3FJ7A

Crystal structure of l-phospholactate bound peb3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
231
structure length
231
Chain Sequence
DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity of Campylobacter jejuni adhesin PEB3 for phosphates and structural differences among its ligand complexes.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Protein binding
molecule keywords Major antigenic peptide PEB3
total genus 85
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fj7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fj7A02
2QSXA 1LCTA 2ONSA 1FQCA 3PMXA 4U4SA 4JXIA 1B3GA 4YB5A 3PUYE 1FTLA 4C1TA 4ZZAA 3VLUA 2H5YA 1H45A 3LBSA 4KR5A 4NWDA 4MH5A 1WDNA 2O68A 4G4PA 2P2AA 3C34A 1H76A 4QF9A 1MH4A 1SBPA 4TQUQ 3AXFA 1MS7A 1A7LA 4MF3A 2NXOA 3QK6A 5DEXB 3GLBA 1LB9A 5CBSA 5I56B 2F97A 3TUSA 3E4RA 5ICTA 3MP1A 3K01A 1UIUA 3DELB 4WEDA 3FXRA 3KN7A 4H5FA 4NE4A 3IOWA 3ODBA 3ZKLA 4EUOA 3SERA 3TZAA 1QUKA 1MPBA 3MUQA 2HXWA 1AOVA 2P1SA 3B6WA 1B46A 2O7IA 1IXCA 4FECA 3TCFA 3Q25A 5LOMA 2NVUB 4OERA 4Q8RA 1LFHA 1B1XA 1P1QA 3CSBA 1A40A 4NF4B 1N3WA 2M8CA 3CFZA 1EU8A 3KEIA 5L9SA 3N26A 4PFYA 3VXCA 5KCJB 3U8QA 2XXXA 1XOCA 3OSRA 5FHNA 3PPOA 4IO3A 1FTKA 1URDA 3E13X 4KFQA 1Y3NA 5K2XA 1XC1A 1IEJA 2I48A 3T66A 2QS2A 3VXBA 4DCYA 5L9MA 3RLFE 5CM6A 5K2YA 4KCDA 5CMBA 1UTBB 3BBRA 1UTHA 3G7WA 1DSNA 1MXVA 3LSXA 2Q9TA 3TQWA 3USDA 3Q28A 4QRZA 1JW5A 1Y4TA 3KSXA 2PMSA 4QFNA 2QRYA 3TDJA 1ZBMA 4F18A 2O7UA 2PBWA 2LAOA 4R9FA 3K02A 1LBBA 1MQJA 4HCYA 3PMWA 2B3BA 1Q35A 2I3VA 3OO9A 1QUJA 2RCBA 2ALUA 1YPNA 2ZMBA 3EQ1A 3OMBA 3TFLA 2VP1A 4XKQA 3CI8A 4Z0IA 3VDFA 4M4GA 3ZS6A 2IEEA 4EXLA 1GTKA 1FW0A 2DE3A 3FD3A 3I6VA 5DTBA 2NOOA 2Z22A 3LR1A 1MXYA 5IKBA 5ISUA 4DLDA 4R9GA 1B3FA 1UTHB 1M5CA 2UVGA 4BDQA 5ICQA 2HEUA 3KJTA 2ZNTA 2H4IA 3HSTA 3OXNA 3EHUA 4KYEA 3MP8A 5H8HA 3R7XA 3UN6A 2XXVA 4O3CA 2ABHA 3B6QA 4IB2A 1M5FA 1JEVA 1EZ9A 4N07A 3PUZE 4R72A 1UQWA 2X7PA 4XIGQ 3RUMA 5CI5A 3S2VA 1ZJLA 1EZOA 1JVXA 4MLVA 1Y3QA 1RYXA 2Y7KA 1HSEA 2PT1A 3WAEA 2Y7WA 1Z7NE 1IIWA 4K3FA 4U4XA 2XXQA 1H43A 4C0RA 4YU0A 4RY1A 3FVOA 1B4ZA 4ND9A 3TKDA 1MQHA 3KOTA 3QYTA 4GXSB 4KQPA 4P0GA 1IXIA 2VD2A 3PPRA 4U2RA 4EDPA 1B40A 3MZ9A 4BDOA 3OELA 3ILTB 1TXFA 4G8HA 2A5SA 4NEDA 3U72A 1NNFA 3KBRA 4R2BA 4MFIA 4RYAA 3I5OA 2Z8FA 1P1NA 1JETA 4G68B 4N6PA 5EHSA 1B0HA 3K4UA 4ZZEA 2F7AA 3TODA 1I6AA 3CG1A 4L17A 3K6VA 4WEPA 1MQDA 4R6HA 3FXUA 4YKPA 5AA4A 1DMBA 3OO6A 3N5LA 1FCKA 1N84A 2F7CA 4GLIA 4O3BA 2AL5A 1A8FA 2XXRA 3PU5A 3S4UA 3SETA 3SEYA 3TPAA 3UK4A 1MY2A 4G68A 4G77A 1B7HA 4OYVA 3IOUA 2DSFA 2XXHA 4KPTA 2H99A 2GHBA 4Z7EA 5I84A 1R9LA 1IZ1A 1B5HA 1JEUA 1JQFA 1RKMA 2DWIA 5I58A 3H7MA 3OEKA 1TFDA 1VFDA 5B70A 3T96B 3KN3A 3Q26A 2OJTA 3IJOB 4RK2A 4TLMB 2GFEA 2Y84A 3TTNA 1LBCA 3ILUB 5HM4B 2RINA 2GRVA 4G8NA 1SQYA 3RQTA 2UYEA 3K1PA 3VFJA 1PB8A 1POTA 3DP6A 2OBGA 3FXQA 4PE5B 4IGTA 3WAFA 3S9MC 2F8DA 3K6UA 2Q2AA 1MY1A 3O66A 3PGFA 2XD2A 2DWHA 5DYHA 5EYFA 5JTYA 3K0VA 1D9YA 3MVYA 3N6UA 1ATGA 2V3QA 2DVCA 2ZNSA 2O1LA 1NNPA 1P1UA 2R6GE 2F35A 5H8HB 1B6HA 1ZU0A 3JV9A 4XKRA 4X9TA 5HPQA 3IJXB 3OENA 4FJPA 4ZS9A 4DZ1A 3TCHA 5CC2A 3M8UA 1Z7ME 1MDP1 1UIVA 2PX1A 2DXYA 3MWBA 3IB2A 2Z8EA 3IOTA 1B3EA 4R73A 4ELQA 2DP8A 1BKAA 3OSQA 3UIFA 3CG3A 3KOSA 4O3AA 4F31B 3RTWB 1ZIUA 2DE2A 3K2DA 1QVSA 3F11A 2CZLA 2E1SA 2X26A 3IR1A 4PFWA 3V83A 1US5A 3FZVA 1PEBA 1B9JA 4IO2A 2OWSA 4POXA 2E0SA 1VE4A 3FASA 3O2AA 1BTJA 2VGQA 4LA9A 3SDFA 2I6EA 3PD8A 1B3HA 3H6TA 3S9LC 2H98A 1B7ZA 4NMYA 4YB6A 2GHAA 2I4CA 