2H9BA

Crystal structure of the effector binding domain of a benm variant (benm r156h/t157s)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
216
Chain Sequence
EKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKHSLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator benM
publication title Inducer responses of BenM, a LysR-type transcriptional regulator from Acinetobacter baylyi ADP1.
pubmed doi rcsb
source organism Acinetobacter sp.
total genus 69
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h9bA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h9bA02
3W15C 1MY4A 3IB0A 4YICA 1MY2A 3SEVA 2Y84A 4JWOA 5H8QA 3K6VA 3MVYA 4GVOA 4Q30B 1OLAA 1FQDA 3DLNA 1URGA 2M8CA 4NEDA 2RC8A 3OXNA 4XKRA 2Q89A 2NXOA 3VLWA 1HSEA 4PFUA 1IXCA 3U92A 4ESWA 4N07A 4OQOA 1MXXA 4G8NA 2G93A 4U21A 3AXFA 1B32A 3O6GA 5TP9A 3ILUB 1I6AA 4BDRA 4X9TA 3OO9A 2V93A 1B6HA 4FECA 2I3VA 5AA4A 4GL0A 1P1UA 2R71A 3PMXA 4NF4A 1AMFA 1M5BA 2DVZA 3KG2A 1UIUA 3F11A 1FTJA 5B7DA 4NTLA 1JQFA 3G3IA 2XD3A 3T9UA 5H8FB 3M3LA 4BDMA 4F39A 4QFNA 1LBCA 3TTMA 3RGYA 5I58A 4GL8A 3LSLA 4KHZE 4OETA 3KSXA 3ODBA 3C35A 3FVKA 1B51A 2RCBA 1IZ1A 1NFTA 1PBPA 1LFHA 4R73A 3H4ZA 3B6QA 5F1QA 4MLQA 3FJMA 3FXRA 1ZBMA 2XD2A 3QIMA 1AOVA 4MLVA 5I56A 1MQGA 1DSNA 1SW1A 3T66A 3OENA 1GTKA 1QJMA 1FQBA 3E4RA 3B7DA 3IJXB 4R6KA 3CFLA 2QS2A 1XT8A 4ZEFA 1NH8A 2ESNA 1FQFA 4R9FA 3JYRA 3FUZA 1LGBC 5AA2D 3JZJA 2B65A 4BDNA 3M8UA 4DXCA 4ZEKA 2YLNA 4FJPA 2D3IA 4OFOA 2OWSA 1SVXB 4FATA 4K3FA 3E9XA 3H03A 1USYH 3LBSA 5HBCA 3W9VA 4PETA 2Q9TA 3BFTA 3B6TA 3R26A 1JNFA 3PPNA 2REJA 4OYVA 4OTEA 2REGA 2VGQA 4C1TA 3PPQA 1TFAA 1ANFA 1M5FA 2UVIA 2HFBA 3T93B 4X1DA 3PU5A 1SYIA 1Y1ZA 2ZNUA 1BKAA 3HV1A 3KN7A 5AA1A 4OVJA 4NF5A 1M5DA 2O51A 2Y7RA 5F7VA 1N04A 2A5TB 3H6WA 4YZZA 5CRYA 5H8HB 2QS3A 1MS7A 5DVIA 3O28A 5I2NA 2HQ0A 4QFOA 1B4HA 3T9HB 4U23A 1DOTA 4KI0E 3VLUA 4JB7A 4OEVA 5H8NA 4I62A 1PC3A 2F7CA 1N3XA 3HSTA 4OESA 2B3BA 4F1UA 1OIBA 5KDTA 3R7XA 4F2QA 5J1DA 1M5EA 3OO6A 4FIMA 1MDQA 2QMWA 3ZS6A 1UIVA 5CBRA 3PPOA 4OEUA 1SYHA 5A5XA 3MP8A 4IY6A 4XKNA 4KQPA 2DOJA 3U94A 1P1QA 4P0GA 4OFLA 3PUZE 2V3UA 1B40A 3RTFB 2H9BA 3RQTA 3DP4A 5FHNA 3K1PA 1ELJA 3CVGA 5JTYB 4Q5TA 4RJZA 3G7WA 2XHDA 5JEIA 3SETA 3SDFA 3FJGA 2E1SA 4F3PA 1S9TA 3OEMA 1IXHA 3M3FA 3K6UA 3HN0A 2HAUA 2O69A 5CM6A 1ZIUA 2QRYA 1EH3A 4LATA 3OELA 4YB6A 3G3FA 3Q28A 3QAXA 2XXRA 2OBGA 2RKMA 4AQ4A 1XVXA 3VXBA 3PPPA 3GBBA 4JSOA 2GHBA 1GR2A 4KCDA 5CMBA 3VLVA 4POXA 4JBZA 4PFWA 4G68B 1NH7A 4Z0IA 3ONMA 4POWA 3G3KA 3LR1A 2X7QA 1A7LA 1B3LA 5L9SA 5DYHA 1XC1A 1P1OA 1B5IA 4ZS9A 4ZE9A 3MZBA 1PBQA 5HM4B 4XTCQ 3ECRA 3FV2A 2XXWA 2ANJA 2QS1A 4TQUQ 2VOZA 4BDOA 4XKPA 5K2XA 1FTOA 3H3GA 2V84A 5TPAB 1A8FA 1Y3PA 4TOZA 1LCFA 1B1XA 1MG1A 5DEXA 1USYE 3LSFB 4QSEA 3CRBA 4DCYA 4ZDMA 1MRPA 2UYFA 3VDFA 1B7UA 3T9VA 3A3UA 3KFMA 5K2YA 3QUFA 1POTA 4IGTA 3GBAA 4YU0A 1IITA 4DLDA 1IXGA 2OWTA 1RKMA 2GRVA 4YKKA 4FAJA 3HO7A 2O1LA 1BLFA 3USDA 3SERA 4C0RA 5DTBA 4KCCA 4ELQA 2P1SA 3OOAA 3MJNA 3P7IA 3VVEA 3Q26A 4F2OA 4GXSB 4U22A 4ZZEA 2YJPA 2ZYNA 4BDLA 4KFQA 1US4A 3OEKA 3THIA 2Z23A 1B3EA 3O6IA 1RYXA 2PYYA 5ITPA 1B7HA 5ICQA 4XKQA 4IO3A 5DT6A 2LAOA 1XHYA 4H6DA 3SESA 2XXPA 2VP1A 4NF8A 3BBRA 3O6HA 2XXVA 2H4IA 3K1NA 1YAEA 5KCJB 1ATGA 2RC9A 5L8DA 3E13X 3TDJA 2RCAA 3UN6A 4TLLB 3RTWB 1NNPA 3PUVE 4NF4B 1BP5A 4H1XA 4Q8RA 2ABHA 1B3HA 4RPOA 2AL4A 2QSXA 3KBRA 3N94A 3K02A 3KJ7A 4E0XA 5ITOA 2CMOA 3B6WA 1DMBA 3EHTA 3CSBA 3KEIA 2NVUB 1B9JA 2ONKE 4EDPA 5I2KA 2QPQA 3K01A 1UTBA 1UTHB 1TWYA 3MC2A 2F7AA 3LSWA 2PBWA 3CFZA 1H76A 2ONSA 1LAGE 3RN8A 3TMGA 4YAHX 2IEEA 2PT1A 4R6YA 3H06B 4F18A 4KPTA 1AIVA 1D4NA 2DS9A 2H25A 1D9VA 4IO4A 4YB7A 1VSOA 1R9LA 5AA2A 4ND9A 3CR9A 4GQOA 3TEPA 4HCWA 2NOOA 4C1UA 3LC8A 4FORA 4R74A 5I57B 2I3WA 1Q1KA 1S50A 4DE8A 3S9MC 4RK9A 3RT8A 4QF9A 3JV9A 2XXTA 3TTRA 1LSTA 1LAHE 3KOSA 1URSA 3QXMA 2DWJA 4LP2B 1WDNA 1GVCA 4GXAA 2D5WA 4WEPA 5I84A 3KZGA 3Q25A 2F8DA 3IO4A 1XS5A 2XX9A 4I8CA 4YKJA 1J1NA 2KLFA 2UVHA 3L6HA 2ZMBA 3UGWA 1N84A 3D4GA 5ICTA 1LB8A 1MQIA 3VFJA 2F35A 1OVBA 4G8HA 4F1YA 4QHQA 3FVNA 1FCKA 4G77A 2QL3A 1RYOA 1R1NA 1MQDA 2HEUA 4NF6B 3V89B 4LQ5A 1H43A 2R6GE 1A8EA 4R6HA 3S2VA 4EXKA 4JSDA 4WXJA 4FE8A 1LLSA 4Q0CA 5H8FA 2H5YA 2XX7A 2HAVA 1POY1 2G29A 4H67A 4HCYA 2QS4A 2ONRA 1SI0A 3N6UA 2Q8JA 3I5OA 4H8IA 1MM6A 1QUIA 1B52A 3FASA 1MM7A 1OQHA 1QULA 2OLBA 2CZLA 3U93A 1N76A 3UORA 3S9LC 1UQWA 3UK4A 2O6AA 2V3TA 1L5TA 1OVTA 1B46A 2GFEA 3N5LA 5IKBA 4YMAA 4G8MA 1TXFA 3IOVA 3O97A 4U1ZA 3T96B 4ZEDA 1ZU0A 4IO2A 4G4PA 3RT6B 3QYTA 3UP9A 2R9JA 2FA7A 3C33A 1H44A 4F22A 3K00A 2PT2A 4PE5B 4AB5A 2YPNA 4YKIA 3TYHA 3BKIB 4F1VA 1ZTYA 4GF8A 4I1DA 4OMBA 4JWYA 4EF1A 4QSDA 1QKAA 1Y1MA 3O2AA 4LZ8A 1OQGA 3MW0A 4Z7EA 3KN8A 1O64A 1CE2A 3V5AA 2VD3A 3CG1A 3FVOA 3TQWA 3IAZA 4P0IA 3EF7A 3KSJA 4NWCA 4TLMB 3ZSFA 1LFIA 3QK6A 4ZZAA 2DE2A 2Z8FA 1II5A 5CMKA 5L9OA 3IOUA 4E0WA 5EHSA 4ZEIA 1FTLA 4PP0A 2NWJA 4F31B 2Z22A 3OO8A 2DWAA 1VFEA 3C34A 4HW8A 3PD8A 4KYSA 2UYEA 2AYSA 3SEXA 4PQJA 2FYIA 4H5GA 2A5TA 2OK2A 5H8HA 2UVGA 1SW5A 3H6UA 5KZTA 4F3SA 1F9BA 1FQCA 3M3KA 4ZE8A 5TU0A 1SI1A 3MUQA 1MY1A 5FHOA 1MQJA 3C4MA 3MAMA 1N7XA 4GOTA 1T0KA 4X48A 5CBSA 4GIZA 3FVGA 4R9GA 4BDQA 4ZECA 2I0CA 4H0WA 3PUXE 1Y20A 2PX1A 3N26A 5IAIA 3IOTA 3GLBA 5FHMA 2ZYOA 5ELVA 4OHNA 2O1MA 1MH3A 1Y4CA 3SEUA 3MPKA 4IB2A 4F29A 4PFTA 5AA3A 3FZVA 2H99A 4LUBA 1QW0A 4H5FA 5DVJA 4M4GA 2XXHA 3TUSA 5JTYA 3MZ1A 3PV0E 2V25A 2F5XA 2OJTA 3ZKKA 1JVXA 3TKDA 1B7ZA 5CMMA 4EQ9A 1VFDA 2X7PA 1EZOA 3LUYA 3IO6A 4DIGA 4LZ7A 4XXUA 3KJTA 3QUJA 4GD5A 4DZ1A 3UA8A 4X1BA 1SW2A 4EXLA 4RY1A 4DDDA 1R6ZA 3N6TA 2E0SA 4RXLA 5B70A 1PB8A 1FTKA 3ZKLA 3E3KA 5I59B 1ZJLA 1Y9UA 4IY5A 3BFUA 1B0LA 4G68A 4EQBA 3A3CA 1MXVA 2F34A 3MVWA 4R72A 3PMVA 1N0TA 3V8XB 1SW4A 1BIYA 3U72A 3K6XA 4GRKA 4UACA 5H8QB 3Q29A 1Z7NE 2XXIA 5I2KB 1I6BA 4F3BA 2DE3A 5FTHA 5TPAA 3D4CA 1IQ7A 2RINA 5TP9B 2F97A 1N3WA 1LCTA 2O68A 4F3GA 5AA4B 4MF3A 3OO7A 1NKXA 4O3BA 2OCUA 2THIA 1YPNA 5BUUA 2HZKA 4I9DA 2I58A 4O3CA 2I48A 3VVFA 2I4CA 1XVYA 1FTMA 5I58B 2WKYA 1DPEA 4RK2A 1Y3NA 3O9PA 3OD7A 3DM0A 3TELA 2X26A 4HTGA 2DWHA 2Y7PA 4QFLA 4GWOA 4QRZA 2I0BA 4LA9A 3H6VA 3TZAA 3FXQA 3TQLA 3EQ1A 5I56B 1US5A 2F78A 1A55A 3WAFA 1SD3A 4DXUA 1H45A 1LBBA 4GLIA 3MVZA 1D3KA 5CI5A 1B0HA 3A09A 3MP1A 2ALUA 3C9HA 2XX8A 3H6TA 4MFIA 2Q2AA 4EQ7A 2B3FA 5M2VA 3CG3A 1GGGA 4OENA 4H8JA 1ZLQA 1IEJA 1GV8A 1LB9A 3QSLA 3G3JA 5KCJA 3PUYE 1Y4TA 2HZLA 1NNTA 2QJEA 2DVCA 1QKBA 3MP6A 4N13A 4ELPA 4WEDA 3OMBA 4KYEA 1ZMGA 4NMYA 4AB6A 1YCJA 2GH9A 4ZEBA 3MQ9A 2D21A 5LOMA 3GZGA 2AIXA 1VE4A 1QVSA 3KN3A 3Q27A 1SQYA 3HPIA 1UTHA 3W9WA 2I4BA 3CIJA 4ELOA 3IJOB 3S9NC 2DXRA 4G2ZA 4DCXA 4NF5B 1B4ZA 1NL5A 1WVJA 3KOTA 3O66A 3OSRA 3MZ9A 4U4SA 3FGSA 2A5SA 4ISUA 1TT1A 1H3DA 5H8SA 4IGRA 4DXBA 1LAFE 5I2NB 3TTKA 5L9MA 3T22A 5EHMA 3S4UA 4QSCA 3I3VA 5H8NB 2HCAA 2F36A 3HHFA 5I57A 2DE4A 4WKMA 2DXYA 1JEUA 4GFRA 1JVYA 4RYAA 4FEDA 5KDTB 4IO6A 2F6PA 2V3QA 3PGFA 1BTJA 3S9EA 3VXCA 1LAXA 2Q88A 3MVXA 3IB1A 4NE4A 4OXVA 1IUDA 5FTIA 3U1OA 5A5XB 1IIWA 3C31A 3T9XB 3G3GA 4EF2A 1PEBA 3FD3A 5CMCA 5BWJA 4P11A 4RA1A 1PB9A 1DTGA 1B3FA 1ZKBA 1P1NA 3H7MA 2F6GA 4YB5A 4FEBA 4JWXA 1JW4A 4MH5A 1Y3QA 4U1OA 3K2DA 3VV5A 3PMWA 3TTNA 3K0VA 4KYDA 3G3HA 3IORA 4IO5A 4H65A 1MXWA 4NF6A 2PVUA 3VVDA 3K6WA 1MXYA 1DPPA 3FXUA 1O7TA 2Z8EA 3RNNA 4EUOA 3C32A 5HPQA 1MQHA 1CB6A 1B5HA 4LVQA 1B58A 2PMSA 3K1MA 5DVFA 4MBPA 3TPAA 2ZNSA 4RNSA 2O7IA 1B5JA 1WODA 1R9QA 2DSFA 2F7BA 1P99A 3TTLA 3GXAA 3IR1A 3IB2A 1A54A 2I49A 1TFDA 4OFJA 1FQAA 4YMBA 1DTZA 2AL5A 2VHAA 1AL3A 3C36A 1KWHA 2O84X 3EHSA 1SDXA 1JW1A 1MDP1 1JW5A 3U8QA 4OERA 4L17A 4U2RA 3IK6B 4BLAA 3IL1B 1Z7ME 3SEYA 4YKPA 5DEXB 3L6GA 3K4UA 4JXIA 3TCFA 1M5CA 2UVJA 1A99A 5CC2A 2XXYA 1D9YA 1MPDA 2P2AA 1FW0A 4LQ2A 4U4XA 1PDAA 4QFKA 1N7WA 4M1VA 4RPNA 3V83A 2I6EA 5EYFA 1OLCA 5JK4A 3CFXA 1B1HA 3MWBA 4ESXA 4ECFA 1S7YA 3RPWA 1MY3A 4O3AA 2DYXA 3TCGA 4N6PA 3DP8A 2FNCA 3PD9A 1JETA 3O29A 4R2FA 1EU8A 2H98A 2P0SA 3CI8A 4JDFA 4KR5A 2RF1A 2Y7KA 4LZ5A 3TFLA 2XXQA 4NWDA 4F19A 1LFGA 1SBPA 2ZNTA 3TCHA 3RY3A 1VR5A 2VD2A 3DELB 1B3GA 1MXUA 4XIGQ 3I6VA 4ELRA 1B05A 3HCQA 3VE1B 3KGCA 4KD5A 3FV1A 1I6QA 4ONYA 4QFPA 3PPRA 4NF8B 3EHUA 3FIRA 2Y7IA 2UXAA 2XXUA 4IO7A 5AE4A 2O7UA 2ZXTA 3RLFE 1EZPA 3IOWA 1QUKA 4UA8A 3LSXA 1JEVA 1O63A 3RUMA 2Q2CA 1MY0A 2QMXA 4PFYA 2NUVA 1OMPA 3TAJA 3HHGA 1A40A 4THIA 4OZ9A 4OWDA 2IA4A 3FATA 1URDA 1QUJA 1HSJA 1MXZA 1AH5A 3DP6A 3SKPA 1NNFA 2DP8A 2XXXA 3PUWE 4R2BA 1UTBB 1P1WA 2ZYMA 4G68C 3FJ7A 3EPEA 1XOCA 3SEWA 1EZ9A 1MPBA 3WAEA 3ILTB 4R75A 2BJJX 1MH4A 2OZZA 3IX1A 3OSQA 1PB7A 1FQEA 1Q35A 3EN3A 1HSLA 3UIFA 5AA2B 2DWIA 2HXWA 4LONB 2DQVA 3CSGA 3TODA 4HS7A 3R6UA 2Y7WA 2GHAA 5ISUA 1NMUA 5I59A 2W7YA 1MPCA 1NNKA 2RC7A 2ZYKA 3MPLA 1I69A 1B2HA 1YTVA 1IXIA 3MBPA 2Z8DA
