2Q88A

Crystal structure of ehub in complex with ectoine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
257
structure length
257
Chain Sequence
RDENKLEELKEQGFARIAIANEPPFTAVGADGKVSGAAPDVAREIFKRLGVADVVASISEYGAMIPGLQAGRHDAITAGLFMKPERCAAVAYSQPILCDAEAFALKKGNPLGLKSYKDIADNPDAKIGAPGGGTEEKLALEAGVPRDRVIVVPDGQSGLKMLQDGRIDVYSLPVLSINDLVSKANDPNVEVLAPVEGAPVYCDGAAFRKGDEALRDAFDVELAKLKESGEFAKIIEPYGFSAKAAMSTTREKLCAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ABC transporter amino acid-binding protein
publication title Crystal structure of the ligand-binding protein EhuB from Sinorhizobium meliloti reveals substrate recognition of the compatible solutes ectoine and hydroxyectoine.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transport protein
total genus 81
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2007-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2q88A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2q88A02
1LFIA 4NF8B 1MY4A 3TQLA 4GLIA 2REJA 4NF4A 2DVCA 4HS7A 3HSTA 4YB7A 2XD2A 1MS7A 1SQYA 4G4PA 3HCQA 4PE5B 1XC1A 2Y84A 3TZAA 5CMMA 4BDMA 4KYDA 4GRKA 5AA4A 4XIGQ 1N3XA 2V93A 5BUUA 3TKDA 3O29A 2DVZA 4PFUA 3QK6A 5I56B 2ZMBA 3UP9A 5KCJA 2GFEA 5L8DA 4OVJA 1UIUA 3C36A 4RK2A 2PT2A 4R74A 3RTWB 4C1UA 3K01A 1UTHA 4XKRA 4QFKA 4OXVA 4AB5A 3CIJA 3KEIA 5ITOA 1FQCA 1POY1 5ICQA 4OMBA 1P1OA 2YLNA 3PPPA 1SYHA 1LSTA 4R72A 2KLFA 1MXZA 3Q26A 3IOUA 3OO8A 1VR5A 3PPNA 5H8HB 4PFTA 2UVHA 5FHMA 1BKAA 3FATA 4F29A 3WAFA 1FTOA 2H5YA 4JB7A 1YPNA 4KD5A 3V8XB 1AH5A 2ONRA 3UN6A 2QSXA 3AXFA 2DE2A 2R9JA 4TLLB 2PVUA 1NH7A 4KFQA 2Q2CA 1HSJA 3L6GA 2O7UA 1LAXA 1PEBA 1P99A 1BLFA 4G2ZA 4UA8A 3KN8A 5FTHA 2UYEA 3IO6A 5I58A 5I57A 3PUVE 1PBPA 4MFIA 1IITA 3VLWA 3UIFA 2O6AA 2HAUA 5HPQA 2AL4A 2H25A 2UYFA 4R2BA 5FHNA 1URDA 3T9VA 3HHGA 4GXSB 3S9NC 4OENA 3TCFA 3VV5A 2DQVA 1NFTA 2HFBA 2XXWA 3MPLA 4NWCA 4F1YA 4H8IA 3BBRA 3ZKKA 2V25A 2E1SA 3A3CA 2ZNTA 2ZYOA 2I3WA 1LCFA 1ELJA 3DP4A 2ANJA 1IXHA 3SETA 1OVTA 4MH5A 1JVYA 2QPQA 4DDDA 3UA8A 3MZ1A 3A09A 2F97A 3FVOA 2ZYNA 2DWJA 1TFDA 3C31A 3MVZA 4GFRA 4BDLA 3IOTA 3ZKLA 3M3KA 4QSEA 2ZYKA 3BKIB 2RF1A 1TWYA 3HHFA 5F7VA 3K4UA 5EHMA 3IJXB 2WKYA 5HM4B 1XOCA 3K2DA 4WKMA 4KI0E 2I48A 4R9FA 4PP0A 2IA4A 4M4GA 3QAXA 4YB6A 3FJ7A 3PPRA 1A8FA 3G3GA 3KOSA 1FTJA 1ZIUA 1ZLQA 3Q25A 4NE4A 3PUXE 2GHBA 3OO7A 1MG1A 3IORA 4H5FA 2DE3A 1M5FA 1AMFA 1VE4A 1SW5A 1EU8A 4ESXA 4GL0A 1D3KA 1FTKA 2Q88A 1B3FA 2OK2A 3EF7A 4YICA 3FASA 4OFJA 4QRZA 2XXRA 3OD7A 1B6HA 4YB5A 4IO6A 1IXGA 1FQBA 3H6WA 4TOZA 2ZNUA 2HZLA 1OQHA 4L17A 5CMKA 3KN7A 2Y7KA 3KJ7A 4ZEBA 5FTIA 1R6ZA 5TU0A 3U72A 5H8NB 2I58A 3C9HA 4OERA 1NMUA 3OENA 3VVFA 3E3KA 3LSWA 1Y20A 3VVEA 5EHSA 1LCTA 1ZU0A 1DTGA 4IO2A 3MVXA 4ZS9A 5I2NA 1S9TA 1USYE 1MDQA 3GXAA 1FQAA 4QF9A 1QJMA 1SI0A 3S9LC 3O97A 4EDPA 3G7WA 5CMBA 3VLUA 4OWDA 3T9UA 1OLAA 3B6QA 3S9MC 1D9VA 4I1DA 5IAIA 1B51A 3VXCA 3SESA 3T9XB 3JYRA 1ANFA 1MRPA 5B70A 2VOZA 2OJTA 5DVJA 4YKJA 4KPTA 5BWJA 1YTVA 2VGQA 3IJOB 5TP9B 5M2VA 3QSLA 3OO9A 3TEPA 3USDA 1ZTYA 1RYOA 2XXIA 1YAEA 4MF3A 1I6QA 2I0CA 3MVYA 1B2HA 4GXAA 5ISUA 4IY6A 5CI5A 1MQGA 5AE4A 1B7ZA 4WEDA 1MXXA 1M5DA 1URGA 1B5IA 2OZZA 2PYYA 4HCYA 4H5GA 4Q5TA 1Y1MA 2B65A 3RUMA 3TYHA 4QFLA 1B05A 3H7MA 1PDAA 4P0GA 3KZGA 3P7IA 2OWSA 4RY1A 1AIVA 1HSEA 5ELVA 3TAJA 3Q29A 1DMBA 2PBWA 4EF1A 2H4IA 3H06B 1B1HA 3EHSA 5DVFA 3C4MA 3CG3A 3CI8A 4YKKA 4DXBA 4IO7A 4F3SA 3TFLA 2F8DA 2D21A 2ESNA 1HSLA 4H1XA 4THIA 3SEUA 2Y7RA 4C0RA 4EXLA 1I69A 2VHAA 4IGRA 1DTZA 3RPWA 4X9TA 4U4XA 1IXIA 1CE2A 4FATA 3TQWA 1LBBA 1MXYA 3ODBA 2DE4A 3CG1A 4F2QA 5H8SA 1BP5A 3IB0A 4X48A 2DSFA 1WDNA 4ZEFA 2PMSA 2RINA 2XXUA 1O7TA 5FHOA 2V3TA 4U2RA 1LB9A 2Z8DA 3N6UA 3DLNA 3H3GA 1N7WA 4OFLA 2Z23A 3TMGA 1FQFA 3G3HA 4QFPA 4DIGA 3RGYA 3N26A 4ZEIA 5TPAA 4EUOA 4FEBA 1H3DA 4YU0A 5H8FB 3ZSFA 1YCJA 5DEXA 3N5LA 4U1OA 2E0SA 2UVIA 1XVXA 1EZ9A 2DOJA 5K2XA 2GRVA 5H8QA 1UQWA 4LZ5A 2AL5A 1JEUA 3B6TA 5L9OA 1B9JA 2Y7PA 3W15C 2Q9TA 2HEUA 1QKAA 2DP8A 2IEEA 1H76A 3PUWE 3MPKA 2QS1A 3ZS6A 3OSQA 3TDJA 1LB8A 2XXHA 3TTKA 3VE1B 3CFXA 5I59A 4Q8RA 3GLBA 4POWA 1EH3A 1ATGA 4YMBA 1JVXA 1FTMA 4ESWA 1MQIA 1USYH 5I2KB 2UVGA 2F36A 2O1MA 4PQJA 1JNFA 4M1VA 2RC7A 1AL3A 4NTLA 3LSLA 3MJNA 4GOTA 1T0KA 2BJJX 4DZ1A 4K3FA 2VD3A 4PETA 4G68C 4BLAA 5KDTA 2AYSA 1B3HA 4HTGA 3K0VA 3M3LA 3W9WA 3U93A 3G3JA 3MC2A 2XX8A 1Z7ME 1FTLA 2NXOA 2OBGA 4F1UA 1N7XA 1XT8A 4LVQA 1Y4CA 4ZE8A 5KZTA 3ILTB 1UTBA 1DOTA 4ZZEA 3SERA 4DXCA 2PX1A 4JWXA 1GGGA 2ABHA 3W9VA 2R6GE 1OIBA 3TODA 1QULA 5AA2A 3PUZE 2A5TB 3MZBA 2A5SA 3FD3A 2F5XA 2O84X 2F34A 4F2OA 3QXMA 3N6TA 4RA1A 3TTMA 5A5XA 1R1NA 1B32A 1MXUA 2UVJA 3IB2A 4NF4B 4I9DA 1P1WA 1MQDA 1R9QA 1M5BA 4XXUA 3UORA 1VFEA 1B4ZA 2QRYA 2Z8EA 3RQTA 3FXUA 4I8CA 1VSOA 3RLFE 5AA4B 5IKBA 1GV8A 2X7QA 3OSRA 1I6AA 2D3IA 3R6UA 1URSA 3K6XA 3OXNA 5KCJB 4ND9A 3E13X 3BFTA 4RK9A 1B4HA 2NWJA 4NF5A 3V89B 2QMWA 3G3FA 1UTHB 1QUJA 3LSXA 4UACA 1EZPA 4G68A 3GBBA 4LZ7A 2OWTA 2DWAA 2HCAA 1OLCA 5LOMA 4JXIA 3O66A 2X26A 1FQEA 4F39A 2Q2AA 4ZE9A 4IY5A 5HBCA 1LGBC 4IB2A 3F11A 4P0IA 1JW1A 2RKMA 4DCYA 1MXVA 3KFMA 1MPBA 3SKPA 2ALUA 4KQPA 1LAFE 4PFWA 1LFGA 2O68A 1SBPA 5CBSA 2I4CA 1D9YA 2O69A 3RT8A 1MY1A 3MUQA 4H8JA 3KOTA 5JTYA 2HQ0A 5CBRA 3FUZA 4NMYA 1TT1A 2RC8A 4QSCA 3LSFB 3TPAA 1JW5A 2I4BA 2RCAA 4LONB 4NF8A 1DPPA 3O6HA 1IUDA 1Q1KA 4F18A 2ONKE 4U4SA 4GF8A 2P2AA 4LZ8A 2R71A 4MLQA 2O1LA 2QS4A 4GIZA 2I3VA 2H99A 4NEDA 3K6UA 3U1OA 3FJMA 3EHUA 2Q8JA 4GL8A 5I56A 1MQJA 2V3QA 2F6PA 3B7DA 2OCUA 5I58B 5I57B 1B0HA 3CSBA 1TFAA 4YAHX 1MY3A 1J1NA 2V3UA 1SI1A 1M5CA 3O9PA 3FXQA 3Q28A 3SDFA 1GR2A 1Y3QA 4RPOA 4KCDA 4DE8A 4F3BA 3DP6A 1F9BA 3CVGA 2VP1A 3MBPA 3PMXA 3FV2A 4LQ2A 4E0XA 3EPEA 4H6DA 3KSXA 4GVOA 3QYTA 3MP6A 1M5EA 2O7IA 1NL5A 5H8HA 3ONMA 1A54A 4JWOA 1PB9A 2XXXA 2OLBA 4EQ9A 3K1PA 4LQ5A 3IB1A 1QVSA 1B7UA 3KJTA 3H6TA 3IOWA 4I62A 3VDFA 1NNFA 2CMOA 2FA7A 3T96B 4EQ7A 2QS2A 1N84A 1N0TA 2DYXA 3MAMA 3O6IA 5F1QA 1A8EA 1R9LA 2XXPA 1NNKA 3SEWA 4MLVA 2P0SA 4R9GA 1LBCA 2XHDA 4R6YA 4U1ZA 3TUSA 3K00A 3O6GA 1Y1ZA 4H0WA 3FIRA 3H6UA 1ZJLA 4ZECA 2THIA 1Y4TA 1FCKA 1A99A 4FIMA 1DSNA 4O3BA 3I6VA 4R2FA 5L9MA 4NF6B 1XVYA 4KYSA 4Z7EA 4YKPA 3MP1A 4RPNA 3S4UA 3TCGA 3H6VA 3VVDA 1P1UA 3H03A 4POXA 1WVJA 1H43A 4ZDMA 1IIWA 1Z7NE 4ZZAA 3ECRA 4FECA 4KHZE 4OESA 2NUVA 3S2VA 3TCHA 2NVUB 3V5AA 3UK4A 4FJPA 3UGWA 2QL3A 3K6VA 4R6KA 3M3FA 4X1DA 2B3FA 5AA3A 1B0LA 2GH9A 4LP2B 3I5OA 1AOVA 1PB8A 4R73A 5AA2D 5I2NB 1IEJA 4JDFA 3HO7A 2LAOA 1MM6A 4FORA 4P11A 4OFOA 1Y9UA 1N04A 3O2AA 1QW0A 1SD3A 2VD2A 2DXRA 4IO3A 1Q35A 2G29A 4YZZA 1NNPA 1B7HA 3OO6A 1H44A 2Q89A 4DXUA 1MXWA 3IAZA 3PV0E 4GD5A 3MZ9A 3M8UA 2XX7A 4Q30B 4RJZA 3RN8A 3IK6B 4R75A 5J1DA 3WAEA 3H4ZA 4ONYA 3MVWA 3RNNA 1B46A 3U92A 2PT1A 3N94A 2Y7WA 1MPDA 2X7PA 2XXQA 1B58A 4ELPA 4F1VA 3IO4A 4GWOA 2I6EA 3ILUB 5EYFA 4PFYA 1JETA 1O64A 4JWYA 3KGCA 4QHQA 3R26A 4RXLA 1US5A 5B7DA 1PBQA 3BFUA 4BDRA 3D4CA 3C34A 5CRYA 1ZBMA 3CRBA 2F7BA 2QMXA 3FZVA 4O3CA 4EXKA 4LUBA 5H8NA 1IQ7A 4OYVA 1JW4A 3JZJA 4JSOA 4O3AA 4KR5A 1B5JA 1P1NA 4BDNA 1LFHA 3O28A 2ZXTA 2DXYA 2HAVA 4G77A 4TQUQ 3CFZA 1SW1A 4AQ4A 3SEYA 5ITPA 5JK4A 4MBPA 4DCXA 3T9HB 4G8NA 1B3LA 3MQ9A 3VXBA 1MM7A 4QSDA 2H98A 5L9SA 2XXVA 1BTJA 3HV1A 3TTLA 4FAJA 3FXRA 3G3KA 1SVXB 1N3WA 1Y3NA 3TTNA 3R7XA 3GZGA 4BDQA 3IL1B 4G8HA 2CZLA 3PU5A 3SEVA 4H67A 4U22A 5DT6A 3RY3A 3PPOA 5TP9A 4RNSA 4OEVA 4N6PA 3PMWA 3LUYA 4X1BA 3CR9A 4TLMB 1MY2A 3RT6B 1US4A 5TPAB 1POTA 1S7YA 1QUIA 4F3PA 3JV9A 1EZOA 2FNCA 3GBAA 2XXTA 2GHAA 1PB7A 5DEXB 4EQBA 2ZYMA 4F19A 4QFNA 1DPEA 3MP8A 1OMPA 2ZNSA 5H8QB 4U23A 2XD3A 2NOOA 3C33A 4N07A 3THIA 1SDXA 5K2YA 3SEXA 3FGSA 4OETA 3G3IA 3RTFB 1A40A 4ECFA 1I6BA 4HCWA 1JQFA 3FVGA 1II5A 1P1QA 1LAHE 1LLSA 1XS5A 3T22A 3U8QA 5DVIA 5I59B 4XKNA 1FW0A 1LAGE 2HXWA 1B3GA 1H45A 2O51A 4F3GA 1SW2A 1TXFA 3EN3A 4H65A 4KCCA 2XXYA 4OTEA 1KWHA 4QFOA 5DTBA 1MY0A 5I84A 5AA1A 4ZEKA 4U21A 3MW0A 1B1XA 2W7YA 3C32A 4LA9A 1GVCA 1BIYA 3LBSA 1JEVA 3PPQA 3PGFA 4Q0CA 4E0WA 1ZMGA 3IX1A 2DWHA 4NF6A 1XHYA 1ZKBA 2F7CA 3OEKA 3OOAA 4OEUA 4DLDA 2YJPA 5CMCA 5KDTB 3OEMA 1QUKA 3CFLA 2DS9A 4JSDA 3V83A 2V84A 3Q27A 4N13A 2REGA 3A3UA 1B40A 1IXCA 2D5WA 2RC9A 4ISUA 3HPIA 2Y7IA 5CM6A 3S9EA 2I49A 2AIXA 2B3BA 4OQOA 2UXAA 2H9BA 1A7LA 1PC3A 3L6HA 3OELA 3PUYE 4ELOA 3CSGA 1QKBA 4RYAA 5H8FA 1MDP1 1UTBB 4GQOA 1RKMA 3QUJA 1MH4A 3TTRA 3LR1A 1NKXA 2F78A 2F6GA 2F7AA 1B52A 1CB6A 3E4RA 5JEIA 1A55A 5AA2B 1MQHA 3FVNA 1UIVA 3FV1A 3PD9A 3EQ1A 3PD8A 1O63A 1OVBA 3DM0A 3LC8A 4F31B 4BDOA 1B5HA 5A5XB 2Z8FA 4NWDA 4Z0IA 4XKQA 2QS3A 3K6WA 3VLVA 4IO5A 4OZ9A 1WODA 4FE8A 1RYXA 4YMAA 3FVKA 4JBZA 4R6HA 1GTKA 3OMBA 4OHNA 5I2KA 3U94A 3KG2A 2QJEA 4YKIA 3C35A 4HW8A 1SW4A 3IOVA 4EF2A 4ELQA 1Y3PA 3DELB 4NF5B 2XX9A 1OQGA 4AB6A 2F35A 4XTCQ 2I0BA 3HN0A 3QIMA 2Z22A 1NNTA 3B6WA 3QUFA 3K1NA 4G68B 3PMVA 3E9XA 4KYEA 4ELRA 3DP8A 2YPNA 3K02A 3K1MA 5ICTA 1MH3A 1B3EA 3KN3A 4G8MA 1VFDA 3I3VA 2ONSA 4IO4A 4WEPA 4F22A 1SYIA 4WXJA 2G93A 4LATA 3D4GA 2DWIA 3EHTA 2RCBA 2FYIA 4ZEDA 3KSJA 2M8CA 1MPCA 3KBRA 4XKPA 4IGTA 1NH8A 3FJGA 2P1SA 3IR1A 3VFJA 4FEDA 5CC2A 3T66A 1N76A 5JTYB 5DYHA 2HZKA 1IZ1A 1FQDA 1S50A 2A5TA 1D4NA 1L5TA 4C1TA 3MWBA 3T93B 3TELA