3V5AA 4PFTA 3SKPA 1S7YA 2RC9A 4YAHX 4HTGA 4GF8A 2O84X 4E0XA 2F6PA 3FVNA 2XXTA 3HPIA 4FORA 1URSA 3UP9A 4F2QA 4ZE9A 3VE1B 1M5BA 4F22A 2HZKA 3KJ7A 3CRBA 3CSGA 4GD5A 3T9HB 1Y3PA 3DP4A 3OOAA 4LZ5A 1H44A 4P11A 5FTHA 1B51A 3TMGA 4MBPA 1GVCA 5I2NA 3TEPA 1B52A 3MP6A 4F1YA 1AMFA 3RGYA 4FEBA 4NF4A 4UACA 3UGWA 3TTKA 4F19A 3H06B 2I0CA 4LVQA 1FTOA 2RC7A 4X1DA 1Y20A 1MY4A 2A5TA 3M3LA 2DE4A 3QUJA 4AB5A 3T9XB 4OEVA 3HN0A 5FHOA 1SW2A 3KFMA 2NUVA 3TCGA 2UYFA 3BKIB 1ZMGA 1Y4CA 2QL3A 3FJGA 1ZLQA 4NTLA 1MY3A 4ESXA 2VOZA 3PPPA 1MXUA 1URGA 3RPWA 2AYSA 3H6VA 1P99A 3RTFB 5I58B 5H8FB 3G3GA 1ANFA 5B7DA 3O6IA 4XKPA 1XHYA 2P0SA 4LONB 2Y7RA 4PQJA 5TPAB 2B65A 4R2FA 1OIBA 1LAFE 1OVBA 3PMVA 4X1BA 3U94A 2XXWA 1JNFA 5KDTA 3IX1A 3LC8A 4Q30B 4YKJA 1LAXA 4I1DA 2HQ0A 3IO4A 2I49A 2VHAA 3ONMA 1GR2A 3FGSA 4MLQA 3SESA 5KDTB 3PUVE 1LB8A 4ZEKA 4U22A 1SYHA 1Q1KA 3LSLA 4FE8A 4F29A 1XVXA 1SD3A 1TWYA 2Q8JA 1JW4A 4BDLA 3KSJA 3FATA 5KCJA 3BFUA 3MBPA 4ZE8A 3SEUA 3FJ7A 5CRYA 3U92A 2ONRA 3CVGA 2IA4A 1IQ7A 2UVIA 3RY3A 3E9XA 4NF6A 2QJEA 4XKNA 4IGRA 1FQFA 4KD5A 4ZEDA 3MVZA 5FTIA 3V8XB 1A55A 5TP9A 3PV0E 4OETA 2A5TB 1LLSA 1O7TA 2OK2A 4HCWA 4YZZA 3TYHA 4OTEA 1B3LA 2I4BA 3O6GA 4ZEFA 4QFKA 1GV8A 1TT1A 5JK4A 4H65A 2DOJA 3EN3A 4BDRA 4E0WA 1N7XA 3L6GA 3H03A 4YICA 1AIVA 1LAGE 4EF1A 4KCCA 3C9HA 1B1HA 4JSDA 1PDAA 1RYOA 2REJA 4JWYA 3VVEA 4DXUA 3ZSFA 4GIZA 3RN8A 1XT8A 5I56A 5I2KB 2O6AA 3TELA 1B58A 1USYH 4I9DA 5FHMA 3VLVA 1QJMA 2QPQA 2B3FA 4GXAA 4NF5A 2R9JA 4H5GA 4WKMA 1YTVA 1YCJA 3THIA 2PYYA 3G3HA 4JWOA 5I2KA 3D4GA 1MXZA 3H6WA 4F3BA 1T0KA 3W9WA 4PETA 1M5EA 1M5DA 3P7IA 4NF5B 3L6HA 4M1VA 1LGBC 2XHDA 3MPKA 4LP2B 4N13A 4GWOA 1SDXA 1SW4A 4QHQA 4GRKA 1MG1A 4RXLA 5H8QB 4F1UA 1AL3A 3MZ1A 2QMWA 5H8NB 3N6TA 5TPAA 1QKAA 2YJPA 2UVHA 3C33A 4R6KA 5DT6A 3C31A 2NWJA 4FAJA 2HAVA 1LFIA 2V3UA 3T9UA 5BUUA 4ELOA 3JZJA 4G2ZA 4BLAA 5A5XB 2HFBA 4U1ZA 4KHZE 5TP9B 3CFLA 2XX8A 4YKKA 3IL1B 5AA2B 2F7BA 3S9NC 1MY0A 2H25A 4AQ4A 4WXJA 1JVYA 1II5A 4Q5TA 1XS5A 1FQAA 4YKIA 4ZEBA 1L5TA 5DVJA 5L8DA 4AB6A 4R75A 4RPOA 2F36A 4OZ9A 4EQ9A 2QS1A 1LAHE 5AA2A 1DOTA 1YAEA 4ZEIA 3UA8A 1NH8A 4TLLB 3TAJA 5DVIA 3RT8A 3CR9A 3T93B 3LSFB 5H8FA 2BJJX 3W15C 2Q2CA 4QSDA 1B2HA 2Q89A 3JYRA 4FEDA 4DE8A 1PC3A 4F39A 5ELVA 1H3DA 5KZTA 2V84A 1MRPA 4OFOA 2XXUA 2QS4A 2VD3A 4KYSA 1HSJA 4U23A 4ONYA 3KZGA 1LCFA 4JB7A 3K6WA 3U93A 5L9OA 4G8MA 2YPNA 2YLNA 1A54A 1KWHA 1IXGA 2HCAA 2HAUA 3A3CA 2F5XA 4JWXA 4IO5A 3DM0A 5H8QA 3RNNA 3G3JA 4ISUA 4OESA 3VVFA 3SEVA 3FUZA 4EF2A 2XXIA 3Q29A 1MH3A 1P1WA 3HV1A 4F3SA 2V25A 3W9VA 3O28A 3O29A 2OCUA 4DXCA 2HZLA 2D3IA 4EQ7A 1EH3A 2V3TA 2ZYMA 3QXMA 3PD9A 4GVOA 4JSOA 3HO7A 2QS3A 3Q27A 3QSLA 4QFOA 1B5IA 5I57B 2DXRA 4C1UA 5J1DA 3N94A 4XXUA 4ZECA 2D21A 5HBCA 1B7UA 5I2NB 4XTCQ 3GBBA 3DP8A 1LFGA 2O69A 3D4CA 3TTLA 5I59B 5IAIA 1D4NA 5CBRA 5JEIA 1OMPA 3QIMA 1DPPA 1MPCA 3PPQA 4RJZA 4RNSA 4ELPA 1MM6A 4OHNA 2XX7A 3I3VA 4Q0CA 4H6DA 5H8NA 4OFJA 2WKYA 3QUFA 4OVJA 4BDMA 2Y7IA 2OZZA 5A5XA 3FVGA 1MXXA 3KGCA 5ITOA 3FV1A 1VFEA 1N7WA 3C32A 4TOZA 3HHGA 3C4MA 2XXPA 3MQ9A 3T22A 4I8CA 5I59A 3R26A 4H8IA 1I6BA 2DWJA 3H3GA 4POWA 1MQIA 1OQGA 2OLBA 1P1OA 2PT2A 3HHFA 4IO4A 3TQLA 4P0IA 5CMCA 1N76A 3K6XA 3EF7A 1TFAA 3QAXA 4ECFA 4YMAA 1J1NA 2OWTA 5JTYB 4RPNA 1OLAA 3PUWE 2RC8A 1R1NA 2QMXA 4NF8B 1VR5A 2XD3A 2G29A 4IY5A 2RKMA 3K1MA 3O9PA 3E3KA 1WODA 1QKBA 4QSEA 3DLNA 1OLCA 4FATA 4NF8A 1B0LA 1NL5A 4LATA 1ZTYA 2FA7A 4QFPA 4QSCA 5DVFA 3KG2A 1SYIA 4HW8A 3T9VA 1I69A 5EHMA 4OXVA 3C35A 3H4ZA 1BLFA 3FJMA 3IB1A 3EPEA 