chains in the Genus database with same CATH superfamily
3W15C 3IFAA 1MY4A 3IB0A 4YICA 1MY2A 3SEVA 1LBXA 2Y84A 4JWOA 5H8QA 3K6VA 3MVYA 4GVOA 4Q30B 2PCRA 1OLAA 3KC1A 1FQDA 3DLNA 1URGA 2M8CA 4NEDA 2RC8A 3OXNA 4XKRA 2Q89A 2NXOA 3VLWA 1HSEA 4PFUA 1IXCA 3U92A 4ESWA 4N07A 4OQOA 1MXXA 4G8NA 2G93A 4U21A 3AXFA 1B32A 1XI6A 3O6GA 5TP9A 3ILUB 1I6AA 4BDRA 4X9TA 3OO9A 4G61A 2V93A 1B6HA 4FECA 2I3VA 5AA4A 4GL0A 4N17A 1P1UA 2R71A 3PMXA 4NF4A 1AMFA 4FBPA 1M5BA 2DVZA 3KG2A 1UIUA 3F11A 1FTJA 5B7DA 4NTLA 2WEFA 1JQFA 3G3IA 2XD3A 3MYUA 3T9UA 5H8FB 3M3LA 4BDMA 4F39A 4QFNA 1LBCA 3TTMA 3RGYA 5I58A 4GL8A 3LSLA 4KHZE 4OETA 3KSXA 4O7IA 5ET5A 3ODBA 3C35A 3FVKA 1B51A 2RCBA 1IZ1A 1NFTA 1PBPA 3BIHA 1LFHA 1NV0A 4R73A 3H4ZA 3B6QA 5F1QA 4MLQA 3FJMA 3FXRA 1ZBMA 2XD2A 3QIMA 1AOVA 4MLVA 5I56A 1MQGA 1DSNA 1SW1A 5EQ9A 2MKZA 3T66A 3OENA 2XWIA 4MNPA 1GTKA 1QJMA 1FQBA 3E4RA 3B7DA 4PE3A 5T3JA 4OVTA 3IJXB 4R6KA 3CFLA 2QS2A 1IMBA 1XT8A 4ZEFA 1NH8A 2ESNA 1FQFA 4R9FA 3JYRA 3FUZA 4PF8A 4OA4A 1LGBC 5AA2D 3JZJA 2B65A 4BDNA 3M8UA 4DXCA 4ZEKA 2R8TA 4PTKA 2YLNA 4FJPA 2D3IA 4OFOA 4GWYA 2OWSA 3U65A 1SVXB 4FATA 4K3FA 2CZHA 4NQ8A 3E9XA 3H03A 1USYH 4X04A 3LBSA 4GWZA 3ISPA 5HBCA 3W9VA 4N6KA 4PETA 2Q9TA 1FPBA 3BFTA 3B6TA 1DBZA 4N8GA 3R26A 1JNFA 3PPNA 2REJA 5EYGA 4OYVA 4OTEA 1FPIA 2QFLA 2REGA 2VGQA 2WBBA 4C1TA 3PPQA 1TFAA 4XF5A 1ANFA 1M5FA 2UVIA 2HFBA 3T93B 5FBPA 4X1DA 3PU5A 1SYIA 4PCDA 4MIJA 1Y1ZA 2ZNUA 1BKAA 3HV1A 3KN7A 2CEXA 5AA1A 4OVJA 3T1BA 4NF5A 1M5DA 2O51A 2Y7RA 5F7VA 2FIXA 1N04A 2A5TB 3H6WA 4YZZA 5CRYA 5H8HB 1FRPA 2QS3A 1MS7A 5DVIA 3O28A 5I2NA 2HQ0A 2FBPA 4QFOA 4P56A 1NI9A 1B4HA 3T9HB 4U23A 1DOTA 4KI0E 3VLUA 4JB7A 4OEVA 5H8NA 4I62A 1PC3A 2L5VA 2F7CA 1N3XA 5IZ1A 3HSTA 4OESA 5I7IA 2B3BA 4F1UA 1OIBA 5KDTA 3R7XA 4F2QA 5J1DA 1M5EA 3OO6A 4FIMA 1MDQA 2JJKA 2QMWA 3ZS6A 1UIVA 5CBRA 1KA1A 1YXIA 3PPOA 4OEUA 4MX6A 1NV3A 1SYHA 5A5XA 3MP8A 4IY6A 4XKNA 1FBHA 4KQPA 2DOJA 3U94A 5IGAA 2B4LA 1P1QA 4P0GA 4OFLA 1NUYA 3PUZE 2V3UA 1B40A 3RTFB 2H9BA 3RQTA 3DP4A 5FHNA 3K1PA 1ELJA 3CVGA 4Q5TA 4RJZA 5JTYB 3G7WA 2XHDA 5JEIA 3SETA 3SDFA 4OVPA 3FJGA 2E1SA 4PAFA 4F3PA 1S9TA 3OEMA 1IXHA 3M3FA 3K6UA 4NHBA 2HAUA 3HN0A 2O69A 1QGXA 4JVDA 2Y5LA 5CM6A 1ZIUA 2QRYA 1IMEA 4H45A 1EH3A 4LATA 3OELA 4YB6A 3G3FA 3Q28A 3QAXA 4DI4B 2XXRA 2OBGA 1G0HA 2RKMA 4AQ4A 1XVXA 3VXBA 3PPPA 3GBBA 4JSOA 2GHBA 1GR2A 4KCDA 5CMBA 3VLVA 4POXA 4JBZA 4PFWA 4G68B 1NH7A 4Z0IA 3ONMA 4POWA 1D9QA 3G3KA 3LR1A 2X7QA 2PFYA 4PAKA 1A7LA 1B3LA 5L9SA 1FPEA 5DYHA 1P1OA 1XC1A 1B5IA 4ZS9A 4ZE9A 3MZBA 1PBQA 5HM4B 4XTCQ 2XA5A 2XWOA 3ECRA 3FV2A 2XXWA 2ANJA 4N81A 1EYIA 2QS1A 4TQUQ 2VOZA 3E78A 4BDOA 4XKPA 1NV6A 5K2XA 1FTOA 3H3GA 2V84A 5TPAB 1A8FA 1Y3PA 4TOZA 1LCFA 1B1XA 1MG1A 5DEXA 1CNQA 2HXRA 1USYE 2CZKA 3LSFB 4QSEA 3CRBA 4DCYA 4ZDMA 1MRPA 2UYFA 3VDFA 1B7UA 5LTCA 3T9VA 3A3UA 3KFMA 5K2YA 4P8BA 3QUFA 1POTA 4QBAA 4IGTA 3GBAA 4YU0A 1IITA 4DLDA 1IXGA 2OWTA 1RKMA 2GRVA 4YKKA 4FAJA 3HO7A 2O1LA 1BLFA 3USDA 3SERA 2B4MA 4C0RA 5DTBA 4KCCA 4OVRA 4ELQA 2P1SA 3OOAA 3MJNA 3BIGA 3P7IA 3VVEA 3Q26A 4F2OA 4GXSB 5IZ3A 4U22A 4ZZEA 2YJPA 2ZYNA 4BDLA 4KFQA 1US4A 3OEKA 3THIA 2Z23A 1B3EA 3O6IA 1RYXA 2PYYA 5ITPA 1B7HA 5ICQA 4XKQA 4IO3A 5F24A 5DT6A 1FBDA 1XHYA 2LAOA 4H6DA 4MCOA 3SESA 2XXPA 2VP1A 4NF8A 3BBRA 3O6HA 1NV1A 4MEVA 3LUZA 2XXVA 2H4IA 3K1NA 1YAEA 5KCJB 1ATGA 2RC9A 5L8DA 3E13X 3TDJA 2RCAA 3UN6A 2CZIA 4TLLB 3RTWB 1NNPA 3PUVE 4NF4B 1BP5A 3HFUA 4H1XA 4Q8RA 2ABHA 4GX3A 1B3HA 4RPOA 2AL4A 2QSXA 3KBRA 3N94A 1FPLA 1BK4A 3K02A 1NUXA 3KJ7A 4E0XA 4MNIA 5ITOA 2CMOA 3B6WA 1DMBA 3EHTA 3CSBA 3KEIA 2NVUB 1B9JA 2ONKE 4EDPA 5I2KA 2QPQA 3K01A 1UTBA 1UTHB 1TWYA 3MC2A 4PF6A 1FBPA 2F7AA 3LSWA 2PBWA 2P3NA 3CFZA 1FPKA 4UABA 1H76A 2ONSA 1LAGE 3RN8A 3TMGA 4YAHX 2IEEA 1LBWA 1EYJA 2PT1A 4R6YA 3H06B 4AS5A 4F18A 4KPTA 1AIVA 2FHYA 3NOHA 1D4NA 2DS9A 2H25A 1D9VA 4IO4A 4YB7A 4MHFA 1VSOA 1R9LA 5AA2A 4ND9A 3CR9A 4GQOA 3TEPA 4HCWA 2NOOA 4C1UA 3LC8A 4FORA 4R74A 5I57B 2I3WA 1Q1KA 1S50A 4DE8A 3S9MC 4RK9A 3RT8A 4QF9A 3JV9A 2XXTA 4OVSA 3TTRA 1LSTA 1LAHE 3KOSA 1URSA 3QXMA 2DWJA 4LP2B 4HE2A 1WDNA 4X8RA 1GVCA 3MSTA 4GXAA 3LV0A 2D5WA 4WEPA 5I84A 5EQAA 3KZGA 3Q25A 2F8DA 3IO4A 1XS5A 2XX9A 3EKIA 1LBYA 4I8CA 4YKJA 1J1NA 2KLFA 2UVHA 3L6HA 3PTYA 2ZMBA 3UGWA 2KR0A 1N84A 3D4GA 4XEQA 2OWZA 5ICTA 1LB8A 2P3VA 1MQIA 3VFJA 1FSAA 2F35A 1OVBA 4G8HA 4F1YA 4QHQA 3FVNA 1FCKA 4G77A 4MMPA 2QL3A 1RYOA 1R1NA 1MQDA 2HEUA 4NF6B 3V89B 4LQ5A 4P3LA 2XXKA 1H43A 2R6GE 1A8EA 4KXPA 4R6HA 3S2VA 4EXKA 4JSDA 4I3YA 4WXJA 4FE8A 1LLSA 4Q0CA 4I40A 5H8FA 2H5YA 2XX7A 2HAVA 1POY1 2G29A 1EYKA 4H67A 4HCYA 2QS4A 1FJ6A 2ONRA 1SI0A 3N6UA 2Q8JA 3I5OA 4H8IA 1MM6A 1QUIA 1B52A 3FASA 1MM7A 1OQHA 1QULA 2OLBA 2CZLA 3U93A 1N76A 3UORA 3S9LC 1NUZA 1UQWA 3UK4A 2O6AA 2V3TA 1L5TA 1OVTA 1B46A 2GFEA 1FBEA 3N5LA 5IKBA 4YMAA 4G8MA 4AS4A 1TXFA 3IOVA 3O97A 4U1ZA 3T96B 4ZEDA 1ZU0A 4IO2A 4G4PA 3RT6B 4PC9A 3QYTA 3UP9A 2R9JA 2FA7A 3C33A 1H44A 4F22A 3K00A 4NX1A 2PT2A 4PE5B 4AB5A 2YPNA 4YKIA 3TYHA 3BKIB 3RPLB 4F1VA 1ZTYA 4GF8A 3SZPA 4I1DA 4OMBA 4JWYA 4EF1A 4QSDA 5IZZA 4NAPA 1QKAA 3QMFA 1Y1MA 3O2AA 4LZ8A 1OQGA 2FVZA 3MW0A 4Z7EA 3KN8A 1O64A 1CE2A 3V5AA 2VD3A 3CG1A 3FVOA 4O94A 3TQWA 3IAZA 4P0IA 3EF7A 3KSJA 1IMAA 4NWCA 4TLMB 3ZSFA 1LFIA 3QK6A 4ZZAA 2DE2A 1VDWA 2Z8FA 1II5A 5CMKA 5L9OA 3IOUA 4E0WA 5EHSA 4ZEIA 1FTLA 1NV2A 4PP0A 2NWJA 4F31B 2Z22A 3OO8A 2DWAA 1VFEA 3C34A 5DW8A 4HW8A 3PD8A 4KYSA 2UYEA 2AYSA 3SEXA 4PQJA 2FYIA 1RDZA 4H5GA 2A5TA 4P9KA 2OK2A 5EQ8A 5H8HA 2UVGA 1SW5A 3H6UA 5KZTA 2DDKA 4F3SA 3ROJA 1F9BA 1FQCA 3M3KA 4ZE8A 5TU0A 1SI1A 3MUQA 1MY1A 5FHOA 1MQJA 3C4MA 3MAMA 1N7XA 4GOTA 1T0KA 4X48A 5CBSA 4GIZA 3FVGA 4N91A 4R9GA 4BDQA 4ZECA 1RDXA 1DCUA 2I0CA 4H0WA 3PUXE 1Y20A 2PX1A 3N26A 5IAIA 1K9YA 3IOTA 3GLBA 5FHMA 2ZYOA 5ELVA 4OHNA 2O1MA 1MH3A 1Y4CA 3SEUA 3MPKA 1JP4A 4IB2A 4F29A 1K9ZA 4PFTA 5AA3A 3FZVA 2H99A 4LUBA 1QW0A 4LN5A 2Y5KA 4H5FA 2WBDA 5DVJA 4M4GA 2XXHA 3TUSA 5JTYA 3MZ1A 3PV0E 2V25A 2F5XA 2OJTA 3ZKKA 1JVXA 3E79A 3TKDA 1B7ZA 4GWWA 5CMMA 4EQ9A 1VFDA 1NV4A 2F3DA 2Q74A 2X7PA 1EZOA 3LUYA 1FBCA 5I5PA 5IM2A 3IO6A 4DIGA 4LZ7A 4XXUA 3D1RA 3KJTA 3QUJA 4NF0A 4GD5A 4DZ1A 1YZ0A 3UA8A 4X1BA 3A29A 1SW2A 4EXLA 4RY1A 4DDDA 1R6ZA 3N6TA 2E0SA 4RXLA 5B70A 1PB8A 1FTKA 4DI3D 3ZKLA 2Q8MA 3E3KA 5I59B 1ZJLA 1Y9UA 4IY5A 3BFUA 1KA0A 1B0LA 4G68A 4EQBA 3A3CA 1MXVA 2F34A 3MVWA 4R72A 3PMVA 1N0TA 4P1LA 3V8XB 4GX6A 1SW4A 3B50A 1BIYA 3U72A 3K6XA 4PGPA 4GBWA 4GRKA 4UACA 5H8QB 3Q29A 1Z7NE 2XXIA 5ET7A 5I2KB 1I6BA 2ZZXA 2QVRA 4F3BA 2DE3A 3FBPA 5ET6A 3KBZA 5FTHA 5TPAA 3D4CA 1IQ7A 2RINA 5TP9B 2F97A 1N3WA 4N4UA 1LCTA 2O68A 4F3GA 1FPJA 4NG7A 5AA4B 4MF3A 3OO7A 1NKXA 4O3BA 2OCUA 2THIA 1YPNA 5BUUA 2GQ1A 2HZKA 4I9DA 4PFBA 2OX3A 2I58A 1AWBA 4O3CA 2I48A 2VPOA 3VVFA 2I4CA 1XVYA 4PFRA 1FTMA 5I58B 2WKYA 1DPEA 1RDYA 4RK2A 1Y3NA 3O9PA 3OD7A 3DM0A 3TELA 1INPA 2X26A 4HTGA 2DWHA 4OVQA 2Y7PA 3T0JA 4QFLA 3IFCA 4GWOA 4QRZA 2I0BA 4LA9A 3H6VA 3TZAA 3FXQA 3TQLA 3EQ1A 5I56B 1SPIA 1US5A 2F78A 1A55A 5ESYA 3WAFA 1SD3A 4DXUA 1NV5A 1H45A 1LBBA 4GLIA 3MVZA 1D3KA 5CI5A 1B0HA 3A09A 3MP1A 2ALUA 3C9HA 2XX8A 3H6TA 4MFIA 4HXVA 2Q2AA 4EQ7A 2B3FA 5M2VA 3CG3A 1GGGA 4OENA 5J16A 4H8JA 1LBVA 1ZLQA 1IEJA 1GV8A 1LB9A 3QSLA 3G3JA 5KCJA 4HE1A 3PUYE 1Y4TA 4PDHA 2XWVA 2HZLA 4IR8A 1NNTA 2QJEA 2DVCA 3GYYA 1QKBA 3MP6A 4N13A 4ELPA 4WEDA 3OMBA 4KYEA 1ZMGA 4NMYA 4AB6A 1YCJA 2GH9A 4ZEBA 3MQ9A 1IMDA 2D21A 5LOMA 3GZGA 2AIXA 1LBZA 1VE4A 1QVSA 3KN3A 3Q27A 1SQYA 3HPIA 1UTHA 4N15A 3W9WA 4N6DA 2I4BA 3CIJA 4ELOA 3IJOB 3S9NC 2VPNA 2DXRA 4G2ZA 4DCXA 4NF5B 1B4ZA 1NL5A 1WVJA 3FXBA 3KOTA 3O66A 3OSRA 3MZ9A 4U4SA 3FGSA 2A5SA 4ISUA 1TT1A 5LDZA 1H3DA 4P1EA 5H8SA 4IGRA 4DXBA 1LAFE 5I2NB 3TTKA 2CEYA 5L9MA 3T22A 5EHMA 3S4UA 4QSCA 3I3VA 4XFEA 5H8NB 1NV7A 2HCAA 4JVIA 2F36A 3HHFA 5I57A 4PBQA 2DE4A 2VT5A 4WKMA 2DXYA 1JEUA 4GFRA 4GX4A 1JVYA 4RYAA 5A5LA 4FEDA 5KDTB 4IO6A 2F6PA 2V3QA 1KZ8A 3PGFA 4QXDA 1BTJA 3S9EA 3VXCA 1LAXA 2Q88A 3MVXA 3IB1A 4NE4A 2XWKA 