3FJ7A

Crystal structure of l-phospholactate bound peb3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
231
structure length
231
Chain Sequence
DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity of Campylobacter jejuni adhesin PEB3 for phosphates and structural differences among its ligand complexes.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Protein binding
molecule keywords Major antigenic peptide PEB3
total genus 85
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fj7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fj7A02
2UVGA 3QXMA 3UK4A 2ZYOA 4PFUA 3PUWE 3EQ1A 1XT8A 1MPCA 5I2KA 3N6UA 4R9FA 2DE4A 1ANFA 3ZSFA 3KN3A 4OEUA 3UA8A 4NE4A 4G77A 3SEUA 4EQBA 3PPOA 4OWDA 1MY3A 3CVGA 1DSNA 1NMUA 4ZECA 2Q88A 5EYFA 2G29A 4N6PA 4C0RA 2HZKA 1JW1A 5BUUA 2F7BA 1OQGA 2O51A 5HPQA 3OD7A 3G3GA 3H6UA 1ZU0A 4QFNA 3S9NC 4ZEIA 2R6GE 4JWOA 3TQWA 1J1NA 1Y3QA 4FECA 5ELVA 3TKDA 4NWDA 1B5JA 5BWJA 1URGA 4RK9A 3QUJA 4ZDMA 3W9WA 1A7LA 4JSOA 4U4SA 4QFOA 3D4GA 2F6PA 2XHDA 3M3FA 3ODBA 4YB7A 3FZVA 3MC2A 3QAXA 3PPQA 4F1YA 5I56B 1PEBA 1SW5A 5H8FA 2HQ0A 3I3VA 3IR1A 1O7TA 4RYAA 1M5CA 3PD9A 3SERA 3UGWA 1JVXA 2GH9A 4JXIA 4U2RA 3RLFE 4EQ9A 4EQ7A 3CG1A 2D21A 4PE5B 1EZPA 4R72A 2F78A 3N6TA 2GRVA 1SW1A 4Q0CA 1XOCA 4UA8A 1FQDA 3VVEA 1MY0A 1AIVA 1A54A 2AYSA 2GHAA 2XD3A 2I3VA 4NF6B 1B3GA 1Y3NA 4IY5A 5AA4A 4ONYA 4DZ1A 4DXUA 1N3WA 4R6YA 3FD3A 1XVXA 1DPEA 1MXYA 2DVZA 3CFZA 2DYXA 1MXUA 4POWA 5F7VA 2XXYA 3SEYA 5A5XB 2AL4A 2E0SA 4XIGQ 4ZE8A 3W15C 4FJPA 4H8IA 2ZNUA 1MPBA 3WAEA 3HN0A 2OJTA 5ITPA 4NTLA 3C35A 1FTOA 5TU0A 1IQ7A 1OLAA 3MP1A 3FXQA 2QS3A 2I49A 4G8HA 4U22A 2THIA 4NMYA 4OFJA 4XXUA 3RY3A 1B32A 4G8NA 2B65A 4I62A 1IEJA 4FIMA 3TMGA 1B1HA 4AB5A 2XXPA 2M8CA 3PUXE 3PUVE 4LUBA 3EHSA 4ZEFA 5DYHA 1P99A 2IA4A 3S9LC 2OWSA 3E13X 1R1NA 2V25A 1CE2A 4NF5B 4WEPA 3MZ9A 4RPOA 4RPNA 1B40A 2PMSA 1IZ1A 4OFLA 1HSLA 3CFXA 4O3CA 4MLVA 3T9HB 4F1UA 3RQTA 3N94A 3QK6A 1MQGA 1YAEA 3E9XA 3IOUA 3MVZA 1QUIA 4FE8A 2PBWA 2NXOA 3H6TA 3O6GA 3RGYA 3TCFA 4OEVA 2FNCA 3F11A 2ALUA 2Q89A 4NF4B 2NUVA 4YB6A 1Y1ZA 5DEXB 3C31A 3UIFA 3VXBA 4ZEDA 1GVCA 2XX8A 4YU0A 1MM7A 1TFDA 4R9GA 3IO4A 5KDTB 4Z7EA 3D4CA 3ZS6A 2OZZA 3O97A 2A5TB 1R9LA 3M3LA 4KI0E 3OO7A 4IO2A 2KLFA 3KSXA 4LP2B 4PFWA 1MXXA 2H25A 2PT2A 3FVOA 1SW2A 4GFRA 3TEPA 2RC9A 1UIVA 2I3WA 3K4UA 3N26A 4OZ9A 4KR5A 5AE4A 1B52A 1POTA 1T0KA 5TP9B 1NFTA 4YMAA 1TT1A 2O84X 3T9UA 2HZLA 4YZZA 3MVWA 4YAHX 1XS5A 4PFTA 4JBZA 5KCJB 4K3FA 5CMCA 1N7XA 4E0XA 3SEVA 4ZEBA 1USYE 3QIMA 3TFLA 4OESA 2ONRA 1ZTYA 3IJOB 1B58A 4JWXA 1Q1KA 1NNFA 1FTLA 2LAOA 2XD2A 4XTCQ 1AL3A 3FVGA 1QUKA 4F22A 3FIRA 4QRZA 4YKIA 3KJ7A 1ZJLA 2I6EA 2Z8FA 5DVIA 3T22A 2RCBA 1B4HA 1PB7A 2UVHA 2YJPA 4DXCA 2RC7A 4LVQA 2H98A 1WODA 5LOMA 1FQCA 4F3PA 3VFJA 5EHMA 4U4XA 1ATGA 3K6VA 5IAIA 1LAXA 2XXUA 1HSEA 1GR2A 3O2AA 1WVJA 3PU5A 1ZMGA 1B3LA 3H6VA 3OMBA 5JK4A 1URDA 2F97A 2Y7PA 4H5GA 1N04A 2X7PA 5KDTA 1XVYA 2Z8DA 3KG2A 4QHQA 3LSXA 3HHFA 4M4GA 1BKAA 1BLFA 1LFIA 3C36A 4ZE9A 1B7ZA 3Q27A 4C1UA 2FA7A 3T93B 5A5XA 5I58B 3LBSA 5JEIA 4LATA 4KHZE 4PFYA 1DMBA 4DXBA 4U1ZA 1ZBMA 1A99A 1IXCA 3L6GA 1YCJA 1A55A 2F36A 4KYDA 5TPAA 4PQJA 1DOTA 2DWHA 3U93A 3EPEA 2DWIA 3K6XA 3TAJA 5ISUA 5L9OA 1LGBC 4ELRA 1OVTA 4TQUQ 1M5EA 2DE2A 1MRPA 1D3KA 2Y7KA 3DP4A 4IB2A 4KPTA 4OQOA 1N7WA 4WKMA 4DLDA 4BDLA 1MQHA 2HFBA 3JYRA 2H9BA 2H5YA 3PPNA 4RY1A 3HHGA 3FXUA 4IGTA 1QKBA 3G3IA 1H43A 2CZLA 4H8JA 5I2NB 5EHSA 3OENA 1GGGA 2VGQA 1B46A 4G2ZA 3C34A 3O28A 4F3GA 1JEVA 3M3KA 2DWAA 1O63A 1H76A 2Q9TA 3JZJA 3EN3A 3K2DA 3PV0E 4KCDA 2NWJA 4MH5A 4OENA 2Q8JA 4HCWA 4ELOA 1A8EA 1LCFA 2VP1A 4ELPA 2RKMA 4LZ7A 3KBRA 2PX1A 3V8XB 4RNSA 4P0GA 1B51A 2HAVA 3CR9A 1B3EA 4EF1A 1AH5A 1QJMA 2QS1A 3KZGA 5AA3A 4LA9A 4LZ5A 3IOVA 4OVJA 2Q2CA 3DP6A 4NF8B 1B05A 2ZXTA 3H7MA 3GBAA 1VR5A 3T9VA 4ESWA 3DLNA 1Z7NE 4FAJA 3RTFB 4GF8A 1PB9A 1B5HA 2ZYMA 4EUOA 1EH3A 1I6BA 1KWHA 1DTZA 2GFEA 4ZEKA 5TP9A 3UP9A 3PD8A 4ECFA 4F18A 1N3XA 4P11A 3RTWB 1M5DA 1EU8A 2REGA 3IAZA 5TPAB 4BDQA 4L17A 2XXVA 5DVFA 3MZ1A 3K00A 5AA2A 5KCJA 4GD5A 1B9JA 1ZLQA 2V3TA 4QSDA 3UORA 1R9QA 4BDRA 3TPAA 3K6UA 5L9MA 1M5BA 4Q30B 1LLSA 1IITA 3OEKA 4IO3A 4AQ4A 2P1SA 3PMWA 5KZTA 1MQJA 2X26A 1MDQA 1MXWA 2XX7A 3FUZA 3G3HA 4JWYA 5FHOA 1UQWA 2QRYA 3MPLA 4EXKA 1DTGA 3MJNA 5B70A 5L9SA 1MM6A 2HCAA 4H67A 5F1QA 3TCHA 5CBSA 4QFPA 1YTVA 1ZIUA 3BFUA 1FCKA 4G68C 1JW5A 4H1XA 4IO5A 3I6VA 4DDDA 5M2VA 1B4ZA 1I6AA 2ESNA 1BTJA 2DP8A 2DSFA 3Q28A 3U94A 2ABHA 1LFHA 3IB1A 3MWBA 2O7UA 1MY2A 1LFGA 3G3KA 3LSFB 3PMXA 2WKYA 4YB5A 2B3BA 2I0CA 4EF2A 4O3AA 4GLIA 1QULA 4OHNA 3G7WA 4OYVA 1N84A 4C1TA 4N13A 4TOZA 1LAHE 1FQAA 2OWTA 2ZMBA 4GWOA 3MVYA 4NEDA 1LAFE 5CC2A 3HCQA 1PDAA 4FEDA 2ANJA 1IXIA 3CFLA 1POY1 2VHAA 3IB0A 4MLQA 1P1QA 1TWYA 1H45A 3OSQA 4NWCA 5H8NA 1AOVA 3Q29A 1MH4A 4GRKA 3RPWA 2CMOA 3LSLA 2R9JA 3SEWA 2O6AA 5B7DA 3DM0A 3MQ9A 2DVCA 2VOZA 2D5WA 3IJXB 5I84A 3CG3A 2O68A 2A5TA 5CMBA 4HW8A 3K01A 3TQLA 1O64A 1FTKA 4YICA 3S9EA 3B6QA 4FORA 2OBGA 1LBBA 2ZNSA 3OXNA 2DQVA 2YPNA 3MBPA 3H6WA 1WDNA 4JB7A 5DVJA 3R26A 1OQHA 1P1NA 1Y4CA 2G93A 2Y84A 3FVNA 3OO8A 4G68B 1RKMA 2DE3A 4I9DA 4OTEA 1JEUA 1S7YA 2Q2AA 5I59A 4LZ8A 3IX1A 3BFTA 1Y20A 3B6TA 2F35A 2DWJA 5CMMA 5DT6A 1F9BA 3QSLA 3S4UA 4WXJA 1B3FA 1SVXB 5JTYB 4BDOA 4NF8A 4ESXA 1LSTA 4TLLB 3Q25A 3RUMA 2UYFA 5CMKA 1UTHA 4XKPA 1PC3A 1SBPA 3VLWA 1SI1A 4NF5A 1B2HA 1GTKA 1N76A 1RYOA 3WAFA 2R71A 3RNNA 1SDXA 1VE4A 2H4IA 2XXIA 4KCCA 1ZKBA 1Z7ME 2UXAA 3KFMA 3B7DA 3OSRA 4XKQA 3TTLA 2O1MA 1N0TA 2DOJA 3TYHA 4OFOA 1Y4TA 3ZKLA 1S50A 3VLUA 4OMBA 4X1DA 1FQEA 4FATA 2OLBA 3VE1B 5H8QB 1B3HA 3PMVA 2I0BA 1SW4A 2FYIA 5I2NA 5I58A 2DXRA 4O3BA 3K1NA 3JV9A 3ONMA 3T9XB 1UIUA 3FATA 3TELA 1MS7A 3TTNA 3AXFA 3O29A 3IOTA 4THIA 1B6HA 1US4A 3HPIA 3KJTA 1D4NA 3VXCA 4DCYA 1TXFA 3GLBA 4QSCA 5AA2B 1MXZA 3FGSA 4R2BA 3S9MC 1CB6A 1MQDA 1P1UA 3K1MA 2QSXA 2YLNA 4UACA 3CSGA 4XKNA 4F39A 4ZZAA 5I57B 3C9HA 4NF6A 4BDMA 1FQBA 1Q35A 1NKXA 2AL5A 3U8QA 3KGCA 2Y7WA 5FTHA 4KQPA 3O6HA 3MP6A 4FEBA 3M8UA 1D9VA 1JETA 4U1OA 4DIGA 3FJ7A 4GVOA 5K2XA 1JQFA 1XC1A 1SQYA 3G3JA 4DE8A 2Z8EA 4QFLA 4U21A 3RT6B 2REJA 2QJEA 2UVIA 4QF9A 2XXXA 3FV1A 3KOSA 1LB9A 3K02A 3CSBA 1US5A 4F2OA 5IKBA 4G8MA 4F31B 2I58A 1B7HA 3SETA 2QS2A 4WEDA 1AMFA 3N5LA 3VVDA 1LAGE 1RYXA 2AIXA 3H03A 3OELA 5CI5A 5L8DA 5H8HA 3OEMA 2ZNTA 3DELB 3ZKKA 5H8NB 4R73A 2DS9A 4JDFA 2QPQA 4MF3A 1OMPA 1LCTA 1I6QA 1ELJA 4IO7A 1II5A 3ECRA 4HS7A 1H3DA 4GL8A 2HEUA 3G3FA 3R7XA 1OIBA 2XXWA 4EXLA 4F19A 3SESA 2H99A 3C33A 1MXVA 3V83A 4G68A 5CBRA 3CRBA 3UN6A 3KEIA 4POXA 1A40A 1LBCA 1SYIA 1NNTA 1MQIA 2I4CA 3OO9A 4YMBA 1NNKA 1USYH 4P0IA 4LONB 1UTBA 3LSWA 4IGRA 1Y9UA 2Z23A 1VSOA 1QKAA 1MY4A 2HXWA 2V3UA 3ILUB 3QUFA 3BKIB 1FTJA 2I48A 3EHTA 4IO4A 3VVFA 3RN8A 1NH7A 3H06B 1GV8A 3VV5A 1JVYA 4M1VA 4F29A 3H4ZA 4PETA 2QMXA 1BP5A 2X7QA 3TZAA 2RCAA 1BIYA 3W9VA 4OETA 3U1OA 1QVSA 2Z22A 2P0SA 5I57A 2VD2A 5ICQA 1B5IA 2ZYKA 3USDA 3PGFA 1SYHA 5AA2D 3IOWA 5FTIA 2PVUA 5FHMA 5CM6A 4I1DA 3QYTA 2F34A 3K1PA 1D9YA 3K6WA 2Y7IA 4MBPA 4QSEA 4XKRA 1SD3A 2XXQA 3OO6A 4ZS9A 1MPDA 4R2FA 3PUYE 3A3CA 3EHUA 3MAMA 3P7IA 1P1OA 4G4PA 4Q5TA 4RXLA 4Z0IA 3V5AA 3A09A 1MG1A 2E1SA 2V3QA 3BBRA 4R74A 3O9PA 2V84A 2XXRA 5HBCA 3A3UA 2V93A 3MZBA 1IUDA 3MW0A 1TFAA 3CIJA 5ITOA 1VFEA 4BDNA 3GZGA 1JW4A 4YKKA 3PPPA 2RC8A 3KSJA 2I4BA 4LQ5A 3IL1B 1B1XA 4MFIA 3LR1A 3MVXA 1A8FA 4OERA 5H8QA 3IB2A 1B0HA 5H8SA 3FVKA 2ONKE 2RF1A 1YPNA 5I59B 3IO6A 4HCYA 3H3GA 4GIZA 4NF4A 4R75A 4ZZEA 3O6IA 4LQ2A 1MDP1 3SDFA 2NOOA 2DXYA 3LUYA 2Y7RA 4H0WA 3E3KA 3U72A 2B3FA 5AA1A 2BJJX 5JTYA 1FTMA 2A5SA 1QW0A 1Y1MA 4X48A 3IK6B 1FW0A 4Q8RA 3K0VA 1LB8A 1S9TA 1VFDA 3HSTA 1UTHB 2QL3A 3KN7A 4YKPA 1EZ9A 5DTBA 3TTKA 4ELQA 1IIWA 2RINA 3TTMA 3V89B 4H5FA 1OLCA 3MP8A 4IO6A 1URSA 1DPPA 1IXGA 3B6WA 1JNFA 3IORA 3TCGA 3VLVA 3TUSA 4PP0A 4F3BA 4EDPA 1PB8A 4RA1A 1FQFA 4H65A 4AB6A 4RJZA 4BLAA 3ILTB 4DCXA 5H8FB 3FV2A 3RT8A 2XXTA 4KYEA 1EZOA 4RK2A 3TDJA 3GXAA 3S2VA 2OK2A 2PYYA 4OXVA 2D3IA 2F5XA 5DEXA 2UYEA 4R6HA 3THIA 2F6GA 4F2QA 2P2AA 1L5TA 3I5OA 3PUZE 3T96B 4ND9A 3CI8A 3DP8A 4GQOA 4R6KA 2VD3A 5AA4B 1OVBA 2F7AA 4QFKA 4E0WA 1PBQA 1UTBB 3MUQA 3PPRA 4HTGA 1R6ZA 4KYSA 4N07A 3HV1A 1NL5A 4GL0A 4H6DA 3C32A 4X9TA 3L6HA 2QMWA 3OOAA 2GHBA 5ICTA 3LC8A 1H44A 1B0LA 1I69A 1XHYA 1SI0A 2F8DA 4U23A 3KOTA 2IEEA 2ONSA 4YKJA 1MY1A 3E4RA 3TODA 2O7IA 3MPKA 2XX9A 5CRYA 4GOTA 1NNPA 2O1LA 3EF7A 3FJMA 3O66A 1P1WA 4TLMB 2PT1A 5J1DA 4KD5A 2QS4A 4GXSB 5I56A 4JSDA 3R6UA 2XXHA 5K2YA 4F1VA 2OCUA 3SEXA 4X1BA 4F3SA 2UVJA 3VDFA 1HSJA 4IY6A 1M5FA 1NH8A 2NVUB 3Q26A 5H8HB 1B7UA 2ZYNA 3HO7A 3FXRA 5FHNA 3U92A 1PBPA 3TTRA 3KN8A 1QUJA 1IXHA 3C4MA 1MH3A 3FJGA 2W7YA 4ISUA 2HAUA 3FASA 4KFQA 1Y3PA 2O69A 4GXAA 4I8CA 3SKPA 3GBBA 2F7CA 3T66A 5HM4B 5I2KB
