1QKA A;  2FNC A;  4GVO A;  1VR5 A;  3C9H A;  1GR2 A;  4F3B A;  1LBY A;  2HXR A;  1LFI A;  2XXK A;  1AIV A;  2NXO A;  3MVX A;  2AL4 A;  5AA4 A;  4HE2 A;  5JK4 A;  2V3Q A;  4JVC A;  2XWI A;  2VD3 A;  5F24 A;  1OIB A;  4M4G A;  4N8Y A;  2MKZ A;  3CR9 A;  1MS7 A;  2RC8 A;  3CG1 A;  4YB7 A;  2VGQ A;  1LAG E;  4KQP A;  1OQH A;  4WXJ A;  2HPG A;  4YKP A;  5M2V A;  2V4C A;  2PYY A;  2QS3 A;  2F7B A;  3PTY A;  2ZNU A;  1LBV A;  1FPI A;  3RTW B;  3UOR A;  2YLN A;  1IZ1 A;  3T9H B;  2XX7 A;  1SW1 A;  1B3H A;  5I59 B;  3THI A;  4R6Y A;  2AL5 A;  3HHG A;  1B3L A;  1SI0 A;  2DE3 A;  2ZYN A;  2DSF A;  3K2D A;  3H06 B;  3TTK A;  4GLI A;  2JJK A;  4XFE A;  5TPA B;  4EQ9 A;  2QL3 A;  4QF9 A;  3CG3 A;  3FJ7 A;  4GWW A;  1D3K A;  3R26 A;  2I0B A;  3FVG A;  4GWZ A;  4OYV A;  3U72 A;  2O69 A;  5KCJ B;  4PAF A;  2QS1 A;  2FIE A;  3L6G A;  5J16 A;  1A8F A;  1Y1Z A;  5FBP A;  1FPL A;  4MNP A;  2FYI A;  3K6X A;  5JTY B;  1S9T A;  4MH5 A;  1EYI A;  1MQD A;  4FED A;  4NGU A;  3C34 A;  4RPO A;  4R9G A;  4HW8 A;  5BUU A;  1A54 A;  3FAT A;  1Q9D A;  1QW0 A;  1P1U A;  1ZU0 A;  2IEE A;  2BJJ X;  2QRY A;  1R9L A;  5IKB A;  4OWD A;  4IO7 A;  4U4S A;  4AB6 A;  1SPI A;  3V8X B;  4ZDM A;  2OX3 A;  3D1R A;  1LGB C;  3ISP A;  1JEU A;  1VE4 A;  2RIN A;  2QFL A;  4X48 A;  2RC9 A;  4EXL A;  3TCF A;  2ONK E;  3SES A;  5IZ3 B;  4YB5 A;  4ZZE A;  5DVF A;  2OCU A;  5ISU A;  4N13 A;  4R73 A;  4MNC A;  4HS7 A;  1SD3 A;  4YIC A;  4PGN A;  4IO3 A;  2B3F A;  4PE5 B;  1URG A;  3VV5 A;  2F5X A;  4RK2 A;  4I3E A;  1M5D A;  2KR0 A;  2H4I A;  2H5Y A;  3FGS A;  5ICQ A;  1EYK A;  3A29 A;  1QUJ A;  4U4X A;  4F18 A;  1VDW A;  4ELP A;  4F29 A;  3GBA A;  2X26 A;  2Y5K A;  3SEW A;  4JSD A;  4GXA A;  3CHG A;  1RDX A;  3KZG A;  5DYH A;  4RY1 A;  2ZZV A;  1POT A;  3QMF A;  3TEL A;  2A5T A;  2FBP A;  4R2F A;  2THI A;  5JTY A;  2Z23 A;  5ET6 A;  3H03 A;  2PT2 A;  1IIW A;  3C36 A;  3S9M C;  3TZA A;  5LDZ A;  2FIX A;  1MXY A;  2XXV A;  1LB8 A;  1PBP A;  5EQ9 A;  4P11 A;  1Y1M A;  2UYE A;  1INP A;  1LFG A;  4OTE A;  1NV1 A;  1SYI A;  3N5L A;  3UK4 A;  1Y3N A;  1YPN A;  3IAZ A;  4GD5 A;  2Y5L A;  2O7I A;  4H6D A;  1FQB A;  1N84 A;  2I4C A;  1Y20 A;  5IZ3 A;  4DI4 B;  3KOT A;  2Z8E A;  3PUY E;  4BLA A;  4AS4 A;  4Z0I A;  5EQA A;  2DE2 A;  3CSG A;  3WAE A;  3MZ1 A;  1TXF A;  2PT1 A;  3T0J A;  1AOV A;  1EU8 A;  5L9M A;  1B9J A;  1NUW A;  5K2X A;  2ZZW A;  1IMB A;  2HCA A;  4YKK A;  2HAU A;  3PD9 A;  4IR8 A;  1SVX B;  3G3F A;  4X1B A;  3VDF A;  4HCY A;  2WYP A;  3SZP A;  2XXQ A;  1I6B A;  4NQ8 A;  2WEF A;  3H6V A;  3PMX A;  2DVZ A;  5LTC A;  1RDZ A;  3PUX E;  4YKI A;  1B0H A;  2NOO A;  2UVH A;  4POX A;  1B3E A;  2Y7R A;  4QFO A;  3S4U A;  1USY E;  4U21 A;  4LN5 A;  3CI8 A;  4P9K A;  5ET8 A;  3N94 A;  4IB2 A;  1B58 A;  4G61 A;  1P1N A;  5I57 B;  4N8G A;  1B1H A;  3ILU B;  3G3I A;  3N6U A;  4MEV A;  3HFU A;  3HST A;  4PFB A;  1YTV A;  4BDL A;  3LSF B;  4P8B A;  3KFM A;  2NUV A;  3RN8 A;  4OZ9 A;  4ISU A;  1FTJ A;  1R9Q A;  1UIU A;  4PDD A;  4HE0 A;  4IO5 A;  1IMD A;  4P3L A;  1II5 A;  1FPJ A;  1MDQ A;  2QVU A;  3IR1 A;  3KJ7 A;  4RXL A;  1O63 A;  3KBR A;  4OVP A;  1ATG A;  2H25 A;  5ESY A;  1YAE A;  1NV0 A;  2Q89 A;  1MXZ A;  5FHO A;  4YU0 A;  1FCK A;  3KN8 A;  3C32 A;  4WEP A;  2R9J A;  1NUX A;  