2Q88A

Crystal structure of ehub in complex with ectoine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
257
structure length
257
Chain Sequence
RDENKLEELKEQGFARIAIANEPPFTAVGADGKVSGAAPDVAREIFKRLGVADVVASISEYGAMIPGLQAGRHDAITAGLFMKPERCAAVAYSQPILCDAEAFALKKGNPLGLKSYKDIADNPDAKIGAPGGGTEEKLALEAGVPRDRVIVVPDGQSGLKMLQDGRIDVYSLPVLSINDLVSKANDPNVEVLAPVEGAPVYCDGAAFRKGDEALRDAFDVELAKLKESGEFAKIIEPYGFSAKAAMSTTREKLCAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ABC transporter amino acid-binding protein
publication title Crystal structure of the ligand-binding protein EhuB from Sinorhizobium meliloti reveals substrate recognition of the compatible solutes ectoine and hydroxyectoine.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transport protein
total genus 81
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2007-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2q88A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2q88A02
1H44A 1B7ZA 1GVCA 1MY4A 2PBWA 1B4ZA 1MPBA 5J1DA 3CG1A 3S2VA 2VD3A 5JTYA 3GBBA 1Z7NE 3FVKA 1IUDA 4EXKA 4H65A 3CI8A 3IB1A 1MXYA 5I2NB 2W7YA 4OESA 5B70A 3L6GA 3QUFA 3I6VA 1P1NA 2XXWA 3WAFA 4K3FA 1MG1A 4XXUA 3RUMA 1A40A 1YTVA 1MQGA 1JVXA 3T96B 4O3AA 2H4IA 2D21A 4F22A 4GFRA 2VOZA 4GLIA 1MXVA 4OTEA 3I3VA 3N26A 3TQLA 5I58B 2DE4A 3E3KA 4RXLA 1WODA 4G2ZA 1ZU0A 4IY6A 3CFZA 3EHTA 5DVIA 3KJ7A 5H8FB 1Y20A 3V89B 3FJGA 4RK9A 3W9WA 3H7MA 4U1ZA 1NNPA 4GWOA 3THIA 3SETA 4NE4A 4NF4B 4OXVA 1L5TA 1UIUA 3VLUA 3A3CA 4R6HA 4KHZE 1GTKA 1B9JA 4KI0E 2DE3A 1M5BA 3H6UA 3W15C 5A5XB 3MJNA 3KZGA 1NNFA 1VFDA 3OSQA 5CMKA 4GXAA 3FVOA 4O3BA 2NXOA 5JK4A 2RC9A 4ELRA 3O97A 5L8DA 4QFKA 4QF9A 1N0TA 2D5WA 3LSFB 1UQWA 1B2HA 1OLAA 3H06B 3KJTA 3T9UA 1QKAA 1ZMGA 1TWYA 5HPQA 4KFQA 4YB6A 2GFEA 3PUZE 2Q2AA 3IO4A 4HW8A 3G3KA 4Q5TA 4IY5A 4XKPA 4DE8A 5CM6A 5LOMA 2V3TA 4I9DA 1LSTA 5IAIA 3EHSA 4I62A 1USYH 2P1SA 4TLLB 3VE1B 2QMXA 4PETA 2AIXA 1HSJA 3IB2A 3TTLA 4R73A 2DSFA 2OJTA 1XC1A 4LONB 4EQ9A 1AMFA 1DOTA 1JVYA 4GF8A 3MZ9A 5TU0A 4FORA 3KN7A 3ZKKA 3EN3A 3K01A 4ESXA 4QSDA 2YLNA 1IXGA 4RA1A 3N5LA 1ATGA 3LC8A 4XTCQ 1M5FA 2GH9A 4ZECA 2AL5A 5I59B 3H4ZA 1Q1KA 5DTBA 2RCBA 1MS7A 5DVFA 1N3WA 3DM0A 2DVCA 1AOVA 3PMVA 3EQ1A 3O6IA 4LZ8A 1XVXA 3S9LC 1US4A 2O51A 3S9EA 1ZLQA 4ZS9A 3BFUA 4F1VA 4Z7EA 1I6QA 2H25A 1Y3NA 3H3GA 3FGSA 1SYHA 3MPKA 3O2AA 3IB0A 4P0GA 5CC2A 3UORA 1WVJA 4YU0A 2Y7KA 4HCYA 2ONSA 4WXJA 1B1HA 1S50A 1MH3A 1II5A 2B3BA 4TOZA 2Q89A 1MM7A 4QHQA 4F31B 4F39A 4XIGQ 2F7BA 3IOWA 2Q88A 2RF1A 3G7WA 3DELB 1TT1A 1QVSA 5BWJA 5CMMA 4ELPA 4KYSA 3U8QA 4PFUA 4ZEBA 4NF6B 1MY0A 1LGBC 4U2RA 3AXFA 5AA2D 1H43A 3FXRA 3QXMA 1M5CA 1MXUA 5JEIA 3IK6B 4FAJA 3K6XA 4OFJA 5I2KB 5ITOA 3CSGA 1EZ9A 1HSEA 3TAJA 1VFEA 3CFXA 4H5GA 3QAXA 4YKPA 2OBGA 2XX7A 2GHBA 3RPWA 3PGFA 1QW0A 4DXUA 2ABHA 1LFGA 2F97A 3VXCA 1MQDA 1Y3PA 3OSRA 1JETA 2I6EA 2VP1A 5DT6A 1RKMA 2DWIA 1B32A 3GLBA 4GL8A 3TFLA 3LR1A 4RPNA 3TCGA 2Z8FA 4BDOA 4F2OA 1FQCA 5H8SA 4EXLA 4F29A 3I5OA 1MQJA 3PUWE 2OWSA 3O6HA 1P1UA 3CIJA 1FW0A 2QS2A 3MUQA 3PMWA 1R9QA 3RLFE 3SEXA 5B7DA 1B6HA 4IGRA 4Q0CA 2PYYA 2ALUA 4DXCA 2GHAA 3OO9A 5CMCA 4P0IA 1LAHE 1QULA 2E0SA 3GXAA 2P2AA 5I56A 4QSCA 4N6PA 2O1LA 4OVJA 2A5TB 1J1NA 3C31A 4R6YA 1SD3A 1MH4A 5CBRA 5H8NA 2HZKA 1Y4TA 4LZ5A 3UN6A 1FTOA 4H8IA 1US5A 2ZXTA 1AH5A 2NUVA 1LCTA 1MPDA 3F11A 3O28A 1P99A 4R72A 3PPOA 1QKBA 3Q25A 1M5EA 3TTRA 4KR5A 1VR5A 3TCFA 3K02A 3FD3A 4H8JA 3RTFB 4R9GA 3IJXB 1IQ7A 4YKIA 1Q35A 5L9SA 4NWDA 3D4CA 3MC2A 1ZTYA 3PUVE 3MVZA 2IA4A 2VD2A 3TPAA 2DXYA 4F3SA 2UVJA 1EU8A 1MXXA 3LSXA 3FVGA 1MY3A 1JQFA 1S9TA 1B0HA 5EYFA 3HPIA 2RCAA 4ESWA 1B3FA 4R6KA 3O6GA 1A99A 4FATA 1JEUA 3SESA 3MP8A 3ZS6A 3RY3A 5AA4B 3HHFA 3R6UA 1LB9A 1QJMA 2YPNA 4L17A 4Q30B 4C1TA 4OWDA 5HM4B 4RNSA 3E9XA 3RN8A 3N94A 1TXFA 3EPEA 4DIGA 3OOAA 1LAFE 2LAOA 3TDJA 4Q8RA 5ITPA 1B52A 3K6VA 4H0WA 4U4XA 3WAEA 3G3IA 4XKNA 3DP4A 3TTNA 5DEXA 5KDTB 3PPPA 4NF5B 2O84X 2Y84A 2XXQA 5FTIA 5FHNA 2NVUB 2XD3A 1KWHA 3V8XB 2QPQA 4H1XA 4Z0IA 3TELA 3P7IA 1SBPA 3RGYA 4FEBA 1DTZA 4PE5B 2DWHA 2P0SA 3FJ7A 5KCJA 4R2FA 5F1QA 2G29A 2V84A 1B5JA 2X7PA 2FYIA 2H99A 3EHUA 3TQWA 3TEPA 4ISUA 2R6GE 4F18A 1FCKA 4G68C 3A09A 2Z23A 4RPOA 3GZGA 4YZZA 3IOUA 4LUBA 2DWJA 3K1MA 1IXHA 4MFIA 2V3UA 3RT6B 2XXVA 4GRKA 2ZYMA 4G8MA 3OO7A 1OLCA 4LQ5A 2UXAA 1SI0A 4ZZAA 1D3KA 3O29A 1YAEA 4FE8A 3ILUB 4BDMA 3QUJA 4ZEDA 2QS1A 2XX8A 4MF3A 1MXZA 1IITA 5TP9B 1RYXA 3C32A 3ZSFA 4R75A 3H6WA 1PBQA 2UVGA 1D9VA 4OENA 3S9NC 4EDPA 4GL0A 1MPCA 1CB6A 4QSEA 1LLSA 3W9VA 1PC3A 2ZNUA 4IO5A 5EHSA 5ICTA 2YJPA 2Z8EA 3D4GA 4YKKA 5CMBA 2UYFA 3O66A 3TMGA 1XVYA 1OIBA 5EHMA 4I8CA 3UP9A 2NWJA 2FNCA 3T9VA 2REJA 1Y1MA 2AL4A 3R7XA 1BP5A 4XKQA 3CG3A 2VGQA 3MP1A 2F35A 4OZ9A 1O63A 4R74A 2Y7RA 2V25A 4F2QA 1JW5A 4GOTA 2V3QA 5H8HB 1XOCA 2F6PA 4YAHX 5H8QA 3IAZA 4I1DA 4U4SA 4YKJA 1UTHA 5I57B 3K2DA 4MLVA 4TQUQ 4YB5A 3Q28A 3SEYA 5HBCA 1NKXA 2Z8DA 3FATA 1AIVA 3QYTA 3S4UA 4JBZA 3G3HA 3VLWA 2F6GA 3M3KA 1PEBA 4G8HA 1UTBA 3K0VA 4BLAA 1BIYA 2I58A 5I56B 1QUIA 1MY2A 3PD8A 1PB8A 4P11A 1DSNA 1B0LA 4YICA 3B6TA 2QRYA 2GRVA 1NNKA 2Q8JA 2I3WA 2IEEA 3IX1A 3H6TA 3M8UA 1XS5A 3LSWA 5I58A 3T66A 2HAVA 1PB7A 1Y3QA 4ONYA 3IO6A 3PPRA 3IJOB 3U93A 3KOTA 5H8FA 4IB2A 3Q29A 3VDFA 2REGA 3TTKA 4NF8B 3RNNA 1T0KA 4OQOA 3SEWA 3VVFA 1B3EA 1GV8A 3PPQA 1N04A 3TCHA 4ZEKA 2F8DA 4X1BA 4RYAA 4FEDA 2OCUA 3T93B 2PT1A 3HN0A 1FQFA 3CRBA 5TPAB 2XXIA 3IR1A 3PD9A 4JWYA 1Y4CA 2ZMBA 3PV0E 1M5DA 5A5XA 1HSLA 1IXIA 3JV9A 4R9FA 5CI5A 2F78A 1QUJA 4QFLA 3CSBA 1FQDA 1B51A 1O7TA 1ANFA 2V93A 3T22A 1LB8A 1P1QA 3K00A 3K6WA 3MVWA 3OELA 4OEUA 2PMSA 4FJPA 5JTYB 4JDFA 4KQPA 2PX1A 2PT2A 3QK6A 3G3GA 3KOSA 4U22A 1XT8A 2Q2CA 3UGWA 3M3LA 1SW2A 2ZYOA 4AB5A 5KZTA 1LFIA 4NEDA 4OERA 1B3GA 4F1YA 5DVJA 4UA8A 1URGA 3UK4A 4F3PA 4KCDA 1CE2A 2HXWA 2H9BA 3VFJA 4G68A 4JSDA 2QSXA 4KYEA 4X9TA 3V83A 2Y7WA 4MH5A 3LSLA 4H5FA 4DLDA 3C4MA 3SEVA 1A7LA 4OETA 2HAUA 3IOVA 1LCFA 4ZZEA 4NTLA 2I4BA 1OQHA 1A54A 5I59A 4LA9A 4PFYA 4RY1A 2DVZA 1R9LA 3JZJA 1H45A 1OMPA 2HEUA 3QSLA 4LVQA 4PP0A 2DE2A 3TYHA 4H6DA 1AL3A 4HS7A 3KGCA 3C36A 1DPPA 4OFOA 2ONRA 4DXBA 1B7UA 1SYIA 2B65A 4PQJA 2OK2A 2I48A 2O68A 3LUYA 4MBPA 1VSOA 4PFWA 1I6AA 5AE4A 3VV5A 1PB9A 2I4CA 1MY1A 3T9HB 1LFHA 4LP2B 3HCQA 1NL5A 4QFPA 3KSJA 5FTHA 4GVOA 4ZDMA 2M8CA 4U23A 2I49A 1MM6A 2A5SA 4OMBA 2HQ0A 3CR9A 3B6QA 4LATA 3VVDA 1IZ1A 1TFDA 3CFLA 2XXHA 1B3LA 3Q27A 4HCWA 3ZKLA 4F19A 1URDA 3R26A 3B6WA 1DMBA 5I2KA 3TUSA 2ONKE 3OENA 3DP6A 3B7DA 3G3FA 4KD5A 3ODBA 2F34A 4POXA 5H8QB 2F5XA 4M1VA 2KLFA 1H3DA 1UTHB 1UIVA 2QJEA 4ECFA 4OFLA 5L9MA 1POTA 4C1UA 3U94A 1PDAA 4E0XA 4U1OA 1FTJA 4F3BA 2WKYA 1D9YA 4PFTA 1UTBB 5CRYA 1OVTA 1B3HA 4WKMA 4KPTA 1USYE 4MLQA 1SQYA 1NNTA 3E4RA 3KBRA 2DYXA 1JEVA 3FASA 4BDLA 1MDP1 2X7QA 5ICQA 5FHOA 3H03A 2VHAA 1A55A 2ZYKA 3FVNA 2XXXA 1MRPA 1IEJA 2XXRA 3OEKA 3SEUA 3MVYA 4C0RA 4YMBA 4GD5A 4G4PA 4YB7A 1BLFA 3BKIB 1NMUA 1JNFA 2Y7PA 3VVEA 4H67A 3SERA 1Z7ME 3JYRA 2A5TA 3K6UA 2H5YA 3KEIA 4QFOA 1H76A 3PUXE 4BDRA 3A3UA 2RKMA 2NOOA 2F36A 1NH8A 1Y1ZA 3IL1B 2Q9TA 4DDDA 3S9MC 3SKPA 1R1NA 4R2BA 1LBBA 4GQOA 1B7HA 3OXNA 2RINA 4EF2A 2BJJX 1VE4A 3U1OA 4JSOA 4IO3A 4O3CA 4JWOA 1MQHA 5I84A 1MQIA 1EH3A 5FHMA 2F7AA 2F7CA 3HHGA 2CZLA 1NFTA 1SVXB 3OO6A 5L9OA 5AA2A 1FTKA 4OHNA 2XHDA 4IO7A 1LAXA 1N3XA 1N7XA 4QFNA 4KCCA 3SDFA 3U72A 1R6ZA 1N7WA 2XXTA 2E1SA 1SW5A 2I0BA 3O9PA 3IORA 4AQ4A 2DP8A 2DS9A 4DCXA 1S7YA 2ESNA 5M2VA 3KFMA 4QRZA 3C9HA 4IO4A 1IXCA 1RYOA 2QMWA 4IO2A 2HZLA 2DXRA 3KN8A 5AA4A 4EQBA 1B05A 4G68B 1N84A 3PMXA 1FQEA 4FIMA 3K1NA 2ZNSA 3V5AA 1Y9UA 2PVUA 1D4NA 3VXBA 2QS3A 1I69A 2XXUA 2HFBA 4LQ2A 4M4GA 2DOJA 4ZEFA 4ZEIA 5I2NA 4YMAA 4DZ1A 1B40A 3DLNA 4THIA 2THIA 3EF7A 1ZKBA 2B3FA 4JB7A 3BBRA 1P1OA 4GXSB 3OO8A 4POWA 1QUKA 2XXYA 2ANJA 5KDTA 1DPEA 4WEDA 4E0WA 4NF5A 5H8NB 4IO6A 3TODA 1B4HA 1ZBMA 1NH7A 2O7UA 1DTGA 1TFAA 3IOTA 4ND9A 3KN3A 3UA8A 1ZIUA 1ELJA 1B5HA 3PPNA 3QIMA 4NF4A 3FZVA 3FV1A 1PBPA 3ONMA 4EUOA 4LZ7A 1N76A 3RTWB 3U92A 4WEPA 2Z22A 2O1MA 2O69A 4ZE8A 2UYEA 2UVIA 3FJMA 3MAMA 1OQGA 3OMBA 2Y7IA 3MZ1A 3E13X 3ILTB 1FTLA 1IIWA 2AYSA 3MBPA 3MQ9A 2XXPA 3L6HA 1SI1A 1MXWA 4NMYA 4TLMB 1F9BA 5ELVA 3FXQA 5TP9A 1LAGE 4G77A 3C33A 3MWBA 3CVGA 1WDNA 4DCYA 1SDXA 2X26A 1URSA 4IGTA 1GR2A 5AA3A 1BKAA 3LBSA 4GIZA 1P1WA 3MVXA 2OZZA 5IKBA 3ECRA 1JW4A 4EQ7A 4OEVA 4EF1A 4RJZA 3N6TA 5ISUA 3PU5A 2XX9A 3G3JA 2G93A 1B1XA 4KYDA 4RK2A 2R71A 3H6VA 3RT8A 5DEXB 1OVBA 1FTMA 3KSXA 2RC7A 2OWTA 2I3VA 4N07A 3KG2A 3Q26A 4JXIA 5H8HA 3VLVA 3C35A 3FXUA 3TTMA 1POY1 5I57A 2FA7A 4FECA 5CBSA 5KCJB 1FQBA 1EZOA 2O7IA 1SW1A 3USDA 3TZAA 1JW1A 4AB6A 2XD2A 4HTGA 5K2XA 3FIRA 2DQVA 4XKRA 5DYHA 4U21A 1B46A 2H98A 1YCJA 3HSTA 3K1PA 4N13A 4NWCA 3OEMA 3N6UA 1LBCA 4F3GA 3PUYE 1BTJA 1FQAA 1I6BA 1GGGA 3DP8A 1A8FA 3BFTA 4OYVA 1YPNA 2R9JA 4BDNA 1B58A 3K4UA 5AA1A 4ELOA 2ZYNA 2QL3A 4G8NA 1XHYA 4X1DA 4BDQA 2QS4A 1EZPA 4NF8A 5BUUA 3MPLA 3GBAA 2I0CA 5AA2B 2CMOA 3FV2A 3C34A 4X48A 5F7VA 4NF6A 5TPAA 2HCAA 3M3FA 1MDQA 2OLBA 2DWAA 3MZBA 1SW4A 3OD7A 1A8EA 2O6AA 2D3IA 4ZE9A 3HO7A 4ELQA 3UIFA 1ZJLA 3MP6A 3RQTA 5K2YA 4F1UA 2UVHA 3MW0A 3TKDA 1B5IA 2RC8A 4JWXA 1O64A 3FUZA 2ZNTA 3HV1A 3T9XB 4UACA