2REGA 1PBPA 3TTMA 2AIXA 4KI0E 2XX9A 2THIA 4IO6A 2O51A 3EHTA 2XXYA 1ELJA 3PPNA 2F78A 4THIA 4LZ8A 3CIJA 2V93A 4IY6A 3BFTA 1NKXA 2PVUA 2ZYOA 4GFRA 4H67A 4GQOA 1MXWA 1DTGA 4QFLA 1MM7A 3EHSA 4BDNA 3G3IA 1D9VA 2AL4A 2DVZA 4RA1A 1SI1A 3MVXA 4OWDA 4ZDMA 2ANJA 5AA1A 5CMKA 3IK6B 1NFTA 1OQHA 3C36A 4GL0A 1A8EA 1CE2A 1DPEA 1QULA 2I3WA 3IORA 4R6YA 1MQGA 1SI0A 2X7QA 4LQ5A 3IO6A 3FIRA 1R9QA 3OEMA 4EQBA 1R6ZA 3M3FA 1N0TA 3IOVA 2R71A 4LZ7A 4NWCA 5AA3A 2ONKE 4GOTA 1A99A 2CMOA 1QW0A 3M3KA 4IO7A 3TTRA 5BWJA 3A3UA 3S9EA 5F1QA 3G3FA 1B5JA 2ZNUA 4F2OA 3IB0A 4PP0A 3A09A 1PBQA 1D3KA 1FTMA 5AA2D 5I57A 5ITPA 3VLWA 4RK9A 3ZKKA 3U1OA 3RT6B 1QUIA 2RF1A 3H6UA 4GL8A 4PFUA 1S50A 4LUBA 2UVJA 2W7YA 5DEXA 1N04A 1UTBA 2ESNA 1FQEA 1CB6A 1USYE 4R74A 1SVXB 2DWAA 1ZKBA 1Y9UA 5H8SA 2ZYKA 4G68C 1IITA 2ZYNA 2D5WA 2FNCA 4X48A 2Z23A 1PB7A 1PB9A 3MZBA 3IAZA 1F9BA 4FIMA 2ZXTA 1NNTA 1OVTA 2O1MA 5TU0A 1Y1MA 1FQDA 2Z8DA 2DQVA 2F34A 3OO8A 3PUXE 2G93A 3UORA 5AA4B 1EZPA 1GGGA 1S9TA 1SW1A 1US4A 1NMUA 4OENA 1POY1 4OEUA 3KN8A 4EXKA 3ECRA 3G3KA 1IXHA 1NNKA 2F6GA 3B7DA 3LSWA 3MC2A 4OFLA 5CMMA 4H0WA 3SEXA 4F3PA 1FTJA 1JW1A 4KYDA 1B05A 3FV2A 2I58A 1N3XA 4HS7A 1Y1ZA 3MJNA 4OQOA 4F3GA 1AH5A 4JBZA 3O97A 2Q88A 4DCXA 2UXAA 2DYXA 1B4HA 4LQ2A 4DXBA 1NH7A 4OMBA 2Y7PA 3SEWA 1WVJA 5F7VA 4F1VA 1XVYA 3K1NA 2RCAA 3MAMA 1I6QA 4I62A 3VV5A 4H8JA 5AE4A 2GH9A 3VVDA 4UA8A 4NF6B 4YMBA 2KLFA 3FVKA 3V89B 4ELRA 1MDQA 1O64A 1SW5A 3K00A 3R6UA 3MW0A 4DDDA 2H9BA 3OD7A 3MPLA 5M2VA 1B32A 1IUDA 3GXAA 3O6HA 1MPDA 1HSLA 3LUYA 1LSTA 3HCQA 4U1OA 4ESWA 2FYIA 4JDFA 1FQBA 4H1XA 3CFXA 1BIYA 3GBAA 4DIGA 1O63A 1BP5A 3GZGA 2I0BA 3MVWA 1VSOA 2DS9A 4U21A 1DTZA 3B6TA 3OO7A 4YB7A
chains in the Genus database with same CATH superfamily
5LTCA 1NV5A 5IGAA 4YB5A 4JXIA 3PUYE 4C1TA 4ZZAA 1NV1A 2H5YA 3LBSA 3LUZA 3C34A 4ZE8A 1NUYA 5DEXB 1A7LA 4OVRA 3E4RA 2MKZA 3ZKLA 4NE4A 1FJ6A 3IOWA 4N8GA 3MUQA 2P1SA 3B6WA 3TCFA 4N15A 3Q25A 4JVDA 4Q8RA 1LFHA 2M8CA 3KEIA 3T66A 4P8BA 1IEJA 4PDHA 4OANA 3G7WA 3KSXA 1ZBMA 2LAOA 1MQJA 1AWBA 3OMBA 4Z0IA 2DE3A 5ISUA 1MXYA 2B4MA 4DLDA 4R9GA 3KJTA 2H4IA 3HSTA 3UN6A 3B6QA 1UQWA 1ZJLA 4GX4A 2Y7WA 4U4XA 4K3FA 2XXQA 4YU0A 3TKDA 4GX3A 4F18A 1MQHA 4O94A 2VD2A 3ILTB 4G8HA 2A5SA 3KBRA 4R2BA 3I5OA 4PBQA 4N6PA 4ZZEA 3K4UA 1MQDA 2CZIA 5AA4A 3N5LA 3S4UA 1A8FA 3PU5A 3SETA 1MY2A 4G77A 4OYVA 2DSFA 4KPTA 1JQFA 2GFEA 3ILUB 2GRVA 4G8NA 2UYEA 3K1PA 1PB8A 4PE5B 2OBGA 2XA5A 2F8DA 4GBWA 1MY1A 3PGFA 2FIEA 2XD2A 1YYZA 3K0VA 1D9YA 1ATGA 2ZNSA 1NNPA 4XKRA 4X9TA 3IJXB 3M8UA 1MDP1 1UIVA 3IB2A 4PAKA 1ZIUA 2DE2A 4PFWA 3IR1A 1US5A 3FZVA 2OWSA 3O2AA 1B3HA 4NMYA 1SPIA 2RC9A 2F6PA 3HPIA 1URSA 3T9HB 1GVCA 1AMFA 1FBHA 4MMPA 1EYJA 2KQZA 4LVQA 2A5TA 4OEVA 3HN0A 2UYFA 1Y4CA 2QL3A 3FJGA 4PC9A 1URGA 3RPWA 3H6VA 3RTFB 5I58B 3G3GA 5B7DA 4XKPA 1XHYA 5LDZA 2B65A 1OIBA 1LAFE 1OVBA 5IZ3B 5KDTA 3LC8A 4Q30B 4I1DA 4XF5A 1GR2A 3FGSA 4MLQA 4N6KA 1LB8A 4F29A 1SD3A 1TWYA 3FATA 2CEYA 5CRYA 2ONRA 4NAPA 2UVIA 2QJEA 4IGRA 3HFUA 3V8XB 3PV0E 1O7TA 4H65A 3EN3A 5EQAA 1LAGE 1FBPA 1RYOA 4GIZA 5I56A 1USYH 4I9DA 4WKMA 2R9JA 1YCJA 5I2KA 2PYYA 1FRPA 3D4GA 1EYIA 3H6WA 3P7IA 4OVSA 2XHDA 4F1UA 1MG1A 2F3BA 2QMWA 3C31A 3T9UA 1EYKA 1FJ9A 4U1ZA 4KHZE 2F7BA 2H25A 1II5A 1XS5A 1FQAA 2F36A 1LAHE 4ZEIA 5DVIA 3RT8A 5H8FA 4F39A 5KZTA 2V84A 4X04A 2VD3A 4KYSA 1K9YA 3KZGA 4JB7A 1IXGA 2HCAA 2HAUA 1IMAA 3E78A 3RNNA 4OESA 1MH3A 3HV1A 4F3SA 2OCUA 2QS3A 3Q27A 3QSLA 3N94A 1LFGA 2O69A 5I59B 5JEIA 2F3DA 1OMPA 1DBZA 1DPPA 4Q0CA 4BDMA 2OZZA 1MXXA 