3FJ7A

Crystal structure of l-phospholactate bound peb3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
231
structure length
231
Chain Sequence
DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Major antigenic peptide PEB3
publication title Specificity of Campylobacter jejuni adhesin PEB3 for phosphates and structural differences among its ligand complexes.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 85
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fj7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fj7A02
2REJA 1B5HA 3CRBA 3UK4A 3W9WA 2A5TA 4THIA 5H8FB 3R26A 3DM0A 4ESXA 3CFXA 4MBPA 1XS5A 1A7LA 1LAGE 3FVGA 2Q2CA 1SW4A 4O3CA 1B4ZA 3CG1A 4JBZA 2THIA 3CR9A 2HEUA 4HTGA 4RY1A 2WKYA 1I69A 4G68B 2I4CA 1A54A 3O66A 2XXPA 5CBSA 1JW5A 2I4BA 1SI0A 3VXCA 5AA4B 4AQ4A 3EQ1A 5K2YA 4JWXA 3OSQA 2DVZA 3N26A 4R6YA 2GH9A 3E3KA 1H3DA 3FVOA 1AH5A 1BIYA 1OQGA 4FJPA 1LAFE 2XD3A 5ITPA 3MPLA 1LFIA 4KD5A 1BTJA 1Y20A 3IR1A 1DOTA 1Y4TA 3UGWA 4H1XA 4LQ2A 3TELA 3V83A 3EHUA 3IOWA 2O7IA 4ELOA 4PQJA 1SW1A 5CC2A 2O1LA 4C0RA 4R73A 4XTCQ 4P11A 1PB7A 1DPPA 4WEDA 1QW0A 1LCFA 4F31B 3DP6A 1PB8A 4DCXA 3KOTA 3SEXA 3T96B 2DWJA 3MZBA 3TTMA 2XXUA 5BWJA 1UTHB 2Q8JA 3IJOB 2OJTA 3OSRA 1B1XA 4KCDA 1UQWA 5J1DA 3MZ9A 3SESA 4M4GA 3GLBA 2DYXA 2HZLA 4G77A 3FVKA 1MQDA 2PYYA 1TFAA 5I2NA 4MLVA 4F2OA 5ICTA 2I3WA 1P1UA 2VD3A 4F1UA 3N6TA 1SYHA 1VSOA 3TAJA 4QFKA 2B65A 1J1NA 4QSDA 4TOZA 5L9SA 4FIMA 4F19A 1QJMA 1B05A 1JVXA 3PUZE 5B70A 2HQ0A 1LFGA 3T9UA 2RC7A 3HHFA 3MPKA 3KN3A 5H8FA 4P0IA 4G8MA 3T93B 4DXBA 3H3GA 3LSXA 3R7XA 3DELB 1OLCA 2QS2A 2ABHA 2NWJA 2H5YA 4NF6B 3FJGA 1B3FA 3G7WA 1Y3NA 4G68A 1OVBA 2F7AA 3RQTA 1LAHE 3Q26A 3C9HA 1NNPA 1MY3A 1D9YA 5TP9A 3TDJA 2DQVA 3A3UA 5JK4A 1MQJA 3UA8A 4H8JA 4DDDA 3O6HA 3DP4A 1PEBA 1Q1KA 4IO4A 4QHQA 1XHYA 1BKAA 1MXXA 2PT2A 3OO8A 2HAUA 4XXUA 3MVWA 3PPNA 4PFYA 3N5LA 2XXYA 1WDNA 3RT8A 1IXHA 1HSLA 4ZDMA 2UYEA 3MVZA 3MWBA 1GGGA 2A5SA 1JQFA 2OWTA 4RK2A 1UTHA 4LUBA 4NF8B 1YAEA 4NTLA 2QJEA 3ILTB 3K6XA 3UORA 1R9QA 3U92A 1AIVA 3I3VA 1PDAA 3ZKKA 3TUSA 1P99A 1A99A 4OHNA 1IQ7A 1Y9UA 1UTBB 2X7PA 3PPRA 3TCGA 3VVDA 2E1SA 2XXQA 4NMYA 1LBCA 3S9EA 2W7YA 5DTBA 4QF9A 3FXUA 4KQPA 4O3AA 5DEXB 1FQAA 2XXXA 1NNFA 1MDP1 3SEWA 4RK9A 2O51A 2UYFA 1URGA 4GLIA 5HBCA 4EQBA 4EDPA 2OBGA 1USYE 3PUWE 1S50A 4G68C 4H5GA 3S2VA 2YLNA 2BJJX 5DVJA 1L5TA 3AXFA 3BKIB 2QPQA 4YKPA 1N76A 3O97A 3S9LC 3S9MC 2ALUA 4QFOA 2XXWA 4LVQA 4KYSA 2QS3A 4NF6A 4ELPA 4GRKA 5CM6A 3HHGA 3VDFA 3USDA 4MLQA 3Q27A 3N6UA 4H65A 3E13X 2I48A 4IO5A 1NNKA 1IXGA 4OXVA 3F11A 4NWCA 4R6HA 4XKPA 1FQFA 1D4NA 1NL5A 1PC3A 4FE8A 2P0SA 3RTWB 2DE4A 3H4ZA 3HCQA 4NF4B 1FTLA 3T9HB 2H4IA 1VFDA 1B7HA 4JDFA 3WAEA 3MP8A 3TCHA 3FJMA 4I8CA 4FATA 2XD2A 3SDFA 3CSBA 2UVIA 3N94A 3TTLA 2F6PA 4JWYA 2ZNSA 1LBBA 3QK6A 5LOMA 3K02A 3RUMA 3IL1B 2ANJA 3TEPA 4NF8A 3TKDA 3RN8A 5A5XB 1TFDA 2CZLA 2R6GE 3KGCA 1FQDA 3RPWA 1MXWA 2HXWA 2UVHA 4EUOA 4PFTA 3KJTA 5JEIA 4U1OA 4LATA 4KI0E 3C31A 1UTBA 2O68A 3SEYA 1B7UA 3IK6B 1MQHA 1LFHA 1MS7A 5DT6A 3EPEA 4OFLA 3HO7A 1S7YA 2PBWA 4HW8A 5DEXA 5KDTB 3QAXA 2DOJA 3PPQA 2OZZA 4YAHX 2HAVA 3ILUB 3QUJA 3U1OA 4BDMA 3OO9A 4JSOA 4C1UA 4F39A 1USYH 1NH7A 3C35A 3PMXA 2V3TA 3ONMA 2V93A 1NFTA 3H6TA 3MP1A 4Z7EA 1IXIA 1TWYA 1EZ9A 1F9BA 2UXAA 3Q28A 4MH5A 3G3KA 2DVCA 1YCJA 1SW2A 5ELVA 1B2HA 4N07A 2FA7A 4R72A 1EZPA 3SEVA 1N84A 4IGRA 4Z0IA 3GBAA 1I6BA 5IAIA 3G3HA 4NF4A 3RTFB 2Y84A 4ZEBA 3KN8A 4N13A 5HPQA 5TP9B 1O64A 3EF7A 4LZ7A 4IY5A 3QIMA 4OZ9A 1SD3A 4OERA 3OEMA 1TXFA 1NNTA 5DYHA 3VXBA 4DCYA 3HN0A 3VLWA 1QKBA 3MVYA 1M5CA 3B6TA 3JZJA 2G93A 4GIZA 3O9PA 4U22A 4FORA 4WEPA 3TQLA 2O7UA 3ODBA 1B40A 3H06B 2ZNUA 1TT1A 3DLNA 1AL3A 1ELJA 4OTEA 5FHOA 5A5XA 4ND9A 4IY6A 4XKRA 1AMFA 1UIVA 3C4MA 4R9GA 2XHDA 1CE2A 4LQ5A 4UACA 1KWHA 4IO2A 3KJ7A 3QXMA 3MVXA 1RYXA 5M2VA 1N3WA 3PMWA 3FXRA 4GVOA 1ZLQA 2NOOA 4ZS9A 2R9JA 3TMGA 3IB2A 4RPNA 4U4SA 5KDTA 4I1DA 3L6HA 3FV2A 4L17A 3O6GA 1POTA 3MJNA 4H67A 3KFMA 2V3UA 3DP8A 1RYOA 2Z23A 2V3QA 5IKBA 1OMPA 1MXZA 2AIXA 4RYAA 4OETA 4X1BA 3LR1A 5TU0A 3LSWA 4F3SA 3E4RA 5EHSA 3TTKA 2F78A 3LSLA 3V5AA 1EZOA 1US5A 3IOVA 1MXUA 4Q5TA 1PBQA 3HSTA 1BP5A 4R2FA 1XVXA 3HPIA 3M3KA 4NWDA 4ZE8A 3CVGA 1O7TA 1JEUA 2V84A 1B7ZA 3H6UA 2B3BA 1JW4A 2XXHA 2IA4A 2I3VA 1UIUA 2XX7A 2DE3A 4YB7A 2NVUB 2VHAA 3JYRA 2QS4A 3KSXA 2RCBA 3H7MA 1PBPA 5KZTA 1H45A 2RC9A 5ITOA 4F22A 3MP6A 4KHZE 1QVSA 4HCYA 1H76A 5I58B 2XXRA 4FEDA 4FAJA 1SW5A 2Z22A 5CBRA 2GRVA 3G3GA 4PFWA 3PPOA 4ESWA 3I5OA 1GVCA 4DZ1A 4RNSA 3TZAA 1IUDA 4GXAA 4KFQA 1SQYA 3SERA 1B0HA 1B46A 4QFLA 4EF2A 2D21A 3C32A 1ZMGA 4QSEA 3B7DA 5DVIA 3RGYA 3U72A 2Q89A 4GFRA 2O84X 1HSEA 2X26A 3VLUA 3FGSA 4ECFA 4YMAA 4K3FA 4GXSB 2H9BA 4KYEA 5CMMA 3C34A 1FTKA 1MY4A 3OD7A 1SBPA 3JV9A 3H03A 4POXA 1MY2A 2DXYA 3LC8A 5FHNA 1MQIA 3T9XB 4C1TA 3IB1A 5FTIA 1FTOA 3L6GA 1MH4A 1IIWA 5AA2D 4LP2B 2FYIA 4DLDA 2ONRA 2R71A 3O2AA 2LAOA 2NXOA 1B32A 1JVYA 1N0TA 4H5FA 2XX9A 1B3GA 3FZVA 3C33A 4HS7A 2VOZA 1ZJLA 1Z7NE 4U2RA 1OQHA 2HZKA 3K2DA 3TPAA 5TPAB 3BBRA 1ATGA 2ZNTA 3CFLA 3K1PA 3K6VA 3FD3A 3FVNA 3RNNA 1DMBA 2D5WA 1MRPA 1EH3A 2DWAA 5F7VA 1SVXB 3VLVA 1MG1A 4X9TA 1MM6A 5AA3A 2AL5A 2KLFA 4OQOA 4ONYA 4YKIA 3Q25A 3IB0A 1B5JA 2QL3A 1Y3PA 5CI5A 4YICA 2XXTA 4QRZA 2AYSA 3MAMA 4KYDA 4R74A 3H6VA 5I58A 3VV5A 1B3LA 3G3FA 1P1OA 1SI1A 3FASA 4RJZA 2DE2A 3T9VA 4YMBA 4H6DA 4DXCA 4LZ5A 1XOCA 3C36A 4JXIA 5DVFA 2F34A 2FNCA 4F1YA 2OWSA 2I6EA 5CMKA 2Y7PA 4NF5B 1MY0A 4PFUA 4N6PA 3TTNA 3PD8A 4GQOA 5ICQA 4IO3A 3W9VA 3O28A 1FQEA 2OLBA 2QRYA 3TODA 3K1NA 5AA1A 4R75A 2I0BA 4PP0A 5L8DA 5AA2B 3ECRA 4F3BA 4F3PA 1IITA 5B7DA 1WVJA 3BFUA 4U23A 1NKXA 4Q8RA 3GZGA 5K2XA 1LAXA 1LSTA 2ONKE 3K0VA 2XXVA 4OVJA 4GOTA 3FATA 3LBSA 2H99A 1DSNA 4GL0A 4BDLA 3I6VA 2AL4A 1BLFA 3OO6A 4I62A 4YB5A 3KN7A 2YJPA 4TLMB 4E0WA 1YTVA 1FCKA 3K1MA 3QSLA 2ZYOA 1N7WA 2H25A 5I84A 2DS9A 4H8IA 3T22A 1M5BA 1AOVA 1JNFA 5L9MA 4LZ8A 4ZEDA 1MPBA 4OEVA 1B1HA 1JW1A 5TPAA 4BLAA 1P1NA 4BDRA 3M3LA 2XXIA 2HFBA 3FUZA 4IO7A 1T0KA 5I57B 4GF8A 1Z7ME 1SDXA 4DE8A 1MM7A 4EXLA 3TTRA 3K4UA 1MXVA 1JETA 3CSGA 1MDQA 1A40A 4ZZEA 1MPCA 1ZU0A 4ISUA 1D3KA 2HCAA 3PPPA 1FTMA 4DXUA 3G3JA 3PUYE 1URDA 1P1WA 2F5XA 4AB6A 3FXQA 3UIFA 4XIGQ 4GL8A 3W15C 4HCWA 2F7CA 4YB6A 4MFIA 2X7QA 5CMBA 4RA1A 1FQBA 4OWDA 3EHTA 4G2ZA 3FIRA 3KEIA 5H8NB 1B3EA 3EN3A 3PU5A 4DIGA 4FECA 4RPOA 3KBRA 2P2AA 1ZIUA 1MQGA 1LLSA 4OFOA 2VD2A 4OFJA 4NF5A 1D9VA 3BFTA 4XKQA 2ZYMA 1IEJA 3GXAA 3SKPA 4LONB 1Y1MA 3O6IA 3WAFA 2F97A 3MZ1A 5AA2A 3U8QA 4OEUA 2RINA 4OESA 2Z8EA 1HSJA 1QUJA 1NH8A 2UVJA 2QS1A 4FEBA 4R6KA 1LB8A 3Q29A 1P1QA 4BDQA 1Q35A 4U21A 3K6WA 4F3GA 1VE4A 1B58A 1A8FA 3B6WA 4QFPA 1VR5A 4ZECA 1H44A 3QUFA 4EXKA 2OK2A 4G8NA 2O6AA 4O3BA 2I49A 3PUXE 4JWOA 1ZTYA 3IORA 4AB5A 5I59A 2PT1A 5HM4B 1LCTA 4X1DA 3K6UA 1OIBA 1POY1 2Y7KA 3QYTA 4OENA 3D4CA 1LB9A 5I57A 4EF1A 4GWOA 1RKMA 2NUVA 2RC8A 5KCJB 2Y7IA 3G3IA 3VFJA 2H98A 4QSCA 1PB9A 1MY1A 4IGTA 4LA9A 1FW0A 2G29A 2I58A 1MH3A 1LGBC 3LSFB 4QFNA 5I2KB 5H8QB 4BDOA 1I6AA 3OOAA 3IOTA 4OMBA 4POWA 1QUIA 1N04A 2ZMBA 3HV1A 3M8UA 1M5DA 4F29A 4G4PA 3PMVA 3OEKA 4U1ZA 5H8NA 2M8CA 3OMBA 1VFEA 1IZ1A 3IX1A 2DSFA 3PGFA 4R2BA 1YPNA 5CRYA 2E0SA 5AA4A 3U93A 1QKAA 3UN6A 2F35A 1M5EA 3VE1B 4PETA 4ELQA 1GV8A 2ZYNA 1SYIA 2F36A 2DXRA 1QULA 5FHMA 4M1VA 3A3CA 3IO6A 2YPNA 3MQ9A 2P1SA 3CG3A 4NEDA 2ESNA 3GBBA 3RT6B 2DWHA 1B3HA 1B6HA 5I56B 3THIA 3H6WA 4GD5A 5AE4A 3CI8A 4PE5B 4NE4A 2I0CA 3VVEA 1B5IA 2Y7RA 4TLLB 3IAZA 4ZEIA 3RY3A 4G8HA 1URSA 3ZKLA 2XX8A 4P0GA 2RKMA 3FV1A 3KSJA 1XVYA 2Q88A 2ONSA 3KOSA 3LUYA 4YKJA 4IB2A 4YU0A 4F18A 4WXJA 2Q2AA 4IO6A 1B0LA 1US4A 4U4XA 2GHAA 3OENA 2OCUA 4KPTA 4OYVA 2REGA 2Q9TA 4ELRA 1Y1ZA 3UP9A 1R6ZA 4MF3A 5JTYB 3A09A 2QMWA 4RXLA 4ZEKA 4Q30B 2F8DA 2O69A 4F1VA 1DTZA 5BUUA 1H43A 3E9XA 3ZS6A 5KCJA 1OLAA 4UA8A 4X48A 1N7XA 2Z8DA 3R6UA 5H8HB 3S9NC 1B51A 1QUKA 2Y7WA 3IOUA 1ANFA 5ISUA 2F6GA 1N3XA 5I2KA 5H8QA 2GFEA 3MBPA 1O63A 1M5FA 3MUQA 5EYFA 1EU8A 5CMCA 3TQWA 4ZZAA 3PV0E 2F7BA 3OO7A 1B9JA 2A5TB 2CMOA 1OVTA 4JSDA 4JB7A 2PMSA 2RCAA 5EHMA 1IXCA 3OXNA 3V89B 3IO4A 4TQUQ 4EQ7A 3S4UA 4EQ9A 3TFLA 1JEVA 2VGQA 3SEUA 1NMUA 2D3IA 4BDNA 3OELA 3U94A 2DP8A 3M3FA 3V8XB 4KR5A 3EHSA 5I56A 3MC2A 3PD9A 2IEEA 1FQCA 2UVGA 4KCCA 3O29A 1MPDA 1Y4CA 2QSXA 1GR2A 1II5A 3P7IA 2V25A 3MW0A 3TYHA 3KZGA 1WODA 3CIJA 1DTGA 3RLFE 1ZBMA 4YKKA 1I6QA 3TCFA 3B6QA 3VVFA 1B52A 4F2QA 1GTKA 4WKMA 1B4HA 4XKNA 4YZZA 5FTHA 2O1MA 1FTJA 3ZSFA 2DWIA 2RF1A 1S9TA 2ZYKA 1A55A 2QMXA 4I9DA 1MXYA 1XC1A 5H8SA 4Q0CA 3T66A 5JTYA 3KG2A 1ZKBA 3IJXB 4E0XA 2Z8FA 2GHBA 4H0WA 3K01A 3PUVE 1R9LA 2VP1A 2PX1A 1CB6A 5I59B 3FJ7A 5H8HA 5F1QA 5I2NB 3CFZA 1DPEA 1XT8A 4ZEFA 2B3FA 1R1NA 4R9FA 5L9OA 1A8EA 3D4GA 2PVUA 3SETA 3K00A 4ZE9A 2ZXTA 1Y3QA