chains in the Genus database with same CATH superfamily
1H44A 1B7ZA 1GVCA 1MY4A 2PBWA 1B4ZA 1MPBA 5J1DA 3CG1A 3S2VA 2VD3A 5JTYA 3GBBA 1Z7NE 3FVKA 1IUDA 4EXKA 4H65A 4N91A 3CI8A 3IB1A 1MXYA 5I2NB 2W7YA 4NN3A 4OESA 5B70A 3L6GA 4PFIA 3QUFA 3I6VA 1P1NA 2XXWA 3WAFA 4K3FA 1MG1A 2WYPA 4XXUA 3RUMA 1A40A 1YTVA 1MQGA 1JVXA 3NOHA 3T96B 4O3AA 2H4IA 2D21A 4F22A 3D1RA 4GFRA 2VOZA 4GLIA 1MXVA 4OTEA 3I3VA 3N26A 3TQLA 5I58B 2DE4A 3E3KA 4RXLA 1WODA 4G2ZA 1ZU0A 4IY6A 3CFZA 4XEQA 3EHTA 5DVIA 3KJ7A 5H8FB 1Y20A 3V89B 3FJGA 2VPOA 4PBHA 4RK9A 3W9WA 4JVIA 5EQ8A 2OWZA 3H7MA 4U1ZA 2Y5LA 2WEFA 1NNPA 4GWOA 3THIA 3SETA 4NE4A 4NF4B 4OXVA 1L5TA 1UIUA 3VLUA 3A3CA 4R6HA 4KHZE 1GTKA 1B9JA 1NUXA 4KI0E 2DE3A 1M5BA 3H6UA 3MJNA 3W15C 5A5XB 3KZGA 1NNFA 1VFDA 3OSQA 5CMKA 3FBPA 4GXAA 3FVOA 4PFBA 4IR8A 4O3BA 2NXOA 5JK4A 2RC9A 4ELRA 3O97A 5L8DA 4QFKA 4QF9A 1N0TA 2D5WA 3LSFB 1UQWA 1B2HA 1OLAA 3H06B 3KJTA 3T9UA 1QKAA 1ZMGA 1FPFA 1TWYA 5HPQA 4KFQA 4YB6A 2GFEA 3PUZE 2Q2AA 1FBPA 3IO4A 4HW8A 3G3KA 4Q5TA 4IY5A 4XKPA 4DE8A 5CM6A 1G0IA 5LOMA 2V3TA 4HE1A 4I9DA 1LSTA 2R8TA 5IAIA 3EHSA 4I62A 1USYH 2P1SA 4TLLB 3VE1B 2QMXA 4PETA 2AIXA 1HSJA 3IB2A 3TTLA 4R73A 2DSFA 2OJTA 1XC1A 4LONB 4EQ9A 1AMFA 1DOTA 1JVYA 4GF8A 3MZ9A 4HXVA 5TU0A 4FORA 3KN7A 3ZKKA 3EN3A 2FHYA 3K01A 4ESXA 4OVTA 4QSDA 2YLNA 1IXGA 4RA1A 3N5LA 1ATGA 3LC8A 4XTCQ 1M5FA 2GH9A 4ZECA 2AL5A 5I59B 4OA4A 3H4ZA 1Q1KA 2RCBA 5DTBA 1MS7A 5DVFA 1N3WA 1EYJA 3DM0A 2DVCA 1AOVA 3PMVA 4GBVA 4P8BA 3EQ1A 3O6IA 4LZ8A 2B4MA 1XVXA 3S9LC 5IM2A 3RPLA 1US4A 2O51A 3S9EA 1ZLQA 1FPJA 4ZS9A 1K9YA 3BFUA 4MNIA 4F1VA 1YYZA 4Z7EA 1I6QA 2H25A 1Y3NA 3H3GA 3FGSA 1SYHA 3MPKA 5EYHA 3O2AA 3IB0A 4P0GA 5CC2A 3UORA 1WVJA 4YU0A 3LV0A 2Y7KA 4HCYA 2ONSA 4WXJA 1B1HA 1S50A 1MH3A 1NV1A 1FJ6A 1II5A 2B3BA 4O94A 4TOZA 2Q89A 1MM7A 4QHQA 4F31B 4F39A 5T3JA 4XIGQ 2F7BA 3IOWA 2Q88A 2RF1A 1NV4A 3G7WA 4NAPA 2XWIA 3DELB 1TT1A 4OVRA 1QVSA 2Q74A 4PE3A 5BWJA 5CMMA 4ELPA 4KYSA 1G0HA 4X04A 5IZZA 3U8QA 4PFUA 4ZEBA 4NF6B 2WX9A 1MY0A 1LGBC 5J16A 4U2RA 2WYKA 3AXFA 5AA2D 1H43A 5IZ3A 3FXRA 3QXMA 1M5CA 1MXUA 5JEIA 3IK6B 4FAJA 3K6XA 4OFJA 5I2KB 5ITOA 3CSGA 1EZ9A 1HSEA 3TAJA 1VFEA 3CFXA 4H5GA 3QAXA 4YKPA 2OBGA 2XX7A 2GHBA 3RPWA 3PGFA 1QW0A 4DXUA 2ABHA 1LFGA 3KC1A 2F97A 3VXCA 1MQDA 1Y3PA 3OSRA 1JETA 2I6EA 2VP1A 4GX3A 5DT6A 5I3SA 1RKMA 5A5LA 2DWIA 1B32A 3GLBA 4GL8A 3A29A 4GWSA 3TFLA 3LR1A 4RPNA 3TCGA 2Z8FA 4BDOA 4F2OA 1FQCA 4I3EA 5H8SA 4EXLA 4F29A 3I5OA 1MQJA 1FPIA 3PUWE 2OWSA 3O6HA 4XF5A 1P1UA 3CIJA 1FW0A 4AS4A 2QS2A 3MUQA 2WBBA 2PFYA 3PMWA 2QFLA 1R9QA 3RLFE 4H45A 4N81A 3SEXA 5B7DA 4NHBA 1B6HA 4IGRA 4QXDA 4Q0CA 2PYYA 2ALUA 4DXCA 2GHAA 3OO9A 5CMCA 4PGPA 4P0IA 1LAHE 1FBGA 1QULA 2E0SA 4OVQA 3GXAA 2P2AA 5I56A 3E78A 4QSCA 4N6PA 2O1LA 5LDZA 2ZZXA 4H46A 4OVJA 2A5TB 1J1NA 3C31A 4R6YA 2V4CA 1RDYA 1SD3A 1MH4A 5CBRA 5H8NA 2HZKA 1FBDA 4OVPA 1Y4TA 4GWXA 4LZ5A 3UN6A 1FTOA 4H8IA 1US5A 2ZXTA 1AH5A 2NUVA 1LCTA 1MPDA 3F11A 3O28A 1P99A 4R72A 5EYGA 3PPOA 1QKBA 2XA5A 3Q25A 1M5EA 3TTRA 3HFUA 4KR5A 1VR5A 4DI3D 3TCFA 3K02A 3FD3A 4H8JA 3RTFB 4R9GA 3IJXB 1IQ7A 4YKIA 1Q35A 5L9SA 4NWDA 3D4CA 4GWYA 3MC2A 2CEXA 1ZTYA 3PUVE 3MVZA 4PF6A 2IA4A 1KA1A 2VD2A 3MSTA 4NG7A 3TPAA 2DXYA 4F3SA 4PDHA 2UVJA 1EU8A 1MXXA 3LSXA 5I5PA 3FVGA 1MY3A 1JQFA 1S9TA 1B0HA 4HE0A 5EYFA 3HPIA 1FBEA 2RCAA 4ESWA 2ZZWA 1NV6A 1B3FA 4R6KA 3O6GA 1A99A 4FATA 4P1EA 1JEUA 2VPNA 3SESA 1NV0A 3MP8A 3ZS6A 3RY3A 5AA4B 3HHFA 5ET8A 1FTAA 3R6UA 1LB9A 2Y5KA 1QJMA 2KQZA 2YPNA 4P9KA 4L17A 4MJOA 1EYIA 4Q30B 4C1TA 4OWDA 5HM4B 4RNSA 3E9XA 4P3LA 3RN8A 3N94A 1TXFA 3EPEA 4DIGA 2F3DA 3OOAA 1LAFE 4PGNA 2LAOA 3TDJA 4Q8RA 2FBPA 2DDKA 5ITPA 1B52A 3K6VA 4H0WA 4U4XA 2GQ1A 3WAEA 3G3IA 4XKNA 2Q8MA 3DP4A 3TTNA 5DEXA 5KDTB 3PPPA 4NF5B 2O84X 2Y84A 4MX6A 2XXQA 5FTIA 5FHNA 2NVUB 2XD3A 1KWHA 3V8XB 2QPQA 3RPLB 4H1XA 4Z0IA 3TELA 3P7IA 1SBPA 1AWBA 3RGYA 4FEBA 1DTZA 4PE5B 2DWHA 2P0SA 3FJ7A 4MMPA 5KCJA 4R2FA 5F1QA 2G29A 2V84A 4HE2A 1B5JA 5I7IA 2X7PA 2FYIA 2H99A 3EHUA 3TQWA 3TEPA 5IZ1A 4ISUA 2R6GE 4F18A 4PAFA 4JVCA 3BIHA 1FCKA 4G68C 3A09A 2Z23A 4RPOA 3GZGA 4YZZA 2BJIA 3IOUA 4LUBA 2DWJA 3K1MA 1IXHA 4MFIA 2V3UA 3RT6B 2XXVA 4GRKA 2ZYMA 4G8MA 3OO7A 1OLCA 4LQ5A 2UXAA 1SI0A 4ZZAA 1D3KA 4PDDA 3O29A 1YAEA 4FE8A 3ILUB 4BDMA 4O7IA 3QUJA 4ZEDA 2QS1A 2XX8A 4MF3A 1MXZA 1IITA 5TP9B 1RYXA 3C32A 3ZSFA 4R75A 3H6WA 1PBQA 2UVGA 1D9VA 4OENA 1FBHA 3S9NC 4LN5A 4EDPA 4GL0A 1MPCA 1CB6A 4QSEA 1LLSA 3W9VA 1PC3A 2ZNUA 4IO5A 5EHSA 5ET7A 5ICTA 2YJPA 3ISPA 2Z8EA 1FBFA 3D4GA 4YKKA 5CMBA 4AS5A 2UYFA 1NUWA 3O66A 3TMGA 1XVYA 1OIBA 5EHMA 4I8CA 3UP9A 2NWJA 2FNCA 3T9VA 3KC0A 2REJA 1Y1MA 2FVZA 2AL4A 3RYDA 3R7XA 1BP5A 4GBWA 4XKQA 3CG3A 2VGQA 3MP1A 2F35A 4OZ9A 1O63A 2QVVA 4R74A 2Y7RA 5EQAA 2V25A 4F2QA 1JW5A 2F3BA 4GOTA 1BK4A 1RDXA 2V3QA 5H8HB 1XOCA 2F6PA 4YAHX 5H8QA 3IAZA 4I1DA 4U4SA 4YKJA 1UTHA 5I57B 3K2DA 1LBZA 4MAGA 4NF0A 4GX4A 4MLVA 4TQUQ 4YB5A 3Q28A 2CEYA 3SEYA 5HBCA 1NKXA 2Z8DA 3FATA 1AIVA 1FPKA 3QYTA 4I3YA 3S4UA 4JBZA 3G3HA 3VLWA 2F6GA 3M3KA 1PEBA 4G8HA 1UTBA 4G61A 3K0VA 1IMCA 2OX3A 4BLAA 2PCRA 1BIYA 2I58A 5I56B 2FIXA 4DI4B 1K9ZA 1QUIA 1MY2A 3PD8A 1PB8A 4OVSA 4MNPA 4P11A 1DSNA 1B0LA 4YICA 3B6TA 2QRYA 2GRVA 1NNKA 2Q8JA 2I3WA 4PAKA 2IEEA 3IX1A 3H6TA 3M8UA 1XS5A 3LSWA 5I58A 3T66A 2HAVA 1PB7A 1Y3QA 4MCOA 4ONYA 3IO6A 3PPRA 3IJOB 3IFCA 3U93A 3KOTA 5H8FA 4FBPA 4JVDA 4IB2A 3Q29A 1D9QA 1LBVA 3VDFA 2REGA 1JP4A 3TTKA 4NF8B 3RNNA 1T0KA 4OQOA 3T1BA 3SEWA 3VVFA 1B3EA 1GV8A 1FPEA 2L5VA 3PPQA 1N04A 3TCHA 4ZEKA 2F8DA 4X1BA 4RYAA 4FEDA 2OCUA 3T93B 1SPIA 2PT1A 3HN0A 1FQFA 3CRBA 5TPAB 2XXIA 3IR1A 3PD9A 4JWYA 1Y4CA 2ZMBA 3PV0E 1M5DA 5A5XA 1HSLA 1IXIA 3JV9A 4R9FA 5CI5A 2F78A 1QUJA 2CZHA 4QFLA 3CSBA 1FQDA 1B51A 1O7TA 1NV5A 1ANFA 2V93A 3T22A 1LB8A 1P1QA 3K00A 3K6WA 3MVWA 3OELA 4OEUA 2PMSA 4FJPA 5JTYB 4JDFA 4KQPA 2PX1A 2PT2A 1DBZA 3QK6A 3G3GA 3KOSA 4U22A 1XT8A 2Q2CA 3UGWA 3M3LA 1SW2A 2ZYOA 4AB5A 5FBPA 5KZTA 1LFIA 4NEDA 4OERA 1B3GA 4F1YA 5DVJA 4UA8A 2HPGA 1URGA 3UK4A 4F3PA 4KCDA 1CE2A 2HXWA 2H9BA 3VFJA 4G68A 4JSDA 3SZPA 2QSXA 4KYEA 4GWZA 4X9TA 3V83A 2Y7WA 4MH5A 3LSLA 4H5FA 4DLDA 3C4MA 3SEVA 1A7LA 1NI9A 4OETA 2HAUA 3T0JA 3IOVA 1LCFA 4ZZEA 4NTLA 2I4BA 1YZ0A 1OQHA 3KBZA 2XWKA 1A54A 5I59A 4LA9A 2XWVA 4PFYA 4RY1A 2DVZA 1IMFA 1R9LA 4QBAA 3JZJA 1H45A 1OMPA 2HEUA 3QSLA 4LVQA 4PP0A 2DE2A 3TYHA 3B50A 1AL3A 4H6DA 4HS7A 3KGCA 4PF8A 3C36A 1DPPA 4OFOA 3MYUA 2ONRA 4DXBA 1B7UA 1SYIA 2B65A 4PQJA 4N15A 2OK2A 2I48A 4PTKA 2O68A 3LUYA 4MBPA 1VSOA 4PFWA 1I6AA 4MIJA 5AE4A 2P3VA 3VV5A 1PB9A 2I4CA 1MY1A 3T9HB 1LFHA 4LP2B 3HCQA 1NL5A 4QFPA 3PTYA 3KSJA 1INPA 4GVOA 5FTHA 4ZDMA 2M8CA 4U23A 2I49A 1MM6A 1FJ9A 2A5SA 4GWWA 4OMBA 2HQ0A 3CR9A 3B6QA 4LATA 3VVDA 1IZ1A 1FSAA 4N6DA 1TFDA 3CFLA 2XXHA 1B3LA 3Q27A 4HCWA 3U65A 3ZKLA 4F19A 5ET6A 1URDA 3R26A 3B6WA 1DMBA 5I2KA 3TUSA 2ONKE 3OENA 3DP6A 1YXIA 3B7DA 3G3FA 4KD5A 1DCUA 3ODBA 2F34A 4POXA 5H8QB 2F5XA 4M1VA 2KLFA 1H3DA 1UTHB 1UIVA 2QJEA 4ECFA 1NV3A 4OFLA 5L9MA 1POTA 4C1UA 3U94A 4PCDA 1PDAA 4E0XA 4N8YA 4U1OA 1DK4A 1FTJA 4F3BA 2WKYA 1D9YA 2HHMA 4PFTA 1IMAA 1UTBB 5CRYA 1OVTA 1B3HA 4WKMA 4KPTA 1USYE 4MLQA 1SQYA 1NNTA 3E4RA 4N4UA 1QGXA 3KBRA 4GWUA 2DYXA 1JEVA 3FASA 4BDLA 4UABA 2CZIA 1CNQA 1MDP1 2X7QA 5ICQA 5FHOA 3CHGA 3H03A 1FRPA 2VHAA 1A55A 1LBYA 2ZYKA 3FVNA 2XXXA 1NUZA 1MRPA 1IEJA 2XXRA 3OEKA 4I40A 3SEUA 3MVYA 4C0RA 4YMBA 2WBDA 4GD5A 4G4PA 4YB7A 1BLFA 3BKIB 1NMUA 1JNFA 2Y7PA 3VVEA 4PC9A 4H67A 3SERA 4PAIA 1Z7ME 5IGAA 5ET5A 3JYRA 2A5TA 3K6UA 2H5YA 3KEIA 4QFOA 1H76A 3PUXE 4BDRA 3A3UA 2RKMA 2NOOA 2F36A 1NH8A 1Y1ZA 3IL1B 2Q9TA 4DDDA 3S9MC 3EKIA 4N8GA 1KZ8A 3SKPA 1R1NA 4R2BA 3E79A 1LBBA 4GQOA 5IZ3B 1B7HA 1IMEA 2RINA 3OXNA 4EF2A 