chains in the Genus database with same CATH superfamily
1LFIA 4NF8B 3A29A 1MY4A 3TQLA 4GLIA 2REJA 4NF4A 5EQ7A 2DVCA 4HS7A 3HSTA 4YB7A 2XD2A 1MS7A 1SQYA 4G4PA 3HCQA 4PE5B 1XC1A 2Y84A 4X04A 3TZAA 5CMMA 4BDMA 4KYDA 4GRKA 5AA4A 4XIGQ 2FIXA 1N3XA 2V93A 4N4UA 5BUUA 3TKDA 3O29A 2DVZA 4PFUA 3QK6A 5I56B 2ZMBA 3UP9A 5KCJA 2GFEA 5L8DA 4OVJA 1UIUA 3C36A 4PDHA 4RK2A 2PT2A 4R74A 3RTWB 4C1UA 2PFZA 3K01A 1UTHA 4XKRA 4QFKA 2ZZXA 4OXVA 1SPIA 4AB5A 3CIJA 1G0HA 1NUWA 3RPLB 1IMDA 3KEIA 5ITOA 1FQCA 1VDWA 1POY1 5ICQA 4OMBA 2CZKA 1P1OA 2YLNA 3PPPA 1FBDA 1SYHA 1LSTA 1FPEA 5A5LA 4R72A 4QBAA 2KLFA 1MXZA 3Q26A 4PBHA 3IOUA 2Q8MA 3OO8A 2B4MA 5LDZA 1VR5A 4GWZA 3PPNA 5H8HB 4PFTA 2HHMA 2UVHA 4AS4A 5FHMA 1BKAA 3FATA 4F29A 3WAFA 1FTOA 2H5YA 3E79A 4JB7A 1YPNA 4KD5A 3V8XB 4IR8A 1AH5A 2ONRA 3UN6A 2QSXA 3AXFA 2DE2A 1YYZA 2R9JA 4TLLB 2PVUA 1NH7A 4KFQA 2CZHA 3B50A 4O7MA 2Q2CA 5I7IA 1HSJA 3L6GA 1EYJA 2O7UA 1LAXA 1PEBA 4PE3A 1LEVA 1P99A 1BLFA 4G2ZA 4UA8A 3KN8A 5FTHA 2CEYA 2UYEA 3IO6A 5I58A 5I57A 3PUVE 1FPIA 1PBPA 4MFIA 1IITA 3VLWA 3UIFA 2O6AA 2HAUA 5HPQA 2AL4A 2H25A 2UYFA 4R2BA 5EYHA 5FHNA 1FBFA 1URDA 3T9VA 3HHGA 4GXSB 3S9NC 4OENA 3TCFA 3VV5A 2DQVA 1NFTA 2HFBA 2XXWA 3MPLA 4NWCA 4F1YA 4H8IA 3BBRA 3ZKKA 2VPOA 2V25A 2E1SA 1G0IA 3A3CA 2OWZA 2ZNTA 2ZYOA 2BJIA 4MJOA 2I3WA 4GBVA 1LCFA 1ELJA 3DP4A 2ANJA 4P8BA 1IXHA 4PF8A 3SETA 1OVTA 4MH5A 1JVYA 2QPQA 4DDDA 3UA8A 3MZ1A 3A09A 2F97A 4GWYA 3FVOA 2ZYNA 2DWJA 1TFDA 3C31A 3MVZA 4GFRA 4MAGA 4BDLA 3IOTA 3ZKLA 3M3KA 4QSEA 2ZYKA 3BKIB 2RF1A 1TWYA 3HHFA 5F7VA 3K4UA 4DI4B 5EHMA 3IJXB 2WKYA 2WBBA 5HM4B 1XOCA 3K2DA 4WKMA 4KI0E 2I48A 4R9FA 4PP0A 5J16A 2IA4A 4M4GA 3QAXA 4YB6A 3FJ7A 3PPRA 1A8FA 3G3GA 3KOSA 1NV3A 1FTJA 1NV2A 1ZIUA 1ZLQA 3Q25A 4NE4A 1YZ0A 4PFRA 3PUXE 2GHBA 3OO7A 2Q74A 1MG1A 3IORA 4H5FA 2DE3A 1M5FA 1AMFA 1VE4A 1SW5A 1EU8A 4ESXA 4GL0A 1D3KA 1FTKA 2Q88A 1CNQA 1B3FA 1BK4A 2OK2A 3EF7A 4YICA 4PDDA 4OVPA 2WYPA 3FASA 4OFJA 4QRZA 2Y5KA 2XXRA 3OD7A 1B6HA 4YB5A 4IO6A 1IXGA 1FQBA 3H6WA 4TOZA 2ZNUA 4N6DA 2HZLA 5EQ8A 1OQHA 4OVQA 1RDYA 4L17A 5CMKA 3KN7A 4O94A 2CZIA 2Y7KA 3KJ7A 4ZEBA 5FTIA 1R6ZA 5TU0A 3U72A 2QVUA 5H8NB 5ET8A 2I58A 3C9HA 4OERA 1NMUA 3OENA 3VVFA 1FPLA 3E3KA 3LSWA 1NI9A 1Y20A 3VVEA 4XFEA 5EHSA 1LCTA 1ZU0A 4N91A 1LBYA 1DTGA 4IO2A 3MVXA 4ZS9A 5I2NA 1S9TA 1USYE 1MDQA 3GXAA 1FQAA 4QF9A 1QJMA 1FPKA 1SI0A 3S9LC 3O97A 4EDPA 3G7WA 5CMBA 3VLUA 4OWDA 3T9UA 1OLAA 3B6QA 3S9MC 1D9VA 4I1DA 5IAIA 1B51A 3VXCA 3SESA 3T9XB 3JYRA 1ANFA 1MRPA 5B70A 2VOZA 2OJTA 5DVJA 4YKJA 4KPTA 5ET6A 5BWJA 1YTVA 2VGQA 3IJOB 5TP9B 5M2VA 3QSLA 3OO9A 3TEPA 3USDA 1ZTYA 1RYOA 2XXIA 1YAEA 4MF3A 3KBZA 1I6QA 2I0CA 3MVYA 1B2HA 4GXAA 5ISUA 4IY6A 5CI5A 1MQGA 5AE4A 1B7ZA 4WEDA 1FJ6A 1MXXA 1M5DA 1URGA 1B5IA 5ET7A 2OZZA 2PYYA 4HCYA 4H5GA 4Q5TA 2JJKA 1Y1MA 2B65A 4NQ8A 3RUMA 3TYHA 4QFLA 1B05A 1NV6A 4PAIA 2XWOA 3H7MA 1PDAA 4P0GA 3KZGA 3P7IA 5DW8A 2OWSA 4RY1A 1AIVA 1HSEA 5ELVA 3TAJA 3Q29A 1DMBA 2PBWA 4EF1A 2H4IA 3H06B 1B1HA 3EHSA 5DVFA 3C4MA 3CG3A 3CI8A 4YKKA 2WYKA 4DXBA 4IO7A 4F3SA 5IGAA 3TFLA 2F8DA 2D21A 2ESNA 1HSLA 4H1XA 4THIA 1NUYA 4NAPA 3SEUA 2Y7RA 2XWKA 4C0RA 4EXLA 1I69A 2VHAA 1FPBA 1IMFA 4IGRA 1DTZA 1EYIA 2DDKA 5EQ9A 3RPWA 4X9TA 4U4XA 1IXIA 1CE2A 2QVVA 4FATA 3TQWA 4NHBA 1LBBA 1MXYA 3ODBA 4OVRA 2DE4A 3CG1A 4F2QA 2PCRA 5H8SA 1BP5A 3IB0A 4X48A 2DSFA 1WDNA 4ZEFA 2PMSA 2RINA 2XXUA 1O7TA 5FHOA 2V3TA 2Y5LA 4GWSA 4U2RA 5I5PA 1LB9A 2Z8DA 3N6UA 3DLNA 3H3GA 3SZPA 1N7WA 4OFLA 2CEXA 2Z23A 3TMGA 1FQFA 3G3HA 4QFPA 4MNPA 4DIGA 3RGYA 3N26A 4ZEIA 1NV5A 5TPAA 4EUOA 4FEBA 1H3DA 4YU0A 5H8FB 3ZSFA 1YCJA 5DEXA 3N5LA 3EKIA 4U1OA 2KR0A 2E0SA 2UVIA 1XVXA 1EZ9A 2DOJA 5K2XA 2XXKA 2GRVA 5H8QA 1UQWA 4LZ5A 2AL5A 1JEUA 3B6TA 5L9OA 4P1EA 1B9JA 2Y7PA 3W15C 2Q9TA 2HEUA 1QKAA 2DP8A 2IEEA 1H76A 3PUWE 2FHYA 3MPKA 2QS1A 5IZ3B 3ZS6A 3OSQA 3TDJA 1LB8A 2XXHA 3TTKA 3VE1B 3CFXA 5I59A 4Q8RA 4POWA 3GLBA 1EH3A 4JVCA 1ATGA 4YMBA 1JVXA 1FTMA 4ESWA 1MQIA 1USYH 5I2KB 4MEVA 2UVGA 2F36A 2O1MA 4PQJA 1NUZA 1JNFA 4M1VA 2RC7A 1AL3A 1DBZA 4P56A 4NTLA 3LSLA 3MJNA 4GOTA 1T0KA 2BJJX 1IMEA 4DZ1A 4HE2A 4K3FA 2VD3A 4PETA 4G68C 4BLAA 5KDTA 2AYSA 4P1LA 1B3HA 4HTGA 4PFIA 4N6KA 3K0VA 3M3LA 3W9WA 3U93A 3G3JA 3MC2A 2XX8A 1Z7ME 1FTLA 2NXOA 2OBGA 4F1UA 1N7XA 1XT8A 4UABA 4LVQA 1Y4CA 4ZE8A 5KZTA 3FXBA 3ILTB 1UTBA 3KC1A 1DOTA 2QFLA 2XWIA 4ZZEA 3SERA 4DXCA 2PX1A 4JWXA 1GGGA 2ABHA 4PGNA 3W9VA 2R6GE 1OIBA 3TODA 1QULA 5AA2A 3PUZE 2A5TB 3MZBA 2A5SA 3FD3A 2F5XA 2O84X 5ET5A 2F34A 4F2OA 3QXMA 3N6TA 1FPJA 4RA1A 3TTMA 5A5XA 1R1NA 1B32A 1MXUA 2UVJA 3IB2A 4NF4B 4I9DA 1P1WA 4NGUA 1MQDA 4I40A 1R9QA 3U65A 1K9YA 1M5BA 4XXUA 3UORA 1VFEA 1B4ZA 2QRYA 2Z8EA 3RQTA 3FXUA 4I8CA 4I3YA 1LBZA 1VSOA 3RLFE 5AA4B 5IKBA 1GV8A 4PTKA 2X7QA 2QVRA 3OSRA 1I6AA 2D3IA 3R6UA 1RDZA 1URSA 3K6XA 3OXNA 5KCJB 4ND9A 1IMBA 4KXPA 3E13X 3BFTA 4RK9A 1B4HA 2NWJA 4NF5A 1FPGA 3V89B 2QMWA 3G3FA 3T0JA 4N8YA 1UTHB 1QUJA 3IFAA 3LSXA 4UACA 1EZPA 4G68A 3GBBA 4LZ7A 2OWTA 2DWAA 2FBPA 2HCAA 1OLCA 5LOMA 4JXIA 3O66A 2X26A 1FQEA 4F39A 2Q2AA 4ZE9A 4IY5A 5HBCA 1LGBC 4IB2A 3F11A 4P0IA 4DI3D 1JW1A 2RKMA 4DCYA 1KA1A 1MXVA 1FPFA 3KFMA 1MPBA 2FVZA 3SKPA 2ALUA 1FBEA 4KQPA 1LAFE 4PFWA 1LFGA 1XI6A 2O68A 1KA0A 1SBPA 5CBSA 2I4CA 1D9YA 2O69A 3RT8A 1MY1A 3MUQA 2VPNA 3D1RA 4H8JA 3KOTA 5JTYA 2HQ0A 5CBRA 3PTYA 4GWWA 3FUZA 4NMYA 4PCDA 1TT1A 1YXIA 2RC8A 4QSCA 3LSFB 3TPAA 1JW5A 2I4BA 2RCAA 4LONB 4NF8A 4OANA 1DPPA 3O6HA 1IUDA 2F3DA 1Q1KA 4F18A 2ONKE 4U4SA 4GF8A 2P2AA 4LZ8A 2R71A 4MLQA 2O1LA 2QS4A 1NV0A 4GIZA 2I3VA 4H46A 2H99A 3RYDA 2KQZA 4NEDA 5EQAA 2OX3A 3K6UA 3U1OA 3FJMA 3EHUA 2Q8JA 2V4CA 4GL8A 4OA4A 5I56A 1MQJA 2V3QA 2F6PA 1LBWA 3B7DA 2OCUA 5I58B 5I57B 1B0HA 3CSBA 1K9ZA 1TFAA 2XA5A 3ISPA 4YAHX 3IFCA 1MY3A 1J1NA 4O7IA 4N15A 5LTCA 2V3UA 1SI1A 1M5CA 3O9PA 3FXQA 3Q28A 3SDFA 1GR2A 1IMCA 3RPLA 1Y3QA 4RPOA 4KCDA 4DE8A 4F3BA 3DP6A 1F9BA 3CVGA 2VP1A 4GWXA 3MBPA 3PMXA 3FV2A 4LQ2A 4E0XA 4GX4A 3EPEA 4H6DA 3KSXA 4GVOA 3QYTA 5EYGA 3MP6A 1M5EA 1LBXA 4PGPA 2O7IA 1NL5A 5H8HA 3ONMA 1A54A 2L5VA 4JVDA 4JWOA 1PB9A 2XXXA 4JVIA 2OLBA 4EQ9A 2PFYA 3K1PA 4LQ5A 3IB1A 3BIGA 1QVSA 1B7UA 4MX6A 3KJTA 3FBPA 3H6TA 3IOWA 4I62A 3VDFA 1NNFA 2CMOA 2FA7A 1FSAA 3T96B 4EQ7A 2QS2A 1N84A 1N0TA 2DYXA 4XEQA 3MAMA 4AS5A 4O8MA 3O6IA 5F1QA 1R9LA 1A8EA 1RDXA 2XXPA 3E78A 4PC9A 1NNKA 3SEWA 4MLVA 2P0SA 4R9GA 1LBCA 2P3VA 2XHDA 4R6YA 4U1ZA 3TUSA 2ZZVA 3K00A 3O6GA 2XWVA 1Y1ZA 4H0WA 3FIRA 1NV4A 3GYYA 1KZ8A 4PFBA 3H6UA 1ZJLA 5F24A 4ZECA 2THIA 1Y4TA 1FCKA 1A99A 4FIMA 1DSNA 4O3BA 3I6VA 4R2FA 5L9MA 4NF6B 1XVYA 4KYSA 4Z7EA 4YKPA 3MP1A 4RPNA 3S4UA 3H6VA 3TCGA 1FPDA 3VVDA 1P1UA 3H03A 4POXA 1WVJA 1H43A 4ZDMA 1IIWA 1Z7NE 4ZZAA 3ECRA 4FECA 4KHZE 4OESA 2NUVA 3S2VA 3TCHA 2NVUB 3V5AA 3UK4A 4FJPA 3UGWA 2QL3A 3K6VA 4R6KA 3M3FA 4X1DA 1FBPA 2B3FA 5AA3A 1B0LA 2GH9A 4LP2B 3I5OA 1AOVA 1FBGA 1PB8A 4R73A 4MMPA 5AA2D 5I2NB 2ZZWA 4MCOA 1IEJA 4JDFA 3HO7A 2LAOA 4NF0A 1MM6A 1AWBA 4FORA 4P11A 4OFOA 1Y9UA 1N04A 3O2AA 1QW0A 1SD3A 2VD2A 2DXRA 4MHFA 4IO3A 1Q35A 2G29A 2WEFA 4YZZA 1NNPA 1B7HA 3B8BA 3OO6A 1H44A 2Q89A 4DXUA 1MXWA 3IAZA 3PV0E 4GD5A 3MZ9A 3M8UA 2XX7A 4Q30B 4RJZA 3RN8A 3IK6B 4R75A 2HXRA 1D9QA 5J1DA 3WAEA 3H4ZA 4ONYA 3MVWA 3RNNA 1B46A 3U92A 2PT1A 3N94A 2Y7WA 1MPDA 2X7PA 2XXQA 1B58A 4ELPA 4F1VA 3IO4A 4GWOA 1FBCA 1FTAA 2I6EA 3ILUB 5EYFA 4PFYA 1JETA 4NG7A 1O64A 4JWYA 1IMAA 3KGCA 4QHQA 3R26A 5IZZA 4RXLA 1US5A 5B7DA 1PBQA 3BFUA 4BDRA 2F3BA 3D4CA 3C34A 5CRYA 1ZBMA 3KC0A 3CRBA 2F7BA 2QMXA 3FZVA 4O3CA 4EXKA 4LUBA 5H8NA 1IQ7A 4OYVA 1JW4A 3JZJA 4JSOA 4O3AA 4KR5A 1B5JA 1P1NA 4BDNA 1LFHA 3O28A 5IZ1A 4N81A 2ZXTA 2DXYA 2HAVA 4G77A 4TQUQ 3CFZA 1SW1A 4AQ4A 3SEYA 5ITPA 5JK4A 4MBPA 1FBHA 4DCXA 4H45A 