3FV1A 5I59A 2XXPA 4H8IA 4POWA 3H3GA 1MQIA 3TQLA 2OLBA 1P1OA 4IO4A 3K6XA 3QAXA 2OWTA 5JTYB 2RC8A 2QMXA 2XD3A 2G29A 3K1MA 1WODA 1QKBA 4QFPA 1SYIA 5EHMA 4OXVA 3C35A 1IMDA 3H4ZA 3EPEA 2REGA 1PBPA 1YXIA 4KI0E 3TTMA 2XX9A 2THIA 3EHTA 4THIA 4LZ8A 3CIJA 2V93A 3BFTA 4H67A 4GQOA 3EHSA 4BDNA 3G3IA 1D9VA 2DVZA 1SI1A 2ANJA 3IK6B 3C36A 1DPEA 4R6YA 5I5PA 3OEMA 1N0TA 3IOVA 2R71A 4GOTA 2XWVA 3TTRA 3A09A 1FTMA 1KA0A 1FPJA 4RK9A 4PFUA 4LUBA 2W7YA 4FBPA 2ESNA 1CB6A 4GWZA 5H8SA 4G68C 2D5WA 5TU0A 1Y1MA 2ZZXA 5AA4B 4OEUA 1US4A 4EXKA 3KN8A 5CMMA 3LSWA 3B7DA 4GWSA 1FBDA 1FTJA 3FV2A 2I58A 1Y1ZA 3MJNA 5I7IA 1AH5A 1NH7A 4OMBA 3PTYA 1XVYA 2RCAA 4UA8A 3FVKA 1SW5A 3OD7A 1B32A 1LSTA 4ESWA 4JDFA 2CEXA 4IR8A 4MIJA 1BP5A 3MVWA 2I0BA 4OA4A 3TEPA 3UGWA 4YB7A 2QSXA 1LCTA 2ONSA 4U4SA 1QGXA 4G4PA 4QF9A 1H76A 1MH4A 4MF3A 5I56B 2F97A 3MP1A 3K01A 4WEDA 3ODBA 4PGPA 3SERA 3TZAA 1MPBA 3ROJA 4OERA 1N3WA 3CFZA 1EU8A 4MCOA 2CZHA 4PFYA 4NX1A 3VXCA 3U8QA 2XXXA 1XOCA 3OSRA 4IO3A 1IMBA 5K2XA 4DCYA 1XC1A 5L9MA 3RLFE 5CM6A 2WBDA 4KCDA 1UTBB 1UTHA 2VPNA 3Q28A 1JW5A 2PMSA 2O7UA 4R9FA 1DTZA 3KBZA 3A29A 4OVPA 4HCYA 2B3BA 2RCBA 2ALUA 3CI8A 3I6VA 1FPKA 5ICQA 2HEUA 2ZNTA 3EHUA 1M5FA 1EZ9A 1NV6A 3PUZE 3S2VA 2X7PA 1EZOA 1Y3QA 3WAEA 1H43A 4RY1A 4ND9A 2QVVA 3KOTA 4HE1A 4KQPA 3PPRA 4EDPA 1FPBA 4BDOA 3OELA 3U72A 4RYAA 1P1NA 1B0HA 1I6AA 3CG1A 3FXUA 3U65A 4YKPA 1FCKA 4GLIA 4O3BA 3SEYA 1B7HA 2XXHA 2H99A 1JEUA 2DWIA 3OEKA 3Q26A 5HM4B 1LBCA 2RINA 3DP6A 3FXQA 4IGTA 3K6UA 2DWHA 2V3QA 5H8HB 2FVZA 2R6GE 2F35A 1B6HA 3JV9A 4ZS9A 4DZ1A 4R73A 2Z8EA 3IOTA 3CG3A 3RTWB 2ZZWA 1Q9DA 3V83A 4POXA 5A5LA 2VGQA 3PD8A 4YB6A 1B7ZA 3V5AA 1S7YA 4YAHX 4E0XA 2O84X 3UP9A 3VE1B 3KJ7A 5L9SA 3OOAA 4MBPA 4OVTA 3MP6A 4NF4A 2Q8MA 3TTKA 4F19A 1FTOA 1RDZA 3T9XB 2NUVA 3BKIB 4NTLA 2VOZA 3O6IA 2P0SA 3PMVA 1JNFA 3IX1A 2BJIA 4YKJA 3RPLB 1LAXA 4X8RA 2I49A 5KDTB 1FBCA 3PUVE 4U22A 1SYHA 4BDLA 3MBPA 5ET5A 3E9XA 1FPLA 4XKNA 1FQFA 3ISPA 3MVZA 1A55A 5TP9A 3CHGA 2A5TB 1LLSA 4YZZA 1B3LA 2KR0A 3O6GA 1IMEA 1TT1A 1KZ8A 2DOJA 1DK4A 4N4UA 1N7XA 4YICA 4KCCA 2REJA 1D9QA 5FHMA 1QJMA 2QPQA 4GXAA 4NF5A 4PFBA 4GWWA 3RPLA 3THIA 4PAFA 1FSAA 4F3BA 1LBWA 1MXZA 1M5EA 4M1VA 4LP2B 4GWOA 5H8QB 4RXLA 1AL3A 3MZ1A 5TPAA 2YJPA 2UVHA 4XFEA 5DT6A 5BUUA 2HAVA 4ELOA 4BLAA 1FBFA 5AA2B 3S9NC 4AQ4A 1JVYA 4Q5TA 2R8TA 4YKIA 4ZEBA 2QFLA 5DVJA 5L8DA 4R75A 3UA8A 3TAJA 2BJJX 1B2HA 1FBEA 3JYRA 4FEDA 1H3DA 5L9OA 3D1RA 3GYYA 4G8MA 1FPFA 4JWXA 5H8QA 4ISUA 5ESYA 3FUZA 3O28A 1EH3A 2ZYMA 4QFOA 5I57B 2DXRA 4QXDA 2D21A 5HBCA 3GBBA 3DP8A 4NF0A 2XX7A 3I3VA 4OVJA 2Y7IA 3KGCA 5ITOA 1VFEA 1N7WA 3C32A 3T22A 4MHFA 4I8CA 4I3EA 2PT2A 5CMCA 4I3YA 4PFIA 1OLAA 1R1NA 4NF8B 3E3KA 5DVFA 2FA7A 1I69A 4AS4A 4P1EA 2AIXA 3PPNA 1ELJA 2ZYOA 4QFLA 3MVXA 5EYHA 1CE2A 2I3WA 3IO6A 2VT5A 3FIRA 1R6ZA 3M3KA 3A3UA 5F1QA 1PBQA 3EKIA 2WBBA 5ITPA 1LEVA 3RT6B 4GL8A 1S50A 1FQEA 4R74A 1SVXB 2DWAA 1ZKBA 3FBPA 2ZYKA 1IITA 2ZYNA 2FNCA 4X48A 2Z23A 3MZBA 1F9BA 2O1MA 5FBPA 1FQDA 3PUXE 2DQVA 2FHYA 1SW1A 1POY1 3ECRA 3G3KA 1NUZA 1NNKA 2F6GA 3T0JA 1JW1A 1N3XA 4OQOA 4F3GA 3O97A 2Q88A 4DXBA 2Y7PA 1NV0A 1XI6A 3V89B 3B8BA 4DDDA 5EQ8A 5EQ9A 5M2VA 5IZZA 3GXAA 1MPDA 3CFXA 4DIGA 1O63A 2DS9A 4U21A 1FQCA 1FTLA 4NWDA 1H45A 4KR5A 4TQUQ 1MS7A 5CBSA 1LB9A 2QVUA 3DELB 4H5FA 4AS5A 1AOVA 1B46A 2O7IA 4FECA 5LOMA 2NVUB 2HHMA 4PDDA 1A40A 4NF4B 4PF6A 3N26A 5KCJB 2PCRA 4GBVA 1FTKA 1URDA 3E13X 1Y3NA 5CMBA 3LSXA 1MXVA 4QRZA 4QFNA 3TDJA 2QRYA 2PBWA 1LBZA 3K02A 2PFYA 2I3VA 1RDXA 1QUJA 1FPGA 3EQ1A 