2BJJX 1VE4A 3U1OA 4JSOA 4IO3A 4O3CA 4JWOA 1MQHA 5I84A 1MQIA 1EH3A 5FHMA 2F7AA 2F7CA 3HHGA 2CZLA 1NFTA 1SVXB 3OO6A 5L9OA 5AA2A 1FTKA 4NQ8A 2FIEA 2XHDA 4OHNA 4IO7A 3LUZA 1LAXA 1N3XA 1N7XA 4QFNA 4KCCA 3SDFA 3U72A 1R6ZA 1N7WA 2XXTA 2E1SA 1SW5A 3BIGA 2I0BA 3O9PA 1Q9DA 3IORA 4AQ4A 2DP8A 2DS9A 4DCXA 4N17A 1S7YA 2ESNA 1EYKA 5M2VA 3KFMA 4QRZA 3C9HA 4IO4A 1IXCA 1RYOA 2QMWA 1FBCA 4IO2A 2HZLA 2DXRA 3KN8A 5AA4A 4EQBA 1B05A 4G68B 1RDZA 1N84A 3PMXA 1FQEA 4FIMA 1NV7A 3K1NA 2ZNSA 3V5AA 1Y9UA 2PVUA 1D4NA 3VXBA 2QS3A 1I69A 2XXUA 2HFBA 4LQ2A 4M4GA 2DOJA 4ZEFA 2XWOA 4ZEIA 5I2NA 4YMAA 4DZ1A 4MNCA 1B40A 3DLNA 3ROJA 2CZKA 4THIA 4GX6A 2THIA 3EF7A 2ZZVA 1ZKBA 2HXRA 4X8RA 2B3FA 4JB7A 3BBRA 1P1OA 4GXSB 5F24A 3OO8A 4POWA 1QUKA 2XXYA 2ANJA 5KDTA 2B4LA 1DPEA 4WEDA 4E0WA 4NF5A 5H8NB 4IO6A 3TODA 1B4HA 1ZBMA 1FPDA 1NH7A 2O7UA 1DTGA 1TFAA 3IOTA 1NV2A 4ND9A 3KN3A 3UA8A 1ZIUA 1ELJA 1B5HA 3PPNA 3QIMA 4NF4A 5EQ7A 3FZVA 3FV1A 3B8BA 1PBPA 3ONMA 4EUOA 3FXBA 4MHFA 1LBXA 2KR0A 4LZ7A 1N76A 3RTWB 3U92A 4WEPA 2Z22A 2O1MA 2O69A 2QVUA 5DW8A 4ZE8A 2UYEA 2UVIA 3FJMA 3MAMA 1OQGA 3OMBA 4XFEA 2Y7IA 3MZ1A 3E13X 3ILTB 1FTLA 1IIWA 2AYSA 3MBPA 3MQ9A 2XXPA 2JJKA 3L6HA 1SI1A 1MXWA 4NMYA 4NGUA 4TLMB 1F9BA 5ELVA 3FXQA 5TP9A 2P3NA 1LAGE 4G77A 3C33A 3MWBA 3CVGA 1WDNA 4NX1A 4DCYA 1SDXA 2X26A 1URSA 4IGTA 1GR2A 5AA3A 4OANA 1XI6A 1BKAA 3LBSA 4GIZA 1P1WA 3MVXA 2OZZA 5IKBA 3ECRA 1JW4A 4EQ7A 4OEVA 4EF1A 4RJZA 3N6TA 5ISUA 3PU5A 2XX9A 3G3JA 1LBWA 2G93A 1B1XA 4KYDA 4RK2A 1NUYA 2R71A 3H6VA 3RT8A 5DEXB 1OVBA 4P56A 1FTMA 3KSXA 2RC7A 2OWTA 2I3VA 4N07A 3KG2A 3Q26A 1LEVA 4JXIA 5H8HA 3VLVA 3C35A 3FXUA 3TTMA 1POY1 5I57A 2FA7A 1KA0A 4N6KA 4O7MA 2VT5A 4FECA 5CBSA 5LTCA 5KCJB 1FQBA 1EZOA 2O7IA 2PFZA 1IMDA 1SW1A 5ESYA 3USDA 3TZAA 1JW1A 1IMBA 4AB6A 2XD2A 4O8MA 4MEVA 4HTGA 5K2XA 3FIRA 2DQVA 4XKRA 5DYHA 4U21A 1B46A 2H98A 1YCJA 3HSTA 3K1PA 4N13A 4NWCA 3OEMA 3N6UA 1LBCA 4F3GA 3PUYE 1BTJA 1FQAA 1I6BA 1GGGA 1VDWA 3DP8A 1A8FA 3BFTA 4OYVA 1YPNA 2R9JA 4BDNA 4P1LA 1B58A 4PBQA 3K4UA 5AA1A 4PFRA 2XXKA 5EQ9A 4ELOA 2ZYNA 2QL3A 4G8NA 1XHYA 4X1DA 4BDQA 2QS4A 1EZPA 3IFAA 4NF8A 5BUUA 3MPLA 2QVRA 3GBAA 2I0CA 1FPLA 5AA2B 2CMOA 1FPGA 3FV2A 3C34A 4X48A 3QMFA 5F7VA 1FPBA 4NF6A 5TPAA 2HCAA 3M3FA 1MDQA 4KXPA 2OLBA 2DWAA 3MZBA 1SW4A 3OD7A 1A8EA 2O6AA 3GYYA 2D3IA 4ZE9A 3HO7A 4ELQA 3UIFA 1ZJLA 3MP6A 4P47A 3RQTA 5K2YA 4F1UA 2UVHA 3MW0A 3TKDA 1B5IA 2MKZA 2RC8A 4JWXA 1O64A 3FUZA 2ZNTA 3HV1A 3T9XB 4UACA
chains in the Genus database with same CATH topology
1H44A 1B7ZA 1GVCA 1MY4A 2PBWA 1B4ZA 1MPBA 5J1DA 3CG1A 3S2VA 2VD3A 5JTYA 3GBBA 1Z7NE 3FVKA 1IUDA 4EXKA 4H65A 3CI8A 3IB1A 1MXYA 5I2NB 2W7YA 4OESA 5B70A 3L6GA 3QUFA 3I6VA 1P1NA 2XXWA 3WAFA 4K3FA 1MG1A 4XXUA 3RUMA 1A40A 1YTVA 1MQGA 1JVXA 3T96B 4O3AA 2H4IA 2D21A 4F22A 4GFRA 2VOZA 4GLIA 1MXVA 4OTEA 3I3VA 3N26A 3TQLA 5I58B 2DE4A 3E3KA 4RXLA 1WODA 4G2ZA 1ZU0A 4IY6A 3CFZA 3EHTA 5DVIA 3KJ7A 5H8FB 1Y20A 3V89B 3FJGA 4RK9A 3W9WA 3H7MA 4U1ZA 1NNPA 4GWOA 3THIA 3SETA 4NE4A 4NF4B 4OXVA 1L5TA 1UIUA 3VLUA 3A3CA 4R6HA 4KHZE 1GTKA 1B9JA 4KI0E 2DE3A 1M5BA 3H6UA 3W15C 5A5XB 3MJNA 3KZGA 1NNFA 1VFDA 3OSQA 5CMKA 4GXAA 3FVOA 4O3BA 2NXOA 5JK4A 2RC9A 4ELRA 3O97A 5L8DA 4QFKA 4QF9A 1N0TA 2D5WA 3LSFB 1UQWA 1B2HA 1OLAA 3H06B 3KJTA 3T9UA 1QKAA 1ZMGA 1TWYA 5HPQA 4KFQA 4YB6A 2GFEA 3PUZE 2Q2AA 3IO4A 4HW8A 3G3KA 4Q5TA 4IY5A 4XKPA 4DE8A 5CM6A 5LOMA 2V3TA 4I9DA 1LSTA 5IAIA 3EHSA 4I62A 1USYH 2P1SA 4TLLB 3VE1B 2QMXA 4PETA 2AIXA 1HSJA 3IB2A 3TTLA 4R73A 2DSFA 2OJTA 1XC1A 4LONB 4EQ9A 1AMFA 1DOTA 1JVYA 4GF8A 3MZ9A 5TU0A 4FORA 3KN7A 3ZKKA 3EN3A 3K01A 4ESXA 4QSDA 2YLNA 1IXGA 4RA1A 3N5LA 1ATGA 3LC8A 4XTCQ 1M5FA 2GH9A 4ZECA 2AL5A 5I59B 3H4ZA 1Q1KA 5DTBA 2RCBA 1MS7A 5DVFA 1N3WA 3DM0A 2DVCA 1AOVA 3PMVA 3EQ1A 3O6IA 4LZ8A 1XVXA 3S9LC 1US4A 2O51A 3S9EA 1ZLQA 4ZS9A 3BFUA 4F1VA 4Z7EA 1I6QA 2H25A 1Y3NA 3H3GA 3FGSA 1SYHA 3MPKA 3O2AA 3IB0A 4P0GA 5CC2A 3UORA 1WVJA 4YU0A 2Y7KA 4HCYA 2ONSA 4WXJA 1B1HA 1S50A 1MH3A 1II5A 2B3BA 4TOZA 2Q89A 1MM7A 4QHQA 4F31B 4F39A 4XIGQ 2F7BA 3IOWA 2Q88A 2RF1A 3G7WA 3DELB 1TT1A 1QVSA 5BWJA 5CMMA 4ELPA 4KYSA 3U8QA 4PFUA 4ZEBA 4NF6B 1MY0A 1LGBC 4U2RA 3AXFA 5AA2D 1H43A 3FXRA 3QXMA 1M5CA 1MXUA 5JEIA 3IK6B 4FAJA 3K6XA 4OFJA 5I2KB 5ITOA 3CSGA 1EZ9A 1HSEA 3TAJA 1VFEA 3CFXA 4H5GA 3QAXA 4YKPA 2OBGA 2XX7A 2GHBA 3RPWA 3PGFA 1QW0A 4DXUA 2ABHA 1LFGA 2F97A 3VXCA 1MQDA 1Y3PA 3OSRA 1JETA 2I6EA 2VP1A 5DT6A 1RKMA 2DWIA 1B32A 3GLBA 4GL8A 3TFLA 3LR1A 4RPNA 3TCGA 2Z8FA 4BDOA 4F2OA 1FQCA 5H8SA 4EXLA 4F29A 3I5OA 1MQJA 3PUWE 2OWSA 3O6HA 1P1UA 3CIJA 1FW0A 2QS2A 3MUQA 3PMWA 1R9QA 3RLFE 3SEXA 5B7DA 1B6HA 4IGRA 4Q0CA 2PYYA 2ALUA 4DXCA 2GHAA 3OO9A 5CMCA 4P0IA 1LAHE 1QULA 2E0SA 3GXAA 2P2AA 5I56A 4QSCA 4N6PA 2O1LA 4OVJA 2A5TB 1J1NA 3C31A 4R6YA 1SD3A 1MH4A 5CBRA 5H8NA 2HZKA 1Y4TA 4LZ5A 3UN6A 1FTOA 4H8IA 1US5A 2ZXTA 1AH5A 2NUVA 1LCTA 1MPDA 3F11A 3O28A 1P99A 4R72A 3PPOA 1QKBA 3Q25A 1M5EA 3TTRA 4KR5A 1VR5A 3TCFA 3K02A 3FD3A 4H8JA 3RTFB 4R9GA 3IJXB 1IQ7A 4YKIA 1Q35A 5L9SA 4NWDA 3D4CA 3MC2A 1ZTYA 3PUVE 3MVZA 2IA4A 2VD2A 3TPAA 2DXYA 4F3SA 2UVJA 1EU8A 1MXXA 3LSXA 3FVGA 1MY3A 1JQFA 1S9TA 1B0HA 5EYFA 3HPIA 2RCAA 4ESWA 1B3FA 4R6KA 3O6GA 1A99A 4FATA 1JEUA 3SESA 3MP8A 3ZS6A 3RY3A 5AA4B 3HHFA 3R6UA 1LB9A 1QJMA 2YPNA 4L17A 4Q30B 4C1TA 4OWDA 5HM4B 4RNSA 3E9XA 3RN8A 3N94A 1TXFA 3EPEA 4DIGA 3OOAA 1LAFE 2LAOA 3TDJA 4Q8RA 5ITPA 1B52A 3K6VA 4H0WA 4U4XA 3WAEA 3G3IA 4XKNA 3DP4A 3TTNA 5DEXA 5KDTB 3PPPA 4NF5B 2O84X 2Y84A 2XXQA 5FTIA 5FHNA 2NVUB 2XD3A 1KWHA 3V8XB 2QPQA 4H1XA 4Z0IA 3TELA 3P7IA 1SBPA 3RGYA 4FEBA 1DTZA 4PE5B 2DWHA 2P0SA 3FJ7A 5KCJA 4R2FA 5F1QA 2G29A 2V84A 1B5JA 2X7PA 2FYIA 2H99A 3EHUA 3TQWA 3TEPA 4ISUA 2R6GE 4F18A 1FCKA 4G68C 3A09A 2Z23A 4RPOA 3GZGA 4YZZA 3IOUA 4LUBA 2DWJA 3K1MA 1IXHA 4MFIA 2V3UA 3RT6B 2XXVA 4GRKA 2ZYMA 4G8MA 3OO7A 1OLCA 4LQ5A 2UXAA 1SI0A 4ZZAA 1D3KA 3O29A 1YAEA 4FE8A 3ILUB 4BDMA 3QUJA 4ZEDA 2QS1A 2XX8A 4MF3A 1MXZA 1IITA 5TP9B 1RYXA 3C32A 3ZSFA 4R75A 3H6WA 1PBQA 2UVGA 1D9VA 4OENA 3S9NC 4EDPA 4GL0A 1MPCA 1CB6A 4QSEA 1LLSA 3W9VA 1PC3A 2ZNUA 4IO5A 5EHSA 5ICTA 2YJPA 2Z8EA 3D4GA 4YKKA 5CMBA 2UYFA 3O66A 3TMGA 1XVYA 1OIBA 5EHMA 4I8CA 3UP9A 2NWJA 2FNCA 3T9VA 2REJA 1Y1MA 2AL4A 3R7XA 1BP5A 4XKQA 3CG3A 2VGQA 3MP1A 2F35A 4OZ9A 1O63A 4R74A 2Y7RA 2V25A 4F2QA 1JW5A 4GOTA 2V3QA 5H8HB 1XOCA 2F6PA 4YAHX 5H8QA 3IAZA 4I1DA 4U4SA 4YKJA 1UTHA 5I57B 3K2DA 4MLVA 4TQUQ 4YB5A 3Q28A 3SEYA 5HBCA 1NKXA 2Z8DA 3FATA 1AIVA 3QYTA 3S4UA 4JBZA 3G3HA 3VLWA 2F6GA 3M3KA 1PEBA 4G8HA 1UTBA 3K0VA 4BLAA 1BIYA 2I58A 5I56B 1QUIA 1MY2A 3PD8A 1PB8A 4P11A 1DSNA 1B0LA 4YICA 3B6TA 2QRYA 2GRVA 1NNKA 2Q8JA 2I3WA 2IEEA 3IX1A 3H6TA 3M8UA 1XS5A 3LSWA 5I58A 3T66A 2HAVA 1PB7A 1Y3QA 4ONYA 3IO6A 3PPRA 3IJOB 3U93A 3KOTA 5H8FA 4IB2A 3Q29A 3VDFA 2REGA 3TTKA 4NF8B 3RNNA 1T0KA 4OQOA 3SEWA 3VVFA 1B3EA 1GV8A 3PPQA 1N04A 3TCHA 4ZEKA 2F8DA 4X1BA 4RYAA 4FEDA 2OCUA 3T93B 2PT1A 3HN0A 1FQFA 3CRBA 5TPAB 2XXIA 3IR1A 3PD9A 4JWYA 1Y4CA 2ZMBA 3PV0E 1M5DA 5A5XA 1HSLA 1IXIA 3JV9A 4R9FA 5CI5A 2F78A 1QUJA 4QFLA 3CSBA 1FQDA 1B51A 1O7TA 1ANFA 2V93A 3T22A 1LB8A 1P1QA 3K00A 3K6WA 3MVWA 3OELA 4OEUA 2PMSA 4FJPA 5JTYB 4JDFA 4KQPA 2PX1A 2PT2A 3QK6A 3G3GA 3KOSA 4U22A 1XT8A 2Q2CA 3UGWA 3M3LA 1SW2A 2ZYOA 4AB5A 5KZTA 1LFIA 4NEDA 4OERA 1B3GA 4F1YA 5DVJA 4UA8A 1URGA 3UK4A 4F3PA 4KCDA 1CE2A 2HXWA 2H9BA 3VFJA 4G68A 4JSDA 2QSXA 4KYEA 4X9TA 3V83A 2Y7WA 4MH5A 3LSLA 4H5FA 4DLDA 3C4MA 3SEVA 1A7LA 4OETA 2HAUA 3IOVA 1LCFA 4ZZEA 4NTLA 2I4BA 1OQHA 1A54A 5I59A 4LA9A 4PFYA 4RY1A 2DVZA 1R9LA 3JZJA 1H45A 1OMPA 2HEUA 3QSLA 4LVQA 4PP0A 2DE2A 3TYHA 4H6DA 1AL3A 4HS7A 3KGCA 3C36A 1DPPA 4OFOA 2ONRA 4DXBA 1B7UA 1SYIA 2B65A 4PQJA 2OK2A 2I48A 2O68A 3LUYA 4MBPA 1VSOA 4PFWA 1I6AA 5AE4A 3VV5A 1PB9A 2I4CA 1MY1A 3T9HB 1LFHA 4LP2B 3HCQA 1NL5A 4QFPA 3KSJA 5FTHA 4GVOA 4ZDMA 2M8CA 4U23A 2I49A 1MM6A 2A5SA 4OMBA 2HQ0A 3CR9A 3B6QA 4LATA 3VVDA 1IZ1A 1TFDA 3CFLA 2XXHA 1B3LA 3Q27A 4HCWA 3ZKLA 4F19A 1URDA 3R26A 3B6WA 1DMBA 5I2KA 3TUSA 2ONKE 3OENA 3DP6A 3B7DA 3G3FA 4KD5A 3ODBA 2F34A 4POXA 5H8QB 2F5XA 4M1VA 2KLFA 1H3DA 1UTHB 1UIVA 2QJEA 4ECFA 4OFLA 5L9MA 1POTA 4C1UA 3U94A 1PDAA 4E0XA 4U1OA 1FTJA 4F3BA 2WKYA 1D9YA 4PFTA 1UTBB 5CRYA 1OVTA 1B3HA 4WKMA 4KPTA 1USYE 4MLQA 1SQYA 1NNTA 3E4RA 3KBRA 2DYXA 1JEVA 3FASA 4BDLA 1MDP1 2X7QA 5ICQA 5FHOA 3H03A 2VHAA 1A55A 2ZYKA 3FVNA 2XXXA 1MRPA 1IEJA 2XXRA 3OEKA 3SEUA 3MVYA 4C0RA 4YMBA 4GD5A 4G4PA 4YB7A 1BLFA 