chains in the Genus database with same CATH superfamily
5LTCA 2REJA 1B5HA 3CRBA 3UK4A 3W9WA 2A5TA 4THIA 5H8FB 3R26A 3DM0A 4ESXA 4I3EA 2CZIA 3CFXA 2P3VA 4MBPA 1XS5A 1A7LA 1LAGE 3FVGA 2Q2CA 1SW4A 4O3CA 4GWXA 1B4ZA 3CG1A 4PE3A 4JBZA 2THIA 3CR9A 2HEUA 1FPFA 4HTGA 4MEVA 4RY1A 2WKYA 1I69A 4G68B 1FPIA 2I4CA 1NV1A 1A54A 3O66A 3RPLB 2XXPA 5CBSA 1JW5A 2I4BA 2WBDA 1SI0A 3BIGA 3VXCA 4MNPA 5AA4B 4AQ4A 3EQ1A 5K2YA 4JWXA 3OSQA 2DVZA 3N26A 4R6YA 2GH9A 3E3KA 1H3DA 3FVOA 1AH5A 1BIYA 1OQGA 4FJPA 1LAFE 2XD3A 5ITPA 3MPLA 1LFIA 4KD5A 1BTJA 1Y20A 4P47A 3IR1A 1DOTA 1Y4TA 3UGWA 4H1XA 4LQ2A 3TELA 3V83A 3EHUA 3IOWA 2O7IA 4ELOA 4PQJA 1SW1A 5CC2A 2O1LA 4C0RA 1NV3A 4R73A 2V4CA 4XTCQ 4P11A 1PB7A 1DPPA 4WEDA 1QW0A 1LCFA 4P56A 4F31B 3DP6A 1PB8A 4DCXA 2PFYA 3KOTA 3SEXA 3T96B 1FRPA 2DWJA 3MZBA 5I5PA 3TTMA 2XXUA 5BWJA 1NUWA 4OVPA 1UTHB 2Q8JA 3IJOB 2B4LA 2OJTA 3OSRA 1B1XA 1FPGA 4KCDA 1IMDA 1UQWA 5J1DA 4FBPA 5IGAA 5T3JA 3MZ9A 3SESA 2KR0A 4M4GA 3GLBA 2DYXA 2HZLA 4G77A 3FVKA 1MQDA 2PYYA 1TFAA 5I2NA 4MLVA 4F2OA 5ICTA 3FXBA 2I3WA 1P1UA 2VD3A 4F1UA 3N6TA 1SYHA 1VSOA 3TAJA 4QFKA 2B65A 1J1NA 4QSDA 4TOZA 2WYPA 2CZHA 4FIMA 5L9SA 4F19A 2QVRA 1QJMA 1B05A 3PTYA 1JVXA 3PUZE 5B70A 2HQ0A 1LFGA 3T9UA 2RC7A 3HHFA 3MPKA 4LN5A 3KN3A 5H8FA 4P0IA 3BIHA 2XWOA 4G8MA 3T93B 4DXBA 3H3GA 3LSXA 4NG7A 3R7XA 3DELB 1OLCA 2QS2A 2ABHA 2NWJA 2H5YA 2DDKA 4NF6B 4N81A 4MHFA 3FJGA 1AWBA 2CZKA 1B3FA 3G7WA 1Y3NA 4G68A 4PDDA 1OVBA 1NV4A 3RPLA 2F7AA 4GWYA 3RQTA 1LAHE 3Q26A 3C9HA 1NNPA 1MY3A 1D9YA 1INPA 4PFIA 5TP9A 3TDJA 2DQVA 4H45A 1EYJA 3A3UA 5JK4A 1MQJA 1FPKA 3UA8A 4H8JA 3MSTA 4DDDA 3O6HA 2WYKA 3DP4A 1DCUA 1PEBA 1Q1KA 4IO4A 4QHQA 1XHYA 1BKAA 1MXXA 2PT2A 3OO8A 2HAUA 4XXUA 3MVWA 3PPNA 4PFYA 3N5LA 4PF6A 2XXYA 1WDNA 3RT8A 1IXHA 1HSLA 4ZDMA 2UYEA 3MVZA 3MWBA 1GGGA 2A5SA 1JQFA 5EYGA 5ET5A 2OWTA 4RK2A 2OX3A 1UTHA 4LUBA 4NF8B 1YAEA 4NTLA 2FBPA 2QJEA 2Q74A 3ILTB 3K6XA 1FBCA 3UORA 1R9QA 3U92A 1AIVA 3I3VA 1PDAA 3ZKKA 3TUSA 2OWZA 1P99A 1A99A 4OHNA 1IQ7A 1FPBA 2XWVA 1Y9UA 1UTBB 4PBHA 2X7PA 4OA4A 3PPRA 3TCGA 3VVDA 2E1SA 2XXQA 1CNQA 4NMYA 1LBCA 3S9EA 2W7YA 2XA5A 5DTBA 4QF9A 3FXUA 4KQPA 4O3AA 5DEXB 1FQAA 2XXXA 1NNFA 1MDP1 4JVCA 4RK9A 3SEWA 2O51A 2UYFA 1URGA 4GLIA 5HBCA 4EQBA 4EDPA 2OBGA 3E79A 1USYE 3PUWE 1S50A 4G68C 4H5GA 4NN3A 3S2VA 2YLNA 2BJJX 5DVJA 1JP4A 1L5TA 2QVUA 2B4MA 3AXFA 4I3YA 3BKIB 2QPQA 4YKPA 1N76A 5ESYA 3O97A 1IMFA 3S9LC 3S9MC 2ALUA 4QFOA 2XXWA 4LVQA 4KYSA 2QS3A 4NF6A 4ELPA 4GRKA 5CM6A 3HHGA 3VDFA 5FBPA 3USDA 1FSAA 4MLQA 3Q27A 3N6UA 4H65A 3E13X 5I7IA 2I48A 4IO5A 1NNKA 1IXGA 4OXVA 3F11A 4NWCA 4R6HA 4XKPA 1FQFA 1D4NA 1NL5A 1PC3A 4FE8A 2P0SA 3RTWB 2DE4A 3H4ZA 3HCQA 4NF4B 1FTLA 3T9HB 2H4IA 1VFDA 1B7HA 4JDFA 3WAEA 3MP8A 3TCHA 3FJMA 4I8CA 4O7IA 4FATA 2XD2A 3SDFA 3CSBA 2UVIA 3N94A 3TTLA 1DBZA 2F6PA 4JWYA 2ZNSA 1LBBA 3QK6A 5LOMA 3K02A 3RUMA 3IL1B 2ANJA 4MNCA 3TEPA 4OVRA 4NF8A 3TKDA 3RN8A 5A5XB 4P3LA 1TFDA 2CZLA 2R6GE 3KGCA 1FQDA 3RPWA 1MXWA 2HXWA 2UVHA 5IZ3B 4EUOA 3GYYA 4PFTA 3KJTA 5JEIA 4HE2A 4N6DA 4U1OA 4LATA 4KI0E 3C31A 1UTBA 2O68A 1K9YA 3SEYA 1B7UA 2XWIA 3IK6B 3RYDA 1MQHA 1LFHA 1MS7A 5DT6A 3EPEA 4OFLA 3HO7A 1S7YA 4GX6A 2PBWA 4HW8A 1NV7A 5DEXA 5KDTB 3QAXA 2DOJA 3T1BA 3PPQA 2OZZA 4YAHX 2HAVA 2QFLA 3ILUB 3QUJA 1NV5A 3U1OA 4BDMA 3OO9A 4JSOA 4C1UA 4F39A 1USYH 1LEVA 2P3NA 3D1RA 1NH7A 3C35A 3PMXA 2V3TA 3ONMA 2V93A 1NUYA 1NFTA 3H6TA 3MP1A 4Z7EA 1IXIA 1TWYA 4GBVA 1NUZA 1EZ9A 3FBPA 1F9BA 1NV2A 2UXAA 4PC9A 4N8YA 3Q28A 4MH5A 3G3KA 2DVCA 1YCJA 1SW2A 5ELVA 1B2HA 4N07A 2FA7A 4R72A 1EZPA 3SEVA 1N84A 4IGRA 4AS4A 4Z0IA 5EQ9A 3GBAA 4P1EA 1I6BA 5IAIA 3G3HA 4NF4A 3RTFB 2Y84A 4ZEBA 3KN8A 4N13A 5HPQA 5TP9B 1O64A 3EF7A 4LZ7A 4IY5A 3QIMA 4OVQA 4JVIA 4OZ9A 1SD3A 4OERA 3OEMA 1TXFA 4PGNA 1NNTA 2PCRA 5DYHA 3VXBA 4DCYA 3HN0A 3VLWA 1QKBA 3MVYA 1M5CA 3B6TA 3JZJA 2G93A 4GIZA 3O9PA 4NAPA 4FORA 4U22A 4WEPA 3TQLA 2O7UA 3ODBA 1B40A 3H06B 2ZNUA 1TT1A 3DLNA 1AL3A 1ELJA 4OTEA 5FHOA 5A5XA 4ND9A 2WBBA 4IY6A 4XKRA 1AMFA 5EQ7A 5IZ3A 1UIVA 5F24A 3C4MA 4NX1A 4R9GA 2F3BA 2XHDA 1CE2A 4LQ5A 4UACA 1KWHA 4IO2A 3KJ7A 3QXMA 3MVXA 1RYXA 5M2VA 1N3WA 4I40A 3PMWA 3FXRA 4GVOA 1FTAA 1ZLQA 2NOOA 4ZS9A 2R9JA 3TMGA 4P1LA 3IB2A 4RPNA 4U4SA 5KDTA 4I1DA 3L6HA 2FIEA 3FV2A 4L17A 3O6GA 1POTA 3MJNA 4H67A 3KFMA 3LV0A 2V3UA 3DP8A 1BK4A 1RYOA 2Z23A 2V3QA 5IKBA 1OMPA 1MXZA 2AIXA 4RYAA 4OETA 4X1BA 3LR1A 5TU0A 3LSWA 2WEFA 4F3SA 3E4RA 5EHSA 3TTKA 2F78A 3LSLA 3V5AA 1EZOA 1US5A 3IOVA 4N17A 1MXUA 4N4UA 4PBQA 4Q5TA 1PBQA 3HSTA 1BP5A 4R2FA 3NOHA 1XVXA 3HPIA 2QVVA 3M3KA 4NWDA 4ZE8A 3CVGA 1O7TA 1JEUA 1IMAA 2V84A 2XWKA 3KBZA 1B7ZA 3H6UA 2B3BA 1RDZA 4X8RA 1JW4A 2XXHA 2IA4A 1VDWA 2I3VA 1UIUA 2XX7A 2DE3A 4YB7A 2NVUB 2VHAA 3JYRA 2QS4A 3KSXA 2RCBA 3H7MA 1PBPA 1IMBA 5KZTA 3KC0A 1H45A 2RC9A 5ITOA 4F22A 3MP6A 2FVZA 4KHZE 1QVSA 4HCYA 1H76A 1IMCA 1NV0A 5I58B 1IMEA 2XXRA 1LBVA 4FEDA 4FAJA 3B8BA 1SW5A 2Z22A 5CBRA 2GRVA 3G3GA 4PFWA 3PPOA 4ESWA 3I5OA 2GQ1A 1GVCA 1FBPA 5EYHA 4DZ1A 4RNSA 1FJ6A 1IUDA 4GXAA 3TZAA 4KFQA 1SQYA 4NF0A 3SERA 1B0HA 1B46A 4QFLA 4O94A 3CHGA 4EF2A 2D21A 3C32A 1FPEA 2VT5A 1ZMGA 4QSEA 3B7DA 3E78A 5DVIA 3RGYA 3U72A 4MCOA 2Q89A 3LUZA 4GFRA 1YXIA 1KZ8A 2O84X 1HSEA 2R8TA 2X26A 1DK4A 3VLUA 3FGSA 4ECFA 4YMAA 4K3FA 4GXSB 2H9BA 4KYEA 5CMMA 3C34A 1FTKA 1MY4A 3OD7A 1SBPA 3JV9A 3H03A 4POXA 1MY2A 2DXYA 3LC8A 5FHNA 1MQIA 3T9XB 4C1TA 5EQ8A 4N91A 3IB1A 5FTIA 1FTOA 4GWZA 3L6GA 1MH4A 1IIWA 4XFEA 5AA2D 4LP2B 2FYIA 4DLDA 5DW8A 2ONRA 4DI3D 1FBDA 2R71A 3O2AA 2LAOA 2NXOA 1B32A 4GX4A 1JVYA 1N0TA 4H5FA 1EYIA 2XX9A 1B3GA 3FZVA 4UABA 3C33A 4HS7A 2VOZA 1ZJLA 1Z7NE 4U2RA 1OQHA 2HZKA 3K2DA 3TPAA 2Q8MA 5TPAB 3BBRA 1ATGA 2ZNTA 2Y5LA 3EKIA 3CFLA 3K1PA 3K6VA 3FD3A 3FVNA 3RNNA 1DMBA 2D5WA 1MRPA 1EH3A 3T0JA 1RDXA 2DWAA 5F7VA 1SVXB 3VLVA 1MG1A 4MNIA 4X9TA 1MM6A 1SPIA 5AA3A 2AL5A 2KLFA 4OQOA 4ONYA 4YKIA 3Q25A 3IB0A 1B5JA 2QL3A 2PFZA 1Y3PA 5CI5A 4YICA 2XXTA 4QRZA 2AYSA 4PFRA 1NUXA 3HFUA 3MAMA 4KYDA 4R74A 3H6VA 5I58A 3VV5A 1B3LA 3G3FA 1P1OA 1SI1A 3FASA 4RJZA 2DE2A 3T9VA 4YMBA 4H6DA 4DXCA 4LZ5A 1XOCA 2XXKA 3C36A 4JXIA 5DVFA 2F34A 2FNCA 4F1YA 2OWSA 2I6EA 5CMKA 2Y7PA 4NF5B 4N6KA 4XF5A 1MY0A 4PFUA 4N6PA 3TTNA 3PD8A 4GQOA 5ICQA 4IO3A 3W9VA 3O28A 1FQEA 5LDZA 4G61A 2OLBA 2QRYA 3TODA 3K1NA 4PDHA 5AA1A 4R75A 2I0BA 4PP0A 5L8DA 5AA2B 3ECRA 4F3BA 4F3PA 1IITA 5B7DA 1WVJA 3BFUA 4U23A 1QGXA 1NKXA 2FIXA 4Q8RA 4QXDA 3GZGA 5K2XA 1LAXA 1LSTA 2ONKE 3K0VA 2XXVA 4OVJA 4GOTA 3FATA 3LBSA 2H99A 1DSNA 4GL0A 4BDLA 3I6VA 4NQ8A 2AL4A 1BLFA 3OO6A 4I62A 4PTKA 1K9ZA 2ZZXA 4YB5A 3KN7A 2YJPA 4PGPA 4TLMB 4E0WA 1YTVA 4HE0A 1FCKA 3K1MA 3QSLA 2ZYOA 1N7WA 4XEQA 2H25A 1NV6A 2VPNA 5I84A 2DS9A 4H8IA 3T22A 1M5BA 1AOVA 4NHBA 1JNFA 5L9MA 4LZ8A 4ZEDA 1MPBA 4OEVA 1B1HA 1JW1A 5TPAA 4BLAA 1P1NA 3A29A 4BDRA 3M3LA 2XXIA 1G0IA 2HFBA 3FUZA 4IO7A 1T0KA 1LBZA 5I57B 4GF8A 1Z7ME 1SDXA 4DE8A 4AS5A 1MM7A 4EXLA 3TTRA 1D9QA 3K4UA 1MXVA 4OVTA 1JETA 4O8MA 4N15A 3CSGA 1MDQA 1A40A 2HPGA 4ZZEA 1MPCA 1XI6A 1ZU0A 4ISUA 1D3KA 2HCAA 2KQZA 3PPPA 1FTMA 4DXUA 3G3JA 3PUYE 1URDA 1P1WA 2F5XA 4AB6A 3FXQA 3UIFA 4XIGQ 4GL8A 3W15C 4HCWA 2F7CA 4P9KA 1FPJA 4YB6A 4MFIA 2X7QA 5CMBA 2FHYA 4RA1A 1FQBA 4OWDA 3EHTA 4G2ZA 3FIRA 3KEIA 1FPLA 5H8NB 1B3EA 3EN3A 3PU5A 1LBWA 4DIGA 4FECA 4RPOA 3KBRA 2P2AA 4QBAA 1ZIUA 2HHMA 1MQGA 1LLSA 4OFOA 2VD2A 4OFJA 4NF5A 1D9VA 4PF8A 2Y5KA 3BFTA 4XKQA 2ZYMA 1IEJA 3GXAA 3SKPA 4LONB 4H46A 1Y1MA 3O6IA 4OVSA 3WAFA 2F97A 3MZ1A 3QMFA 5AA2A 3U8QA 4OEUA 2RINA 4OESA 2Z8EA 1HSJA 1QUJA 1NH8A 2UVJA 2QS1A 4FEBA 1KA0A 4JVDA 4R6KA 1LB8A 3Q29A 1P1QA 4BDQA 1Q35A 4U21A 3K6WA 4F3GA 2F3DA 1VE4A 1B58A 1A8FA 3B6WA 4QFPA 1VR5A 4ZECA 1H44A 4MX6A 3QUFA 4EXKA 2OK2A 4G8NA 4PAFA 2O6AA 3B50A 4O3BA 2I49A 3PUXE 4JWOA 1ZTYA 4HE1A 4KXPA 3IORA 4AB5A 5I59A 2PT1A 5HM4B 1LCTA 4X1DA 3K6UA 1OIBA 1POY1 2Y7KA 1EYKA 4GWSA 3QYTA 2VPOA 4OENA 3D4CA 1LB9A 5I57A 4EF1A 4GWOA 1RKMA 2NUVA 2RC8A 5KCJB 2Y7IA 3G3IA 5IZZA 3VFJA 2MKZA 2H98A 4QSCA 1PB9A 1MY1A 4LA9A 4IGTA 1FW0A 3MYUA 4N8GA 2HXRA 2G29A 2I58A 