chains in the Genus database with same CATH superfamily
3NOHA 4EQBA 3PTYA 4OWDA 5BUUA 2JJKA 5ELVA 4NWDA 5BWJA 3W9WA 4JSOA 4U4SA 2OX3A 1PEBA 5H8FA 2HQ0A 4RYAA 3PD9A 4EQ7A 4U2RA 4PE5B 1EZPA 2GRVA 1SW1A 1XOCA 3VVEA 1INPA 1FRPA 2Q74A 1AIVA 1A54A 2I3VA 5EQAA 3SEYA 5A5XB 1MXUA 2AL4A 3ISPA 5ITPA 4MAGA 3MP1A 4U22A 2THIA 4NMYA 4XXUA 3RY3A 4G8NA 4LUBA 4ZEFA 1P99A 1NUYA 2V25A 3MZ9A 4RPOA 2PMSA 5A5LA 2VT5A 3CFXA 4O3CA 3T9HB 3RQTA 1MQGA 1YAEA 3RGYA 4ZEDA 2NUVA 1FSAA 3C31A 1TFDA 2OZZA 1NV4A 1MXXA 2H25A 3FVOA 2RC9A 3K4UA 4OZ9A 1FPJA 1NUZA 3T9UA 4YZZA 5FBPA 4E0XA 1ZTYA 2B4MA 1Q1KA 2LAOA 4XTCQ 1AL3A 3FVGA 1QUKA 1FBGA 4YKIA 3KJ7A 4PFBA 1LBWA 2YJPA 2RC7A 1IMBA 1ATGA 3K6VA 1LAXA 3O2AA 1B3LA 3H6VA 3A29A 1N04A 4MIJA 4M4GA 3HHFA 3FBPA 5A5XA 4LATA 4PFYA 4DXBA 1YCJA 2F36A 4PQJA 2DWHA 3U93A 1LEVA 2DWIA 3K6XA 4TQUQ 1N7WA 1FPDA 2XWKA 3HHGA 3FXUA 3G3IA 1K9ZA 2CZLA 4H8JA 5I2NB 2VGQA 2DWAA 1O63A 2Q9TA 3EN3A 4OENA 2Q8JA 3U65A 4ELOA 1A8EA 3KBRA 2PX1A 4EF1A 2QS1A 5AA3A 4LZ5A 1NV3A 1PB9A 1B5HA 4JVCA 4JVIA 4L17A 1KZ8A 5AA2A 2V3TA 3T1BA 5L9MA 5KZTA 1MDQA 4NF0A 3MJNA 5L9SA 3TCHA 1YTVA 1JW5A 3I6VA 1B4ZA 1I6AA 3Q28A 2DP8A 1LFHA 3IB1A 3LSFB 4OHNA 4C1TA 4TOZA 1LAHE 5CC2A 3MVYA 3TEPA 1PDAA 4FEDA 3CFLA 4JVDA 3KC1A 1P1QA 3OSQA 2R9JA 4GWWA 2VOZA 1NV6A 2D5WA 5I84A 4MJOA 1FBPA 2OBGA 2DQVA 5ET7A 3H6WA 3FVNA 1Y4CA 3OO8A 2DE3A 4LZ8A 5EYHA 5CMMA 3QSLA 1IMEA 1LSTA 4P8BA 1PC3A 1SBPA 2F3BA 1FBFA 1B2HA 2FIEA 4LN5A 2CZHA 1SDXA 2H4IA 4KCCA 4KQPA 3B7DA 4O7MA 4HE2A 4OMBA 4X1DA 1FQEA 3VE1B 3PMVA 2I0BA 4O3BA 3K1NA 3T9XB 3TTNA 4OVPA 3IOTA 5AA2B 3GLBA 4QSCA 3FGSA 3S9MC 1CB6A 4UACA 4F39A 4NF6A 1FQBA 1NKXA 1XI6A 5FTHA 3O6HA 3MP6A 1D9VA 1JETA 4DIGA 5K2XA 1FPLA 1JQFA 1SQYA 3MYUA 3K02A 3CSBA 5IKBA 4F31B 3SETA 4WEDA 1RYXA 2AIXA 3H03A 5CI5A 1RDYA 1YZ0A 2QPQA 1ELJA 4IO7A 3ECRA 1H3DA 4GL8A 3R7XA 4EXLA 4HE0A 2H99A 3KEIA 1LBCA 1MQIA 1NNKA 1USYH 4LONB 3LSWA 4IGRA 1Y9UA 2Z23A 1VSOA 1QKAA 1MY4A 2HXWA 3QUFA 3ILUB 2I48A 4FBPA 3W9VA 2X7QA 4OVRA 1QVSA 2Z22A 5ICQA 2VD2A 2ZYKA 5AA2D 3IOWA 5FTIA 2PVUA 3QYTA 4GX4A 4XKRA 5I56A 3PUYE 3MAMA 3EHUA 4Z0IA 3V5AA 3O9PA 2V93A 1IUDA 4N8YA 5EQ9A 5ITOA 3PPPA 2RC8A 4MFIA 3MVXA 1A8FA 5H8SA 3IO6A 4R75A 4LQ2A 2NOOA 3LUYA 2Y7RA 4H0WA 2B3FA 4N6KA 1QW0A 4Q8RA 3K0VA 2RINA 4H5FA 3IORA 4F3BA 4H65A 4DCXA 3ILTB 5H8FB 4KYEA 1AWBA 4F2QA 4P56A 2P2AA 2KR0A 3IFAA 4R6KA 4MNPA 1R6ZA 4KYSA 3HV1A 3C32A 4N15A 5ICTA 1H44A 2QFLA 4I3YA 1D9QA 3E4RA 2XX9A 4TLMB 2PT1A 4GXSB 4N81A 5K2YA 1BK4A 4F3SA 4O8MA 1M5FA 4DI4B 1B7UA 2ZYNA 3HO7A 5FHNA 3U92A 1QUJA 4ISUA 5HM4B 2UVGA 3QXMA 3EQ1A 3ZSFA 3CVGA 4ZECA 2G29A 4N6PA 2F7BA 1OQGA 4N17A 3OD7A 3G3GA 3S9NC 4ZEIA 2VPOA 4FECA 4AS4A 2L5VA 1URGA 4RK9A 3QUJA 1FPBA 3D4GA 2XHDA 3M3FA 3ODBA 3QAXA 3PPQA 1SW5A 3I3VA 1O7TA 3UGWA 2F3DA 5ET6A 2F78A 3N6TA 4Q0CA 1MY0A 4G61A 2GHAA 2XD3A 4NF6B 4ONYA 3FD3A 1XVXA 1DPEA 2DVZA 4POWA 2DYXA 4ZE8A 3WAEA 1MPBA 3BIGA 4NAPA 3C35A 1FTOA 1IQ7A 2I49A 4XF5A 4N8GA 2ZZXA 4PGNA 2B65A 4I62A 2M8CA 3EHSA 2OWSA 4NF5B 1CE2A 4WEPA 4F1UA 4NHBA 2XA5A 3E9XA 4FE8A 3IOUA 3TCFA 4NF4B 2ALUA 5IZ1A 4YB6A 3VXBA 1DK4A 3RYDA 1MM7A 5KDTB 2A5TB 1R9LA 3OO7A 4IO2A 1RDZA 3KSXA 4P47A 4GFRA 1UIVA 3N26A 4KR5A 1B52A 1POTA 3E78A 1TT1A 2FVZA 4YAHX 4JBZA 1NI9A 4K3FA 5CMCA 3SEVA 1USYE 1NUWA 4OESA 3IJOB 1B58A 2XD2A 1NNFA 3FIRA 4PFIA 3T22A 2I6EA 1PB7A 4DXCA 5EHMA 4U4XA 1GR2A 3PU5A 2Y7PA 2X7PA 4GWYA 3C36A 1B7ZA 1ZBMA 1A99A 1G0HA 2GQ1A 3B50A 4WKMA 4DLDA 3SZPA 5IM2A 3PPNA 2H9BA 2H5YA 4H45A 3OENA 1EYKA 1GGGA 1B46A 4G2ZA 3C34A 3QMFA 4GWXA 1JEVA 3M3KA 3JZJA 2NWJA 1H76A 4KCDA 3PV0E 2VP1A 4LZ7A 3V8XB 2CEYA 4RNSA 1AH5A 1QJMA 4LA9A 1K9YA 2Q2CA 3T9VA 3DLNA 4FAJA 3RTFB 1KWHA 4PF6A 4ECFA 3PD8A 2MKZA 4P11A 1M5DA 3IAZA 4BDQA 4GD5A 1ZLQA 1R9QA 3K6UA 1LLSA 4IO3A 4NQ8A 1MQJA 3FUZA 3MPLA 2HCAA 4H67A 5F1QA 1NV0A 1ZIUA 3BFUA 3KBZA 4G68C 4OA4A 2ABHA 4EF2A 2WKYA 2WX9A 4OYVA 1N84A 4N13A 1FQAA 2ZMBA 1YXIA 4MLQA 2VHAA 1H45A 3Q29A 4GRKA 4X8RA 5B7DA 2DVCA 3IJXB 3CG3A 4HW8A 3K01A 1O64A 1FTKA 4N91A 4HE1A 1LBBA 4NG7A 1WDNA 1RKMA 4O7IA 4DI3D 4GBVA 1SVXB 2HPGA 4BDOA 1LBYA 4NF5A 1RYOA 3WAFA 2R71A 1VE4A 4XKQA 2UXAA 2O1MA 2DOJA 4OFOA 1S50A 2OLBA 1B3HA 3GYYA 1QGXA 3O29A 3HPIA 1D4NA 1TXFA 1MXZA 1P1UA 4XKNA 3CSGA 3KC0A 3U8QA 4FEBA 5J16A 2Y5KA 1XC1A 3G3JA 4QFLA 3RT6B 3FV1A 3KOSA 1B7HA 3N5LA 1FJ6A 3ZKKA 5H8NB 2DS9A 4JDFA 1OMPA 4HS7A 4X04A 3SESA 3C33A 3D1RA 3UN6A 2XWIA 1A40A 1NNTA 2I4CA 3OO9A 4YMBA 1LBZA 1FTJA 4IO4A 3H06B 1GV8A 3VV5A 4F29A 4PETA 1BP5A 2RCAA 2P0SA 4UABA 1B5IA 3PGFA 5CM6A 2F34A 3K1PA 3OO6A 2XXQA 5ESYA 4RXLA 1P1OA 3A09A 1MG1A 4OVSA 3BBRA 3A3UA 5IZ3A 4PAIA 4BDNA 2I4BA 4LQ5A 1B1XA 3LR1A 1B0HA 5I59B 3H3GA 4GIZA 4NN3A 2XWVA 3E3KA 5JTYA 1FTMA 4H46A 1FW0A 3HSTA 3KN7A 1EZ9A 5I7IA 4ELQA 3V89B 1OLCA 3MP8A 1URSA 1DPPA 1JNFA 4AB6A 2XXTA 1FPKA 4PCDA 4NGUA 2PYYA 4OXVA 2D3IA 2F6GA 3I5OA 3PUZE 4ND9A 3DP8A 2VD3A 2F7AA 4QFKA 4E0WA 1PBQA 3PPRA 4N07A 4GL0A 4H6DA 2QMWA 4HXVA 1SI0A 3KOTA 2ONSA 4YKJA 2O7IA 2O1LA 5LTCA 4MCOA 5J1DA 2QS4A 1NH8A 1FBEA 3Q26A 5H8HB 1PBPA 3FJGA 4KFQA 2O69A 2ZNSA 2F7CA 5I2KB 4PFUA 4KXPA 2ZZWA 4R9FA 3KN3A 4G77A 3SEUA 3PPOA 1MY3A 1NV1A 2Q88A 5EYFA 2HZKA 1JW1A 3H6UA 2R6GE 4MNIA 4PDDA 1B5JA 2PFYA 4ZDMA 4QFOA 4YB7A 4F1YA 3IR1A 2GH9A 4JXIA 3RLFE 4EQ9A 4UA8A 5F24A 2AYSA 1B3GA 1Y3NA 4IY5A 4DXUA 1N3WA 1MXYA 3CFZA 1FPFA 2E0SA 4I3EA 2V4CA 4FJPA 3HN0A 4PE3A 4NTLA 5TU0A 3FXQA 4G8HA 4XEQA 1B32A 1IEJA 3TMGA 2XXPA 3PUVE 2CZKA 4RPNA 4OFLA 1HSLA 2B4LA 2NXOA 3H6TA 3O6GA 4OEVA 2FNCA 5DEXB 1GVCA 2XX8A 4R9GA 3IO4A 3ZS6A 3O97A 3M3LA 4KI0E 2PT2A 2I3WA 2KQZA 5TP9B 1Q9DA 1NFTA 4YMAA 2HZLA 3MVWA 4PBQA 3BIHA 5KCJB 1N7XA 4ZEBA 4PAFA 3TFLA 1FTLA 4QRZA 1ZJLA 5DVIA 2RCBA 1B4HA 2UVHA 3VFJA 5IAIA 2XXUA 1HSEA 5JK4A 3OMBA 1URDA 5KDTA 4QHQA 3LSXA 1BLFA 1LFIA 4ZE9A 3Q27A 3T93B 5JEIA 2PCRA 1DMBA 4U1ZA 1IXCA 1SPIA 1A55A 4KYDA 5TPAA 1DOTA 3EPEA 4I40A 2DDKA 1OVTA 1M5EA 1MRPA 4KPTA 4OQOA 4BDLA 3JYRA 1QKBA 1H43A 5EHSA 4PBHA 3O28A 4F3GA 3K2DA 4MH5A 4HCWA 3IFCA 1LCFA 4ELPA 2RKMA 4P0GA 1B51A 3CR9A 1B3EA 3KZGA 3IOVA 4OVJA 4NF8B 1B05A 2FHYA 4MX6A 5I3SA 2ZYMA 1I6BA 5TP9A 1DTZA 2GFEA 3UP9A 3RTWB 1EU8A 5DVFA 3K00A 5KCJA 4BDRA 4P3LA 3UORA 3LV0A 4P1LA 4PGPA 4Q30B 2P1SA 3PMWA 2XX7A 1MXWA 3G3HA 5FHOA 4JWYA 1UQWA 1DTGA 5B70A 1NV2A 2FIXA 5CBSA 4H1XA 4DDDA 4GBWA 1FPGA 2O7UA 3G7WA 4PDHA 4GWOA 1LAFE 3HCQA 1IXIA 3IB0A 1POY1 5H8NA 1AOVA 1MH4A 3LSLA 3SEWA 2O6AA 3MQ9A 2O68A 2A5TA 5IZ3B 1RDXA 3TQLA 3OXNA 3MBPA 1OQHA 2G93A 4PAKA 4OTEA 4G68B 5I59A 4I9DA 1S7YA 3IX1A 1Y20A 3B6TA 2F35A 5DT6A 4WXJA 4N4UA 5JTYB 4NF8A 1KA1A 4PFRA 4TLLB 3RUMA 1JP4A 1KA0A 2ZZVA 4XKPA 4MMPA 1SI1A 3VLWA 1GTKA 3RPLA 2XXIA 1Z7ME 3KFMA 3TTLA 1N0TA 3ZKLA 1Y4TA 4FATA 1FBDA 1SW4A 2FYIA 1T0KA 3TELA 3JV9A 3ONMA 3AXFA 1B6HA 1US4A 3KJTA 3VXCA 3E79A 2QSXA 2YLNA 3C9HA 1Q35A 3T0JA 4QXDA 4AS5A 4U1OA 2Z8EA 4U21A 2REJA 2QJEA 4QF9A 4PF8A 4O94A 1IMFA 4PTKA 1US5A 4F2OA 4G8MA 2QS2A 1AMFA 5L8DA 5H8HA 3OEMA 4MF3A 3G3FA 1OIBA 3V83A 4G68A 5CBRA 4GWUA 1FTAA 4P0IA 5T3JA 3BKIB 5ET8A 3EHTA 1NV5A 3VVFA 2BJIA 3H4ZA 2QMXA 3TZAA 1BIYA 4OETA 3U1OA 3USDA 3ROJA 4MBPA 4ZEKA 1D9YA 2Y7IA 1L5TA 4ZS9A 1SD3A 4F3PA 1FJ9A 4YICA 1MPDA 2V3QA 4R74A 2V84A 2XXRA 3MZBA 1TFAA 3CIJA 1JW4A 2P3VA 3IB2A 4HCYA 4ZZEA 3SDFA 4N6DA 4P1EA 2HHMA 3U72A 2BJJX 1Y1MA 4X48A 3IK6B 1LB8A 1S9TA 1UTHB 2QL3A 5EYGA 3TTKA 1IIWA 3LUZA 3TTMA 4IO6A 3VLVA 1IXGA 3B6WA 3TUSA 1LBXA 4PP0A 1PB8A 3RT8A 1EZOA 4RK2A 3TDJA 3GXAA 3S2VA 4MNCA 2F5XA 5ET5A 3T96B 3CI8A 1IMCA 4X9TA 3OOAA 2GHBA 2XXKA 2PFZA 1I69A 3LC8A 1XHYA 4U23A 5EQ7A 2IEEA 3MPKA 4GOTA 1NNPA 3EF7A 1P1WA 4KD5A 4JSDA 3R6UA 2XXHA 2OCUA 4X1BA 1HSJA 4IY6A 2NVUB 3FXRA 4OANA 3TTRA 1MH3A 2HAUA 5IZZA 1Y3PA 4GXAA 4I8CA 3UK4A 2ZYOA 3PUWE 1XT8A 1MPCA 3N6UA 2DE4A 1ANFA 4OEUA 3UA8A 4NE4A 1DSNA 1NMUA 4C0RA 5HPQA 2O51A 4QFNA 1ZU0A 3FXBA 4JWOA 3TQWA 1J1NA 1Y3QA 3TKDA 3HFUA 1A7LA 1NV7A 2F6PA 3FZVA 3MC2A 5I56B 1M5CA 3SERA 1JVXA 3CG1A 2D21A 4R72A 1FQDA 4GWSA 5AA4A 4DZ1A 4R6YA 3EKIA 5I58A 5I2KA 