3TFLA 2VP1A 4XKQA 3VDFA 4M4GA 5IM2A 4GWXA 1FW0A 3FD3A 5DTBA 3LR1A 5IKBA 1B3FA 1UTHB 2UVGA 4BDQA 4HE0A 4NGUA 3OXNA 4KYEA 5H8HA 4IB2A 1JEVA 3RUMA 1JVXA 2Y7KA 2PT1A 4PAIA 1Z7NE 1IIWA 4HW8A 3QYTA 4U2RA 4GXSB 4P0GA 1IXIA 4KXPA 3MZ9A 1TXFA 4NEDA 1NNFA 4MFIA 4G68B 4HE2A 2OX3A 2F7AA 4P47A 4WEPA 4R6HA 1NV2A 2F7CA 3UK4A 3TPAA 5IZ3A 2JJKA 2GHBA 1K9ZA 5I58A 1VFDA 5B70A 1CNQA 3T96B 2OJTA 2Y84A 3TTNA 1SQYA 1INPA 3VFJA 1POTA 1JP4A 4H46A 2Q2AA 5ET8A 5EYFA 3MVYA 2DVCA 1P1UA 1ZU0A 3OENA 5CC2A 3TCHA 4UABA 2DXYA 3MWBA 1B3EA 2DP8A 1BKAA 3OSQA 3KOSA 1QVSA 2CZLA 2E1SA 1FBGA 1PEBA 1B9JA 4IO2A 4MX6A 4N6DA 4LA9A 5T3JA 3FVNA 4FORA 1M5BA 3CRBA 3CSGA 4P11A 5FTHA 1B51A 1NV4A 3QMFA 1B52A 4FEBA 4UACA 3FXBA 3H06B 2I0CA 2RC7A 1Y20A 3M3LA 2DE4A 3QUJA 4AB5A 5FHOA 1SW2A 3KFMA 2WEFA 3TCGA 1ZMGA 3IFAA 1MXUA 1NV3A 2AYSA 1P99A 1ANFA 4N8YA 2Y7RA 4PQJA 5TPAB 4R2FA 4X1BA 1NUWA 2OWZA 2HQ0A 3IO4A 2VHAA 1LBVA 3ONMA 4N81A 3SESA 5I3SA 4MAGA 4FE8A 1XVXA 2Q8JA 1JW4A 5KCJA 3BFUA 4PF8A 3SEUA 3FJ7A 1IQ7A 3RY3A 4ZEDA 4OETA 3TYHA 2OK2A 4ZEFA 4BDRA 2WX9A 3H03A 2Y5KA 1B1HA 1PDAA 4DXUA 3VVEA 3RN8A 2O6AA 3TELA 4N17A 1B58A 3VLVA 3MYUA 2B3FA 4H5GA 1T0KA 4P1LA 3MSTA 3KC0A 3W9WA 1M5DA 4GWYA 1SW4A 4QHQA 1YZ0A 3N6TA 1QKAA 4FAJA 3C33A 2V3UA 3JZJA 2HFBA 5TP9B 3IL1B 1MY0A 4WXJA 4PGNA 1L5TA 4OZ9A 5AA2A 1IMCA 1NH8A 4TLLB 3T93B 1BK4A 3CR9A 4QSDA 2Q89A 4DE8A 1PC3A 5ELVA 4OFOA 1MRPA 2XXUA 4MEVA 4PBHA 4ONYA 5EYGA 1LCFA 2ZZVA 2YPNA 2YLNA 1KWHA 4IO5A 3IFCA 3VVFA 3SEVA 4O7IA 3Q29A 1P1WA 3RYDA 3O29A 4EQ7A 2HZLA 2D3IA 4GVOA 3PD9A 4JSOA 3HO7A 4C1UA 4DI3D 5I2NB 4XTCQ 3D4CA 2P3VA 4JVIA 1MPCA 4RJZA 3PPQA 2VPOA 5BWJA 4H6DA 5H8NA 4OFJA 2WKYA 4P3LA 4TOZA 3HHGA 3C4MA 3R26A 1OQGA 3BIHA 4P0IA 1N76A 3EF7A 4RPNA 4I40A 4IY5A 2RKMA 3O9PA 3DLNA 4FATA 4NF8A 1NL5A 4QSCA 4PCDA 3T9VA 4NG7A 1BLFA 2XXYA 2PVUA 4GFRA 1MXWA 1DTGA 2AL4A 4ZDMA 4OWDA 4GL0A 3IORA 1SI0A 2X7QA 4NWCA 2CMOA 1QW0A 4IO7A 1B5JA 2ZNUA 3IB0A 4PP0A 1D3KA 3ZKKA 2RF1A 3H6UA 2UVJA 1N04A 1USYE 4PTKA 1IMFA 1PB7A 1PB9A 2ZXTA 1NNTA 1OVTA 2Z8DA 1EZPA 2F34A 3OO8A 3UORA 2G93A 4OENA 5J16A 4N91A 1IXHA 4OFLA 4H0WA 3SEXA 4F3PA 4KYDA 1B05A 4HS7A 4GWUA 4DCXA 2UXAA 2DYXA 4LQ2A 1WVJA 5F7VA 3MAMA 3VV5A 1G0HA 4H8JA 2GH9A 3VVDA 4YMBA 2KLFA 1MDQA 1O64A 3R6UA 5F24A 4G61A 3MPLA 1HSLA 3LUYA 4U1OA 1FQBA 4H1XA 1BIYA 2WYKA 1VSOA 3B6TA 4NN3A 3PMXA 1B3GA 4MJOA 3VLUA 2XWIA 4MH5A 1FPDA 1WDNA 2O68A 2P2AA 1FPIA 1SBPA 4F1VA 3AXFA 5H8NB 2NXOA 3QK6A 3TUSA 3GLBA 5ICTA 1UIUA 3FXRA 3KN7A 4EUOA 1LBXA 1QUKA 2HXWA 1IXCA 1B1XA 1P1QA 3CSBA 5FHNA 3PPOA 4KFQA 2I48A 3VXBA 2QS2A 5K2YA 4MNIA 1LBYA 3BBRA 1DSNA 3USDA 2Q9TA 3TQWA 1Y4TA 1LBBA 1DCUA 3PMWA 1Q35A 3OO9A 1YPNA 2ZMBA 3ZS6A 2IEEA 4EXLA 1GTKA 4O7MA 2NOOA 2Z22A 1M5CA 3MP8A 3R7XA 2XXVA 4O3CA 2ABHA 4R72A 4N07A 4XIGQ 5CI5A 4MLVA 1RYXA 1HSEA 5IZ1A 2HXRA 4C0RA 3FVOA 1B4ZA 4DI4B 1B40A 2Z8FA 5EHSA 1JETA 3TODA 4L17A 3K6VA 2HPGA 1DMBA 3OO6A 1N84A 2AL5A 2XXRA 4G68A 3OO7A 3IOUA 4Z7EA 5I84A 1R9LA 1IZ1A 1B5HA 1RKMA 3H7MA 1TFDA 3KN3A 3IJOB 4RK2A 4TLMB 3RQTA 3S9MC 3WAFA 3O66A 4O8MA 5DYHA 5JTYA 3N6UA 2O1LA 5HPQA 4FJPA 1Z7ME 2PX1A 4ELQA 4MNCA 3UIFA 4O3AA 4F31B 3K2DA 3F11A 2X26A 2GQ1A 2E0SA 1VE4A 3FASA 3SDFA 1BTJA 2I6EA 3H6TA 3S9LC 2H98A 3LV0A 2GHAA 2I4CA 4PFTA 3SKPA 4HTGA 4GF8A 2XXTA 2CZKA 4F2QA 4ZE9A 2HZKA 4GD5A 1KA1A 1Y3PA 3DP4A 4LZ5A 3TMGA 1H44A 5I2NA 1RDYA 4F1YA 3RGYA 4X1DA 1MY4A 4JVCA 1ZLQA 1MY3A 4ESXA 3PPPA 5H8FB 4LONB 3U94A 2QVRA 2XXWA 1NI9A 4PE3A 4ZEKA 3LSLA 1Q1KA 4HXVA 4MNPA 3KSJA 2FIXA 1VDWA 3U92A 3CVGA 