1MH3A 1LGBC 3LSFB 4QFNA 5I2KB 5H8QB 4BDOA 1I6AA 3OOAA 4MJOA 3IOTA 4P8BA 4OMBA 4POWA 1QUIA 1N04A 2ZMBA 3HV1A 3M8UA 1M5DA 3ROJA 4F29A 4G4PA 3PMVA 3OEKA 4U1ZA 5H8NA 2M8CA 3OMBA 1VFEA 1IZ1A 3IX1A 2DSFA 5IZ1A 5I3SA 5J16A 3PGFA 4R2BA 1YPNA 5CRYA 2E0SA 4NGUA 5ET6A 5AA4A 3U93A 1QKAA 3UN6A 2F35A 1M5EA 3VE1B 4PETA 4ELQA 1GV8A 2ZYNA 1SYIA 2F36A 2DXRA 1QULA 5FHMA 4M1VA 3A3CA 3IO6A 2YPNA 3MQ9A 2P1SA 4PAIA 3CG3A 4NEDA 2ESNA 2ZZVA 3GBBA 3RT6B 2DWHA 1B3HA 1B6HA 5I56B 5EQAA 4O7MA 3THIA 3U65A 3H6WA 4GD5A 5AE4A 3CI8A 4PE5B 4NE4A 2I0CA 3VVEA 1B5IA 2Y7RA 4TLLB 3ISPA 3IAZA 4ZEIA 3RY3A 4G8HA 4GX3A 1URSA 3ZKLA 2XX8A 4P0GA 2RKMA 3FV1A 3KSJA 1XVYA 2Q88A 2ONSA 3KOSA 3LUYA 4YKJA 4IB2A 4YU0A 4F18A 4WXJA 2Q2AA 4IO6A 1FPDA 1B0LA 1US4A 4U4XA 2GHAA 3OENA 2OCUA 4KPTA 4OYVA 2REGA 2Q9TA 4ELRA 1Y1ZA 3UP9A 1R6ZA 2BJIA 4MF3A 4PAKA 5JTYB 3A09A 2QMWA 1FBGA 4RXLA 4HXVA 4ZEKA 4Q30B 2F8DA 2O69A 4F1VA 1DTZA 5BUUA 1H43A 3E9XA 1YZ0A 1NI9A 3ZS6A 5KCJA 1OLAA 4UA8A 2JJKA 4X48A 1N7XA 2Z8DA 3R6UA 5H8HB 3S9NC 3SZPA 1B51A 1QUKA 2Y7WA 3IOUA 1ANFA 4DI4B 5ISUA 2F6GA 1N3XA 4GWUA 5I2KA 5H8QA 5IM2A 2GFEA 3MBPA 4MMPA 1O63A 1M5FA 3MUQA 5EYFA 1EU8A 5CMCA 3TQWA 4ZZAA 3PV0E 2F7BA 3OO7A 1B9JA 4MIJA 2A5TB 2CMOA 1OVTA 4JSDA 3IFCA 4JB7A 2PMSA 2RCAA 5EHMA 1IXCA 2WX9A 4MAGA 4X04A 1KA1A 3OXNA 3V89B 3IO4A 4TQUQ 4EQ7A 3S4UA 4EQ9A 3TFLA 1JEVA 2VGQA 3SEUA 1NMUA 2D3IA 4BDNA 2CEXA 3OELA 3U94A 2DP8A 3M3FA 3V8XB 4KR5A 3EHSA 5I56A 3MC2A 3PD9A 1LBYA 2IEEA 1FQCA 5A5LA 2UVGA 2ZZWA 4KCCA 5ET8A 3O29A 1MPDA 1Y4CA 2QSXA 1GR2A 1II5A 3P7IA 2V25A 3MW0A 3TYHA 3KZGA 1WODA 3CIJA 1DTGA 3RLFE 4GWWA 1ZBMA 4YKKA 1I6QA 3TCFA 3B6QA 3VVFA 1B52A 4F2QA 4OANA 1GTKA 4PFBA 4PCDA 4WKMA 1B4HA 1G0HA 4XKNA 4YZZA 3KC1A 1FBFA 4IR8A 5FTHA 2O1MA 1FTJA 3ZSFA 2DWIA 1RDYA 2RF1A 1S9TA 2ZYKA 1A55A 2QMXA 4I9DA 1MXYA 1XC1A 5H8SA 1YYZA 4Q0CA 3T66A 5JTYA 3KG2A 1ZKBA 4GBWA 3IJXB 1FBHA 3IFAA 4E0XA 2Z8FA 2GHBA 4H0WA 3K01A 2L5VA 3PUVE 1FBEA 1R9LA 2VP1A 2PX1A 1CB6A 5I59B 3FJ7A 2CEYA 5H8HA 5F1QA 5ET7A 5I2NB 3CFZA 1DPEA 1FJ9A 1LBXA 1XT8A 4ZEFA 2B3FA 1R1NA 4R9FA 5L9OA 1A8EA 3D4GA 2PVUA 3SETA 3K00A 1Q9DA 4ZE9A 2ZXTA 1Y3QA
chains in the Genus database with same CATH topology
2REJA 1B5HA 3CRBA 3UK4A 3W9WA 2A5TA 4THIA 5H8FB 3R26A 3DM0A 4ESXA 3CFXA 4MBPA 1XS5A 1A7LA 1LAGE 3FVGA 2Q2CA 1SW4A 4O3CA 1B4ZA 3CG1A 4JBZA 2THIA 3CR9A 2HEUA 4HTGA 4RY1A 2WKYA 1I69A 4G68B 2I4CA 1A54A 3O66A 2XXPA 5CBSA 1JW5A 2I4BA 1SI0A 3VXCA 5AA4B 4AQ4A 3EQ1A 5K2YA 4JWXA 3OSQA 2DVZA 3N26A 4R6YA 2GH9A 3E3KA 1H3DA 3FVOA 1AH5A 1BIYA 1OQGA 4FJPA 1LAFE 2XD3A 5ITPA 3MPLA 1LFIA 4KD5A 1BTJA 1Y20A 3IR1A 1DOTA 1Y4TA 3UGWA 4H1XA 4LQ2A 3TELA 3V83A 3EHUA 3IOWA 2O7IA 4ELOA 4PQJA 1SW1A 5CC2A 2O1LA 4C0RA 4R73A 4XTCQ 4P11A 1PB7A 1DPPA 4WEDA 1QW0A 1LCFA 4F31B 3DP6A 1PB8A 4DCXA 3KOTA 3SEXA 3T96B 2DWJA 3MZBA 3TTMA 2XXUA 5BWJA 1UTHB 2Q8JA 3IJOB 2OJTA 3OSRA 1B1XA 4KCDA 1UQWA 5J1DA 3MZ9A 3SESA 4M4GA 3GLBA 2DYXA 2HZLA 4G77A 3FVKA 1MQDA 2PYYA 1TFAA 5I2NA 4MLVA 4F2OA 5ICTA 2I3WA 1P1UA 2VD3A 4F1UA 3N6TA 1SYHA 1VSOA 3TAJA 4QFKA 2B65A 1J1NA 4QSDA 4TOZA 5L9SA 4FIMA 4F19A 1QJMA 1B05A 1JVXA 3PUZE 5B70A 2HQ0A 1LFGA 3T9UA 2RC7A 3HHFA 3MPKA 3KN3A 5H8FA 4P0IA 4G8MA 3T93B 4DXBA 3H3GA 3LSXA 3R7XA 3DELB 1OLCA 2QS2A 2ABHA 2NWJA 2H5YA 4NF6B 3FJGA 1B3FA 3G7WA 1Y3NA 4G68A 1OVBA 2F7AA 3RQTA 1LAHE 3Q26A 3C9HA 1NNPA 1MY3A 1D9YA 5TP9A 3TDJA 2DQVA 3A3UA 5JK4A 1MQJA 3UA8A 4H8JA 4DDDA 3O6HA 3DP4A 1PEBA 1Q1KA 4IO4A 4QHQA 1XHYA 1BKAA 1MXXA 2PT2A 3OO8A 2HAUA 4XXUA 3MVWA 3PPNA 4PFYA 3N5LA 2XXYA 1WDNA 3RT8A 1IXHA 1HSLA 4ZDMA 2UYEA 3MVZA 3MWBA 1GGGA 2A5SA 1JQFA 2OWTA 4RK2A 1UTHA 4LUBA 4NF8B 1YAEA 4NTLA 2QJEA 3ILTB 3K6XA 3UORA 1R9QA 3U92A 1AIVA 3I3VA 1PDAA 3ZKKA 3TUSA 1P99A 1A99A 4OHNA 1IQ7A 1Y9UA 1UTBB 2X7PA 3PPRA 3TCGA 3VVDA 2E1SA 2XXQA 4NMYA 1LBCA 3S9EA 2W7YA 5DTBA 4QF9A 3FXUA 4KQPA 4O3AA 5DEXB 1FQAA 2XXXA 1NNFA 1MDP1 3SEWA 4RK9A 2O51A 2UYFA 1URGA 4GLIA 5HBCA 4EQBA 4EDPA 2OBGA 1USYE 3PUWE 1S50A 4G68C 4H5GA 3S2VA 2YLNA 2BJJX 5DVJA 1L5TA 3AXFA 3BKIB 2QPQA 4YKPA 1N76A 3O97A 3S9LC 3S9MC 2ALUA 4QFOA 2XXWA 4LVQA 4KYSA 2QS3A 4NF6A 4ELPA 4GRKA 5CM6A 3HHGA 3VDFA 3USDA 4MLQA 3Q27A 3N6UA 4H65A 3E13X 2I48A 4IO5A 1NNKA 1IXGA 4OXVA 3F11A 4NWCA 4R6HA 4XKPA 1FQFA 1D4NA 1NL5A 1PC3A 4FE8A 2P0SA 3RTWB 2DE4A 3H4ZA 3HCQA 4NF4B 1FTLA 3T9HB 2H4IA 1VFDA 1B7HA 4JDFA 3WAEA 3MP8A 3TCHA 3FJMA 4I8CA 4FATA 2XD2A 3SDFA 3CSBA 2UVIA 3N94A 3TTLA 2F6PA 4JWYA 2ZNSA 1LBBA 3QK6A 5LOMA 3K02A 3RUMA 3IL1B 2ANJA 3TEPA 4NF8A 3TKDA 3RN8A 5A5XB 1TFDA 2CZLA 2R6GE 3KGCA 1FQDA 3RPWA 1MXWA 2HXWA 2UVHA 4EUOA 4PFTA 3KJTA 5JEIA 4U1OA 4LATA 4KI0E 3C31A 1UTBA 2O68A 3SEYA 1B7UA 3IK6B 1MQHA 1LFHA 1MS7A 5DT6A 3EPEA 4OFLA 3HO7A 1S7YA 2PBWA 4HW8A 5DEXA 5KDTB 3QAXA 2DOJA 3PPQA 2OZZA 4YAHX 2HAVA 3ILUB 3QUJA 3U1OA 4BDMA 3OO9A 4JSOA 4C1UA 4F39A 1USYH 1NH7A 3C35A 3PMXA 2V3TA 3ONMA 2V93A 1NFTA 3H6TA 3MP1A 4Z7EA 1IXIA 1TWYA 1EZ9A 1F9BA 2UXAA 3Q28A 4MH5A 3G3KA 2DVCA 1YCJA 1SW2A 5ELVA 1B2HA 4N07A 2FA7A 4R72A 1EZPA 3SEVA 1N84A 4IGRA 4Z0IA 3GBAA 1I6BA 5IAIA 3G3HA 4NF4A 3RTFB 2Y84A 4ZEBA 3KN8A 4N13A 5HPQA 5TP9B 1O64A 3EF7A 4LZ7A 4IY5A 3QIMA 4OZ9A 1SD3A 4OERA 3OEMA 1TXFA 1NNTA 5DYHA 3VXBA 4DCYA 3HN0A 3VLWA 1QKBA 3MVYA 1M5CA 3B6TA 3JZJA 2G93A 4GIZA 3O9PA 4U22A 4FORA 4WEPA 3TQLA 2O7UA 3ODBA 1B40A 3H06B 2ZNUA 1TT1A 3DLNA 1AL3A 1ELJA 4OTEA 5FHOA 5A5XA 4ND9A 4IY6A 4XKRA 1AMFA 1UIVA 3C4MA 4R9GA 2XHDA 1CE2A 4LQ5A 4UACA 1KWHA 4IO2A 3KJ7A 3QXMA 3MVXA 1RYXA 5M2VA 1N3WA 3PMWA 3FXRA 4GVOA 1ZLQA 2NOOA 4ZS9A 2R9JA 3TMGA 3IB2A 4RPNA 4U4SA 5KDTA 4I1DA 3L6HA 3FV2A 4L17A 3O6GA 1POTA 3MJNA 4H67A 3KFMA 2V3UA 3DP8A 1RYOA 2Z23A 2V3QA 5IKBA 1OMPA 1MXZA 2AIXA 4RYAA 4OETA 4X1BA 3LR1A 5TU0A 3LSWA 4F3SA 3E4RA 5EHSA 3TTKA 2F78A 3LSLA 3V5AA 1EZOA 1US5A 3IOVA 1MXUA 4Q5TA 1PBQA 3HSTA 1BP5A 4R2FA 1XVXA 3HPIA 3M3KA 4NWDA 4ZE8A 3CVGA 1O7TA 1JEUA 2V84A 1B7ZA 3H6UA 2B3BA 1JW4A 2XXHA 2IA4A 2I3VA 1UIUA 2XX7A 2DE3A 4YB7A 2NVUB 2VHAA 3JYRA 2QS4A 3KSXA 2RCBA 3H7MA 1PBPA 5KZTA 1H45A 2RC9A 5ITOA 4F22A 3MP6A 4KHZE 1QVSA 4HCYA 1H76A 5I58B 2XXRA 4FEDA 4FAJA 1SW5A 2Z22A 5CBRA 2GRVA 3G3GA 4PFWA 3PPOA 4ESWA 3I5OA 1GVCA 4DZ1A 4RNSA 3TZAA 1IUDA 4GXAA 4KFQA 1SQYA 3SERA 1B0HA 1B46A 4QFLA 4EF2A 2D21A 3C32A 1ZMGA 4QSEA 3B7DA 5DVIA 3RGYA 3U72A 2Q89A 4GFRA 2O84X 1HSEA 2X26A 3VLUA 3FGSA 4ECFA 4YMAA 4K3FA 4GXSB 2H9BA 4KYEA 5CMMA 3C34A 1FTKA 1MY4A 3OD7A 1SBPA 3JV9A 3H03A 4POXA 1MY2A 2DXYA 3LC8A 5FHNA 1MQIA 3T9XB 4C1TA 3IB1A 5FTIA 1FTOA 3L6GA 1MH4A 1IIWA 5AA2D 4LP2B 2FYIA 4DLDA 2ONRA 2R71A 3O2AA 2LAOA 2NXOA 1B32A 1JVYA 1N0TA 4H5FA 2XX9A 1B3GA 3FZVA 3C33A 4HS7A 2VOZA 1ZJLA 1Z7NE 4U2RA 1OQHA 2HZKA 3K2DA 3TPAA 5TPAB 3BBRA 1ATGA 2ZNTA 3CFLA 3K1PA 3K6VA 3FD3A 3FVNA 3RNNA 1DMBA 2D5WA 1MRPA 1EH3A 2DWAA 5F7VA 1SVXB 3VLVA 1MG1A 4X9TA 1MM6A 5AA3A 2AL5A 2KLFA 4OQOA 4ONYA 4YKIA 3Q25A 3IB0A 1B5JA 2QL3A 1Y3PA 5CI5A 4YICA 2XXTA 4QRZA 2AYSA 3MAMA 4KYDA 4R74A 3H6VA 5I58A 3VV5A 1B3LA 3G3FA 1P1OA 1SI1A 3FASA 4RJZA 2DE2A 3T9VA 4YMBA 4H6DA 4DXCA 4LZ5A 1XOCA 3C36A 4JXIA 5DVFA 2F34A 2FNCA 4F1YA 2OWSA 2I6EA 5CMKA 2Y7PA 4NF5B 1MY0A 4PFUA 4N6PA 3TTNA 3PD8A 4GQOA 5ICQA 4IO3A 3W9VA 3O28A 1FQEA 2OLBA 2QRYA 3TODA 3K1NA 5AA1A 4R75A 2I0BA 4PP0A 5L8DA 5AA2B 3ECRA 4F3BA 4F3PA 1IITA 5B7DA 1WVJA 3BFUA 4U23A 1NKXA 4Q8RA 3GZGA 5K2XA 1LAXA 1LSTA 2ONKE 3K0VA 2XXVA 4OVJA 4GOTA 3FATA 3LBSA 2H99A 1DSNA 4GL0A 4BDLA 3I6VA 2AL4A 1BLFA 3OO6A 4I62A 4YB5A 3KN7A 2YJPA 4TLMB 4E0WA 1YTVA 1FCKA 3K1MA 3QSLA 2ZYOA 1N7WA 2H25A 5I84A 2DS9A 4H8IA 3T22A 1M5BA 1AOVA 1JNFA 5L9MA 4LZ8A 4ZEDA 1MPBA 4OEVA 1B1HA 1JW1A 5TPAA 4BLAA 1P1NA 4BDRA 3M3LA 2XXIA 2HFBA 3FUZA 4IO7A 1T0KA 5I57B 4GF8A 1Z7ME 1SDXA 4DE8A 1MM7A 4EXLA 3TTRA 3K4UA 1MXVA 1JETA 3CSGA 1MDQA 1A40A 4ZZEA 1MPCA 1ZU0A 4ISUA 1D3KA 2HCAA 3PPPA 1FTMA 4DXUA 3G3JA 3PUYE 1URDA 1P1WA 2F5XA 4AB6A 3FXQA 3UIFA 4XIGQ 4GL8A 3W15C 4HCWA 2F7CA 4YB6A 4MFIA 2X7QA 5CMBA 4RA1A 1FQBA 4OWDA 3EHTA 4G2ZA 3FIRA 3KEIA 5H8NB 1B3EA 3EN3A 3PU5A 4DIGA 4FECA 4RPOA 3KBRA 2P2AA 1ZIUA 1MQGA 1LLSA 4OFOA 2VD2A 4OFJA 4NF5A 1D9VA 3BFTA 4XKQA 2ZYMA 1IEJA 3GXAA 3SKPA 4LONB 1Y1MA 3O6IA 3WAFA 2F97A 3MZ1A 5AA2A 3U8QA 4OEUA 2RINA 4OESA 2Z8EA 1HSJA 1QUJA 1NH8A 2UVJA 2QS1A 4FEBA 4R6KA 1LB8A 3Q29A 1P1QA 4BDQA 1Q35A 4U21A 3K6WA 4F3GA 1VE4A 1B58A 1A8FA 3B6WA 4QFPA 1VR5A 4ZECA 1H44A 3QUFA 4EXKA 2OK2A 4G8NA 2O6AA 4O3BA 2I49A 3PUXE 4JWOA 