3BKIB 1NMUA 1JNFA 2Y7PA 3VVEA 4H67A 3SERA 1Z7ME 3JYRA 2A5TA 3K6UA 2H5YA 3KEIA 4QFOA 1H76A 3PUXE 4BDRA 3A3UA 2RKMA 2NOOA 2F36A 1NH8A 1Y1ZA 3IL1B 2Q9TA 4DDDA 3S9MC 3SKPA 1R1NA 4R2BA 1LBBA 4GQOA 1B7HA 3OXNA 2RINA 4EF2A 2BJJX 1VE4A 3U1OA 4JSOA 4IO3A 4O3CA 4JWOA 1MQHA 5I84A 1MQIA 1EH3A 5FHMA 2F7AA 2F7CA 3HHGA 2CZLA 1NFTA 1SVXB 3OO6A 5L9OA 5AA2A 1FTKA 4OHNA 2XHDA 4IO7A 1LAXA 1N3XA 1N7XA 4QFNA 4KCCA 3SDFA 3U72A 1R6ZA 1N7WA 2XXTA 2E1SA 1SW5A 2I0BA 3O9PA 3IORA 4AQ4A 2DP8A 2DS9A 4DCXA 1S7YA 2ESNA 5M2VA 3KFMA 4QRZA 3C9HA 4IO4A 1IXCA 1RYOA 2QMWA 4IO2A 2HZLA 2DXRA 3KN8A 5AA4A 4EQBA 1B05A 4G68B 1N84A 3PMXA 1FQEA 4FIMA 3K1NA 2ZNSA 3V5AA 1Y9UA 2PVUA 1D4NA 3VXBA 2QS3A 1I69A 2XXUA 2HFBA 4LQ2A 4M4GA 2DOJA 4ZEFA 4ZEIA 5I2NA 4YMAA 4DZ1A 1B40A 3DLNA 4THIA 2THIA 3EF7A 1ZKBA 2B3FA 4JB7A 3BBRA 1P1OA 4GXSB 3OO8A 4POWA 1QUKA 2XXYA 2ANJA 5KDTA 1DPEA 4WEDA 4E0WA 4NF5A 5H8NB 4IO6A 3TODA 1B4HA 1ZBMA 1NH7A 2O7UA 1DTGA 1TFAA 3IOTA 4ND9A 3KN3A 3UA8A 1ZIUA 1ELJA 1B5HA 3PPNA 3QIMA 4NF4A 3FZVA 3FV1A 1PBPA 3ONMA 4EUOA 4LZ7A 1N76A 3RTWB 3U92A 4WEPA 2Z22A 2O1MA 2O69A 4ZE8A 2UYEA 2UVIA 3FJMA 3MAMA 1OQGA 3OMBA 2Y7IA 3MZ1A 3E13X 3ILTB 1FTLA 1IIWA 2AYSA 3MBPA 3MQ9A 2XXPA 3L6HA 1SI1A 1MXWA 4NMYA 4TLMB 1F9BA 5ELVA 3FXQA 5TP9A 1LAGE 4G77A 3C33A 3MWBA 3CVGA 1WDNA 4DCYA 1SDXA 2X26A 1URSA 4IGTA 1GR2A 5AA3A 1BKAA 3LBSA 4GIZA 1P1WA 3MVXA 2OZZA 5IKBA 3ECRA 1JW4A 4EQ7A 4OEVA 4EF1A 4RJZA 3N6TA 5ISUA 3PU5A 2XX9A 3G3JA 2G93A 1B1XA 4KYDA 4RK2A 2R71A 3H6VA 3RT8A 5DEXB 1OVBA 1FTMA 3KSXA 2RC7A 2OWTA 2I3VA 4N07A 3KG2A 3Q26A 4JXIA 5H8HA 3VLVA 3C35A 3FXUA 3TTMA 1POY1 5I57A 2FA7A 4FECA 5CBSA 5KCJB 1FQBA 1EZOA 2O7IA 1SW1A 3USDA 3TZAA 1JW1A 4AB6A 2XD2A 4HTGA 5K2XA 3FIRA 2DQVA 4XKRA 5DYHA 4U21A 1B46A 2H98A 1YCJA 3HSTA 3K1PA 4N13A 4NWCA 3OEMA 3N6UA 1LBCA 4F3GA 3PUYE 1BTJA 1FQAA 1I6BA 1GGGA 3DP8A 1A8FA 3BFTA 4OYVA 1YPNA 2R9JA 4BDNA 1B58A 3K4UA 5AA1A 4ELOA 2ZYNA 2QL3A 4G8NA 1XHYA 4X1DA 4BDQA 2QS4A 1EZPA 4NF8A 5BUUA 3MPLA 3GBAA 2I0CA 5AA2B 2CMOA 3FV2A 3C34A 4X48A 5F7VA 4NF6A 5TPAA 2HCAA 3M3FA 1MDQA 2OLBA 2DWAA 3MZBA 1SW4A 3OD7A 1A8EA 2O6AA 2D3IA 4ZE9A 3HO7A 4ELQA 3UIFA 1ZJLA 3MP6A 3RQTA 5K2YA 4F1UA 2UVHA 3MW0A 3TKDA 1B5IA 2RC8A 4JWXA 1O64A 3FUZA 2ZNTA 3HV1A 3T9XB 4UACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H44 A;  1B7Z A;  1GVC A;  1MY4 A;  2PBW A;  1B4Z A;  1MPB A;  5J1D A;  3CG1 A;  3S2V A;  2VD3 A;  5JTY A;  3GBB A;  1Z7N E;  3FVK A;  1IUD A;  4EXK A;  4H65 A;  3CI8 A;  3IB1 A;  1MXY A;  5I2N B;  2W7Y A;  4OES A;  5B70 A;  3L6G A;  3QUF A;  3I6V A;  1P1N A;  2XXW A;  3WAF A;  4K3F A;  1MG1 A;  4XXU A;  3RUM A;  1A40 A;  1YTV A;  1MQG A;  1JVX A;  3T96 B;  4O3A A;  2H4I A;  2D21 A;  4F22 A;  4GFR A;  2VOZ A;  4GLI A;  1MXV A;  4OTE A;  3I3V A;  3N26 A;  3TQL A;  5I58 B;  2DE4 A;  3E3K A;  4RXL A;  1WOD A;  4G2Z A;  1ZU0 A;  4IY6 A;  3CFZ A;  3EHT A;  5DVI A;  3KJ7 A;  5H8F B;  1Y20 A;  3V89 B;  3FJG A;  4RK9 A;  3W9W A;  3H7M A;  4U1Z A;  1NNP A;  4GWO A;  3THI A;  3SET A;  4NE4 A;  4NF4 B;  4OXV A;  1L5T A;  1UIU A;  3VLU A;  3A3C A;  4R6H A;  4KHZ E;  1GTK A;  1B9J A;  4KI0 E;  2DE3 A;  1M5B A;  3H6U A;  3W15 C;  5A5X B;  3MJN A;  3KZG A;  1NNF A;  1VFD A;  3OSQ A;  5CMK A;  4GXA A;  3FVO A;  4O3B A;  2NXO A;  5JK4 A;  2RC9 A;  4ELR A;  3O97 A;  5L8D A;  4QFK A;  4QF9 A;  1N0T A;  2D5W A;  3LSF B;  1UQW A;  1B2H A;  1OLA A;  3H06 B;  3KJT A;  3T9U A;  1QKA A;  1ZMG A;  1TWY A;  5HPQ A;  4KFQ A;  4YB6 A;  2GFE A;  3PUZ E;  2Q2A A;  3IO4 A;  4HW8 A;  3G3K A;  4Q5T A;  4IY5 A;  4XKP A;  4DE8 A;  5CM6 A;  5LOM A;  2V3T A;  4I9D A;  1LST A;  5IAI A;  3EHS A;  4I62 A;  1USY H;  2P1S A;  4TLL B;  3VE1 B;  2QMX A;  4PET A;  2AIX A;  1HSJ A;  3IB2 A;  3TTL A;  4R73 A;  2DSF A;  2OJT A;  1XC1 A;  4LON B;  4EQ9 A;  1AMF A;  1DOT A;  1JVY A;  4GF8 A;  3MZ9 A;  5TU0 A;  4FOR A;  3KN7 A;  3ZKK A;  3EN3 A;  3K01 A;  4ESX A;  4QSD A;  2YLN A;  1IXG A;  4RA1 A;  3N5L A;  1ATG A;  3LC8 A;  4XTC Q;  1M5F A;  2GH9 A;  4ZEC A;  2AL5 A;  5I59 B;  3H4Z A;  1Q1K A;  5DTB A;  2RCB A;  1MS7 A;  5DVF A;  1N3W A;  3DM0 A;  2DVC A;  1AOV A;  3PMV A;  3EQ1 A;  3O6I A;  4LZ8 A;  1XVX A;  3S9L C;  1US4 A;  2O51 A;  3S9E A;  1ZLQ A;  4ZS9 A;  3BFU A;  4F1V A;  4Z7E A;  1I6Q A;  2H25 A;  1Y3N A;  3H3G A;  3FGS A;  1SYH A;  3MPK A;  3O2A A;  3IB0 A;  4P0G A;  5CC2 A;  3UOR A;  1WVJ A;  4YU0 A;  2Y7K A;  4HCY A;  2ONS A;  4WXJ A;  1B1H A;  1S50 A;  1MH3 A;  1II5 A;  2B3B A;  4TOZ A;  2Q89 A;  1MM7 A;  4QHQ A;  4F31 B;  4F39 A;  4XIG Q;  2F7B A;  3IOW A;  2Q88 A;  2RF1 A;  3G7W A;  3DEL B;  1TT1 A;  1QVS A;  5BWJ A;  5CMM A;  4ELP A;  4KYS A;  3U8Q A;  4PFU A;  4ZEB A;  4NF6 B;  1MY0 A;  1LGB C;  4U2R A;  3AXF A;  5AA2 D;  1H43 A;  3FXR A;  3QXM A;  1M5C A;  1MXU A;  5JEI A;  3IK6 B;  4FAJ A;  3K6X A;  4OFJ A;  5I2K B;  5ITO A;  3CSG A;  1EZ9 A;  1HSE A;  3TAJ A;  1VFE A;  3CFX A;  4H5G A;  3QAX A;  4YKP A;  2OBG A;  2XX7 A;  2GHB A;  3RPW A;  3PGF A;  1QW0 A;  4DXU A;  2ABH A;  1LFG A;  2F97 A;  3VXC A;  1MQD A;  1Y3P A;  3OSR A;  1JET A;  2I6E A;  2VP1 A;  5DT6 A;  1RKM A;  2DWI A;  1B32 A;  3GLB A;  4GL8 A;  3TFL A;  3LR1 A;  4RPN A;  3TCG A;  2Z8F A;  4BDO A;  4F2O A;  1FQC A;  5H8S A;  4EXL A;  4F29 A;  3I5O A;  1MQJ A;  3PUW E;  2OWS A;  3O6H A;  1P1U A;  3CIJ A;  1FW0 A;  2QS2 A;  3MUQ A;  3PMW A;  1R9Q A;  3RLF E;  3SEX A;  5B7D A;  1B6H A;  4IGR A;  4Q0C A;  2PYY A;  2ALU A;  4DXC A;  2GHA A;  3OO9 A;  5CMC A;  4P0I A;  1LAH E;  1QUL A;  2E0S A;  3GXA A;  2P2A A;  5I56 A;  4QSC A;  4N6P A;  2O1L A;  4OVJ A;  2A5T B;  1J1N A;  3C31 A;  4R6Y A;  1SD3 A;  1MH4 A;  5CBR A;  5H8N A;  2HZK A;  1Y4T A;  4LZ5 A;  3UN6 A;  1FTO A;  4H8I A;  1US5 A;  2ZXT A;  1AH5 A;  2NUV A;  1LCT A;  1MPD A;  3F11 A;  3O28 A;  1P99 A;  4R72 A;  3PPO A;  1QKB A;  3Q25 A;  1M5E A;  3TTR A;  4KR5 A;  1VR5 A;  3TCF A;  3K02 A;  3FD3 A;  4H8J A;  3RTF B;  4R9G A;  3IJX B;  1IQ7 A;  4YKI A;  1Q35 A;  5L9S A;  4NWD A;  3D4C A;  3MC2 A;  1ZTY A;  3PUV E;  3MVZ A;  2IA4 A;  2VD2 A;  3TPA A;  2DXY A;  4F3S A;  2UVJ A;  1EU8 A;  1MXX A;  3LSX A;  3FVG A;  1MY3 A;  1JQF A;  1S9T A;  1B0H A;  5EYF A;  3HPI A;  2RCA A;  4ESW A;  1B3F A;  4R6K A;  3O6G A;  1A99 A;  4FAT A;  1JEU A;  3SES A;  3MP8 A;  3ZS6 A;  3RY3 A;  5AA4 B;  3HHF A;  3R6U A;  1LB9 A;  1QJM A;  2YPN A;  4L17 A;  4Q30 B;  4C1T A;  4OWD A;  5HM4 B;  4RNS A;  3E9X A;  3RN8 A;  3N94 A;  1TXF A;  3EPE A;  4DIG A;  3OOA A;  1LAF E;  2LAO A;  3TDJ A;  4Q8R A;  5ITP A;  1B52 A;  3K6V A;  4H0W A;  4U4X A;  3WAE A;  3G3I A;  4XKN A;  3DP4 A;  3TTN A;  5DEX A;  5KDT B;  3PPP A;  4NF5 B;  2O84 X;  2Y84 A;  2XXQ A;  5FTI A;  5FHN A;  2NVU B;  2XD3 A;  1KWH A;  3V8X B;  2QPQ A;  4H1X A;  4Z0I A;  3TEL A;  3P7I A;  1SBP A;  3RGY A;  4FEB A;  1DTZ A;  4PE5 B;  2DWH A;  2P0S A;  3FJ7 A;  5KCJ A;  4R2F A;  5F1Q A;  2G29 A;  2V84 A;  1B5J A;  2X7P A;  2FYI A;  2H99 A;  3EHU A;  3TQW A;  3TEP A;  4ISU A;  2R6G E;  4F18 A;  1FCK A;  4G68 C;  3A09 A;  2Z23 A;  4RPO A;  3GZG A;  4YZZ A;  3IOU A;  4LUB A;  2DWJ A;  3K1M A;  1IXH A;  4MFI A;  2V3U A;  3RT6 B;  2XXV A;  4GRK A;  2ZYM A;  4G8M A;  3OO7 A;  1OLC A;  4LQ5 A;  2UXA A;  1SI0 A;  4ZZA A;  1D3K A;  3O29 A;  1YAE A;  4FE8 A;  3ILU B;  4BDM A;  3QUJ A;  4ZED A;  2QS1 A;  2XX8 A;  4MF3 A;  1MXZ A;  1IIT A;  5TP9 B;  1RYX A;  3C32 A;  3ZSF A;  4R75 A;  3H6W A;  1PBQ A;  2UVG A;  1D9V A;  4OEN A;  3S9N C;  4EDP A;  4GL0 A;  1MPC A;  1CB6 A;  4QSE A;  1LLS A;  3W9V A;  1PC3 A;  2ZNU A;  4IO5 A;  5EHS A;  5ICT A;  2YJP A;  2Z8E A;  3D4G A;  4YKK A;  5CMB A;  2UYF A;  3O66 A;  3TMG A;  1XVY A;  1OIB A;  5EHM A;  4I8C A;  3UP9 A;  2NWJ A;  2FNC A;  3T9V A;  2REJ A;  1Y1M A;  2AL4 A;  3R7X A;  1BP5 A;  4XKQ A;  3CG3 A;  2VGQ A;  3MP1 A;  2F35 A;  4OZ9 A;  1O63 A;  4R74 A;  2Y7R A;  2V25 A;  4F2Q A;  1JW5 A;  4GOT A;  2V3Q A;  5H8H B;  1XOC A;  2F6P A;  4YAH X;  5H8Q A;  3IAZ A;  4I1D A;  4U4S A;  4YKJ A;  1UTH A;  5I57 B;  3K2D A;  4MLV A;  4TQU Q;  4YB5 A;  3Q28 A;  3SEY A;  5HBC A;  1NKX A;  2Z8D A;  3FAT A;  1AIV A;  3QYT A;  3S4U A;  4JBZ A;  3G3H A;  3VLW A;  2F6G A;  3M3K A;  1PEB A;  4G8H A;  1UTB A;  3K0V A;  4BLA A;  1BIY A;  2I58 A;  5I56 B;  1QUI A;  1MY2 A;  3PD8 A;  1PB8 A;  4P11 A;  1DSN A;  1B0L A;  