4OXVA 1IUDA 1FBFA 4PDDA 5FTIA 3U1OA 5A5XB 3CHGA 1IIWA 3C31A 3T9XB 3G3GA 4EF2A 1PEBA 3FD3A 5CMCA 5BWJA 4P11A 1FBGA 1YYZA 4RA1A 4GWXA 1PB9A 1DTGA 1B3FA 1ZKBA 1P1NA 3H7MA 2F6GA 2V4CA 2HPGA 4YB5A 5EQ7A 4FEBA 4JWXA 1JW4A 4MH5A 1Y3QA 2QVVA 1IMFA 3K2DA 4U1OA 3VV5A 3PMWA 3TTNA 3K0VA 4KYDA 3G3HA 3IORA 4IO5A 4H65A 1MXWA 4NF6A 2PVUA 3VVDA 3K6WA 1G0IA 1MXYA 1DPPA 3FXUA 1O7TA 2KQZA 4NN3A 2Z8EA 3RNNA 4EUOA 3C32A 5HPQA 1MQHA 1CB6A 1B5HA 4LVQA 1B58A 2PMSA 3K1MA 5DVFA 4MBPA 3TPAA 2ZNSA 4RNSA 2O7IA 1B5JA 1WODA 1R9QA 4MNCA 2DSFA 2F7BA 4HE0A 1P99A 3TTLA 2WYPA 3GXAA 3IR1A 3IB2A 1A54A 2I49A 1TFDA 4OFJA 2WX9A 4PFIA 1FQAA 4YMBA 1DTZA 1FJ9A 2AL5A 2VHAA 5ET8A 1AL3A 3C36A 1KWHA 2O84X 3EHSA 1SDXA 1JW1A 1MDP1 1JW5A 3U8QA 4OERA 4L17A 4U2RA 3IK6B 4BLAA 3IL1B 1Z7ME 4MJOA 3SEYA 4YKPA 5DEXB 4GBVA 3L6GA 3K4UA 1Q9DA 4JXIA 3TCFA 1M5CA 2UVJA 3RPLA 1A99A 5CC2A 2XXYA 1D9YA 1MPDA 2P2AA 2QVUA 1FW0A 4LQ2A 4U4XA 4GWUA 1PDAA 4QFKA 1N7WA 4M1VA 4RPNA 3V83A 2I6EA 5EYFA 1OLCA 4N8YA 3CFXA 1B1HA 5JK4A 3MWBA 4ESXA 4ECFA 1S7YA 2BJIA 3RPWA 1MY3A 4O3AA 2DYXA 3TCGA 4N6PA 1FPGA 3DP8A 2FNCA 3PD9A 2WYKA 1JETA 3O29A 4R2FA 1EU8A 2H98A 4O8MA 2FIEA 5IZ3B 2P0SA 3CI8A 3B8BA 4JDFA 4KR5A 2RF1A 1LEVA 2Y7KA 4LZ5A 3TFLA 2XXQA 4NWDA 4F19A 1LFGA 1SBPA 2ZNTA 3TCHA 3RY3A 1VR5A 2VD2A 3DELB 1B3GA 1MXUA 4XIGQ 3I6VA 4H46A 4ELRA 1B05A 3HCQA 3VE1B 3KGCA 4KD5A 3FV1A 1I6QA 4I3EA 4ONYA 4QFPA 4JVCA 3PPRA 4NF8B 3EHUA 3FIRA 2Y7IA 4OANA 2UXAA 2XXUA 4IO7A 5AE4A 5I3SA 2O7UA 2ZXTA 3RLFE 1EZPA 1FPDA 3IOWA 2F3BA 1QUKA 4UA8A 3LSXA 1JEVA 1O63A 4PGNA 3RUMA 2Q2CA 1MY0A 2QMXA 4PFYA 2NUVA 1OMPA 3TAJA 3HHGA 1A40A 1DK4A 4THIA 4OZ9A 4OWDA 2IA4A 3FATA 1URDA 4PBHA 1QUJA 1HSJA 1MXZA 1IMCA 1AH5A 3DP6A 3SKPA 1NNFA 2DP8A 4R2BA 2XXXA 3PUWE 4O7MA 1UTBB 1P1WA 2ZYMA 4G68C 3FJ7A 3KC0A 3EPEA 1XOCA 5EYHA 1FTAA 2HHMA 3SEWA 1EZ9A 1MPBA 3WAEA 3ILTB 4R75A 2BJJX 1MH4A 2OZZA 3IX1A 3OSQA 1PB7A 1FQEA 1Q35A 3EN3A 1HSLA 3UIFA 5AA2B 2DWIA 2ZZWA 2HXWA 4LONB 4NGUA 4MAGA 2DQVA 3CSGA 3TODA 4P47A 4HS7A 3R6UA 2Y7WA 2GHAA 5ISUA 1NMUA 5I59A 2W7YA 1MPCA 1NNKA 2RC7A 2ZYKA 3MPLA 2PFZA 1NUWA 4GWSA 1I69A 1B2HA 1YTVA 1IXIA 2ZZVA 3RYDA 3MBPA 1FPFA 4PAIA 2Z8DA
chains in the Genus database with same CATH topology
3W15C 1MY4A 3IB0A 4YICA 1MY2A 3SEVA 2Y84A 4JWOA 5H8QA 3K6VA 3MVYA 4GVOA 4Q30B 1OLAA 1FQDA 3DLNA 1URGA 2M8CA 4NEDA 2RC8A 3OXNA 4XKRA 2Q89A 2NXOA 3VLWA 1HSEA 4PFUA 1IXCA 3U92A 4ESWA 4N07A 4OQOA 1MXXA 4G8NA 2G93A 4U21A 3AXFA 1B32A 3O6GA 5TP9A 3ILUB 1I6AA 4BDRA 4X9TA 3OO9A 2V93A 1B6HA 4FECA 2I3VA 5AA4A 4GL0A 1P1UA 2R71A 3PMXA 4NF4A 1AMFA 1M5BA 2DVZA 3KG2A 1UIUA 3F11A 1FTJA 5B7DA 4NTLA 1JQFA 3G3IA 2XD3A 3T9UA 5H8FB 3M3LA 4BDMA 4F39A 4QFNA 1LBCA 3TTMA 3RGYA 5I58A 4GL8A 3LSLA 4KHZE 4OETA 3KSXA 3ODBA 3C35A 3FVKA 1B51A 2RCBA 1IZ1A 1NFTA 1PBPA 1LFHA 4R73A 3H4ZA 3B6QA 5F1QA 4MLQA 3FJMA 3FXRA 1ZBMA 2XD2A 3QIMA 1AOVA 4MLVA 5I56A 1MQGA 1DSNA 1SW1A 3T66A 3OENA 1GTKA 1QJMA 1FQBA 3E4RA 3B7DA 3IJXB 4R6KA 3CFLA 2QS2A 1XT8A 4ZEFA 1NH8A 2ESNA 1FQFA 4R9FA 3JYRA 3FUZA 1LGBC 5AA2D 3JZJA 2B65A 4BDNA 3M8UA 4DXCA 4ZEKA 2YLNA 4FJPA 2D3IA 4OFOA 2OWSA 1SVXB 4FATA 4K3FA 3E9XA 3H03A 1USYH 3LBSA 5HBCA 3W9VA 4PETA 2Q9TA 3BFTA 3B6TA 3R26A 1JNFA 3PPNA 2REJA 4OYVA 4OTEA 2REGA 2VGQA 4C1TA 3PPQA 1TFAA 1ANFA 1M5FA 2UVIA 2HFBA 3T93B 4X1DA 3PU5A 1SYIA 1Y1ZA 2ZNUA 1BKAA 3HV1A 3KN7A 5AA1A 4OVJA 4NF5A 1M5DA 2O51A 2Y7RA 5F7VA 1N04A 2A5TB 3H6WA 4YZZA 5CRYA 5H8HB 2QS3A 1MS7A 5DVIA 3O28A 5I2NA 2HQ0A 4QFOA 1B4HA 3T9HB 4U23A 1DOTA 4KI0E 3VLUA 4JB7A 4OEVA 5H8NA 4I62A 1PC3A 2F7CA 1N3XA 3HSTA 4OESA 2B3BA 4F1UA 1OIBA 5KDTA 3R7XA 4F2QA 5J1DA 1M5EA 3OO6A 4FIMA 1MDQA 2QMWA 3ZS6A 1UIVA 5CBRA 3PPOA 4OEUA 1SYHA 5A5XA 3MP8A 4IY6A 4XKNA 4KQPA 2DOJA 3U94A 1P1QA 4P0GA 4OFLA 3PUZE 2V3UA 1B40A 3RTFB 2H9BA 3RQTA 3DP4A 5FHNA 3K1PA 1ELJA 3CVGA 5JTYB 4Q5TA 4RJZA 3G7WA 2XHDA 5JEIA 3SETA 3SDFA 3FJGA 2E1SA 4F3PA 1S9TA 3OEMA 1IXHA 3M3FA 3K6UA 3HN0A 2HAUA 2O69A 5CM6A 1ZIUA 2QRYA 1EH3A 4LATA 3OELA 4YB6A 3G3FA 3Q28A 3QAXA 2XXRA 2OBGA 2RKMA 4AQ4A 1XVXA 3VXBA 3PPPA 3GBBA 4JSOA 2GHBA 1GR2A 4KCDA 5CMBA 3VLVA 4POXA 4JBZA 4PFWA 4G68B 1NH7A 4Z0IA 3ONMA 4POWA 3G3KA 3LR1A 2X7QA 1A7LA 1B3LA 5L9SA 5DYHA 1XC1A 1P1OA 1B5IA 4ZS9A 4ZE9A 3MZBA 1PBQA 5HM4B 4XTCQ 3ECRA 3FV2A 2XXWA 2ANJA 2QS1A 4TQUQ 2VOZA 4BDOA 4XKPA 5K2XA 1FTOA 3H3GA 2V84A 5TPAB 1A8FA 1Y3PA 4TOZA 1LCFA 1B1XA 1MG1A 5DEXA 1USYE 3LSFB 4QSEA 3CRBA 4DCYA 4ZDMA 1MRPA 2UYFA 3VDFA 1B7UA 3T9VA 3A3UA 3KFMA 5K2YA 3QUFA 1POTA 4IGTA 3GBAA 4YU0A 1IITA 4DLDA 1IXGA 2OWTA 1RKMA 2GRVA 4YKKA 4FAJA 3HO7A 2O1LA 1BLFA 3USDA 3SERA 4C0RA 5DTBA 4KCCA 4ELQA 2P1SA 3OOAA 3MJNA 3P7IA 3VVEA 3Q26A 4F2OA 4GXSB 4U22A 4ZZEA 2YJPA 2ZYNA 4BDLA 4KFQA 1US4A 3OEKA 3THIA 2Z23A 1B3EA 3O6IA 1RYXA 2PYYA 5ITPA 1B7HA 5ICQA 4XKQA 4IO3A 5DT6A 2LAOA 1XHYA 4H6DA 3SESA 2XXPA 2VP1A 4NF8A 3BBRA 3O6HA 2XXVA 2H4IA 3K1NA 1YAEA 5KCJB 1ATGA 2RC9A 5L8DA 3E13X 3TDJA 2RCAA 3UN6A 4TLLB 3RTWB 1NNPA 3PUVE 4NF4B 1BP5A 4H1XA 4Q8RA 2ABHA 1B3HA 4RPOA 2AL4A 2QSXA 3KBRA 3N94A 3K02A 3KJ7A 4E0XA 5ITOA 2CMOA 3B6WA 1DMBA 3EHTA 3CSBA 3KEIA 2NVUB 1B9JA 2ONKE 4EDPA 5I2KA 2QPQA 3K01A 1UTBA 1UTHB 1TWYA 3MC2A 2F7AA 3LSWA 2PBWA 3CFZA 1H76A 2ONSA 1LAGE 3RN8A 3TMGA 4YAHX 2IEEA 2PT1A 4R6YA 3H06B 4F18A 4KPTA 1AIVA 1D4NA 2DS9A 2H25A 1D9VA 4IO4A 4YB7A 1VSOA 1R9LA 5AA2A 4ND9A 3CR9A 4GQOA 3TEPA 4HCWA 2NOOA 4C1UA 3LC8A 4FORA 4R74A 5I57B 2I3WA 1Q1KA 1S50A 4DE8A 3S9MC 4RK9A 3RT8A 4QF9A 3JV9A 2XXTA 3TTRA 1LSTA 1LAHE 3KOSA 1URSA 3QXMA 2DWJA 4LP2B 1WDNA 1GVCA 4GXAA 2D5WA 4WEPA 5I84A 3KZGA 3Q25A 2F8DA 3IO4A 1XS5A 2XX9A 4I8CA 4YKJA 1J1NA 2KLFA 2UVHA 3L6HA 2ZMBA 3UGWA 1N84A 3D4GA 5ICTA 1LB8A 1MQIA 3VFJA 2F35A 1OVBA 4G8HA 4F1YA 4QHQA 3FVNA 1FCKA 4G77A 2QL3A 1RYOA 1R1NA 1MQDA 2HEUA 4NF6B 3V89B 4LQ5A 1H43A 2R6GE 1A8EA 4R6HA 3S2VA 4EXKA 4JSDA 4WXJA 4FE8A 1LLSA 4Q0CA 5H8FA 2H5YA 2XX7A 2HAVA 1POY1 2G29A 4H67A 4HCYA 2QS4A 2ONRA 1SI0A 3N6UA 2Q8JA 3I5OA 4H8IA 1MM6A 1QUIA 1B52A 3FASA 1MM7A 1OQHA 1QULA 2OLBA 2CZLA 3U93A 1N76A 3UORA 3S9LC 1UQWA 3UK4A 2O6AA 2V3TA 1L5TA 1OVTA 1B46A 2GFEA 3N5LA 5IKBA 4YMAA 4G8MA 1TXFA 3IOVA 3O97A 4U1ZA 3T96B 4ZEDA 1ZU0A 4IO2A 4G4PA 3RT6B 3QYTA 3UP9A 2R9JA 2FA7A 3C33A 1H44A 4F22A 3K00A 2PT2A 4PE5B 4AB5A 2YPNA 4YKIA 3TYHA 3BKIB 4F1VA 1ZTYA 4GF8A 4I1DA 4OMBA 4JWYA 4EF1A 4QSDA 1QKAA 1Y1MA 3O2AA 4LZ8A 1OQGA 3MW0A 4Z7EA 3KN8A 1O64A 1CE2A 3V5AA 2VD3A 3CG1A 3FVOA 3TQWA 3IAZA 4P0IA 3EF7A 3KSJA 4NWCA 4TLMB 3ZSFA 1LFIA 3QK6A 4ZZAA 2DE2A 2Z8FA 1II5A 5CMKA 5L9OA 3IOUA 4E0WA 5EHSA 4ZEIA 1FTLA 4PP0A 2NWJA 4F31B 2Z22A 3OO8A 2DWAA 1VFEA 3C34A 4HW8A 3PD8A 4KYSA 2UYEA 2AYSA 3SEXA 4PQJA 2FYIA 4H5GA 2A5TA 2OK2A 5H8HA 2UVGA 1SW5A 3H6UA 5KZTA 4F3SA 1F9BA 1FQCA 3M3KA 4ZE8A 5TU0A 1SI1A 3MUQA 1MY1A 5FHOA 1MQJA 3C4MA 3MAMA 1N7XA 4GOTA 1T0KA 4X48A 5CBSA 4GIZA 3FVGA 4R9GA 4BDQA 4ZECA 2I0CA 4H0WA 3PUXE 1Y20A 2PX1A 3N26A 5IAIA 3IOTA 3GLBA 5FHMA 2ZYOA 5ELVA 4OHNA 2O1MA 1MH3A 1Y4CA 3SEUA 3MPKA 4IB2A 4F29A 4PFTA 5AA3A 3FZVA 2H99A 4LUBA 1QW0A 4H5FA 5DVJA 4M4GA 2XXHA 3TUSA 5JTYA 3MZ1A 3PV0E 2V25A 2F5XA 2OJTA 3ZKKA 1JVXA 3TKDA 1B7ZA 5CMMA 4EQ9A 1VFDA 2X7PA 1EZOA 3LUYA 3IO6A 4DIGA 4LZ7A 4XXUA 3KJTA 3QUJA 4GD5A 4DZ1A 3UA8A 4X1BA 1SW2A 4EXLA 4RY1A 4DDDA 1R6ZA 3N6TA 2E0SA 4RXLA 5B70A 1PB8A 1FTKA 3ZKLA 3E3KA 5I59B 1ZJLA 1Y9UA 4IY5A 3BFUA 1B0LA 4G68A 4EQBA 3A3CA 1MXVA 2F34A 3MVWA 4R72A 3PMVA 1N0TA 3V8XB 1SW4A 1BIYA 3U72A 3K6XA 4GRKA 4UACA 5H8QB 3Q29A 1Z7NE 2XXIA 5I2KB 1I6BA 4F3BA 2DE3A 5FTHA 5TPAA 3D4CA 1IQ7A 2RINA 5TP9B 2F97A 1N3WA 1LCTA 2O68A 4F3GA 5AA4B 4MF3A 3OO7A 1NKXA 4O3BA 2OCUA 2THIA 1YPNA 5BUUA 2HZKA 4I9DA 2I58A 4O3CA 2I48A 3VVFA 2I4CA 1XVYA 1FTMA 5I58B 2WKYA 1DPEA 4RK2A 1Y3NA 3O9PA 3OD7A 3DM0A 3TELA 2X26A 4HTGA 2DWHA 2Y7PA 4QFLA 4GWOA 4QRZA 2I0BA 4LA9A 3H6VA 3TZAA 3FXQA 3TQLA 3EQ1A 5I56B 1US5A 2F78A 1A55A 3WAFA 1SD3A 4DXUA 1H45A 1LBBA 4GLIA 3MVZA 1D3KA 5CI5A 1B0HA 3A09A 3MP1A 2ALUA 3C9HA 2XX8A 3H6TA 4MFIA 2Q2AA 4EQ7A 2B3FA 5M2VA 3CG3A 1GGGA 4OENA 4H8JA 1ZLQA 1IEJA 1GV8A 1LB9A 3QSLA 3G3JA 5KCJA 3PUYE 1Y4TA 2HZLA 1NNTA 2QJEA 2DVCA 1QKBA 3MP6A 4N13A 4ELPA 4WEDA 3OMBA 4KYEA 1ZMGA 4NMYA 4AB6A 1YCJA 2GH9A 4ZEBA 3MQ9A 2D21A 5LOMA 3GZGA 2AIXA 1VE4A 1QVSA 3KN3A 3Q27A 1SQYA 3HPIA 1UTHA 3W9WA 2I4BA 3CIJA 4ELOA 3IJOB 3S9NC 2DXRA 4G2ZA 4DCXA 4NF5B 1B4ZA 1NL5A 1WVJA 3KOTA 3O66A 3OSRA 3MZ9A 4U4SA 3FGSA 2A5SA 4ISUA 1TT1A 1H3DA 