1ZTYA 3IORA 4AB5A 5I59A 2PT1A 5HM4B 1LCTA 4X1DA 3K6UA 1OIBA 1POY1 2Y7KA 3QYTA 4OENA 3D4CA 1LB9A 5I57A 4EF1A 4GWOA 1RKMA 2NUVA 2RC8A 5KCJB 2Y7IA 3G3IA 3VFJA 2H98A 4QSCA 1PB9A 1MY1A 4IGTA 4LA9A 1FW0A 2G29A 2I58A 1MH3A 1LGBC 3LSFB 4QFNA 5I2KB 5H8QB 4BDOA 1I6AA 3OOAA 3IOTA 4OMBA 4POWA 1QUIA 1N04A 2ZMBA 3HV1A 3M8UA 1M5DA 4F29A 4G4PA 3PMVA 3OEKA 4U1ZA 5H8NA 2M8CA 3OMBA 1VFEA 1IZ1A 3IX1A 2DSFA 3PGFA 4R2BA 1YPNA 5CRYA 2E0SA 5AA4A 3U93A 1QKAA 3UN6A 2F35A 1M5EA 3VE1B 4PETA 4ELQA 1GV8A 2ZYNA 1SYIA 2F36A 2DXRA 1QULA 5FHMA 4M1VA 3A3CA 3IO6A 2YPNA 3MQ9A 2P1SA 3CG3A 4NEDA 2ESNA 3GBBA 3RT6B 2DWHA 1B3HA 1B6HA 5I56B 3THIA 3H6WA 4GD5A 5AE4A 3CI8A 4PE5B 4NE4A 2I0CA 3VVEA 1B5IA 2Y7RA 4TLLB 3IAZA 4ZEIA 3RY3A 4G8HA 1URSA 3ZKLA 2XX8A 4P0GA 2RKMA 3FV1A 3KSJA 1XVYA 2Q88A 2ONSA 3KOSA 3LUYA 4YKJA 4IB2A 4YU0A 4F18A 4WXJA 2Q2AA 4IO6A 1B0LA 1US4A 4U4XA 2GHAA 3OENA 2OCUA 4KPTA 4OYVA 2REGA 2Q9TA 4ELRA 1Y1ZA 3UP9A 1R6ZA 4MF3A 5JTYB 3A09A 2QMWA 4RXLA 4ZEKA 4Q30B 2F8DA 2O69A 4F1VA 1DTZA 5BUUA 1H43A 3E9XA 3ZS6A 5KCJA 1OLAA 4UA8A 4X48A 1N7XA 2Z8DA 3R6UA 5H8HB 3S9NC 1B51A 1QUKA 2Y7WA 3IOUA 1ANFA 5ISUA 2F6GA 1N3XA 5I2KA 5H8QA 2GFEA 3MBPA 1O63A 1M5FA 3MUQA 5EYFA 1EU8A 5CMCA 3TQWA 4ZZAA 3PV0E 2F7BA 3OO7A 1B9JA 2A5TB 2CMOA 1OVTA 4JSDA 4JB7A 2PMSA 2RCAA 5EHMA 1IXCA 3OXNA 3V89B 3IO4A 4TQUQ 4EQ7A 3S4UA 4EQ9A 3TFLA 1JEVA 2VGQA 3SEUA 1NMUA 2D3IA 4BDNA 3OELA 3U94A 2DP8A 3M3FA 3V8XB 4KR5A 3EHSA 5I56A 3MC2A 3PD9A 2IEEA 1FQCA 2UVGA 4KCCA 3O29A 1MPDA 1Y4CA 2QSXA 1GR2A 1II5A 3P7IA 2V25A 3MW0A 3TYHA 3KZGA 1WODA 3CIJA 1DTGA 3RLFE 1ZBMA 4YKKA 1I6QA 3TCFA 3B6QA 3VVFA 1B52A 4F2QA 1GTKA 4WKMA 1B4HA 4XKNA 4YZZA 5FTHA 2O1MA 1FTJA 3ZSFA 2DWIA 2RF1A 1S9TA 2ZYKA 1A55A 2QMXA 4I9DA 1MXYA 1XC1A 5H8SA 4Q0CA 3T66A 5JTYA 3KG2A 1ZKBA 3IJXB 4E0XA 2Z8FA 2GHBA 4H0WA 3K01A 3PUVE 1R9LA 2VP1A 2PX1A 1CB6A 5I59B 3FJ7A 5H8HA 5F1QA 5I2NB 3CFZA 1DPEA 1XT8A 4ZEFA 2B3FA 1R1NA 4R9FA 5L9OA 1A8EA 3D4GA 2PVUA 3SETA 3K00A 4ZE9A 2ZXTA 1Y3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2REJ A;  1B5H A;  3CRB A;  3UK4 A;  3W9W A;  2A5T A;  4THI A;  5H8F B;  3R26 A;  3DM0 A;  4ESX A;  3CFX A;  4MBP A;  1XS5 A;  1A7L A;  1LAG E;  3FVG A;  2Q2C A;  1SW4 A;  4O3C A;  1B4Z A;  3CG1 A;  4JBZ A;  2THI A;  3CR9 A;  2HEU A;  4HTG A;  4RY1 A;  2WKY A;  1I69 A;  4G68 B;  2I4C A;  1A54 A;  3O66 A;  2XXP A;  5CBS A;  1JW5 A;  2I4B A;  1SI0 A;  3VXC A;  5AA4 B;  4AQ4 A;  3EQ1 A;  5K2Y A;  4JWX A;  3OSQ A;  2DVZ A;  3N26 A;  4R6Y A;  2GH9 A;  3E3K A;  1H3D A;  3FVO A;  1AH5 A;  1BIY A;  1OQG A;  4FJP A;  1LAF E;  2XD3 A;  5ITP A;  3MPL A;  1LFI A;  4KD5 A;  1BTJ A;  1Y20 A;  3IR1 A;  1DOT A;  1Y4T A;  3UGW A;  4H1X A;  4LQ2 A;  3TEL A;  3V83 A;  3EHU A;  3IOW A;  2O7I A;  4ELO A;  4PQJ A;  1SW1 A;  5CC2 A;  2O1L A;  4C0R A;  4R73 A;  4XTC Q;  4P11 A;  1PB7 A;  1DPP A;  4WED A;  1QW0 A;  1LCF A;  4F31 B;  3DP6 A;  1PB8 A;  4DCX A;  3KOT A;  3SEX A;  3T96 B;  2DWJ A;  3MZB A;  3TTM A;  2XXU A;  5BWJ A;  1UTH B;  2Q8J A;  3IJO B;  2OJT A;  3OSR A;  1B1X A;  4KCD A;  1UQW A;  5J1D A;  3MZ9 A;  3SES A;  4M4G A;  3GLB A;  2DYX A;  2HZL A;  4G77 A;  3FVK A;  1MQD A;  2PYY A;  1TFA A;  5I2N A;  4MLV A;  4F2O A;  5ICT A;  2I3W A;  1P1U A;  2VD3 A;  4F1U A;  3N6T A;  1SYH A;  1VSO A;  3TAJ A;  4QFK A;  2B65 A;  1J1N A;  4QSD A;  4TOZ A;  5L9S A;  4FIM A;  4F19 A;  1QJM A;  1B05 A;  1JVX A;  3PUZ E;  5B70 A;  2HQ0 A;  1LFG A;  3T9U A;  2RC7 A;  3HHF A;  3MPK A;  3KN3 A;  5H8F A;  4P0I A;  4G8M A;  3T93 B;  4DXB A;  3H3G A;  3LSX A;  3R7X A;  3DEL B;  1OLC A;  2QS2 A;  2ABH A;  2NWJ A;  2H5Y A;  4NF6 B;  3FJG A;  1B3F A;  3G7W A;  1Y3N A;  4G68 A;  1OVB A;  2F7A A;  3RQT A;  1LAH E;  3Q26 A;  3C9H A;  1NNP A;  1MY3 A;  1D9Y A;  5TP9 A;  3TDJ A;  2DQV A;  3A3U A;  5JK4 A;  1MQJ A;  3UA8 A;  4H8J A;  4DDD A;  3O6H A;  3DP4 A;  1PEB A;  1Q1K A;  4IO4 A;  4QHQ A;  1XHY A;  1BKA A;  1MXX A;  2PT2 A;  3OO8 A;  2HAU A;  4XXU A;  3MVW A;  3PPN A;  4PFY A;  3N5L A;  2XXY A;  1WDN A;  3RT8 A;  1IXH A;  1HSL A;  4ZDM A;  2UYE A;  3MVZ A;  3MWB A;  1GGG A;  2A5S A;  1JQF A;  2OWT A;  4RK2 A;  1UTH A;  4LUB A;  4NF8 B;  1YAE A;  4NTL A;  2QJE A;  3ILT B;  3K6X A;  3UOR A;  1R9Q A;  3U92 A;  1AIV A;  3I3V A;  1PDA A;  3ZKK A;  3TUS A;  1P99 A;  1A99 A;  4OHN A;  1IQ7 A;  1Y9U A;  1UTB B;  2X7P A;  3PPR A;  3TCG A;  3VVD A;  2E1S A;  2XXQ A;  4NMY A;  1LBC A;  3S9E A;  2W7Y A;  5DTB A;  4QF9 A;  3FXU A;  4KQP A;  4O3A A;  5DEX B;  1FQA A;  2XXX A;  1NNF A;  1MDP 1;  3SEW A;  4RK9 A;  2O51 A;  2UYF A;  1URG A;  4GLI A;  5HBC A;  4EQB A;  4EDP A;  2OBG A;  1USY E;  3PUW E;  1S50 A;  4G68 C;  4H5G A;  3S2V A;  2YLN A;  2BJJ X;  5DVJ A;  1L5T A;  3AXF A;  3BKI B;  2QPQ A;  4YKP A;  1N76 A;  3O97 A;  3S9L C;  3S9M C;  2ALU A;  4QFO A;  2XXW A;  4LVQ A;  4KYS A;  2QS3 A;  4NF6 A;  4ELP A;  4GRK A;  5CM6 A;  3HHG A;  3VDF A;  3USD A;  4MLQ A;  3Q27 A;  3N6U A;  4H65 A;  3E13 X;  2I48 A;  4IO5 A;  1NNK A;  1IXG A;  4OXV A;  3F11 A;  4NWC A;  4R6H A;  4XKP A;  1FQF A;  1D4N A;  1NL5 A;  1PC3 A;  4FE8 A;  2P0S A;  3RTW B;  2DE4 A;  3H4Z A;  3HCQ A;  4NF4 B;  1FTL A;  3T9H B;  2H4I A;  1VFD A;  1B7H A;  4JDF A;  3WAE A;  3MP8 A;  3TCH A;  3FJM A;  4I8C A;  4FAT A;  2XD2 A;  3SDF A;  3CSB A;  2UVI A;  3N94 A;  3TTL A;  2F6P A;  4JWY A;  2ZNS A;  1LBB A;  3QK6 A;  5LOM A;  3K02 A;  3RUM A;  3IL1 B;  2ANJ A;  3TEP A;  4NF8 A;  3TKD A;  3RN8 A;  5A5X B;  1TFD A;  2CZL A;  2R6G E;  3KGC A;  1FQD A;  3RPW A;  1MXW A;  2HXW A;  2UVH A;  4EUO A;  4PFT A;  3KJT A;  5JEI A;  4U1O A;  4LAT A;  4KI0 E;  3C31 A;  1UTB A;  2O68 A;  3SEY A;  1B7U A;  3IK6 B;  1MQH A;  1LFH A;  1MS7 A;  5DT6 A;  3EPE A;  4OFL A;  3HO7 A;  1S7Y A;  2PBW A;  4HW8 A;  5DEX A;  5KDT B;  3QAX A;  2DOJ A;  3PPQ A;  2OZZ A;  4YAH X;  2HAV A;  3ILU B;  3QUJ A;  3U1O A;  4BDM A;  3OO9 A;  4JSO A;  4C1U A;  4F39 A;  1USY H;  1NH7 A;  3C35 A;  3PMX A;  2V3T A;  3ONM A;  2V93 A;  1NFT A;  3H6T A;  3MP1 A;  4Z7E A;  1IXI A;  1TWY A;  1EZ9 A;  1F9B A;  2UXA A;  3Q28 A;  4MH5 A;  3G3K A;  2DVC A;  1YCJ A;  1SW2 A;  5ELV A;  1B2H A;  4N07 A;  2FA7 A;  4R72 A;  1EZP A;  3SEV A;  1N84 A;  4IGR A;  4Z0I A;  3GBA A;  1I6B A;  5IAI A;  3G3H A;  4NF4 A;  3RTF B;  2Y84 A;  4ZEB A;  3KN8 A;  4N13 A;  5HPQ A;  5TP9 B;  1O64 A;  3EF7 A;  4LZ7 A;  4IY5 A;  3QIM A;  4OZ9 A;  1SD3 A;  4OER A;  3OEM A;  1TXF A;  1NNT A;  5DYH A;  3VXB A;  4DCY A;  3HN0 A;  3VLW A;  1QKB A;  3MVY A;  1M5C A;  3B6T A;  3JZJ A;  2G93 A;  4GIZ A;  3O9P A;  4U22 A;  4FOR A;  4WEP A;  3TQL A;  2O7U A;  3ODB A;  1B40 A;  3H06 B;  2ZNU A;  1TT1 A;  3DLN A;  1AL3 A;  1ELJ A;  4OTE A;  5FHO A;  5A5X A;  4ND9 A;  4IY6 A;  4XKR A;  1AMF A;  1UIV A;  3C4M A;  4R9G A;  2XHD A;  1CE2 A;  4LQ5 A;  4UAC A;  1KWH A;  4IO2 A;  3KJ7 A;  3QXM A;  3MVX A;  1RYX A;  5M2V A;  1N3W A;  3PMW A;  3FXR A;  4GVO A;  1ZLQ A;  2NOO A;  4ZS9 A;  2R9J A;  3TMG A;  3IB2 A;  4RPN A;  4U4S A;  5KDT A;  4I1D A;  3L6H A;  3FV2 A;  4L17 A;  3O6G A;  1POT A;  3MJN A;  4H67 A;  3KFM A;  2V3U A;  3DP8 A;  1RYO A;  2Z23 A;  2V3Q A;  5IKB A;  1OMP A;  1MXZ A;  2AIX A;  4RYA A;  4OET A;  4X1B A;  3LR1 A;  5TU0 A;  3LSW A;  4F3S A;  3E4R A;  5EHS A;  3TTK A;  2F78 A;  3LSL A;  3V5A A;  1EZO A;  1US5 A;  3IOV A;  1MXU A;  4Q5T A;  1PBQ A;  3HST A;  1BP5 A;  4R2F A;  1XVX A;  3HPI A;  3M3K A;  4NWD A;  4ZE8 A;  3CVG A;  1O7T A;  1JEU A;  2V84 A;  1B7Z A;  3H6U A;  2B3B A;  1JW4 A;  2XXH A;  2IA4 A;  2I3V A;  1UIU A;  2XX7 A;  2DE3 A;  4YB7 A;  2NVU B;  2VHA A;  3JYR A;  2QS4 A;  3KSX A;  2RCB A;  3H7M A;  1PBP A;  5KZT A;  1H45 A;  2RC9 A;  5ITO A;  4F22 A;  3MP6 A;  4KHZ E;  1QVS A;  4HCY A;  1H76 A;  5I58 B;  2XXR A;  4FED A;  4FAJ A;  1SW5 A;  2Z22 A;  5CBR A;  2GRV A;  3G3G A;  4PFW A;  3PPO A;  4ESW A;  3I5O A;  1GVC A;  4DZ1 A;  4RNS A;  3TZA A;  1IUD A;  4GXA A;  4KFQ A;  1SQY A;  3SER A;  1B0H A;  1B46 A;  4QFL A;  4EF2 A;  2D21 A;  3C32 A;  1ZMG A;  4QSE A;  3B7D A;  5DVI A;  3RGY A;  3U72 A;  2Q89 A;  4GFR A;  2O84 X;  1HSE A;  2X26 A;  3VLU A;  3FGS A;  4ECF A;  4YMA A;  4K3F A;  4GXS B;  2H9B A;  4KYE A;  5CMM A;  3C34 A;  1FTK A;  1MY4 A;  3OD7 A;  1SBP A;  3JV9 A;  3H03 A;  4POX A;  1MY2 