4PQJ A;  3RQT A;  1B7U A;  4U2R A;  5L9O A;  4H8J A;  3HV1 A;  1QGX A;  3IFC A;  4R2B A;  1O7T A;  3VLW A;  1DPP A;  4ZEK A;  3K0V A;  3BIH A;  2P3V A;  1R1N A;  1FTO A;  5KDT B;  1H43 A;  5A5X B;  4KHZ E;  5I3S A;  1DMB A;  5EYG A;  3PPP A;  3B6Q A;  2ZXT A;  1OMP A;  2XHD A;  2PCR A;  3E79 A;  3SET A;  1SQY A;  3RTF B;  4M1V A;  2XXP A;  3OO8 A;  4NTL A;  1ELJ A;  2F34 A;  3TTR A;  2XXI A;  4JVD A;  5K2Y A;  3PPO A;  4NN3 A;  4RNS A;  3H7M A;  3GLB A;  4QSE A;  3BBR A;  3OO6 A;  5L9S A;  4PTK A;  1AMF A;  2LAO A;  5DEX A;  4ELQ A;  3K1M A;  3MPK A;  4BDM A;  4IY5 A;  5IM2 A;  1Q35 A;  1CNQ A;  4KCD A;  3SKP A;  4O3A A;  1A99 A;  3MVY A;  4WKM A;  4MAG A;  3D4C A;  1M5E A;  3KEI A;  1I6Q A;  5CMM A;  1FJ9 A;  3U1O A;  3UP9 A;  4YZZ A;  4NG7 A;  1MH3 A;  1NKX A;  1PC3 A;  3SEU A;  4F3G A;  3FUZ A;  1N04 A;  4U1Z A;  2QJE A;  2FVZ A;  4Z7E A;  4PF6 A;  3ODB A;  4QFN A;  4JWX A;  4GRK A;  1GVC A;  1SW2 A;  3IJO B;  2ZYM A;  3EHT A;  1RKM A;  2O1M A;  1JET A;  4X04 A;  2QS4 A;  4LVQ A;  2CZK A;  2XD3 A;  5EYH A;  3TTN A;  5KDT A;  3TUS A;  1IUD A;  3JV9 A;  3FVN A;  3FXB A;  1LBB A;  2GHB A;  3Q27 A;  4I8C A;  3RPL A;  3OSQ A;  1NV4 A;  4G2Z A;  3HN0 A;  5HPQ A;  4NF6 B;  4P0I A;  3FV2 A;  4ZEI A;  3O9P A;  3I3V A;  5EQ8 A;  1YYZ A;  4OVJ A;  4GX6 A;  3FXR A;  1B4H A;  1US5 A;  2DS9 A;  3S2V A;  4C1T A;  3RY3 A;  3TTL A;  4FAJ A;  1NNT A;  1FW0 A;  2XX8 A;  2QMW A;  4OXV A;  3LR1 A;  2XX9 A;  5I56 B;  3TTM A;  2V3T A;  4NF8 B;  3O29 A;  1BP5 A;  3EF7 A;  1BIY A;  2REG A;  4GWU A;  3EHS A;  3MP8 A;  1BTJ A;  1FQE A;  2DYX A;  5FHM A;  3QUJ A;  5I5P A;  3NOH A;  4F1V A;  4XKR A;  1A7L A;  3H6U A;  4R6H A;  3H6T A;  3KG2 A;  4OAN A;  1XVX A;  4ZEB A;  1I69 A;  3E9X A;  4ZZA A;  3H4Z A;  4PET A;  4QHQ A;  1OQG A;  3IO6 A;  5DVI A;  4MF3 A;  3V89 B;  4BDQ A;  4G77 A;  4KPT A;  3F11 A;  4JVI A;  3C33 A;  1KA0 A;  3MST A;  3PU5 A;  3U94 A;  4ONY A;  4HXV A;  4YAH X;  2GRV A;  1I6A A;  4KD5 A;  4RA1 A;  5I2K B;  3K6W A;  4N15 A;  4TQU Q;  3V5A A;  1NNP A;  3DM0 A;  1NV3 A;  3OO7 A;  1HSL A;  2OBG A;  3R6U A;  5H8S A;  1NH8 A;  4QFK A;  4NHB A;  3H3G A;  1IMC A;  1LB9 A;  1ANF A;  3T9X B;  5I2N A;  4GWX A;  3EKI A;  2RCA A;  5I84 A;  2Q9T A;  2VT5 A;  5AA2 D;  1LCF A;  3JYR A;  2HXW A;  3G3G A;  4POW A;  2Z8D A;  3SEX A;  2ZNS A;  1TT1 A;  3K00 A;  1MQG A;  2I58 A;  4TOZ A;  4ESW A;  5B7D A;  3IB2 A;  4FE8 A;  4HCW A;  1EH3 A;  1IIT A;  2HEU A;  5I58 B;  4NWD A;  2F7C A;  3QSL A;  4NF4 A;  1P1O A;  3OMB A;  3P7I A;  1SW5 A;  1IEJ A;  2DWJ A;  1B40 A;  1XVY A;  3B6T A;  4NAP A;  2Z22 A;  3KC0 A;  2L5V A;  5DTB A;  5CC2 A;  4R9F A;  4JBZ A;  3BIG A;  1ZJL A;  4NF5 B;  2GH9 A;  4PFR A;  1FTA A;  5FHN A;  1NV2 A;  2Q2A A;  3O66 A;  4GOT A;  4QFL A;  1YZ0 A;  3MJN A;  3TEP A;  3IB1 A;  3ZKL A;  1PB7 A;  2I0C A;  4H1X A;  5AA1 A;  3E13 X;  4I40 A;  4FAT A;  2WKY A;  1FBP A;  4DXB A;  4KCC A;  2F35 A;  2GHA A;  3A3U A;  1R6Z A;  1G0H A;  5I59 A;  1MQJ A;  3KSX A;  2XXT A;  3IOV A;  1OVB A;  3TAJ A;  5EHS A;  2CZI A;  1M5F A;  5AA3 A;  3MVW A;  2F8D A;  4QXD A;  2G29 A;  2VHA A;  4KYD A;  5TPA A;  1LAF E;  4DIG A;  3MPL A;  4JWO A;  2X7Q A;  1B7Z A;  3PUW E;  1POY 1;  3B8B A;  2M8C A;  3ROJ A;  1G0I A;  4OEU A;  4ZEF A;  1Z7N E;  5T3J A;  