5H8SA 4IGRA 4DXBA 1LAFE 5I2NB 3TTKA 5L9MA 3T22A 5EHMA 3S4UA 4QSCA 3I3VA 5H8NB 2HCAA 2F36A 3HHFA 5I57A 2DE4A 4WKMA 2DXYA 1JEUA 4GFRA 1JVYA 4RYAA 4FEDA 5KDTB 4IO6A 2F6PA 2V3QA 3PGFA 1BTJA 3S9EA 3VXCA 1LAXA 2Q88A 3MVXA 3IB1A 4NE4A 4OXVA 1IUDA 5FTIA 3U1OA 5A5XB 1IIWA 3C31A 3T9XB 3G3GA 4EF2A 1PEBA 3FD3A 5CMCA 5BWJA 4P11A 4RA1A 1PB9A 1DTGA 1B3FA 1ZKBA 1P1NA 3H7MA 2F6GA 4YB5A 4FEBA 4JWXA 1JW4A 4MH5A 1Y3QA 4U1OA 3K2DA 3VV5A 3PMWA 3TTNA 3K0VA 4KYDA 3G3HA 3IORA 4IO5A 4H65A 1MXWA 4NF6A 2PVUA 3VVDA 3K6WA 1MXYA 1DPPA 3FXUA 1O7TA 2Z8EA 3RNNA 4EUOA 3C32A 5HPQA 1MQHA 1CB6A 1B5HA 4LVQA 1B58A 2PMSA 3K1MA 5DVFA 4MBPA 3TPAA 2ZNSA 4RNSA 2O7IA 1B5JA 1WODA 1R9QA 2DSFA 2F7BA 1P99A 3TTLA 3GXAA 3IR1A 3IB2A 1A54A 2I49A 1TFDA 4OFJA 1FQAA 4YMBA 1DTZA 2AL5A 2VHAA 1AL3A 3C36A 1KWHA 2O84X 3EHSA 1SDXA 1JW1A 1MDP1 1JW5A 3U8QA 4OERA 4L17A 4U2RA 3IK6B 4BLAA 3IL1B 1Z7ME 3SEYA 4YKPA 5DEXB 3L6GA 3K4UA 4JXIA 3TCFA 1M5CA 2UVJA 1A99A 5CC2A 2XXYA 1D9YA 1MPDA 2P2AA 1FW0A 4LQ2A 4U4XA 1PDAA 4QFKA 1N7WA 4M1VA 4RPNA 3V83A 2I6EA 5EYFA 1OLCA 5JK4A 3CFXA 1B1HA 3MWBA 4ESXA 4ECFA 1S7YA 3RPWA 1MY3A 4O3AA 2DYXA 3TCGA 4N6PA 3DP8A 2FNCA 3PD9A 1JETA 3O29A 4R2FA 1EU8A 2H98A 2P0SA 3CI8A 4JDFA 4KR5A 2RF1A 2Y7KA 4LZ5A 3TFLA 2XXQA 4NWDA 4F19A 1LFGA 1SBPA 2ZNTA 3TCHA 3RY3A 1VR5A 2VD2A 3DELB 1B3GA 1MXUA 4XIGQ 3I6VA 4ELRA 1B05A 3HCQA 3VE1B 3KGCA 4KD5A 3FV1A 1I6QA 4ONYA 4QFPA 3PPRA 4NF8B 3EHUA 3FIRA 2Y7IA 2UXAA 2XXUA 4IO7A 5AE4A 2O7UA 2ZXTA 3RLFE 1EZPA 3IOWA 1QUKA 4UA8A 3LSXA 1JEVA 1O63A 3RUMA 2Q2CA 1MY0A 2QMXA 4PFYA 2NUVA 1OMPA 3TAJA 3HHGA 1A40A 4THIA 4OZ9A 4OWDA 2IA4A 3FATA 1URDA 1QUJA 1HSJA 1MXZA 1AH5A 3DP6A 3SKPA 1NNFA 2DP8A 2XXXA 3PUWE 4R2BA 1UTBB 1P1WA 2ZYMA 4G68C 3FJ7A 3EPEA 1XOCA 3SEWA 1EZ9A 1MPBA 3WAEA 3ILTB 4R75A 2BJJX 1MH4A 2OZZA 3IX1A 3OSQA 1PB7A 1FQEA 1Q35A 3EN3A 1HSLA 3UIFA 5AA2B 2DWIA 2HXWA 4LONB 2DQVA 3CSGA 3TODA 4HS7A 3R6UA 2Y7WA 2GHAA 5ISUA 1NMUA 5I59A 2W7YA 1MPCA 1NNKA 2RC7A 2ZYKA 3MPLA 1I69A 1B2HA 1YTVA 1IXIA 3MBPA 2Z8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W15 C;  1MY4 A;  3IB0 A;  4YIC A;  1MY2 A;  3SEV A;  2Y84 A;  4JWO A;  5H8Q A;  3K6V A;  3MVY A;  4GVO A;  4Q30 B;  1OLA A;  1FQD A;  3DLN A;  1URG A;  2M8C A;  4NED A;  2RC8 A;  3OXN A;  4XKR A;  2Q89 A;  2NXO A;  3VLW A;  1HSE A;  4PFU A;  1IXC A;  3U92 A;  4ESW A;  4N07 A;  4OQO A;  1MXX A;  4G8N A;  2G93 A;  4U21 A;  3AXF A;  1B32 A;  3O6G A;  5TP9 A;  3ILU B;  1I6A A;  4BDR A;  4X9T A;  3OO9 A;  2V93 A;  1B6H A;  4FEC A;  2I3V A;  5AA4 A;  4GL0 A;  1P1U A;  2R71 A;  3PMX A;  4NF4 A;  1AMF A;  1M5B A;  2DVZ A;  3KG2 A;  1UIU A;  3F11 A;  1FTJ A;  5B7D A;  4NTL A;  1JQF A;  3G3I A;  2XD3 A;  3T9U A;  5H8F B;  3M3L A;  4BDM A;  4F39 A;  4QFN A;  1LBC A;  3TTM A;  3RGY A;  5I58 A;  4GL8 A;  3LSL A;  4KHZ E;  4OET A;  3KSX A;  3ODB A;  3C35 A;  3FVK A;  1B51 A;  2RCB A;  1IZ1 A;  1NFT A;  1PBP A;  1LFH A;  4R73 A;  3H4Z A;  3B6Q A;  5F1Q A;  4MLQ A;  3FJM A;  3FXR A;  1ZBM A;  2XD2 A;  3QIM A;  1AOV A;  4MLV A;  5I56 A;  1MQG A;  1DSN A;  1SW1 A;  3T66 A;  3OEN A;  1GTK A;  1QJM A;  1FQB A;  3E4R A;  3B7D A;  3IJX B;  4R6K A;  3CFL A;  2QS2 A;  1XT8 A;  4ZEF A;  1NH8 A;  2ESN A;  1FQF A;  4R9F A;  3JYR A;  3FUZ A;  1LGB C;  5AA2 D;  3JZJ A;  2B65 A;  4BDN A;  3M8U A;  4DXC A;  4ZEK A;  2YLN A;  4FJP A;  2D3I A;  4OFO A;  2OWS A;  1SVX B;  4FAT A;  4K3F A;  3E9X A;  3H03 A;  1USY H;  3LBS A;  5HBC A;  3W9V A;  4PET A;  2Q9T A;  3BFT A;  3B6T A;  3R26 A;  1JNF A;  3PPN A;  2REJ A;  4OYV A;  4OTE A;  2REG A;  2VGQ A;  4C1T A;  3PPQ A;  1TFA A;  1ANF A;  1M5F A;  2UVI A;  2HFB A;  3T93 B;  4X1D A;  3PU5 A;  1SYI A;  1Y1Z A;  2ZNU A;  1BKA A;  3HV1 A;  3KN7 A;  5AA1 A;  4OVJ A;  4NF5 A;  1M5D A;  2O51 A;  2Y7R A;  5F7V A;  1N04 A;  2A5T B;  3H6W A;  4YZZ A;  5CRY A;  5H8H B;  2QS3 A;  1MS7 A;  5DVI A;  3O28 A;  5I2N A;  2HQ0 A;  4QFO A;  1B4H A;  3T9H B;  4U23 A;  1DOT A;  4KI0 E;  3VLU A;  4JB7 A;  4OEV A;  5H8N A;  4I62 A;  1PC3 A;  2F7C A;  1N3X A;  3HST A;  4OES A;  2B3B A;  4F1U A;  1OIB A;  5KDT A;  3R7X A;  4F2Q A;  5J1D A;  1M5E A;  3OO6 A;  4FIM A;  1MDQ A;  2QMW A;  3ZS6 A;  1UIV A;  5CBR A;  3PPO A;  4OEU A;  1SYH A;  5A5X A;  3MP8 A;  4IY6 A;  4XKN A;  4KQP A;  2DOJ A;  3U94 A;  1P1Q A;  4P0G A;  4OFL A;  3PUZ E;  2V3U A;  1B40 A;  3RTF B;  2H9B A;  3RQT A;  3DP4 A;  5FHN A;  3K1P A;  1ELJ A;  3CVG A;  5JTY B;  4Q5T A;  4RJZ A;  3G7W A;  2XHD A;  5JEI A;  3SET A;  3SDF A;  3FJG A;  2E1S A;  4F3P A;  1S9T A;  3OEM A;  1IXH A;  3M3F A;  3K6U A;  3HN0 A;  2HAU A;  2O69 A;  5CM6 A;  1ZIU A;  2QRY A;  1EH3 A;  4LAT A;  3OEL A;  4YB6 A;  3G3F A;  3Q28 A;  3QAX A;  2XXR A;  2OBG A;  2RKM A;  4AQ4 A;  1XVX A;  3VXB A;  3PPP A;  3GBB A;  4JSO A;  2GHB A;  1GR2 A;  4KCD A;  5CMB A;  3VLV A;  4POX A;  4JBZ A;  4PFW A;  4G68 B;  1NH7 A;  4Z0I A;  3ONM A;  4POW A;  3G3K A;  3LR1 A;  2X7Q A;  1A7L A;  1B3L A;  5L9S A;  5DYH A;  1XC1 A;  1P1O A;  1B5I A;  4ZS9 A;  4ZE9 A;  3MZB A;  1PBQ A;  5HM4 B;  4XTC Q;  3ECR A;  3FV2 A;  2XXW A;  2ANJ A;  2QS1 A;  4TQU Q;  2VOZ A;  4BDO A;  4XKP A;  5K2X A;  1FTO A;  3H3G A;  2V84 A;  5TPA B;  1A8F A;  1Y3P A;  4TOZ A;  1LCF A;  1B1X A;  1MG1 A;  5DEX A;  1USY E;  3LSF B;  4QSE A;  3CRB A;  4DCY A;  4ZDM A;  1MRP A;  2UYF A;  3VDF A;  1B7U A;  3T9V A;  3A3U A;  3KFM A;  5K2Y A;  3QUF A;  1POT A;  4IGT A;  3GBA A;  4YU0 A;  1IIT A;  4DLD A;  1IXG A;  2OWT A;  1RKM A;  2GRV A;  4YKK A;  4FAJ A;  3HO7 A;  2O1L A;  1BLF A;  3USD A;  3SER A;  4C0R A;  5DTB A;  4KCC A;  4ELQ A;  2P1S A;  3OOA A;  3MJN A;  3P7I A;  3VVE A;  3Q26 A;  4F2O A;  4GXS B;  4U22 A;  4ZZE A;  2YJP A;  2ZYN A;  4BDL A;  4KFQ A;  1US4 A;  3OEK A;  3THI A;  2Z23 A;  1B3E A;  3O6I A;  1RYX A;  2PYY A;  5ITP A;  1B7H A;  5ICQ A;  4XKQ A;  4IO3 A;  5DT6 A;  2LAO A;  1XHY A;  4H6D A;  3SES A;  2XXP A;  2VP1 A;  4NF8 A;  3BBR A;  3O6H A;  2XXV A;  2H4I A;  3K1N A;  1YAE A;  5KCJ B;  1ATG A;  2RC9 A;  5L8D A;  3E13 X;  3TDJ A;  2RCA A;  3UN6 A;  4TLL B;  3RTW B;  1NNP A;  3PUV E;  4NF4 B;  1BP5 A;  4H1X A;  4Q8R A;  2ABH A;  1B3H A;  4RPO A;  2AL4 A;  2QSX A;  3KBR A;  3N94 A;  3K02 A;  3KJ7 A;  4E0X A;  5ITO A;  2CMO A;  3B6W A;  1DMB A;  3EHT A;  3CSB A;  3KEI A;  2NVU B;  1B9J A;  2ONK E;  4EDP A;  5I2K A;  2QPQ A;  3K01 A;  1UTB A;  1UTH B;  1TWY A;  3MC2 A;  2F7A A;  3LSW A;  2PBW A;  3CFZ A;  1H76 A;  2ONS A;  1LAG E;  3RN8 A;  3TMG A;  4YAH X;  2IEE A;  2PT1 A;  4R6Y A;  3H06 B;  4F18 A;  4KPT A;  1AIV A;  1D4N A;  2DS9 A;  2H25 A;  1D9V A;  4IO4 A;  4YB7 A;  1VSO A;  1R9L A;  5AA2 A;  4ND9 A;  3CR9 A;  4GQO A;  3TEP A;  4HCW A;  2NOO A;  4C1U A;  3LC8 A;  4FOR A;  4R74 A;  5I57 B;  2I3W A;  1Q1K A;  1S50 A;  4DE8 A;  3S9M C;  4RK9 A;  3RT8 A;  4QF9 A;  3JV9 A;  2XXT A;  3TTR A;  1LST A;  1LAH E;  3KOS A;  1URS A;  3QXM A;  2DWJ A;  4LP2 B;  1WDN A;  1GVC A;  4GXA A;  2D5W A;  4WEP A;  5I84 A;  3KZG A;  3Q25 A;  2F8D A;  3IO4 A;  1XS5 A;  2XX9 A;  4I8C A;  4YKJ A;  1J1N A;  2KLF A;  2UVH A;  3L6H A;  2ZMB A;  3UGW A;  1N84 A;  3D4G A;  5ICT A;  1LB8 A;  1MQI A;  3VFJ A;  2F35 A;  1OVB A;  4G8H A;  4F1Y A;  4QHQ A;  3FVN A;  1FCK A;  4G77 A;  2QL3 A;  1RYO A;  1R1N A;  1MQD A;  2HEU A;  4NF6 B;  3V89 B;  4LQ5 A;  1H43 A;  2R6G E;  1A8E A;  4R6H A;  3S2V A;  4EXK A;  4JSD A;  4WXJ A;  4FE8 A;  1LLS A;  4Q0C A;  5H8F A;  2H5Y A;  2XX7 A;  2HAV A;  1POY 1;  2G29 A;  4H67 A;  4HCY A;  2QS4 A;  2ONR A;  1SI0 A;  3N6U A;  2Q8J A;  3I5O A;  4H8I A;  1MM6 A;  1QUI A;  1B52 A;  3FAS A;  1MM7 A;  1OQH A;  1QUL A;  2OLB A;  2CZL A;  3U93 A;  1N76 A;  3UOR A;  3S9L C;  1UQW A;  3UK4 A;  2O6A A;  2V3T A;  1L5T A;  1OVT A;  1B46 A;  2GFE A;  3N5L A;  5IKB A;  4YMA A;  4G8M A;  1TXF A;  3IOV A;  3O97 A;  4U1Z A;  3T96 B;  4ZED A;  1ZU0 A;  4IO2 A;  4G4P A;  3RT6 B;  3QYT A;  3UP9 A;  2R9J A;  2FA7 A;  3C33 A;  1H44 A;  4F22 A;  3K00 A;  2PT2 A;  4PE5 B;  4AB5 A;  2YPN A;  4YKI A;  3TYH A;  3BKI B;  4F1V A;  1ZTY A;  4GF8 A;  4I1D A;  4OMB A;  4JWY A;  4EF1 A;  4QSD A;  1QKA A;  1Y1M A;  3O2A A;  4LZ8 A;  1OQG A;  3MW0 A;  4Z7E A;  3KN8 A;  1O64 A;  1CE2 A;  3V5A A;  2VD3 A;  3CG1 A;  3FVO A;  3TQW A;  3IAZ A;  4P0I A;  3EF7 A;  3KSJ A;  