A;  2DXY A;  3LC8 A;  5FHN A;  1MQI A;  3T9X B;  4C1T A;  3IB1 A;  5FTI A;  1FTO A;  3L6G A;  1MH4 A;  1IIW A;  5AA2 D;  4LP2 B;  2FYI A;  4DLD A;  2ONR A;  2R71 A;  3O2A A;  2LAO A;  2NXO A;  1B32 A;  1JVY A;  1N0T A;  4H5F A;  2XX9 A;  1B3G A;  3FZV A;  3C33 A;  4HS7 A;  2VOZ A;  1ZJL A;  1Z7N E;  4U2R A;  1OQH A;  2HZK A;  3K2D A;  3TPA A;  5TPA B;  3BBR A;  1ATG A;  2ZNT A;  3CFL A;  3K1P A;  3K6V A;  3FD3 A;  3FVN A;  3RNN A;  1DMB A;  2D5W A;  1MRP A;  1EH3 A;  2DWA A;  5F7V A;  1SVX B;  3VLV A;  1MG1 A;  4X9T A;  1MM6 A;  5AA3 A;  2AL5 A;  2KLF A;  4OQO A;  4ONY A;  4YKI A;  3Q25 A;  3IB0 A;  1B5J A;  2QL3 A;  1Y3P A;  5CI5 A;  4YIC A;  2XXT A;  4QRZ A;  2AYS A;  3MAM A;  4KYD A;  4R74 A;  3H6V A;  5I58 A;  3VV5 A;  1B3L A;  3G3F A;  1P1O A;  1SI1 A;  3FAS A;  4RJZ A;  2DE2 A;  3T9V A;  4YMB A;  4H6D A;  4DXC A;  4LZ5 A;  1XOC A;  3C36 A;  4JXI A;  5DVF A;  2F34 A;  2FNC A;  4F1Y A;  2OWS A;  2I6E A;  5CMK A;  2Y7P A;  4NF5 B;  1MY0 A;  4PFU A;  4N6P A;  3TTN A;  3PD8 A;  4GQO A;  5ICQ A;  4IO3 A;  3W9V A;  3O28 A;  1FQE A;  2OLB A;  2QRY A;  3TOD A;  3K1N A;  5AA1 A;  4R75 A;  2I0B A;  4PP0 A;  5L8D A;  5AA2 B;  3ECR A;  4F3B A;  4F3P A;  1IIT A;  5B7D A;  1WVJ A;  3BFU A;  4U23 A;  1NKX A;  4Q8R A;  3GZG A;  5K2X A;  1LAX A;  1LST A;  2ONK E;  3K0V A;  2XXV A;  4OVJ A;  4GOT A;  3FAT A;  3LBS A;  2H99 A;  1DSN A;  4GL0 A;  4BDL A;  3I6V A;  2AL4 A;  1BLF A;  3OO6 A;  4I62 A;  4YB5 A;  3KN7 A;  2YJP A;  4TLM B;  4E0W A;  1YTV A;  1FCK A;  3K1M A;  3QSL A;  2ZYO A;  1N7W A;  2H25 A;  5I84 A;  2DS9 A;  4H8I A;  3T22 A;  1M5B A;  1AOV A;  1JNF A;  5L9M A;  4LZ8 A;  4ZED A;  1MPB A;  4OEV A;  1B1H A;  1JW1 A;  5TPA A;  4BLA A;  1P1N A;  4BDR A;  3M3L A;  2XXI A;  2HFB A;  3FUZ A;  4IO7 A;  1T0K A;  5I57 B;  4GF8 A;  1Z7M E;  1SDX A;  4DE8 A;  1MM7 A;  4EXL A;  3TTR A;  3K4U A;  1MXV A;  1JET A;  3CSG A;  1MDQ A;  1A40 A;  4ZZE A;  1MPC A;  1ZU0 A;  4ISU A;  1D3K A;  2HCA A;  3PPP A;  1FTM A;  4DXU A;  3G3J A;  3PUY E;  1URD A;  1P1W A;  2F5X A;  4AB6 A;  3FXQ A;  3UIF A;  4XIG Q;  4GL8 A;  3W15 C;  4HCW A;  2F7C A;  4YB6 A;  4MFI A;  2X7Q A;  5CMB A;  4RA1 A;  1FQB A;  4OWD A;  3EHT A;  4G2Z A;  3FIR A;  3KEI A;  5H8N B;  1B3E A;  3EN3 A;  3PU5 A;  4DIG A;  4FEC A;  4RPO A;  3KBR A;  2P2A A;  1ZIU A;  1MQG A;  1LLS A;  4OFO A;  2VD2 A;  4OFJ A;  4NF5 A;  1D9V A;  3BFT A;  4XKQ A;  2ZYM A;  1IEJ A;  3GXA A;  3SKP A;  4LON B;  1Y1M A;  3O6I A;  3WAF A;  2F97 A;  3MZ1 A;  5AA2 A;  3U8Q A;  4OEU A;  2RIN A;  4OES A;  2Z8E A;  1HSJ A;  1QUJ A;  1NH8 A;  2UVJ A;  2QS1 A;  4FEB A;  4R6K A;  1LB8 A;  3Q29 A;  1P1Q A;  4BDQ A;  1Q35 A;  4U21 A;  3K6W A;  4F3G A;  1VE4 A;  1B58 A;  1A8F A;  3B6W A;  4QFP A;  1VR5 A;  4ZEC A;  1H44 A;  3QUF A;  4EXK A;  2OK2 A;  4G8N A;  2O6A A;  4O3B A;  2I49 A;  3PUX E;  4JWO A;  1ZTY A;  3IOR A;  4AB5 A;  5I59 A;  2PT1 A;  5HM4 B;  1LCT A;  4X1D A;  3K6U A;  1OIB A;  1POY 1;  2Y7K A;  3QYT A;  4OEN A;  3D4C A;  1LB9 A;  5I57 A;  4EF1 A;  4GWO A;  1RKM A;  2NUV A;  2RC8 A;  5KCJ B;  2Y7I A;  3G3I A;  3VFJ A;  2H98 A;  4QSC A;  1PB9 A;  1MY1 A;  4IGT A;  4LA9 A;  1FW0 A;  2G29 A;  2I58 A;  1MH3 A;  1LGB C;  3LSF B;  4QFN A;  5I2K B;  5H8Q B;  4BDO A;  1I6A A;  3OOA A;  3IOT A;  4OMB A;  4POW A;  1QUI A;  1N04 A;  2ZMB A;  3HV1 A;  3M8U A;  1M5D A;  4F29 A;  4G4P A;  3PMV A;  3OEK A;  4U1Z A;  5H8N A;  2M8C A;  3OMB A;  1VFE A;  1IZ1 A;  3IX1 A;  2DSF A;  3PGF A;  4R2B A;  1YPN A;  5CRY A;  2E0S A;  5AA4 A;  3U93 A;  1QKA A;  3UN6 A;  2F35 A;  1M5E A;  3VE1 B;  4PET A;  4ELQ A;  1GV8 A;  2ZYN A;  1SYI A;  2F36 A;  2DXR A;  1QUL A;  5FHM A;  4M1V A;  3A3C A;  3IO6 A;  2YPN A;  3MQ9 A;  2P1S A;  3CG3 A;  4NED A;  2ESN A;  3GBB A;  3RT6 B;  2DWH A;  1B3H A;  1B6H A;  5I56 B;  3THI A;  3H6W A;  4GD5 A;  5AE4 A;  3CI8 A;  4PE5 B;  4NE4 A;  2I0C A;  3VVE A;  1B5I A;  2Y7R A;  4TLL B;  3IAZ A;  4ZEI A;  3RY3 A;  4G8H A;  1URS A;  3ZKL A;  2XX8 A;  4P0G A;  2RKM A;  3FV1 A;  3KSJ A;  1XVY A;  2Q88 A;  2ONS A;  3KOS A;  3LUY A;  4YKJ A;  4IB2 A;  4YU0 A;  4F18 A;  4WXJ A;  2Q2A A;  4IO6 A;  1B0L A;  1US4 A;  4U4X A;  2GHA A;  3OEN A;  2OCU A;  4KPT A;  4OYV A;  2REG A;  2Q9T A;  4ELR A;  1Y1Z A;  3UP9 A;  1R6Z A;  4MF3 A;  5JTY B;  3A09 A;  2QMW A;  4RXL A;  4ZEK A;  4Q30 B;  2F8D A;  2O69 A;  4F1V A;  1DTZ A;  5BUU A;  1H43 A;  3E9X A;  3ZS6 A;  5KCJ A;  1OLA A;  4UA8 A;  4X48 A;  1N7X A;  2Z8D A;  3R6U A;  5H8H B;  3S9N C;  1B51 A;  1QUK A;  2Y7W A;  3IOU A;  1ANF A;  5ISU A;  2F6G A;  1N3X A;  5I2K A;  5H8Q A;  2GFE A;  3MBP A;  1O63 A;  1M5F A;  3MUQ A;  5EYF A;  1EU8 A;  5CMC A;  3TQW A;  4ZZA A;  3PV0 E;  2F7B A;  3OO7 A;  1B9J A;  2A5T B;  2CMO A;  1OVT A;  4JSD A;  4JB7 A;  2PMS A;  2RCA A;  5EHM A;  1IXC A;  3OXN A;  3V89 B;  3IO4 A;  4TQU Q;  4EQ7 A;  3S4U A;  4EQ9 A;  3TFL A;  1JEV A;  2VGQ A;  3SEU A;  1NMU A;  2D3I A;  4BDN A;  3OEL A;  3U94 A;  2DP8 A;  3M3F A;  3V8X B;  4KR5 A;  3EHS A;  5I56 A;  3MC2 A;  3PD9 A;  2IEE A;  1FQC A;  2UVG A;  4KCC A;  3O29 A;  1MPD A;  1Y4C A;  2QSX A;  1GR2 A;  1II5 A;  3P7I A;  2V25 A;  3MW0 A;  3TYH A;  3KZG A;  1WOD A;  3CIJ A;  1DTG A;  3RLF E;  1ZBM A;  4YKK A;  1I6Q A;  3TCF A;  3B6Q A;  3VVF A;  1B52 A;  4F2Q A;  1GTK A;  4WKM A;  1B4H A;  4XKN A;  4YZZ A;  5FTH A;  2O1M A;  1FTJ A;  3ZSF A;  2DWI A;  2RF1 A;  1S9T A;  2ZYK A;  1A55 A;  2QMX A;  4I9D A;  1MXY A;  1XC1 A;  5H8S A;  4Q0C A;  3T66 A;  5JTY A;  3KG2 A;  1ZKB A;  3IJX B;  4E0X A;  2Z8F A;  2GHB A;  4H0W A;  3K01 A;  3PUV E;  1R9L A;  2VP1 A;  2PX1 A;  1CB6 A;  5I59 B;  3FJ7 A;  5H8H A;  5F1Q A;  5I2N B;  3CFZ A;  1DPE A;  1XT8 A;  4ZEF A;  2B3F A;  1R1N A;  4R9F A;  5L9O A;  1A8E A;  3D4G A;  2PVU A;  3SET A;  3K00 A;  4ZE9 A;  2ZXT A;  1Y3Q A; 
#chains in the Genus database with same CATH topology
 5LTC A;  2REJ A;  1B5H A;  3CRB A;  3UK4 A;  3W9W A;  2A5T A;  4THI A;  5H8F B;  3R26 A;  3DM0 A;  4ESX A;  4I3E A;  2CZI A;  3CFX A;  2P3V A;  4MBP A;  1XS5 A;  1A7L A;  1LAG E;  3FVG A;  2Q2C A;  1SW4 A;  4O3C A;  4GWX A;  1B4Z A;  3CG1 A;  4PE3 A;  4JBZ A;  2THI A;  3CR9 A;  2HEU A;  1FPF A;  4HTG A;  4MEV A;  4RY1 A;  2WKY A;  1I69 A;  4G68 B;  1FPI A;  2I4C A;  1NV1 A;  1A54 A;  3O66 A;  3RPL B;  2XXP A;  5CBS A;  1JW5 A;  2I4B A;  2WBD A;  1SI0 A;  3BIG A;  3VXC A;  4MNP A;  5AA4 B;  4AQ4 A;  3EQ1 A;  5K2Y A;  4JWX A;  3OSQ A;  2DVZ A;  3N26 A;  4R6Y A;  2GH9 A;  3E3K A;  1H3D A;  3FVO A;  1AH5 A;  1BIY A;  1OQG A;  4FJP A;  1LAF E;  2XD3 A;  5ITP A;  3MPL A;  1LFI A;  4KD5 A;  1BTJ A;  1Y20 A;  4P47 A;  3IR1 A;  1DOT A;  1Y4T A;  3UGW A;  4H1X A;  4LQ2 A;  3TEL A;  3V83 A;  3EHU A;  3IOW A;  2O7I A;  4ELO A;  4PQJ A;  1SW1 A;  5CC2 A;  2O1L A;  4C0R A;  1NV3 A;  4R73 A;  2V4C A;  4XTC Q;  4P11 A;  1PB7 A;  1DPP A;  4WED A;  1QW0 A;  1LCF A;  4P56 A;  4F31 B;  3DP6 A;  1PB8 A;  4DCX A;  2PFY A;  3KOT A;  3SEX A;  3T96 B;  1FRP A;  2DWJ A;  3MZB A;  5I5P A;  3TTM A;  2XXU A;  5BWJ A;  1NUW A;  4OVP A;  1UTH B;  2Q8J A;  3IJO B;  2B4L A;  2OJT A;  3OSR A;  1B1X A;  1FPG A;  4KCD A;  1IMD A;  1UQW A;  5J1D A;  4FBP A;  5IGA A;  5T3J A;  3MZ9 A;  3SES A;  2KR0 A;  4M4G A;  3GLB A;  2DYX A;  2HZL A;  4G77 A;  3FVK A;  1MQD A;  2PYY A;  1TFA A;  5I2N A;  4MLV A;  4F2O A;  5ICT A;  3FXB A;  2I3W A;  1P1U A;  2VD3 A;  4F1U A;  3N6T A;  1SYH A;  1VSO A;  3TAJ A;  4QFK A;  2B65 A;  1J1N A;  4QSD A;  4TOZ A;  2WYP A;  2CZH A;  4FIM A;  5L9S A;  4F19 A;  2QVR A;  1QJM A;  1B05 A;  3PTY A;  1JVX A;  3PUZ E;  5B70 A;  2HQ0 A;  1LFG A;  3T9U A;  2RC7 A;  3HHF A;  3MPK A;  4LN5 A;  3KN3 A;  5H8F A;  4P0I A;  3BIH A;  2XWO A;  4G8M A;  3T93 B;  4DXB A;  3H3G A;  3LSX A;  4NG7 A;  3R7X A;  3DEL B;  1OLC A;  2QS2 A;  2ABH A;  2NWJ A;  2H5Y A;  2DDK A;  4NF6 B;  4N81 A;  4MHF A;  3FJG A;  1AWB A;  2CZK A;  1B3F A;  3G7W A;  1Y3N A;  4G68 A;  4PDD A;  1OVB A;  1NV4 A;  3RPL A;  2F7A A;  4GWY A;  3RQT A;  1LAH E;  3Q26 A;  3C9H A;  1NNP A;  1MY3 A;  1D9Y A;  1INP A;  4PFI A;  5TP9 A;  3TDJ A;  2DQV A;  4H45 A;  1EYJ A;  3A3U A;  5JK4 A;  1MQJ A;  1FPK A;  3UA8 A;  4H8J A;  3MST A;  4DDD A;  3O6H A;  2WYK A;  3DP4 A;  1DCU