4YIC A;  3B6T A;  2QRY A;  2GRV A;  1NNK A;  2Q8J A;  2I3W A;  2IEE A;  3IX1 A;  3H6T A;  3M8U A;  1XS5 A;  3LSW A;  5I58 A;  3T66 A;  2HAV A;  1PB7 A;  1Y3Q A;  4ONY A;  3IO6 A;  3PPR A;  3IJO B;  3U93 A;  3KOT A;  5H8F A;  4IB2 A;  3Q29 A;  3VDF A;  2REG A;  3TTK A;  4NF8 B;  3RNN A;  1T0K A;  4OQO A;  3SEW A;  3VVF A;  1B3E A;  1GV8 A;  3PPQ A;  1N04 A;  3TCH A;  4ZEK A;  2F8D A;  4X1B A;  4RYA A;  4FED A;  2OCU A;  3T93 B;  2PT1 A;  3HN0 A;  1FQF A;  3CRB A;  5TPA B;  2XXI A;  3IR1 A;  3PD9 A;  4JWY A;  1Y4C A;  2ZMB A;  3PV0 E;  1M5D A;  5A5X A;  1HSL A;  1IXI A;  3JV9 A;  4R9F A;  5CI5 A;  2F78 A;  1QUJ A;  4QFL A;  3CSB A;  1FQD A;  1B51 A;  1O7T A;  1ANF A;  2V93 A;  3T22 A;  1LB8 A;  1P1Q A;  3K00 A;  3K6W A;  3MVW A;  3OEL A;  4OEU A;  2PMS A;  4FJP A;  5JTY B;  4JDF A;  4KQP A;  2PX1 A;  2PT2 A;  3QK6 A;  3G3G A;  3KOS A;  4U22 A;  1XT8 A;  2Q2C A;  3UGW A;  3M3L A;  1SW2 A;  2ZYO A;  4AB5 A;  5KZT A;  1LFI A;  4NED A;  4OER A;  1B3G A;  4F1Y A;  5DVJ A;  4UA8 A;  1URG A;  3UK4 A;  4F3P A;  4KCD A;  1CE2 A;  2HXW A;  2H9B A;  3VFJ A;  4G68 A;  4JSD A;  2QSX A;  4KYE A;  4X9T A;  3V83 A;  2Y7W A;  4MH5 A;  3LSL A;  4H5F A;  4DLD A;  3C4M A;  3SEV A;  1A7L A;  4OET A;  2HAU A;  3IOV A;  1LCF A;  4ZZE A;  4NTL A;  2I4B A;  1OQH A;  1A54 A;  5I59 A;  4LA9 A;  4PFY A;  4RY1 A;  2DVZ A;  1R9L A;  3JZJ A;  1H45 A;  1OMP A;  2HEU A;  3QSL A;  4LVQ A;  4PP0 A;  2DE2 A;  3TYH A;  4H6D A;  1AL3 A;  4HS7 A;  3KGC A;  3C36 A;  1DPP A;  4OFO A;  2ONR A;  4DXB A;  1B7U A;  1SYI A;  2B65 A;  4PQJ A;  2OK2 A;  2I48 A;  2O68 A;  3LUY A;  4MBP A;  1VSO A;  4PFW A;  1I6A A;  5AE4 A;  3VV5 A;  1PB9 A;  2I4C A;  1MY1 A;  3T9H B;  1LFH A;  4LP2 B;  3HCQ A;  1NL5 A;  4QFP A;  3KSJ A;  5FTH A;  4GVO A;  4ZDM A;  2M8C A;  4U23 A;  2I49 A;  1MM6 A;  2A5S A;  4OMB A;  2HQ0 A;  3CR9 A;  3B6Q A;  4LAT A;  3VVD A;  1IZ1 A;  1TFD A;  3CFL A;  2XXH A;  1B3L A;  3Q27 A;  4HCW A;  3ZKL A;  4F19 A;  1URD A;  3R26 A;  3B6W A;  1DMB A;  5I2K A;  3TUS A;  2ONK E;  3OEN A;  3DP6 A;  3B7D A;  3G3F A;  4KD5 A;  3ODB A;  2F34 A;  4POX A;  5H8Q B;  2F5X A;  4M1V A;  2KLF A;  1H3D A;  1UTH B;  1UIV A;  2QJE A;  4ECF A;  4OFL A;  5L9M A;  1POT A;  4C1U A;  3U94 A;  1PDA A;  4E0X A;  4U1O A;  1FTJ A;  4F3B A;  2WKY A;  1D9Y A;  4PFT A;  1UTB B;  5CRY A;  1OVT A;  1B3H A;  4WKM A;  4KPT A;  1USY E;  4MLQ A;  1SQY A;  1NNT A;  3E4R A;  3KBR A;  2DYX A;  1JEV A;  3FAS A;  4BDL A;  1MDP 1;  2X7Q A;  5ICQ A;  5FHO A;  3H03 A;  2VHA A;  1A55 A;  2ZYK A;  3FVN A;  2XXX A;  1MRP A;  1IEJ A;  2XXR A;  3OEK A;  3SEU A;  3MVY A;  4C0R A;  4YMB A;  4GD5 A;  4G4P A;  4YB7 A;  1BLF A;  3BKI B;  1NMU A;  1JNF A;  2Y7P A;  3VVE A;  4H67 A;  3SER A;  1Z7M E;  3JYR A;  2A5T A;  3K6U A;  2H5Y A;  3KEI A;  4QFO A;  1H76 A;  3PUX E;  4BDR A;  3A3U A;  2RKM A;  2NOO A;  2F36 A;  1NH8 A;  1Y1Z A;  3IL1 B;  2Q9T A;  4DDD A;  3S9M C;  3SKP A;  1R1N A;  4R2B A;  1LBB A;  4GQO A;  1B7H A;  3OXN A;  2RIN A;  4EF2 A;  2BJJ X;  1VE4 A;  3U1O A;  4JSO A;  4IO3 A;  4O3C A;  4JWO A;  1MQH A;  5I84 A;  1MQI A;  1EH3 A;  5FHM A;  2F7A A;  2F7C A;  3HHG A;  2CZL A;  1NFT A;  1SVX B;  3OO6 A;  5L9O A;  5AA2 A;  1FTK A;  4OHN A;  2XHD A;  4IO7 A;  1LAX A;  1N3X A;  1N7X A;  4QFN A;  4KCC A;  3SDF A;  3U72 A;  1R6Z A;  1N7W A;  2XXT A;  2E1S A;  1SW5 A;  2I0B A;  3O9P A;  3IOR A;  4AQ4 A;  2DP8 A;  2DS9 A;  4DCX A;  1S7Y A;  2ESN A;  5M2V A;  3KFM A;  4QRZ A;  3C9H A;  4IO4 A;  1IXC A;  1RYO A;  2QMW A;  4IO2 A;  2HZL A;  2DXR A;  3KN8 A;  5AA4 A;  4EQB A;  1B05 A;  4G68 B;  1N84 A;  3PMX A;  1FQE A;  4FIM A;  3K1N A;  2ZNS A;  3V5A A;  1Y9U A;  2PVU A;  1D4N A;  3VXB A;  2QS3 A;  1I69 A;  2XXU A;  2HFB A;  4LQ2 A;  4M4G A;  2DOJ A;  4ZEF A;  4ZEI A;  5I2N A;  4YMA A;  4DZ1 A;  1B40 A;  3DLN A;  4THI A;  2THI A;  3EF7 A;  1ZKB A;  2B3F A;  4JB7 A;  3BBR A;  1P1O A;  4GXS B;  3OO8 A;  4POW A;  1QUK A;  2XXY A;  2ANJ A;  5KDT A;  1DPE A;  4WED A;  4E0W A;  4NF5 A;  5H8N B;  4IO6 A;  3TOD A;  1B4H A;  1ZBM A;  1NH7 A;  2O7U A;  1DTG A;  1TFA A;  3IOT A;  4ND9 A;  3KN3 A;  3UA8 A;  1ZIU A;  1ELJ A;  1B5H A;  3PPN A;  3QIM A;  4NF4 A;  3FZV A;  3FV1 A;  1PBP A;  3ONM A;  4EUO A;  4LZ7 A;  1N76 A;  3RTW B;  3U92 A;  4WEP A;  2Z22 A;  2O1M A;  2O69 A;  4ZE8 A;  2UYE A;  2UVI A;  3FJM A;  3MAM A;  1OQG A;  3OMB A;  2Y7I A;  3MZ1 A;  3E13 X;  3ILT B;  1FTL A;  1IIW A;  2AYS A;  3MBP A;  3MQ9 A;  2XXP A;  3L6H A;  1SI1 A;  1MXW A;  4NMY A;  4TLM B;  1F9B A;  5ELV A;  3FXQ A;  5TP9 A;  1LAG E;  4G77 A;  3C33 A;  3MWB A;  3CVG A;  1WDN A;  4DCY A;  1SDX A;  2X26 A;  1URS A;  4IGT A;  1GR2 A;  5AA3 A;  1BKA A;  3LBS A;  4GIZ A;  1P1W A;  3MVX A;  2OZZ A;  5IKB A;  3ECR A;  1JW4 A;  4EQ7 A;  4OEV A;  4EF1 A;  4RJZ A;  3N6T A;  5ISU A;  3PU5 A;  2XX9 A;  3G3J A;  2G93 A;  1B1X A;  4KYD A;  4RK2 A;  2R71 A;  3H6V A;  3RT8 A;  5DEX B;  1OVB A;  1FTM A;  3KSX A;  2RC7 A;  2OWT A;  2I3V A;  4N07 A;  3KG2 A;  3Q26 A;  4JXI A;  5H8H A;  3VLV A;  3C35 A;  3FXU A;  3TTM A;  1POY 1;  5I57 A;  2FA7 A;  4FEC A;  5CBS A;  5KCJ B;  1FQB A;  1EZO A;  2O7I A;  1SW1 A;  3USD A;  3TZA A;  1JW1 A;  4AB6 A;  2XD2 A;  4HTG A;  5K2X A;  3FIR A;  2DQV A;  4XKR A;  5DYH A;  4U21 A;  1B46 A;  2H98 A;  1YCJ A;  3HST A;  3K1P A;  4N13 A;  4NWC A;  3OEM A;  3N6U A;  1LBC A;  4F3G A;  3PUY E;  1BTJ A;  1FQA A;  1I6B A;  1GGG A;  3DP8 A;  1A8F A;  3BFT A;  4OYV A;  1YPN A;  2R9J A;  4BDN A;  1B58 A;  3K4U A;  5AA1 A;  4ELO A;  2ZYN A;  2QL3 A;  4G8N A;  1XHY A;  4X1D A;  4BDQ A;  2QS4 A;  1EZP A;  4NF8 A;  5BUU A;  3MPL A;  3GBA A;  2I0C A;  5AA2 B;  2CMO A;  3FV2 A;  3C34 A;  4X48 A;  5F7V A;  4NF6 A;  5TPA A;  2HCA A;  3M3F A;  1MDQ A;  2OLB A;  2DWA A;  3MZB A;  1SW4 A;  3OD7 A;  1A8E A;  2O6A A;  2D3I A;  4ZE9 A;  3HO7 A;  4ELQ A;  3UIF A;  1ZJL A;  3MP6 A;  3RQT A;  5K2Y A;  4F1U A;  2UVH A;  3MW0 A;  3TKD A;  1B5I A;  2RC8 A;  4JWX A;  1O64 A;  3FUZ A;  2ZNT A;  3HV1 A;  3T9X B;  4UAC A; 
#chains in the Genus database with same CATH topology
 1H44 A;  1B7Z A;  1GVC A;  1MY4 A;  2PBW A;  1B4Z A;  1MPB A;  5J1D A;  3CG1 A;  3S2V A;  2VD3 A;  5JTY A;  3GBB A;  1Z7N E;  3FVK A;  1IUD A;  4EXK A;  4H65 A;  4N91 A;  3CI8 A;  3IB1 A;  1MXY A;  5I2N B;  2W7Y A;  4NN3 A;  4OES A;  5B70 A;  3L6G A;  4PFI A;  3QUF A;  3I6V A;  1P1N A;  2XXW A;  3WAF A;  4K3F A;  1MG1 A;  2WYP A;  4XXU A;  3RUM A;  1A40 A;  1YTV A;  1MQG A;  1JVX A;  3NOH A;  3T96 B;  4O3A A;  2H4I A;  2D21 A;  4F22 A;  3D1R A;  4GFR A;  2VOZ A;  4GLI A;  1MXV A;  4OTE A;  3I3V A;  3N26 A;  3TQL A;  5I58 B;  2DE4 A;  3E3K A;  4RXL A;  1WOD A;  4G2Z A;  1ZU0 A;  4IY6 A;  3CFZ A;  4XEQ A;  3EHT A;  5DVI A;  3KJ7 A;  5H8F B;  1Y20 A;  3V89 B;  3FJG A;  2VPO A;  4PBH A;  4RK9 A;  3W9W A;  4JVI A;  5EQ8 A;  2OWZ A;  3H7M A;  4U1Z A;  2Y5L A;  2WEF A;  1NNP A;  4GWO A;  3THI A;  3SET A;  4NE4 A;  4NF4 B;  4OXV A;  1L5T A;  1UIU A;  3VLU A;  3A3C A;  4R6H A;  4KHZ E;  1GTK A;  1B9J A;  1NUX A;  4KI0 E;  2DE3 A;  1M5B A;  3H6U A;  3MJN A;  3W15 C;  5A5X B;  3KZG A;  1NNF A;  1VFD A;  3OSQ A;  5CMK A;  3FBP A;  4GXA A;  3FVO A;  4PFB A;  4IR8 A;  4O3B A;  2NXO A;  5JK4 A;  2RC9 A;  4ELR A;  3O97 A;  5L8D A;  4QFK A;  4QF9 A;  1N0T A;  2D5W A;  3LSF B;  1UQW A;  1B2H A;  1OLA A;  3H06 B;  3KJT A;  3T9U A;  1QKA A;  1ZMG A;  1FPF A;  1TWY A;  5HPQ A;  4KFQ A;  4YB6 A;  2GFE A;  3PUZ E;  2Q2A A;  1FBP A;  3IO4 A;  4HW8 A;  3G3K A;  4Q5T A;  4IY5 A;  4XKP A;  4DE8 A;  5CM6 A;  1G0I A;  5LOM A;  2V3T A;  4HE1 A;  4I9D A;  1LST A;  2R8T A;  5IAI A;  3EHS A;  4I62 A;  1USY H;  2P1S A;  4TLL B;  3VE1 B;  2QMX A;  4PET A;  2AIX A;  1HSJ A;  3IB2 A;  3TTL A;  4R73 A;  2DSF A;  2OJT A;  1XC1 A;  4LON B;  4EQ9 A;  1AMF A;  1DOT A;  1JVY A;  4GF8 A;  3MZ9 A;  4HXV A;  5TU0 A;  4FOR A;  3KN7 A;  3ZKK A;  3EN3 A;  2FHY A;  3K01 A;  4ESX A;  4OVT A;  4QSD A;  2YLN A;  1IXG A;  4RA1 A;  3N5L A;  1ATG A;  3LC8 A;  4XTC Q;  1M5F A;  2GH9 A;  4ZEC A;  2AL5 A;  5I59 B;  4OA4 A;  3H4Z A;  1Q1K A;  2RCB A;  5DTB A;  1MS7 A;  5DVF A;  1N3W A;  1EYJ A;  3DM0 A;  2DVC A;  1AOV A;  3PMV A;  4GBV A;  4P8B A;  3EQ1 A;  3O6I A;  4LZ8 A;  2B4M A;  1XVX A;  3S9L C;  5IM2 A;  3RPL A;  