4NWC A;  4TLM B;  3ZSF A;  1LFI A;  3QK6 A;  4ZZA A;  2DE2 A;  2Z8F A;  1II5 A;  5CMK A;  5L9O A;  3IOU A;  4E0W A;  5EHS A;  4ZEI A;  1FTL A;  4PP0 A;  2NWJ A;  4F31 B;  2Z22 A;  3OO8 A;  2DWA A;  1VFE A;  3C34 A;  4HW8 A;  3PD8 A;  4KYS A;  2UYE A;  2AYS A;  3SEX A;  4PQJ A;  2FYI A;  4H5G A;  2A5T A;  2OK2 A;  5H8H A;  2UVG A;  1SW5 A;  3H6U A;  5KZT A;  4F3S A;  1F9B A;  1FQC A;  3M3K A;  4ZE8 A;  5TU0 A;  1SI1 A;  3MUQ A;  1MY1 A;  5FHO A;  1MQJ A;  3C4M A;  3MAM A;  1N7X A;  4GOT A;  1T0K A;  4X48 A;  5CBS A;  4GIZ A;  3FVG A;  4R9G A;  4BDQ A;  4ZEC A;  2I0C A;  4H0W A;  3PUX E;  1Y20 A;  2PX1 A;  3N26 A;  5IAI A;  3IOT A;  3GLB A;  5FHM A;  2ZYO A;  5ELV A;  4OHN A;  2O1M A;  1MH3 A;  1Y4C A;  3SEU A;  3MPK A;  4IB2 A;  4F29 A;  4PFT A;  5AA3 A;  3FZV A;  2H99 A;  4LUB A;  1QW0 A;  4H5F A;  5DVJ A;  4M4G A;  2XXH A;  3TUS A;  5JTY A;  3MZ1 A;  3PV0 E;  2V25 A;  2F5X A;  2OJT A;  3ZKK A;  1JVX A;  3TKD A;  1B7Z A;  5CMM A;  4EQ9 A;  1VFD A;  2X7P A;  1EZO A;  3LUY A;  3IO6 A;  4DIG A;  4LZ7 A;  4XXU A;  3KJT A;  3QUJ A;  4GD5 A;  4DZ1 A;  3UA8 A;  4X1B A;  1SW2 A;  4EXL A;  4RY1 A;  4DDD A;  1R6Z A;  3N6T A;  2E0S A;  4RXL A;  5B70 A;  1PB8 A;  1FTK A;  3ZKL A;  3E3K A;  5I59 B;  1ZJL A;  1Y9U A;  4IY5 A;  3BFU A;  1B0L A;  4G68 A;  4EQB A;  3A3C A;  1MXV A;  2F34 A;  3MVW A;  4R72 A;  3PMV A;  1N0T A;  3V8X B;  1SW4 A;  1BIY A;  3U72 A;  3K6X A;  4GRK A;  4UAC A;  5H8Q B;  3Q29 A;  1Z7N E;  2XXI A;  5I2K B;  1I6B A;  4F3B A;  2DE3 A;  5FTH A;  5TPA A;  3D4C A;  1IQ7 A;  2RIN A;  5TP9 B;  2F97 A;  1N3W A;  1LCT A;  2O68 A;  4F3G A;  5AA4 B;  4MF3 A;  3OO7 A;  1NKX A;  4O3B A;  2OCU A;  2THI A;  1YPN A;  5BUU A;  2HZK A;  4I9D A;  2I58 A;  4O3C A;  2I48 A;  3VVF A;  2I4C A;  1XVY A;  1FTM A;  5I58 B;  2WKY A;  1DPE A;  4RK2 A;  1Y3N A;  3O9P A;  3OD7 A;  3DM0 A;  3TEL A;  2X26 A;  4HTG A;  2DWH A;  2Y7P A;  4QFL A;  4GWO A;  4QRZ A;  2I0B A;  4LA9 A;  3H6V A;  3TZA A;  3FXQ A;  3TQL A;  3EQ1 A;  5I56 B;  1US5 A;  2F78 A;  1A55 A;  3WAF A;  1SD3 A;  4DXU A;  1H45 A;  1LBB A;  4GLI A;  3MVZ A;  1D3K A;  5CI5 A;  1B0H A;  3A09 A;  3MP1 A;  2ALU A;  3C9H A;  2XX8 A;  3H6T A;  4MFI A;  2Q2A A;  4EQ7 A;  2B3F A;  5M2V A;  3CG3 A;  1GGG A;  4OEN A;  4H8J A;  1ZLQ A;  1IEJ A;  1GV8 A;  1LB9 A;  3QSL A;  3G3J A;  5KCJ A;  3PUY E;  1Y4T A;  2HZL A;  1NNT A;  2QJE A;  2DVC A;  1QKB A;  3MP6 A;  4N13 A;  4ELP A;  4WED A;  3OMB A;  4KYE A;  1ZMG A;  4NMY A;  4AB6 A;  1YCJ A;  2GH9 A;  4ZEB A;  3MQ9 A;  2D21 A;  5LOM A;  3GZG A;  2AIX A;  1VE4 A;  1QVS A;  3KN3 A;  3Q27 A;  1SQY A;  3HPI A;  1UTH A;  3W9W A;  2I4B A;  3CIJ A;  4ELO A;  3IJO B;  3S9N C;  2DXR A;  4G2Z A;  4DCX A;  4NF5 B;  1B4Z A;  1NL5 A;  1WVJ A;  3KOT A;  3O66 A;  3OSR A;  3MZ9 A;  4U4S A;  3FGS A;  2A5S A;  4ISU A;  1TT1 A;  1H3D A;  5H8S A;  4IGR A;  4DXB A;  1LAF E;  5I2N B;  3TTK A;  5L9M A;  3T22 A;  5EHM A;  3S4U A;  4QSC A;  3I3V A;  5H8N B;  2HCA A;  2F36 A;  3HHF A;  5I57 A;  2DE4 A;  4WKM A;  2DXY A;  1JEU A;  4GFR A;  1JVY A;  4RYA A;  4FED A;  5KDT B;  4IO6 A;  2F6P A;  2V3Q A;  3PGF A;  1BTJ A;  3S9E A;  3VXC A;  1LAX A;  2Q88 A;  3MVX A;  3IB1 A;  4NE4 A;  4OXV A;  1IUD A;  5FTI A;  3U1O A;  5A5X B;  1IIW A;  3C31 A;  3T9X B;  3G3G A;  4EF2 A;  1PEB A;  3FD3 A;  5CMC A;  5BWJ A;  4P11 A;  4RA1 A;  1PB9 A;  1DTG A;  1B3F A;  1ZKB A;  1P1N A;  3H7M A;  2F6G A;  4YB5 A;  4FEB A;  4JWX A;  1JW4 A;  4MH5 A;  1Y3Q A;  4U1O A;  3K2D A;  3VV5 A;  3PMW A;  3TTN A;  3K0V A;  4KYD A;  3G3H A;  3IOR A;  4IO5 A;  4H65 A;  1MXW A;  4NF6 A;  2PVU A;  3VVD A;  3K6W A;  1MXY A;  1DPP A;  3FXU A;  1O7T A;  2Z8E A;  3RNN A;  4EUO A;  3C32 A;  5HPQ A;  1MQH A;  1CB6 A;  1B5H A;  4LVQ A;  1B58 A;  2PMS A;  3K1M A;  5DVF A;  4MBP A;  3TPA A;  2ZNS A;  4RNS A;  2O7I A;  1B5J A;  1WOD A;  1R9Q A;  2DSF A;  2F7B A;  1P99 A;  3TTL A;  3GXA A;  3IR1 A;  3IB2 A;  1A54 A;  2I49 A;  1TFD A;  4OFJ A;  1FQA A;  4YMB A;  1DTZ A;  2AL5 A;  2VHA A;  1AL3 A;  3C36 A;  1KWH A;  2O84 X;  3EHS A;  1SDX A;  1JW1 A;  1MDP 1;  1JW5 A;  3U8Q A;  4OER A;  4L17 A;  4U2R A;  3IK6 B;  4BLA A;  3IL1 B;  1Z7M E;  3SEY A;  4YKP A;  5DEX B;  3L6G A;  3K4U A;  4JXI A;  3TCF A;  1M5C A;  2UVJ A;  1A99 A;  5CC2 A;  2XXY A;  1D9Y A;  1MPD A;  2P2A A;  1FW0 A;  4LQ2 A;  4U4X A;  1PDA A;  4QFK A;  1N7W A;  4M1V A;  4RPN A;  3V83 A;  2I6E A;  5EYF A;  1OLC A;  5JK4 A;  3CFX A;  1B1H A;  3MWB A;  4ESX A;  4ECF A;  1S7Y A;  3RPW A;  1MY3 A;  4O3A A;  2DYX A;  3TCG A;  4N6P A;  3DP8 A;  2FNC A;  3PD9 A;  1JET A;  3O29 A;  4R2F A;  1EU8 A;  2H98 A;  2P0S A;  3CI8 A;  4JDF A;  4KR5 A;  2RF1 A;  2Y7K A;  4LZ5 A;  3TFL A;  2XXQ A;  4NWD A;  4F19 A;  1LFG A;  1SBP A;  2ZNT A;  3TCH A;  3RY3 A;  1VR5 A;  2VD2 A;  3DEL B;  1B3G A;  1MXU A;  4XIG Q;  3I6V A;  4ELR A;  1B05 A;  3HCQ A;  3VE1 B;  3KGC A;  4KD5 A;  3FV1 A;  1I6Q A;  4ONY A;  4QFP A;  3PPR A;  4NF8 B;  3EHU A;  3FIR A;  2Y7I A;  2UXA A;  2XXU A;  4IO7 A;  5AE4 A;  2O7U A;  2ZXT A;  3RLF E;  1EZP A;  3IOW A;  1QUK A;  4UA8 A;  3LSX A;  1JEV A;  1O63 A;  3RUM A;  2Q2C A;  1MY0 A;  2QMX A;  4PFY A;  2NUV A;  1OMP A;  3TAJ A;  3HHG A;  1A40 A;  4THI A;  4OZ9 A;  4OWD A;  2IA4 A;  3FAT A;  1URD A;  1QUJ A;  1HSJ A;  1MXZ A;  1AH5 A;  3DP6 A;  3SKP A;  1NNF A;  2DP8 A;  2XXX A;  3PUW E;  4R2B A;  1UTB B;  1P1W A;  2ZYM A;  4G68 C;  3FJ7 A;  3EPE A;  1XOC A;  3SEW A;  1EZ9 A;  1MPB A;  3WAE A;  3ILT B;  4R75 A;  2BJJ X;  1MH4 A;  2OZZ A;  3IX1 A;  3OSQ A;  1PB7 A;  1FQE A;  1Q35 A;  3EN3 A;  1HSL A;  3UIF A;  5AA2 B;  2DWI A;  2HXW A;  4LON B;  2DQV A;  3CSG A;  3TOD A;  4HS7 A;  3R6U A;  2Y7W A;  2GHA A;  5ISU A;  1NMU A;  5I59 A;  2W7Y A;  1MPC A;  1NNK A;  2RC7 A;  2ZYK A;  3MPL A;  1I69 A;  1B2H A;  1YTV A;  1IXI A;  3MBP A;  2Z8D A; 
#chains in the Genus database with same CATH topology
 3W15 C;  3IFA A;  1MY4 A;  3IB0 A;  4YIC A;  1MY2 A;  3SEV A;  1LBX A;  2Y84 A;  4JWO A;  5H8Q A;  3K6V A;  3MVY A;  4GVO A;  4Q30 B;  2PCR A;  1OLA A;  3KC1 A;  1FQD A;  3DLN A;  1URG A;  2M8C A;  4NED A;  2RC8 A;  3OXN A;  4XKR A;  2Q89 A;  2NXO A;  3VLW A;  1HSE A;  4PFU A;  1IXC A;  3U92 A;  4ESW A;  4N07 A;  4OQO A;  1MXX A;  4G8N A;  2G93 A;  4U21 A;  3AXF A;  1B32 A;  1XI6 A;  3O6G A;  5TP9 A;  3ILU B;  1I6A A;  4BDR A;  4X9T A;  3OO9 A;  4G61 A;  2V93 A;  1B6H A;  4FEC A;  2I3V A;  5AA4 A;  4GL0 A;  4N17 A;  1P1U A;  2R71 A;  3PMX A;  4NF4 A;  1AMF A;  4FBP A;  1M5B A;  2DVZ A;  3KG2 A;  1UIU A;  3F11 A;  1FTJ A;  5B7D A;  4NTL A;  2WEF A;  1JQF A;  3G3I A;  2XD3 A;  3MYU A;  3T9U A;  5H8F B;  3M3L A;  4BDM A;  4F39 A;  4QFN A;  1LBC A;  3TTM A;  3RGY A;  5I58 A;  4GL8 A;  3LSL A;  4KHZ E;  4OET A;  3KSX A;  4O7I A;  5ET5 A;  3ODB A;  3C35 A;  3FVK A;  1B51 A;  2RCB A;  1IZ1 A;  1NFT A;  1PBP A;  3BIH A;  1LFH A;  1NV0 A;  4R73 A;  3H4Z A;  3B6Q A;  5F1Q A;  4MLQ A;  3FJM A;  3FXR A;  1ZBM A;  2XD2 A;  3QIM A;  1AOV A;  4MLV A;  5I56 A;  1MQG A;  1DSN A;  1SW1 A;  5EQ9 A;  2MKZ A;  3T66 A;  3OEN A;  2XWI A;  4MNP A;  1GTK A;  1QJM A;  1FQB A;  3E4R A;  3B7D A;  4PE3 A;  5T3J A;  4OVT A;  3IJX B;  4R6K A;  3CFL A;  2QS2 A;  1IMB A;  1XT8 A;  4ZEF A;  1NH8 A;  2ESN A;  1FQF A;  4R9F A;  3JYR A;  3FUZ A;  4PF8 A;  4OA4 A;  1LGB C;  5AA2 D;  3JZJ A;  2B65 A;  4BDN A;  3M8U A;  4DXC A;  4ZEK A;  2R8T A;  4PTK A;  2YLN A;  4FJP A;  2D3I A;  4OFO A;  4GWY A;  2OWS A;  3U65 A;  1SVX B;  4FAT A;  4K3F A;  2CZH A;  4NQ8 A;  3E9X A;  3H03 A;  1USY H;  4X04 A;  3LBS A;  4GWZ A;  3ISP A;  5HBC A;  3W9V A;  4N6K A;  4PET A;  2Q9T A;  1FPB A;  3BFT A;  3B6T A;  1DBZ A;  4N8G A;  3R26 A;  1JNF A;  3PPN A;  2REJ A;  5EYG A;  4OYV A;  4OTE A;  1FPI A;  2QFL A;  2REG A;  2VGQ A;  2WBB A;  4C1T A;  3PPQ A;  1TFA A;  4XF5 A;  1ANF A;  1M5F A;  2UVI A;  2HFB A;  3T93 B;  5FBP A;  4X1D A;  3PU5 A;  1SYI A;  4PCD A;  4MIJ A;  1Y1Z A;  2ZNU A;  1BKA A;  3HV1 A;  3KN7 A;  2CEX A;  5AA1 A;  4OVJ A;  3T1B A;  4NF5 A;  1M5D A;  2O51 A;  2Y7R A;  5F7V A;  2FIX A;  1N04 A;  2A5T B;  3H6W A;  4YZZ A;  5CRY A;  5H8H B;  1FRP A;  2QS3 A;  1MS7 A;  5DVI A;  3O28 A;  5I2N A;  2HQ0 A;  2FBP A;  4QFO A;  4P56 A;  1NI9 A;  