A;  1PEB A;  1Q1K A;  4IO4 A;  4QHQ A;  1XHY A;  1BKA A;  1MXX A;  2PT2 A;  3OO8 A;  2HAU A;  4XXU A;  3MVW A;  3PPN A;  4PFY A;  3N5L A;  4PF6 A;  2XXY A;  1WDN A;  3RT8 A;  1IXH A;  1HSL A;  4ZDM A;  2UYE A;  3MVZ A;  3MWB A;  1GGG A;  2A5S A;  1JQF A;  5EYG A;  5ET5 A;  2OWT A;  4RK2 A;  2OX3 A;  1UTH A;  4LUB A;  4NF8 B;  1YAE A;  4NTL A;  2FBP A;  2QJE A;  2Q74 A;  3ILT B;  3K6X A;  1FBC A;  3UOR A;  1R9Q A;  3U92 A;  1AIV A;  3I3V A;  1PDA A;  3ZKK A;  3TUS A;  2OWZ A;  1P99 A;  1A99 A;  4OHN A;  1IQ7 A;  1FPB A;  2XWV A;  1Y9U A;  1UTB B;  4PBH A;  2X7P A;  4OA4 A;  3PPR A;  3TCG A;  3VVD A;  2E1S A;  2XXQ A;  1CNQ A;  4NMY A;  1LBC A;  3S9E A;  2W7Y A;  2XA5 A;  5DTB A;  4QF9 A;  3FXU A;  4KQP A;  4O3A A;  5DEX B;  1FQA A;  2XXX A;  1NNF A;  1MDP 1;  4JVC A;  4RK9 A;  3SEW A;  2O51 A;  2UYF A;  1URG A;  4GLI A;  5HBC A;  4EQB A;  4EDP A;  2OBG A;  3E79 A;  1USY E;  3PUW E;  1S50 A;  4G68 C;  4H5G A;  4NN3 A;  3S2V A;  2YLN A;  2BJJ X;  5DVJ A;  1JP4 A;  1L5T A;  2QVU A;  2B4M A;  3AXF A;  4I3Y A;  3BKI B;  2QPQ A;  4YKP A;  1N76 A;  5ESY A;  3O97 A;  1IMF A;  3S9L C;  3S9M C;  2ALU A;  4QFO A;  2XXW A;  4LVQ A;  4KYS A;  2QS3 A;  4NF6 A;  4ELP A;  4GRK A;  5CM6 A;  3HHG A;  3VDF A;  5FBP A;  3USD A;  1FSA A;  4MLQ A;  3Q27 A;  3N6U A;  4H65 A;  3E13 X;  5I7I A;  2I48 A;  4IO5 A;  1NNK A;  1IXG A;  4OXV A;  3F11 A;  4NWC A;  4R6H A;  4XKP A;  1FQF A;  1D4N A;  1NL5 A;  1PC3 A;  4FE8 A;  2P0S A;  3RTW B;  2DE4 A;  3H4Z A;  3HCQ A;  4NF4 B;  1FTL A;  3T9H B;  2H4I A;  1VFD A;  1B7H A;  4JDF A;  3WAE A;  3MP8 A;  3TCH A;  3FJM A;  4I8C A;  4O7I A;  4FAT A;  2XD2 A;  3SDF A;  3CSB A;  2UVI A;  3N94 A;  3TTL A;  1DBZ A;  2F6P A;  4JWY A;  2ZNS A;  1LBB A;  3QK6 A;  5LOM A;  3K02 A;  3RUM A;  3IL1 B;  2ANJ A;  4MNC A;  3TEP A;  4OVR A;  4NF8 A;  3TKD A;  3RN8 A;  5A5X B;  4P3L A;  1TFD A;  2CZL A;  2R6G E;  3KGC A;  1FQD A;  3RPW A;  1MXW A;  2HXW A;  2UVH A;  5IZ3 B;  4EUO A;  3GYY A;  4PFT A;  3KJT A;  5JEI A;  4HE2 A;  4N6D A;  4U1O A;  4LAT A;  4KI0 E;  3C31 A;  1UTB A;  2O68 A;  1K9Y A;  3SEY A;  1B7U A;  2XWI A;  3IK6 B;  3RYD A;  1MQH A;  1LFH A;  1MS7 A;  5DT6 A;  3EPE A;  4OFL A;  3HO7 A;  1S7Y A;  4GX6 A;  2PBW A;  4HW8 A;  1NV7 A;  5DEX A;  5KDT B;  3QAX A;  2DOJ A;  3T1B A;  3PPQ A;  2OZZ A;  4YAH X;  2HAV A;  2QFL A;  3ILU B;  3QUJ A;  1NV5 A;  3U1O A;  4BDM A;  3OO9 A;  4JSO A;  4C1U A;  4F39 A;  1USY H;  1LEV A;  2P3N A;  3D1R A;  1NH7 A;  3C35 A;  3PMX A;  2V3T A;  3ONM A;  2V93 A;  1NUY A;  1NFT A;  3H6T A;  3MP1 A;  4Z7E A;  1IXI A;  1TWY A;  4GBV A;  1NUZ A;  1EZ9 A;  3FBP A;  1F9B A;  1NV2 A;  2UXA A;  4PC9 A;  4N8Y A;  3Q28 A;  4MH5 A;  3G3K A;  2DVC A;  1YCJ A;  1SW2 A;  5ELV A;  1B2H A;  4N07 A;  2FA7 A;  4R72 A;  1EZP A;  3SEV A;  1N84 A;  4IGR A;  4AS4 A;  4Z0I A;  5EQ9 A;  3GBA A;  4P1E A;  1I6B A;  5IAI A;  3G3H A;  4NF4 A;  3RTF B;  2Y84 A;  4ZEB A;  3KN8 A;  4N13 A;  5HPQ A;  5TP9 B;  1O64 A;  3EF7 A;  4LZ7 A;  4IY5 A;  3QIM A;  4OVQ A;  4JVI A;  4OZ9 A;  1SD3 A;  4OER A;  3OEM A;  1TXF A;  4PGN A;  1NNT A;  2PCR A;  5DYH A;  3VXB A;  4DCY A;  3HN0 A;  3VLW A;  1QKB A;  3MVY A;  1M5C A;  3B6T A;  3JZJ A;  2G93 A;  4GIZ A;  3O9P A;  4NAP A;  4FOR A;  4U22 A;  4WEP A;  3TQL A;  2O7U A;  3ODB A;  1B40 A;  3H06 B;  2ZNU A;  1TT1 A;  3DLN A;  1AL3 A;  1ELJ A;  4OTE A;  5FHO A;  5A5X A;  4ND9 A;  2WBB A;  4IY6 A;  4XKR A;  1AMF A;  5EQ7 A;  5IZ3 A;  1UIV A;  5F24 A;  3C4M A;  4NX1 A;  4R9G A;  2F3B A;  2XHD A;  1CE2 A;  4LQ5 A;  4UAC A;  1KWH A;  4IO2 A;  3KJ7 A;  3QXM A;  3MVX A;  1RYX A;  5M2V A;  1N3W A;  4I40 A;  3PMW A;  3FXR A;  4GVO A;  1FTA A;  1ZLQ A;  2NOO A;  4ZS9 A;  2R9J A;  3TMG A;  4P1L A;  3IB2 A;  4RPN A;  4U4S A;  5KDT A;  4I1D A;  3L6H A;  2FIE A;  3FV2 A;  4L17 A;  3O6G A;  1POT A;  3MJN A;  4H67 A;  3KFM A;  3LV0 A;  2V3U A;  3DP8 A;  1BK4 A;  1RYO A;  2Z23 A;  2V3Q A;  5IKB A;  1OMP A;  1MXZ A;  2AIX A;  4RYA A;  4OET A;  4X1B A;  3LR1 A;  5TU0 A;  3LSW A;  2WEF A;  4F3S A;  3E4R A;  5EHS A;  3TTK A;  2F78 A;  3LSL A;  3V5A A;  1EZO A;  1US5 A;  3IOV A;  4N17 A;  1MXU A;  4N4U A;  4PBQ A;  4Q5T A;  1PBQ A;  3HST A;  1BP5 A;  4R2F A;  3NOH A;  1XVX A;  3HPI A;  2QVV A;  3M3K A;  4NWD A;  4ZE8 A;  3CVG A;  1O7T A;  1JEU A;  1IMA A;  2V84 A;  2XWK A;  3KBZ A;  1B7Z A;  3H6U A;  2B3B A;  1RDZ A;  4X8R A;  1JW4 A;  2XXH A;  2IA4 A;  1VDW A;  2I3V A;  1UIU A;  2XX7 A;  2DE3 A;  4YB7 A;  2NVU B;  2VHA A;  3JYR A;  2QS4 A;  3KSX A;  2RCB A;  3H7M A;  1PBP A;  1IMB A;  5KZT A;  3KC0 A;  1H45 A;  2RC9 A;  5ITO A;  4F22 A;  3MP6 A;  2FVZ A;  4KHZ E;  1QVS A;  4HCY A;  1H76 A;  1IMC A;  1NV0 A;  5I58 B;  1IME A;  2XXR A;  1LBV A;  4FED A;  4FAJ A;  3B8B A;  1SW5 A;  2Z22 A;  5CBR A;  2GRV A;  3G3G A;  4PFW A;  3PPO A;  4ESW A;  3I5O A;  2GQ1 A;  1GVC A;  1FBP A;  5EYH A;  4DZ1 A;  4RNS A;  1FJ6 A;  1IUD A;  4GXA A;  3TZA A;  4KFQ A;  1SQY A;  4NF0 A;  3SER A;  1B0H A;  1B46 A;  4QFL A;  4O94 A;  3CHG A;  4EF2 A;  2D21 A;  3C32 A;  1FPE A;  2VT5 A;  1ZMG A;  4QSE A;  3B7D A;  3E78 A;  5DVI A;  3RGY A;  3U72 A;  4MCO A;  2Q89 A;  3LUZ A;  4GFR A;  1YXI A;  1KZ8 A;  2O84 X;  1HSE A;  2R8T A;  2X26 A;  1DK4 A;  3VLU A;  3FGS A;  4ECF A;  4YMA A;  4K3F A;  4GXS B;  2H9B A;  4KYE A;  5CMM A;  3C34 A;  1FTK A;  1MY4 A;  3OD7 A;  1SBP A;  3JV9 A;  3H03 A;  4POX A;  1MY2 A;  2DXY A;  3LC8 A;  5FHN A;  1MQI A;  3T9X B;  4C1T A;  5EQ8 A;  4N91 A;  3IB1 A;  5FTI A;  1FTO A;  4GWZ A;  3L6G A;  1MH4 A;  1IIW A;  4XFE A;  5AA2 D;  4LP2 B;  2FYI A;  4DLD A;  5DW8 A;  2ONR A;  4DI3 D;  1FBD A;  2R71 A;  3O2A A;  2LAO A;  2NXO A;  1B32 A;  4GX4 A;  1JVY A;  1N0T A;  4H5F A;  1EYI A;  2XX9 A;  1B3G A;  3FZV A;  4UAB A;  3C33 A;  4HS7 A;  2VOZ A;  1ZJL A;  1Z7N E;  4U2R A;  1OQH A;  2HZK A;  3K2D A;  3TPA A;  2Q8M A;  5TPA B;  3BBR A;  1ATG A;  2ZNT A;  2Y5L A;  3EKI A;  3CFL A;  3K1P A;  3K6V A;  3FD3 A;  3FVN A;  3RNN A;  1DMB A;  2D5W A;  1MRP A;  1EH3 A;  3T0J A;  1RDX A;  2DWA A;  5F7V A;  1SVX B;  3VLV A;  1MG1 A;  4MNI A;  4X9T A;  1MM6 A;  1SPI A;  5AA3 A;  2AL5 A;  2KLF A;  4OQO A;  4ONY A;  4YKI A;  3Q25 A;  3IB0 A;  1B5J A;  2QL3 A;  2PFZ A;  1Y3P A;  5CI5 A;  4YIC A;  2XXT A;  4QRZ A;  2AYS A;  4PFR A;  1NUX A;  3HFU A;  3MAM A;  4KYD A;  4R74 A;  3H6V A;  5I58 A;  3VV5 A;  1B3L A;  3G3F A;  1P1O A;  1SI1 A;  3FAS A;  4RJZ A;  2DE2 A;  3T9V A;  4YMB A;  4H6D A;  4DXC A;  4LZ5 A;  1XOC A;  2XXK A;  3C36 A;  4JXI A;  5DVF A;  2F34 A;  2FNC A;  4F1Y A;  2OWS A;  2I6E A;  5CMK A;  2Y7P A;  4NF5 B;  4N6K A;  4XF5 A;  1MY0 A;  4PFU A;  4N6P A;  3TTN A;  3PD8 A;  4GQO A;  5ICQ A;  4IO3 A;  3W9V A;  3O28 A;  1FQE A;  5LDZ A;  4G61 A;  2OLB A;  2QRY A;  3TOD A;  3K1N A;  4PDH A;  5AA1 A;  4R75 A;  2I0B A;  4PP0 A;  5L8D A;  5AA2 B;  3ECR A;  4F3B A;  4F3P A;  1IIT A;  5B7D A;  1WVJ A;  3BFU A;  4U23 A;  1QGX A;  1NKX A;  2FIX A;  4Q8R A;  4QXD A;  3GZG A;  5K2X A;  1LAX A;  1LST A;  2ONK E;  3K0V A;  2XXV A;  4OVJ A;  4GOT A;  3FAT A;  3LBS A;  2H99 A;  1DSN A;  4GL0 A;  4BDL A;  3I6V A;  4NQ8 A;  2AL4 A;  1BLF A;  3OO6 A;  4I62 A;  4PTK A;  1K9Z A;  2ZZX A;  4YB5 A;  3KN7 A;  2YJP A;  4PGP A;  4TLM B;  4E0W A;  1YTV A;  4HE0 A;  1FCK A;  3K1M A;  3QSL A;  2ZYO A;  1N7W A;  4XEQ A;  2H25 A;  1NV6 A;  2VPN A;  5I84 A;  2DS9 A;  4H8I A;  3T22 A;  1M5B A;  1AOV A;  4NHB A;  1JNF A;  5L9M A;  4LZ8 A;  4ZED A;  1MPB A;  4OEV A;  1B1H A;  1JW1 A;  5TPA A;  4BLA A;  1P1N A;  3A29 A;  4BDR A;  3M3L A;  2XXI A;  1G0I A;  2HFB A;  3FUZ A;  4IO7 A;  1T0K A;  1LBZ A;  5I57 B;  4GF8 A;  1Z7M E;  1SDX A;  4DE8 A;  4AS5 A;  1MM7 A;  4EXL A;  3TTR A;  1D9Q A;  3K4U A;  1MXV A;  4OVT A;  1JET A;  4O8M A;  4N15 A;  3CSG A;  1MDQ A;  1A40 A;  2HPG A;  4ZZE A;  1MPC A;  1XI6 A;  1ZU0 A;  4ISU A;  1D3K A;  2HCA A;  2KQZ A;  3PPP A;  1FTM A;  4DXU A;  3G3J A;  3PUY E;  1URD A;  1P1W A;  2F5X A;  4AB6 A;  3FXQ A;  3UIF A;  4XIG Q;  4GL8 A;  3W15 C;  4HCW A;  2F7C A;  4P9K A;  1FPJ A;  4YB6 A;  4MFI A;  2X7Q A;  5CMB A;  2FHY A;  4RA1 A;  1FQB A;  4OWD A;  3EHT A;  4G2Z A;  3FIR A;  3KEI A;  1FPL A;  5H8N B;  1B3E A;  3EN3 A;  3PU5 A;  1LBW A;  