1US4 A;  2O51 A;  3S9E A;  1ZLQ A;  1FPJ A;  4ZS9 A;  1K9Y A;  3BFU A;  4MNI A;  4F1V A;  1YYZ A;  4Z7E A;  1I6Q A;  2H25 A;  1Y3N A;  3H3G A;  3FGS A;  1SYH A;  3MPK A;  5EYH A;  3O2A A;  3IB0 A;  4P0G A;  5CC2 A;  3UOR A;  1WVJ A;  4YU0 A;  3LV0 A;  2Y7K A;  4HCY A;  2ONS A;  4WXJ A;  1B1H A;  1S50 A;  1MH3 A;  1NV1 A;  1FJ6 A;  1II5 A;  2B3B A;  4O94 A;  4TOZ A;  2Q89 A;  1MM7 A;  4QHQ A;  4F31 B;  4F39 A;  5T3J A;  4XIG Q;  2F7B A;  3IOW A;  2Q88 A;  2RF1 A;  1NV4 A;  3G7W A;  4NAP A;  2XWI A;  3DEL B;  1TT1 A;  4OVR A;  1QVS A;  2Q74 A;  4PE3 A;  5BWJ A;  5CMM A;  4ELP A;  4KYS A;  1G0H A;  4X04 A;  5IZZ A;  3U8Q A;  4PFU A;  4ZEB A;  4NF6 B;  2WX9 A;  1MY0 A;  1LGB C;  5J16 A;  4U2R A;  2WYK A;  3AXF A;  5AA2 D;  1H43 A;  5IZ3 A;  3FXR A;  3QXM A;  1M5C A;  1MXU A;  5JEI A;  3IK6 B;  4FAJ A;  3K6X A;  4OFJ A;  5I2K B;  5ITO A;  3CSG A;  1EZ9 A;  1HSE A;  3TAJ A;  1VFE A;  3CFX A;  4H5G A;  3QAX A;  4YKP A;  2OBG A;  2XX7 A;  2GHB A;  3RPW A;  3PGF A;  1QW0 A;  4DXU A;  2ABH A;  1LFG A;  3KC1 A;  2F97 A;  3VXC A;  1MQD A;  1Y3P A;  3OSR A;  1JET A;  2I6E A;  2VP1 A;  4GX3 A;  5DT6 A;  5I3S A;  1RKM A;  5A5L A;  2DWI A;  1B32 A;  3GLB A;  4GL8 A;  3A29 A;  4GWS A;  3TFL A;  3LR1 A;  4RPN A;  3TCG A;  2Z8F A;  4BDO A;  4F2O A;  1FQC A;  4I3E A;  5H8S A;  4EXL A;  4F29 A;  3I5O A;  1MQJ A;  1FPI A;  3PUW E;  2OWS A;  3O6H A;  4XF5 A;  1P1U A;  3CIJ A;  1FW0 A;  4AS4 A;  2QS2 A;  3MUQ A;  2WBB A;  2PFY A;  3PMW A;  2QFL A;  1R9Q A;  3RLF E;  4H45 A;  4N81 A;  3SEX A;  5B7D A;  4NHB A;  1B6H A;  4IGR A;  4QXD A;  4Q0C A;  2PYY A;  2ALU A;  4DXC A;  2GHA A;  3OO9 A;  5CMC A;  4PGP A;  4P0I A;  1LAH E;  1FBG A;  1QUL A;  2E0S A;  4OVQ A;  3GXA A;  2P2A A;  5I56 A;  3E78 A;  4QSC A;  4N6P A;  2O1L A;  5LDZ A;  2ZZX A;  4H46 A;  4OVJ A;  2A5T B;  1J1N A;  3C31 A;  4R6Y A;  2V4C A;  1RDY A;  1SD3 A;  1MH4 A;  5CBR A;  5H8N A;  2HZK A;  1FBD A;  4OVP A;  1Y4T A;  4GWX A;  4LZ5 A;  3UN6 A;  1FTO A;  4H8I A;  1US5 A;  2ZXT A;  1AH5 A;  2NUV A;  1LCT A;  1MPD A;  3F11 A;  3O28 A;  1P99 A;  4R72 A;  5EYG A;  3PPO A;  1QKB A;  2XA5 A;  3Q25 A;  1M5E A;  3TTR A;  3HFU A;  4KR5 A;  1VR5 A;  4DI3 D;  3TCF A;  3K02 A;  3FD3 A;  4H8J A;  3RTF B;  4R9G A;  3IJX B;  1IQ7 A;  4YKI A;  1Q35 A;  5L9S A;  4NWD A;  3D4C A;  4GWY A;  3MC2 A;  2CEX A;  1ZTY A;  3PUV E;  3MVZ A;  4PF6 A;  2IA4 A;  1KA1 A;  2VD2 A;  3MST A;  4NG7 A;  3TPA A;  2DXY A;  4F3S A;  4PDH A;  2UVJ A;  1EU8 A;  1MXX A;  3LSX A;  5I5P A;  3FVG A;  1MY3 A;  1JQF A;  1S9T A;  1B0H A;  4HE0 A;  5EYF A;  3HPI A;  1FBE A;  2RCA A;  4ESW A;  2ZZW A;  1NV6 A;  1B3F A;  4R6K A;  3O6G A;  1A99 A;  4FAT A;  4P1E A;  1JEU A;  2VPN A;  3SES A;  1NV0 A;  3MP8 A;  3ZS6 A;  3RY3 A;  5AA4 B;  3HHF A;  5ET8 A;  1FTA A;  3R6U A;  1LB9 A;  2Y5K A;  1QJM A;  2KQZ A;  2YPN A;  4P9K A;  4L17 A;  4MJO A;  1EYI A;  4Q30 B;  4C1T A;  4OWD A;  5HM4 B;  4RNS A;  3E9X A;  4P3L A;  3RN8 A;  3N94 A;  1TXF A;  3EPE A;  4DIG A;  2F3D A;  3OOA A;  1LAF E;  4PGN A;  2LAO A;  3TDJ A;  4Q8R A;  2FBP A;  2DDK A;  5ITP A;  1B52 A;  3K6V A;  4H0W A;  4U4X A;  2GQ1 A;  3WAE A;  3G3I A;  4XKN A;  2Q8M A;  3DP4 A;  3TTN A;  5DEX A;  5KDT B;  3PPP A;  4NF5 B;  2O84 X;  2Y84 A;  4MX6 A;  2XXQ A;  5FTI A;  5FHN A;  2NVU B;  2XD3 A;  1KWH A;  3V8X B;  2QPQ A;  3RPL B;  4H1X A;  4Z0I A;  3TEL A;  3P7I A;  1SBP A;  1AWB A;  3RGY A;  4FEB A;  1DTZ A;  4PE5 B;  2DWH A;  2P0S A;  3FJ7 A;  4MMP A;  5KCJ A;  4R2F A;  5F1Q A;  2G29 A;  2V84 A;  4HE2 A;  1B5J A;  5I7I A;  2X7P A;  2FYI A;  2H99 A;  3EHU A;  3TQW A;  3TEP A;  5IZ1 A;  4ISU A;  2R6G E;  4F18 A;  4PAF A;  4JVC A;  3BIH A;  1FCK A;  4G68 C;  3A09 A;  2Z23 A;  4RPO A;  3GZG A;  4YZZ A;  2BJI A;  3IOU A;  4LUB A;  2DWJ A;  3K1M A;  1IXH A;  4MFI A;  2V3U A;  3RT6 B;  2XXV A;  4GRK A;  2ZYM A;  4G8M A;  3OO7 A;  1OLC A;  4LQ5 A;  2UXA A;  1SI0 A;  4ZZA A;  1D3K A;  4PDD A;  3O29 A;  1YAE A;  4FE8 A;  3ILU B;  4BDM A;  4O7I A;  3QUJ A;  4ZED A;  2QS1 A;  2XX8 A;  4MF3 A;  1MXZ A;  1IIT A;  5TP9 B;  1RYX A;  3C32 A;  3ZSF A;  4R75 A;  3H6W A;  1PBQ A;  2UVG A;  1D9V A;  4OEN A;  1FBH A;  3S9N C;  4LN5 A;  4EDP A;  4GL0 A;  1MPC A;  1CB6 A;  4QSE A;  1LLS A;  3W9V A;  1PC3 A;  2ZNU A;  4IO5 A;  5EHS A;  5ET7 A;  5ICT A;  2YJP A;  3ISP A;  2Z8E A;  1FBF A;  3D4G A;  4YKK A;  5CMB A;  4AS5 A;  2UYF A;  1NUW A;  3O66 A;  3TMG A;  1XVY A;  1OIB A;  5EHM A;  4I8C A;  3UP9 A;  2NWJ A;  2FNC A;  3T9V A;  3KC0 A;  2REJ A;  1Y1M A;  2FVZ A;  2AL4 A;  3RYD A;  3R7X A;  1BP5 A;  4GBW A;  4XKQ A;  3CG3 A;  2VGQ A;  3MP1 A;  2F35 A;  4OZ9 A;  1O63 A;  2QVV A;  4R74 A;  2Y7R A;  5EQA A;  2V25 A;  4F2Q A;  1JW5 A;  2F3B A;  4GOT A;  1BK4 A;  1RDX A;  2V3Q A;  5H8H B;  1XOC A;  2F6P A;  4YAH X;  5H8Q A;  3IAZ A;  4I1D A;  4U4S A;  4YKJ A;  1UTH A;  5I57 B;  3K2D A;  1LBZ A;  4MAG A;  4NF0 A;  4GX4 A;  4MLV A;  4TQU Q;  4YB5 A;  3Q28 A;  2CEY A;  3SEY A;  5HBC A;  1NKX A;  2Z8D A;  3FAT A;  1AIV A;  1FPK A;  3QYT A;  4I3Y A;  3S4U A;  4JBZ A;  3G3H A;  3VLW A;  2F6G A;  3M3K A;  1PEB A;  4G8H A;  1UTB A;  4G61 A;  3K0V A;  1IMC A;  2OX3 A;  4BLA A;  2PCR A;  1BIY A;  2I58 A;  5I56 B;  2FIX A;  4DI4 B;  1K9Z A;  1QUI A;  1MY2 A;  3PD8 A;  1PB8 A;  4OVS A;  4MNP A;  4P11 A;  1DSN A;  1B0L A;  4YIC A;  3B6T A;  2QRY A;  2GRV A;  1NNK A;  2Q8J A;  2I3W A;  4PAK A;  2IEE A;  3IX1 A;  3H6T A;  3M8U A;  1XS5 A;  3LSW A;  5I58 A;  3T66 A;  2HAV A;  1PB7 A;  1Y3Q A;  4MCO A;  4ONY A;  3IO6 A;  3PPR A;  3IJO B;  3IFC A;  3U93 A;  3KOT A;  5H8F A;  4FBP A;  4JVD A;  4IB2 A;  3Q29 A;  1D9Q A;  1LBV A;  3VDF A;  2REG A;  1JP4 A;  3TTK A;  4NF8 B;  3RNN A;  1T0K A;  4OQO A;  3T1B A;  3SEW A;  3VVF A;  1B3E A;  1GV8 A;  1FPE A;  2L5V A;  3PPQ A;  1N04 A;  3TCH A;  4ZEK A;  2F8D A;  4X1B A;  4RYA A;  4FED A;  2OCU A;  3T93 B;  1SPI A;  2PT1 A;  3HN0 A;  1FQF A;  3CRB A;  5TPA B;  2XXI A;  3IR1 A;  3PD9 A;  4JWY A;  1Y4C A;  2ZMB A;  3PV0 E;  1M5D A;  5A5X A;  1HSL A;  1IXI A;  3JV9 A;  4R9F A;  5CI5 A;  2F78 A;  1QUJ A;  2CZH A;  4QFL A;  3CSB A;  1FQD A;  1B51 A;  1O7T A;  1NV5 A;  1ANF A;  2V93 A;  3T22 A;  1LB8 A;  1P1Q A;  3K00 A;  3K6W A;  3MVW A;  3OEL A;  4OEU A;  2PMS A;  4FJP A;  5JTY B;  4JDF A;  4KQP A;  2PX1 A;  2PT2 A;  1DBZ A;  3QK6 A;  3G3G A;  3KOS A;  4U22 A;  1XT8 A;  2Q2C A;  3UGW A;  3M3L A;  1SW2 A;  2ZYO A;  4AB5 A;  5FBP A;  5KZT A;  1LFI A;  4NED A;  4OER A;  1B3G A;  4F1Y A;  5DVJ A;  4UA8 A;  2HPG A;  1URG A;  3UK4 A;  4F3P A;  4KCD A;  1CE2 A;  2HXW A;  2H9B A;  3VFJ A;  4G68 A;  4JSD A;  3SZP A;  2QSX A;  4KYE A;  4GWZ A;  4X9T A;  3V83 A;  2Y7W A;  4MH5 A;  3LSL A;  4H5F A;  4DLD A;  3C4M A;  3SEV A;  1A7L A;  1NI9 A;  4OET A;  2HAU A;  3T0J A;  3IOV A;  1LCF A;  4ZZE A;  4NTL A;  2I4B A;  1YZ0 A;  1OQH A;  3KBZ A;  2XWK A;  1A54 A;  5I59 A;  4LA9 A;  2XWV A;  4PFY A;  4RY1 A;  2DVZ A;  1IMF A;  1R9L A;  4QBA A;  3JZJ A;  1H45 A;  1OMP A;  2HEU A;  3QSL A;  4LVQ A;  4PP0 A;  2DE2 A;  3TYH A;  3B50 A;  1AL3 A;  4H6D A;  4HS7 A;  3KGC A;  4PF8 A;  3C36 A;  1DPP A;  4OFO A;  3MYU A;  2ONR A;  4DXB A;  1B7U A;  1SYI A;  2B65 A;  4PQJ A;  4N15 A;  2OK2 A;  2I48 A;  4PTK A;  2O68 A;  3LUY A;  4MBP A;  1VSO A;  4PFW A;  1I6A A;  4MIJ A;  5AE4 A;  2P3V A;  3VV5 A;  1PB9 A;  2I4C A;  1MY1 A;  3T9H B;  1LFH A;  4LP2 B;  3HCQ A;  1NL5 A;  4QFP A;  3PTY A;  3KSJ A;  1INP A;  4GVO A;  5FTH A;  4ZDM A;  2M8C A;  4U23 A;  2I49 A;  1MM6 A;  1FJ9 A;  2A5S A;  4GWW A;  4OMB A;  2HQ0 A;  3CR9 A;  3B6Q A;  4LAT A;  3VVD A;  1IZ1 A;  1FSA A;  4N6D A;  1TFD A;  3CFL A;  2XXH A;  1B3L A;  3Q27 A;  4HCW A;  3U65 A;  3ZKL A;  4F19 A;  5ET6 A;  1URD A;  3R26 A;  3B6W A;  1DMB A;  5I2K A;  3TUS A;  2ONK E;  3OEN A;  3DP6 A;  1YXI A;  3B7D A;  3G3F A;  4KD5 A;  1DCU A;  3ODB A;  2F34 A;  4POX A;  5H8Q B;  2F5X A;  4M1V A;  2KLF A;  1H3D A;  1UTH B;  1UIV A;  2QJE A;  4ECF A;  1NV3 A;  4OFL A;  5L9M A;  1POT A;  4C1U A;  3U94 A;  4PCD A;  1PDA A;  4E0X A;  4N8Y A;  4U1O A;  1DK4 A;  1FTJ A;  4F3B A;  2WKY A;  1D9Y A;  2HHM A;  4PFT A;  1IMA A;  1UTB B;  5CRY A;  1OVT A;  1B3H A;  4WKM A;  4KPT A;  1USY E;  4MLQ A;  1SQY A;  1NNT A;  3E4R A;  4N4U A;  1QGX A;  3KBR