3T9HB 4G8NA 1B3LA 3MQ9A 3VXBA 1MM7A 4QSDA 2H98A 5L9SA 2XXVA 1BTJA 3HV1A 3TTLA 2R8TA 2VT5A 4FAJA 3FXRA 3G3KA 1SVXB 4GWUA 2WBDA 1N3WA 1Y3NA 3TTNA 3R7XA 3GZGA 4BDQA 2FIEA 3IL1B 5ESYA 1JP4A 4G8HA 2CZLA 3PU5A 3SEVA 4HXVA 3T1BA 4H67A 4U22A 5DT6A 3RY3A 3PPOA 5TP9A 4RNSA 4OEVA 4N6PA 3PMWA 3ROJA 1NV7A 2P3NA 4PF6A 1LBVA 3LUYA 4X1BA 3CR9A 3BIHA 3MSTA 4OVSA 4TLMB 1MY2A 5T3JA 3RT6B 1US4A 5TPAB 1POTA 1S7YA 1QUIA 4F3PA 3JV9A 1EZOA 2FNCA 3GBAA 5I3SA 2XXTA 2GHAA 1PB7A 5DEXB 4EQBA 2ZYMA 4F19A 4QFNA 1DPEA 3MP8A 3LUZA 1OMPA 3CHGA 2ZNSA 5H8QB 4U23A 2XD3A 2NOOA 5FBPA 3C33A 4N07A 3THIA 1SDXA 5K2YA 3SEXA 3FGSA 4OETA 3G3IA 3RTFB 1QGXA 1A40A 4ECFA 4FBPA 1I6BA 4HCWA 1JQFA 3FVGA 1II5A 1P1QA 1NUXA 1DK4A 1LAHE 1LLSA 1XS5A 3T22A 3U8QA 4NX1A 5DVIA 5I59B 4XKNA 4MNCA 1FW0A 1LAGE 2HXWA 1B3GA 1H45A 2O51A 4F3GA 1SW2A 1TXFA 3EN3A 4H65A 4KCCA 2XXYA 4OTEA 1KWHA 4MNIA 4QFOA 5DTBA 1MY0A 5I84A 5AA1A 4ZEKA 4U21A 3MW0A 5IM2A 1B1XA 2W7YA 3C32A 4LA9A 1GVCA 1BIYA 3LBSA 3LV0A 1EYKA 1JEVA 3PPQA 3PGFA 4Q0CA 4E0WA 4HE0A 1ZMGA 3IX1A 1NV1A 2DWHA 3MYUA 4NF6A 1XHYA 1ZKBA 2F7CA 3OEKA 3OOAA 4OEUA 4DLDA 2YJPA 5CMCA 4NN3A 5KDTB 3OEMA 1QUKA 3CFLA 1DCUA 2DS9A 4JSDA 4PAKA 3V83A 2V84A 3Q27A 4N13A 2B4LA 2REGA 3A3UA 1Q9DA 2GQ1A 1B40A 1IXCA 2D5WA 2RC9A 4ISUA 3HPIA 2Y7IA 5CM6A 3S9EA 2I49A 2AIXA 2B3BA 4OQOA 2UXAA 2H9BA 1A7LA 1PC3A 3L6HA 3OELA 3PUYE 4ELOA 3CSGA 1QKBA 4RYAA 5H8FA 1MDP1 1UTBB 4PAFA 4GQOA 1RKMA 3QUJA 1MH4A 3HFUA 3TTRA 3LR1A 1NKXA 2F78A 2F6GA 4MIJA 2F7AA 1B52A 1CB6A 3E4RA 5JEIA 1A55A 5AA2B 1MQHA 3FVNA 1UIVA 3FV1A 3PD9A 3EQ1A 3PD8A 1O63A 1OVBA 4P47A 3DM0A 3LC8A 4F31B 4BDOA 1B5HA 4I3EA 5A5XB 2Z8FA 4NWDA 4PBQA 5IZ3A 4Z0IA 4XKQA 2QS3A 3K6WA 3VLVA 4IO5A 4OZ9A 3QMFA 1WODA 4FE8A 1RYXA 4YMAA 3FVKA 4JBZA 4R6HA 1GTKA 4GBWA 3OMBA 4OHNA 5I2KA 3U94A 3KG2A 2QJEA 4G61A 4P3LA 4YKIA 4GX6A 3C35A 1INPA 4HW8A 1SW4A 3IOVA 4EF2A 4ELQA 4OVTA 1Y3PA 3DELB 4NF5B 2XX9A 1OQGA 4AB6A 2F35A 4XTCQ 2I0BA 3HN0A 3QIMA 2Z22A 4XF5A 1NNTA 3B6WA 3QUFA 3K1NA 4G68B 3PMVA 3E9XA 4KYEA 4ELRA 2WX9A 3DP8A 2YPNA 3K02A 3K1MA 5ICTA 4QXDA 1MH3A 1B3EA 3KN3A 4N8GA 4G8MA 4N17A 1VFDA 3I3VA 2ONSA 4IO4A 4WEPA 2HPGA 4F22A 4X8RA 1SYIA 4WXJA 2G93A 4LATA 3D4GA 2DWIA 3EHTA 2RCBA 2FYIA 1FRPA 4ZEDA 3KSJA 2M8CA 1MPCA 3KBRA 4XKPA 4IGTA 1NH8A 3FJGA 2P1SA 3IR1A 3VFJA 4FEDA 4HE1A 5CC2A 4P9KA 3T66A 4GX3A 1N76A 5JTYB 2MKZA 5DYHA 2HZKA 1IZ1A 1FQDA 1S50A 2A5TA 1D4NA 1L5TA 4LN5A 4C1TA 3MWBA 1FJ9A 3NOHA 3T93B 3TELA
chains in the Genus database with same CATH topology
1LFIA 4NF8B 1MY4A 3TQLA 4GLIA 2REJA 4NF4A 2DVCA 4HS7A 3HSTA 4YB7A 2XD2A 1MS7A 1SQYA 4G4PA 3HCQA 4PE5B 1XC1A 2Y84A 3TZAA 5CMMA 4BDMA 4KYDA 4GRKA 5AA4A 4XIGQ 1N3XA 2V93A 5BUUA 3TKDA 3O29A 2DVZA 4PFUA 3QK6A 5I56B 2ZMBA 3UP9A 5KCJA 2GFEA 5L8DA 4OVJA 1UIUA 3C36A 4RK2A 2PT2A 4R74A 3RTWB 4C1UA 3K01A 1UTHA 4XKRA 4QFKA 4OXVA 4AB5A 3CIJA 3KEIA 5ITOA 1FQCA 1POY1 5ICQA 4OMBA 1P1OA 2YLNA 3PPPA 1SYHA 1LSTA 4R72A 2KLFA 1MXZA 3Q26A 3IOUA 3OO8A 1VR5A 3PPNA 5H8HB 4PFTA 2UVHA 5FHMA 1BKAA 3FATA 4F29A 3WAFA 1FTOA 2H5YA 4JB7A 1YPNA 4KD5A 3V8XB 1AH5A 2ONRA 3UN6A 2QSXA 3AXFA 2DE2A 2R9JA 4TLLB 2PVUA 1NH7A 4KFQA 2Q2CA 1HSJA 3L6GA 2O7UA 1LAXA 1PEBA 1P99A 1BLFA 4G2ZA 4UA8A 3KN8A 5FTHA 2UYEA 3IO6A 5I58A 5I57A 3PUVE 1PBPA 4MFIA 1IITA 3VLWA 3UIFA 2O6AA 2HAUA 5HPQA 2AL4A 2H25A 2UYFA 4R2BA 5FHNA 1URDA 3T9VA 3HHGA 4GXSB 3S9NC 4OENA 3TCFA 3VV5A 2DQVA 1NFTA 2HFBA 2XXWA 3MPLA 4NWCA 4F1YA 4H8IA 3BBRA 3ZKKA 2V25A 2E1SA 3A3CA 2ZNTA 2ZYOA 2I3WA 1LCFA 1ELJA 3DP4A 2ANJA 1IXHA 3SETA 1OVTA 4MH5A 1JVYA 2QPQA 4DDDA 3UA8A 3MZ1A 3A09A 2F97A 3FVOA 2ZYNA 2DWJA 1TFDA 3C31A 3MVZA 4GFRA 4BDLA 3IOTA 3ZKLA 3M3KA 4QSEA 2ZYKA 3BKIB 2RF1A 1TWYA 3HHFA 5F7VA 3K4UA 5EHMA 3IJXB 2WKYA 5HM4B 1XOCA 3K2DA 4WKMA 4KI0E 2I48A 4R9FA 4PP0A 2IA4A 4M4GA 3QAXA 4YB6A 3FJ7A 3PPRA 1A8FA 3G3GA 3KOSA 1FTJA 1ZIUA 1ZLQA 3Q25A 4NE4A 3PUXE 2GHBA 3OO7A 1MG1A 3IORA 4H5FA 2DE3A 1M5FA 1AMFA 1VE4A 1SW5A 1EU8A 4ESXA 4GL0A 1D3KA 1FTKA 2Q88A 1B3FA 2OK2A 3EF7A 4YICA 3FASA 4OFJA 4QRZA 2XXRA 3OD7A 1B6HA 4YB5A 4IO6A 1IXGA 1FQBA 3H6WA 4TOZA 2ZNUA 2HZLA 1OQHA 4L17A 5CMKA 3KN7A 2Y7KA 3KJ7A 4ZEBA 5FTIA 1R6ZA 5TU0A 3U72A 5H8NB 2I58A 3C9HA 4OERA 1NMUA 3OENA 3VVFA 3E3KA 3LSWA 1Y20A 3VVEA 5EHSA 1LCTA 1ZU0A 1DTGA 4IO2A 3MVXA 4ZS9A 5I2NA 1S9TA 1USYE 1MDQA 3GXAA 1FQAA 4QF9A 1QJMA 1SI0A 3S9LC 3O97A 4EDPA 3G7WA 5CMBA 3VLUA 4OWDA 3T9UA 1OLAA 3B6QA 3S9MC 1D9VA 4I1DA 5IAIA 1B51A 3VXCA 3SESA 3T9XB 3JYRA 1ANFA 1MRPA 5B70A 2VOZA 2OJTA 5DVJA 4YKJA 4KPTA 5BWJA 1YTVA 2VGQA 3IJOB 5TP9B 5M2VA 3QSLA 3OO9A 3TEPA 3USDA 1ZTYA 1RYOA 2XXIA 1YAEA 4MF3A 1I6QA 2I0CA 3MVYA 1B2HA 4GXAA 5ISUA 4IY6A 5CI5A 1MQGA 5AE4A 1B7ZA 4WEDA 1MXXA 1M5DA 1URGA 1B5IA 2OZZA 2PYYA 4HCYA 4H5GA 4Q5TA 1Y1MA 2B65A 3RUMA 3TYHA 4QFLA 1B05A 3H7MA 1PDAA 4P0GA 3KZGA 3P7IA 2OWSA 4RY1A 1AIVA 1HSEA 5ELVA 3TAJA 3Q29A 1DMBA 2PBWA 4EF1A 2H4IA 3H06B 1B1HA 3EHSA 5DVFA 3C4MA 3CG3A 3CI8A 4YKKA 4DXBA 4IO7A 4F3SA 3TFLA 2F8DA 2D21A 2ESNA 1HSLA 4H1XA 4THIA 3SEUA 2Y7RA 4C0RA 4EXLA 1I69A 2VHAA 4IGRA 1DTZA 3RPWA 4X9TA 4U4XA 1IXIA 1CE2A 4FATA 3TQWA 1LBBA 1MXYA 3ODBA 2DE4A 3CG1A 4F2QA 5H8SA 1BP5A 3IB0A 4X48A 2DSFA 1WDNA 4ZEFA 2PMSA 2RINA 2XXUA 1O7TA 5FHOA 2V3TA 4U2RA 1LB9A 2Z8DA 3N6UA 3DLNA 3H3GA 1N7WA 4OFLA 2Z23A 3TMGA 1FQFA 3G3HA 4QFPA 4DIGA 3RGYA 3N26A 4ZEIA 5TPAA 4EUOA 4FEBA 1H3DA 4YU0A 5H8FB 3ZSFA 1YCJA 5DEXA 3N5LA 4U1OA 2E0SA 2UVIA 1XVXA 1EZ9A 2DOJA 5K2XA 2GRVA 5H8QA 1UQWA 4LZ5A 2AL5A 1JEUA 3B6TA 5L9OA 1B9JA 2Y7PA 3W15C 2Q9TA 2HEUA 1QKAA 2DP8A 2IEEA 1H76A 3PUWE 3MPKA 2QS1A 3ZS6A 3OSQA 3TDJA 1LB8A 2XXHA 3TTKA 3VE1B 3CFXA 5I59A 4Q8RA 3GLBA 4POWA 1EH3A 1ATGA 4YMBA 1JVXA 1FTMA 4ESWA 1MQIA 1USYH 5I2KB 2UVGA 2F36A 2O1MA 4PQJA 1JNFA 4M1VA 2RC7A 1AL3A 4NTLA 3LSLA 3MJNA 4GOTA 1T0KA 2BJJX 4DZ1A 4K3FA 2VD3A 4PETA 4G68C 4BLAA 5KDTA 2AYSA 1B3HA 4HTGA 3K0VA 3M3LA 3W9WA 3U93A 3G3JA 3MC2A 2XX8A 1Z7ME 1FTLA 2NXOA 2OBGA 4F1UA 1N7XA 1XT8A 4LVQA 1Y4CA 4ZE8A 5KZTA 3ILTB 1UTBA 1DOTA 4ZZEA 3SERA 4DXCA 2PX1A 4JWXA 1GGGA 2ABHA 3W9VA 2R6GE 1OIBA 3TODA 1QULA 5AA2A 3PUZE 2A5TB 3MZBA 2A5SA 3FD3A 2F5XA 2O84X 2F34A 4F2OA 3QXMA 3N6TA 4RA1A 3TTMA 5A5XA 1R1NA 1B32A 1MXUA 2UVJA 3IB2A 4NF4B 4I9DA 1P1WA 1MQDA 1R9QA 1M5BA 4XXUA 3UORA 1VFEA 1B4ZA 2QRYA 2Z8EA 3RQTA 3FXUA 4I8CA 1VSOA 3RLFE 5AA4B 5IKBA 1GV8A 2X7QA 3OSRA 1I6AA 2D3IA 3R6UA 1URSA 3K6XA 3OXNA 5KCJB 4ND9A 3E13X 3BFTA 4RK9A 1B4HA 2NWJA 4NF5A 3V89B 2QMWA 3G3FA 1UTHB 1QUJA 3LSXA 4UACA 1EZPA 4G68A 3GBBA 4LZ7A 2OWTA 2DWAA 2HCAA 1OLCA 5LOMA 4JXIA 3O66A 2X26A 1FQEA 4F39A 2Q2AA 4ZE9A 4IY5A 5HBCA 1LGBC 4IB2A 3F11A 4P0IA 1JW1A 2RKMA 4DCYA 1MXVA 3KFMA 1MPBA 3SKPA 2ALUA 4KQPA 1LAFE 4PFWA 1LFGA 2O68A 1SBPA 5CBSA 2I4CA 1D9YA 2O69A 3RT8A 1MY1A 3MUQA 4H8JA 3KOTA 5JTYA 2HQ0A 5CBRA 3FUZA 4NMYA 1TT1A 2RC8A 4QSCA 3LSFB 3TPAA 1JW5A 2I4BA 2RCAA 4LONB 4NF8A 1DPPA 3O6HA 1IUDA 1Q1KA 4F18A 2ONKE 4U4SA 4GF8A 2P2AA 4LZ8A 2R71A 4MLQA 2O1LA 2QS4A 4GIZA 2I3VA 2H99A 4NEDA 3K6UA 3U1OA 3FJMA 3EHUA 2Q8JA 4GL8A 5I56A 1MQJA 2V3QA 2F6PA 3B7DA 2OCUA 5I58B 5I57B 1B0HA 3CSBA 1TFAA 4YAHX 1MY3A 1J1NA 2V3UA 1SI1A 1M5CA 3O9PA 3FXQA 3Q28A 3SDFA 1GR2A 1Y3QA 4RPOA 4KCDA 4DE8A 4F3BA 3DP6A 1F9BA 3CVGA 2VP1A 3MBPA 3PMXA 3FV2A 4LQ2A 4E0XA 3EPEA 4H6DA 3KSXA 4GVOA 3QYTA 3MP6A 1M5EA 2O7IA 1NL5A 5H8HA 3ONMA 1A54A 4JWOA 1PB9A 2XXXA 2OLBA 4EQ9A 3K1PA 4LQ5A 3IB1A 1QVSA 1B7UA 3KJTA 3H6TA 3IOWA 4I62A 3VDFA 1NNFA 2CMOA 2FA7A 3T96B 4EQ7A 2QS2A 1N84A 1N0TA 2DYXA 3MAMA 3O6IA 5F1QA 1A8EA 1R9LA 2XXPA 1NNKA 3SEWA 4MLVA 2P0SA 4R9GA 1LBCA 2XHDA 4R6YA 4U1ZA 3TUSA 3K00A 3O6GA 1Y1ZA 4H0WA 3FIRA 3H6UA 1ZJLA 4ZECA 2THIA 1Y4TA 1FCKA 1A99A 4FIMA 1DSNA 4O3BA 3I6VA 4R2FA 5L9MA 4NF6B 1XVYA 4KYSA 4Z7EA 4YKPA 3MP1A 4RPNA 3S4UA 3TCGA 3H6VA 3VVDA 1P1UA 3H03A 4POXA 1WVJA 1H43A 4ZDMA 1IIWA 1Z7NE 4ZZAA 3ECRA 4FECA 4KHZE 4OESA 2NUVA 3S2VA 3TCHA 2NVUB 3V5AA 3UK4A 4FJPA 3UGWA 2QL3A 3K6VA 4R6KA 3M3FA 4X1DA 2B3FA 5AA3A 1B0LA 2GH9A 4LP2B 3I5OA 1AOVA 1PB8A 4R73A 5AA2D 5I2NB 1IEJA 4JDFA 3HO7A 2LAOA 1MM6A 4FORA 4P11A 4OFOA 1Y9UA 1N04A 3O2AA 1QW0A 1SD3A 2VD2A 2DXRA 4IO3A 1Q35A 2G29A 4YZZA 1NNPA 1B7HA 3OO6A 1H44A 2Q89A 4DXUA 1MXWA 3IAZA 3PV0E 4GD5A 3MZ9A 3M8UA 2XX7A 4Q30B 4RJZA 3RN8A 3IK6B 4R75A 5J1DA 3WAEA 3H4ZA 4ONYA 3MVWA 3RNNA 1B46A 3U92A 2PT1A 3N94A 2Y7WA 1MPDA 2X7PA 2XXQA 1B58A 4ELPA 4F1VA 3IO4A 4GWOA 2I6EA 3ILUB 5EYFA 4PFYA 1JETA 1O64A 4JWYA 3KGCA 4QHQA 3R26A 4RXLA 1US5A 5B7DA 1PBQA 3BFUA 