2IA4A 4NF6A 4KD5A 4QBAA 5FTIA 4HCWA 4OTEA 2I4BA 4QFKA 1GV8A 5JK4A 4E0WA 3L6GA 1AIVA 4EF1A 3C9HA 4JSDA 5ET7A 4NHBA 4JWYA 3ZSFA 1XT8A 5I2KB 1YTVA 3G3HA 4JWOA 4PETA 4NF5B 3L6HA 1LGBC 3MPKA 4N13A 1SDXA 4GRKA 2NWJA 4F22A 4R6KA 1LFIA 4G2ZA 5A5XB 3SZPA 3CFLA 2XX8A 4YKKA 1FPEA 4AB6A 3BIGA 4EQ9A 2QS1A 1DOTA 1YAEA 3LSFB 5DW8A 3W15C 2Q2CA 1FTAA 4LN5A 2FBPA 4U23A 2QS4A 1HSJA 3K6WA 3U93A 1A54A 3A3CA 2F5XA 3DM0A 3G3JA 4EF2A 2XXIA 1G0IA 1NV7A 2V25A 3W9VA 4DXCA 2V3TA 3QXMA 2PFZA 1B5IA 5J1DA 4XXUA 4ZECA 1B7UA 3TTLA 5IAIA 1D4NA 5CBRA 3QIMA 3KC1A 4ELPA 4RNSA 1MM6A 4OHNA 2V4CA 5A5XA 3QUFA 4P9KA 3MQ9A 1I6BA 2DWJA 3HHFA 4P56A 1TFAA 4ECFA 4YMAA 1J1NA 3PUWE 4PFRA 1VR5A 4QSEA 1OLCA 2L5VA 1B0LA 4LATA 1ZTYA 3KG2A 3E79A 3FJMA 3IB1A 4IO6A 2O51A 2F78A 1NUXA 4IY6A 1NKXA 1MM7A 4H45A 2P3NA 4RA1A 5AA1A 5CMKA 1NFTA 1OQHA 1A8EA 1QULA 1MQGA 4LQ5A 5ET6A 4EQBA 1R9QA 2B4LA 2XWKA 3M3FA 5AA3A 4LZ7A 2ONKE 1A99A 3S9EA 3G3FA 4F2OA 2XXKA 5AA2D 5I57A 3VLWA 3U1OA 1QUIA 3B50A 5DEXA 1UTBA 1Y9UA 2XWOA 3IAZA 4FIMA 5EQ7A 2DDKA 1GGGA 1S9TA 1NMUA 3MC2A 4NQ8A 4JBZA 2Y5LA 1B4HA 3SEWA 3K1NA 1I6QA 2Q74A 4I62A 5AE4A 4NF6B 4ELRA 3K00A 3MW0A 3T1BA 2H9BA 3NOHA 1IUDA 3O6HA 4XEQA 3HCQA 2FYIA 4GX6A 2WYPA 3GBAA 3GZGA 4OVQA 3FVGA 4RPOA
chains in the Genus database with same CATH topology
2QSXA 1LCTA 2ONSA 1FQCA 3PMXA 4U4SA 4JXIA 1B3GA 4YB5A 3PUYE 1FTLA 4C1TA 4ZZAA 3VLUA 2H5YA 1H45A 3LBSA 4KR5A 4NWDA 4MH5A 1WDNA 2O68A 4G4PA 2P2AA 3C34A 1H76A 4QF9A 1MH4A 1SBPA 4TQUQ 3AXFA 1MS7A 1A7LA 4MF3A 2NXOA 3QK6A 5DEXB 3GLBA 1LB9A 5CBSA 5I56B 2F97A 3TUSA 3E4RA 5ICTA 3MP1A 3K01A 1UIUA 3DELB 4WEDA 3FXRA 3KN7A 4H5FA 4NE4A 3IOWA 3ODBA 3ZKLA 4EUOA 3SERA 3TZAA 1QUKA 1MPBA 3MUQA 2HXWA 1AOVA 2P1SA 3B6WA 1B46A 2O7IA 1IXCA 4FECA 3TCFA 3Q25A 5LOMA 2NVUB 4OERA 4Q8RA 1LFHA 1B1XA 1P1QA 3CSBA 1A40A 4NF4B 1N3WA 2M8CA 3CFZA 1EU8A 3KEIA 5L9SA 3N26A 4PFYA 3VXCA 5KCJB 3U8QA 2XXXA 1XOCA 3OSRA 5FHNA 3PPOA 4IO3A 1FTKA 1URDA 3E13X 4KFQA 1Y3NA 5K2XA 1XC1A 1IEJA 2I48A 3T66A 2QS2A 3VXBA 4DCYA 5L9MA 3RLFE 5CM6A 5K2YA 4KCDA 5CMBA 1UTBB 3BBRA 1UTHA 3G7WA 1DSNA 1MXVA 3LSXA 2Q9TA 3TQWA 3USDA 3Q28A 4QRZA 1JW5A 1Y4TA 3KSXA 2PMSA 4QFNA 2QRYA 3TDJA 1ZBMA 4F18A 2O7UA 2PBWA 2LAOA 4R9FA 3K02A 1LBBA 1MQJA 4HCYA 3PMWA 2B3BA 1Q35A 2I3VA 3OO9A 1QUJA 2RCBA 2ALUA 1YPNA 2ZMBA 3EQ1A 3OMBA 3TFLA 2VP1A 4XKQA 3CI8A 4Z0IA 3VDFA 4M4GA 3ZS6A 2IEEA 4EXLA 1GTKA 1FW0A 2DE3A 3FD3A 3I6VA 5DTBA 2NOOA 2Z22A 3LR1A 1MXYA 5IKBA 5ISUA 4DLDA 4R9GA 1B3FA 1UTHB 1M5CA 2UVGA 4BDQA 5ICQA 2HEUA 3KJTA 2ZNTA 2H4IA 3HSTA 3OXNA 3EHUA 4KYEA 3MP8A 5H8HA 3R7XA 3UN6A 2XXVA 4O3CA 2ABHA 3B6QA 4IB2A 1M5FA 1JEVA 1EZ9A 4N07A 3PUZE 4R72A 1UQWA 2X7PA 4XIGQ 3RUMA 5CI5A 3S2VA 1ZJLA 1EZOA 1JVXA 4MLVA 1Y3QA 1RYXA 2Y7KA 1HSEA 2PT1A 3WAEA 2Y7WA 1Z7NE 1IIWA 4K3FA 4U4XA 2XXQA 1H43A 4C0RA 4YU0A 4RY1A 3FVOA 1B4ZA 4ND9A 3TKDA 1MQHA 3KOTA 3QYTA 4GXSB 4KQPA 4P0GA 1IXIA 2VD2A 3PPRA 4U2RA 4EDPA 1B40A 3MZ9A 4BDOA 3OELA 3ILTB 1TXFA 4G8HA 2A5SA 4NEDA 3U72A 1NNFA 3KBRA 4R2BA 4MFIA 4RYAA 3I5OA 2Z8FA 1P1NA 1JETA 4G68B 4N6PA 5EHSA 1B0HA 3K4UA 4ZZEA 2F7AA 3TODA 1I6AA 3CG1A 4L17A 3K6VA 4WEPA 1MQDA 4R6HA 3FXUA 4YKPA 5AA4A 1DMBA 3OO6A 3N5LA 1FCKA 1N84A 2F7CA 4GLIA 4O3BA 2AL5A 1A8FA 2XXRA 3PU5A 3S4UA 3SETA 3SEYA 3TPAA 3UK4A 1MY2A 4G68A 4G77A 1B7HA 4OYVA 3IOUA 2DSFA 2XXHA 4KPTA 2H99A 2GHBA 4Z7EA 5I84A 1R9LA 1IZ1A 1B5HA 1JEUA 1JQFA 1RKMA 2DWIA 5I58A 3H7MA 3OEKA 1TFDA 1VFDA 5B70A 3T96B 3KN3A 3Q26A 2OJTA 3IJOB 4RK2A 4TLMB 2GFEA 2Y84A 3TTNA 1LBCA 3ILUB 5HM4B 