1B4H A;  3T9H B;  4U23 A;  1DOT A;  4KI0 E;  3VLU A;  4JB7 A;  4OEV A;  5H8N A;  4I62 A;  1PC3 A;  2L5V A;  2F7C A;  1N3X A;  5IZ1 A;  3HST A;  4OES A;  5I7I A;  2B3B A;  4F1U A;  1OIB A;  5KDT A;  3R7X A;  4F2Q A;  5J1D A;  1M5E A;  3OO6 A;  4FIM A;  1MDQ A;  2JJK A;  2QMW A;  3ZS6 A;  1UIV A;  5CBR A;  1KA1 A;  1YXI A;  3PPO A;  4OEU A;  4MX6 A;  1NV3 A;  1SYH A;  5A5X A;  3MP8 A;  4IY6 A;  4XKN A;  1FBH A;  4KQP A;  2DOJ A;  3U94 A;  5IGA A;  2B4L A;  1P1Q A;  4P0G A;  4OFL A;  1NUY A;  3PUZ E;  2V3U A;  1B40 A;  3RTF B;  2H9B A;  3RQT A;  3DP4 A;  5FHN A;  3K1P A;  1ELJ A;  3CVG A;  4Q5T A;  4RJZ A;  5JTY B;  3G7W A;  2XHD A;  5JEI A;  3SET A;  3SDF A;  4OVP A;  3FJG A;  2E1S A;  4PAF A;  4F3P A;  1S9T A;  3OEM A;  1IXH A;  3M3F A;  3K6U A;  4NHB A;  2HAU A;  3HN0 A;  2O69 A;  1QGX A;  4JVD A;  2Y5L A;  5CM6 A;  1ZIU A;  2QRY A;  1IME A;  4H45 A;  1EH3 A;  4LAT A;  3OEL A;  4YB6 A;  3G3F A;  3Q28 A;  3QAX A;  4DI4 B;  2XXR A;  2OBG A;  1G0H A;  2RKM A;  4AQ4 A;  1XVX A;  3VXB A;  3PPP A;  3GBB A;  4JSO A;  2GHB A;  1GR2 A;  4KCD A;  5CMB A;  3VLV A;  4POX A;  4JBZ A;  4PFW A;  4G68 B;  1NH7 A;  4Z0I A;  3ONM A;  4POW A;  1D9Q A;  3G3K A;  3LR1 A;  2X7Q A;  2PFY A;  4PAK A;  1A7L A;  1B3L A;  5L9S A;  1FPE A;  5DYH A;  1P1O A;  1XC1 A;  1B5I A;  4ZS9 A;  4ZE9 A;  3MZB A;  1PBQ A;  5HM4 B;  4XTC Q;  2XA5 A;  2XWO A;  3ECR A;  3FV2 A;  2XXW A;  2ANJ A;  4N81 A;  1EYI A;  2QS1 A;  4TQU Q;  2VOZ A;  3E78 A;  4BDO A;  4XKP A;  1NV6 A;  5K2X A;  1FTO A;  3H3G A;  2V84 A;  5TPA B;  1A8F A;  1Y3P A;  4TOZ A;  1LCF A;  1B1X A;  1MG1 A;  5DEX A;  1CNQ A;  2HXR A;  1USY E;  2CZK A;  3LSF B;  4QSE A;  3CRB A;  4DCY A;  4ZDM A;  1MRP A;  2UYF A;  3VDF A;  1B7U A;  5LTC A;  3T9V A;  3A3U A;  3KFM A;  5K2Y A;  4P8B A;  3QUF A;  1POT A;  4QBA A;  4IGT A;  3GBA A;  4YU0 A;  1IIT A;  4DLD A;  1IXG A;  2OWT A;  1RKM A;  2GRV A;  4YKK A;  4FAJ A;  3HO7 A;  2O1L A;  1BLF A;  3USD A;  3SER A;  2B4M A;  4C0R A;  5DTB A;  4KCC A;  4OVR A;  4ELQ A;  2P1S A;  3OOA A;  3MJN A;  3BIG A;  3P7I A;  3VVE A;  3Q26 A;  4F2O A;  4GXS B;  5IZ3 A;  4U22 A;  4ZZE A;  2YJP A;  2ZYN A;  4BDL A;  4KFQ A;  1US4 A;  3OEK A;  3THI A;  2Z23 A;  1B3E A;  3O6I A;  1RYX A;  2PYY A;  5ITP A;  1B7H A;  5ICQ A;  4XKQ A;  4IO3 A;  5F24 A;  5DT6 A;  1FBD A;  1XHY A;  2LAO A;  4H6D A;  4MCO A;  3SES A;  2XXP A;  2VP1 A;  4NF8 A;  3BBR A;  3O6H A;  1NV1 A;  4MEV A;  3LUZ A;  2XXV A;  2H4I A;  3K1N A;  1YAE A;  5KCJ B;  1ATG A;  2RC9 A;  5L8D A;  3E13 X;  3TDJ A;  2RCA A;  3UN6 A;  2CZI A;  4TLL B;  3RTW B;  1NNP A;  3PUV E;  4NF4 B;  1BP5 A;  3HFU A;  4H1X A;  4Q8R A;  2ABH A;  4GX3 A;  1B3H A;  4RPO A;  2AL4 A;  2QSX A;  3KBR A;  3N94 A;  1FPL A;  1BK4 A;  3K02 A;  1NUX A;  3KJ7 A;  4E0X A;  4MNI A;  5ITO A;  2CMO A;  3B6W A;  1DMB A;  3EHT A;  3CSB A;  3KEI A;  2NVU B;  1B9J A;  2ONK E;  4EDP A;  5I2K A;  2QPQ A;  3K01 A;  1UTB A;  1UTH B;  1TWY A;  3MC2 A;  4PF6 A;  1FBP A;  2F7A A;  3LSW A;  2PBW A;  2P3N A;  3CFZ A;  1FPK A;  4UAB A;  1H76 A;  2ONS A;  1LAG E;  3RN8 A;  3TMG A;  4YAH X;  2IEE A;  1LBW A;  1EYJ A;  2PT1 A;  4R6Y A;  3H06 B;  4AS5 A;  4F18 A;  4KPT A;  1AIV A;  2FHY A;  3NOH A;  1D4N A;  2DS9 A;  2H25 A;  1D9V A;  4IO4 A;  4YB7 A;  4MHF A;  1VSO A;  1R9L A;  5AA2 A;  4ND9 A;  3CR9 A;  4GQO A;  3TEP A;  4HCW A;  2NOO A;  4C1U A;  3LC8 A;  4FOR A;  4R74 A;  5I57 B;  2I3W A;  1Q1K A;  1S50 A;  4DE8 A;  3S9M C;  4RK9 A;  3RT8 A;  4QF9 A;  3JV9 A;  2XXT A;  4OVS A;  3TTR A;  1LST A;  1LAH E;  3KOS A;  1URS A;  3QXM A;  2DWJ A;  4LP2 B;  4HE2 A;  1WDN A;  4X8R A;  1GVC A;  3MST A;  4GXA A;  3LV0 A;  2D5W A;  4WEP A;  5I84 A;  5EQA A;  3KZG A;  3Q25 A;  2F8D A;  3IO4 A;  1XS5 A;  2XX9 A;  3EKI A;  1LBY A;  4I8C A;  4YKJ A;  1J1N A;  2KLF A;  2UVH A;  3L6H A;  3PTY A;  2ZMB A;  3UGW A;  2KR0 A;  1N84 A;  3D4G A;  4XEQ A;  2OWZ A;  5ICT A;  1LB8 A;  2P3V A;  1MQI A;  3VFJ A;  1FSA A;  2F35 A;  1OVB A;  4G8H A;  4F1Y A;  4QHQ A;  3FVN A;  1FCK A;  4G77 A;  4MMP A;  2QL3 A;  1RYO A;  1R1N A;  1MQD A;  2HEU A;  4NF6 B;  3V89 B;  4LQ5 A;  4P3L A;  2XXK A;  1H43 A;  2R6G E;  1A8E A;  4KXP A;  4R6H A;  3S2V A;  4EXK A;  4JSD A;  4I3Y A;  4WXJ A;  4FE8 A;  1LLS A;  4Q0C A;  4I40 A;  5H8F A;  2H5Y A;  2XX7 A;  2HAV A;  1POY 1;  2G29 A;  1EYK A;  4H67 A;  4HCY A;  2QS4 A;  1FJ6 A;  2ONR A;  1SI0 A;  3N6U A;  2Q8J A;  3I5O A;  4H8I A;  1MM6 A;  1QUI A;  1B52 A;  3FAS A;  1MM7 A;  1OQH A;  1QUL A;  2OLB A;  2CZL A;  3U93 A;  1N76 A;  3UOR A;  3S9L C;  1NUZ A;  1UQW A;  3UK4 A;  2O6A A;  2V3T A;  1L5T A;  1OVT A;  1B46 A;  2GFE A;  1FBE A;  3N5L A;  5IKB A;  4YMA A;  4G8M A;  4AS4 A;  1TXF A;  3IOV A;  3O97 A;  4U1Z A;  3T96 B;  4ZED A;  1ZU0 A;  4IO2 A;  4G4P A;  3RT6 B;  4PC9 A;  3QYT A;  3UP9 A;  2R9J A;  2FA7 A;  3C33 A;  1H44 A;  4F22 A;  3K00 A;  4NX1 A;  2PT2 A;  4PE5 B;  4AB5 A;  2YPN A;  4YKI A;  3TYH A;  3BKI B;  3RPL B;  4F1V A;  1ZTY A;  4GF8 A;  3SZP A;  4I1D A;  4OMB A;  4JWY A;  4EF1 A;  4QSD A;  5IZZ A;  4NAP A;  1QKA A;  3QMF A;  1Y1M A;  3O2A A;  4LZ8 A;  1OQG A;  2FVZ A;  3MW0 A;  4Z7E A;  3KN8 A;  1O64 A;  1CE2 A;  3V5A A;  2VD3 A;  3CG1 A;  3FVO A;  4O94 A;  3TQW A;  3IAZ A;  4P0I A;  3EF7 A;  3KSJ A;  1IMA A;  4NWC A;  4TLM B;  3ZSF A;  1LFI A;  3QK6 A;  4ZZA A;  2DE2 A;  1VDW A;  2Z8F A;  1II5 A;  5CMK A;  5L9O A;  3IOU A;  4E0W A;  5EHS A;  4ZEI A;  1FTL A;  1NV2 A;  4PP0 A;  2NWJ A;  4F31 B;  2Z22 A;  3OO8 A;  2DWA A;  1VFE A;  3C34 A;  5DW8 A;  4HW8 A;  3PD8 A;  4KYS A;  2UYE A;  2AYS A;  3SEX A;  4PQJ A;  2FYI A;  1RDZ A;  4H5G A;  2A5T A;  4P9K A;  2OK2 A;  5EQ8 A;  5H8H A;  2UVG A;  1SW5 A;  3H6U A;  5KZT A;  2DDK A;  4F3S A;  3ROJ A;  1F9B A;  1FQC A;  3M3K A;  4ZE8 A;  5TU0 A;  1SI1 A;  3MUQ A;  1MY1 A;  5FHO A;  1MQJ A;  3C4M A;  3MAM A;  1N7X A;  4GOT A;  1T0K A;  4X48 A;  5CBS A;  4GIZ A;  3FVG A;  4N91 A;  4R9G A;  4BDQ A;  4ZEC A;  1RDX A;  1DCU A;  2I0C A;  4H0W A;  3PUX E;  1Y20 A;  2PX1 A;  3N26 A;  5IAI A;  1K9Y A;  3IOT A;  3GLB A;  5FHM A;  2ZYO A;  5ELV A;  4OHN A;  2O1M A;  1MH3 A;  1Y4C A;  3SEU A;  3MPK A;  1JP4 A;  4IB2 A;  4F29 A;  1K9Z A;  4PFT A;  5AA3 A;  3FZV A;  2H99 A;  4LUB A;  1QW0 A;  4LN5 A;  2Y5K A;  4H5F A;  2WBD A;  5DVJ A;  4M4G A;  2XXH A;  3TUS A;  5JTY A;  3MZ1 A;  3PV0 E;  2V25 A;  2F5X A;  2OJT A;  3ZKK A;  1JVX A;  3E79 A;  3TKD A;  1B7Z A;  4GWW A;  5CMM A;  4EQ9 A;  1VFD A;  1NV4 A;  2F3D A;  2Q74 A;  2X7P A;  1EZO A;  3LUY A;  1FBC A;  5I5P A;  5IM2 A;  3IO6 A;  4DIG A;  4LZ7 A;  4XXU A;  3D1R A;  3KJT A;  3QUJ A;  4NF0 A;  4GD5 A;  4DZ1 A;  1YZ0 A;  3UA8 A;  4X1B A;  3A29 A;  1SW2 A;  4EXL A;  4RY1 A;  4DDD A;  1R6Z A;  3N6T A;  2E0S A;  4RXL A;  5B70 A;  1PB8 A;  1FTK A;  4DI3 D;  3ZKL A;  2Q8M A;  3E3K A;  5I59 B;  1ZJL A;  1Y9U A;  4IY5 A;  3BFU A;  1KA0 A;  1B0L A;  4G68 A;  4EQB A;  3A3C A;  1MXV A;  2F34 A;  3MVW A;  4R72 A;  3PMV A;  1N0T A;  4P1L A;  3V8X B;  4GX6 A;  1SW4 A;  3B50 A;  1BIY A;  3U72 A;  3K6X A;  4PGP A;  4GBW A;  4GRK A;  4UAC A;  5H8Q B;  3Q29 A;  1Z7N E;  2XXI A;  5ET7 A;  5I2K B;  1I6B A;  2ZZX A;  2QVR A;  4F3B A;  2DE3 A;  3FBP A;  5ET6 A;  3KBZ A;  5FTH A;  5TPA A;  3D4C A;  1IQ7 A;  2RIN A;  5TP9 B;  2F97 A;  1N3W A;  4N4U A;  1LCT A;  2O68 A;  4F3G A;  1FPJ A;  4NG7 A;  5AA4 B;  4MF3 A;  3OO7 A;  1NKX A;  4O3B A;  2OCU A;  2THI A;  1YPN A;  5BUU A;  2GQ1 A;  2HZK A;  4I9D A;  4PFB A;  2OX3 A;  2I58 A;  1AWB A;  4O3C A;  2I48 A;  2VPO A;  3VVF A;  2I4C A;  1XVY A;  4PFR A;  1FTM A;  5I58 B;  2WKY A;  1DPE A;  1RDY A;  4RK2 A;  1Y3N A;  3O9P A;  3OD7 A;  3DM0 A;  3TEL A;  1INP A;  2X26 A;  4HTG A;  2DWH A;  4OVQ A;  2Y7P A;  3T0J A;  4QFL A;  3IFC A;  4GWO A;  4QRZ A;  2I0B A;  4LA9 A;  3H6V A;  3TZA A;  3FXQ A;  3TQL A;  3EQ1 A;  5I56 B;  1SPI A;  1US5 A;  2F78 A;  1A55 A;  5ESY A;  3WAF A;  1SD3 A;  4DXU A;  1NV5 A;  1H45 A;  1LBB A;  4GLI A;  3MVZ A;  1D3K A;  5CI5 A;  1B0H A;  3A09 A;  3MP1 A;  2ALU A;  3C9H A;  2XX8 A;  3H6T A;  4MFI A;  4HXV A;  2Q2A A;  4EQ7 A;  2B3F A;  5M2V A;  3CG3 A;  1GGG A;  4OEN A;  5J16 A;  4H8J A;  1LBV A;  1ZLQ A;  1IEJ A;  1GV8 A;  1LB9 A;  3QSL A;  3G3J A;  