A;  4GWU A;  2DYX A;  1JEV A;  3FAS A;  4BDL A;  4UAB A;  2CZI A;  1CNQ A;  1MDP 1;  2X7Q A;  5ICQ A;  5FHO A;  3CHG A;  3H03 A;  1FRP A;  2VHA A;  1A55 A;  1LBY A;  2ZYK A;  3FVN A;  2XXX A;  1NUZ A;  1MRP A;  1IEJ A;  2XXR A;  3OEK A;  4I40 A;  3SEU A;  3MVY A;  4C0R A;  4YMB A;  2WBD A;  4GD5 A;  4G4P A;  4YB7 A;  1BLF A;  3BKI B;  1NMU A;  1JNF A;  2Y7P A;  3VVE A;  4PC9 A;  4H67 A;  3SER A;  4PAI A;  1Z7M E;  5IGA A;  5ET5 A;  3JYR A;  2A5T A;  3K6U A;  2H5Y A;  3KEI A;  4QFO A;  1H76 A;  3PUX E;  4BDR A;  3A3U A;  2RKM A;  2NOO A;  2F36 A;  1NH8 A;  1Y1Z A;  3IL1 B;  2Q9T A;  4DDD A;  3S9M C;  3EKI A;  4N8G A;  1KZ8 A;  3SKP A;  1R1N A;  4R2B A;  3E79 A;  1LBB A;  4GQO A;  5IZ3 B;  1B7H A;  1IME A;  2RIN A;  3OXN A;  4EF2 A;  2BJJ X;  1VE4 A;  3U1O A;  4JSO A;  4IO3 A;  4O3C A;  4JWO A;  1MQH A;  5I84 A;  1MQI A;  1EH3 A;  5FHM A;  2F7A A;  2F7C A;  3HHG A;  2CZL A;  1NFT A;  1SVX B;  3OO6 A;  5L9O A;  5AA2 A;  1FTK A;  4NQ8 A;  2FIE A;  2XHD A;  4OHN A;  4IO7 A;  3LUZ A;  1LAX A;  1N3X A;  1N7X A;  4QFN A;  4KCC A;  3SDF A;  3U72 A;  1R6Z A;  1N7W A;  2XXT A;  2E1S A;  1SW5 A;  3BIG A;  2I0B A;  3O9P A;  1Q9D A;  3IOR A;  4AQ4 A;  2DP8 A;  2DS9 A;  4DCX A;  4N17 A;  1S7Y A;  2ESN A;  1EYK A;  5M2V A;  3KFM A;  4QRZ A;  3C9H A;  4IO4 A;  1IXC A;  1RYO A;  2QMW A;  1FBC A;  4IO2 A;  2HZL A;  2DXR A;  3KN8 A;  5AA4 A;  4EQB A;  1B05 A;  4G68 B;  1RDZ A;  1N84 A;  3PMX A;  1FQE A;  4FIM A;  1NV7 A;  3K1N A;  2ZNS A;  3V5A A;  1Y9U A;  2PVU A;  1D4N A;  3VXB A;  2QS3 A;  1I69 A;  2XXU A;  2HFB A;  4LQ2 A;  4M4G A;  2DOJ A;  4ZEF A;  2XWO A;  4ZEI A;  5I2N A;  4YMA A;  4DZ1 A;  4MNC A;  1B40 A;  3DLN A;  3ROJ A;  2CZK A;  4THI A;  4GX6 A;  2THI A;  3EF7 A;  2ZZV A;  1ZKB A;  2HXR A;  4X8R A;  2B3F A;  4JB7 A;  3BBR A;  1P1O A;  4GXS B;  5F24 A;  3OO8 A;  4POW A;  1QUK A;  2XXY A;  2ANJ A;  5KDT A;  2B4L A;  1DPE A;  4WED A;  4E0W A;  4NF5 A;  5H8N B;  4IO6 A;  3TOD A;  1B4H A;  1ZBM A;  1FPD A;  1NH7 A;  2O7U A;  1DTG A;  1TFA A;  3IOT A;  1NV2 A;  4ND9 A;  3KN3 A;  3UA8 A;  1ZIU A;  1ELJ A;  1B5H A;  3PPN A;  3QIM A;  4NF4 A;  5EQ7 A;  3FZV A;  3FV1 A;  3B8B A;  1PBP A;  3ONM A;  4EUO A;  3FXB A;  4MHF A;  1LBX A;  2KR0 A;  4LZ7 A;  1N76 A;  3RTW B;  3U92 A;  4WEP A;  2Z22 A;  2O1M A;  2O69 A;  2QVU A;  5DW8 A;  4ZE8 A;  2UYE A;  2UVI A;  3FJM A;  3MAM A;  1OQG A;  3OMB A;  4XFE A;  2Y7I A;  3MZ1 A;  3E13 X;  3ILT B;  1FTL A;  1IIW A;  2AYS A;  3MBP A;  3MQ9 A;  2XXP A;  2JJK A;  3L6H A;  1SI1 A;  1MXW A;  4NMY A;  4NGU A;  4TLM B;  1F9B A;  5ELV A;  3FXQ A;  5TP9 A;  2P3N A;  1LAG E;  4G77 A;  3C33 A;  3MWB A;  3CVG A;  1WDN A;  4NX1 A;  4DCY A;  1SDX A;  2X26 A;  1URS A;  4IGT A;  1GR2 A;  5AA3 A;  4OAN A;  1XI6 A;  1BKA A;  3LBS A;  4GIZ A;  1P1W A;  3MVX A;  2OZZ A;  5IKB A;  3ECR A;  1JW4 A;  4EQ7 A;  4OEV A;  4EF1 A;  4RJZ A;  3N6T A;  5ISU A;  3PU5 A;  2XX9 A;  3G3J A;  1LBW A;  2G93 A;  1B1X A;  4KYD A;  4RK2 A;  1NUY A;  2R71 A;  3H6V A;  3RT8 A;  5DEX B;  1OVB A;  4P56 A;  1FTM A;  3KSX A;  2RC7 A;  2OWT A;  2I3V A;  4N07 A;  3KG2 A;  3Q26 A;  1LEV A;  4JXI A;  5H8H A;  3VLV A;  3C35 A;  3FXU A;  3TTM A;  1POY 1;  5I57 A;  2FA7 A;  1KA0 A;  4N6K A;  4O7M A;  2VT5 A;  4FEC A;  5CBS A;  5LTC A;  5KCJ B;  1FQB A;  1EZO A;  2O7I A;  2PFZ A;  1IMD A;  1SW1 A;  5ESY A;  3USD A;  3TZA A;  1JW1 A;  1IMB A;  4AB6 A;  2XD2 A;  4O8M A;  4MEV A;  4HTG A;  5K2X A;  3FIR A;  2DQV A;  4XKR A;  5DYH A;  4U21 A;  1B46 A;  2H98 A;  1YCJ A;  3HST A;  3K1P A;  4N13 A;  4NWC A;  3OEM A;  3N6U A;  1LBC A;  4F3G A;  3PUY E;  1BTJ A;  1FQA A;  1I6B A;  1GGG A;  1VDW A;  3DP8 A;  1A8F A;  3BFT A;  4OYV A;  1YPN A;  2R9J A;  4BDN A;  4P1L A;  1B58 A;  4PBQ A;  3K4U A;  5AA1 A;  4PFR A;  2XXK A;  5EQ9 A;  4ELO A;  2ZYN A;  2QL3 A;  4G8N A;  1XHY A;  4X1D A;  4BDQ A;  2QS4 A;  1EZP A;  3IFA A;  4NF8 A;  5BUU A;  3MPL A;  2QVR A;  3GBA A;  2I0C A;  1FPL A;  5AA2 B;  2CMO A;  1FPG A;  3FV2 A;  3C34 A;  4X48 A;  3QMF A;  5F7V A;  1FPB A;  4NF6 A;  5TPA A;  2HCA A;  3M3F A;  1MDQ A;  4KXP A;  2OLB A;  2DWA A;  3MZB A;  1SW4 A;  3OD7 A;  1A8E A;  2O6A A;  3GYY A;  2D3I A;  4ZE9 A;  3HO7 A;  4ELQ A;  3UIF A;  1ZJL A;  3MP6 A;  4P47 A;  3RQT A;  5K2Y A;  4F1U A;  2UVH A;  3MW0 A;  3TKD A;  1B5I A;  2MKZ A;  2RC8 A;  4JWX A;  1O64 A;  3FUZ A;  2ZNT A;  3HV1 A;  3T9X B;  4UAC A; 
#chains in the Genus database with same CATH homology
 1H44 A;  1B7Z A;  1GVC A;  1MY4 A;  2PBW A;  1B4Z A;  1MPB A;  5J1D A;  3CG1 A;  3S2V A;  2VD3 A;  5JTY A;  3GBB A;  1Z7N E;  3FVK A;  1IUD A;  4EXK A;  4H65 A;  3CI8 A;  3IB1 A;  1MXY A;  5I2N B;  2W7Y A;  4OES A;  5B70 A;  3L6G A;  3QUF A;  3I6V A;  1P1N A;  2XXW A;  3WAF A;  4K3F A;  1MG1 A;  4XXU A;  3RUM A;  1A40 A;  1YTV A;  1MQG A;  1JVX A;  3T96 B;  4O3A A;  2H4I A;  2D21 A;  4F22 A;  4GFR A;  2VOZ A;  4GLI A;  1MXV A;  4OTE A;  3I3V A;  3N26 A;  3TQL A;  5I58 B;  2DE4 A;  3E3K A;  4RXL A;  1WOD A;  4G2Z A;  1ZU0 A;  4IY6 A;  3CFZ A;  3EHT A;  5DVI A;  3KJ7 A;  5H8F B;  1Y20 A;  3V89 B;  3FJG A;  4RK9 A;  3W9W A;  3H7M A;  4U1Z A;  1NNP A;  4GWO A;  3THI A;  3SET A;  4NE4 A;  4NF4 B;  4OXV A;  1L5T A;  1UIU A;  3VLU A;  3A3C A;  4R6H A;  4KHZ E;  1GTK A;  1B9J A;  4KI0 E;  2DE3 A;  1M5B A;  3H6U A;  3W15 C;  5A5X B;  3MJN A;  3KZG A;  1NNF A;  1VFD A;  3OSQ A;  5CMK A;  4GXA A;  3FVO A;  4O3B A;  2NXO A;  5JK4 A;  2RC9 A;  4ELR A;  3O97 A;  5L8D A;  4QFK A;  4QF9 A;  1N0T A;  2D5W A;  3LSF B;  1UQW A;  1B2H A;  1OLA A;  3H06 B;  3KJT A;  3T9U A;  1QKA A;  1ZMG A;  1TWY A;  5HPQ A;  4KFQ A;  4YB6 A;  2GFE A;  3PUZ E;  2Q2A A;  3IO4 A;  4HW8 A;  3G3K A;  4Q5T A;  4IY5 A;  4XKP A;  4DE8 A;  5CM6 A;  5LOM A;  2V3T A;  4I9D A;  1LST A;  5IAI A;  3EHS A;  4I62 A;  1USY H;  2P1S A;  4TLL B;  3VE1 B;  2QMX A;  4PET A;  2AIX A;  1HSJ A;  3IB2 A;  3TTL A;  4R73 A;  2DSF A;  2OJT A;  1XC1 A;  4LON B;  4EQ9 A;  1AMF A;  1DOT A;  1JVY A;  4GF8 A;  3MZ9 A;  5TU0 A;  4FOR A;  3KN7 A;  3ZKK A;  3EN3 A;  3K01 A;  4ESX A;  4QSD A;  2YLN A;  1IXG A;  4RA1 A;  3N5L A;  1ATG A;  3LC8 A;  4XTC Q;  1M5F A;  2GH9 A;  4ZEC A;  2AL5 A;  5I59 B;  3H4Z A;  1Q1K A;  5DTB A;  2RCB A;  1MS7 A;  5DVF A;  1N3W A;  3DM0 A;  2DVC A;  1AOV A;  3PMV A;  3EQ1 A;  3O6I A;  4LZ8 A;  1XVX A;  3S9L C;  1US4 A;  2O51 A;  3S9E A;  1ZLQ A;  4ZS9 A;  3BFU A;  4F1V A;  4Z7E A;  1I6Q A;  2H25 A;  1Y3N A;  3H3G A;  3FGS A;  1SYH A;  3MPK A;  3O2A A;  3IB0 A;  4P0G A;  5CC2 A;  3UOR A;  1WVJ A;  4YU0 A;  2Y7K A;  4HCY A;  2ONS A;  4WXJ A;  1B1H A;  1S50 A;  1MH3 A;  1II5 A;  2B3B A;  4TOZ A;  2Q89 A;  1MM7 A;  4QHQ A;  4F31 B;  4F39 A;  4XIG Q;  2F7B A;  3IOW A;  2Q88 A;  2RF1 A;  3G7W A;  3DEL B;  1TT1 A;  1QVS A;  5BWJ A;  5CMM A;  4ELP A;  4KYS A;  3U8Q A;  4PFU A;  4ZEB A;  4NF6 B;  1MY0 A;  1LGB C;  4U2R A;  3AXF A;  5AA2 D;  1H43 A;  3FXR A;  3QXM A;  1M5C A;  1MXU A;  5JEI A;  3IK6 B;  4FAJ A;  3K6X A;  4OFJ A;  5I2K B;  5ITO A;  3CSG A;  1EZ9 A;  1HSE A;  3TAJ A;  1VFE A;  3CFX A;  4H5G A;  3QAX A;  4YKP A;  2OBG A;  2XX7 A;  2GHB A;  3RPW A;  3PGF A;  1QW0 A;  4DXU A;  2ABH A;  1LFG A;  2F97 A;  3VXC A;  1MQD A;  1Y3P A;  3OSR A;  1JET A;  2I6E A;  2VP1 A;  5DT6 A;  1RKM A;  2DWI A;  1B32 A;  3GLB A;  4GL8 A;  3TFL A;  3LR1 A;  4RPN A;  3TCG A;  2Z8F A;  4BDO A;  4F2O A;  1FQC A;  5H8S A;  4EXL A;  4F29 A;  3I5O A;  1MQJ A;  3PUW E;  2OWS A;  3O6H A;  1P1U A;  3CIJ A;  1FW0 A;  2QS2 A;  3MUQ A;  3PMW A;  1R9Q A;  3RLF E;  3SEX A;  5B7D A;  1B6H A;  4IGR A;  4Q0C A;  2PYY A;  2ALU A;  4DXC A;  2GHA A;  3OO9 A;  5CMC A;  4P0I A;  1LAH E;  1QUL A;  2E0S A;  3GXA A;  2P2A A;  5I56 A;  4QSC A;  4N6P A;  2O1L A;  4OVJ A;  2A5T B;  1J1N A;  3C31 A;  4R6Y A;  1SD3 A;  1MH4 A;  5CBR A;  5H8N A;  2HZK A;  1Y4T A;  4LZ5 A;  3UN6 A;  1FTO A;  4H8I A;  1US5 A;  2ZXT A;  1AH5 A;  2NUV A;  1LCT A;  1MPD A;  3F11 A;  3O28 A;  1P99 A;  4R72 A;  3PPO A;  1QKB A;  3Q25 A;  1M5E A;  3TTR A;  4KR5 A;  1VR5 A;  3TCF A;  3K02 A;  3FD3 A;  4H8J A;  3RTF B;  4R9G A;  3IJX B;  1IQ7 A;  4YKI A;  1Q35 A;  5L9S A;  4NWD A;  3D4C A;  3MC2 A;  1ZTY A;  3PUV E;  3MVZ A;  2IA4 A;  2VD2 A;  3TPA A;  2DXY A;  4F3S A;  2UVJ A;  1EU8 A;  1MXX A;  3LSX