2RINA 2GRVA 4G8NA 1SQYA 3RQTA 2UYEA 3K1PA 3VFJA 1PB8A 1POTA 3DP6A 2OBGA 3FXQA 4PE5B 4IGTA 3WAFA 3S9MC 2F8DA 3K6UA 2Q2AA 1MY1A 3O66A 3PGFA 2XD2A 2DWHA 5DYHA 5EYFA 5JTYA 3K0VA 1D9YA 3MVYA 3N6UA 1ATGA 2V3QA 2DVCA 2ZNSA 2O1LA 1NNPA 1P1UA 2R6GE 2F35A 5H8HB 1B6HA 1ZU0A 3JV9A 4XKRA 4X9TA 5HPQA 3IJXB 3OENA 4FJPA 4ZS9A 4DZ1A 3TCHA 5CC2A 3M8UA 1Z7ME 1MDP1 1UIVA 2PX1A 2DXYA 3MWBA 3IB2A 2Z8EA 3IOTA 1B3EA 4R73A 4ELQA 2DP8A 1BKAA 3OSQA 3UIFA 3CG3A 3KOSA 4O3AA 4F31B 3RTWB 1ZIUA 2DE2A 3K2DA 1QVSA 3F11A 2CZLA 2E1SA 2X26A 3IR1A 4PFWA 3V83A 1US5A 3FZVA 1PEBA 1B9JA 4IO2A 2OWSA 4POXA 2E0SA 1VE4A 3FASA 3O2AA 1BTJA 2VGQA 4LA9A 3SDFA 2I6EA 3PD8A 1B3HA 3H6TA 3S9LC 2H98A 1B7ZA 4NMYA 4YB6A 2GHAA 2I4CA 3V5AA 4PFTA 3SKPA 1S7YA 2RC9A 4YAHX 4HTGA 4GF8A 2O84X 4E0XA 2F6PA 3FVNA 2XXTA 3HPIA 4FORA 1URSA 3UP9A 4F2QA 4ZE9A 3VE1B 1M5BA 4F22A 2HZKA 3KJ7A 3CRBA 3CSGA 4GD5A 3T9HB 1Y3PA 3DP4A 3OOAA 4LZ5A 1H44A 4P11A 5FTHA 1B51A 3TMGA 4MBPA 1GVCA 5I2NA 3TEPA 1B52A 3MP6A 4F1YA 1AMFA 3RGYA 4FEBA 4NF4A 4UACA 3UGWA 3TTKA 4F19A 3H06B 2I0CA 4LVQA 1FTOA 2RC7A 4X1DA 1Y20A 1MY4A 2A5TA 3M3LA 2DE4A 3QUJA 4AB5A 3T9XB 4OEVA 3HN0A 5FHOA 1SW2A 3KFMA 2NUVA 3TCGA 2UYFA 3BKIB 1ZMGA 1Y4CA 2QL3A 3FJGA 1ZLQA 4NTLA 1MY3A 4ESXA 2VOZA 3PPPA 1MXUA 1URGA 3RPWA 2AYSA 3H6VA 1P99A 3RTFB 5I58B 5H8FB 3G3GA 1ANFA 5B7DA 3O6IA 4XKPA 1XHYA 2P0SA 4LONB 2Y7RA 4PQJA 5TPAB 2B65A 4R2FA 1OIBA 1LAFE 1OVBA 3PMVA 4X1BA 3U94A 2XXWA 1JNFA 5KDTA 3IX1A 3LC8A 4Q30B 4YKJA 1LAXA 4I1DA 2HQ0A 3IO4A 2I49A 2VHAA 3ONMA 1GR2A 3FGSA 4MLQA 3SESA 5KDTB 3PUVE 1LB8A 4ZEKA 4U22A 1SYHA 1Q1KA 3LSLA 4FE8A 4F29A 1XVXA 1SD3A 1TWYA 2Q8JA 1JW4A 4BDLA 3KSJA 3FATA 5KCJA 3BFUA 3MBPA 4ZE8A 3SEUA 3FJ7A 5CRYA 3U92A 2ONRA 3CVGA 2IA4A 1IQ7A 2UVIA 3RY3A 3E9XA 4NF6A 2QJEA 4XKNA 4IGRA 1FQFA 4KD5A 4ZEDA 3MVZA 5FTIA 3V8XB 1A55A 5TP9A 3PV0E 4OETA 2A5TB 1LLSA 1O7TA 2OK2A 4HCWA 4YZZA 3TYHA 4OTEA 1B3LA 2I4BA 3O6GA 4ZEFA 4QFKA 1GV8A 1TT1A 5JK4A 4H65A 2DOJA 3EN3A 4BDRA 4E0WA 1N7XA 3L6GA 3H03A 4YICA 1AIVA 1LAGE 4EF1A 4KCCA 3C9HA 1B1HA 4JSDA 1PDAA 1RYOA 2REJA 4JWYA 3VVEA 4DXUA 3ZSFA 4GIZA 3RN8A 1XT8A 5I56A 5I2KB 2O6AA 3TELA 1B58A 1USYH 4I9DA 5FHMA 3VLVA 1QJMA 2QPQA 2B3FA 4GXAA 4NF5A 2R9JA 4H5GA 4WKMA 1YTVA 1YCJA 3THIA 2PYYA 3G3HA 4JWOA 5I2KA 3D4GA 1MXZA 3H6WA 4F3BA 1T0KA 3W9WA 4PETA 1M5EA 1M5DA 3P7IA 4NF5B 3L6HA 4M1VA 1LGBC 2XHDA 3MPKA 4LP2B 4N13A 4GWOA 1SDXA 1SW4A 4QHQA 4GRKA 1MG1A 4RXLA 5H8QB 4F1UA 1AL3A 3MZ1A 2QMWA 5H8NB 3N6TA 5TPAA 1QKAA 2YJPA 2UVHA 3C33A 4R6KA 5DT6A 3C31A 2NWJA 4FAJA 2HAVA 1LFIA 2V3UA 3T9UA 5BUUA 4ELOA 3JZJA 4G2ZA 4BLAA 5A5XB 2HFBA 4U1ZA 4KHZE 5TP9B 3CFLA 2XX8A 4YKKA 3IL1B 5AA2B 2F7BA 3S9NC 1MY0A 2H25A 4AQ4A 4WXJA 1JVYA 1II5A 4Q5TA 1XS5A 1FQAA 4YKIA 4ZEBA 1L5TA 5DVJA 5L8DA 4AB6A 4R75A 4RPOA 2F36A 4OZ9A 4EQ9A 2QS1A 1LAHE 5AA2A 1DOTA 1YAEA 4ZEIA 3UA8A 1NH8A 4TLLB 3TAJA 5DVIA 3RT8A 3CR9A 3T93B 3LSFB 5H8FA 2BJJX 3W15C 2Q2CA 4QSDA 1B2HA 2Q89A 3JYRA 4FEDA 4DE8A 1PC3A 4F39A 5ELVA 1H3DA 5KZTA 2V84A 1MRPA 4OFOA 2XXUA 2QS4A 2VD3A 4KYSA 1HSJA 4U23A 4ONYA 3KZGA 1LCFA 4JB7A 3K6WA 3U93A 5L9OA 4G8MA 2YPNA 2YLNA 1A54A 1KWHA 1IXGA 2HCAA 2HAUA 3A3CA 2F5XA 4JWXA 4IO5A 3DM0A 5H8QA 3RNNA 3G3JA 4ISUA 4OESA 3VVFA 3SEVA 3FUZA 4EF2A 2XXIA 3Q29A 1MH3A 1P1WA 3HV1A 4F3SA 2V25A 3W9VA 3O28A 3O29A 2OCUA 4DXCA 2HZLA 2D3IA 4EQ7A 1EH3A 2V3TA 2ZYMA 3QXMA 3PD9A 4GVOA 4JSOA 3HO7A 2QS3A 3Q27A 3QSLA 4QFOA 1B5IA 5I57B 2DXRA 4C1UA 5J1DA 3N94A 4XXUA 4ZECA 2D21A 5HBCA 1B7UA 5I2NB 4XTCQ 3GBBA 3DP8A 1LFGA 2O69A 3D4CA 3TTLA 