5KCJ A;  4HE1 A;  3PUY E;  1Y4T A;  4PDH A;  2XWV A;  2HZL A;  4IR8 A;  1NNT A;  2QJE A;  2DVC A;  3GYY A;  1QKB A;  3MP6 A;  4N13 A;  4ELP A;  4WED A;  3OMB A;  4KYE A;  1ZMG A;  4NMY A;  4AB6 A;  1YCJ A;  2GH9 A;  4ZEB A;  3MQ9 A;  1IMD A;  2D21 A;  5LOM A;  3GZG A;  2AIX A;  1LBZ A;  1VE4 A;  1QVS A;  3KN3 A;  3Q27 A;  1SQY A;  3HPI A;  1UTH A;  4N15 A;  3W9W A;  4N6D A;  2I4B A;  3CIJ A;  4ELO A;  3IJO B;  3S9N C;  2VPN A;  2DXR A;  4G2Z A;  4DCX A;  4NF5 B;  1B4Z A;  1NL5 A;  1WVJ A;  3FXB A;  3KOT A;  3O66 A;  3OSR A;  3MZ9 A;  4U4S A;  3FGS A;  2A5S A;  4ISU A;  1TT1 A;  5LDZ A;  1H3D A;  4P1E A;  5H8S A;  4IGR A;  4DXB A;  1LAF E;  5I2N B;  3TTK A;  2CEY A;  5L9M A;  3T22 A;  5EHM A;  3S4U A;  4QSC A;  3I3V A;  4XFE A;  5H8N B;  1NV7 A;  2HCA A;  4JVI A;  2F36 A;  3HHF A;  5I57 A;  4PBQ A;  2DE4 A;  2VT5 A;  4WKM A;  2DXY A;  1JEU A;  4GFR A;  4GX4 A;  1JVY A;  4RYA A;  5A5L A;  4FED A;  5KDT B;  4IO6 A;  2F6P A;  2V3Q A;  1KZ8 A;  3PGF A;  4QXD A;  1BTJ A;  3S9E A;  3VXC A;  1LAX A;  2Q88 A;  3MVX A;  3IB1 A;  4NE4 A;  2XWK A;  4OXV A;  1IUD A;  1FBF A;  4PDD A;  5FTI A;  3U1O A;  5A5X B;  3CHG A;  1IIW A;  3C31 A;  3T9X B;  3G3G A;  4EF2 A;  1PEB A;  3FD3 A;  5CMC A;  5BWJ A;  4P11 A;  1FBG A;  1YYZ A;  4RA1 A;  4GWX A;  1PB9 A;  1DTG A;  1B3F A;  1ZKB A;  1P1N A;  3H7M A;  2F6G A;  2V4C A;  2HPG A;  4YB5 A;  5EQ7 A;  4FEB A;  4JWX A;  1JW4 A;  4MH5 A;  1Y3Q A;  2QVV A;  1IMF A;  3K2D A;  4U1O A;  3VV5 A;  3PMW A;  3TTN A;  3K0V A;  4KYD A;  3G3H A;  3IOR A;  4IO5 A;  4H65 A;  1MXW A;  4NF6 A;  2PVU A;  3VVD A;  3K6W A;  1G0I A;  1MXY A;  1DPP A;  3FXU A;  1O7T A;  2KQZ A;  4NN3 A;  2Z8E A;  3RNN A;  4EUO A;  3C32 A;  5HPQ A;  1MQH A;  1CB6 A;  1B5H A;  4LVQ A;  1B58 A;  2PMS A;  3K1M A;  5DVF A;  4MBP A;  3TPA A;  2ZNS A;  4RNS A;  2O7I A;  1B5J A;  1WOD A;  1R9Q A;  4MNC A;  2DSF A;  2F7B A;  4HE0 A;  1P99 A;  3TTL A;  2WYP A;  3GXA A;  3IR1 A;  3IB2 A;  1A54 A;  2I49 A;  1TFD A;  4OFJ A;  2WX9 A;  4PFI A;  1FQA A;  4YMB A;  1DTZ A;  1FJ9 A;  2AL5 A;  2VHA A;  5ET8 A;  1AL3 A;  3C36 A;  1KWH A;  2O84 X;  3EHS A;  1SDX A;  1JW1 A;  1MDP 1;  1JW5 A;  3U8Q A;  4OER A;  4L17 A;  4U2R A;  3IK6 B;  4BLA A;  3IL1 B;  1Z7M E;  4MJO A;  3SEY A;  4YKP A;  5DEX B;  4GBV A;  3L6G A;  3K4U A;  1Q9D A;  4JXI A;  3TCF A;  1M5C A;  2UVJ A;  3RPL A;  1A99 A;  5CC2 A;  2XXY A;  1D9Y A;  1MPD A;  2P2A A;  2QVU A;  1FW0 A;  4LQ2 A;  4U4X A;  4GWU A;  1PDA A;  4QFK A;  1N7W A;  4M1V A;  4RPN A;  3V83 A;  2I6E A;  5EYF A;  1OLC A;  4N8Y A;  3CFX A;  1B1H A;  5JK4 A;  3MWB A;  4ESX A;  4ECF A;  1S7Y A;  2BJI A;  3RPW A;  1MY3 A;  4O3A A;  2DYX A;  3TCG A;  4N6P A;  1FPG A;  3DP8 A;  2FNC A;  3PD9 A;  2WYK A;  1JET A;  3O29 A;  4R2F A;  1EU8 A;  2H98 A;  4O8M A;  2FIE A;  5IZ3 B;  2P0S A;  3CI8 A;  3B8B A;  4JDF A;  4KR5 A;  2RF1 A;  1LEV A;  2Y7K A;  4LZ5 A;  3TFL A;  2XXQ A;  4NWD A;  4F19 A;  1LFG A;  1SBP A;  2ZNT A;  3TCH A;  3RY3 A;  1VR5 A;  2VD2 A;  3DEL B;  1B3G A;  1MXU A;  4XIG Q;  3I6V A;  4H46 A;  4ELR A;  1B05 A;  3HCQ A;  3VE1 B;  3KGC A;  4KD5 A;  3FV1 A;  1I6Q A;  4I3E A;  4ONY A;  4QFP A;  4JVC A;  3PPR A;  4NF8 B;  3EHU A;  3FIR A;  2Y7I A;  4OAN A;  2UXA A;  2XXU A;  4IO7 A;  5AE4 A;  5I3S A;  2O7U A;  2ZXT A;  3RLF E;  1EZP A;  1FPD A;  3IOW A;  2F3B A;  1QUK A;  4UA8 A;  3LSX A;  1JEV A;  1O63 A;  4PGN A;  3RUM A;  2Q2C A;  1MY0 A;  2QMX A;  4PFY A;  2NUV A;  1OMP A;  3TAJ A;  3HHG A;  1A40 A;  1DK4 A;  4THI A;  4OZ9 A;  4OWD A;  2IA4 A;  3FAT A;  1URD A;  4PBH A;  1QUJ A;  1HSJ A;  1MXZ A;  1IMC A;  1AH5 A;  3DP6 A;  3SKP A;  1NNF A;  2DP8 A;  4R2B A;  2XXX A;  3PUW E;  4O7M A;  1UTB B;  1P1W A;  2ZYM A;  4G68 C;  3FJ7 A;  3KC0 A;  3EPE A;  1XOC A;  5EYH A;  1FTA A;  2HHM A;  3SEW A;  1EZ9 A;  1MPB A;  3WAE A;  3ILT B;  4R75 A;  2BJJ X;  1MH4 A;  2OZZ A;  3IX1 A;  3OSQ A;  1PB7 A;  1FQE A;  1Q35 A;  3EN3 A;  1HSL A;  3UIF A;  5AA2 B;  2DWI A;  2ZZW A;  2HXW A;  4LON B;  4NGU A;  4MAG A;  2DQV A;  3CSG A;  3TOD A;  4P47 A;  4HS7 A;  3R6U A;  2Y7W A;  2GHA A;  5ISU A;  1NMU A;  5I59 A;  2W7Y A;  1MPC A;  1NNK A;  2RC7 A;  2ZYK A;  3MPL A;  2PFZ A;  1NUW A;  4GWS A;  1I69 A;  1B2H A;  1YTV A;  1IXI A;  2ZZV A;  3RYD A;  3MBP A;  1FPF A;  4PAI A;  2Z8D A; 
#chains in the Genus database with same CATH homology
 3W15 C;  1MY4 A;  3IB0 A;  4YIC A;  1MY2 A;  3SEV A;  2Y84 A;  4JWO A;  5H8Q A;  3K6V A;  3MVY A;  4GVO A;  4Q30 B;  1OLA A;  1FQD A;  3DLN A;  1URG A;  2M8C A;  4NED A;  2RC8 A;  3OXN A;  4XKR A;  2Q89 A;  2NXO A;  3VLW A;  1HSE A;  4PFU A;  1IXC A;  3U92 A;  4ESW A;  4N07 A;  4OQO A;  1MXX A;  4G8N A;  2G93 A;  4U21 A;  3AXF A;  1B32 A;  3O6G A;  5TP9 A;  3ILU B;  1I6A A;  4BDR A;  4X9T A;  3OO9 A;  2V93 A;  1B6H A;  4FEC A;  2I3V A;  5AA4 A;  4GL0 A;  1P1U A;  2R71 A;  3PMX A;  4NF4 A;  1AMF A;  1M5B A;  2DVZ A;  3KG2 A;  1UIU A;  3F11 A;  1FTJ A;  5B7D A;  4NTL A;  1JQF A;  3G3I A;  2XD3 A;  3T9U A;  5H8F B;  3M3L A;  4BDM A;  4F39 A;  4QFN A;  1LBC A;  3TTM A;  3RGY A;  5I58 A;  4GL8 A;  3LSL A;  4KHZ E;  4OET A;  3KSX A;  3ODB A;  3C35 A;  3FVK A;  1B51 A;  2RCB A;  1IZ1 A;  1NFT A;  1PBP A;  1LFH A;  4R73 A;  3H4Z A;  3B6Q A;  5F1Q A;  4MLQ A;  3FJM A;  3FXR A;  1ZBM A;  2XD2 A;  3QIM A;  1AOV A;  4MLV A;  5I56 A;  1MQG A;  1DSN A;  1SW1 A;  3T66 A;  3OEN A;  1GTK A;  1QJM A;  1FQB A;  3E4R A;  3B7D A;  3IJX B;  4R6K A;  3CFL A;  2QS2 A;  1XT8 A;  4ZEF A;  1NH8 A;  2ESN A;  1FQF A;  4R9F A;  3JYR A;  3FUZ A;  1LGB C;  5AA2 D;  3JZJ A;  2B65 A;  4BDN A;  3M8U A;  4DXC A;  4ZEK A;  2YLN A;  4FJP A;  2D3I A;  4OFO A;  2OWS A;  1SVX B;  4FAT A;  4K3F A;  3E9X A;  3H03 A;  1USY H;  3LBS A;  5HBC A;  3W9V A;  4PET A;  2Q9T A;  3BFT A;  3B6T A;  3R26 A;  1JNF A;  3PPN A;  2REJ A;  4OYV A;  4OTE A;  2REG A;  2VGQ A;  4C1T A;  3PPQ A;  1TFA A;  1ANF A;  1M5F A;  2UVI A;  2HFB A;  3T93 B;  4X1D A;  3PU5 A;  1SYI A;  1Y1Z A;  2ZNU A;  1BKA A;  3HV1 A;  3KN7 A;  5AA1 A;  4OVJ A;  4NF5 A;  1M5D A;  2O51 A;  2Y7R A;  5F7V A;  1N04 A;  2A5T B;  3H6W A;  4YZZ A;  5CRY A;  5H8H B;  2QS3 A;  1MS7 A;  5DVI A;  3O28 A;  5I2N A;  2HQ0 A;  4QFO A;  1B4H A;  3T9H B;  4U23 A;  1DOT A;  4KI0 E;  3VLU A;  4JB7 A;  4OEV A;  5H8N A;  4I62 A;  1PC3 A;  2F7C A;  1N3X A;  3HST A;  4OES A;  2B3B A;  4F1U A;  1OIB A;  5KDT A;  3R7X A;  4F2Q A;  5J1D A;  1M5E A;  3OO6 A;  4FIM A;  1MDQ A;  2QMW A;  3ZS6 A;  1UIV A;  5CBR A;  3PPO A;  4OEU A;  1SYH A;  5A5X A;  3MP8 A;  4IY6 A;  4XKN A;  4KQP A;  2DOJ A;  3U94 A;  1P1Q A;  4P0G A;  4OFL A;  3PUZ E;  2V3U A;  1B40 A;  3RTF B;  2H9B A;  3RQT A;  3DP4 A;  5FHN A;  3K1P A;  1ELJ A;  3CVG A;  5JTY B;  4Q5T A;  4RJZ A;  3G7W A;  2XHD A;  5JEI A;  3SET A;  3SDF A;  3FJG A;  2E1S A;  4F3P A;  1S9T A;  3OEM A;  1IXH A;  3M3F A;  3K6U A;  3HN0 A;  2HAU A;  2O69 A;  5CM6 A;  1ZIU A;  2QRY A;  1EH3 A;  4LAT A;  3OEL A;  4YB6 A;  3G3F A;  3Q28 A;  3QAX A;  2XXR A;  2OBG A;  2RKM A;  4AQ4 A;  1XVX A;  3VXB A;  3PPP A;  3GBB A;  4JSO A;  2GHB A;  1GR2 A;  4KCD A;  5CMB A;  3VLV A;  4POX A;  4JBZ A;  4PFW A;  4G68 B;  1NH7 A;  4Z0I A;  3ONM A;  4POW A;  3G3K A;  3LR1 A;  2X7Q A;  1A7L A;  1B3L A;  5L9S A;  5DYH A;  1XC1 A;  1P1O A;  1B5I A;  4ZS9 A;  4ZE9 A;  3MZB A;  1PBQ A;  5HM4 B;  4XTC Q;  3ECR A;  3FV2 A;  2XXW A;  2ANJ A;  2QS1 A;  4TQU Q;  2VOZ A;  4BDO A;  4XKP A;  5K2X A;  1FTO A;  3H3G A;  2V84 A;  5TPA B;  1A8F A;  1Y3P A;  4TOZ A;  1LCF A;  1B1X A;  1MG1 A;  5DEX A;  1USY E;  3LSF B;  4QSE A;  3CRB A;  4DCY A;  4ZDM A;  1MRP A;  2UYF A;  3VDF A;  1B7U A;  3T9V A;  3A3U A;  3KFM A;  5K2Y A;  3QUF A;  1POT A;  4IGT A;  3GBA A;  4YU0 A;  1IIT A;  4DLD A;  1IXG A;  2OWT A;  1RKM A;  2GRV A;  4YKK A;  4FAJ A;  3HO7 A;  2O1L A;  1BLF A;  3USD A;  3SER A;  4C0R A;  5DTB A;  4KCC A;  4ELQ A;  2P1S A;  3OOA A;  3MJN A;  3P7I A;  3VVE A;  3Q26 A;  4F2O A;  4GXS B;  4U22 A;  4ZZE A;  2YJP A;  2ZYN A;  4BDL A;  4KFQ A;  1US4 A;  3OEK A;  3THI A;  2Z23 A;  1B3E A;  3O6I A;  1RYX A;  2PYY A;  5ITP A;  1B7H A;  5ICQ A;  4XKQ A;  4IO3 A;  5DT6 A;  2LAO A;  1XHY A;  4H6D A;  3SES A;  2XXP A;  2VP1 A;  4NF8 A;  3BBR A;  3O6H