2KQZ A;  2VPO A;  4OES A;  1LBC A;  1TWY A;  5CRY A;  1USY H;  1L5T A;  5ET5 A;  4QSC A;  3O6H A;  3ZSF A;  1MY4 A;  4PFT A;  5I58 A;  5H8Q B;  5KCJ A;  4XXU A;  2DWI A;  4JB7 A;  1J1N A;  2O7U A;  3M3F A;  2FA7 A;  4F3P A;  4KR5 A;  1UTB B;  2HFB A;  4AB5 A;  2DP8 A;  3MC2 A;  3SEY A;  3O2A A;  3U93 A;  3HCQ A;  4LAT A;  4OET A;  3VLU A;  2FHY A;  4F19 A;  3Q28 A;  1VFE A;  4P0G A;  3IFA A;  4OVT A;  4EDP A;  4N4U A;  4X9T A;  2O1L A;  2UVI A;  2Q74 A;  4IO6 A;  2R8T A;  4TLL B;  4EQB A;  1GV8 A;  2ONS A;  4OFO A;  2AIX A;  2GQ1 A;  2O51 A;  4LA9 A;  4K3F A;  4PBH A;  2O68 A;  1JW5 A;  3D4G A;  1D9Y A;  4PFY A;  4JSO A;  1FPB A;  1MPC A;  1Y4C A;  3W9V A;  4OVR A;  2WYK A;  3VXB A;  2XXW A;  3B50 A;  2H99 A;  4DLD A;  1T0K A;  4DDD A;  1MPB A;  4GQO A;  3OEK A;  3FJM A;  4Q0C A;  2PFZ A;  1QUI A;  1LBZ A;  3CRB A;  2QSX A;  3QYT A;  5HM4 B;  1Y3P A;  1ZTY A;  4H5F A;  2DQV A;  4F1U A;  1JEV A;  1B7H A;  4H0W A;  3MWB A;  5IZZ A;  1FBF A;  1XT8 A;  1ZBM A;  3QXM A;  3OD7 A;  2F6G A;  3GZG A;  4ZEC A;  4O7I A;  5F7V A;  2UXA A;  1NV6 A;  4MMP A;  5B70 A;  1FBC A;  4JDF A;  4KXP A;  3E3K A;  1B0L A;  3WAF A;  4ESX A;  4YMB A;  4O94 A;  4G68 B;  3T66 A;  1NI9 A;  1TFA A;  4MLV A;  3RT8 A;  4FEB A;  4N07 A;  3IJX B;  3RPW A;  4PF8 A;  4BDN A;  4EF2 A;  1JNF A;  1BLF A;  2F78 A;  4PCD A;  4PBQ A;  3OEM A;  2GFE A;  2KLF A;  4NWC A;  3V83 A;  1CB6 A;  4OVS A;  1N7W A;  3OEL A;  4F2O A;  2QS2 A;  1Q1K A;  1B32 A;  1SW4 A;  1LEV A;  1MDP 1;  4OMB A;  2OZZ A;  1QJM A;  1N3W A;  4H8I A;  1B5H A;  2RF1 A;  1DCU A;  3KN3 A;  2OWZ A;  2I49 A;  3LC8 A;  1PB8 A;  2RC7 A;  5ITO A;  4MJO A;  1OLC A;  3LV0 A;  5ICT A;  1LST A;  2A5S A;  1LBW A;  1B5J A;  4G8M A;  2W7Y A;  1HSE A;  3MW0 A;  1FPD A;  3RNN A;  1SBP A;  4O3C A;  2D21 A;  2REJ A;  1A55 A;  4U23 A;  3T96 B;  4I1D A;  3I6V A;  3T22 A;  4P56 A;  2XWK A;  3AXF A;  4TLM B;  4IO4 A;  3SEV A;  2XXY A;  3IOR A;  3PMV A;  4FIM A;  1EYJ A;  5H8H B;  4ELR A;  4ZE9 A;  1MY0 A;  5H8F B;  1MQI A;  1DOT A;  4DCX A;  3O97 A;  4C1U A;  3M3K A;  4I62 A;  3K6V A;  5I57 A;  1PDA A;  3JZJ A;  3FV1 A;  3CFZ A;  3T9U A;  3LSX A;  4MCO A;  4RJZ A;  4DXU A;  1WDN A;  4KYE A;  1US4 A;  2D5W A;  3MP6 A;  1IMF A;  3OO9 A;  3KSJ A;  3RGY A;  4N6K A;  1URS A;  1OLA A;  2Y84 A;  3OEN A;  4N81 A;  5IZ1 A;  5CMC A;  2E1S A;  4AS5 A;  2DXR A;  2D3I A;  1ZKB A;  4ZE8 A;  2VOZ A;  3DLN A;  1SI1 A;  4O3B A;  2ALU A;  2VD2 A;  3RYD A;  1KWH A;  2NWJ A;  1IXI A;  3MZ9 A;  3K01 A;  4NE4 A;  4O8M A;  4LZ8 A;  1B5I A;  1ZIU A;  2X7P A;  2F7A A;  4E0W A;  1UQW A;  3U92 A;  1TFD A;  1MPD A;  1KA1 A;  1LLS A;  3B6W A;  2ZYO A;  4G8N A;  1DTZ A;  4IY6 A;  3VFJ A;  2Y7P A;  3O6G A;  5A5X A;  1ZMG A;  1YCJ A;  5AA4 B;  4PP0 A;  4DXC A;  4R74 A;  3OOA A;  1EZ9 A;  1SDX A;  1Y3Q A;  3T1B A;  1A40 A;  5L8D A;  3B7D A;  2OK2 A;  5H8F A;  1AL3 A;  1FBG A;  1MQH A;  3TPA A;  2HZK A;  3GYY A;  4ECF A;  1AH5 A;  1XHY A;  1FQC A;  3S9N C;  2XXX A;  3BKI B;  5AE4 A;  1N3X A;  4OVQ A;  3TQW A;  4P47 A;  3VE1 B;  4KI0 E;  3N6T A;  5H8N B;  2AYS A;  2I4B A;  4ND9 A;  1JW1 A;  4LQ5 A;  1XC1 A;  3KGC A;  4HTG A;  2I6E A;  4LON B;  4I3Y A;  4PAI A;  3UA8 A;  2HHM A;  3ONM A;  3DP8 A;  3BFT A;  3T9V A;  1DK4 A;  5CBS A;  1P1W A;  3FJG A;  