5F7VA 4NX1A 2XXYA 4MHFA 4XIGQ 3W15C 4H8IA 2ZNUA 2OJTA 5DW8A 1OLAA 2QS3A 2WBDA 4OFJA 2VPNA 4FIMA 4AB5A 1B1HA 3PUXE 4XFEA 3S9LC 5DYHA 2IA4A 2WBBA 3E13X 1R1NA 4GX6A 2R8TA 1B40A 1IZ1A 4MLVA 3N94A 3QK6A 3MVZA 1QUIA 2PBWA 3F11A 2Q89A 4IR8A 3UIFA 1Y1ZA 4YU0A 4Z7EA 3B8BA 3D4CA 4PC9A 2KLFA 4LP2B 4PFWA 1SW2A 2QVRA 5AE4A 2OWZA 3CHGA 2O84X 1XS5A 4PFTA 3QIMA 2ONRA 1CNQA 4JWXA 4F22A 2Z8FA 2CEXA 4LVQA 2H98A 1WODA 1FQCA 1WVJA 1ZMGA 2F97A 4H5GA 1XVYA 2Z8DA 3KG2A 1BKAA 4C1UA 2FA7A 5I58B 3LBSA 4KHZE 1YYZA 3L6GA 3TAJA 5ISUA 5L9OA 1LGBC 4ELRA 2DE2A 3DP4A 2Y7KA 1D3KA 4IB2A 1MQHA 2HFBA 4RY1A 4IGTA 2WYPA 3MSTA 2HAVA 3DP6A 2ZXTA 3H7MA 4ESWA 3GBAA 1VR5A 5LDZA 4QBAA 1Z7NE 3RPLB 4GF8A 4EUOA 1EH3A 1IMAA 4F18A 1N3XA 2REGA 5TPAB 2WEFA 2XXVA 3MZ1A 1B9JA 4QSDA 3TPAA 1M5BA 1IITA 3OEKA 4AQ4A 2X26A 4EXKA 2QRYA 1MM6A 4QFPA 1FCKA 4IO5A 5M2VA 2ESNA 1BTJA 2DSFA 3U94A 3MWBA 1MY2A 1LFGA 1FPIA 3G3KA 3PMXA 4YB5A 2B3BA 2I0CA 4O3AA 4GLIA 1QULA 4NEDA 2OWTA 1FPEA 2P3NA 2ANJA 4NWCA 1TWYA 4GWZA 3RPWA 2CMOA 3DM0A 4OVTA 5CMBA 3S9EA 3B6QA 4FORA 2YPNA 4JB7A 5DVJA 3R26A 1P1NA 5I5PA 2Y84A 1JEUA 2Q2AA 3BFTA 2WYKA 2DWJA 1F9BA 3S4UA 1B3FA 4ESXA 2HXRA 3Q25A 2UYFA 5CMKA 1UTHA 1N76A 3RNNA 1FBHA 1ZKBA 3OSRA 5LOMA 3TYHA 4MEVA 3VLUA 1VDWA 5H8QB 5I2NA 2DXRA 1DCUA 1UIUA 3FATA 1MS7A 4THIA 4DCYA 4R2BA 1MQDA 3K1MA 4ZZAA 5I57B 2XWOA 4BDMA 2AL5A 3KGCA 2Y7WA 3M8UA 3FJ7A 4GVOA 4DE8A 1DBZA 2UVIA 2XXXA 1LB9A 1EYJA 2I58A 3VVDA 1LAGE 3OELA 2ZNTA 3DELB 4R73A 1LCTA 1I6QA 1II5A 2HEUA 4F19A 2XXWA 1MXVA 3CRBA 4POXA 1NUXA 1SYIA 1UTBA 2V3UA 3RN8A 1NH7A 1JVYA 4M1VA 4OVQA 1SYHA 5FHMA 2QVUA 4I1DA 3K6WA 4QSEA 1EYIA 4GX3A 4R2FA 4G4PA 3A3CA 4Q5TA 3P7IA 2E1SA 5HBCA 3MW0A 1VFEA 3GZGA 4YKKA 3KSJA 3IL1B 4OERA 5H8QA 3FVKA 2ONKE 2RF1A 1YPNA 5I57A 4NF4A 3O6IA 2Q8MA 1MDP1 2DXYA 5AA1A 2A5SA 2CZIA 1IMDA 1VFDA 4YKPA 5DTBA 3TCGA 4EDPA 4RA1A 1FQFA 4BLAA 4RJZA 5IGAA 3FV2A 2OK2A 5DEXA 2UYEA 4R6HA 3THIA 4GQOA 5AA4B 1OVBA 1FBCA 3MUQA 1UTBB 4HTGA 1NL5A 3L6HA 1B0LA 2F8DA 1LBVA 1MY1A 4P9KA 3TODA 5CRYA 3O66A 3FJMA 4F1VA 3SEXA 2UVJA 3VDFA 1G0IA 3KN8A 1IXHA 2Y5LA 3C4MA 2FBPA 2W7YA 5EQ8A 3FASA 2QVVA 3SKPA 3GBBA 3T66A
chains in the Genus database with same CATH topology
2UVGA 3QXMA 3UK4A 2ZYOA 4PFUA 3PUWE 3EQ1A 1XT8A 1MPCA 5I2KA 3N6UA 4R9FA 2DE4A 1ANFA 3ZSFA 3KN3A 4OEUA 3UA8A 4NE4A 4G77A 3SEUA 4EQBA 3PPOA 4OWDA 1MY3A 3CVGA 1DSNA 1NMUA 4ZECA 2Q88A 5EYFA 2G29A 4N6PA 4C0RA 2HZKA 1JW1A 5BUUA 2F7BA 1OQGA 2O51A 5HPQA 3OD7A 3G3GA 3H6UA 1ZU0A 4QFNA 3S9NC 4ZEIA 2R6GE 4JWOA 3TQWA 1J1NA 1Y3QA 4FECA 5ELVA 3TKDA 4NWDA 1B5JA 5BWJA 1URGA 4RK9A 3QUJA 4ZDMA 3W9WA 1A7LA 4JSOA 4U4SA 4QFOA 3D4GA 2F6PA 2XHDA 3M3FA 3ODBA 4YB7A 3FZVA 3MC2A 3QAXA 3PPQA 4F1YA 5I56B 1PEBA 1SW5A 5H8FA 2HQ0A 3I3VA 3IR1A 1O7TA 4RYAA 1M5CA 3PD9A 3SERA 3UGWA 1JVXA 2GH9A 4JXIA 4U2RA 3RLFE 4EQ9A 4EQ7A 3CG1A 2D21A 4PE5B 1EZPA 4R72A 2F78A 3N6TA 2GRVA 1SW1A 4Q0CA 1XOCA 4UA8A 1FQDA 3VVEA 1MY0A 1AIVA 1A54A 2AYSA 2GHAA 2XD3A 2I3VA 4NF6B 1B3GA 1Y3NA 4IY5A 5AA4A 4ONYA 4DZ1A 4DXUA 1N3WA 4R6YA 3FD3A 1XVXA 1DPEA 1MXYA 2DVZA 3CFZA 2DYXA 1MXUA 4POWA 5F7VA 2XXYA 3SEYA 5A5XB 2AL4A 2E0SA 4XIGQ 4ZE8A 3W15C 4FJPA 4H8IA 2ZNUA 1MPBA 3WAEA 3HN0A 2OJTA 5ITPA 4NTLA 3C35A 1FTOA 5TU0A 1IQ7A 1OLAA 3MP1A 3FXQA 2QS3A 2I49A 4G8HA 4U22A 2THIA 4NMYA 4OFJA 4XXUA 3RY3A 1B32A 4G8NA 2B65A 4I62A 1IEJA 4FIMA 3TMGA 1B1HA 4AB5A 2XXPA 2M8CA 3PUXE 3PUVE 4LUBA 3EHSA 4ZEFA 5DYHA 1P99A 2IA4A 3S9LC 2OWSA 3E13X 1R1NA 2V25A 1CE2A 4NF5B 4WEPA 3MZ9A 4RPOA 4RPNA 1B40A 2PMSA 1IZ1A 4OFLA 1HSLA 3CFXA 4O3CA 4MLVA 3T9HB 4F1UA 3RQTA 3N94A 3QK6A 1MQGA 1YAEA 3E9XA 3IOUA 3MVZA 1QUIA 4FE8A 2PBWA 2NXOA 3H6TA 3O6GA 3RGYA 3TCFA 4OEVA 2FNCA 3F11A 2ALUA 2Q89A 4NF4B 2NUVA 4YB6A 1Y1ZA 5DEXB 3C31A 3UIFA 3VXBA 4ZEDA 1GVCA 2XX8A 4YU0A 1MM7A 1TFDA 4R9GA 3IO4A 5KDTB 4Z7EA 3D4CA 3ZS6A 2OZZA 3O97A 2A5TB 1R9LA 3M3LA 4KI0E 3OO7A 4IO2A 2KLFA 3KSXA 4LP2B 4PFWA 1MXXA 2H25A 2PT2A 3FVOA 1SW2A 4GFRA 3TEPA 2RC9A 1UIVA 2I3WA 3K4UA 3N26A 4OZ9A 4KR5A 5AE4A 1B52A 1POTA 1T0KA 5TP9B 1NFTA 4YMAA 1TT1A 2O84X 3T9UA 2HZLA 4YZZA 3MVWA 4YAHX 1XS5A 4PFTA 4JBZA 5KCJB 4K3FA 5CMCA 1N7XA 4E0XA 3SEVA 4ZEBA 1USYE 3QIMA 3TFLA 4OESA 2ONRA 1ZTYA 3IJOB 1B58A 4JWXA 1Q1KA 1NNFA 1FTLA 2LAOA 2XD2A 4XTCQ 1AL3A 3FVGA 1QUKA 4F22A 3FIRA 4QRZA 4YKIA 3KJ7A 1ZJLA 2I6EA 2Z8FA 5DVIA 3T22A 2RCBA 1B4HA 1PB7A 2UVHA 2YJPA 4DXCA 2RC7A 4LVQA 2H98A 1WODA 5LOMA 1FQCA 4F3PA 3VFJA 5EHMA 4U4XA 1ATGA 3K6VA 5IAIA 1LAXA 2XXUA 1HSEA 1GR2A 3O2AA 1WVJA 3PU5A 1ZMGA 1B3LA 3H6VA 3OMBA 5JK4A 1URDA 2F97A 2Y7PA 4H5GA 1N04A 2X7PA 5KDTA 1XVYA 2Z8DA 3KG2A 4QHQA 3LSXA 3HHFA 4M4GA 1BKAA 1BLFA 1LFIA 3C36A 4ZE9A 1B7ZA 3Q27A 4C1UA 2FA7A 3T93B 5A5XA 5I58B 3LBSA 5JEIA 4LATA 4KHZE 4PFYA 1DMBA 4DXBA 4U1ZA 1ZBMA 1A99A 1IXCA 3L6GA 1YCJA 1A55A 2F36A 4KYDA 5TPAA 4PQJA 1DOTA 2DWHA 3U93A 3EPEA 2DWIA 3K6XA 3TAJA 5ISUA 5L9OA 1LGBC 4ELRA 1OVTA 4TQUQ 1M5EA 2DE2A 1MRPA 1D3KA 2Y7KA 3DP4A 4IB2A 4KPTA 4OQOA 1N7WA 4WKMA 4DLDA 4BDLA 1MQHA 2HFBA 3JYRA 2H9BA 2H5YA 3PPNA 4RY1A 3HHGA 3FXUA 4IGTA 1QKBA 3G3IA 1H43A 2CZLA 4H8JA 5I2NB 5EHSA 3OENA 1GGGA 2VGQA 1B46A 4G2ZA 3C34A 3O28A 4F3GA 1JEVA 3M3KA 2DWAA 1O63A 1H76A 2Q9TA 3JZJA 3EN3A 3K2DA 3PV0E 4KCDA 2NWJA 4MH5A 4OENA 2Q8JA 4HCWA 4ELOA 1A8EA 1LCFA 2VP1A 4ELPA 2RKMA 4LZ7A 3KBRA 2PX1A 3V8XB 4RNSA 4P0GA 1B51A 2HAVA 3CR9A 1B3EA 4EF1A 1AH5A 1QJMA 2QS1A 3KZGA 5AA3A 4LA9A 4LZ5A 3IOVA 4OVJA 2Q2CA 3DP6A 4NF8B 1B05A 2ZXTA 3H7MA 3GBAA 1VR5A 3T9VA 4ESWA 3DLNA 1Z7NE 4FAJA 3RTFB 4GF8A 1PB9A 1B5HA 2ZYMA 4EUOA 1EH3A 1I6BA 1KWHA 1DTZA 2GFEA 4ZEKA 5TP9A 3UP9A 3PD8A 4ECFA 4F18A 1N3XA 4P11A 3RTWB 1M5DA 1EU8A 2REGA 3IAZA 5TPAB 4BDQA 4L17A 2XXVA 5DVFA 3MZ1A 3K00A 5AA2A 5KCJA 4GD5A 1B9JA 1ZLQA 2V3TA 4QSDA 3UORA 1R9QA 4BDRA 3TPAA 3K6UA 5L9MA 1M5BA 4Q30B 1LLSA 1IITA 3OEKA 4IO3A 4AQ4A 2P1SA 3PMWA 5KZTA 1MQJA 2X26A 1MDQA 1MXWA 2XX7A 3FUZA 3G3HA 4JWYA 5FHOA 1UQWA 2QRYA 3MPLA 4EXKA 1DTGA 3MJNA 5B70A 5L9SA 1MM6A 2HCAA 4H67A 5F1QA 3TCHA 5CBSA 4QFPA 1YTVA 1ZIUA 3BFUA 1FCKA 4G68C 1JW5A 4H1XA 4IO5A 3I6VA 4DDDA 5M2VA 1B4ZA 1I6AA 2ESNA 1BTJA 2DP8A 2DSFA 3Q28A 3U94A 2ABHA 1LFHA 3IB1A 3MWBA 2O7UA 1MY2A 1LFGA 3G3KA 3LSFB 3PMXA 2WKYA 4YB5A 2B3BA 2I0CA 4EF2A 4O3AA 4GLIA 1QULA 4OHNA 3G7WA 4OYVA 1N84A 4C1TA 4N13A 4TOZA 1LAHE 1FQAA 2OWTA 2ZMBA 4GWOA 3MVYA 4NEDA 1LAFE 5CC2A 3HCQA 1PDAA 4FEDA 2ANJA 1IXIA 3CFLA 1POY1 2VHAA 3IB0A 4MLQA 1P1QA 1TWYA 1H45A 3OSQA 4NWCA 5H8NA 1AOVA 3Q29A 1MH4A 4GRKA 3RPWA 2CMOA 3LSLA 2R9JA 3SEWA 2O6AA 5B7DA 3DM0A 3MQ9A 2DVCA 2VOZA 2D5WA 3IJXB 5I84A 3CG3A 2O68A 2A5TA 5CMBA 4HW8A 3K01A 3TQLA 1O64A 1FTKA 4YICA 3S9EA 3B6QA 4FORA 2OBGA 1LBBA 2ZNSA 3OXNA 2DQVA 2YPNA 3MBPA 3H6WA 1WDNA 4JB7A 5DVJA 3R26A 1OQHA 1P1NA 1Y4CA 2G93A 2Y84A 3FVNA 3OO8A 4G68B 1RKMA 2DE3A 4I9DA 4OTEA 1JEUA 1S7YA 2Q2AA 5I59A 4LZ8A 3IX1A 3BFTA 1Y20A 3B6TA 2F35A 2DWJA 5CMMA 5DT6A 1F9BA 3QSLA 3S4UA 4WXJA 1B3FA 1SVXB 5JTYB 4BDOA 4NF8A 4ESXA 1LSTA 4TLLB 3Q25A 3RUMA 2UYFA 5CMKA 1UTHA 4XKPA 1PC3A 1SBPA 3VLWA 1SI1A 4NF5A 1B2HA 1GTKA 1N76A 1RYOA 3WAFA 2R71A 3RNNA 1SDXA 1VE4A 2H4IA 2XXIA 4KCCA 1ZKBA 1Z7ME 2UXAA 3KFMA 3B7DA 3OSRA 4XKQA 3TTLA 2O1MA 1N0TA 2DOJA 3TYHA 4OFOA 1Y4TA 3ZKLA 1S50A 3VLUA 4OMBA 4X1DA 1FQEA 4FATA 2OLBA 3VE1B 5H8QB 1B3HA 3PMVA 2I0BA 1SW4A 2FYIA 5I2NA 5I58A 2DXRA 4O3BA 3K1NA 3JV9A 3ONMA 3T9XB 1UIUA 3FATA 3TELA 1MS7A 3TTNA 3AXFA 3O29A 3IOTA 4THIA 1B6HA 1US4A 3HPIA 3KJTA 1D4NA 3VXCA 4DCYA 1TXFA 3GLBA 4QSCA 5AA2B 1MXZA 3FGSA 4R2BA 3S9MC 1CB6A 1MQDA 1P1UA 3K1MA 2QSXA 2YLNA 4UACA 3CSGA 4XKNA 4F39A 4ZZAA 5I57B 3C9HA 4NF6A 4BDMA 1FQBA 1Q35A 1NKXA 2AL5A 3U8QA 3KGCA 2Y7WA 5FTHA 4KQPA 3O6HA 3MP6A 4FEBA 3M8UA 1D9VA 1JETA 4U1OA 4DIGA 3FJ7A 4GVOA 5K2XA 1JQFA 1XC1A 1SQYA 3G3JA 4DE8A 2Z8EA 4QFLA 4U21A 3RT6B 2REJA 2QJEA 2UVIA 4QF9A 2XXXA 3FV1A 3KOSA 1LB9A 3K02A 3CSBA 1US5A 4F2OA 5IKBA 4G8MA 4F31B 2I58A 1B7HA 3SETA 2QS2A 4WEDA 1AMFA 3N5LA 3VVDA 1LAGE 1RYXA 2AIXA 3H03A 3OELA 5CI5A 5L8DA 5H8HA 3OEMA 2ZNTA 3DELB 3ZKKA 5H8NB 4R73A 2DS9A 4JDFA 2QPQA 4MF3A 1OMPA 1LCTA 1I6QA 1ELJA 4IO7A 1II5A 3ECRA 4HS7A 1H3DA 4GL8A 2HEUA 3G3FA 3R7XA 1OIBA 2XXWA 4EXLA 4F19A 3SESA 2H99A 3C33A 1MXVA 3V83A 4G68A 5CBRA 3CRBA 3UN6A 3KEIA 4POXA 1A40A 1LBCA 1SYIA 1NNTA 1MQIA 2I4CA 3OO9A 4YMBA 1NNKA 1USYH 4P0IA 4LONB 1UTBA 3LSWA 4IGRA 1Y9UA 2Z23A 1VSOA 1QKAA 1MY4A 2HXWA 2V3UA 3ILUB 3QUFA 3BKIB 1FTJA 2I48A 3EHTA 4IO4A 