4DIG A;  4FEC A;  4RPO A;  3KBR A;  2P2A A;  4QBA A;  1ZIU A;  2HHM A;  1MQG A;  1LLS A;  4OFO A;  2VD2 A;  4OFJ A;  4NF5 A;  1D9V A;  4PF8 A;  2Y5K A;  3BFT A;  4XKQ A;  2ZYM A;  1IEJ A;  3GXA A;  3SKP A;  4LON B;  4H46 A;  1Y1M A;  3O6I A;  4OVS A;  3WAF A;  2F97 A;  3MZ1 A;  3QMF A;  5AA2 A;  3U8Q A;  4OEU A;  2RIN A;  4OES A;  2Z8E A;  1HSJ A;  1QUJ A;  1NH8 A;  2UVJ A;  2QS1 A;  4FEB A;  1KA0 A;  4JVD A;  4R6K A;  1LB8 A;  3Q29 A;  1P1Q A;  4BDQ A;  1Q35 A;  4U21 A;  3K6W A;  4F3G A;  2F3D A;  1VE4 A;  1B58 A;  1A8F A;  3B6W A;  4QFP A;  1VR5 A;  4ZEC A;  1H44 A;  4MX6 A;  3QUF A;  4EXK A;  2OK2 A;  4G8N A;  4PAF A;  2O6A A;  3B50 A;  4O3B A;  2I49 A;  3PUX E;  4JWO A;  1ZTY A;  4HE1 A;  4KXP A;  3IOR A;  4AB5 A;  5I59 A;  2PT1 A;  5HM4 B;  1LCT A;  4X1D A;  3K6U A;  1OIB A;  1POY 1;  2Y7K A;  1EYK A;  4GWS A;  3QYT A;  2VPO A;  4OEN A;  3D4C A;  1LB9 A;  5I57 A;  4EF1 A;  4GWO A;  1RKM A;  2NUV A;  2RC8 A;  5KCJ B;  2Y7I A;  3G3I A;  5IZZ A;  3VFJ A;  2MKZ A;  2H98 A;  4QSC A;  1PB9 A;  1MY1 A;  4LA9 A;  4IGT A;  1FW0 A;  3MYU A;  4N8G A;  2HXR A;  2G29 A;  2I58 A;  1MH3 A;  1LGB C;  3LSF B;  4QFN A;  5I2K B;  5H8Q B;  4BDO A;  1I6A A;  3OOA A;  4MJO A;  3IOT A;  4P8B A;  4OMB A;  4POW A;  1QUI A;  1N04 A;  2ZMB A;  3HV1 A;  3M8U A;  1M5D A;  3ROJ A;  4F29 A;  4G4P A;  3PMV A;  3OEK A;  4U1Z A;  5H8N A;  2M8C A;  3OMB A;  1VFE A;  1IZ1 A;  3IX1 A;  2DSF A;  5IZ1 A;  5I3S A;  5J16 A;  3PGF A;  4R2B A;  1YPN A;  5CRY A;  2E0S A;  4NGU A;  5ET6 A;  5AA4 A;  3U93 A;  1QKA A;  3UN6 A;  2F35 A;  1M5E A;  3VE1 B;  4PET A;  4ELQ A;  1GV8 A;  2ZYN A;  1SYI A;  2F36 A;  2DXR A;  1QUL A;  5FHM A;  4M1V A;  3A3C A;  3IO6 A;  2YPN A;  3MQ9 A;  2P1S A;  4PAI A;  3CG3 A;  4NED A;  2ESN A;  2ZZV A;  3GBB A;  3RT6 B;  2DWH A;  1B3H A;  1B6H A;  5I56 B;  5EQA A;  4O7M A;  3THI A;  3U65 A;  3H6W A;  4GD5 A;  5AE4 A;  3CI8 A;  4PE5 B;  4NE4 A;  2I0C A;  3VVE A;  1B5I A;  2Y7R A;  4TLL B;  3ISP A;  3IAZ A;  4ZEI A;  3RY3 A;  4G8H A;  4GX3 A;  1URS A;  3ZKL A;  2XX8 A;  4P0G A;  2RKM A;  3FV1 A;  3KSJ A;  1XVY A;  2Q88 A;  2ONS A;  3KOS A;  3LUY A;  4YKJ A;  4IB2 A;  4YU0 A;  4F18 A;  4WXJ A;  2Q2A A;  4IO6 A;  1FPD A;  1B0L A;  1US4 A;  4U4X A;  2GHA A;  3OEN A;  2OCU A;  4KPT A;  4OYV A;  2REG A;  2Q9T A;  4ELR A;  1Y1Z A;  3UP9 A;  1R6Z A;  2BJI A;  4MF3 A;  4PAK A;  5JTY B;  3A09 A;  2QMW A;  1FBG A;  4RXL A;  4HXV A;  4ZEK A;  4Q30 B;  2F8D A;  2O69 A;  4F1V A;  1DTZ A;  5BUU A;  1H43 A;  3E9X A;  1YZ0 A;  1NI9 A;  3ZS6 A;  5KCJ A;  1OLA A;  4UA8 A;  2JJK A;  4X48 A;  1N7X A;  2Z8D A;  3R6U A;  5H8H B;  3S9N C;  3SZP A;  1B51 A;  1QUK A;  2Y7W A;  3IOU A;  1ANF A;  4DI4 B;  5ISU A;  2F6G A;  1N3X A;  4GWU A;  5I2K A;  5H8Q A;  5IM2 A;  2GFE A;  3MBP A;  4MMP A;  1O63 A;  1M5F A;  3MUQ A;  5EYF A;  1EU8 A;  5CMC A;  3TQW A;  4ZZA A;  3PV0 E;  2F7B A;  3OO7 A;  1B9J A;  4MIJ A;  2A5T B;  2CMO A;  1OVT A;  4JSD A;  3IFC A;  4JB7 A;  2PMS A;  2RCA A;  5EHM A;  1IXC A;  2WX9 A;  4MAG A;  4X04 A;  1KA1 A;  3OXN A;  3V89 B;  3IO4 A;  4TQU Q;  4EQ7 A;  3S4U A;  4EQ9 A;  3TFL A;  1JEV A;  2VGQ A;  3SEU A;  1NMU A;  2D3I A;  4BDN A;  2CEX A;  3OEL A;  3U94 A;  2DP8 A;  3M3F A;  3V8X B;  4KR5 A;  3EHS A;  5I56 A;  3MC2 A;  3PD9 A;  1LBY A;  2IEE A;  1FQC A;  5A5L A;  2UVG A;  2ZZW A;  4KCC A;  5ET8 A;  3O29 A;  1MPD A;  1Y4C A;  2QSX A;  1GR2 A;  1II5 A;  3P7I A;  2V25 A;  3MW0 A;  3TYH A;  3KZG A;  1WOD A;  3CIJ A;  1DTG A;  3RLF E;  4GWW A;  1ZBM A;  4YKK A;  1I6Q A;  3TCF A;  3B6Q A;  3VVF A;  1B52 A;  4F2Q A;  4OAN A;  1GTK A;  4PFB A;  4PCD A;  4WKM A;  1B4H A;  1G0H A;  4XKN A;  4YZZ A;  3KC1 A;  1FBF A;  4IR8 A;  5FTH A;  2O1M A;  1FTJ A;  3ZSF A;  2DWI A;  1RDY A;  2RF1 A;  1S9T A;  2ZYK A;  1A55 A;  2QMX A;  4I9D A;  1MXY A;  1XC1 A;  5H8S A;  1YYZ A;  4Q0C A;  3T66 A;  5JTY A;  3KG2 A;  1ZKB A;  4GBW A;  3IJX B;  1FBH A;  3IFA A;  4E0X A;  2Z8F A;  2GHB A;  4H0W A;  3K01 A;  2L5V A;  3PUV E;  1FBE A;  1R9L A;  2VP1 A;  2PX1 A;  1CB6 A;  5I59 B;  3FJ7 A;  2CEY A;  5H8H A;  5F1Q A;  5ET7 A;  5I2N B;  3CFZ A;  1DPE A;  1FJ9 A;  1LBX A;  1XT8 A;  4ZEF A;  2B3F A;  1R1N A;  4R9F A;  5L9O A;  1A8E A;  3D4G A;  2PVU A;  3SET A;  3K00 A;  1Q9D A;  4ZE9 A;  2ZXT A;  1Y3Q A; 
#chains in the Genus database with same CATH homology
 2REJ A;  1B5H A;  3CRB A;  3UK4 A;  3W9W A;  2A5T A;  4THI A;  5H8F B;  3R26 A;  3DM0 A;  4ESX A;  3CFX A;  4MBP A;  1XS5 A;  1A7L A;  1LAG E;  3FVG A;  2Q2C A;  1SW4 A;  4O3C A;  1B4Z A;  3CG1 A;  4JBZ A;  2THI A;  3CR9 A;  2HEU A;  4HTG A;  4RY1 A;  2WKY A;  1I69 A;  4G68 B;  2I4C A;  1A54 A;  3O66 A;  2XXP A;  5CBS A;  1JW5 A;  2I4B A;  1SI0 A;  3VXC A;  5AA4 B;  4AQ4 A;  3EQ1 A;  5K2Y A;  4JWX A;  3OSQ A;  2DVZ A;  3N26 A;  4R6Y A;  2GH9 A;  3E3K A;  1H3D A;  3FVO A;  1AH5 A;  1BIY A;  1OQG A;  4FJP A;  1LAF E;  2XD3 A;  5ITP A;  3MPL A;  1LFI A;  4KD5 A;  1BTJ A;  1Y20 A;  3IR1 A;  1DOT A;  1Y4T A;  3UGW A;  4H1X A;  4LQ2 A;  3TEL A;  3V83 A;  3EHU A;  3IOW A;  2O7I A;  4ELO A;  4PQJ A;  1SW1 A;  5CC2 A;  2O1L A;  4C0R A;  4R73 A;  4XTC Q;  4P11 A;  1PB7 A;  1DPP A;  4WED A;  1QW0 A;  1LCF A;  4F31 B;  3DP6 A;  1PB8 A;  4DCX A;  3KOT A;  3SEX A;  3T96 B;  2DWJ A;  3MZB A;  3TTM A;  2XXU A;  5BWJ A;  1UTH B;  2Q8J A;  3IJO B;  2OJT A;  3OSR A;  1B1X A;  4KCD A;  1UQW A;  5J1D A;  3MZ9 A;  3SES A;  4M4G A;  3GLB A;  2DYX A;  2HZL A;  4G77 A;  3FVK A;  1MQD A;  2PYY A;  1TFA A;  5I2N A;  4MLV A;  4F2O A;  5ICT A;  2I3W A;  1P1U A;  2VD3 A;  4F1U A;  3N6T A;  1SYH A;  1VSO A;  3TAJ A;  4QFK A;  2B65 A;  1J1N A;  4QSD A;  4TOZ A;  5L9S A;  4FIM A;  4F19 A;  1QJM A;  1B05 A;  1JVX A;  3PUZ E;  5B70 A;  2HQ0 A;  1LFG A;  3T9U A;  2RC7 A;  3HHF A;  3MPK A;  3KN3 A;  5H8F A;  4P0I A;  4G8M A;  3T93 B;  4DXB A;  3H3G A;  3LSX A;  3R7X A;  3DEL B;  1OLC A;  2QS2 A;  2ABH A;  2NWJ A;  2H5Y A;  4NF6 B;  3FJG A;  1B3F A;  3G7W A;  1Y3N A;  4G68 A;  1OVB A;  2F7A A;  3RQT A;  1LAH E;  3Q26 A;  3C9H A;  1NNP A;  1MY3 A;  1D9Y A;  5TP9 A;  3TDJ A;  2DQV A;  3A3U A;  5JK4 A;  1MQJ A;  3UA8 A;  4H8J A;  4DDD A;  3O6H A;  3DP4 A;  1PEB A;  1Q1K A;  4IO4 A;  4QHQ A;  1XHY A;  1BKA A;  1MXX A;  2PT2 A;  3OO8 A;  2HAU A;  4XXU A;  3MVW A;  3PPN A;  4PFY A;  3N5L A;  2XXY A;  1WDN A;  3RT8 A;  1IXH A;  1HSL A;  4ZDM A;  2UYE A;  3MVZ A;  3MWB A;  1GGG A;  2A5S A;  1JQF A;  2OWT A;  4RK2 A;  1UTH A;  4LUB A;  4NF8 B;  1YAE A;  4NTL A;  2QJE A;  3ILT B;  3K6X A;  3UOR A;  1R9Q A;  3U92 A;  1AIV A;  3I3V A;  1PDA A;  3ZKK A;  3TUS A;  1P99 A;  1A99 A;  4OHN A;  1IQ7 A;  1Y9U A;  1UTB B;  2X7P A;  3PPR A;  3TCG A;  3VVD A;  2E1S A;  2XXQ A;  4NMY A;  1LBC A;  3S9E A;  2W7Y A;  5DTB A;  4QF9 A;  3FXU A;  4KQP A;  4O3A A;  5DEX B;  1FQA A;  2XXX A;  1NNF A;  1MDP 1;  3SEW A;  4RK9 A;  2O51 A;  2UYF A;  1URG A;  4GLI A;  5HBC A;  4EQB A;  4EDP A;  2OBG A;  1USY E;  3PUW E;  1S50 A;  4G68 C;  4H5G A;  3S2V A;  2YLN A;  2BJJ X;  5DVJ A;  1L5T A;  3AXF A;  3BKI B;  2QPQ A;  4YKP A;  1N76 A;  3O97 A;  3S9L C;  3S9M C;  2ALU A;  4QFO A;  2XXW A;  4LVQ A;  4KYS A;  2QS3 A;  4NF6 A;  4ELP A;  4GRK A;  5CM6 A;  3HHG A;  3VDF A;  3USD A;  4MLQ A;  3Q27 A;  3N6U A;  4H65 A;  3E13 X;  2I48 A;  4IO5 A;  1NNK A;  1IXG A;  4OXV A;  3F11 A;  4NWC A;  4R6H A;  4XKP A;  1FQF A;  1D4N A;  1NL5 A;  1PC3 A;  4FE8 A;  2P0S A;  3RTW B;  2DE4 A;  3H4Z A;  3HCQ A;  4NF4 B;  1FTL A;  3T9H B;  2H4I A;  1VFD A;  1B7H A;  4JDF A;  3WAE A;  3MP8 A;  3TCH A;  3FJM A;  4I8C A;  4FAT A;  2XD2 A;  3SDF A;  3CSB A;  2UVI A;  3N94 A;  3TTL A;  2F6P A;  4JWY A;  2ZNS A;  1LBB A;  3QK6 A;  5LOM A;  3K02 A;  3RUM A;  3IL1 B;  2ANJ A;  3TEP A;  4NF8 A;  3TKD A;  3RN8 A;  5A5X B;  1TFD A;  2CZL A;  2R6G E;  3KGC A;  1FQD A;  3RPW A;  1MXW A;  2HXW A;  2UVH A;  4EUO A;  4PFT A;  3KJT A;  5JEI A;  4U1O A;  4LAT A;  4KI0 E;  3C31 A;  1UTB A;  2O68 A;  3SEY A;  1B7U A;  3IK6 B;  1MQH A;  1LFH A;  1MS7 A;  5DT6 A;  3EPE A;  4OFL A;  3HO7 A;  1S7Y A;  2PBW A;  4HW8 A;  5DEX A;  5KDT B;  3QAX A;  2DOJ A;  3PPQ A;  2OZZ A;  4YAH X;  2HAV A;  3ILU B;  3QUJ A;  3U1O A;  4BDM A;  3OO9 A;  4JSO A;  4C1U A;  