1VFD A;  4YKJ A;  3O6I A;  4PFI A;  3Q29 A;  1H76 A;  1NNF A;  4JXI A;  3EPE A;  4GWS A;  2QVV A;  4WED A;  4OER A;  3KJT A;  5CI5 A;  1FBE A;  1MXX A;  1NNK A;  4R75 A;  2UVG A;  5I7I A;  2F6P A;  3USD A;  2Q88 A;  1O64 A;  3E78 A;  2XD2 A;  3PPR A;  3U8Q A;  1DPE A;  1OVT A;  2Y7K A;  3M3L A;  4MIJ A;  1FPF A;  4GIZ A;  1PB9 A;  3FXQ A;  3MQ9 A;  4OEN A;  1DSN A;  4NF6 A;  1HSJ A;  2YJP A;  4I9D A;  1NV7 A;  4R6K A;  4EUO A;  1UTH B;  3DEL B;  1SYH A;  4HE1 A;  4F22 A;  4H65 A;  3HPI A;  1QUL A;  1K9Z A;  1D4N A;  1MH4 A;  2PX1 A;  3SER A;  5I56 A;  4NF8 A;  3K02 A;  5H8N A;  4XIG Q;  1MXU A;  3PPQ A;  3KBZ A;  5JEI A;  3PMW A;  2CZL A;  4KYS A;  4Q8R A;  1Y4T A;  2Z8F A;  2B65 A;  2V93 A;  1LFH A;  3C4M A;  3CVG A;  4P1L A;  2OLB A;  1XOC A;  2XXU A;  1RYO A;  3FVO A;  4RK9 A;  5F1Q A;  4FEC A;  1B1X A;  1H45 A;  2B4L A;  2G93 A;  3KC1 A;  4MHF A;  3TFL A;  4RYA A;  1GGG A;  2DWA A;  1K9Y A;  4OEV A;  2WBD A;  2PVU A;  2A5T B;  2P0S A;  4X1D A;  1LCT A;  1Y9U A;  1P1Q A;  4KFQ A;  3TCH A;  3O28 A;  2XWO A;  3FXU A;  1QUK A;  1FQD A;  3TCG A;  4FJP A;  3DP6 A;  4N6D A;  2QPQ A;  3M8U A;  3PD8 A;  3TQL A;  4ZED A;  2RKM A;  4GL8 A;  5I2K A;  1FBD A;  3LUZ A;  4QFP A;  3IK6 B;  4H46 A;  4UA8 A;  3VVD A;  1JQF A;  3EN3 A;  1P99 A;  1UTH A;  5EHM A;  4ZS9 A;  2DVC A;  2DE4 A;  4NF0 A;  3L6H A;  4OQO A;  5J1D A;  1A8E A;  1NMU A;  4IGR A;  1FPE A;  2F36 A;  4XKN A;  5TU0 A;  1JP4 A;  1JW4 A;  3UGW A;  4N17 A;  1BKA A;  5FTH A;  1NH7 A;  3ECR A;  2XA5 A;  2R71 A;  1IQ7 A;  2OWS A;  3G3H A;  1MXV A;  1XI6 A;  3IOT A;  1NL5 A;  5ELV A;  4EF1 A;  3MVZ A;  5HBC A;  3IO4 A;  5CMB A;  5A5L A;  1B05 A;  4FBP A;  5EQ7 A;  4H67 A;  1N7X A;  3DP4 A;  5DT6 A;  1IXH A;  3RUM A;  4BDR A;  1FTM A;  2VPN A;  3VXC A;  3ZS6 A;  2WBB A;  4GF8 A;  4GX3 A;  4NF5 A;  4C0R A;  4LQ2 A;  3OSR A;  3QK6 A;  4G68 C;  2OJT A;  1QKB A;  3H6W A;  5KZT A;  1D9Q A;  4GFR A;  3S9L C;  2QMX A;  3MBP A;  2ABH A;  1H44 A;  3W15 C;  1M5B A;  4EQ7 A;  3A3C A;  4N91 A;  5EYF A;  3QUF A;  1EZO A;  2V25 A;  1JVX A;  4F31 B;  3CSB A;  4H5G A;  1MXW A;  1B2H A;  1AWB A;  2B4M A;  2HAV A;  4MNI A;  2V84 A;  1MM6 A;  5FTI A;  2F3B A;  1MY1 A;  1N0T A;  3W9W A;  2DDK A;  3VVE A;  5DVJ A;  1FJ6 A;  2P1S A;  2DOJ A;  2QVR A;  2OWT A;  4H45 A;  3E4R A;  4DI3 D;  2F3D A;  4FOR A;  3MYU A;  3GBB A;  2ZMB A;  1S50 A;  1D9V A;  1QVS A;  2E0S A;  4GL0 A;  3HHF A;  2Q8J A;  4OFJ A;  4GX4 A;  3ILT B;  4P1E A;  2ZZX A;  3TMG A;  3QIM A;  2CMO A;  3C35 A;  4GXS B;  5H8Q A;  4G8H A;  1IME A;  5CBR A;  1LAX A;  3K1N A;  3C31 A;  2PBW A;  4U22 A;  4MX6 A;  3VLV A;  4IO2 A;  2I48 A;  4G4P A;  1GTK A;  1DBZ A;  4UAB A;  1UTB A;  3CFL A;  3K4U A;  3FD3 A;  5CM6 A;  4LP2 B;  3ZKK A;  3SDF A;  1FTL A;  2CEY A;  1B4Z A;  1IXG A;  4MFI A;  1B51 A;  2P3N A;  2IA4 A;  4R72 A;  3S9E A;  2UYF A;  1MG1 A;  2Y7W A;  1LAH E;  4OFL A;  4PFW A;  3Q26 A;  2R6G E;  1YXI A;  3K6U A;  4PFU A;  4XKP A;  5DEX B;  1B46 A;  1LBX A;  2VP1 A;  5AA2 B;  3TKD A;  1RYX A;  2ONR A;  3RLF E;  1S7Y A;  3LBS A;  4UAC A;  2ANJ A;  1KZ8 A;  1H3D A;  4AQ4 A;  3VVF A;  3EQ1 A;  3PV0 E;  2YPN A;  3A09 A;  4L17 A;  5CMK A;  4OHN A;  4DZ1 A;  2H98 A;  1FRP A;  1FTK A;  5TP9 B;  3PPN A;  4MBP A;  3TOD A;  4NMY A;  3N26 A;  