4BDRA 3D4CA 3C34A 5CRYA 1ZBMA 3CRBA 2F7BA 2QMXA 3FZVA 4O3CA 4EXKA 4LUBA 5H8NA 1IQ7A 4OYVA 1JW4A 3JZJA 4JSOA 4O3AA 4KR5A 1B5JA 1P1NA 4BDNA 1LFHA 3O28A 2ZXTA 2DXYA 2HAVA 4G77A 4TQUQ 3CFZA 1SW1A 4AQ4A 3SEYA 5ITPA 5JK4A 4MBPA 4DCXA 3T9HB 4G8NA 1B3LA 3MQ9A 3VXBA 1MM7A 4QSDA 2H98A 5L9SA 2XXVA 1BTJA 3HV1A 3TTLA 4FAJA 3FXRA 3G3KA 1SVXB 1N3WA 1Y3NA 3TTNA 3R7XA 3GZGA 4BDQA 3IL1B 4G8HA 2CZLA 3PU5A 3SEVA 4H67A 4U22A 5DT6A 3RY3A 3PPOA 5TP9A 4RNSA 4OEVA 4N6PA 3PMWA 3LUYA 4X1BA 3CR9A 4TLMB 1MY2A 3RT6B 1US4A 5TPAB 1POTA 1S7YA 1QUIA 4F3PA 3JV9A 1EZOA 2FNCA 3GBAA 2XXTA 2GHAA 1PB7A 5DEXB 4EQBA 2ZYMA 4F19A 4QFNA 1DPEA 3MP8A 1OMPA 2ZNSA 5H8QB 4U23A 2XD3A 2NOOA 3C33A 4N07A 3THIA 1SDXA 5K2YA 3SEXA 3FGSA 4OETA 3G3IA 3RTFB 1A40A 4ECFA 1I6BA 4HCWA 1JQFA 3FVGA 1II5A 1P1QA 1LAHE 1LLSA 1XS5A 3T22A 3U8QA 5DVIA 5I59B 4XKNA 1FW0A 1LAGE 2HXWA 1B3GA 1H45A 2O51A 4F3GA 1SW2A 1TXFA 3EN3A 4H65A 4KCCA 2XXYA 4OTEA 1KWHA 4QFOA 5DTBA 1MY0A 5I84A 5AA1A 4ZEKA 4U21A 3MW0A 1B1XA 2W7YA 3C32A 4LA9A 1GVCA 1BIYA 3LBSA 1JEVA 3PPQA 3PGFA 4Q0CA 4E0WA 1ZMGA 3IX1A 2DWHA 4NF6A 1XHYA 1ZKBA 2F7CA 3OEKA 3OOAA 4OEUA 4DLDA 2YJPA 5CMCA 5KDTB 3OEMA 1QUKA 3CFLA 2DS9A 4JSDA 3V83A 2V84A 3Q27A 4N13A 2REGA 3A3UA 1B40A 1IXCA 2D5WA 2RC9A 4ISUA 3HPIA 2Y7IA 5CM6A 3S9EA 2I49A 2AIXA 2B3BA 4OQOA 2UXAA 2H9BA 1A7LA 1PC3A 3L6HA 3OELA 3PUYE 4ELOA 3CSGA 1QKBA 4RYAA 5H8FA 1MDP1 1UTBB 4GQOA 1RKMA 3QUJA 1MH4A 3TTRA 3LR1A 1NKXA 2F78A 2F6GA 2F7AA 1B52A 1CB6A 3E4RA 5JEIA 1A55A 5AA2B 1MQHA 3FVNA 1UIVA 3FV1A 3PD9A 3EQ1A 3PD8A 1O63A 1OVBA 3DM0A 3LC8A 4F31B 4BDOA 1B5HA 5A5XB 2Z8FA 4NWDA 4Z0IA 4XKQA 2QS3A 3K6WA 3VLVA 4IO5A 4OZ9A 1WODA 4FE8A 1RYXA 4YMAA 3FVKA 4JBZA 4R6HA 1GTKA 3OMBA 4OHNA 5I2KA 3U94A 3KG2A 2QJEA 4YKIA 3C35A 4HW8A 1SW4A 3IOVA 4EF2A 4ELQA 1Y3PA 3DELB 4NF5B 2XX9A 1OQGA 4AB6A 2F35A 4XTCQ 2I0BA 3HN0A 3QIMA 2Z22A 1NNTA 3B6WA 3QUFA 3K1NA 4G68B 3PMVA 3E9XA 4KYEA 4ELRA 3DP8A 2YPNA 3K02A 3K1MA 5ICTA 1MH3A 1B3EA 3KN3A 4G8MA 1VFDA 3I3VA 2ONSA 4IO4A 4WEPA 4F22A 1SYIA 4WXJA 2G93A 4LATA 3D4GA 2DWIA 3EHTA 2RCBA 2FYIA 4ZEDA 3KSJA 2M8CA 1MPCA 3KBRA 4XKPA 4IGTA 1NH8A 3FJGA 2P1SA 3IR1A 3VFJA 4FEDA 5CC2A 3T66A 1N76A 5JTYB 5DYHA 2HZKA 1IZ1A 1FQDA 1S50A 2A5TA 1D4NA 1L5TA 4C1TA 3MWBA 3T93B 3TELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFI A;  4NF8 B;  1MY4 A;  3TQL A;  4GLI A;  2REJ A;  4NF4 A;  2DVC A;  4HS7 A;  3HST A;  4YB7 A;  2XD2 A;  1MS7 A;  1SQY A;  4G4P A;  3HCQ A;  4PE5 B;  1XC1 A;  2Y84 A;  3TZA A;  5CMM A;  4BDM A;  4KYD A;  4GRK A;  5AA4 A;  4XIG Q;  1N3X A;  2V93 A;  5BUU A;  3TKD A;  3O29 A;  2DVZ A;  4PFU A;  3QK6 A;  5I56 B;  2ZMB A;  3UP9 A;  5KCJ A;  2GFE A;  5L8D A;  4OVJ A;  1UIU A;  3C36 A;  4RK2 A;  2PT2 A;  4R74 A;  3RTW B;  4C1U A;  3K01 A;  1UTH A;  4XKR A;  4QFK A;  4OXV A;  4AB5 A;  3CIJ A;  3KEI A;  5ITO A;  1FQC A;  1POY 1;  5ICQ A;  4OMB A;  1P1O A;  2YLN A;  3PPP A;  1SYH A;  1LST A;  4R72 A;  2KLF A;  1MXZ A;  3Q26 A;  3IOU A;  3OO8 A;  1VR5 A;  3PPN A;  5H8H B;  4PFT A;  2UVH A;  5FHM A;  1BKA A;  3FAT A;  4F29 A;  3WAF A;  1FTO A;  2H5Y A;  4JB7 A;  1YPN A;  4KD5 A;  3V8X B;  1AH5 A;  2ONR A;  3UN6 A;  2QSX A;  3AXF A;  2DE2 A;  2R9J A;  4TLL B;  2PVU A;  1NH7 A;  4KFQ A;  2Q2C A;  1HSJ A;  3L6G A;  2O7U A;  1LAX A;  1PEB A;  1P99 A;  1BLF A;  4G2Z A;  4UA8 A;  3KN8 A;  5FTH A;  2UYE A;  3IO6 A;  5I58 A;  5I57 A;  3PUV E;  1PBP A;  4MFI A;  1IIT A;  3VLW A;  3UIF A;  2O6A A;  2HAU A;  5HPQ A;  2AL4 A;  2H25 A;  2UYF A;  4R2B A;  5FHN A;  1URD A;  3T9V A;  3HHG A;  4GXS B;  3S9N C;  4OEN A;  3TCF A;  3VV5 A;  2DQV A;  1NFT A;  2HFB A;  2XXW A;  3MPL A;  4NWC A;  4F1Y A;  4H8I A;  3BBR A;  3ZKK A;  2V25 A;  2E1S A;  3A3C A;  2ZNT A;  2ZYO A;  2I3W A;  1LCF A;  1ELJ A;  3DP4 A;  2ANJ A;  1IXH A;  3SET A;  1OVT A;  4MH5 A;  1JVY A;  2QPQ A;  4DDD A;  3UA8 A;  3MZ1 A;  3A09 A;  2F97 A;  3FVO A;  2ZYN A;  2DWJ A;  1TFD A;  3C31 A;  3MVZ A;  4GFR A;  4BDL A;  3IOT A;  3ZKL A;  3M3K A;  4QSE A;  2ZYK A;  3BKI B;  2RF1 A;  1TWY A;  3HHF A;  5F7V A;  3K4U A;  5EHM A;  3IJX B;  2WKY A;  5HM4 B;  1XOC A;  3K2D A;  4WKM A;  4KI0 E;  2I48 A;  4R9F A;  4PP0 A;  2IA4 A;  4M4G A;  3QAX A;  4YB6 A;  3FJ7 A;  3PPR A;  1A8F A;  3G3G A;  3KOS A;  1FTJ A;  1ZIU A;  1ZLQ A;  3Q25 A;  4NE4 A;  3PUX E;  2GHB A;  3OO7 A;  1MG1 A;  3IOR A;  4H5F A;  2DE3 A;  1M5F A;  1AMF A;  1VE4 A;  1SW5 A;  1EU8 A;  4ESX A;  4GL0 A;  1D3K A;  1FTK A;  2Q88 A;  1B3F A;  2OK2 A;  3EF7 A;  4YIC A;  3FAS A;  4OFJ A;  4QRZ A;  2XXR A;  3OD7 A;  1B6H A;  4YB5 A;  4IO6 A;  1IXG A;  1FQB A;  3H6W A;  4TOZ A;  2ZNU A;  2HZL A;  1OQH A;  4L17 A;  5CMK A;  3KN7 A;  2Y7K A;  3KJ7 A;  4ZEB A;  5FTI A;  1R6Z A;  5TU0 A;  3U72 A;  5H8N B;  2I58 A;  3C9H A;  4OER A;  1NMU A;  3OEN A;  3VVF A;  3E3K A;  3LSW A;  1Y20 A;  3VVE A;  5EHS A;  1LCT A;  1ZU0 A;  1DTG A;  4IO2 A;  3MVX A;  4ZS9 A;  5I2N A;  1S9T A;  1USY E;  1MDQ A;  3GXA A;  1FQA A;  4QF9 A;  1QJM A;  1SI0 A;  3S9L C;  3O97 A;  4EDP A;  3G7W A;  5CMB A;  3VLU A;  4OWD A;  3T9U A;  1OLA A;  3B6Q A;  3S9M C;  1D9V A;  4I1D A;  5IAI A;  1B51 A;  3VXC A;  3SES A;  3T9X B;  3JYR A;  1ANF A;  1MRP A;  5B70 A;  2VOZ A;  2OJT A;  5DVJ A;  4YKJ A;  4KPT A;  5BWJ A;  1YTV A;  2VGQ A;  3IJO B;  5TP9 B;  5M2V A;  3QSL A;  3OO9 A;  3TEP A;  3USD A;  1ZTY A;  1RYO A;  2XXI A;  1YAE A;  4MF3 A;  1I6Q A;  2I0C A;  3MVY A;  1B2H A;  4GXA A;  5ISU A;  4IY6 A;  5CI5 A;  1MQG A;  5AE4 A;  1B7Z A;  4WED A;  1MXX A;  1M5D A;  1URG A;  1B5I A;  2OZZ A;  2PYY A;  4HCY A;  4H5G A;  4Q5T A;  1Y1M A;  2B65 A;  3RUM A;  3TYH A;  4QFL A;  1B05 A;  3H7M A;  1PDA A;  4P0G A;  3KZG A;  3P7I A;  2OWS A;  4RY1 A;  1AIV A;  1HSE A;  5ELV A;  3TAJ A;  3Q29 A;  1DMB A;  2PBW A;  4EF1 A;  2H4I A;  3H06 B;  1B1H A;  3EHS A;  5DVF A;  3C4M A;  3CG3 A;  3CI8 A;  4YKK A;  4DXB A;  4IO7 A;  4F3S A;  3TFL A;  2F8D A;  2D21 A;  2ESN A;  1HSL A;  4H1X A;  4THI A;  3SEU A;  2Y7R A;  4C0R A;  4EXL A;  1I69 A;  2VHA A;  4IGR A;  1DTZ A;  3RPW A;  4X9T A;  4U4X A;  1IXI A;  1CE2 A;  4FAT A;  3TQW A;  1LBB A;  1MXY A;  3ODB A;  2DE4 A;  3CG1 A;  4F2Q A;  5H8S A;  1BP5 A;  3IB0 A;  4X48 A;  2DSF A;  1WDN A;  4ZEF A;  2PMS A;  2RIN A;  2XXU A;  1O7T A;  5FHO A;  2V3T A;  4U2R A;  1LB9 A;  2Z8D A;  3N6U A;  3DLN A;  3H3G A;  1N7W A;  4OFL A;  2Z23 A;  3TMG A;  1FQF A;  3G3H A;  4QFP A;  4DIG A;  3RGY A;  3N26 A;  4ZEI A;  5TPA A;  4EUO A;  4FEB A;  1H3D A;  4YU0 A;  5H8F B;  3ZSF A;  1YCJ A;  5DEX A;  3N5L A;  4U1O A;  2E0S A;  2UVI A;  1XVX A;  1EZ9 A;  2DOJ A;  5K2X A;  2GRV A;  5H8Q A;  1UQW A;  4LZ5 A;  2AL5 A;  1JEU A;  3B6T A;  5L9O A;  1B9J A;  2Y7P A;  3W15 C;  2Q9T A;  2HEU A;  1QKA A;  2DP8 A;  2IEE A;  1H76 A;  3PUW E;  3MPK A;  2QS1 A;  3ZS6 A;  3OSQ A;  3TDJ A;  1LB8 A;  2XXH A;  3TTK A;  3VE1 B;  3CFX A;  5I59 A;  4Q8R A;  3GLB A;  4POW A;  1EH3 A;  1ATG A;  4YMB A;  1JVX A;  1FTM A;  4ESW A;  1MQI A;  1USY H;  5I2K B;  2UVG A;  2F36 A;  2O1M A;  4PQJ A;  1JNF A;  4M1V A;  2RC7 A;  1AL3 A;  4NTL A;  3LSL A;  3MJN A;  4GOT A;  1T0K A;  2BJJ X;  4DZ1 A;  4K3F A;  2VD3 A;  4PET A;  4G68 C;  4BLA A;  5KDT A;  2AYS A;  1B3H A;  4HTG A;  3K0V A;  3M3L A;  3W9W A;  3U93 A;  3G3J A;  3MC2 A;  2XX8 A;  1Z7M E;  1FTL A;  2NXO A;  2OBG A;  4F1U A;  1N7X A;  1XT8 A;  4LVQ A;  1Y4C A;  4ZE8 A;  5KZT A;  3ILT B;  1UTB A;  1DOT A;  4ZZE A;  3SER A;  4DXC A;  2PX1 A;  4JWX A;  1GGG A;  2ABH A;  3W9V A;  2R6G E;  1OIB A;  3TOD A;  1QUL A;  5AA2 A;  3PUZ E;  2A5T B;  3MZB A;  2A5S A;  3FD3 A;  2F5X A;  2O84 X;  2F34 A;  4F2O A;  3QXM A;  3N6T A;  4RA1 A;  3TTM A;  5A5X A;  1R1N A;  1B32 A;  1MXU A;  2UVJ A;  3IB2 A;  4NF4 B;  4I9D A;  1P1W A;  1MQD A;  1R9Q A;  1M5B A;  4XXU A;  3UOR A;  1VFE A;  1B4Z A;  2QRY A;  2Z8E A;  3RQT A;  3FXU A;  4I8C A;  1VSO A;  3RLF E;  5AA4 B;  5IKB A;  1GV8 A;  2X7Q A;  3OSR A;  1I6A A;  2D3I A;  3R6U A;  1URS A;  3K6X A;  3OXN A;  5KCJ B;  4ND9 A;  3E13 X;  3BFT A;  4RK9 A;  1B4H A;  2NWJ A;  4NF5 A;  3V89 B;  2QMW A;  3G3F A;  1UTH B;  1QUJ A;  3LSX A;  4UAC A;  1EZP A;  4G68 A;  3GBB A;  4LZ7 A;  2OWT A;  2DWA A;  2HCA A;  1OLC A;  5LOM A;  4JXI A;  3O66 A;  2X26 A;  1FQE A;  4F39 A;  2Q2A A;  4ZE9 A;  4IY5 A;  5HBC A;  1LGB C;  4IB2 A;  3F11 A;  4P0I A;  