3VVFA 3RN8A 1NH7A 3H06B 1GV8A 3VV5A 1JVYA 4M1VA 4F29A 3H4ZA 4PETA 2QMXA 1BP5A 2X7QA 3TZAA 2RCAA 1BIYA 3W9VA 4OETA 3U1OA 1QVSA 2Z22A 2P0SA 5I57A 2VD2A 5ICQA 1B5IA 2ZYKA 3USDA 3PGFA 1SYHA 5AA2D 3IOWA 5FTIA 2PVUA 5FHMA 5CM6A 4I1DA 3QYTA 2F34A 3K1PA 1D9YA 3K6WA 2Y7IA 4MBPA 4QSEA 4XKRA 1SD3A 2XXQA 3OO6A 4ZS9A 1MPDA 4R2FA 3PUYE 3A3CA 3EHUA 3MAMA 3P7IA 1P1OA 4G4PA 4Q5TA 4RXLA 4Z0IA 3V5AA 3A09A 1MG1A 2E1SA 2V3QA 3BBRA 4R74A 3O9PA 2V84A 2XXRA 5HBCA 3A3UA 2V93A 3MZBA 1IUDA 3MW0A 1TFAA 3CIJA 5ITOA 1VFEA 4BDNA 3GZGA 1JW4A 4YKKA 3PPPA 2RC8A 3KSJA 2I4BA 4LQ5A 3IL1B 1B1XA 4MFIA 3LR1A 3MVXA 1A8FA 4OERA 5H8QA 3IB2A 1B0HA 5H8SA 3FVKA 2ONKE 2RF1A 1YPNA 5I59B 3IO6A 4HCYA 3H3GA 4GIZA 4NF4A 4R75A 4ZZEA 3O6IA 4LQ2A 1MDP1 3SDFA 2NOOA 2DXYA 3LUYA 2Y7RA 4H0WA 3E3KA 3U72A 2B3FA 5AA1A 2BJJX 5JTYA 1FTMA 2A5SA 1QW0A 1Y1MA 4X48A 3IK6B 1FW0A 4Q8RA 3K0VA 1LB8A 1S9TA 1VFDA 3HSTA 1UTHB 2QL3A 3KN7A 4YKPA 1EZ9A 5DTBA 3TTKA 4ELQA 1IIWA 2RINA 3TTMA 3V89B 4H5FA 1OLCA 3MP8A 4IO6A 1URSA 1DPPA 1IXGA 3B6WA 1JNFA 3IORA 3TCGA 3VLVA 3TUSA 4PP0A 4F3BA 4EDPA 1PB8A 4RA1A 1FQFA 4H65A 4AB6A 4RJZA 4BLAA 3ILTB 4DCXA 5H8FB 3FV2A 3RT8A 2XXTA 4KYEA 1EZOA 4RK2A 3TDJA 3GXAA 3S2VA 2OK2A 2PYYA 4OXVA 2D3IA 2F5XA 5DEXA 2UYEA 4R6HA 3THIA 2F6GA 4F2QA 2P2AA 1L5TA 3I5OA 3PUZE 3T96B 4ND9A 3CI8A 3DP8A 4GQOA 4R6KA 2VD3A 5AA4B 1OVBA 2F7AA 4QFKA 4E0WA 1PBQA 1UTBB 3MUQA 3PPRA 4HTGA 1R6ZA 4KYSA 4N07A 3HV1A 1NL5A 4GL0A 4H6DA 3C32A 4X9TA 3L6HA 2QMWA 3OOAA 2GHBA 5ICTA 3LC8A 1H44A 1B0LA 1I69A 1XHYA 1SI0A 2F8DA 4U23A 3KOTA 2IEEA 2ONSA 4YKJA 1MY1A 3E4RA 3TODA 2O7IA 3MPKA 2XX9A 5CRYA 4GOTA 1NNPA 2O1LA 3EF7A 3FJMA 3O66A 1P1WA 4TLMB 2PT1A 5J1DA 4KD5A 2QS4A 4GXSB 5I56A 4JSDA 3R6UA 2XXHA 5K2YA 4F1VA 2OCUA 3SEXA 4X1BA 4F3SA 2UVJA 3VDFA 1HSJA 4IY6A 1M5FA 1NH8A 2NVUB 3Q26A 5H8HB 1B7UA 2ZYNA 3HO7A 3FXRA 5FHNA 3U92A 1PBPA 3TTRA 3KN8A 1QUJA 1IXHA 3C4MA 1MH3A 3FJGA 2W7YA 4ISUA 2HAUA 3FASA 4KFQA 1Y3PA 2O69A 4GXAA 4I8CA 3SKPA 3GBBA 2F7CA 3T66A 5HM4B 5I2KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVG A;  3QXM A;  3UK4 A;  2ZYO A;  4PFU A;  3PUW E;  3EQ1 A;  1XT8 A;  1MPC A;  5I2K A;  3N6U A;  4R9F A;  2DE4 A;  1ANF A;  3ZSF A;  3KN3 A;  4OEU A;  3UA8 A;  4NE4 A;  4G77 A;  3SEU A;  4EQB A;  3PPO A;  4OWD A;  1MY3 A;  3CVG A;  1DSN A;  1NMU A;  4ZEC A;  2Q88 A;  5EYF A;  2G29 A;  4N6P A;  4C0R A;  2HZK A;  1JW1 A;  5BUU A;  2F7B A;  1OQG A;  2O51 A;  5HPQ A;  3OD7 A;  3G3G A;  3H6U A;  1ZU0 A;  4QFN A;  3S9N C;  4ZEI A;  2R6G E;  4JWO A;  3TQW A;  1J1N A;  1Y3Q A;  4FEC A;  5ELV A;  3TKD A;  4NWD A;  1B5J A;  5BWJ A;  1URG A;  4RK9 A;  3QUJ A;  4ZDM A;  3W9W A;  1A7L A;  4JSO A;  4U4S A;  4QFO A;  3D4G A;  2F6P A;  2XHD A;  3M3F A;  3ODB A;  4YB7 A;  3FZV A;  3MC2 A;  3QAX A;  3PPQ A;  4F1Y A;  5I56 B;  1PEB A;  1SW5 A;  5H8F A;  2HQ0 A;  3I3V A;  3IR1 A;  1O7T A;  4RYA A;  1M5C A;  3PD9 A;  3SER A;  3UGW A;  1JVX A;  2GH9 A;  4JXI A;  4U2R A;  3RLF E;  4EQ9 A;  4EQ7 A;  3CG1 A;  2D21 A;  4PE5 B;  1EZP A;  4R72 A;  2F78 A;  3N6T A;  2GRV A;  1SW1 A;  4Q0C A;  1XOC A;  4UA8 A;  1FQD A;  3VVE A;  1MY0 A;  1AIV A;  1A54 A;  2AYS A;  2GHA A;  2XD3 A;  2I3V A;  4NF6 B;  1B3G A;  1Y3N A;  4IY5 A;  5AA4 A;  4ONY A;  4DZ1 A;  4DXU A;  1N3W A;  4R6Y A;  3FD3 A;  1XVX A;  1DPE A;  1MXY A;  2DVZ A;  3CFZ A;  2DYX A;  1MXU A;  4POW A;  5F7V A;  2XXY A;  3SEY A;  5A5X B;  2AL4 A;  2E0S A;  4XIG Q;  4ZE8 A;  3W15 C;  4FJP A;  4H8I A;  2ZNU A;  1MPB A;  3WAE A;  3HN0 A;  2OJT A;  5ITP A;  4NTL A;  3C35 A;  1FTO A;  5TU0 A;  1IQ7 A;  1OLA A;  3MP1 A;  3FXQ A;  2QS3 A;  2I49 A;  4G8H A;  4U22 A;  2THI A;  4NMY A;  4OFJ A;  4XXU A;  3RY3 A;  1B32 A;  4G8N A;  2B65 A;  4I62 A;  1IEJ A;  4FIM A;  3TMG A;  1B1H A;  4AB5 A;  2XXP A;  2M8C A;  3PUX E;  3PUV E;  4LUB A;  3EHS A;  4ZEF A;  5DYH A;  1P99 A;  2IA4 A;  3S9L C;  2OWS A;  3E13 X;  1R1N A;  2V25 A;  1CE2 A;  4NF5 B;  4WEP A;  3MZ9 A;  4RPO A;  4RPN A;  1B40 A;  2PMS A;  1IZ1 A;  4OFL A;  1HSL A;  3CFX A;  4O3C A;  4MLV A;  3T9H B;  4F1U A;  3RQT A;  3N94 A;  3QK6 A;  1MQG A;  1YAE A;  3E9X A;  3IOU A;  3MVZ A;  1QUI A;  4FE8 A;  2PBW A;  2NXO A;  3H6T A;  3O6G A;  3RGY A;  3TCF A;  4OEV A;  2FNC A;  3F11 A;  2ALU A;  2Q89 A;  4NF4 B;  2NUV A;  4YB6 A;  1Y1Z A;  5DEX B;  3C31 A;  3UIF A;  3VXB A;  4ZED A;  1GVC A;  2XX8 A;  4YU0 A;  1MM7 A;  1TFD A;  4R9G A;  3IO4 A;  5KDT B;  4Z7E A;  3D4C A;  3ZS6 A;  2OZZ A;  3O97 A;  2A5T B;  1R9L A;  3M3L A;  4KI0 E;  3OO7 A;  4IO2 A;  2KLF A;  3KSX A;  4LP2 B;  4PFW A;  1MXX A;  2H25 A;  2PT2 A;  3FVO A;  1SW2 A;  4GFR A;  3TEP A;  2RC9 A;  1UIV A;  2I3W A;  3K4U A;  3N26 A;  4OZ9 A;  4KR5 A;  5AE4 A;  1B52 A;  1POT A;  1T0K A;  5TP9 B;  1NFT A;  4YMA A;  1TT1 A;  2O84 X;  3T9U A;  2HZL A;  4YZZ A;  3MVW A;  4YAH X;  1XS5 A;  4PFT A;  4JBZ A;  5KCJ B;  4K3F A;  5CMC A;  1N7X A;  4E0X A;  3SEV A;  4ZEB A;  1USY E;  3QIM A;  3TFL A;  4OES A;  2ONR A;  1ZTY A;  3IJO B;  1B58 A;  4JWX A;  1Q1K A;  1NNF A;  1FTL A;  2LAO A;  2XD2 A;  4XTC Q;  1AL3 A;  3FVG A;  1QUK A;  4F22 A;  3FIR A;  4QRZ A;  4YKI A;  3KJ7 A;  1ZJL A;  2I6E A;  2Z8F A;  5DVI A;  3T22 A;  2RCB A;  1B4H A;  1PB7 A;  2UVH A;  2YJP A;  4DXC A;  2RC7 A;  4LVQ A;  2H98 A;  1WOD A;  5LOM A;  1FQC A;  4F3P A;  3VFJ A;  5EHM A;  4U4X A;  1ATG A;  3K6V A;  5IAI A;  1LAX A;  2XXU A;  1HSE A;  1GR2 A;  3O2A A;  1WVJ A;  3PU5 A;  1ZMG A;  1B3L A;  3H6V A;  3OMB A;  5JK4 A;  1URD A;  2F97 A;  2Y7P A;  4H5G A;  1N04 A;  2X7P A;  5KDT A;  1XVY A;  2Z8D A;  3KG2 A;  4QHQ A;  3LSX A;  3HHF A;  4M4G A;  1BKA A;  1BLF A;  1LFI A;  3C36 A;  4ZE9 A;  1B7Z A;  3Q27 A;  4C1U A;  2FA7 A;  3T93 B;  5A5X A;  5I58 B;  3LBS A;  5JEI A;  4LAT A;  4KHZ E;  4PFY A;  1DMB A;  4DXB A;  4U1Z A;  1ZBM A;  1A99 A;  1IXC A;  3L6G A;  1YCJ A;  1A55 A;  2F36 A;  4KYD A;  5TPA A;  4PQJ A;  1DOT A;  2DWH A;  3U93 A;  3EPE A;  2DWI A;  3K6X A;  3TAJ A;  5ISU A;  5L9O A;  1LGB C;  4ELR A;  1OVT A;  4TQU Q;  1M5E A;  2DE2 A;  1MRP A;  1D3K A;  2Y7K A;  3DP4 A;  4IB2 A;  4KPT A;  4OQO A;  1N7W A;  4WKM A;  4DLD A;  4BDL A;  1MQH A;  2HFB A;  3JYR A;  2H9B A;  2H5Y A;  3PPN A;  4RY1 A;  3HHG A;  3FXU A;  4IGT A;  1QKB A;  3G3I A;  1H43 A;  2CZL A;  4H8J A;  5I2N B;  5EHS A;  3OEN A;  1GGG A;  2VGQ A;  1B46 A;  4G2Z A;  3C34 A;  3O28 A;  4F3G A;  1JEV A;  3M3K A;  2DWA A;  1O63 A;  1H76 A;  2Q9T A;  3JZJ A;  3EN3 A;  3K2D A;  3PV0 E;  4KCD A;  2NWJ A;  4MH5 A;  4OEN A;  2Q8J A;  4HCW A;  4ELO A;  1A8E A;  1LCF A;  2VP1 A;  4ELP A;  2RKM A;  4LZ7 A;  3KBR A;  2PX1 A;  3V8X B;  4RNS A;  4P0G A;  1B51 A;  2HAV A;  3CR9 A;  1B3E A;  4EF1 A;  1AH5 A;  1QJM A;  2QS1 A;  3KZG A;  5AA3 A;  4LA9 A;  4LZ5 A;  3IOV A;  4OVJ A;  2Q2C A;  3DP6 A;  4NF8 B;  1B05 A;  2ZXT A;  3H7M A;  3GBA A;  1VR5 A;  3T9V A;  4ESW A;  3DLN A;  1Z7N E;  4FAJ A;  3RTF B;  4GF8 A;  1PB9 A;  1B5H A;  2ZYM A;  4EUO A;  1EH3 A;  1I6B A;  1KWH A;  1DTZ A;  2GFE A;  4ZEK A;  5TP9 A;  3UP9 A;  3PD8 A;  4ECF A;  4F18 A;  1N3X A;  4P11 A;  3RTW B;  1M5D A;  1EU8 A;  2REG A;  3IAZ A;  5TPA B;  4BDQ A;  4L17 A;  2XXV A;  5DVF A;  3MZ1 A;  3K00 A;  5AA2 A;  5KCJ A;  4GD5 A;  1B9J A;  1ZLQ A;  2V3T A;  4QSD A;  3UOR A;  1R9Q A;  4BDR A;  3TPA A;  3K6U A;  5L9M A;  1M5B A;  4Q30 B;  1LLS A;  1IIT A;  3OEK A;  4IO3 A;  4AQ4 A;  2P1S A;  3PMW A;  5KZT A;  1MQJ A;  2X26 A;  1MDQ A;  1MXW A;  2XX7 A;  3FUZ A;  3G3H A;  4JWY A;  5FHO A;  1UQW A;  2QRY A;  3MPL A;  4EXK A;  1DTG A;  3MJN A;  5B70 A;  5L9S A;  1MM6 A;  2HCA A;  4H67 A;  5F1Q A;  3TCH A;  5CBS A;  4QFP A;  1YTV A;  1ZIU A;  3BFU A;  1FCK A;  4G68 C;  1JW5 A;  4H1X A;  4IO5 A;  3I6V A;  4DDD A;  5M2V A;  1B4Z A;  1I6A A;  2ESN A;  1BTJ A;  2DP8 A;  2DSF A;  3Q28 A;  3U94 A;  2ABH A;  1LFH A;  3IB1 A;  3MWB A;  2O7U A;  1MY2 A;  1LFG A;  3G3K A;  3LSF B;  3PMX A;  2WKY A;  4YB5 A;  2B3B A;  2I0C A;  4EF2 A;  4O3A A;  4GLI A;  1QUL A;  4OHN A;  3G7W A;  4OYV A;  1N84 A;  4C1T A;  4N13 A;  4TOZ A;  1LAH E;  1FQA A;  2OWT A;  2ZMB A;  4GWO A;  3MVY A;  4NED A;  1LAF E;  5CC2 A;  3HCQ A;  1PDA A;  4FED A;  2ANJ A;  1IXI A;  3CFL A;  1POY 1;  2VHA A;  3IB0 A;  4MLQ A;  1P1Q A;  1TWY A;  1H45 A;  3OSQ A;  4NWC A;  5H8N A;  1AOV