3FZV A;  1BK4 A;  1PBQ A;  4G68 A;  3QAX A;  3FIR A;  3R7X A;  3MAM A;  1NFT A;  4THI A;  1IMA A;  3RPL B;  2PFY A;  3G7W A;  4F3S A;  1F9B A;  1PEB A;  3OXN A;  5IAI A;  1MY2 A;  2O6A A;  1MRP A;  2Q2C A;  2ZYK A;  1FBH A;  1NUZ A;  2UVJ A;  1B6H A;  4PGP A;  4JWY A;  1XS5 A;  3T93 B;  2NVU B;  4QBA A;  3MP1 A;  1EZP A;  3TYH A;  4GWO A;  3CIJ A;  4LZ7 A;  3K1P A;  3U65 A;  2PMS A;  1FSA A;  3HO7 A;  3FBP A;  4LUB A;  3UIF A;  3G3J A;  1ZLQ A;  3PGF A;  1FQA A;  4LZ5 A;  3I5O A;  4F2Q A;  5AA2 A;  3PUV E;  4GWY A;  1WOD A;  4PAK A;  4BDO A;  4MLQ A;  5DW8 A;  1B3F A;  1MY3 A;  3KOS A;  5IGA A;  4YMA A;  1MM7 A;  1B52 A;  2XXR A;  2HQ0 A;  4ELO A;  5LOM A;  4XTC Q;  4NX1 A;  4U1O A;  3GXA A;  2WX9 A;  1M5C A;  4YB6 A;  2ESN A;  3BFU A;  2B3B A;  3TDJ A;  4DE8 A;  1VSO A;  4Q30 B;  5TP9 A;  3PUZ E;  3IL1 B;  4DCY A;  2DXY A;  3LSL A;  1FPK A;  3RT6 B;  2I3W A;  4E0X A;  2XXH A;  2I3V A;  5H8H A;  2CZH A;  2XWV A;  3KN7 A;  4QRZ A;  1IXC A;  4F1Y A;  3FVK A;  4PDH A;  1CE2 A;  2Q8M A;  4PE3 A;  1URD A;  2ZNT A;  3MZB A;  4X8R A;  3IX1 A;  1B3G A; 
#chains in the Genus database with same CATH homology
 3MUQ A;  1JVY A;  1UIV A;  2F97 A;  5ITP A;  3G3K A;  3FAS A;  2H9B A;  3UN6 A;  5I2N B;  3EHU A;  4N6P A;  5BWJ A;  4RPN A;  4XKQ A;  1N76 A;  1FQF A;  2Y7I A;  4EXK A;  2P2A A;  2O84 X;  4F39 A;  1DTG A;  3IOW A;  3LUY A;  1Z7M E;  2V3U A;  3Q25 A;  4QSD A;  2DWH A;  4NED A;  3CFX A;  3IB0 A;  3IOU A;  2RCB A;  4Q5T A;  4IGT A;  3LSW A;  1WVJ A;  2HZL A;  4NF4 B;  1QKA A;  2FNC A;  4GVO A;  1VR5 A;  3C9H A;  1GR2 A;  4F3B A;  1LFI A;  1AIV A;  2NXO A;  3MVX A;  2AL4 A;  5AA4 A;  5JK4 A;  2V3Q A;  2VD3 A;  1OIB A;  4M4G A;  3CR9 A;  1MS7 A;  2RC8 A;  3CG1 A;  4YB7 A;  2VGQ A;  1LAG E;  4KQP A;  1OQH A;  4WXJ A;  4YKP A;  5M2V A;  2PYY A;  2QS3 A;  2F7B A;  2ZNU A;  3RTW B;  3UOR A;  2YLN A;  1IZ1 A;  3T9H B;  2XX7 A;  1SW1 A;  1B3H A;  5I59 B;  3THI A;  4R6Y A;  2AL5 A;  3HHG A;  1B3L A;  1SI0 A;  2DE3 A;  2ZYN A;  2DSF A;  3K2D A;  3H06 B;  3TTK A;  4GLI A;  5TPA B;  4EQ9 A;  2QL3 A;  4QF9 A;  3CG3 A;  3FJ7 A;  1D3K A;  3R26 A;  2I0B A;  3FVG A;  4OYV A;  3U72 A;  2O69 A;  5KCJ B;  2QS1 A;  3L6G A;  1A8F A;  1Y1Z A;  2FYI A;  3K6X A;  5JTY B;  1S9T A;  4MH5 A;  1MQD A;  4FED A;  3C34 A;  4RPO A;  4R9G A;  4HW8 A;  5BUU A;  1A54 A;  3FAT A;  1QW0 A;  1P1U A;  1ZU0 A;  2IEE A;  2BJJ X;  2QRY A;  1R9L A;  5IKB A;  4OWD A;  4IO7 A;  4U4S A;  4AB6 A;  3V8X B;  4ZDM A;  1LGB C;  1JEU A;  1VE4 A;  2RIN A;  4X48 A;  2RC9 A;  4EXL A;  3TCF A;  2ONK E;  3SES A;  4YB5 A;  4ZZE A;  5DVF A;  2OCU A;  5ISU A;  4N13 A;  4R73 A;  4HS7 A;  1SD3 A;  4YIC A;  4IO3 A;  2B3F A;  4PE5 B;  1URG A;  3VV5 A;  2F5X A;  4RK2 A;  1M5D A;  2H4I A;  2H5Y A;  3FGS A;  5ICQ A;  1QUJ A;  4U4X A;  4F18 A;  4ELP A;  4F29 A;  3GBA A;  2X26 A;  3SEW A;  4JSD A;  4GXA A;  3KZG A;  5DYH A;  4RY1 A;  1POT A;  3TEL A;  2A5T A;  4R2F A;  2THI A;  5JTY A;  2Z23 A;  3H03 A;  2PT2 A;  1IIW A;  3C36 A;  3S9M C;  3TZA A;  1MXY A;  2XXV A;  1LB8 A;  1PBP A;  4P11 A;  1Y1M A;  2UYE A;  1LFG A;  4OTE A;  1SYI A;  3N5L A;  3UK4 A;  1Y3N A;  1YPN A;  3IAZ A;  4GD5 A;  2O7I A;  4H6D A;  1FQB A;  1N84 A;  2I4C A;  1Y20 A;  3KOT A;  2Z8E A;  3PUY E;  4BLA A;  4Z0I A;  2DE2 