1JW1 A;  2RKM A;  4DCY A;  1MXV A;  3KFM A;  1MPB A;  3SKP A;  2ALU A;  4KQP A;  1LAF E;  4PFW A;  1LFG A;  2O68 A;  1SBP A;  5CBS A;  2I4C A;  1D9Y A;  2O69 A;  3RT8 A;  1MY1 A;  3MUQ A;  4H8J A;  3KOT A;  5JTY A;  2HQ0 A;  5CBR A;  3FUZ A;  4NMY A;  1TT1 A;  2RC8 A;  4QSC A;  3LSF B;  3TPA A;  1JW5 A;  2I4B A;  2RCA A;  4LON B;  4NF8 A;  1DPP A;  3O6H A;  1IUD A;  1Q1K A;  4F18 A;  2ONK E;  4U4S A;  4GF8 A;  2P2A A;  4LZ8 A;  2R71 A;  4MLQ A;  2O1L A;  2QS4 A;  4GIZ A;  2I3V A;  2H99 A;  4NED A;  3K6U A;  3U1O A;  3FJM A;  3EHU A;  2Q8J A;  4GL8 A;  5I56 A;  1MQJ A;  2V3Q A;  2F6P A;  3B7D A;  2OCU A;  5I58 B;  5I57 B;  1B0H A;  3CSB A;  1TFA A;  4YAH X;  1MY3 A;  1J1N A;  2V3U A;  1SI1 A;  1M5C A;  3O9P A;  3FXQ A;  3Q28 A;  3SDF A;  1GR2 A;  1Y3Q A;  4RPO A;  4KCD A;  4DE8 A;  4F3B A;  3DP6 A;  1F9B A;  3CVG A;  2VP1 A;  3MBP A;  3PMX A;  3FV2 A;  4LQ2 A;  4E0X A;  3EPE A;  4H6D A;  3KSX A;  4GVO A;  3QYT A;  3MP6 A;  1M5E A;  2O7I A;  1NL5 A;  5H8H A;  3ONM A;  1A54 A;  4JWO A;  1PB9 A;  2XXX A;  2OLB A;  4EQ9 A;  3K1P A;  4LQ5 A;  3IB1 A;  1QVS A;  1B7U A;  3KJT A;  3H6T A;  3IOW A;  4I62 A;  3VDF A;  1NNF A;  2CMO A;  2FA7 A;  3T96 B;  4EQ7 A;  2QS2 A;  1N84 A;  1N0T A;  2DYX A;  3MAM A;  3O6I A;  5F1Q A;  1A8E A;  1R9L A;  2XXP A;  1NNK A;  3SEW A;  4MLV A;  2P0S A;  4R9G A;  1LBC A;  2XHD A;  4R6Y A;  4U1Z A;  3TUS A;  3K00 A;  3O6G A;  1Y1Z A;  4H0W A;  3FIR A;  3H6U A;  1ZJL A;  4ZEC A;  2THI A;  1Y4T A;  1FCK A;  1A99 A;  4FIM A;  1DSN A;  4O3B A;  3I6V A;  4R2F A;  5L9M A;  4NF6 B;  1XVY A;  4KYS A;  4Z7E A;  4YKP A;  3MP1 A;  4RPN A;  3S4U A;  3TCG A;  3H6V A;  3VVD A;  1P1U A;  3H03 A;  4POX A;  1WVJ A;  1H43 A;  4ZDM A;  1IIW A;  1Z7N E;  4ZZA A;  3ECR A;  4FEC A;  4KHZ E;  4OES A;  2NUV A;  3S2V A;  3TCH A;  2NVU B;  3V5A A;  3UK4 A;  4FJP A;  3UGW A;  2QL3 A;  3K6V A;  4R6K A;  3M3F A;  4X1D A;  2B3F A;  5AA3 A;  1B0L A;  2GH9 A;  4LP2 B;  3I5O A;  1AOV A;  1PB8 A;  4R73 A;  5AA2 D;  5I2N B;  1IEJ A;  4JDF A;  3HO7 A;  2LAO A;  1MM6 A;  4FOR A;  4P11 A;  4OFO A;  1Y9U A;  1N04 A;  3O2A A;  1QW0 A;  1SD3 A;  2VD2 A;  2DXR A;  4IO3 A;  1Q35 A;  2G29 A;  4YZZ A;  1NNP A;  1B7H A;  3OO6 A;  1H44 A;  2Q89 A;  4DXU A;  1MXW A;  3IAZ A;  3PV0 E;  4GD5 A;  3MZ9 A;  3M8U A;  2XX7 A;  4Q30 B;  4RJZ A;  3RN8 A;  3IK6 B;  4R75 A;  5J1D A;  3WAE A;  3H4Z A;  4ONY A;  3MVW A;  3RNN A;  1B46 A;  3U92 A;  2PT1 A;  3N94 A;  2Y7W A;  1MPD A;  2X7P A;  2XXQ A;  1B58 A;  4ELP A;  4F1V A;  3IO4 A;  4GWO A;  2I6E A;  3ILU B;  5EYF A;  4PFY A;  1JET A;  1O64 A;  4JWY A;  3KGC A;  4QHQ A;  3R26 A;  4RXL A;  1US5 A;  5B7D A;  1PBQ A;  3BFU A;  4BDR A;  3D4C A;  3C34 A;  5CRY A;  1ZBM A;  3CRB A;  2F7B A;  2QMX A;  3FZV A;  4O3C A;  4EXK A;  4LUB A;  5H8N A;  1IQ7 A;  4OYV A;  1JW4 A;  3JZJ A;  4JSO A;  4O3A A;  4KR5 A;  1B5J A;  1P1N A;  4BDN A;  1LFH A;  3O28 A;  2ZXT A;  2DXY A;  2HAV A;  4G77 A;  4TQU Q;  3CFZ A;  1SW1 A;  4AQ4 A;  3SEY A;  5ITP A;  5JK4 A;  4MBP A;  4DCX A;  3T9H B;  4G8N A;  1B3L A;  3MQ9 A;  3VXB A;  1MM7 A;  4QSD A;  2H98 A;  5L9S A;  2XXV A;  1BTJ A;  3HV1 A;  3TTL A;  4FAJ A;  3FXR A;  3G3K A;  1SVX B;  1N3W A;  1Y3N A;  3TTN A;  3R7X A;  3GZG A;  4BDQ A;  3IL1 B;  4G8H A;  2CZL A;  3PU5 A;  3SEV A;  4H67 A;  4U22 A;  5DT6 A;  3RY3 A;  3PPO A;  5TP9 A;  4RNS A;  4OEV A;  4N6P A;  3PMW A;  3LUY A;  4X1B A;  3CR9 A;  4TLM B;  1MY2 A;  3RT6 B;  1US4 A;  5TPA B;  1POT A;  1S7Y A;  1QUI A;  4F3P A;  3JV9 A;  1EZO A;  2FNC A;  3GBA A;  2XXT A;  2GHA A;  1PB7 A;  5DEX B;  4EQB A;  2ZYM A;  4F19 A;  4QFN A;  1DPE A;  3MP8 A;  1OMP A;  2ZNS A;  5H8Q B;  4U23 A;  2XD3 A;  2NOO A;  3C33 A;  4N07 A;  3THI A;  1SDX A;  5K2Y A;  3SEX A;  3FGS A;  4OET A;  3G3I A;  3RTF B;  1A40 A;  4ECF A;  1I6B A;  4HCW A;  1JQF A;  3FVG A;  1II5 A;  1P1Q A;  1LAH E;  1LLS A;  1XS5 A;  3T22 A;  3U8Q A;  5DVI A;  5I59 B;  4XKN A;  1FW0 A;  1LAG E;  2HXW A;  1B3G A;  1H45 A;  2O51 A;  4F3G A;  1SW2 A;  1TXF A;  3EN3 A;  4H65 A;  4KCC A;  2XXY A;  4OTE A;  1KWH A;  4QFO A;  5DTB A;  1MY0 A;  5I84 A;  5AA1 A;  4ZEK A;  4U21 A;  3MW0 A;  1B1X A;  2W7Y A;  3C32 A;  4LA9 A;  1GVC A;  1BIY A;  3LBS A;  1JEV A;  3PPQ A;  3PGF A;  4Q0C A;  4E0W A;  1ZMG A;  3IX1 A;  2DWH A;  4NF6 A;  1XHY A;  1ZKB A;  2F7C A;  3OEK A;  3OOA A;  4OEU A;  4DLD A;  2YJP A;  5CMC A;  5KDT B;  3OEM A;  1QUK A;  3CFL A;  2DS9 A;  4JSD A;  3V83 A;  2V84 A;  3Q27 A;  4N13 A;  2REG A;  3A3U A;  1B40 A;  1IXC A;  2D5W A;  2RC9 A;  4ISU A;  3HPI A;  2Y7I A;  5CM6 A;  3S9E A;  2I49 A;  2AIX A;  2B3B A;  4OQO A;  2UXA A;  2H9B A;  1A7L A;  1PC3 A;  3L6H A;  3OEL A;  3PUY E;  4ELO A;  3CSG A;  1QKB A;  4RYA A;  5H8F A;  1MDP 1;  1UTB B;  4GQO A;  1RKM A;  3QUJ A;  1MH4 A;  3TTR A;  3LR1 A;  1NKX A;  2F78 A;  2F6G A;  2F7A A;  1B52 A;  1CB6 A;  3E4R A;  5JEI A;  1A55 A;  5AA2 B;  1MQH A;  3FVN A;  1UIV A;  3FV1 A;  3PD9 A;  3EQ1 A;  3PD8 A;  1O63 A;  1OVB A;  3DM0 A;  3LC8 A;  4F31 B;  4BDO A;  1B5H A;  5A5X B;  2Z8F A;  4NWD A;  4Z0I A;  4XKQ A;  2QS3 A;  3K6W A;  3VLV A;  4IO5 A;  4OZ9 A;  1WOD A;  4FE8 A;  1RYX A;  4YMA A;  3FVK A;  4JBZ A;  4R6H A;  1GTK A;  3OMB A;  4OHN A;  5I2K A;  3U94 A;  3KG2 A;  2QJE A;  4YKI A;  3C35 A;  4HW8 A;  1SW4 A;  3IOV A;  4EF2 A;  4ELQ A;  1Y3P A;  3DEL B;  4NF5 B;  2XX9 A;  1OQG A;  4AB6 A;  2F35 A;  4XTC Q;  2I0B A;  3HN0 A;  3QIM A;  2Z22 A;  1NNT A;  3B6W A;  3QUF A;  3K1N A;  4G68 B;  3PMV A;  3E9X A;  4KYE A;  4ELR A;  3DP8 A;  2YPN A;  3K02 A;  3K1M A;  5ICT A;  1MH3 A;  1B3E A;  3KN3 A;  4G8M A;  1VFD A;  3I3V A;  2ONS A;  4IO4 A;  4WEP A;  4F22 A;  1SYI A;  4WXJ A;  2G93 A;  4LAT A;  3D4G A;  2DWI A;  3EHT A;  2RCB A;  2FYI A;  4ZED A;  3KSJ A;  2M8C A;  1MPC A;  3KBR A;  4XKP A;  4IGT A;  1NH8 A;  3FJG A;  2P1S A;  3IR1 A;  3VFJ A;  4FED A;  5CC2 A;  3T66 A;  1N76 A;  5JTY B;  5DYH A;  2HZK A;  1IZ1 A;  1FQD A;  1S50 A;  2A5T A;  1D4N A;  1L5T A;  4C1T A;  3MWB A;  3T93 B;  3TEL A; 
#chains in the Genus database with same CATH topology
 1LFI A;  4NF8 B;  3A29 A;  1MY4 A;  3TQL A;  4GLI A;  2REJ A;  4NF4 A;  5EQ7 A;  2DVC A;  4HS7 A;  3HST A;  4YB7 A;  2XD2 A;  1MS7 A;  1SQY A;  4G4P A;  3HCQ A;  4PE5 B;  1XC1 A;  2Y84 A;  4X04 A;  3TZA A;  5CMM A;  4BDM A;  4KYD A;  4GRK A;  5AA4 A;  4XIG Q;  2FIX A;  1N3X A;  2V93 A;  4N4U A;  5BUU A;  3TKD A;  3O29 A;  2DVZ A;  4PFU A;  3QK6 A;  5I56 B;  2ZMB A;  3UP9 A;  5KCJ A;  2GFE A;  5L8D A;  4OVJ A;  1UIU A;  3C36 A;  4PDH A;  4RK2 A;  2PT2 A;  4R74 A;  3RTW B;  4C1U A;  2PFZ A;  3K01 A;  1UTH A;  4XKR A;  4QFK A;  2ZZX A;  4OXV A;  1SPI A;  4AB5 A;  3CIJ A;  1G0H A;  1NUW A;  3RPL B;  1IMD A;  3KEI A;  5ITO A;  1FQC A;  1VDW A;  1POY 1;  5ICQ A;  4OMB A;  2CZK A;  1P1O A;  2YLN A;  3PPP A;  1FBD A;  1SYH A;  1LST A;  1FPE A;  5A5L A;  4R72 A;  4QBA A;  2KLF A;  1MXZ A;  3Q26 A;  4PBH A;  3IOU A;  2Q8M A;  3OO8 A;  2B4M A;  5LDZ A;  1VR5 A;  4GWZ A;  3PPN A;  5H8H B;  4PFT A;  2HHM A;  2UVH A;  4AS4 A;  5FHM A;  1BKA A;  3FAT A;  4F29 A;  3WAF A;  1FTO A;  2H5Y A;  3E79 A;  4JB7 A;  1YPN A;  4KD5 A;  3V8X B;  4IR8 A;  1AH5 A;  2ONR A;  3UN6 A;  2QSX A;  3AXF A;  2DE2 A;  1YYZ A;  2R9J A;  4TLL B;  2PVU A;  1NH7 A;  4KFQ A;  2CZH A;  3B50 A;  4O7M A;  2Q2C A;  5I7I A;  1HSJ A;  3L6G A;  1EYJ A;  2O7U A;  1LAX A;  1PEB A;  4PE3 A;  1LEV A;  1P99 A;  1BLF A;  4G2Z A;  4UA8 A;  3KN8 A;  5FTH A;  2CEY A;  2UYE A;  3IO6 A;  5I58 A;  5I57 A;  3PUV E;  1FPI A;  1PBP A;  4MFI A;  1IIT A;  3VLW A;  3UIF A;  2O6A A;  2HAU A;  5HPQ A;  2AL4 A;  2H25 A;  2UYF A;  4R2B A;  5EYH A;  5FHN A;  1FBF A;  1URD A;  3T9V A;  3HHG A;  4GXS B;  3S9N C;  4OEN A;  3TCF A;  3VV5 A;  2DQV A;  1NFT A;  2HFB A;  2XXW A;  3MPL A;  4NWC A;  4F1Y A;  4H8I A;  3BBR A;  3ZKK A;  2VPO A;  2V25 A;  2E1S A;  1G0I A;  3A3C A;  2OWZ A;  2ZNT A;  2ZYO A;  2BJI A;  4MJO A;  2I3W A;  4GBV A;  1LCF A;  1ELJ A;  3DP4 A;  2ANJ A;  4P8B A;  1IXH A;  4PF8 A;  3SET A;  1OVT A;  4MH5 A;  1JVY A;  2QPQ A;  4DDD A;  3UA8 A;  3MZ1 A;  3A09 A;  2F97 A;  4GWY A;  3FVO A;  2ZYN A;  2DWJ A;  1TFD A;  3C31 A;  3MVZ A;  4GFR A;  4MAG A;  4BDL A;  3IOT A;  3ZKL A;  3M3K A;  4QSE A;  2ZYK A;  3BKI B;  2RF1 A;  