A;  3Q29 A;  1MH4 A;  4GRK A;  3RPW A;  2CMO A;  3LSL A;  2R9J A;  3SEW A;  2O6A A;  5B7D A;  3DM0 A;  3MQ9 A;  2DVC A;  2VOZ A;  2D5W A;  3IJX B;  5I84 A;  3CG3 A;  2O68 A;  2A5T A;  5CMB A;  4HW8 A;  3K01 A;  3TQL A;  1O64 A;  1FTK A;  4YIC A;  3S9E A;  3B6Q A;  4FOR A;  2OBG A;  1LBB A;  2ZNS A;  3OXN A;  2DQV A;  2YPN A;  3MBP A;  3H6W A;  1WDN A;  4JB7 A;  5DVJ A;  3R26 A;  1OQH A;  1P1N A;  1Y4C A;  2G93 A;  2Y84 A;  3FVN A;  3OO8 A;  4G68 B;  1RKM A;  2DE3 A;  4I9D A;  4OTE A;  1JEU A;  1S7Y A;  2Q2A A;  5I59 A;  4LZ8 A;  3IX1 A;  3BFT A;  1Y20 A;  3B6T A;  2F35 A;  2DWJ A;  5CMM A;  5DT6 A;  1F9B A;  3QSL A;  3S4U A;  4WXJ A;  1B3F A;  1SVX B;  5JTY B;  4BDO A;  4NF8 A;  4ESX A;  1LST A;  4TLL B;  3Q25 A;  3RUM A;  2UYF A;  5CMK A;  1UTH A;  4XKP A;  1PC3 A;  1SBP A;  3VLW A;  1SI1 A;  4NF5 A;  1B2H A;  1GTK A;  1N76 A;  1RYO A;  3WAF A;  2R71 A;  3RNN A;  1SDX A;  1VE4 A;  2H4I A;  2XXI A;  4KCC A;  1ZKB A;  1Z7M E;  2UXA A;  3KFM A;  3B7D A;  3OSR A;  4XKQ A;  3TTL A;  2O1M A;  1N0T A;  2DOJ A;  3TYH A;  4OFO A;  1Y4T A;  3ZKL A;  1S50 A;  3VLU A;  4OMB A;  4X1D A;  1FQE A;  4FAT A;  2OLB A;  3VE1 B;  5H8Q B;  1B3H A;  3PMV A;  2I0B A;  1SW4 A;  2FYI A;  5I2N A;  5I58 A;  2DXR A;  4O3B A;  3K1N A;  3JV9 A;  3ONM A;  3T9X B;  1UIU A;  3FAT A;  3TEL A;  1MS7 A;  3TTN A;  3AXF A;  3O29 A;  3IOT A;  4THI A;  1B6H A;  1US4 A;  3HPI A;  3KJT A;  1D4N A;  3VXC A;  4DCY A;  1TXF A;  3GLB A;  4QSC A;  5AA2 B;  1MXZ A;  3FGS A;  4R2B A;  3S9M C;  1CB6 A;  1MQD A;  1P1U A;  3K1M A;  2QSX A;  2YLN A;  4UAC A;  3CSG A;  4XKN A;  4F39 A;  4ZZA A;  5I57 B;  3C9H A;  4NF6 A;  4BDM A;  1FQB A;  1Q35 A;  1NKX A;  2AL5 A;  3U8Q A;  3KGC A;  2Y7W A;  5FTH A;  4KQP A;  3O6H A;  3MP6 A;  4FEB A;  3M8U A;  1D9V A;  1JET A;  4U1O A;  4DIG A;  3FJ7 A;  4GVO A;  5K2X A;  1JQF A;  1XC1 A;  1SQY A;  3G3J A;  4DE8 A;  2Z8E A;  4QFL A;  4U21 A;  3RT6 B;  2REJ A;  2QJE A;  2UVI A;  4QF9 A;  2XXX A;  3FV1 A;  3KOS A;  1LB9 A;  3K02 A;  3CSB A;  1US5 A;  4F2O A;  5IKB A;  4G8M A;  4F31 B;  2I58 A;  1B7H A;  3SET A;  2QS2 A;  4WED A;  1AMF A;  3N5L A;  3VVD A;  1LAG E;  1RYX A;  2AIX A;  3H03 A;  3OEL A;  5CI5 A;  5L8D A;  5H8H A;  3OEM A;  2ZNT A;  3DEL B;  3ZKK A;  5H8N B;  4R73 A;  2DS9 A;  4JDF A;  2QPQ A;  4MF3 A;  1OMP A;  1LCT A;  1I6Q A;  1ELJ A;  4IO7 A;  1II5 A;  3ECR A;  4HS7 A;  1H3D A;  4GL8 A;  2HEU A;  3G3F A;  3R7X A;  1OIB A;  2XXW A;  4EXL A;  4F19 A;  3SES A;  2H99 A;  3C33 A;  1MXV A;  3V83 A;  4G68 A;  5CBR A;  3CRB A;  3UN6 A;  3KEI A;  4POX A;  1A40 A;  1LBC A;  1SYI A;  1NNT A;  1MQI A;  2I4C A;  3OO9 A;  4YMB A;  1NNK A;  1USY H;  4P0I A;  4LON B;  1UTB A;  3LSW A;  4IGR A;  1Y9U A;  2Z23 A;  1VSO A;  1QKA A;  1MY4 A;  2HXW A;  2V3U A;  3ILU B;  3QUF A;  3BKI B;  1FTJ A;  2I48 A;  3EHT A;  4IO4 A;  3VVF A;  3RN8 A;  1NH7 A;  3H06 B;  1GV8 A;  3VV5 A;  1JVY A;  4M1V A;  4F29 A;  3H4Z A;  4PET A;  2QMX A;  1BP5 A;  2X7Q A;  3TZA A;  2RCA A;  1BIY A;  3W9V A;  4OET A;  3U1O A;  1QVS A;  2Z22 A;  2P0S A;  5I57 A;  2VD2 A;  5ICQ A;  1B5I A;  2ZYK A;  3USD A;  3PGF A;  1SYH A;  5AA2 D;  3IOW A;  5FTI A;  2PVU A;  5FHM A;  5CM6 A;  4I1D A;  3QYT A;  2F34 A;  3K1P A;  1D9Y A;  3K6W A;  2Y7I A;  4MBP A;  4QSE A;  4XKR A;  1SD3 A;  2XXQ A;  3OO6 A;  4ZS9 A;  1MPD A;  4R2F A;  3PUY E;  3A3C A;  3EHU A;  3MAM A;  3P7I A;  1P1O A;  4G4P A;  4Q5T A;  4RXL A;  4Z0I A;  3V5A A;  3A09 A;  1MG1 A;  2E1S A;  2V3Q A;  3BBR A;  4R74 A;  3O9P A;  2V84 A;  2XXR A;  5HBC A;  3A3U A;  2V93 A;  3MZB A;  1IUD A;  3MW0 A;  1TFA A;  3CIJ A;  5ITO A;  1VFE A;  4BDN A;  3GZG A;  1JW4 A;  4YKK A;  3PPP A;  2RC8 A;  3KSJ A;  2I4B A;  4LQ5 A;  3IL1 B;  1B1X A;  4MFI A;  3LR1 A;  3MVX A;  1A8F A;  4OER A;  5H8Q A;  3IB2 A;  1B0H A;  5H8S A;  3FVK A;  2ONK E;  2RF1 A;  1YPN A;  5I59 B;  3IO6 A;  4HCY A;  3H3G A;  4GIZ A;  4NF4 A;  4R75 A;  4ZZE A;  3O6I A;  4LQ2 A;  1MDP 1;  3SDF A;  2NOO A;  2DXY A;  3LUY A;  2Y7R A;  4H0W A;  3E3K A;  3U72 A;  2B3F A;  5AA1 A;  2BJJ X;  5JTY A;  1FTM A;  2A5S A;  1QW0 A;  1Y1M A;  4X48 A;  3IK6 B;  1FW0 A;  4Q8R A;  3K0V A;  1LB8 A;  1S9T A;  1VFD A;  3HST A;  1UTH B;  2QL3 A;  3KN7 A;  4YKP A;  1EZ9 A;  5DTB A;  3TTK A;  4ELQ A;  1IIW A;  2RIN A;  3TTM A;  3V89 B;  4H5F A;  1OLC A;  3MP8 A;  4IO6 A;  1URS A;  1DPP A;  1IXG A;  3B6W A;  1JNF A;  3IOR A;  3TCG A;  3VLV A;  3TUS A;  4PP0 A;  4F3B A;  4EDP A;  1PB8 A;  4RA1 A;  1FQF A;  4H65 A;  4AB6 A;  4RJZ A;  4BLA A;  3ILT B;  4DCX A;  5H8F B;  3FV2 A;  3RT8 A;  2XXT A;  4KYE A;  1EZO A;  4RK2 A;  3TDJ A;  3GXA A;  3S2V A;  2OK2 A;  2PYY A;  4OXV A;  2D3I A;  2F5X A;  5DEX A;  2UYE A;  4R6H A;  3THI A;  2F6G A;  4F2Q A;  2P2A A;  1L5T A;  3I5O A;  3PUZ E;  3T96 B;  4ND9 A;  3CI8 A;  3DP8 A;  4GQO A;  4R6K A;  2VD3 A;  5AA4 B;  1OVB A;  2F7A A;  4QFK A;  4E0W A;  1PBQ A;  1UTB B;  3MUQ A;  3PPR A;  4HTG A;  1R6Z A;  4KYS A;  4N07 A;  3HV1 A;  1NL5 A;  4GL0 A;  4H6D A;  3C32 A;  4X9T A;  3L6H A;  2QMW A;  3OOA A;  2GHB A;  5ICT A;  3LC8 A;  1H44 A;  1B0L A;  1I69 A;  1XHY A;  1SI0 A;  2F8D A;  4U23 A;  3KOT A;  2IEE A;  2ONS A;  4YKJ A;  1MY1 A;  3E4R A;  3TOD A;  2O7I A;  3MPK A;  2XX9 A;  5CRY A;  4GOT A;  1NNP A;  2O1L A;  3EF7 A;  3FJM A;  3O66 A;  1P1W A;  4TLM B;  2PT1 A;  5J1D A;  4KD5 A;  2QS4 A;  4GXS B;  5I56 A;  4JSD A;  3R6U A;  2XXH A;  5K2Y A;  4F1V A;  2OCU A;  3SEX A;  4X1B A;  4F3S A;  2UVJ A;  3VDF A;  1HSJ A;  4IY6 A;  1M5F A;  1NH8 A;  2NVU B;  3Q26 A;  5H8H B;  1B7U A;  2ZYN A;  3HO7 A;  3FXR A;  5FHN A;  3U92 A;  1PBP A;  3TTR A;  3KN8 A;  1QUJ A;  1IXH A;  3C4M A;  1MH3 A;  3FJG A;  2W7Y A;  4ISU A;  2HAU A;  3FAS A;  4KFQ A;  1Y3P A;  2O69 A;  4GXA A;  4I8C A;  3SKP A;  3GBB A;  2F7C A;  3T66 A;  5HM4 B;  5I2K B; 
#chains in the Genus database with same CATH topology
 3NOH A;  4EQB A;  3PTY A;  4OWD A;  5BUU A;  2JJK A;  5ELV A;  4NWD A;  5BWJ A;  3W9W A;  4JSO A;  4U4S A;  2OX3 A;  1PEB A;  5H8F A;  2HQ0 A;  4RYA A;  3PD9 A;  4EQ7 A;  4U2R A;  4PE5 B;  1EZP A;  2GRV A;  1SW1 A;  1XOC A;  3VVE A;  1INP A;  1FRP A;  2Q74 A;  1AIV A;  1A54 A;  2I3V A;  5EQA A;  3SEY A;  5A5X B;  1MXU A;  2AL4 A;  3ISP A;  5ITP A;  4MAG A;  3MP1 A;  4U22 A;  2THI A;  4NMY A;  4XXU A;  3RY3 A;  4G8N A;  4LUB A;  4ZEF A;  1P99 A;  1NUY A;  2V25 A;  3MZ9 A;  4RPO A;  2PMS A;  5A5L A;  2VT5 A;  3CFX A;  4O3C A;  3T9H B;  3RQT A;  1MQG A;  1YAE A;  3RGY A;  4ZED A;  2NUV A;  1FSA A;  3C31 A;  1TFD A;  2OZZ A;  1NV4 A;  1MXX A;  2H25 A;  3FVO A;  2RC9 A;  3K4U A;  4OZ9 A;  1FPJ A;  1NUZ A;  3T9U A;  4YZZ A;  5FBP A;  4E0X A;  1ZTY A;  2B4M A;  1Q1K A;  2LAO A;  4XTC Q;  1AL3 A;  3FVG A;  1QUK A;  1FBG A;  4YKI A;  3KJ7 A;  4PFB A;  1LBW A;  2YJP A;  2RC7 A;  1IMB A;  1ATG A;  3K6V A;  1LAX A;  3O2A A;  1B3L A;  3H6V A;  3A29 A;  1N04 A;  4MIJ A;  4M4G A;  3HHF A;  3FBP A;  5A5X A;  4LAT A;  4PFY A;  4DXB A;  1YCJ A;  2F36 A;  4PQJ A;  2DWH A;  3U93 A;  1LEV A;  2DWI A;  3K6X A;  4TQU Q;  1N7W A;  1FPD A;  2XWK A;  3HHG A;  3FXU A;  3G3I A;  1K9Z A;  2CZL A;  4H8J A;  5I2N B;  2VGQ A;  2DWA A;  1O63 A;  2Q9T A;  3EN3 A;  4OEN A;  2Q8J A;  3U65 A;  4ELO A;  1A8E A;  3KBR A;  2PX1 A;  4EF1 A;  2QS1 A;  5AA3 A;  4LZ5 A;  1NV3 A;  1PB9 A;  1B5H A;  4JVC A;  4JVI A;  4L17 A;  1KZ8 A;  5AA2 A;  2V3T A;  3T1B A;  5L9M A;  5KZT A;  1MDQ A;  4NF0 A;  3MJN A;  5L9S A;  3TCH A;  1YTV A;  1JW5 A;  3I6V A;  1B4Z A;  1I6A A;  3Q28 A;  2DP8 A;  1LFH A;  3IB1 A;  3LSF B;  4OHN A;  4C1T A;  4TOZ A;  1LAH E;  5CC2 A;  3MVY A;  3TEP A;  1PDA A;  4FED A;  3CFL A;  4JVD A;  3KC1 A;  1P1Q A;  3OSQ A;  2R9J A;  4GWW A;  2VOZ A;  1NV6 A;  2D5W A;  5I84 A;  4MJO A;  1FBP A;  2OBG A;  2DQV A;  5ET7 A;  3H6W A;  3FVN A;  1Y4C A;  3OO8 A;  2DE3 A;  4LZ8 A;  5EYH A;  5CMM A;  3QSL A;  1IME A;  1LST A;  4P8B A;  1PC3 A;  1SBP A;  2F3B A;  1FBF A;  1B2H A;  2FIE A;  4LN5 A;  2CZH A;  1SDX A;  2H4I A;  4KCC A;  4KQP A;  3B7D A;  4O7M A;  4HE2 A;  4OMB A;  4X1D A;  1FQE A;  3VE1 B;  3PMV A;  2I0B A;  4O3B A;  3K1N A;  3T9X B;  3TTN A;  4OVP A;  3IOT A;  5AA2 B;  3GLB A;  4QSC A;  3FGS A;  3S9M C;  1CB6 A;  4UAC A;  4F39 A;  