A;  3FVG A;  1MY3 A;  1JQF A;  1S9T A;  1B0H A;  5EYF A;  3HPI A;  2RCA A;  4ESW A;  1B3F A;  4R6K A;  3O6G A;  1A99 A;  4FAT A;  1JEU A;  3SES A;  3MP8 A;  3ZS6 A;  3RY3 A;  5AA4 B;  3HHF A;  3R6U A;  1LB9 A;  1QJM A;  2YPN A;  4L17 A;  4Q30 B;  4C1T A;  4OWD A;  5HM4 B;  4RNS A;  3E9X A;  3RN8 A;  3N94 A;  1TXF A;  3EPE A;  4DIG A;  3OOA A;  1LAF E;  2LAO A;  3TDJ A;  4Q8R A;  5ITP A;  1B52 A;  3K6V A;  4H0W A;  4U4X A;  3WAE A;  3G3I A;  4XKN A;  3DP4 A;  3TTN A;  5DEX A;  5KDT B;  3PPP A;  4NF5 B;  2O84 X;  2Y84 A;  2XXQ A;  5FTI A;  5FHN A;  2NVU B;  2XD3 A;  1KWH A;  3V8X B;  2QPQ A;  4H1X A;  4Z0I A;  3TEL A;  3P7I A;  1SBP A;  3RGY A;  4FEB A;  1DTZ A;  4PE5 B;  2DWH A;  2P0S A;  3FJ7 A;  5KCJ A;  4R2F A;  5F1Q A;  2G29 A;  2V84 A;  1B5J A;  2X7P A;  2FYI A;  2H99 A;  3EHU A;  3TQW A;  3TEP A;  4ISU A;  2R6G E;  4F18 A;  1FCK A;  4G68 C;  3A09 A;  2Z23 A;  4RPO A;  3GZG A;  4YZZ A;  3IOU A;  4LUB A;  2DWJ A;  3K1M A;  1IXH A;  4MFI A;  2V3U A;  3RT6 B;  2XXV A;  4GRK A;  2ZYM A;  4G8M A;  3OO7 A;  1OLC A;  4LQ5 A;  2UXA A;  1SI0 A;  4ZZA A;  1D3K A;  3O29 A;  1YAE A;  4FE8 A;  3ILU B;  4BDM A;  3QUJ A;  4ZED A;  2QS1 A;  2XX8 A;  4MF3 A;  1MXZ A;  1IIT A;  5TP9 B;  1RYX A;  3C32 A;  3ZSF A;  4R75 A;  3H6W A;  1PBQ A;  2UVG A;  1D9V A;  4OEN A;  3S9N C;  4EDP A;  4GL0 A;  1MPC A;  1CB6 A;  4QSE A;  1LLS A;  3W9V A;  1PC3 A;  2ZNU A;  4IO5 A;  5EHS A;  5ICT A;  2YJP A;  2Z8E A;  3D4G A;  4YKK A;  5CMB A;  2UYF A;  3O66 A;  3TMG A;  1XVY A;  1OIB A;  5EHM A;  4I8C A;  3UP9 A;  2NWJ A;  2FNC A;  3T9V A;  2REJ A;  1Y1M A;  2AL4 A;  3R7X A;  1BP5 A;  4XKQ A;  3CG3 A;  2VGQ A;  3MP1 A;  2F35 A;  4OZ9 A;  1O63 A;  4R74 A;  2Y7R A;  2V25 A;  4F2Q A;  1JW5 A;  4GOT A;  2V3Q A;  5H8H B;  1XOC A;  2F6P A;  4YAH X;  5H8Q A;  3IAZ A;  4I1D A;  4U4S A;  4YKJ A;  1UTH A;  5I57 B;  3K2D A;  4MLV A;  4TQU Q;  4YB5 A;  3Q28 A;  3SEY A;  5HBC A;  1NKX A;  2Z8D A;  3FAT A;  1AIV A;  3QYT A;  3S4U A;  4JBZ A;  3G3H A;  3VLW A;  2F6G A;  3M3K A;  1PEB A;  4G8H A;  1UTB A;  3K0V A;  4BLA A;  1BIY A;  2I58 A;  5I56 B;  1QUI A;  1MY2 A;  3PD8 A;  1PB8 A;  4P11 A;  1DSN A;  1B0L A;  4YIC A;  3B6T A;  2QRY A;  2GRV A;  1NNK A;  2Q8J A;  2I3W A;  2IEE A;  3IX1 A;  3H6T A;  3M8U A;  1XS5 A;  3LSW A;  5I58 A;  3T66 A;  2HAV A;  1PB7 A;  1Y3Q A;  4ONY A;  3IO6 A;  3PPR A;  3IJO B;  3U93 A;  3KOT A;  5H8F A;  4IB2 A;  3Q29 A;  3VDF A;  2REG A;  3TTK A;  4NF8 B;  3RNN A;  1T0K A;  4OQO A;  3SEW A;  3VVF A;  1B3E A;  1GV8 A;  3PPQ A;  1N04 A;  3TCH A;  4ZEK A;  2F8D A;  4X1B A;  4RYA A;  4FED A;  2OCU A;  3T93 B;  2PT1 A;  3HN0 A;  1FQF A;  3CRB A;  5TPA B;  2XXI A;  3IR1 A;  3PD9 A;  4JWY A;  1Y4C A;  2ZMB A;  3PV0 E;  1M5D A;  5A5X A;  1HSL A;  1IXI A;  3JV9 A;  4R9F A;  5CI5 A;  2F78 A;  1QUJ A;  4QFL A;  3CSB A;  1FQD A;  1B51 A;  1O7T A;  1ANF A;  2V93 A;  3T22 A;  1LB8 A;  1P1Q A;  3K00 A;  3K6W A;  3MVW A;  3OEL A;  4OEU A;  2PMS A;  4FJP A;  5JTY B;  4JDF A;  4KQP A;  2PX1 A;  2PT2 A;  3QK6 A;  3G3G A;  3KOS A;  4U22 A;  1XT8 A;  2Q2C A;  3UGW A;  3M3L A;  1SW2 A;  2ZYO A;  4AB5 A;  5KZT A;  1LFI A;  4NED A;  4OER A;  1B3G A;  4F1Y A;  5DVJ A;  4UA8 A;  1URG A;  3UK4 A;  4F3P A;  4KCD A;  1CE2 A;  2HXW A;  2H9B A;  3VFJ A;  4G68 A;  4JSD A;  2QSX A;  4KYE A;  4X9T A;  3V83 A;  2Y7W A;  4MH5 A;  3LSL A;  4H5F A;  4DLD A;  3C4M A;  3SEV A;  1A7L A;  4OET A;  2HAU A;  3IOV A;  1LCF A;  4ZZE A;  4NTL A;  2I4B A;  1OQH A;  1A54 A;  5I59 A;  4LA9 A;  4PFY A;  4RY1 A;  2DVZ A;  1R9L A;  3JZJ A;  1H45 A;  1OMP A;  2HEU A;  3QSL A;  4LVQ A;  4PP0 A;  2DE2 A;  3TYH A;  4H6D A;  1AL3 A;  4HS7 A;  3KGC A;  3C36 A;  1DPP A;  4OFO A;  2ONR A;  4DXB A;  1B7U A;  1SYI A;  2B65 A;  4PQJ A;  2OK2 A;  2I48 A;  2O68 A;  3LUY A;  4MBP A;  1VSO A;  4PFW A;  1I6A A;  5AE4 A;  3VV5 A;  1PB9 A;  2I4C A;  1MY1 A;  3T9H B;  1LFH A;  4LP2 B;  3HCQ A;  1NL5 A;  4QFP A;  3KSJ A;  5FTH A;  4GVO A;  4ZDM A;  2M8C A;  4U23 A;  2I49 A;  1MM6 A;  2A5S A;  4OMB A;  2HQ0 A;  3CR9 A;  3B6Q A;  4LAT A;  3VVD A;  1IZ1 A;  1TFD A;  3CFL A;  2XXH A;  1B3L A;  3Q27 A;  4HCW A;  3ZKL A;  4F19 A;  1URD A;  3R26 A;  3B6W A;  1DMB A;  5I2K A;  3TUS A;  2ONK E;  3OEN A;  3DP6 A;  3B7D A;  3G3F A;  4KD5 A;  3ODB A;  2F34 A;  4POX A;  5H8Q B;  2F5X A;  4M1V A;  2KLF A;  1H3D A;  1UTH B;  1UIV A;  2QJE A;  4ECF A;  4OFL A;  5L9M A;  1POT A;  4C1U A;  3U94 A;  1PDA A;  4E0X A;  4U1O A;  1FTJ A;  4F3B A;  2WKY A;  1D9Y A;  4PFT A;  1UTB B;  5CRY A;  1OVT A;  1B3H A;  4WKM A;  4KPT A;  1USY E;  4MLQ A;  1SQY A;  1NNT A;  3E4R A;  3KBR A;  2DYX A;  1JEV A;  3FAS A;  4BDL A;  1MDP 1;  2X7Q A;  5ICQ A;  5FHO A;  3H03 A;  2VHA A;  1A55 A;  2ZYK A;  3FVN A;  2XXX A;  1MRP A;  1IEJ A;  2XXR A;  3OEK A;  3SEU A;  3MVY A;  4C0R A;  4YMB A;  4GD5 A;  4G4P A;  4YB7 A;  1BLF A;  3BKI B;  1NMU A;  1JNF A;  2Y7P A;  3VVE A;  4H67 A;  3SER A;  1Z7M E;  3JYR A;  2A5T A;  3K6U A;  2H5Y A;  3KEI A;  4QFO A;  1H76 A;  3PUX E;  4BDR A;  3A3U A;  2RKM A;  2NOO A;  2F36 A;  1NH8 A;  1Y1Z A;  3IL1 B;  2Q9T A;  4DDD A;  3S9M C;  3SKP A;  1R1N A;  4R2B A;  1LBB A;  4GQO A;  1B7H A;  3OXN A;  2RIN A;  4EF2 A;  2BJJ X;  1VE4 A;  3U1O A;  4JSO A;  4IO3 A;  4O3C A;  4JWO A;  1MQH A;  5I84 A;  1MQI A;  1EH3 A;  5FHM A;  2F7A A;  2F7C A;  3HHG A;  2CZL A;  1NFT A;  1SVX B;  3OO6 A;  5L9O A;  5AA2 A;  1FTK A;  4OHN A;  2XHD A;  4IO7 A;  1LAX A;  1N3X A;  1N7X A;  4QFN A;  4KCC A;  3SDF A;  3U72 A;  1R6Z A;  1N7W A;  2XXT A;  2E1S A;  1SW5 A;  2I0B A;  3O9P A;  3IOR A;  4AQ4 A;  2DP8 A;  2DS9 A;  4DCX A;  1S7Y A;  2ESN A;  5M2V A;  3KFM A;  4QRZ A;  3C9H A;  4IO4 A;  1IXC A;  1RYO A;  2QMW A;  4IO2 A;  2HZL A;  2DXR A;  3KN8 A;  5AA4 A;  4EQB A;  1B05 A;  4G68 B;  1N84 A;  3PMX A;  1FQE A;  4FIM A;  3K1N A;  2ZNS A;  3V5A A;  1Y9U A;  2PVU A;  1D4N A;  3VXB A;  2QS3 A;  1I69 A;  2XXU A;  2HFB A;  4LQ2 A;  4M4G A;  2DOJ A;  4ZEF A;  4ZEI A;  5I2N A;  4YMA A;  4DZ1 A;  1B40 A;  3DLN A;  4THI A;  2THI A;  3EF7 A;  1ZKB A;  2B3F A;  4JB7 A;  3BBR A;  1P1O A;  4GXS B;  3OO8 A;  4POW A;  1QUK A;  2XXY A;  2ANJ A;  5KDT A;  1DPE A;  4WED A;  4E0W A;  4NF5 A;  5H8N B;  4IO6 A;  3TOD A;  1B4H A;  1ZBM A;  1NH7 A;  2O7U A;  1DTG A;  1TFA A;  3IOT A;  4ND9 A;  3KN3 A;  3UA8 A;  1ZIU A;  1ELJ A;  1B5H A;  3PPN A;  3QIM A;  4NF4 A;  3FZV A;  3FV1 A;  1PBP A;  3ONM A;  4EUO A;  4LZ7 A;  1N76 A;  3RTW B;  3U92 A;  4WEP A;  2Z22 A;  2O1M A;  2O69 A;  4ZE8 A;  2UYE A;  2UVI A;  3FJM A;  3MAM A;  1OQG A;  3OMB A;  2Y7I A;  3MZ1 A;  3E13 X;  3ILT B;  1FTL A;  1IIW A;  2AYS A;  3MBP A;  3MQ9 A;  2XXP A;  3L6H A;  1SI1 A;  1MXW A;  4NMY A;  4TLM B;  1F9B A;  5ELV A;  3FXQ A;  5TP9 A;  1LAG E;  4G77 A;  3C33 A;  3MWB A;  3CVG A;  1WDN A;  4DCY A;  1SDX A;  2X26 A;  1URS A;  4IGT A;  1GR2 A;  5AA3 A;  1BKA A;  3LBS A;  4GIZ A;  1P1W A;  3MVX A;  2OZZ A;  5IKB A;  3ECR A;  1JW4 A;  4EQ7 A;  4OEV A;  4EF1 A;  4RJZ A;  3N6T A;  5ISU A;  3PU5 A;  2XX9 A;  3G3J A;  2G93 A;  1B1X A;  4KYD A;  4RK2 A;  2R71 A;  3H6V A;  3RT8 A;  5DEX B;  1OVB A;  1FTM A;  3KSX A;  2RC7 A;  2OWT A;  2I3V A;  4N07 A;  3KG2 A;  3Q26 A;  4JXI A;  5H8H A;  3VLV A;  3C35 A;  3FXU A;  3TTM A;  1POY 1;  5I57 A;  2FA7 A;  4FEC A;  5CBS A;  5KCJ B;  1FQB A;  1EZO A;  2O7I A;  1SW1 A;  3USD A;  3TZA A;  1JW1 A;  4AB6 A;  2XD2 A;  4HTG A;  5K2X A;  3FIR A;  2DQV A;  4XKR A;  5DYH A;  4U21 A;  1B46 A;  2H98 A;  1YCJ A;  3HST A;  3K1P A;  4N13 A;  4NWC A;  3OEM A;  3N6U A;  1LBC A;  4F3G A;  3PUY E;  1BTJ A;  1FQA A;  1I6B A;  1GGG A;  3DP8 A;  1A8F A;  3BFT A;  4OYV A;  1YPN A;  2R9J A;  4BDN A;  1B58 A;  3K4U A;  5AA1 A;  4ELO A;  2ZYN A;  2QL3 A;  4G8N A;  1XHY A;  4X1D A;  4BDQ A;  2QS4 A;  1EZP A;  4NF8 A;  5BUU A;  3MPL A;  3GBA A;  2I0C A;  5AA2 B;  2CMO A;  3FV2 A;  3C34 A;  4X48 A;  5F7V A;  4NF6 A;  5TPA A;  2HCA A;  3M3F A;  1MDQ A;  2OLB A;  2DWA A;  3MZB A;  1SW4 A;  3OD7 A;  1A8E A;  2O6A A;  2D3I A;  4ZE9 A;  3HO7 A;  4ELQ A;  3UIF A;  1ZJL A;  3MP6 A;  3RQT A;  5K2Y A;  4F1U A;  2UVH A;  3MW0 A;  3TKD A;  1B5I A;  2RC8 A;  4JWX A;  1O64 A;  3FUZ A;  2ZNT A;  3HV1 A;  3T9X B;  4UAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...