1TWY A;  3HHF A;  5F7V A;  3K4U A;  4DI4 B;  5EHM A;  3IJX B;  2WKY A;  2WBB A;  5HM4 B;  1XOC A;  3K2D A;  4WKM A;  4KI0 E;  2I48 A;  4R9F A;  4PP0 A;  5J16 A;  2IA4 A;  4M4G A;  3QAX A;  4YB6 A;  3FJ7 A;  3PPR A;  1A8F A;  3G3G A;  3KOS A;  1NV3 A;  1FTJ A;  1NV2 A;  1ZIU A;  1ZLQ A;  3Q25 A;  4NE4 A;  1YZ0 A;  4PFR A;  3PUX E;  2GHB A;  3OO7 A;  2Q74 A;  1MG1 A;  3IOR A;  4H5F A;  2DE3 A;  1M5F A;  1AMF A;  1VE4 A;  1SW5 A;  1EU8 A;  4ESX A;  4GL0 A;  1D3K A;  1FTK A;  2Q88 A;  1CNQ A;  1B3F A;  1BK4 A;  2OK2 A;  3EF7 A;  4YIC A;  4PDD A;  4OVP A;  2WYP A;  3FAS A;  4OFJ A;  4QRZ A;  2Y5K A;  2XXR A;  3OD7 A;  1B6H A;  4YB5 A;  4IO6 A;  1IXG A;  1FQB A;  3H6W A;  4TOZ A;  2ZNU A;  4N6D A;  2HZL A;  5EQ8 A;  1OQH A;  4OVQ A;  1RDY A;  4L17 A;  5CMK A;  3KN7 A;  4O94 A;  2CZI A;  2Y7K A;  3KJ7 A;  4ZEB A;  5FTI A;  1R6Z A;  5TU0 A;  3U72 A;  2QVU A;  5H8N B;  5ET8 A;  2I58 A;  3C9H A;  4OER A;  1NMU A;  3OEN A;  3VVF A;  1FPL A;  3E3K A;  3LSW A;  1NI9 A;  1Y20 A;  3VVE A;  4XFE A;  5EHS A;  1LCT A;  1ZU0 A;  4N91 A;  1LBY A;  1DTG A;  4IO2 A;  3MVX A;  4ZS9 A;  5I2N A;  1S9T A;  1USY E;  1MDQ A;  3GXA A;  1FQA A;  4QF9 A;  1QJM A;  1FPK A;  1SI0 A;  3S9L C;  3O97 A;  4EDP A;  3G7W A;  5CMB A;  3VLU A;  4OWD A;  3T9U A;  1OLA A;  3B6Q A;  3S9M C;  1D9V A;  4I1D A;  5IAI A;  1B51 A;  3VXC A;  3SES A;  3T9X B;  3JYR A;  1ANF A;  1MRP A;  5B70 A;  2VOZ A;  2OJT A;  5DVJ A;  4YKJ A;  4KPT A;  5ET6 A;  5BWJ A;  1YTV A;  2VGQ A;  3IJO B;  5TP9 B;  5M2V A;  3QSL A;  3OO9 A;  3TEP A;  3USD A;  1ZTY A;  1RYO A;  2XXI A;  1YAE A;  4MF3 A;  3KBZ A;  1I6Q A;  2I0C A;  3MVY A;  1B2H A;  4GXA A;  5ISU A;  4IY6 A;  5CI5 A;  1MQG A;  5AE4 A;  1B7Z A;  4WED A;  1FJ6 A;  1MXX A;  1M5D A;  1URG A;  1B5I A;  5ET7 A;  2OZZ A;  2PYY A;  4HCY A;  4H5G A;  4Q5T A;  2JJK A;  1Y1M A;  2B65 A;  4NQ8 A;  3RUM A;  3TYH A;  4QFL A;  1B05 A;  1NV6 A;  4PAI A;  2XWO A;  3H7M A;  1PDA A;  4P0G A;  3KZG A;  3P7I A;  5DW8 A;  2OWS A;  4RY1 A;  1AIV A;  1HSE A;  5ELV A;  3TAJ A;  3Q29 A;  1DMB A;  2PBW A;  4EF1 A;  2H4I A;  3H06 B;  1B1H A;  3EHS A;  5DVF A;  3C4M A;  3CG3 A;  3CI8 A;  4YKK A;  2WYK A;  4DXB A;  4IO7 A;  4F3S A;  5IGA A;  3TFL A;  2F8D A;  2D21 A;  2ESN A;  1HSL A;  4H1X A;  4THI A;  1NUY A;  4NAP A;  3SEU A;  2Y7R A;  2XWK A;  4C0R A;  4EXL A;  1I69 A;  2VHA A;  1FPB A;  1IMF A;  4IGR A;  1DTZ A;  1EYI A;  2DDK A;  5EQ9 A;  3RPW A;  4X9T A;  4U4X A;  1IXI A;  1CE2 A;  2QVV A;  4FAT A;  3TQW A;  4NHB A;  1LBB A;  1MXY A;  3ODB A;  4OVR A;  2DE4 A;  3CG1 A;  4F2Q A;  2PCR A;  5H8S A;  1BP5 A;  3IB0 A;  4X48 A;  2DSF A;  1WDN A;  4ZEF A;  2PMS A;  2RIN A;  2XXU A;  1O7T A;  5FHO A;  2V3T A;  2Y5L A;  4GWS A;  4U2R A;  5I5P A;  1LB9 A;  2Z8D A;  3N6U A;  3DLN A;  3H3G A;  3SZP A;  1N7W A;  4OFL A;  2CEX A;  2Z23 A;  3TMG A;  1FQF A;  3G3H A;  4QFP A;  4MNP A;  4DIG A;  3RGY A;  3N26 A;  4ZEI A;  1NV5 A;  5TPA A;  4EUO A;  4FEB A;  1H3D A;  4YU0 A;  5H8F B;  3ZSF A;  1YCJ A;  5DEX A;  3N5L A;  3EKI A;  4U1O A;  2KR0 A;  2E0S A;  2UVI A;  1XVX A;  1EZ9 A;  2DOJ A;  5K2X A;  2XXK A;  2GRV A;  5H8Q A;  1UQW A;  4LZ5 A;  2AL5 A;  1JEU A;  3B6T A;  5L9O A;  4P1E A;  1B9J A;  2Y7P A;  3W15 C;  2Q9T A;  2HEU A;  1QKA A;  2DP8 A;  2IEE A;  1H76 A;  3PUW E;  2FHY A;  3MPK A;  2QS1 A;  5IZ3 B;  3ZS6 A;  3OSQ A;  3TDJ A;  1LB8 A;  2XXH A;  3TTK A;  3VE1 B;  3CFX A;  5I59 A;  4Q8R A;  4POW A;  3GLB A;  1EH3 A;  4JVC A;  1ATG A;  4YMB A;  1JVX A;  1FTM A;  4ESW A;  1MQI A;  1USY H;  5I2K B;  4MEV A;  2UVG A;  2F36 A;  2O1M A;  4PQJ A;  1NUZ A;  1JNF A;  4M1V A;  2RC7 A;  1AL3 A;  1DBZ A;  4P56 A;  4NTL A;  3LSL A;  3MJN A;  4GOT A;  1T0K A;  2BJJ X;  1IME A;  4DZ1 A;  4HE2 A;  4K3F A;  2VD3 A;  4PET A;  4G68 C;  4BLA A;  5KDT A;  2AYS A;  4P1L A;  1B3H A;  4HTG A;  4PFI A;  4N6K A;  3K0V A;  3M3L A;  3W9W A;  3U93 A;  3G3J A;  3MC2 A;  2XX8 A;  1Z7M E;  1FTL A;  2NXO A;  2OBG A;  4F1U A;  1N7X A;  1XT8 A;  4UAB A;  4LVQ A;  1Y4C A;  4ZE8 A;  5KZT A;  3FXB A;  3ILT B;  1UTB A;  3KC1 A;  1DOT A;  2QFL A;  2XWI A;  4ZZE A;  3SER A;  4DXC A;  2PX1 A;  4JWX A;  1GGG A;  2ABH A;  4PGN A;  3W9V A;  2R6G E;  1OIB A;  3TOD A;  1QUL A;  5AA2 A;  3PUZ E;  2A5T B;  3MZB A;  2A5S A;  3FD3 A;  2F5X A;  2O84 X;  5ET5 A;  2F34 A;  4F2O A;  3QXM A;  3N6T A;  1FPJ A;  4RA1 A;  3TTM A;  5A5X A;  1R1N A;  1B32 A;  1MXU A;  2UVJ A;  3IB2 A;  4NF4 B;  4I9D A;  1P1W A;  4NGU A;  1MQD A;  4I40 A;  1R9Q A;  3U65 A;  1K9Y A;  1M5B A;  4XXU A;  3UOR A;  1VFE A;  1B4Z A;  2QRY A;  2Z8E A;  3RQT A;  3FXU A;  4I8C A;  4I3Y A;  1LBZ A;  1VSO A;  3RLF E;  5AA4 B;  5IKB A;  1GV8 A;  4PTK A;  2X7Q A;  2QVR A;  3OSR A;  1I6A A;  2D3I A;  3R6U A;  1RDZ A;  1URS A;  3K6X A;  3OXN A;  5KCJ B;  4ND9 A;  1IMB A;  4KXP A;  3E13 X;  3BFT A;  4RK9 A;  1B4H A;  2NWJ A;  4NF5 A;  1FPG A;  3V89 B;  2QMW A;  3G3F A;  3T0J A;  4N8Y A;  1UTH B;  1QUJ A;  3IFA A;  3LSX A;  4UAC A;  1EZP A;  4G68 A;  3GBB A;  4LZ7 A;  2OWT A;  2DWA A;  2FBP A;  2HCA A;  1OLC A;  5LOM A;  4JXI A;  3O66 A;  2X26 A;  1FQE A;  4F39 A;  2Q2A A;  4ZE9 A;  4IY5 A;  5HBC A;  1LGB C;  4IB2 A;  3F11 A;  4P0I A;  4DI3 D;  1JW1 A;  2RKM A;  4DCY A;  1KA1 A;  1MXV A;  1FPF A;  3KFM A;  1MPB A;  2FVZ A;  3SKP A;  2ALU A;  1FBE A;  4KQP A;  1LAF E;  4PFW A;  1LFG A;  1XI6 A;  2O68 A;  1KA0 A;  1SBP A;  5CBS A;  2I4C A;  1D9Y A;  2O69 A;  3RT8 A;  1MY1 A;  3MUQ A;  2VPN A;  3D1R A;  4H8J A;  3KOT A;  5JTY A;  2HQ0 A;  5CBR A;  3PTY A;  4GWW A;  3FUZ A;  4NMY A;  4PCD A;  1TT1 A;  1YXI A;  2RC8 A;  4QSC A;  3LSF B;  3TPA A;  1JW5 A;  2I4B A;  2RCA A;  4LON B;  4NF8 A;  4OAN A;  1DPP A;  3O6H A;  1IUD A;  2F3D A;  1Q1K A;  4F18 A;  2ONK E;  4U4S A;  4GF8 A;  2P2A A;  4LZ8 A;  2R71 A;  4MLQ A;  2O1L A;  2QS4 A;  1NV0 A;  4GIZ A;  2I3V A;  4H46 A;  2H99 A;  3RYD A;  2KQZ A;  4NED A;  5EQA A;  2OX3 A;  3K6U A;  3U1O A;  3FJM A;  3EHU A;  2Q8J A;  2V4C A;  4GL8 A;  4OA4 A;  5I56 A;  1MQJ A;  2V3Q A;  2F6P A;  1LBW A;  3B7D A;  2OCU A;  5I58 B;  5I57 B;  1B0H A;  3CSB A;  1K9Z A;  1TFA A;  2XA5 A;  3ISP A;  4YAH X;  3IFC A;  1MY3 A;  1J1N A;  4O7I A;  4N15 A;  5LTC A;  2V3U A;  1SI1 A;  1M5C A;  3O9P A;  3FXQ A;  3Q28 A;  3SDF A;  1GR2 A;  1IMC A;  3RPL A;  1Y3Q A;  4RPO A;  4KCD A;  4DE8 A;  4F3B A;  3DP6 A;  1F9B A;  3CVG A;  2VP1 A;  4GWX A;  3MBP A;  3PMX A;  3FV2 A;  4LQ2 A;  4E0X A;  4GX4 A;  3EPE A;  4H6D A;  3KSX A;  4GVO A;  3QYT A;  5EYG A;  3MP6 A;  1M5E A;  1LBX A;  4PGP A;  2O7I A;  1NL5 A;  5H8H A;  3ONM A;  1A54 A;  2L5V A;  4JVD A;  4JWO A;  1PB9 A;  2XXX A;  4JVI A;  2OLB A;  4EQ9 A;  2PFY A;  3K1P A;  4LQ5 A;  3IB1 A;  3BIG A;  1QVS A;  1B7U A;  4MX6 A;  3KJT A;  3FBP A;  3H6T A;  3IOW A;  4I62 A;  3VDF A;  1NNF A;  2CMO A;  2FA7 A;  1FSA A;  3T96 B;  4EQ7 A;  2QS2 A;  1N84 A;  1N0T A;  2DYX A;  4XEQ A;  3MAM A;  4AS5 A;  4O8M A;  3O6I A;  5F1Q A;  1R9L A;  1A8E A;  1RDX A;  2XXP A;  3E78 A;  4PC9 A;  1NNK A;  3SEW A;  4MLV A;  2P0S A;  4R9G A;  1LBC A;  2P3V A;  2XHD A;  4R6Y A;  4U1Z A;  3TUS A;  2ZZV A;  3K00 A;  3O6G A;  2XWV A;  1Y1Z A;  4H0W A;  3FIR A;  1NV4 A;  3GYY A;  1KZ8 A;  4PFB A;  3H6U A;  1ZJL A;  5F24 A;  4ZEC A;  2THI A;  1Y4T A;  1FCK A;  1A99 A;  4FIM A;  1DSN A;  4O3B A;  3I6V A;  4R2F A;  5L9M A;  4NF6 B;  1XVY A;  4KYS A;  4Z7E A;  4YKP A;  3MP1 A;  4RPN A;  3S4U A;  3H6V A;  3TCG A;  1FPD A;  3VVD A;  1P1U A;  3H03 A;  4POX A;  1WVJ A;  1H43 A;  4ZDM A;  1IIW A;  1Z7N E;  4ZZA A;  3ECR A;  4FEC A;  4KHZ E;  4OES A;  2NUV A;  3S2V A;  3TCH A;  2NVU B;  3V5A A;  3UK4 A;  4FJP A;  3UGW A;  2QL3 A;  3K6V A;  4R6K A;  3M3F A;  4X1D A;  1FBP A;  2B3F A;  5AA3 A;  1B0L A;  2GH9 A;  4LP2 B;  3I5O A;  1AOV A;  1FBG A;  1PB8 A;  4R73 A;  4MMP A;  5AA2 D;  5I2N B;  2ZZW A;  4MCO A;  1IEJ A;  4JDF A;  3HO7 A;  2LAO A;  4NF0 A;  1MM6 A;  1AWB A;  4FOR A;  4P11 A;  4OFO A;  1Y9U A;  1N04 A;  3O2A A;  1QW0 A;  1SD3 A;  2VD2 A;  2DXR A;  4MHF A;  4IO3 A;  1Q35 A;  2G29 A;  2WEF A;  4YZZ A;  1NNP A;  1B7H A;  3B8B A;  3OO6 A;  1H44 A;  2Q89 A;  4DXU A;  1MXW A;  3IAZ A;  3PV0 E;  4GD5 A;  3MZ9 A;  3M8U A;  2XX7 A;  4Q30 B;  4RJZ A;  3RN8 A;  3IK6 B;  4R75 A;  2HXR A;  1D9Q A;  5J1D A;  