4NF6 A;  1FQB A;  1NKX A;  1XI6 A;  5FTH A;  3O6H A;  3MP6 A;  1D9V A;  1JET A;  4DIG A;  5K2X A;  1FPL A;  1JQF A;  1SQY A;  3MYU A;  3K02 A;  3CSB A;  5IKB A;  4F31 B;  3SET A;  4WED A;  1RYX A;  2AIX A;  3H03 A;  5CI5 A;  1RDY A;  1YZ0 A;  2QPQ A;  1ELJ A;  4IO7 A;  3ECR A;  1H3D A;  4GL8 A;  3R7X A;  4EXL A;  4HE0 A;  2H99 A;  3KEI A;  1LBC A;  1MQI A;  1NNK A;  1USY H;  4LON B;  3LSW A;  4IGR A;  1Y9U A;  2Z23 A;  1VSO A;  1QKA A;  1MY4 A;  2HXW A;  3QUF A;  3ILU B;  2I48 A;  4FBP A;  3W9V A;  2X7Q A;  4OVR A;  1QVS A;  2Z22 A;  5ICQ A;  2VD2 A;  2ZYK A;  5AA2 D;  3IOW A;  5FTI A;  2PVU A;  3QYT A;  4GX4 A;  4XKR A;  5I56 A;  3PUY E;  3MAM A;  3EHU A;  4Z0I A;  3V5A A;  3O9P A;  2V93 A;  1IUD A;  4N8Y A;  5EQ9 A;  5ITO A;  3PPP A;  2RC8 A;  4MFI A;  3MVX A;  1A8F A;  5H8S A;  3IO6 A;  4R75 A;  4LQ2 A;  2NOO A;  3LUY A;  2Y7R A;  4H0W A;  2B3F A;  4N6K A;  1QW0 A;  4Q8R A;  3K0V A;  2RIN A;  4H5F A;  3IOR A;  4F3B A;  4H65 A;  4DCX A;  3ILT B;  5H8F B;  4KYE A;  1AWB A;  4F2Q A;  4P56 A;  2P2A A;  2KR0 A;  3IFA A;  4R6K A;  4MNP A;  1R6Z A;  4KYS A;  3HV1 A;  3C32 A;  4N15 A;  5ICT A;  1H44 A;  2QFL A;  4I3Y A;  1D9Q A;  3E4R A;  2XX9 A;  4TLM B;  2PT1 A;  4GXS B;  4N81 A;  5K2Y A;  1BK4 A;  4F3S A;  4O8M A;  1M5F A;  4DI4 B;  1B7U A;  2ZYN A;  3HO7 A;  5FHN A;  3U92 A;  1QUJ A;  4ISU A;  5HM4 B;  2UVG A;  3QXM A;  3EQ1 A;  3ZSF A;  3CVG A;  4ZEC A;  2G29 A;  4N6P A;  2F7B A;  1OQG A;  4N17 A;  3OD7 A;  3G3G A;  3S9N C;  4ZEI A;  2VPO A;  4FEC A;  4AS4 A;  2L5V A;  1URG A;  4RK9 A;  3QUJ A;  1FPB A;  3D4G A;  2XHD A;  3M3F A;  3ODB A;  3QAX A;  3PPQ A;  1SW5 A;  3I3V A;  1O7T A;  3UGW A;  2F3D A;  5ET6 A;  2F78 A;  3N6T A;  4Q0C A;  1MY0 A;  4G61 A;  2GHA A;  2XD3 A;  4NF6 B;  4ONY A;  3FD3 A;  1XVX A;  1DPE A;  2DVZ A;  4POW A;  2DYX A;  4ZE8 A;  3WAE A;  1MPB A;  3BIG A;  4NAP A;  3C35 A;  1FTO A;  1IQ7 A;  2I49 A;  4XF5 A;  4N8G A;  2ZZX A;  4PGN A;  2B65 A;  4I62 A;  2M8C A;  3EHS A;  2OWS A;  4NF5 B;  1CE2 A;  4WEP A;  4F1U A;  4NHB A;  2XA5 A;  3E9X A;  4FE8 A;  3IOU A;  3TCF A;  4NF4 B;  2ALU A;  5IZ1 A;  4YB6 A;  3VXB A;  1DK4 A;  3RYD A;  1MM7 A;  5KDT B;  2A5T B;  1R9L A;  3OO7 A;  4IO2 A;  1RDZ A;  3KSX A;  4P47 A;  4GFR A;  1UIV A;  3N26 A;  4KR5 A;  1B52 A;  1POT A;  3E78 A;  1TT1 A;  2FVZ A;  4YAH X;  4JBZ A;  1NI9 A;  4K3F A;  5CMC A;  3SEV A;  1USY E;  1NUW A;  4OES A;  3IJO B;  1B58 A;  2XD2 A;  1NNF A;  3FIR A;  4PFI A;  3T22 A;  2I6E A;  1PB7 A;  4DXC A;  5EHM A;  4U4X A;  1GR2 A;  3PU5 A;  2Y7P A;  2X7P A;  4GWY A;  3C36 A;  1B7Z A;  1ZBM A;  1A99 A;  1G0H A;  2GQ1 A;  3B50 A;  4WKM A;  4DLD A;  3SZP A;  5IM2 A;  3PPN A;  2H9B A;  2H5Y A;  4H45 A;  3OEN A;  1EYK A;  1GGG A;  1B46 A;  4G2Z A;  3C34 A;  3QMF A;  4GWX A;  1JEV A;  3M3K A;  3JZJ A;  2NWJ A;  1H76 A;  4KCD A;  3PV0 E;  2VP1 A;  4LZ7 A;  3V8X B;  2CEY A;  4RNS A;  1AH5 A;  1QJM A;  4LA9 A;  1K9Y A;  2Q2C A;  3T9V A;  3DLN A;  4FAJ A;  3RTF B;  1KWH A;  4PF6 A;  4ECF A;  3PD8 A;  2MKZ A;  4P11 A;  1M5D A;  3IAZ A;  4BDQ A;  4GD5 A;  1ZLQ A;  1R9Q A;  3K6U A;  1LLS A;  4IO3 A;  4NQ8 A;  1MQJ A;  3FUZ A;  3MPL A;  2HCA A;  4H67 A;  5F1Q A;  1NV0 A;  1ZIU A;  3BFU A;  3KBZ A;  4G68 C;  4OA4 A;  2ABH A;  4EF2 A;  2WKY A;  2WX9 A;  4OYV A;  1N84 A;  4N13 A;  1FQA A;  2ZMB A;  1YXI A;  4MLQ A;  2VHA A;  1H45 A;  3Q29 A;  4GRK A;  4X8R A;  5B7D A;  2DVC A;  3IJX B;  3CG3 A;  4HW8 A;  3K01 A;  1O64 A;  1FTK A;  4N91 A;  4HE1 A;  1LBB A;  4NG7 A;  1WDN A;  1RKM A;  4O7I A;  4DI3 D;  4GBV A;  1SVX B;  2HPG A;  4BDO A;  1LBY A;  4NF5 A;  1RYO A;  3WAF A;  2R71 A;  1VE4 A;  4XKQ A;  2UXA A;  2O1M A;  2DOJ A;  4OFO A;  1S50 A;  2OLB A;  1B3H A;  3GYY A;  1QGX A;  3O29 A;  3HPI A;  1D4N A;  1TXF A;  1MXZ A;  1P1U A;  4XKN A;  3CSG A;  3KC0 A;  3U8Q A;  4FEB A;  5J16 A;  2Y5K A;  1XC1 A;  3G3J A;  4QFL A;  3RT6 B;  3FV1 A;  3KOS A;  1B7H A;  3N5L A;  1FJ6 A;  3ZKK A;  5H8N B;  2DS9 A;  4JDF A;  1OMP A;  4HS7 A;  4X04 A;  3SES A;  3C33 A;  3D1R A;  3UN6 A;  2XWI A;  1A40 A;  1NNT A;  2I4C A;  3OO9 A;  4YMB A;  1LBZ A;  1FTJ A;  4IO4 A;  3H06 B;  1GV8 A;  3VV5 A;  4F29 A;  4PET A;  1BP5 A;  2RCA A;  2P0S A;  4UAB A;  1B5I A;  3PGF A;  5CM6 A;  2F34 A;  3K1P A;  3OO6 A;  2XXQ A;  5ESY A;  4RXL A;  1P1O A;  3A09 A;  1MG1 A;  4OVS A;  3BBR A;  3A3U A;  5IZ3 A;  4PAI A;  4BDN A;  2I4B A;  4LQ5 A;  1B1X A;  3LR1 A;  1B0H A;  5I59 B;  3H3G A;  4GIZ A;  4NN3 A;  2XWV A;  3E3K A;  5JTY A;  1FTM A;  4H46 A;  1FW0 A;  3HST A;  3KN7 A;  1EZ9 A;  5I7I A;  4ELQ A;  3V89 B;  1OLC A;  3MP8 A;  1URS A;  1DPP A;  1JNF A;  4AB6 A;  2XXT A;  1FPK A;  4PCD A;  4NGU A;  2PYY A;  4OXV A;  2D3I A;  2F6G A;  3I5O A;  3PUZ E;  4ND9 A;  3DP8 A;  2VD3 A;  2F7A A;  4QFK A;  4E0W A;  1PBQ A;  3PPR A;  4N07 A;  4GL0 A;  4H6D A;  2QMW A;  4HXV A;  1SI0 A;  3KOT A;  2ONS A;  4YKJ A;  2O7I A;  2O1L A;  5LTC A;  4MCO A;  5J1D A;  2QS4 A;  1NH8 A;  1FBE A;  3Q26 A;  5H8H B;  1PBP A;  3FJG A;  4KFQ A;  2O69 A;  2ZNS A;  2F7C A;  5I2K B;  4PFU A;  4KXP A;  2ZZW A;  4R9F A;  3KN3 A;  4G77 A;  3SEU A;  3PPO A;  1MY3 A;  1NV1 A;  2Q88 A;  5EYF A;  2HZK A;  1JW1 A;  3H6U A;  2R6G E;  4MNI A;  4PDD A;  1B5J A;  2PFY A;  4ZDM A;  4QFO A;  4YB7 A;  4F1Y A;  3IR1 A;  2GH9 A;  4JXI A;  3RLF E;  4EQ9 A;  4UA8 A;  5F24 A;  2AYS A;  1B3G A;  1Y3N A;  4IY5 A;  4DXU A;  1N3W A;  1MXY A;  3CFZ A;  1FPF A;  2E0S A;  4I3E A;  2V4C A;  4FJP A;  3HN0 A;  4PE3 A;  4NTL A;  5TU0 A;  3FXQ A;  4G8H A;  4XEQ A;  1B32 A;  1IEJ A;  3TMG A;  2XXP A;  3PUV E;  2CZK A;  4RPN A;  4OFL A;  1HSL A;  2B4L A;  2NXO A;  3H6T A;  3O6G A;  4OEV A;  2FNC A;  5DEX B;  1GVC A;  2XX8 A;  4R9G A;  3IO4 A;  3ZS6 A;  3O97 A;  3M3L A;  4KI0 E;  2PT2 A;  2I3W A;  2KQZ A;  5TP9 B;  1Q9D A;  1NFT A;  4YMA A;  2HZL A;  3MVW A;  4PBQ A;  3BIH A;  5KCJ B;  1N7X A;  4ZEB A;  4PAF A;  3TFL A;  1FTL A;  4QRZ A;  1ZJL A;  5DVI A;  2RCB A;  1B4H A;  2UVH A;  3VFJ A;  5IAI A;  2XXU A;  1HSE A;  5JK4 A;  3OMB A;  1URD A;  5KDT A;  4QHQ A;  3LSX A;  1BLF A;  1LFI A;  4ZE9 A;  3Q27 A;  3T93 B;  5JEI A;  2PCR A;  1DMB A;  4U1Z A;  1IXC A;  1SPI A;  1A55 A;  4KYD A;  5TPA A;  1DOT A;  3EPE A;  4I40 A;  2DDK A;  1OVT A;  1M5E A;  1MRP A;  4KPT A;  4OQO A;  4BDL A;  3JYR A;  1QKB A;  1H43 A;  5EHS A;  4PBH A;  3O28 A;  4F3G A;  3K2D A;  4MH5 A;  4HCW A;  3IFC A;  1LCF A;  4ELP A;  2RKM A;  4P0G A;  1B51 A;  3CR9 A;  1B3E A;  3KZG A;  3IOV A;  4OVJ A;  4NF8 B;  1B05 A;  2FHY A;  4MX6 A;  5I3S A;  2ZYM A;  1I6B A;  5TP9 A;  1DTZ A;  2GFE A;  3UP9 A;  3RTW B;  1EU8 A;  5DVF A;  3K00 A;  5KCJ A;  4BDR A;  4P3L A;  3UOR A;  3LV0 A;  4P1L A;  4PGP A;  4Q30 B;  2P1S A;  3PMW A;  2XX7 A;  1MXW A;  3G3H A;  5FHO A;  4JWY A;  1UQW A;  1DTG A;  5B70 A;  1NV2 A;  2FIX A;  5CBS A;  4H1X A;  4DDD A;  4GBW A;  1FPG A;  2O7U A;  3G7W A;  4PDH A;  4GWO A;  1LAF E;  3HCQ A;  1IXI A;  3IB0 A;  1POY 1;  5H8N A;  1AOV A;  1MH4 A;  3LSL A;  3SEW A;  2O6A A;  3MQ9 A;  2O68 A;  2A5T A;  5IZ3 B;  1RDX A;  3TQL A;  3OXN A;  3MBP A;  1OQH A;  2G93 A;  4PAK A;  4OTE A;  4G68 B;  5I59 A;  4I9D A;  1S7Y A;  3IX1 A;  1Y20 A;  3B6T A;  2F35 A;  5DT6 A;  4WXJ A;  4N4U A;  5JTY B;  4NF8 A;  1KA1 A;  4PFR A;  4TLL B;  3RUM A;  1JP4 A;  1KA0 A;  2ZZV A;  4XKP A;  4MMP A;  1SI1 A;  3VLW A;  1GTK A;  3RPL A;  2XXI A;  1Z7M E;  3KFM A;  3TTL A;  1N0T A;  3ZKL A;  1Y4T A;  4FAT A;  1FBD A;  1SW4 A;  2FYI A;  1T0K A;  3TEL A;  3JV9 A;  3ONM A;  3AXF A;  1B6H A;  1US4 A;  3KJT A;  3VXC A;  3E79 A;  2QSX A;  2YLN A;  3C9H A;  1Q35 A;  3T0J A;  4QXD A;  4AS5 A;  4U1O A;  2Z8E A;  4U21 A;  2REJ A;  2QJE A;  4QF9 A;  4PF8 A;  4O94 A;  1IMF A;  4PTK A;  1US5 A;  4F2O A;  4G8M A;  2QS2 A;  1AMF A;  5L8D A;  5H8H A;  3OEM A;  4MF3 A;  3G3F A;  1OIB A;  3V83 A;  4G68 A;  5CBR A;  4GWU A;  1FTA A;  4P0I A;  5T3J A;  3BKI B;  5ET8 A;  3EHT A;  1NV5 A;  3VVF A;  2BJI A;  3H4Z A;  2QMX A;  3TZA A;  1BIY A;  4OET A;  3U1O A;  3USD A;  3ROJ A;  4MBP A;  4ZEK A;  1D9Y A;  2Y7I A;  1L5T A;  4ZS9 A;  1SD3 A;  4F3P A;  1FJ9 A;  4YIC A;  1MPD A;  2V3Q A;  4R74 A;  2V84 A;  2XXR A;  3MZB A;  1TFA A;  3CIJ A;  1JW4 A;  2P3V A;  3IB2 