A;  3CSG A;  3WAE A;  3MZ1 A;  1TXF A;  2PT1 A;  1AOV A;  1EU8 A;  5L9M A;  1B9J A;  5K2X A;  2HCA A;  4YKK A;  2HAU A;  3PD9 A;  1SVX B;  3G3F A;  4X1B A;  3VDF A;  4HCY A;  2XXQ A;  1I6B A;  3H6V A;  3PMX A;  2DVZ A;  3PUX E;  4YKI A;  1B0H A;  2NOO A;  2UVH A;  4POX A;  1B3E A;  2Y7R A;  4QFO A;  3S4U A;  1USY E;  4U21 A;  3CI8 A;  3N94 A;  4IB2 A;  1B58 A;  1P1N A;  5I57 B;  1B1H A;  3ILU B;  3G3I A;  3N6U A;  3HST A;  1YTV A;  4BDL A;  3LSF B;  3KFM A;  2NUV A;  3RN8 A;  4OZ9 A;  4ISU A;  1FTJ A;  1R9Q A;  1UIU A;  4IO5 A;  1II5 A;  1MDQ A;  3IR1 A;  3KJ7 A;  4RXL A;  1O63 A;  3KBR A;  1ATG A;  2H25 A;  1YAE A;  2Q89 A;  1MXZ A;  5FHO A;  4YU0 A;  1FCK A;  3KN8 A;  3C32 A;  4WEP A;  2R9J A;  4PQJ A;  3RQT A;  1B7U A;  4U2R A;  5L9O A;  4H8J A;  3HV1 A;  4R2B A;  1O7T A;  3VLW A;  1DPP A;  4ZEK A;  3K0V A;  1R1N A;  1FTO A;  5KDT B;  1H43 A;  5A5X B;  4KHZ E;  1DMB A;  3PPP A;  3B6Q A;  2ZXT A;  1OMP A;  2XHD A;  3SET A;  1SQY A;  3RTF B;  4M1V A;  2XXP A;  3OO8 A;  4NTL A;  1ELJ A;  2F34 A;  3TTR A;  2XXI A;  5K2Y A;  3PPO A;  4RNS A;  3H7M A;  3GLB A;  4QSE A;  3BBR A;  3OO6 A;  5L9S A;  1AMF A;  2LAO A;  5DEX A;  4ELQ A;  3K1M A;  3MPK A;  4BDM A;  4IY5 A;  1Q35 A;  4KCD A;  3SKP A;  4O3A A;  1A99 A;  3MVY A;  4WKM A;  3D4C A;  1M5E A;  3KEI A;  1I6Q A;  5CMM A;  3U1O A;  3UP9 A;  4YZZ A;  1MH3 A;  1NKX A;  3SEU A;  1PC3 A;  4F3G A;  3FUZ A;  1N04 A;  4U1Z A;  2QJE A;  4Z7E A;  3ODB A;  4QFN A;  4JWX A;  4GRK A;  1GVC A;  1SW2 A;  3IJO B;  2ZYM A;  3EHT A;  1RKM A;  2O1M A;  1JET A;  2QS4 A;  4LVQ A;  2XD3 A;  3TTN A;  5KDT A;  3TUS A;  1IUD A;  3JV9 A;  3FVN A;  1LBB A;  2GHB A;  3Q27 A;  4I8C A;  3OSQ A;  4G2Z A;  3HN0 A;  5HPQ A;  4NF6 B;  4P0I A;  3FV2 A;  4ZEI A;  3O9P A;  3I3V A;  4OVJ A;  3FXR A;  1B4H A;  1US5 A;  2DS9 A;  3S2V A;  4C1T A;  3RY3 A;  3TTL A;  4FAJ A;  1NNT A;  1FW0 A;  2XX8 A;  2QMW A;  4OXV A;  3LR1 A;  2XX9 A;  5I56 B;  3TTM A;  2V3T A;  4NF8 B;  3O29 A;  1BP5 A;  3EF7 A;  1BIY A;  2REG A;  3EHS A;  3MP8 A;  1BTJ A;  1FQE A;  2DYX A;  5FHM A;  3QUJ A;  4F1V A;  4XKR A;  1A7L A;  3H6U A;  4R6H A;  3H6T A;  3KG2 A;  1XVX A;  4ZEB A;  1I69 A;  3E9X A;  4ZZA A;  3H4Z A;  4PET A;  4QHQ A;  1OQG A;  3IO6 A;  5DVI A;  4MF3 A;  3V89 B;  4BDQ A;  4G77 A;  4KPT A;  3F11 A;  3C33 A;  3PU5 A;  3U94 A;  4ONY A;  4YAH X;  2GRV A;  1I6A A;  4KD5 A;  4RA1 A;  5I2K B;  3K6W A;  4TQU Q;  3V5A A;  1NNP A;  3DM0 A;  3OO7 A;  1HSL A;  2OBG A;  3R6U A;  5H8S A;  1NH8 A;  4QFK A;  3H3G A;  1LB9 A;  1ANF A;  3T9X B;  5I2N A;  2RCA A;  5I84 A;  2Q9T A;  5AA2 D;  1LCF A;  3JYR A;  2HXW A;  3G3G A;  4POW A;  2Z8D A;  3SEX A;  2ZNS A;  1TT1 A;  3K00 A;  1MQG A;  2I58 A;  4TOZ A;  4ESW A;  5B7D A;  3IB2 A;  4FE8 A;  4HCW A;  1EH3 A;  1IIT A;  2HEU A;  5I58 B;  4NWD A;  2F7C A;  3QSL A;  4NF4 A;  1P1O A;  3OMB A;  3P7I A;  1SW5 A;  1IEJ A;  2DWJ A;  1B40 A;  1XVY A;  3B6T A;  2Z22 A;  5DTB A;  5CC2 A;  4R9F A;  4JBZ A;  1ZJL A;  4NF5 B;  2GH9 A;  5FHN A;  2Q2A A;  3O66 A;  4GOT A;  4QFL A;  3MJN A;  3TEP A;  3IB1 A;  3ZKL A;  1PB7 A;  2I0C A;  4H1X A;  5AA1 A;  3E13 X;  4FAT A;  2WKY A;  4DXB A;  4KCC A;  2F35 A;  2GHA A;  3A3U A;  1R6Z A;  5I59 A;  1MQJ A;  3KSX A;  2XXT A;  3IOV A;  1OVB A;  3TAJ A;  5EHS A;  1M5F