3WAE A;  3H4Z A;  4ONY A;  3MVW A;  3RNN A;  1B46 A;  3U92 A;  2PT1 A;  3N94 A;  2Y7W A;  1MPD A;  2X7P A;  2XXQ A;  1B58 A;  4ELP A;  4F1V A;  3IO4 A;  4GWO A;  1FBC A;  1FTA A;  2I6E A;  3ILU B;  5EYF A;  4PFY A;  1JET A;  4NG7 A;  1O64 A;  4JWY A;  1IMA A;  3KGC A;  4QHQ A;  3R26 A;  5IZZ A;  4RXL A;  1US5 A;  5B7D A;  1PBQ A;  3BFU A;  4BDR A;  2F3B A;  3D4C A;  3C34 A;  5CRY A;  1ZBM A;  3KC0 A;  3CRB A;  2F7B A;  2QMX A;  3FZV A;  4O3C A;  4EXK A;  4LUB A;  5H8N A;  1IQ7 A;  4OYV A;  1JW4 A;  3JZJ A;  4JSO A;  4O3A A;  4KR5 A;  1B5J A;  1P1N A;  4BDN A;  1LFH A;  3O28 A;  5IZ1 A;  4N81 A;  2ZXT A;  2DXY A;  2HAV A;  4G77 A;  4TQU Q;  3CFZ A;  1SW1 A;  4AQ4 A;  3SEY A;  5ITP A;  5JK4 A;  4MBP A;  1FBH A;  4DCX A;  4H45 A;  3T9H B;  4G8N A;  1B3L A;  3MQ9 A;  3VXB A;  1MM7 A;  4QSD A;  2H98 A;  5L9S A;  2XXV A;  1BTJ A;  3HV1 A;  3TTL A;  2R8T A;  2VT5 A;  4FAJ A;  3FXR A;  3G3K A;  1SVX B;  4GWU A;  2WBD A;  1N3W A;  1Y3N A;  3TTN A;  3R7X A;  3GZG A;  4BDQ A;  2FIE A;  3IL1 B;  5ESY A;  1JP4 A;  4G8H A;  2CZL A;  3PU5 A;  3SEV A;  4HXV A;  3T1B A;  4H67 A;  4U22 A;  5DT6 A;  3RY3 A;  3PPO A;  5TP9 A;  4RNS A;  4OEV A;  4N6P A;  3PMW A;  3ROJ A;  1NV7 A;  2P3N A;  4PF6 A;  1LBV A;  3LUY A;  4X1B A;  3CR9 A;  3BIH A;  3MST A;  4OVS A;  4TLM B;  1MY2 A;  5T3J A;  3RT6 B;  1US4 A;  5TPA B;  1POT A;  1S7Y A;  1QUI A;  4F3P A;  3JV9 A;  1EZO A;  2FNC A;  3GBA A;  5I3S A;  2XXT A;  2GHA A;  1PB7 A;  5DEX B;  4EQB A;  2ZYM A;  4F19 A;  4QFN A;  1DPE A;  3MP8 A;  3LUZ A;  1OMP A;  3CHG A;  2ZNS A;  5H8Q B;  4U23 A;  2XD3 A;  2NOO A;  5FBP A;  3C33 A;  4N07 A;  3THI A;  1SDX A;  5K2Y A;  3SEX A;  3FGS A;  4OET A;  3G3I A;  3RTF B;  1QGX A;  1A40 A;  4ECF A;  4FBP A;  1I6B A;  4HCW A;  1JQF A;  3FVG A;  1II5 A;  1P1Q A;  1NUX A;  1DK4 A;  1LAH E;  1LLS A;  1XS5 A;  3T22 A;  3U8Q A;  4NX1 A;  5DVI A;  5I59 B;  4XKN A;  4MNC A;  1FW0 A;  1LAG E;  2HXW A;  1B3G A;  1H45 A;  2O51 A;  4F3G A;  1SW2 A;  1TXF A;  3EN3 A;  4H65 A;  4KCC A;  2XXY A;  4OTE A;  1KWH A;  4MNI A;  4QFO A;  5DTB A;  1MY0 A;  5I84 A;  5AA1 A;  4ZEK A;  4U21 A;  3MW0 A;  5IM2 A;  1B1X A;  2W7Y A;  3C32 A;  4LA9 A;  1GVC A;  1BIY A;  3LBS A;  3LV0 A;  1EYK A;  1JEV A;  3PPQ A;  3PGF A;  4Q0C A;  4E0W A;  4HE0 A;  1ZMG A;  3IX1 A;  1NV1 A;  2DWH A;  3MYU A;  4NF6 A;  1XHY A;  1ZKB A;  2F7C A;  3OEK A;  3OOA A;  4OEU A;  4DLD A;  2YJP A;  5CMC A;  4NN3 A;  5KDT B;  3OEM A;  1QUK A;  3CFL A;  1DCU A;  2DS9 A;  4JSD A;  4PAK A;  3V83 A;  2V84 A;  3Q27 A;  4N13 A;  2B4L A;  2REG A;  3A3U A;  1Q9D A;  2GQ1 A;  1B40 A;  1IXC A;  2D5W A;  2RC9 A;  4ISU A;  3HPI A;  2Y7I A;  5CM6 A;  3S9E A;  2I49 A;  2AIX A;  2B3B A;  4OQO A;  2UXA A;  2H9B A;  1A7L A;  1PC3 A;  3L6H A;  3OEL A;  3PUY E;  4ELO A;  3CSG A;  1QKB A;  4RYA A;  5H8F A;  1MDP 1;  1UTB B;  4PAF A;  4GQO A;  1RKM A;  3QUJ A;  1MH4 A;  3HFU A;  3TTR A;  3LR1 A;  1NKX A;  2F78 A;  2F6G A;  4MIJ A;  2F7A A;  1B52 A;  1CB6 A;  3E4R A;  5JEI A;  1A55 A;  5AA2 B;  1MQH A;  3FVN A;  1UIV A;  3FV1 A;  3PD9 A;  3EQ1 A;  3PD8 A;  1O63 A;  1OVB A;  4P47 A;  3DM0 A;  3LC8 A;  4F31 B;  4BDO A;  1B5H A;  4I3E A;  5A5X B;  2Z8F A;  4NWD A;  4PBQ A;  5IZ3 A;  4Z0I A;  4XKQ A;  2QS3 A;  3K6W A;  3VLV A;  4IO5 A;  4OZ9 A;  3QMF A;  1WOD A;  4FE8 A;  1RYX A;  4YMA A;  3FVK A;  4JBZ A;  4R6H A;  1GTK A;  4GBW A;  3OMB A;  4OHN A;  5I2K A;  3U94 A;  3KG2 A;  2QJE A;  4G61 A;  4P3L A;  4YKI A;  4GX6 A;  3C35 A;  1INP A;  4HW8 A;  1SW4 A;  3IOV A;  4EF2 A;  4ELQ A;  4OVT A;  1Y3P A;  3DEL B;  4NF5 B;  2XX9 A;  1OQG A;  4AB6 A;  2F35 A;  4XTC Q;  2I0B A;  3HN0 A;  3QIM A;  2Z22 A;  4XF5 A;  1NNT A;  3B6W A;  3QUF A;  3K1N A;  4G68 B;  3PMV A;  3E9X A;  4KYE A;  4ELR A;  2WX9 A;  3DP8 A;  2YPN A;  3K02 A;  3K1M A;  5ICT A;  4QXD A;  1MH3 A;  1B3E A;  3KN3 A;  4N8G A;  4G8M A;  4N17 A;  1VFD A;  3I3V A;  2ONS A;  4IO4 A;  4WEP A;  2HPG A;  4F22 A;  4X8R A;  1SYI A;  4WXJ A;  2G93 A;  4LAT A;  3D4G A;  2DWI A;  3EHT A;  2RCB A;  2FYI A;  1FRP A;  4ZED A;  3KSJ A;  2M8C A;  1MPC A;  3KBR A;  4XKP A;  4IGT A;  1NH8 A;  3FJG A;  2P1S A;  3IR1 A;  3VFJ A;  4FED A;  4HE1 A;  5CC2 A;  4P9K A;  3T66 A;  4GX3 A;  1N76 A;  5JTY B;  2MKZ A;  5DYH A;  2HZK A;  1IZ1 A;  1FQD A;  1S50 A;  2A5T A;  1D4N A;  1L5T A;  4LN5 A;  4C1T A;  3MWB A;  1FJ9 A;  3NOH A;  3T93 B;  3TEL A; 
#chains in the Genus database with same CATH homology
 1LFI A;  4NF8 B;  1MY4 A;  3TQL A;  4GLI A;  2REJ A;  4NF4 A;  2DVC A;  4HS7 A;  3HST A;  4YB7 A;  2XD2 A;  1MS7 A;  1SQY A;  4G4P A;  3HCQ A;  4PE5 B;  1XC1 A;  2Y84 A;  3TZA A;  5CMM A;  4BDM A;  4KYD A;  4GRK A;  5AA4 A;  4XIG Q;  1N3X A;  2V93 A;  5BUU A;  3TKD A;  3O29 A;  2DVZ A;  4PFU A;  3QK6 A;  5I56 B;  2ZMB A;  3UP9 A;  5KCJ A;  2GFE A;  5L8D A;  4OVJ A;  1UIU A;  3C36 A;  4RK2 A;  2PT2 A;  4R74 A;  3RTW B;  4C1U A;  3K01 A;  1UTH A;  4XKR A;  4QFK A;  4OXV A;  4AB5 A;  3CIJ A;  3KEI A;  5ITO A;  1FQC A;  1POY 1;  5ICQ A;  4OMB A;  1P1O A;  2YLN A;  3PPP A;  1SYH A;  1LST A;  4R72 A;  2KLF A;  1MXZ A;  3Q26 A;  3IOU A;  3OO8 A;  1VR5 A;  3PPN A;  5H8H B;  4PFT A;  2UVH A;  5FHM A;  1BKA A;  3FAT A;  4F29 A;  3WAF A;  1FTO A;  2H5Y A;  4JB7 A;  1YPN A;  4KD5 A;  3V8X B;  1AH5 A;  2ONR A;  3UN6 A;  2QSX A;  3AXF A;  2DE2 A;  2R9J A;  4TLL B;  2PVU A;  1NH7 A;  4KFQ A;  2Q2C A;  1HSJ A;  3L6G A;  2O7U A;  1LAX A;  1PEB A;  1P99 A;  1BLF A;  4G2Z A;  4UA8 A;  3KN8 A;  5FTH A;  2UYE A;  3IO6 A;  5I58 A;  5I57 A;  3PUV E;  1PBP A;  4MFI A;  1IIT A;  3VLW A;  3UIF A;  2O6A A;  2HAU A;  5HPQ A;  2AL4 A;  2H25 A;  2UYF A;  4R2B A;  5FHN A;  1URD A;  3T9V A;  3HHG A;  4GXS B;  3S9N C;  4OEN A;  3TCF A;  3VV5 A;  2DQV A;  1NFT A;  2HFB A;  2XXW A;  3MPL A;  4NWC A;  4F1Y A;  4H8I A;  3BBR A;  3ZKK A;  2V25 A;  2E1S A;  3A3C A;  2ZNT A;  2ZYO A;  2I3W A;  1LCF A;  1ELJ A;  3DP4 A;  2ANJ A;  1IXH A;  3SET A;  1OVT A;  4MH5 A;  1JVY A;  2QPQ A;  4DDD A;  3UA8 A;  3MZ1 A;  3A09 A;  2F97 A;  3FVO A;  2ZYN A;  2DWJ A;  1TFD A;  3C31 A;  3MVZ A;  4GFR A;  4BDL A;  3IOT A;  3ZKL A;  3M3K A;  4QSE A;  2ZYK A;  3BKI B;  2RF1 A;  1TWY A;  3HHF A;  5F7V A;  3K4U A;  5EHM A;  3IJX B;  2WKY A;  5HM4 B;  1XOC A;  3K2D A;  4WKM A;  4KI0 E;  2I48 A;  4R9F A;  4PP0 A;  2IA4 A;  4M4G A;  3QAX A;  4YB6 A;  3FJ7 A;  3PPR A;  1A8F A;  3G3G A;  3KOS A;  1FTJ A;  1ZIU A;  1ZLQ A;  3Q25 A;  4NE4 A;  3PUX E;  2GHB A;  3OO7 A;  1MG1 A;  3IOR A;  4H5F A;  2DE3 A;  1M5F A;  1AMF A;  1VE4 A;  1SW5 A;  1EU8 A;  4ESX A;  4GL0 A;  1D3K A;  1FTK A;  2Q88 A;  1B3F A;  2OK2 A;  3EF7 A;  4YIC A;  3FAS A;  4OFJ A;  4QRZ A;  2XXR A;  3OD7 A;  1B6H A;  4YB5 A;  4IO6 A;  1IXG A;  1FQB A;  3H6W A;  4TOZ A;  2ZNU A;  2HZL A;  1OQH A;  4L17 A;  5CMK A;  3KN7 A;  2Y7K A;  3KJ7 A;  4ZEB A;  5FTI A;  1R6Z A;  5TU0 A;  3U72 A;  5H8N B;  2I58 A;  3C9H A;  4OER A;  1NMU A;  3OEN A;  3VVF A;  3E3K A;  3LSW A;  1Y20 A;  3VVE A;  5EHS A;  1LCT A;  1ZU0 A;  1DTG A;  4IO2 A;  3MVX A;  4ZS9 A;  5I2N A;  1S9T A;  1USY E;  1MDQ A;  3GXA A;  1FQA A;  4QF9 A;  1QJM A;  1SI0 A;  3S9L C;  3O97 A;  4EDP A;  3G7W A;  5CMB A;  3VLU A;  4OWD A;  3T9U A;  1OLA A;  3B6Q A;  3S9M C;  1D9V A;  4I1D A;  5IAI A;  1B51 A;  3VXC A;  3SES A;  3T9X B;  3JYR A;  1ANF A;  1MRP A;  5B70 A;  2VOZ A;  2OJT A;  5DVJ A;  4YKJ A;  4KPT A;  5BWJ A;  1YTV A;  2VGQ A;  3IJO B;  5TP9 B;  5M2V A;  3QSL A;  3OO9 A;  3TEP A;  3USD A;  1ZTY A;  1RYO A;  2XXI A;  1YAE A;  4MF3 A;  1I6Q A;  2I0C A;  3MVY A;  1B2H A;  4GXA A;  5ISU A;  4IY6 A;  5CI5 A;  1MQG A;  5AE4 A;  1B7Z A;  4WED A;  1MXX A;  1M5D A;  1URG A;  1B5I A;  2OZZ A;  2PYY A;  4HCY A;  4H5G A;  4Q5T A;  1Y1M A;  2B65 A;  3RUM A;  3TYH A;  4QFL A;  1B05 A;  3H7M A;  1PDA A;  4P0G A;  3KZG A;  3P7I A;  2OWS A;  4RY1 A;  1AIV A;  1HSE A;  5ELV A;  3TAJ A;  3Q29 A;  1DMB A;  2PBW A;  4EF1 A;  2H4I A;  3H06 B;  1B1H A;  3EHS A;  5DVF A;  3C4M A;  3CG3 A;  3CI8 A;  4YKK A;  4DXB A;  4IO7 A;  4F3S A;  3TFL A;  2F8D A;  2D21 A;  2ESN A;  1HSL A;  4H1X A;  4THI A;  3SEU A;  2Y7R A;  4C0R A;  4EXL A;  1I69 A;  2VHA A;  4IGR A;  1DTZ A;  3RPW A;  4X9T A;  4U4X A;  1IXI A;  1CE2 A;  4FAT A;  3TQW A;  1LBB A;  1MXY A;  3ODB