A;  4HCY A;  4ZZE A;  3SDF A;  4N6D A;  4P1E A;  2HHM A;  3U72 A;  2BJJ X;  1Y1M A;  4X48 A;  3IK6 B;  1LB8 A;  1S9T A;  1UTH B;  2QL3 A;  5EYG A;  3TTK A;  1IIW A;  3LUZ A;  3TTM A;  4IO6 A;  3VLV A;  1IXG A;  3B6W A;  3TUS A;  1LBX A;  4PP0 A;  1PB8 A;  3RT8 A;  1EZO A;  4RK2 A;  3TDJ A;  3GXA A;  3S2V A;  4MNC A;  2F5X A;  5ET5 A;  3T96 B;  3CI8 A;  1IMC A;  4X9T A;  3OOA A;  2GHB A;  2XXK A;  2PFZ A;  1I69 A;  3LC8 A;  1XHY A;  4U23 A;  5EQ7 A;  2IEE A;  3MPK A;  4GOT A;  1NNP A;  3EF7 A;  1P1W A;  4KD5 A;  4JSD A;  3R6U A;  2XXH A;  2OCU A;  4X1B A;  1HSJ A;  4IY6 A;  2NVU B;  3FXR A;  4OAN A;  3TTR A;  1MH3 A;  2HAU A;  5IZZ A;  1Y3P A;  4GXA A;  4I8C A;  3UK4 A;  2ZYO A;  3PUW E;  1XT8 A;  1MPC A;  3N6U A;  2DE4 A;  1ANF A;  4OEU A;  3UA8 A;  4NE4 A;  1DSN A;  1NMU A;  4C0R A;  5HPQ A;  2O51 A;  4QFN A;  1ZU0 A;  3FXB A;  4JWO A;  3TQW A;  1J1N A;  1Y3Q A;  3TKD A;  3HFU A;  1A7L A;  1NV7 A;  2F6P A;  3FZV A;  3MC2 A;  5I56 B;  1M5C A;  3SER A;  1JVX A;  3CG1 A;  2D21 A;  4R72 A;  1FQD A;  4GWS A;  5AA4 A;  4DZ1 A;  4R6Y A;  3EKI A;  5I58 A;  5I2K A;  5F7V A;  4NX1 A;  2XXY A;  4MHF A;  4XIG Q;  3W15 C;  4H8I A;  2ZNU A;  2OJT A;  5DW8 A;  1OLA A;  2QS3 A;  2WBD A;  4OFJ A;  2VPN A;  4FIM A;  4AB5 A;  1B1H A;  3PUX E;  4XFE A;  3S9L C;  5DYH A;  2IA4 A;  2WBB A;  3E13 X;  1R1N A;  4GX6 A;  2R8T A;  1B40 A;  1IZ1 A;  4MLV A;  3N94 A;  3QK6 A;  3MVZ A;  1QUI A;  2PBW A;  3F11 A;  2Q89 A;  4IR8 A;  3UIF A;  1Y1Z A;  4YU0 A;  4Z7E A;  3B8B A;  3D4C A;  4PC9 A;  2KLF A;  4LP2 B;  4PFW A;  1SW2 A;  2QVR A;  5AE4 A;  2OWZ A;  3CHG A;  2O84 X;  1XS5 A;  4PFT A;  3QIM A;  2ONR A;  1CNQ A;  4JWX A;  4F22 A;  2Z8F A;  2CEX A;  4LVQ A;  2H98 A;  1WOD A;  1FQC A;  1WVJ A;  1ZMG A;  2F97 A;  4H5G A;  1XVY A;  2Z8D A;  3KG2 A;  1BKA A;  4C1U A;  2FA7 A;  5I58 B;  3LBS A;  4KHZ E;  1YYZ A;  3L6G A;  3TAJ A;  5ISU A;  5L9O A;  1LGB C;  4ELR A;  2DE2 A;  3DP4 A;  2Y7K A;  1D3K A;  4IB2 A;  1MQH A;  2HFB A;  4RY1 A;  4IGT A;  2WYP A;  3MST A;  2HAV A;  3DP6 A;  2ZXT A;  3H7M A;  4ESW A;  3GBA A;  1VR5 A;  5LDZ A;  4QBA A;  1Z7N E;  3RPL B;  4GF8 A;  4EUO A;  1EH3 A;  1IMA A;  4F18 A;  1N3X A;  2REG A;  5TPA B;  2WEF A;  2XXV A;  3MZ1 A;  1B9J A;  4QSD A;  3TPA A;  1M5B A;  1IIT A;  3OEK A;  4AQ4 A;  2X26 A;  4EXK A;  2QRY A;  1MM6 A;  4QFP A;  1FCK A;  4IO5 A;  5M2V A;  2ESN A;  1BTJ A;  2DSF A;  3U94 A;  3MWB A;  1MY2 A;  1LFG A;  1FPI A;  3G3K A;  3PMX A;  4YB5 A;  2B3B A;  2I0C A;  4O3A A;  4GLI A;  1QUL A;  4NED A;  2OWT A;  1FPE A;  2P3N A;  2ANJ A;  4NWC A;  1TWY A;  4GWZ A;  3RPW A;  2CMO A;  3DM0 A;  4OVT A;  5CMB A;  3S9E A;  3B6Q A;  4FOR A;  2YPN A;  4JB7 A;  5DVJ A;  3R26 A;  1P1N A;  5I5P A;  2Y84 A;  1JEU A;  2Q2A A;  3BFT A;  2WYK A;  2DWJ A;  1F9B A;  3S4U A;  1B3F A;  4ESX A;  2HXR A;  3Q25 A;  2UYF A;  5CMK A;  1UTH A;  1N76 A;  3RNN A;  1FBH A;  1ZKB A;  3OSR A;  5LOM A;  3TYH A;  4MEV A;  3VLU A;  1VDW A;  5H8Q B;  5I2N A;  2DXR A;  1DCU A;  1UIU A;  3FAT A;  1MS7 A;  4THI A;  4DCY A;  4R2B A;  1MQD A;  3K1M A;  4ZZA A;  5I57 B;  2XWO A;  4BDM A;  2AL5 A;  3KGC A;  2Y7W A;  3M8U A;  3FJ7 A;  4GVO A;  4DE8 A;  1DBZ A;  2UVI A;  2XXX A;  1LB9 A;  1EYJ A;  2I58 A;  3VVD A;  1LAG E;  3OEL A;  2ZNT A;  3DEL B;  4R73 A;  1LCT A;  1I6Q A;  1II5 A;  2HEU A;  4F19 A;  2XXW A;  1MXV A;  3CRB A;  4POX A;  1NUX A;  1SYI A;  1UTB A;  2V3U A;  3RN8 A;  1NH7 A;  1JVY A;  4M1V A;  4OVQ A;  1SYH A;  5FHM A;  2QVU A;  4I1D A;  3K6W A;  4QSE A;  1EYI A;  4GX3 A;  4R2F A;  4G4P A;  3A3C A;  4Q5T A;  3P7I A;  2E1S A;  5HBC A;  3MW0 A;  1VFE A;  3GZG A;  4YKK A;  3KSJ A;  3IL1 B;  4OER A;  5H8Q A;  3FVK A;  2ONK E;  2RF1 A;  1YPN A;  5I57 A;  4NF4 A;  3O6I A;  2Q8M A;  1MDP 1;  2DXY A;  5AA1 A;  2A5S A;  2CZI A;  1IMD A;  1VFD A;  4YKP A;  5DTB A;  3TCG A;  4EDP A;  4RA1 A;  1FQF A;  4BLA A;  4RJZ A;  5IGA A;  3FV2 A;  2OK2 A;  5DEX A;  2UYE A;  4R6H A;  3THI A;  4GQO A;  5AA4 B;  1OVB A;  1FBC A;  3MUQ A;  1UTB B;  4HTG A;  1NL5 A;  3L6H A;  1B0L A;  2F8D A;  1LBV A;  1MY1 A;  4P9K A;  3TOD A;  5CRY A;  3O66 A;  3FJM A;  4F1V A;  3SEX A;  2UVJ A;  3VDF A;  1G0I A;  3KN8 A;  1IXH A;  2Y5L A;  3C4M A;  2FBP A;  2W7Y A;  5EQ8 A;  3FAS A;  2QVV A;  3SKP A;  3GBB A;  3T66 A; 
#chains in the Genus database with same CATH homology
 2UVG A;  3QXM A;  3UK4 A;  2ZYO A;  4PFU A;  3PUW E;  3EQ1 A;  1XT8 A;  1MPC A;  5I2K A;  3N6U A;  4R9F A;  2DE4 A;  1ANF A;  3ZSF A;  3KN3 A;  4OEU A;  3UA8 A;  4NE4 A;  4G77 A;  3SEU A;  4EQB A;  3PPO A;  4OWD A;  1MY3 A;  3CVG A;  1DSN A;  1NMU A;  4ZEC A;  2Q88 A;  5EYF A;  2G29 A;  4N6P A;  4C0R A;  2HZK A;  1JW1 A;  5BUU A;  2F7B A;  1OQG A;  2O51 A;  5HPQ A;  3OD7 A;  3G3G A;  3H6U A;  1ZU0 A;  4QFN A;  3S9N C;  4ZEI A;  2R6G E;  4JWO A;  3TQW A;  1J1N A;  1Y3Q A;  4FEC A;  5ELV A;  3TKD A;  4NWD A;  1B5J A;  5BWJ A;  1URG A;  4RK9 A;  3QUJ A;  4ZDM A;  3W9W A;  1A7L A;  4JSO A;  4U4S A;  4QFO A;  3D4G A;  2F6P A;  2XHD A;  3M3F A;  3ODB A;  4YB7 A;  3FZV A;  3MC2 A;  3QAX A;  3PPQ A;  4F1Y A;  5I56 B;  1PEB A;  1SW5 A;  5H8F A;  2HQ0 A;  3I3V A;  3IR1 A;  1O7T A;  4RYA A;  1M5C A;  3PD9 A;  3SER A;  3UGW A;  1JVX A;  2GH9 A;  4JXI A;  4U2R A;  3RLF E;  4EQ9 A;  4EQ7 A;  3CG1 A;  2D21 A;  4PE5 B;  1EZP A;  4R72 A;  2F78 A;  3N6T A;  2GRV A;  1SW1 A;  4Q0C A;  1XOC A;  4UA8 A;  1FQD A;  3VVE A;  1MY0 A;  1AIV A;  1A54 A;  2AYS A;  2GHA A;  2XD3 A;  2I3V A;  4NF6 B;  1B3G A;  1Y3N A;  4IY5 A;  5AA4 A;  4ONY A;  4DZ1 A;  4DXU A;  1N3W A;  4R6Y A;  3FD3 A;  1XVX A;  1DPE A;  1MXY A;  2DVZ A;  3CFZ A;  2DYX A;  1MXU A;  4POW A;  5F7V A;  2XXY A;  3SEY A;  5A5X B;  2AL4 A;  2E0S A;  4XIG Q;  4ZE8 A;  3W15 C;  4FJP A;  4H8I A;  2ZNU A;  1MPB A;  3WAE A;  3HN0 A;  2OJT A;  5ITP A;  4NTL A;  3C35 A;  1FTO A;  5TU0 A;  1IQ7 A;  1OLA A;  3MP1 A;  3FXQ A;  2QS3 A;  2I49 A;  4G8H A;  4U22 A;  2THI A;  4NMY A;  4OFJ A;  4XXU A;  3RY3 A;  1B32 A;  4G8N A;  2B65 A;  4I62 A;  1IEJ A;  4FIM A;  3TMG A;  1B1H A;  4AB5 A;  2XXP A;  2M8C A;  3PUX E;  3PUV E;  4LUB A;  3EHS A;  4ZEF A;  5DYH A;  1P99 A;  2IA4 A;  3S9L C;  2OWS A;  3E13 X;  1R1N A;  2V25 A;  1CE2 A;  4NF5 B;  4WEP A;  3MZ9 A;  4RPO A;  4RPN A;  1B40 A;  2PMS A;  1IZ1 A;  4OFL A;  1HSL A;  3CFX A;  4O3C A;  4MLV A;  3T9H B;  4F1U A;  3RQT A;  3N94 A;  3QK6 A;  1MQG A;  1YAE A;  3E9X A;  3IOU A;  3MVZ A;  1QUI A;  4FE8 A;  2PBW A;  2NXO A;  3H6T A;  3O6G A;  3RGY A;  3TCF A;  4OEV A;  2FNC A;  3F11 A;  2ALU A;  2Q89 A;  4NF4 B;  2NUV A;  4YB6 A;  1Y1Z A;  5DEX B;  3C31 A;  3UIF A;  3VXB A;  4ZED A;  1GVC A;  2XX8 A;  4YU0 A;  1MM7 A;  1TFD A;  4R9G A;  3IO4 A;  5KDT B;  4Z7E A;  3D4C A;  3ZS6 A;  2OZZ A;  3O97 A;  2A5T B;  1R9L A;  3M3L A;  4KI0 E;  3OO7 A;  4IO2 A;  2KLF A;  3KSX A;  4LP2 B;  4PFW A;  1MXX A;  2H25 A;  2PT2 A;  3FVO A;  1SW2 A;  4GFR A;  3TEP A;  2RC9 A;  1UIV A;  2I3W A;  3K4U A;  3N26 A;  4OZ9 A;  4KR5 A;  5AE4 A;  1B52 A;  1POT A;  1T0K A;  5TP9 B;  1NFT A;  4YMA A;  1TT1 A;  2O84 X;  3T9U A;  2HZL A;  4YZZ A;  3MVW A;  4YAH X;  1XS5 A;  4PFT A;  4JBZ A;  5KCJ B;  4K3F A;  5CMC A;  1N7X A;  4E0X A;  3SEV A;  4ZEB A;  1USY E;  3QIM A;  3TFL A;  4OES A;  2ONR A;  1ZTY A;  3IJO B;  1B58 A;  4JWX A;  1Q1K A;  1NNF A;  1FTL A;  2LAO A;  2XD2 A;  4XTC Q;  1AL3 A;  3FVG A;  1QUK A;  4F22 A;  3FIR A;  4QRZ A;  4YKI A;  3KJ7 A;  1ZJL A;  2I6E A;  2Z8F A;  5DVI A;  3T22 A;  2RCB A;  1B4H A;  1PB7 A;  2UVH A;  2YJP A;  4DXC A;  2RC7 A;  4LVQ A;  2H98 A;  1WOD A;  5LOM A;  1FQC A;  4F3P A;  3VFJ A;  5EHM A;  4U4X A;  1ATG A;  3K6V A;  5IAI A;  1LAX A;  2XXU A;  1HSE A;  1GR2 A;  3O2A A;  1WVJ A;  3PU5 A;  1ZMG A;  1B3L A;  3H6V A;  3OMB A;  5JK4 A;  1URD A;  2F97 A;  2Y7P A;  4H5G A;  1N04 A;  2X7P A;  5KDT A;  1XVY A;  2Z8D A;  3KG2 A;  4QHQ A;  3LSX A;  3HHF A;  4M4G A;  1BKA A;  1BLF A;  1LFI A;  3C36 A;  4ZE9 A;  1B7Z A;  3Q27 A;  4C1U A;  2FA7 A;  3T93 B;  5A5X A;  5I58 B;  3LBS A;  5JEI A;  4LAT A;  4KHZ E;  4PFY A;  1DMB A;  4DXB A;  4U1Z A;  1ZBM A;  1A99 A;  1IXC A;  3L6G A;  1YCJ A;  1A55 A;  2F36 A;  4KYD A;  5TPA A;  4PQJ A;  1DOT A;  2DWH A;  3U93 A;  3EPE A;  