A;  5AA3 A;  3MVW A;  2F8D A;  2G29 A;  2VHA A;  4KYD A;  5TPA A;  1LAF E;  4DIG A;  3MPL A;  4JWO A;  2X7Q A;  1B7Z A;  3PUW E;  1POY 1;  2M8C A;  4OEU A;  4ZEF A;  1Z7N E;  4OES A;  1LBC A;  1TWY A;  5CRY A;  1USY H;  1L5T A;  4QSC A;  3O6H A;  3ZSF A;  1MY4 A;  4PFT A;  5I58 A;  5H8Q B;  5KCJ A;  4XXU A;  2DWI A;  4JB7 A;  1J1N A;  2O7U A;  3M3F A;  2FA7 A;  4F3P A;  4KR5 A;  1UTB B;  2HFB A;  4AB5 A;  2DP8 A;  3MC2 A;  3SEY A;  3O2A A;  3U93 A;  3HCQ A;  4LAT A;  4OET A;  3VLU A;  4F19 A;  3Q28 A;  1VFE A;  4P0G A;  4EDP A;  4X9T A;  2O1L A;  2UVI A;  4IO6 A;  4TLL B;  4EQB A;  1GV8 A;  2ONS A;  4OFO A;  2AIX A;  2O51 A;  4LA9 A;  4K3F A;  2O68 A;  1JW5 A;  3D4G A;  1D9Y A;  4PFY A;  4JSO A;  1MPC A;  1Y4C A;  3W9V A;  3VXB A;  2XXW A;  2H99 A;  4DLD A;  1T0K A;  4DDD A;  1MPB A;  4GQO A;  3OEK A;  3FJM A;  4Q0C A;  1QUI A;  3CRB A;  2QSX A;  3QYT A;  5HM4 B;  1Y3P A;  1ZTY A;  4H5F A;  2DQV A;  4F1U A;  1JEV A;  1B7H A;  4H0W A;  3MWB A;  1XT8 A;  1ZBM A;  3QXM A;  3OD7 A;  2F6G A;  3GZG A;  4ZEC A;  5F7V A;  2UXA A;  5B70 A;  4JDF A;  3E3K A;  1B0L A;  3WAF A;  4ESX A;  4YMB A;  4G68 B;  3T66 A;  1TFA A;  4MLV A;  3RT8 A;  4FEB A;  4N07 A;  3IJX B;  3RPW A;  4BDN A;  4EF2 A;  1JNF A;  1BLF A;  2F78 A;  3OEM A;  2GFE A;  2KLF A;  4NWC A;  3V83 A;  1CB6 A;  1N7W A;  3OEL A;  4F2O A;  2QS2 A;  1Q1K A;  1B32 A;  1SW4 A;  1MDP 1;  4OMB A;  2OZZ A;  1QJM A;  1N3W A;  4H8I A;  1B5H A;  2RF1 A;  3LC8 A;  3KN3 A;  2I49 A;  1PB8 A;  2RC7 A;  5ITO A;  1OLC A;  5ICT A;  1LST A;  2A5S A;  4G8M A;  1B5J A;  2W7Y A;  1HSE A;  3MW0 A;  3RNN A;  1SBP A;  4O3C A;  2D21 A;  2REJ A;  1A55 A;  4U23 A;  3T96 B;  4I1D A;  3I6V A;  3T22 A;  3AXF A;  4TLM B;  4IO4 A;  3SEV A;  2XXY A;  3IOR A;  3PMV A;  4FIM A;  5H8H B;  4ELR A;  4ZE9 A;  1MY0 A;  5H8F B;  1MQI A;  1DOT A;  4DCX A;  3O97 A;  4C1U A;  3M3K A;  4I62 A;  3K6V A;  5I57 A;  1PDA A;  3JZJ A;  3FV1 A;  3CFZ A;  3T9U A;  3LSX A;  4RJZ A;  4DXU A;  1WDN A;  4KYE A;  1US4 A;  2D5W A;  3MP6 A;  3OO9 A;  3KSJ A;  3RGY A;  1URS A;  1OLA A;  2Y84 A;  3OEN A;  5CMC A;  2E1S A;  2DXR A;  2D3I A;  1ZKB A;  4ZE8 A;  2VOZ A;  3DLN A;  1SI1 A;  4O3B A;  2ALU A;  2VD2 A;  1KWH A;  2NWJ A;  1IXI A;  3MZ9 A;  3K01 A;  4NE4 A;  4LZ8 A;  1B5I A;  1ZIU A;  2X7P A;  2F7A A;  4E0W A;  1UQW A;  3U92 A;  1TFD A;  1MPD A;  1LLS A;  3B6W A;  2ZYO A;  4G8N A;  1DTZ A;  4IY6 A;  3VFJ A;  2Y7P A;  3O6G A;  5A5X A;  1ZMG A;  1YCJ A;  5AA4 B;  4PP0 A;  4DXC A;  4R74 A;  3OOA A;  1EZ9 A;  1SDX A;  1Y3Q A;  1A40 A;  5L8D A;  3B7D A;  2OK2 A;  5H8F A;  1AL3 A;  1MQH A;  3TPA A;  2HZK A;  4ECF A;  1AH5 A;  1XHY A;  1FQC A;  3S9N C;  2XXX A;  5AE4 A;  3BKI B;  1N3X A;  3TQW A;  3VE1 B;  4KI0 E;  3N6T A;  5H8N B;  2AYS A;  2I4B A;  4ND9 A;  1JW1 A;  4LQ5 A;  1XC1 A;  3KGC A;  4HTG A;  2I6E A;  4LON B;  3UA8 A;  3ONM A;  3DP8 A;  3BFT A;  3T9V A;  5CBS A;  1P1W A;  3FJG A;  1VFD A;  4YKJ A;  3O6I A;  3Q29 A;  1H76 A;  1NNF A;  4JXI A;  3EPE A;  4WED A;  4OER A;  3KJT A;  5CI5 A;  1MXX A;  1NNK A;  4R75 A;  2UVG A;  2F6P A;  3USD A;  2Q88 A;  1O64 A;  2XD2 A;  3PPR A;  3U8Q A;  1DPE A;  1OVT A;  2Y7K A;  3M3L A;  4GIZ A;  1PB9 A;  3FXQ A;  3MQ9 A;  4OEN A;  1DSN A;  4NF6 A;  1HSJ A;  2YJP A;  4I9D A;  4R6K A;  4EUO