A;  2DE4 A;  3CG1 A;  4F2Q A;  5H8S A;  1BP5 A;  3IB0 A;  4X48 A;  2DSF A;  1WDN A;  4ZEF A;  2PMS A;  2RIN A;  2XXU A;  1O7T A;  5FHO A;  2V3T A;  4U2R A;  1LB9 A;  2Z8D A;  3N6U A;  3DLN A;  3H3G A;  1N7W A;  4OFL A;  2Z23 A;  3TMG A;  1FQF A;  3G3H A;  4QFP A;  4DIG A;  3RGY A;  3N26 A;  4ZEI A;  5TPA A;  4EUO A;  4FEB A;  1H3D A;  4YU0 A;  5H8F B;  3ZSF A;  1YCJ A;  5DEX A;  3N5L A;  4U1O A;  2E0S A;  2UVI A;  1XVX A;  1EZ9 A;  2DOJ A;  5K2X A;  2GRV A;  5H8Q A;  1UQW A;  4LZ5 A;  2AL5 A;  1JEU A;  3B6T A;  5L9O A;  1B9J A;  2Y7P A;  3W15 C;  2Q9T A;  2HEU A;  1QKA A;  2DP8 A;  2IEE A;  1H76 A;  3PUW E;  3MPK A;  2QS1 A;  3ZS6 A;  3OSQ A;  3TDJ A;  1LB8 A;  2XXH A;  3TTK A;  3VE1 B;  3CFX A;  5I59 A;  4Q8R A;  3GLB A;  4POW A;  1EH3 A;  1ATG A;  4YMB A;  1JVX A;  1FTM A;  4ESW A;  1MQI A;  1USY H;  5I2K B;  2UVG A;  2F36 A;  2O1M A;  4PQJ A;  1JNF A;  4M1V A;  2RC7 A;  1AL3 A;  4NTL A;  3LSL A;  3MJN A;  4GOT A;  1T0K A;  2BJJ X;  4DZ1 A;  4K3F A;  2VD3 A;  4PET A;  4G68 C;  4BLA A;  5KDT A;  2AYS A;  1B3H A;  4HTG A;  3K0V A;  3M3L A;  3W9W A;  3U93 A;  3G3J A;  3MC2 A;  2XX8 A;  1Z7M E;  1FTL A;  2NXO A;  2OBG A;  4F1U A;  1N7X A;  1XT8 A;  4LVQ A;  1Y4C A;  4ZE8 A;  5KZT A;  3ILT B;  1UTB A;  1DOT A;  4ZZE A;  3SER A;  4DXC A;  2PX1 A;  4JWX A;  1GGG A;  2ABH A;  3W9V A;  2R6G E;  1OIB A;  3TOD A;  1QUL A;  5AA2 A;  3PUZ E;  2A5T B;  3MZB A;  2A5S A;  3FD3 A;  2F5X A;  2O84 X;  2F34 A;  4F2O A;  3QXM A;  3N6T A;  4RA1 A;  3TTM A;  5A5X A;  1R1N A;  1B32 A;  1MXU A;  2UVJ A;  3IB2 A;  4NF4 B;  4I9D A;  1P1W A;  1MQD A;  1R9Q A;  1M5B A;  4XXU A;  3UOR A;  1VFE A;  1B4Z A;  2QRY A;  2Z8E A;  3RQT A;  3FXU A;  4I8C A;  1VSO A;  3RLF E;  5AA4 B;  5IKB A;  1GV8 A;  2X7Q A;  3OSR A;  1I6A A;  2D3I A;  3R6U A;  1URS A;  3K6X A;  3OXN A;  5KCJ B;  4ND9 A;  3E13 X;  3BFT A;  4RK9 A;  1B4H A;  2NWJ A;  4NF5 A;  3V89 B;  2QMW A;  3G3F A;  1UTH B;  1QUJ A;  3LSX A;  4UAC A;  1EZP A;  4G68 A;  3GBB A;  4LZ7 A;  2OWT A;  2DWA A;  2HCA A;  1OLC A;  5LOM A;  4JXI A;  3O66 A;  2X26 A;  1FQE A;  4F39 A;  2Q2A A;  4ZE9 A;  4IY5 A;  5HBC A;  1LGB C;  4IB2 A;  3F11 A;  4P0I A;  1JW1 A;  2RKM A;  4DCY A;  1MXV A;  3KFM A;  1MPB A;  3SKP A;  2ALU A;  4KQP A;  1LAF E;  4PFW A;  1LFG A;  2O68 A;  1SBP A;  5CBS A;  2I4C A;  1D9Y A;  2O69 A;  3RT8 A;  1MY1 A;  3MUQ A;  4H8J A;  3KOT A;  5JTY A;  2HQ0 A;  5CBR A;  3FUZ A;  4NMY A;  1TT1 A;  2RC8 A;  4QSC A;  3LSF B;  3TPA A;  1JW5 A;  2I4B A;  2RCA A;  4LON B;  4NF8 A;  1DPP A;  3O6H A;  1IUD A;  1Q1K A;  4F18 A;  2ONK E;  4U4S A;  4GF8 A;  2P2A A;  4LZ8 A;  2R71 A;  4MLQ A;  2O1L A;  2QS4 A;  4GIZ A;  2I3V A;  2H99 A;  4NED A;  3K6U A;  3U1O A;  3FJM A;  3EHU A;  2Q8J A;  4GL8 A;  5I56 A;  1MQJ A;  2V3Q A;  2F6P A;  3B7D A;  2OCU A;  5I58 B;  5I57 B;  1B0H A;  3CSB A;  1TFA A;  4YAH X;  1MY3 A;  1J1N A;  2V3U A;  1SI1 A;  1M5C A;  3O9P A;  3FXQ A;  3Q28 A;  3SDF A;  1GR2 A;  1Y3Q A;  4RPO A;  4KCD A;  4DE8 A;  4F3B A;  3DP6 A;  1F9B A;  3CVG A;  2VP1 A;  3MBP A;  3PMX A;  3FV2 A;  4LQ2 A;  4E0X A;  3EPE A;  4H6D A;  3KSX A;  4GVO A;  3QYT A;  3MP6 A;  1M5E A;  2O7I A;  1NL5 A;  5H8H A;  3ONM A;  1A54 A;  4JWO A;  1PB9 A;  2XXX A;  2OLB A;  4EQ9 A;  3K1P A;  4LQ5 A;  3IB1 A;  1QVS A;  1B7U A;  3KJT A;  3H6T A;  3IOW A;  4I62 A;  3VDF A;  1NNF A;  2CMO A;  2FA7 A;  3T96 B;  4EQ7 A;  2QS2 A;  1N84 A;  1N0T A;  2DYX A;  3MAM A;  3O6I A;  5F1Q A;  1A8E A;  1R9L A;  2XXP A;  1NNK A;  3SEW A;  4MLV A;  2P0S A;  4R9G A;  1LBC A;  2XHD A;  4R6Y A;  4U1Z A;  3TUS A;  3K00 A;  3O6G A;  1Y1Z A;  4H0W A;  3FIR A;  3H6U A;  1ZJL A;  4ZEC A;  2THI A;  1Y4T A;  1FCK A;  1A99 A;  4FIM A;  1DSN A;  4O3B A;  3I6V A;  4R2F A;  5L9M A;  4NF6 B;  1XVY A;  4KYS A;  4Z7E A;  4YKP A;  3MP1 A;  4RPN A;  3S4U A;  3TCG A;  3H6V A;  3VVD A;  1P1U A;  3H03 A;  4POX A;  1WVJ A;  1H43 A;  4ZDM A;  1IIW A;  1Z7N E;  4ZZA A;  3ECR A;  4FEC A;  4KHZ E;  4OES A;  2NUV A;  3S2V A;  3TCH A;  2NVU B;  3V5A A;  3UK4 A;  4FJP A;  3UGW A;  2QL3 A;  3K6V A;  4R6K A;  3M3F A;  4X1D A;  2B3F A;  5AA3 A;  1B0L A;  2GH9 A;  4LP2 B;  3I5O A;  1AOV A;  1PB8 A;  4R73 A;  5AA2 D;  5I2N B;  1IEJ A;  4JDF A;  3HO7 A;  2LAO A;  1MM6 A;  4FOR A;  4P11 A;  4OFO A;  1Y9U A;  1N04 A;  3O2A A;  1QW0 A;  1SD3 A;  2VD2 A;  2DXR A;  4IO3 A;  1Q35 A;  2G29 A;  4YZZ A;  1NNP A;  1B7H A;  3OO6 A;  1H44 A;  2Q89 A;  4DXU A;  1MXW A;  3IAZ A;  3PV0 E;  4GD5 A;  3MZ9 A;  3M8U A;  2XX7 A;  4Q30 B;  4RJZ A;  3RN8 A;  3IK6 B;  4R75 A;  5J1D A;  3WAE A;  3H4Z A;  4ONY A;  3MVW A;  3RNN A;  1B46 A;  3U92 A;  2PT1 A;  3N94 A;  2Y7W A;  1MPD A;  2X7P A;  2XXQ A;  1B58 A;  4ELP A;  4F1V A;  3IO4 A;  4GWO A;  2I6E A;  3ILU B;  5EYF A;  4PFY A;  1JET A;  1O64 A;  4JWY A;  3KGC A;  4QHQ A;  3R26 A;  4RXL A;  1US5 A;  5B7D A;  1PBQ A;  3BFU A;  4BDR A;  3D4C A;  3C34 A;  5CRY A;  1ZBM A;  3CRB A;  2F7B A;  2QMX A;  3FZV A;  4O3C A;  4EXK A;  4LUB A;  5H8N A;  1IQ7 A;  4OYV A;  1JW4 A;  3JZJ A;  4JSO A;  4O3A A;  4KR5 A;  1B5J A;  1P1N A;  4BDN A;  1LFH A;  3O28 A;  2ZXT A;  2DXY A;  2HAV A;  4G77 A;  4TQU Q;  3CFZ A;  1SW1 A;  4AQ4 A;  3SEY A;  5ITP A;  5JK4 A;  4MBP A;  4DCX A;  3T9H B;  4G8N A;  1B3L A;  3MQ9 A;  3VXB A;  1MM7 A;  4QSD A;  2H98 A;  5L9S A;  2XXV A;  1BTJ A;  3HV1 A;  3TTL A;  4FAJ A;  3FXR A;  3G3K A;  1SVX B;  1N3W A;  1Y3N A;  3TTN A;  3R7X A;  3GZG A;  4BDQ A;  3IL1 B;  4G8H A;  2CZL A;  3PU5 A;  3SEV A;  4H67 A;  4U22 A;  5DT6 A;  3RY3 A;  3PPO A;  5TP9 A;  4RNS A;  4OEV A;  4N6P A;  3PMW A;  3LUY A;  4X1B A;  3CR9 A;  4TLM B;  1MY2 A;  3RT6 B;  1US4 A;  5TPA B;  1POT A;  1S7Y A;  1QUI A;  4F3P A;  3JV9 A;  1EZO A;  2FNC A;  3GBA A;  2XXT A;  2GHA A;  1PB7 A;  5DEX B;  4EQB A;  2ZYM A;  4F19 A;  4QFN A;  1DPE A;  3MP8 A;  1OMP A;  2ZNS A;  5H8Q B;  4U23 A;  2XD3 A;  2NOO A;  3C33 A;  4N07 A;  3THI A;  1SDX A;  5K2Y A;  3SEX A;  3FGS A;  4OET A;  3G3I A;  3RTF B;  1A40 A;  4ECF A;  1I6B A;  4HCW A;  1JQF A;  3FVG A;  1II5 A;  1P1Q A;  1LAH E;  1LLS A;  1XS5 A;  3T22 A;  3U8Q A;  5DVI A;  5I59 B;  4XKN A;  1FW0 A;  1LAG E;  2HXW A;  1B3G A;  1H45 A;  2O51 A;  4F3G A;  1SW2 A;  1TXF A;  3EN3 A;  4H65 A;  4KCC A;  2XXY A;  4OTE A;  1KWH A;  4QFO A;  5DTB A;  1MY0 A;  5I84 A;  5AA1 A;  4ZEK A;  4U21 A;  3MW0 A;  1B1X A;  2W7Y A;  3C32 A;  4LA9 A;  1GVC A;  1BIY A;  3LBS A;  1JEV A;  3PPQ A;  3PGF A;  4Q0C A;  4E0W A;  1ZMG A;  3IX1 A;  2DWH A;  4NF6 A;  1XHY A;  1ZKB A;  2F7C A;  3OEK A;  3OOA A;  4OEU A;  4DLD A;  2YJP A;  5CMC A;  5KDT B;  3OEM A;  1QUK A;  3CFL A;  2DS9 A;  4JSD A;  3V83 A;  2V84 A;  3Q27 A;  4N13 A;  2REG A;  3A3U A;  1B40 A;  1IXC A;  2D5W A;  2RC9 A;  4ISU A;  3HPI A;  2Y7I A;  5CM6 A;  3S9E A;  2I49 A;  2AIX A;  2B3B A;  4OQO A;  2UXA A;  2H9B A;  1A7L A;  1PC3 A;  3L6H A;  3OEL A;  3PUY E;  4ELO A;  3CSG A;  1QKB A;  4RYA A;  5H8F A;  1MDP 1;  1UTB B;  4GQO A;  1RKM A;  3QUJ A;  1MH4 A;  3TTR A;  3LR1 A;  1NKX A;  2F78 A;  2F6G A;  2F7A A;  1B52 A;  1CB6 A;  3E4R A;  5JEI A;  1A55 A;  5AA2 B;  1MQH A;  3FVN A;  1UIV A;  3FV1 A;  3PD9 A;  3EQ1 A;  3PD8 A;  1O63 A;  1OVB A;  3DM0 A;  3LC8 A;  4F31 B;  4BDO A;  1B5H A;  5A5X B;  2Z8F A;  4NWD A;  4Z0I A;  4XKQ A;  2QS3 A;  3K6W A;  3VLV A;  4IO5 A;  4OZ9 A;  1WOD A;  4FE8 A;  1RYX A;  4YMA A;  3FVK A;  4JBZ A;  4R6H A;  1GTK A;  3OMB A;  4OHN A;  5I2K A;  3U94 A;  3KG2 A;  2QJE A;  4YKI A;  3C35 A;  4HW8 A;  1SW4 A;  3IOV A;  4EF2 A;  4ELQ A;  1Y3P A;  3DEL B;  4NF5 B;  2XX9 A;  1OQG A;  4AB6 A;  2F35 A;  4XTC Q;  2I0B A;  3HN0 A;  3QIM A;  2Z22 A;  1NNT A;  3B6W A;  3QUF A;  3K1N A;  4G68 B;  3PMV A;  3E9X A;  4KYE A;  4ELR A;  3DP8 A;  2YPN A;  3K02 A;  3K1M A;  5ICT A;  1MH3 A;  1B3E A;  3KN3 A;  4G8M A;  1VFD A;  3I3V A;  2ONS A;  4IO4 A;  4WEP A;  4F22 A;  1SYI A;  4WXJ A;  2G93 A;  4LAT A;  3D4G A;  2DWI A;  3EHT A;  2RCB A;  2FYI A;  4ZED A;  3KSJ A;  2M8C A;  1MPC A;  3KBR A;  4XKP A;  4IGT A;  1NH8 A;  3FJG A;  2P1S A;  3IR1 A;  3VFJ A;  4FED A;  5CC2 A;  3T66 A;  1N76 A;  5JTY B;  5DYH A;  2HZK A;  1IZ1 A;  1FQD A;  1S50 A;  2A5T A;  1D4N A;  1L5T A;  4C1T A;  3MWB A;  3T93 B;  3TEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...