A;  2XXV A;  2H4I A;  3K1N A;  1YAE A;  5KCJ B;  1ATG A;  2RC9 A;  5L8D A;  3E13 X;  3TDJ A;  2RCA A;  3UN6 A;  4TLL B;  3RTW B;  1NNP A;  3PUV E;  4NF4 B;  1BP5 A;  4H1X A;  4Q8R A;  2ABH A;  1B3H A;  4RPO A;  2AL4 A;  2QSX A;  3KBR A;  3N94 A;  3K02 A;  3KJ7 A;  4E0X A;  5ITO A;  2CMO A;  3B6W A;  1DMB A;  3EHT A;  3CSB A;  3KEI A;  2NVU B;  1B9J A;  2ONK E;  4EDP A;  5I2K A;  2QPQ A;  3K01 A;  1UTB A;  1UTH B;  1TWY A;  3MC2 A;  2F7A A;  3LSW A;  2PBW A;  3CFZ A;  1H76 A;  2ONS A;  1LAG E;  3RN8 A;  3TMG A;  4YAH X;  2IEE A;  2PT1 A;  4R6Y A;  3H06 B;  4F18 A;  4KPT A;  1AIV A;  1D4N A;  2DS9 A;  2H25 A;  1D9V A;  4IO4 A;  4YB7 A;  1VSO A;  1R9L A;  5AA2 A;  4ND9 A;  3CR9 A;  4GQO A;  3TEP A;  4HCW A;  2NOO A;  4C1U A;  3LC8 A;  4FOR A;  4R74 A;  5I57 B;  2I3W A;  1Q1K A;  1S50 A;  4DE8 A;  3S9M C;  4RK9 A;  3RT8 A;  4QF9 A;  3JV9 A;  2XXT A;  3TTR A;  1LST A;  1LAH E;  3KOS A;  1URS A;  3QXM A;  2DWJ A;  4LP2 B;  1WDN A;  1GVC A;  4GXA A;  2D5W A;  4WEP A;  5I84 A;  3KZG A;  3Q25 A;  2F8D A;  3IO4 A;  1XS5 A;  2XX9 A;  4I8C A;  4YKJ A;  1J1N A;  2KLF A;  2UVH A;  3L6H A;  2ZMB A;  3UGW A;  1N84 A;  3D4G A;  5ICT A;  1LB8 A;  1MQI A;  3VFJ A;  2F35 A;  1OVB A;  4G8H A;  4F1Y A;  4QHQ A;  3FVN A;  1FCK A;  4G77 A;  2QL3 A;  1RYO A;  1R1N A;  1MQD A;  2HEU A;  4NF6 B;  3V89 B;  4LQ5 A;  1H43 A;  2R6G E;  1A8E A;  4R6H A;  3S2V A;  4EXK A;  4JSD A;  4WXJ A;  4FE8 A;  1LLS A;  4Q0C A;  5H8F A;  2H5Y A;  2XX7 A;  2HAV A;  1POY 1;  2G29 A;  4H67 A;  4HCY A;  2QS4 A;  2ONR A;  1SI0 A;  3N6U A;  2Q8J A;  3I5O A;  4H8I A;  1MM6 A;  1QUI A;  1B52 A;  3FAS A;  1MM7 A;  1OQH A;  1QUL A;  2OLB A;  2CZL A;  3U93 A;  1N76 A;  3UOR A;  3S9L C;  1UQW A;  3UK4 A;  2O6A A;  2V3T A;  1L5T A;  1OVT A;  1B46 A;  2GFE A;  3N5L A;  5IKB A;  4YMA A;  4G8M A;  1TXF A;  3IOV A;  3O97 A;  4U1Z A;  3T96 B;  4ZED A;  1ZU0 A;  4IO2 A;  4G4P A;  3RT6 B;  3QYT A;  3UP9 A;  2R9J A;  2FA7 A;  3C33 A;  1H44 A;  4F22 A;  3K00 A;  2PT2 A;  4PE5 B;  4AB5 A;  2YPN A;  4YKI A;  3TYH A;  3BKI B;  4F1V A;  1ZTY A;  4GF8 A;  4I1D A;  4OMB A;  4JWY A;  4EF1 A;  4QSD A;  1QKA A;  1Y1M A;  3O2A A;  4LZ8 A;  1OQG A;  3MW0 A;  4Z7E A;  3KN8 A;  1O64 A;  1CE2 A;  3V5A A;  2VD3 A;  3CG1 A;  3FVO A;  3TQW A;  3IAZ A;  4P0I A;  3EF7 A;  3KSJ A;  4NWC A;  4TLM B;  3ZSF A;  1LFI A;  3QK6 A;  4ZZA A;  2DE2 A;  2Z8F A;  1II5 A;  5CMK A;  5L9O A;  3IOU A;  4E0W A;  5EHS A;  4ZEI A;  1FTL A;  4PP0 A;  2NWJ A;  4F31 B;  2Z22 A;  3OO8 A;  2DWA A;  1VFE A;  3C34 A;  4HW8 A;  3PD8 A;  4KYS A;  2UYE A;  2AYS A;  3SEX A;  4PQJ A;  2FYI A;  4H5G A;  2A5T A;  2OK2 A;  5H8H A;  2UVG A;  1SW5 A;  3H6U A;  5KZT A;  4F3S A;  1F9B A;  1FQC A;  3M3K A;  4ZE8 A;  5TU0 A;  1SI1 A;  3MUQ A;  1MY1 A;  5FHO A;  1MQJ A;  3C4M A;  3MAM A;  1N7X A;  4GOT A;  1T0K A;  4X48 A;  5CBS A;  4GIZ A;  3FVG A;  4R9G A;  4BDQ A;  4ZEC A;  2I0C A;  4H0W A;  3PUX E;  1Y20 A;  2PX1 A;  3N26 A;  5IAI A;  3IOT A;  3GLB A;  5FHM A;  2ZYO A;  5ELV A;  4OHN A;  2O1M A;  1MH3 A;  1Y4C A;  3SEU A;  3MPK A;  4IB2 A;  4F29 A;  4PFT A;  5AA3 A;  3FZV A;  2H99 A;  4LUB A;  1QW0 A;  4H5F A;  5DVJ A;  4M4G A;  2XXH A;  3TUS A;  5JTY A;  3MZ1 A;  3PV0 E;  2V25 A;  2F5X A;  2OJT A;  3ZKK A;  1JVX A;  3TKD A;  1B7Z A;  5CMM A;  4EQ9 A;  1VFD A;  2X7P A;  1EZO A;  3LUY A;  3IO6 A;  4DIG A;  4LZ7 A;  4XXU A;  3KJT A;  3QUJ A;  4GD5 A;  4DZ1 A;  3UA8 A;  4X1B A;  1SW2 A;  4EXL A;  4RY1 A;  4DDD A;  1R6Z A;  3N6T A;  2E0S A;  4RXL A;  5B70 A;  1PB8 A;  1FTK A;  3ZKL A;  3E3K A;  5I59 B;  1ZJL A;  1Y9U A;  4IY5 A;  3BFU A;  1B0L A;  4G68 A;  4EQB A;  3A3C A;  1MXV A;  2F34 A;  3MVW A;  4R72 A;  3PMV A;  1N0T A;  3V8X B;  1SW4 A;  1BIY A;  3U72 A;  3K6X A;  4GRK A;  4UAC A;  5H8Q B;  3Q29 A;  1Z7N E;  2XXI A;  5I2K B;  1I6B A;  4F3B A;  2DE3 A;  5FTH A;  5TPA A;  3D4C A;  1IQ7 A;  2RIN A;  5TP9 B;  2F97 A;  1N3W A;  1LCT A;  2O68 A;  4F3G A;  5AA4 B;  4MF3 A;  3OO7 A;  1NKX A;  4O3B A;  2OCU A;  2THI A;  1YPN A;  5BUU A;  2HZK A;  4I9D A;  2I58 A;  4O3C A;  2I48 A;  3VVF A;  2I4C A;  1XVY A;  1FTM A;  5I58 B;  2WKY A;  1DPE A;  4RK2 A;  1Y3N A;  3O9P A;  3OD7 A;  3DM0 A;  3TEL A;  2X26 A;  4HTG A;  2DWH A;  2Y7P A;  4QFL A;  4GWO A;  4QRZ A;  2I0B A;  4LA9 A;  3H6V A;  3TZA A;  3FXQ A;  3TQL A;  3EQ1 A;  5I56 B;  1US5 A;  2F78 A;  1A55 A;  3WAF A;  1SD3 A;  4DXU A;  1H45 A;  1LBB A;  4GLI A;  3MVZ A;  1D3K A;  5CI5 A;  1B0H A;  3A09 A;  3MP1 A;  2ALU A;  3C9H A;  2XX8 A;  3H6T A;  4MFI A;  2Q2A A;  4EQ7 A;  2B3F A;  5M2V A;  3CG3 A;  1GGG A;  4OEN A;  4H8J A;  1ZLQ A;  1IEJ A;  1GV8 A;  1LB9 A;  3QSL A;  3G3J A;  5KCJ A;  3PUY E;  1Y4T A;  2HZL A;  1NNT A;  2QJE A;  2DVC A;  1QKB A;  3MP6 A;  4N13 A;  4ELP A;  4WED A;  3OMB A;  4KYE A;  1ZMG A;  4NMY A;  4AB6 A;  1YCJ A;  2GH9 A;  4ZEB A;  3MQ9 A;  2D21 A;  5LOM A;  3GZG A;  2AIX A;  1VE4 A;  1QVS A;  3KN3 A;  3Q27 A;  1SQY A;  3HPI A;  1UTH A;  3W9W A;  2I4B A;  3CIJ A;  4ELO A;  3IJO B;  3S9N C;  2DXR A;  4G2Z A;  4DCX A;  4NF5 B;  1B4Z A;  1NL5 A;  1WVJ A;  3KOT A;  3O66 A;  3OSR A;  3MZ9 A;  4U4S A;  3FGS A;  2A5S A;  4ISU A;  1TT1 A;  1H3D A;  5H8S A;  4IGR A;  4DXB A;  1LAF E;  5I2N B;  3TTK A;  5L9M A;  3T22 A;  5EHM A;  3S4U A;  4QSC A;  3I3V A;  5H8N B;  2HCA A;  2F36 A;  3HHF A;  5I57 A;  2DE4 A;  4WKM A;  2DXY A;  1JEU A;  4GFR A;  1JVY A;  4RYA A;  4FED A;  5KDT B;  4IO6 A;  2F6P A;  2V3Q A;  3PGF A;  1BTJ A;  3S9E A;  3VXC A;  1LAX A;  2Q88 A;  3MVX A;  3IB1 A;  4NE4 A;  4OXV A;  1IUD A;  5FTI A;  3U1O A;  5A5X B;  1IIW A;  3C31 A;  3T9X B;  3G3G A;  4EF2 A;  1PEB A;  3FD3 A;  5CMC A;  5BWJ A;  4P11 A;  4RA1 A;  1PB9 A;  1DTG A;  1B3F A;  1ZKB A;  1P1N A;  3H7M A;  2F6G A;  4YB5 A;  4FEB A;  4JWX A;  1JW4 A;  4MH5 A;  1Y3Q A;  4U1O A;  3K2D A;  3VV5 A;  3PMW A;  3TTN A;  3K0V A;  4KYD A;  3G3H A;  3IOR A;  4IO5 A;  4H65 A;  1MXW A;  4NF6 A;  2PVU A;  3VVD A;  3K6W A;  1MXY A;  1DPP A;  3FXU A;  1O7T A;  2Z8E A;  3RNN A;  4EUO A;  3C32 A;  5HPQ A;  1MQH A;  1CB6 A;  1B5H A;  4LVQ A;  1B58 A;  2PMS A;  3K1M A;  5DVF A;  4MBP A;  3TPA A;  2ZNS A;  4RNS A;  2O7I A;  1B5J A;  1WOD A;  1R9Q A;  2DSF A;  2F7B A;  1P99 A;  3TTL A;  3GXA A;  3IR1 A;  3IB2 A;  1A54 A;  2I49 A;  1TFD A;  4OFJ A;  1FQA A;  4YMB A;  1DTZ A;  2AL5 A;  2VHA A;  1AL3 A;  3C36 A;  1KWH A;  2O84 X;  3EHS A;  1SDX A;  1JW1 A;  1MDP 1;  1JW5 A;  3U8Q A;  4OER A;  4L17 A;  4U2R A;  3IK6 B;  4BLA A;  3IL1 B;  1Z7M E;  3SEY A;  4YKP A;  5DEX B;  3L6G A;  3K4U A;  4JXI A;  3TCF A;  1M5C A;  2UVJ A;  1A99 A;  5CC2 A;  2XXY A;  1D9Y A;  1MPD A;  2P2A A;  1FW0 A;  4LQ2 A;  4U4X A;  1PDA A;  4QFK A;  1N7W A;  4M1V A;  4RPN A;  3V83 A;  2I6E A;  5EYF A;  1OLC A;  5JK4 A;  3CFX A;  1B1H A;  3MWB A;  4ESX A;  4ECF A;  1S7Y A;  3RPW A;  1MY3 A;  4O3A A;  2DYX A;  3TCG A;  4N6P A;  3DP8 A;  2FNC A;  3PD9 A;  1JET A;  3O29 A;  4R2F A;  1EU8 A;  2H98 A;  2P0S A;  3CI8 A;  4JDF A;  4KR5 A;  2RF1 A;  2Y7K A;  4LZ5 A;  3TFL A;  2XXQ A;  4NWD A;  4F19 A;  1LFG A;  1SBP A;  2ZNT A;  3TCH A;  3RY3 A;  1VR5 A;  2VD2 A;  3DEL B;  1B3G A;  1MXU A;  4XIG Q;  3I6V A;  4ELR A;  1B05 A;  3HCQ A;  3VE1 B;  3KGC A;  4KD5 A;  3FV1 A;  1I6Q A;  4ONY A;  4QFP A;  3PPR A;  4NF8 B;  3EHU A;  3FIR A;  2Y7I A;  2UXA A;  2XXU A;  4IO7 A;  5AE4 A;  2O7U A;  2ZXT A;  3RLF E;  1EZP A;  3IOW A;  1QUK A;  4UA8 A;  3LSX A;  1JEV A;  1O63 A;  3RUM A;  2Q2C A;  1MY0 A;  2QMX A;  4PFY A;  2NUV A;  1OMP A;  3TAJ A;  3HHG A;  1A40 A;  4THI A;  4OZ9 A;  4OWD A;  2IA4 A;  3FAT A;  1URD A;  1QUJ A;  1HSJ A;  1MXZ A;  1AH5 A;  3DP6 A;  3SKP A;  1NNF A;  2DP8 A;  2XXX A;  3PUW E;  4R2B A;  1UTB B;  1P1W A;  2ZYM A;  4G68 C;  3FJ7 A;  3EPE A;  1XOC A;  3SEW A;  1EZ9 A;  1MPB A;  3WAE A;  3ILT B;  4R75 A;  2BJJ X;  1MH4 A;  2OZZ A;  3IX1 A;  3OSQ A;  1PB7 A;  1FQE A;  1Q35 A;  3EN3 A;  1HSL A;  3UIF A;  5AA2 B;  2DWI A;  2HXW A;  4LON B;  2DQV A;  3CSG A;  3TOD A;  4HS7 A;  3R6U A;  2Y7W A;  2GHA A;  5ISU A;  1NMU A;  5I59 A;  2W7Y A;  1MPC A;  1NNK A;  2RC7 A;  2ZYK A;  3MPL A;  1I69 A;  1B2H A;  1YTV A;  1IXI A;  3MBP A;  2Z8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...