A;  1UTH B;  3DEL B;  1SYH A;  4F22 A;  4H65 A;  3HPI A;  1QUL A;  1D4N A;  1MH4 A;  2PX1 A;  3SER A;  5I56 A;  4NF8 A;  3K02 A;  5H8N A;  4XIG Q;  1MXU A;  3PPQ A;  5JEI A;  2CZL A;  3PMW A;  4KYS A;  4Q8R A;  1Y4T A;  2Z8F A;  2B65 A;  2V93 A;  1LFH A;  3C4M A;  3CVG A;  2OLB A;  1XOC A;  2XXU A;  1RYO A;  3FVO A;  4RK9 A;  5F1Q A;  4FEC A;  1B1X A;  1H45 A;  2G93 A;  3TFL A;  4RYA A;  1GGG A;  2DWA A;  4OEV A;  2PVU A;  2A5T B;  2P0S A;  4X1D A;  1LCT A;  1Y9U A;  1P1Q A;  4KFQ A;  3TCH A;  3O28 A;  3FXU A;  1QUK A;  1FQD A;  3TCG A;  4FJP A;  3DP6 A;  2QPQ A;  3M8U A;  3PD8 A;  3TQL A;  4ZED A;  2RKM A;  4GL8 A;  5I2K A;  4QFP A;  3IK6 B;  4UA8 A;  3VVD A;  1JQF A;  3EN3 A;  1P99 A;  1UTH A;  5EHM A;  4ZS9 A;  2DVC A;  2DE4 A;  3L6H A;  4OQO A;  5J1D A;  1A8E A;  1NMU A;  4IGR A;  2F36 A;  4XKN A;  5TU0 A;  3UGW A;  1JW4 A;  1BKA A;  5FTH A;  1NH7 A;  3ECR A;  2R71 A;  1IQ7 A;  2OWS A;  3G3H A;  1MXV A;  3IOT A;  1NL5 A;  5ELV A;  4EF1 A;  3MVZ A;  5HBC A;  3IO4 A;  5CMB A;  1B05 A;  4H67 A;  1N7X A;  3DP4 A;  5DT6 A;  1IXH A;  3RUM A;  4BDR A;  1FTM A;  3VXC A;  3ZS6 A;  4GF8 A;  4NF5 A;  4C0R A;  4LQ2 A;  3OSR A;  3QK6 A;  4G68 C;  2OJT A;  1QKB A;  3H6W A;  5KZT A;  4GFR A;  3S9L C;  2QMX A;  3MBP A;  2ABH A;  1H44 A;  3W15 C;  1M5B A;  4EQ7 A;  3A3C A;  5EYF A;  3QUF A;  1EZO A;  2V25 A;  1JVX A;  4F31 B;  3CSB A;  4H5G A;  1MXW A;  1B2H A;  2HAV A;  2V84 A;  1MM6 A;  5FTI A;  1MY1 A;  1N0T A;  3W9W A;  3VVE A;  5DVJ A;  2P1S A;  2DOJ A;  2OWT A;  3E4R A;  4FOR A;  3GBB A;  2ZMB A;  1S50 A;  1D9V A;  1QVS A;  2E0S A;  4GL0 A;  3HHF A;  2Q8J A;  4OFJ A;  3ILT B;  3TMG A;  3QIM A;  2CMO A;  3C35 A;  4GXS B;  5H8Q A;  4G8H A;  5CBR A;  1LAX A;  3K1N A;  3C31 A;  2PBW A;  4U22 A;  3VLV A;  4IO2 A;  2I48 A;  4G4P A;  1GTK A;  1UTB A;  3CFL A;  3K4U A;  3FD3 A;  5CM6 A;  4LP2 B;  3ZKK A;  3SDF A;  1FTL A;  1B4Z A;  1IXG A;  4MFI A;  1B51 A;  2IA4 A;  4R72 A;  3S9E A;  2UYF A;  1MG1 A;  2Y7W A;  1LAH E;  4OFL A;  4PFW A;  3Q26 A;  2R6G E;  3K6U A;  4PFU A;  4XKP A;  5DEX B;  1B46 A;  2VP1 A;  5AA2 B;  3TKD A;  1RYX A;  2ONR A;  3RLF E;  1S7Y A;  3LBS A;  4UAC A;  2ANJ A;  1H3D A;  4AQ4 A;  3VVF A;  3EQ1 A;  3PV0 E;  2YPN A;  3A09 A;  4L17 A;  5CMK A;  4OHN A;  4DZ1 A;  2H98 A;  1FTK A;  5TP9 B;  3PPN A;  4MBP A;  3TOD A;  4NMY A;  3N26 A;  3FZV A;  1PBQ A;  4G68 A;  3QAX A;  3FIR A;  3R7X A;  3MAM A;  1NFT A;  4THI A;  3G7W A;  4F3S A;  1F9B A;  1PEB A;  3OXN A;  5IAI A;  1MY2 A;  2O6A A;  1MRP A;  2Q2C A;  2ZYK A;  2UVJ A;  1B6H A;  4JWY A;  1XS5 A;  3T93 B;  2NVU B;  3MP1 A;  1EZP A;  3TYH A;  4GWO A;  3CIJ A;  4LZ7 A;  3K1P A;  2PMS A;  3HO7 A;  4LUB A;  3UIF A;  3G3J A;  1ZLQ A;  3PGF A;  1FQA A;  4LZ5 A;  3I5O A;  4F2Q A;  5AA2 A;  3PUV E;  1WOD A;  4BDO A;  4MLQ A;  1B3F A;  1MY3 A;  3KOS A;  4YMA A;  1MM7 A;  1B52 A;  2XXR A;  2HQ0 A;  4ELO A;  5LOM A;  4XTC Q;  4U1O A;  3GXA A;  1M5C A;  4YB6 A;  2ESN A;  3BFU A;  2B3B A;  3TDJ A;  4DE8 A;  1VSO A;  4Q30 B;  5TP9 A;  3PUZ E;  3IL1 B;  4DCY A;  2DXY A;  3LSL A;  3RT6 B;  2I3W A;  4E0X A;  2XXH A;  2I3V A;  5H8H A;  3KN7 A;  4QRZ A;  1IXC A;  4F1Y A;  3FVK A;  1CE2 A;  1URD A;  2ZNT A;  3MZB A;  3IX1 A;  1B3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...