4F39 A;  1USY H;  1NH7 A;  3C35 A;  3PMX A;  2V3T A;  3ONM A;  2V93 A;  1NFT A;  3H6T A;  3MP1 A;  4Z7E A;  1IXI A;  1TWY A;  1EZ9 A;  1F9B A;  2UXA A;  3Q28 A;  4MH5 A;  3G3K A;  2DVC A;  1YCJ A;  1SW2 A;  5ELV A;  1B2H A;  4N07 A;  2FA7 A;  4R72 A;  1EZP A;  3SEV A;  1N84 A;  4IGR A;  4Z0I A;  3GBA A;  1I6B A;  5IAI A;  3G3H A;  4NF4 A;  3RTF B;  2Y84 A;  4ZEB A;  3KN8 A;  4N13 A;  5HPQ A;  5TP9 B;  1O64 A;  3EF7 A;  4LZ7 A;  4IY5 A;  3QIM A;  4OZ9 A;  1SD3 A;  4OER A;  3OEM A;  1TXF A;  1NNT A;  5DYH A;  3VXB A;  4DCY A;  3HN0 A;  3VLW A;  1QKB A;  3MVY A;  1M5C A;  3B6T A;  3JZJ A;  2G93 A;  4GIZ A;  3O9P A;  4U22 A;  4FOR A;  4WEP A;  3TQL A;  2O7U A;  3ODB A;  1B40 A;  3H06 B;  2ZNU A;  1TT1 A;  3DLN A;  1AL3 A;  1ELJ A;  4OTE A;  5FHO A;  5A5X A;  4ND9 A;  4IY6 A;  4XKR A;  1AMF A;  1UIV A;  3C4M A;  4R9G A;  2XHD A;  1CE2 A;  4LQ5 A;  4UAC A;  1KWH A;  4IO2 A;  3KJ7 A;  3QXM A;  3MVX A;  1RYX A;  5M2V A;  1N3W A;  3PMW A;  3FXR A;  4GVO A;  1ZLQ A;  2NOO A;  4ZS9 A;  2R9J A;  3TMG A;  3IB2 A;  4RPN A;  4U4S A;  5KDT A;  4I1D A;  3L6H A;  3FV2 A;  4L17 A;  3O6G A;  1POT A;  3MJN A;  4H67 A;  3KFM A;  2V3U A;  3DP8 A;  1RYO A;  2Z23 A;  2V3Q A;  5IKB A;  1OMP A;  1MXZ A;  2AIX A;  4RYA A;  4OET A;  4X1B A;  3LR1 A;  5TU0 A;  3LSW A;  4F3S A;  3E4R A;  5EHS A;  3TTK A;  2F78 A;  3LSL A;  3V5A A;  1EZO A;  1US5 A;  3IOV A;  1MXU A;  4Q5T A;  1PBQ A;  3HST A;  1BP5 A;  4R2F A;  1XVX A;  3HPI A;  3M3K A;  4NWD A;  4ZE8 A;  3CVG A;  1O7T A;  1JEU A;  2V84 A;  1B7Z A;  3H6U A;  2B3B A;  1JW4 A;  2XXH A;  2IA4 A;  2I3V A;  1UIU A;  2XX7 A;  2DE3 A;  4YB7 A;  2NVU B;  2VHA A;  3JYR A;  2QS4 A;  3KSX A;  2RCB A;  3H7M A;  1PBP A;  5KZT A;  1H45 A;  2RC9 A;  5ITO A;  4F22 A;  3MP6 A;  4KHZ E;  1QVS A;  4HCY A;  1H76 A;  5I58 B;  2XXR A;  4FED A;  4FAJ A;  1SW5 A;  2Z22 A;  5CBR A;  2GRV A;  3G3G A;  4PFW A;  3PPO A;  4ESW A;  3I5O A;  1GVC A;  4DZ1 A;  4RNS A;  3TZA A;  1IUD A;  4GXA A;  4KFQ A;  1SQY A;  3SER A;  1B0H A;  1B46 A;  4QFL A;  4EF2 A;  2D21 A;  3C32 A;  1ZMG A;  4QSE A;  3B7D A;  5DVI A;  3RGY A;  3U72 A;  2Q89 A;  4GFR A;  2O84 X;  1HSE A;  2X26 A;  3VLU A;  3FGS A;  4ECF A;  4YMA A;  4K3F A;  4GXS B;  2H9B A;  4KYE A;  5CMM A;  3C34 A;  1FTK A;  1MY4 A;  3OD7 A;  1SBP A;  3JV9 A;  3H03 A;  4POX A;  1MY2 A;  2DXY A;  3LC8 A;  5FHN A;  1MQI A;  3T9X B;  4C1T A;  3IB1 A;  5FTI A;  1FTO A;  3L6G A;  1MH4 A;  1IIW A;  5AA2 D;  4LP2 B;  2FYI A;  4DLD A;  2ONR A;  2R71 A;  3O2A A;  2LAO A;  2NXO A;  1B32 A;  1JVY A;  1N0T A;  4H5F A;  2XX9 A;  1B3G A;  3FZV A;  3C33 A;  4HS7 A;  2VOZ A;  1ZJL A;  1Z7N E;  4U2R A;  1OQH A;  2HZK A;  3K2D A;  3TPA A;  5TPA B;  3BBR A;  1ATG A;  2ZNT A;  3CFL A;  3K1P A;  3K6V A;  3FD3 A;  3FVN A;  3RNN A;  1DMB A;  2D5W A;  1MRP A;  1EH3 A;  2DWA A;  5F7V A;  1SVX B;  3VLV A;  1MG1 A;  4X9T A;  1MM6 A;  5AA3 A;  2AL5 A;  2KLF A;  4OQO A;  4ONY A;  4YKI A;  3Q25 A;  3IB0 A;  1B5J A;  2QL3 A;  1Y3P A;  5CI5 A;  4YIC A;  2XXT A;  4QRZ A;  2AYS A;  3MAM A;  4KYD A;  4R74 A;  3H6V A;  5I58 A;  3VV5 A;  1B3L A;  3G3F A;  1P1O A;  1SI1 A;  3FAS A;  4RJZ A;  2DE2 A;  3T9V A;  4YMB A;  4H6D A;  4DXC A;  4LZ5 A;  1XOC A;  3C36 A;  4JXI A;  5DVF A;  2F34 A;  2FNC A;  4F1Y A;  2OWS A;  2I6E A;  5CMK A;  2Y7P A;  4NF5 B;  1MY0 A;  4PFU A;  4N6P A;  3TTN A;  3PD8 A;  4GQO A;  5ICQ A;  4IO3 A;  3W9V A;  3O28 A;  1FQE A;  2OLB A;  2QRY A;  3TOD A;  3K1N A;  5AA1 A;  4R75 A;  2I0B A;  4PP0 A;  5L8D A;  5AA2 B;  3ECR A;  4F3B A;  4F3P A;  1IIT A;  5B7D A;  1WVJ A;  3BFU A;  4U23 A;  1NKX A;  4Q8R A;  3GZG A;  5K2X A;  1LAX A;  1LST A;  2ONK E;  3K0V A;  2XXV A;  4OVJ A;  4GOT A;  3FAT A;  3LBS A;  2H99 A;  1DSN A;  4GL0 A;  4BDL A;  3I6V A;  2AL4 A;  1BLF A;  3OO6 A;  4I62 A;  4YB5 A;  3KN7 A;  2YJP A;  4TLM B;  4E0W A;  1YTV A;  1FCK A;  3K1M A;  3QSL A;  2ZYO A;  1N7W A;  2H25 A;  5I84 A;  2DS9 A;  4H8I A;  3T22 A;  1M5B A;  1AOV A;  1JNF A;  5L9M A;  4LZ8 A;  4ZED A;  1MPB A;  4OEV A;  1B1H A;  1JW1 A;  5TPA A;  4BLA A;  1P1N A;  4BDR A;  3M3L A;  2XXI A;  2HFB A;  3FUZ A;  4IO7 A;  1T0K A;  5I57 B;  4GF8 A;  1Z7M E;  1SDX A;  4DE8 A;  1MM7 A;  4EXL A;  3TTR A;  3K4U A;  1MXV A;  1JET A;  3CSG A;  1MDQ A;  1A40 A;  4ZZE A;  1MPC A;  1ZU0 A;  4ISU A;  1D3K A;  2HCA A;  3PPP A;  1FTM A;  4DXU A;  3G3J A;  3PUY E;  1URD A;  1P1W A;  2F5X A;  4AB6 A;  3FXQ A;  3UIF A;  4XIG Q;  4GL8 A;  3W15 C;  4HCW A;  2F7C A;  4YB6 A;  4MFI A;  2X7Q A;  5CMB A;  4RA1 A;  1FQB A;  4OWD A;  3EHT A;  4G2Z A;  3FIR A;  3KEI A;  5H8N B;  1B3E A;  3EN3 A;  3PU5 A;  4DIG A;  4FEC A;  4RPO A;  3KBR A;  2P2A A;  1ZIU A;  1MQG A;  1LLS A;  4OFO A;  2VD2 A;  4OFJ A;  4NF5 A;  1D9V A;  3BFT A;  4XKQ A;  2ZYM A;  1IEJ A;  3GXA A;  3SKP A;  4LON B;  1Y1M A;  3O6I A;  3WAF A;  2F97 A;  3MZ1 A;  5AA2 A;  3U8Q A;  4OEU A;  2RIN A;  4OES A;  2Z8E A;  1HSJ A;  1QUJ A;  1NH8 A;  2UVJ A;  2QS1 A;  4FEB A;  4R6K A;  1LB8 A;  3Q29 A;  1P1Q A;  4BDQ A;  1Q35 A;  4U21 A;  3K6W A;  4F3G A;  1VE4 A;  1B58 A;  1A8F A;  3B6W A;  4QFP A;  1VR5 A;  4ZEC A;  1H44 A;  3QUF A;  4EXK A;  2OK2 A;  4G8N A;  2O6A A;  4O3B A;  2I49 A;  3PUX E;  4JWO A;  1ZTY A;  3IOR A;  4AB5 A;  5I59 A;  2PT1 A;  5HM4 B;  1LCT A;  4X1D A;  3K6U A;  1OIB A;  1POY 1;  2Y7K A;  3QYT A;  4OEN A;  3D4C A;  1LB9 A;  5I57 A;  4EF1 A;  4GWO A;  1RKM A;  2NUV A;  2RC8 A;  5KCJ B;  2Y7I A;  3G3I A;  3VFJ A;  2H98 A;  4QSC A;  1PB9 A;  1MY1 A;  4IGT A;  4LA9 A;  1FW0 A;  2G29 A;  2I58 A;  1MH3 A;  1LGB C;  3LSF B;  4QFN A;  5I2K B;  5H8Q B;  4BDO A;  1I6A A;  3OOA A;  3IOT A;  4OMB A;  4POW A;  1QUI A;  1N04 A;  2ZMB A;  3HV1 A;  3M8U A;  1M5D A;  4F29 A;  4G4P A;  3PMV A;  3OEK A;  4U1Z A;  5H8N A;  2M8C A;  3OMB A;  1VFE A;  1IZ1 A;  3IX1 A;  2DSF A;  3PGF A;  4R2B A;  1YPN A;  5CRY A;  2E0S A;  5AA4 A;  3U93 A;  1QKA A;  3UN6 A;  2F35 A;  1M5E A;  3VE1 B;  4PET A;  4ELQ A;  1GV8 A;  2ZYN A;  1SYI A;  2F36 A;  2DXR A;  1QUL A;  5FHM A;  4M1V A;  3A3C A;  3IO6 A;  2YPN A;  3MQ9 A;  2P1S A;  3CG3 A;  4NED A;  2ESN A;  3GBB A;  3RT6 B;  2DWH A;  1B3H A;  1B6H A;  5I56 B;  3THI A;  3H6W A;  4GD5 A;  5AE4 A;  3CI8 A;  4PE5 B;  4NE4 A;  2I0C A;  3VVE A;  1B5I A;  2Y7R A;  4TLL B;  3IAZ A;  4ZEI A;  3RY3 A;  4G8H A;  1URS A;  3ZKL A;  2XX8 A;  4P0G A;  2RKM A;  3FV1 A;  3KSJ A;  1XVY A;  2Q88 A;  2ONS A;  3KOS A;  3LUY A;  4YKJ A;  4IB2 A;  4YU0 A;  4F18 A;  4WXJ A;  2Q2A A;  4IO6 A;  1B0L A;  1US4 A;  4U4X A;  2GHA A;  3OEN A;  2OCU A;  4KPT A;  4OYV A;  2REG A;  2Q9T A;  4ELR A;  1Y1Z A;  3UP9 A;  1R6Z A;  4MF3 A;  5JTY B;  3A09 A;  2QMW A;  4RXL A;  4ZEK A;  4Q30 B;  2F8D A;  2O69 A;  4F1V A;  1DTZ A;  5BUU A;  1H43 A;  3E9X A;  3ZS6 A;  5KCJ A;  1OLA A;  4UA8 A;  4X48 A;  1N7X A;  2Z8D A;  3R6U A;  5H8H B;  3S9N C;  1B51 A;  1QUK A;  2Y7W A;  3IOU A;  1ANF A;  5ISU A;  2F6G A;  1N3X A;  5I2K A;  5H8Q A;  2GFE A;  3MBP A;  1O63 A;  1M5F A;  3MUQ A;  5EYF A;  1EU8 A;  5CMC A;  3TQW A;  4ZZA A;  3PV0 E;  2F7B A;  3OO7 A;  1B9J A;  2A5T B;  2CMO A;  1OVT A;  4JSD A;  4JB7 A;  2PMS A;  2RCA A;  5EHM A;  1IXC A;  3OXN A;  3V89 B;  3IO4 A;  4TQU Q;  4EQ7 A;  3S4U A;  4EQ9 A;  3TFL A;  1JEV A;  2VGQ A;  3SEU A;  1NMU A;  2D3I A;  4BDN A;  3OEL A;  3U94 A;  2DP8 A;  3M3F A;  3V8X B;  4KR5 A;  3EHS A;  5I56 A;  3MC2 A;  3PD9 A;  2IEE A;  1FQC A;  2UVG A;  4KCC A;  3O29 A;  1MPD A;  1Y4C A;  2QSX A;  1GR2 A;  1II5 A;  3P7I A;  2V25 A;  3MW0 A;  3TYH A;  3KZG A;  1WOD A;  3CIJ A;  1DTG A;  3RLF E;  1ZBM A;  4YKK A;  1I6Q A;  3TCF A;  3B6Q A;  3VVF A;  1B52 A;  4F2Q A;  1GTK A;  4WKM A;  1B4H A;  4XKN A;  4YZZ A;  5FTH A;  2O1M A;  1FTJ A;  3ZSF A;  2DWI A;  2RF1 A;  1S9T A;  2ZYK A;  1A55 A;  2QMX A;  4I9D A;  1MXY A;  1XC1 A;  5H8S A;  4Q0C A;  3T66 A;  5JTY A;  3KG2 A;  1ZKB A;  3IJX B;  4E0X A;  2Z8F A;  2GHB A;  4H0W A;  3K01 A;  3PUV E;  1R9L A;  2VP1 A;  2PX1 A;  1CB6 A;  5I59 B;  3FJ7 A;  5H8H A;  5F1Q A;  5I2N B;  3CFZ A;  1DPE A;  1XT8 A;  4ZEF A;  2B3F A;  1R1N A;  4R9F A;  5L9O A;  1A8E A;  3D4G A;  2PVU A;  3SET A;  3K00 A;  4ZE9 A;  2ZXT A;  1Y3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...