2DWI A;  3K6X A;  3TAJ A;  5ISU A;  5L9O A;  1LGB C;  4ELR A;  1OVT A;  4TQU Q;  1M5E A;  2DE2 A;  1MRP A;  1D3K A;  2Y7K A;  3DP4 A;  4IB2 A;  4KPT A;  4OQO A;  1N7W A;  4WKM A;  4DLD A;  4BDL A;  1MQH A;  2HFB A;  3JYR A;  2H9B A;  2H5Y A;  3PPN A;  4RY1 A;  3HHG A;  3FXU A;  4IGT A;  1QKB A;  3G3I A;  1H43 A;  2CZL A;  4H8J A;  5I2N B;  5EHS A;  3OEN A;  1GGG A;  2VGQ A;  1B46 A;  4G2Z A;  3C34 A;  3O28 A;  4F3G A;  1JEV A;  3M3K A;  2DWA A;  1O63 A;  1H76 A;  2Q9T A;  3JZJ A;  3EN3 A;  3K2D A;  3PV0 E;  4KCD A;  2NWJ A;  4MH5 A;  4OEN A;  2Q8J A;  4HCW A;  4ELO A;  1A8E A;  1LCF A;  2VP1 A;  4ELP A;  2RKM A;  4LZ7 A;  3KBR A;  2PX1 A;  3V8X B;  4RNS A;  4P0G A;  1B51 A;  2HAV A;  3CR9 A;  1B3E A;  4EF1 A;  1AH5 A;  1QJM A;  2QS1 A;  3KZG A;  5AA3 A;  4LA9 A;  4LZ5 A;  3IOV A;  4OVJ A;  2Q2C A;  3DP6 A;  4NF8 B;  1B05 A;  2ZXT A;  3H7M A;  3GBA A;  1VR5 A;  3T9V A;  4ESW A;  3DLN A;  1Z7N E;  4FAJ A;  3RTF B;  4GF8 A;  1PB9 A;  1B5H A;  2ZYM A;  4EUO A;  1EH3 A;  1I6B A;  1KWH A;  1DTZ A;  2GFE A;  4ZEK A;  5TP9 A;  3UP9 A;  3PD8 A;  4ECF A;  4F18 A;  1N3X A;  4P11 A;  3RTW B;  1M5D A;  1EU8 A;  2REG A;  3IAZ A;  5TPA B;  4BDQ A;  4L17 A;  2XXV A;  5DVF A;  3MZ1 A;  3K00 A;  5AA2 A;  5KCJ A;  4GD5 A;  1B9J A;  1ZLQ A;  2V3T A;  4QSD A;  3UOR A;  1R9Q A;  4BDR A;  3TPA A;  3K6U A;  5L9M A;  1M5B A;  4Q30 B;  1LLS A;  1IIT A;  3OEK A;  4IO3 A;  4AQ4 A;  2P1S A;  3PMW A;  5KZT A;  1MQJ A;  2X26 A;  1MDQ A;  1MXW A;  2XX7 A;  3FUZ A;  3G3H A;  4JWY A;  5FHO A;  1UQW A;  2QRY A;  3MPL A;  4EXK A;  1DTG A;  3MJN A;  5B70 A;  5L9S A;  1MM6 A;  2HCA A;  4H67 A;  5F1Q A;  3TCH A;  5CBS A;  4QFP A;  1YTV A;  1ZIU A;  3BFU A;  1FCK A;  4G68 C;  1JW5 A;  4H1X A;  4IO5 A;  3I6V A;  4DDD A;  5M2V A;  1B4Z A;  1I6A A;  2ESN A;  1BTJ A;  2DP8 A;  2DSF A;  3Q28 A;  3U94 A;  2ABH A;  1LFH A;  3IB1 A;  3MWB A;  2O7U A;  1MY2 A;  1LFG A;  3G3K A;  3LSF B;  3PMX A;  2WKY A;  4YB5 A;  2B3B A;  2I0C A;  4EF2 A;  4O3A A;  4GLI A;  1QUL A;  4OHN A;  3G7W A;  4OYV A;  1N84 A;  4C1T A;  4N13 A;  4TOZ A;  1LAH E;  1FQA A;  2OWT A;  2ZMB A;  4GWO A;  3MVY A;  4NED A;  1LAF E;  5CC2 A;  3HCQ A;  1PDA A;  4FED A;  2ANJ A;  1IXI A;  3CFL A;  1POY 1;  2VHA A;  3IB0 A;  4MLQ A;  1P1Q A;  1TWY A;  1H45 A;  3OSQ A;  4NWC A;  5H8N A;  1AOV A;  3Q29 A;  1MH4 A;  4GRK A;  3RPW A;  2CMO A;  3LSL A;  2R9J A;  3SEW A;  2O6A A;  5B7D A;  3DM0 A;  3MQ9 A;  2DVC A;  2VOZ A;  2D5W A;  3IJX B;  5I84 A;  3CG3 A;  2O68 A;  2A5T A;  5CMB A;  4HW8 A;  3K01 A;  3TQL A;  1O64 A;  1FTK A;  4YIC A;  3S9E A;  3B6Q A;  4FOR A;  2OBG A;  1LBB A;  2ZNS A;  3OXN A;  2DQV A;  2YPN A;  3MBP A;  3H6W A;  1WDN A;  4JB7 A;  5DVJ A;  3R26 A;  1OQH A;  1P1N A;  1Y4C A;  2G93 A;  2Y84 A;  3FVN A;  3OO8 A;  4G68 B;  1RKM A;  2DE3 A;  4I9D A;  4OTE A;  1JEU A;  1S7Y A;  2Q2A A;  5I59 A;  4LZ8 A;  3IX1 A;  3BFT A;  1Y20 A;  3B6T A;  2F35 A;  2DWJ A;  5CMM A;  5DT6 A;  1F9B A;  3QSL A;  3S4U A;  4WXJ A;  1B3F A;  1SVX B;  5JTY B;  4BDO A;  4NF8 A;  4ESX A;  1LST A;  4TLL B;  3Q25 A;  3RUM A;  2UYF A;  5CMK A;  1UTH A;  4XKP A;  1PC3 A;  1SBP A;  3VLW A;  1SI1 A;  4NF5 A;  1B2H A;  1GTK A;  1N76 A;  1RYO A;  3WAF A;  2R71 A;  3RNN A;  1SDX A;  1VE4 A;  2H4I A;  2XXI A;  4KCC A;  1ZKB A;  1Z7M E;  2UXA A;  3KFM A;  3B7D A;  3OSR A;  4XKQ A;  3TTL A;  2O1M A;  1N0T A;  2DOJ A;  3TYH A;  4OFO A;  1Y4T A;  3ZKL A;  1S50 A;  3VLU A;  4OMB A;  4X1D A;  1FQE A;  4FAT A;  2OLB A;  3VE1 B;  5H8Q B;  1B3H A;  3PMV A;  2I0B A;  1SW4 A;  2FYI A;  5I2N A;  5I58 A;  2DXR A;  4O3B A;  3K1N A;  3JV9 A;  3ONM A;  3T9X B;  1UIU A;  3FAT A;  3TEL A;  1MS7 A;  3TTN A;  3AXF A;  3O29 A;  3IOT A;  4THI A;  1B6H A;  1US4 A;  3HPI A;  3KJT A;  1D4N A;  3VXC A;  4DCY A;  1TXF A;  3GLB A;  4QSC A;  5AA2 B;  1MXZ A;  3FGS A;  4R2B A;  3S9M C;  1CB6 A;  1MQD A;  1P1U A;  3K1M A;  2QSX A;  2YLN A;  4UAC A;  3CSG A;  4XKN A;  4F39 A;  4ZZA A;  5I57 B;  3C9H A;  4NF6 A;  4BDM A;  1FQB A;  1Q35 A;  1NKX A;  2AL5 A;  3U8Q A;  3KGC A;  2Y7W A;  5FTH A;  4KQP A;  3O6H A;  3MP6 A;  4FEB A;  3M8U A;  1D9V A;  1JET A;  4U1O A;  4DIG A;  3FJ7 A;  4GVO A;  5K2X A;  1JQF A;  1XC1 A;  1SQY A;  3G3J A;  4DE8 A;  2Z8E A;  4QFL A;  4U21 A;  3RT6 B;  2REJ A;  2QJE A;  2UVI A;  4QF9 A;  2XXX A;  3FV1 A;  3KOS A;  1LB9 A;  3K02 A;  3CSB A;  1US5 A;  4F2O A;  5IKB A;  4G8M A;  4F31 B;  2I58 A;  1B7H A;  3SET A;  2QS2 A;  4WED A;  1AMF A;  3N5L A;  3VVD A;  1LAG E;  1RYX A;  2AIX A;  3H03 A;  3OEL A;  5CI5 A;  5L8D A;  5H8H A;  3OEM A;  2ZNT A;  3DEL B;  3ZKK A;  5H8N B;  4R73 A;  2DS9 A;  4JDF A;  2QPQ A;  4MF3 A;  1OMP A;  1LCT A;  1I6Q A;  1ELJ A;  4IO7 A;  1II5 A;  3ECR A;  4HS7 A;  1H3D A;  4GL8 A;  2HEU A;  3G3F A;  3R7X A;  1OIB A;  2XXW A;  4EXL A;  4F19 A;  3SES A;  2H99 A;  3C33 A;  1MXV A;  3V83 A;  4G68 A;  5CBR A;  3CRB A;  3UN6 A;  3KEI A;  4POX A;  1A40 A;  1LBC A;  1SYI A;  1NNT A;  1MQI A;  2I4C A;  3OO9 A;  4YMB A;  1NNK A;  1USY H;  4P0I A;  4LON B;  1UTB A;  3LSW A;  4IGR A;  1Y9U A;  2Z23 A;  1VSO A;  1QKA A;  1MY4 A;  2HXW A;  2V3U A;  3ILU B;  3QUF A;  3BKI B;  1FTJ A;  2I48 A;  3EHT A;  4IO4 A;  3VVF A;  3RN8 A;  1NH7 A;  3H06 B;  1GV8 A;  3VV5 A;  1JVY A;  4M1V A;  4F29 A;  3H4Z A;  4PET A;  2QMX A;  1BP5 A;  2X7Q A;  3TZA A;  2RCA A;  1BIY A;  3W9V A;  4OET A;  3U1O A;  1QVS A;  2Z22 A;  2P0S A;  5I57 A;  2VD2 A;  5ICQ A;  1B5I A;  2ZYK A;  3USD A;  3PGF A;  1SYH A;  5AA2 D;  3IOW A;  5FTI A;  2PVU A;  5FHM A;  5CM6 A;  4I1D A;  3QYT A;  2F34 A;  3K1P A;  1D9Y A;  3K6W A;  2Y7I A;  4MBP A;  4QSE A;  4XKR A;  1SD3 A;  2XXQ A;  3OO6 A;  4ZS9 A;  1MPD A;  4R2F A;  3PUY E;  3A3C A;  3EHU A;  3MAM A;  3P7I A;  1P1O A;  4G4P A;  4Q5T A;  4RXL A;  4Z0I A;  3V5A A;  3A09 A;  1MG1 A;  2E1S A;  2V3Q A;  3BBR A;  4R74 A;  3O9P A;  2V84 A;  2XXR A;  5HBC A;  3A3U A;  2V93 A;  3MZB A;  1IUD A;  3MW0 A;  1TFA A;  3CIJ A;  5ITO A;  1VFE A;  4BDN A;  3GZG A;  1JW4 A;  4YKK A;  3PPP A;  2RC8 A;  3KSJ A;  2I4B A;  4LQ5 A;  3IL1 B;  1B1X A;  4MFI A;  3LR1 A;  3MVX A;  1A8F A;  4OER A;  5H8Q A;  3IB2 A;  1B0H A;  5H8S A;  3FVK A;  2ONK E;  2RF1 A;  1YPN A;  5I59 B;  3IO6 A;  4HCY A;  3H3G A;  4GIZ A;  4NF4 A;  4R75 A;  4ZZE A;  3O6I A;  4LQ2 A;  1MDP 1;  3SDF A;  2NOO A;  2DXY A;  3LUY A;  2Y7R A;  4H0W A;  3E3K A;  3U72 A;  2B3F A;  5AA1 A;  2BJJ X;  5JTY A;  1FTM A;  2A5S A;  1QW0 A;  1Y1M A;  4X48 A;  3IK6 B;  1FW0 A;  4Q8R A;  3K0V A;  1LB8 A;  1S9T A;  1VFD A;  3HST A;  1UTH B;  2QL3 A;  3KN7 A;  4YKP A;  1EZ9 A;  5DTB A;  3TTK A;  4ELQ A;  1IIW A;  2RIN A;  3TTM A;  3V89 B;  4H5F A;  1OLC A;  3MP8 A;  4IO6 A;  1URS A;  1DPP A;  1IXG A;  3B6W A;  1JNF A;  3IOR A;  3TCG A;  3VLV A;  3TUS A;  4PP0 A;  4F3B A;  4EDP A;  1PB8 A;  4RA1 A;  1FQF A;  4H65 A;  4AB6 A;  4RJZ A;  4BLA A;  3ILT B;  4DCX A;  5H8F B;  3FV2 A;  3RT8 A;  2XXT A;  4KYE A;  1EZO A;  4RK2 A;  3TDJ A;  3GXA A;  3S2V A;  2OK2 A;  2PYY A;  4OXV A;  2D3I A;  2F5X A;  5DEX A;  2UYE A;  4R6H A;  3THI A;  2F6G A;  4F2Q A;  2P2A A;  1L5T A;  3I5O A;  3PUZ E;  3T96 B;  4ND9 A;  3CI8 A;  3DP8 A;  4GQO A;  4R6K A;  2VD3 A;  5AA4 B;  1OVB A;  2F7A A;  4QFK A;  4E0W A;  1PBQ A;  1UTB B;  3MUQ A;  3PPR A;  4HTG A;  1R6Z A;  4KYS A;  4N07 A;  3HV1 A;  1NL5 A;  4GL0 A;  4H6D A;  3C32 A;  4X9T A;  3L6H A;  2QMW A;  3OOA A;  2GHB A;  5ICT A;  3LC8 A;  1H44 A;  1B0L A;  1I69 A;  1XHY A;  1SI0 A;  2F8D A;  4U23 A;  3KOT A;  2IEE A;  2ONS A;  4YKJ A;  1MY1 A;  3E4R A;  3TOD A;  2O7I A;  3MPK A;  2XX9 A;  5CRY A;  4GOT A;  1NNP A;  2O1L A;  3EF7 A;  3FJM A;  3O66 A;  1P1W A;  4TLM B;  2PT1 A;  5J1D A;  4KD5 A;  2QS4 A;  4GXS B;  5I56 A;  4JSD A;  3R6U A;  2XXH A;  5K2Y A;  4F1V A;  2OCU A;  3SEX A;  4X1B A;  4F3S A;  2UVJ A;  3VDF A;  1HSJ A;  4IY6 A;  1M5F A;  1NH8 A;  2NVU B;  3Q26 A;  5H8H B;  1B7U A;  2ZYN A;  3HO7 A;  3FXR A;  5FHN A;  3U92 A;  1PBP A;  3TTR A;  3KN8 A;  1QUJ A;  1IXH A;  3C4M A;  1MH3 A;  3FJG A;  2W7Y A;  4ISU A;  2HAU A;  3FAS A;  4KFQ A;  1Y3P A;  2O69 A;  4GXA A;  4I8C A;  3SKP A;  3GBB A;  2F7C A;  3T66 A;  5HM4 B;  5I2K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...