5I59B 5IAIA 1D4NA 5CBRA 5JEIA 1OMPA 3QIMA 1DPPA 1MPCA 3PPQA 4RJZA 4RNSA 4ELPA 1MM6A 4OHNA 2XX7A 3I3VA 4Q0CA 4H6DA 5H8NA 4OFJA 2WKYA 3QUFA 4OVJA 4BDMA 2Y7IA 2OZZA 5A5XA 3FVGA 1MXXA 3KGCA 5ITOA 3FV1A 1VFEA 1N7WA 3C32A 4TOZA 3HHGA 3C4MA 2XXPA 3MQ9A 3T22A 4I8CA 5I59A 3R26A 4H8IA 1I6BA 2DWJA 3H3GA 4POWA 1MQIA 1OQGA 2OLBA 1P1OA 2PT2A 3HHFA 4IO4A 3TQLA 4P0IA 5CMCA 1N76A 3K6XA 3EF7A 1TFAA 3QAXA 4ECFA 4YMAA 1J1NA 2OWTA 5JTYB 4RPNA 1OLAA 3PUWE 2RC8A 1R1NA 2QMXA 4NF8B 1VR5A 2XD3A 2G29A 4IY5A 2RKMA 3K1MA 3O9PA 3E3KA 1WODA 1QKBA 4QSEA 3DLNA 1OLCA 4FATA 4NF8A 1B0LA 1NL5A 4LATA 1ZTYA 2FA7A 4QFPA 4QSCA 5DVFA 3KG2A 1SYIA 4HW8A 3T9VA 1I69A 5EHMA 4OXVA 3C35A 3H4ZA 1BLFA 3FJMA 3IB1A 3EPEA 2REGA 1PBPA 3TTMA 2AIXA 4KI0E 2XX9A 2THIA 4IO6A 2O51A 3EHTA 2XXYA 1ELJA 3PPNA 2F78A 4THIA 4LZ8A 3CIJA 2V93A 4IY6A 3BFTA 1NKXA 2PVUA 2ZYOA 4GFRA 4H67A 4GQOA 1MXWA 1DTGA 4QFLA 1MM7A 3EHSA 4BDNA 3G3IA 1D9VA 2AL4A 2DVZA 4RA1A 1SI1A 3MVXA 4OWDA 4ZDMA 2ANJA 5AA1A 5CMKA 3IK6B 1NFTA 1OQHA 3C36A 4GL0A 1A8EA 1CE2A 1DPEA 1QULA 2I3WA 3IORA 4R6YA 1MQGA 1SI0A 2X7QA 4LQ5A 3IO6A 3FIRA 1R9QA 3OEMA 4EQBA 1R6ZA 3M3FA 1N0TA 3IOVA 2R71A 4LZ7A 4NWCA 5AA3A 2ONKE 4GOTA 1A99A 2CMOA 1QW0A 3M3KA 4IO7A 3TTRA 5BWJA 3A3UA 3S9EA 5F1QA 3G3FA 1B5JA 2ZNUA 4F2OA 3IB0A 4PP0A 3A09A 1PBQA 1D3KA 1FTMA 5AA2D 5I57A 5ITPA 3VLWA 4RK9A 3ZKKA 3U1OA 3RT6B 1QUIA 2RF1A 3H6UA 4GL8A 4PFUA 1S50A 4LUBA 2UVJA 2W7YA 5DEXA 1N04A 1UTBA 2ESNA 1FQEA 1CB6A 1USYE 4R74A 1SVXB 2DWAA 1ZKBA 1Y9UA 5H8SA 2ZYKA 4G68C 1IITA 2ZYNA 2D5WA 2FNCA 4X48A 2Z23A 1PB7A 1PB9A 3MZBA 3IAZA 1F9BA 4FIMA 2ZXTA 1NNTA 1OVTA 2O1MA 5TU0A 1Y1MA 1FQDA 2Z8DA 2DQVA 2F34A 3OO8A 3PUXE 2G93A 3UORA 5AA4B 1EZPA 1GGGA 1S9TA 1SW1A 1US4A 1NMUA 4OENA 1POY1 4OEUA 3KN8A 4EXKA 3ECRA 3G3KA 1IXHA 1NNKA 2F6GA 3B7DA 3LSWA 3MC2A 4OFLA 5CMMA 4H0WA 3SEXA 4F3PA 1FTJA 1JW1A 4KYDA 1B05A 3FV2A 2I58A 1N3XA 4HS7A 1Y1ZA 3MJNA 4OQOA 4F3GA 1AH5A 4JBZA 3O97A 2Q88A 4DCXA 2UXAA 2DYXA 1B4HA 4LQ2A 4DXBA 1NH7A 4OMBA 2Y7PA 3SEWA 1WVJA 5F7VA 4F1VA 1XVYA 3K1NA 2RCAA 3MAMA 1I6QA 4I62A 3VV5A 4H8JA 5AE4A 2GH9A 3VVDA 4UA8A 4NF6B 4YMBA 2KLFA 3FVKA 3V89B 4ELRA 1MDQA 1O64A 1SW5A 3K00A 3R6UA 3MW0A 4DDDA 2H9BA 3OD7A 3MPLA 5M2VA 1B32A 1IUDA 3GXAA 3O6HA 1MPDA 1HSLA 3LUYA 1LSTA 3HCQA 4U1OA 4ESWA 2FYIA 4JDFA 1FQBA 4H1XA 3CFXA 1BIYA 3GBAA 4DIGA 1O63A 1BP5A 3GZGA 2I0BA 3MVWA 1VSOA 2DS9A 4U21A 1DTZA 3B6TA 3OO7A 4YB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSX A;  1LCT A;  2ONS A;  1FQC A;  3PMX A;  4U4S A;  4JXI A;  1B3G A;  4YB5 A;  3PUY E;  1FTL A;  4C1T A;  4ZZA A;  3VLU A;  2H5Y A;  1H45 A;  3LBS A;  4KR5 A;  4NWD A;  4MH5 A;  1WDN A;  2O68 A;  4G4P A;  2P2A A;  3C34 A;  1H76 A;  4QF9 A;  1MH4 A;  1SBP A;  4TQU Q;  3AXF A;  1MS7 A;  1A7L A;  4MF3 A;  2NXO A;  3QK6 A;  5DEX B;  3GLB A;  1LB9 A;  5CBS A;  5I56 B;  2F97 A;  3TUS A;  3E4R A;  5ICT A;  3MP1 A;  3K01 A;  1UIU A;  3DEL B;  4WED A;  3FXR A;  3KN7 A;  4H5F A;  4NE4 A;  3IOW A;  3ODB A;  3ZKL A;  4EUO A;  3SER A;  3TZA A;  1QUK A;  1MPB A;  3MUQ A;  2HXW A;  1AOV A;  2P1S A;  3B6W A;  1B46 A;  2O7I A;  1IXC A;  4FEC A;  3TCF A;  3Q25 A;  5LOM A;  2NVU B;  4OER A;  4Q8R A;  1LFH A;  1B1X A;  1P1Q A;  3CSB A;  1A40 A;  4NF4 B;  1N3W A;  2M8C A;  3CFZ A;  1EU8 A;  3KEI A;  5L9S A;  3N26 A;  4PFY A;  3VXC A;  5KCJ B;  3U8Q A;  2XXX A;  1XOC A;  3OSR A;  5FHN A;  3PPO A;  4IO3 A;  1FTK A;  1URD A;  3E13 X;  4KFQ A;  1Y3N A;  5K2X A;  1XC1 A;  1IEJ A;  2I48 A;  3T66 A;  2QS2 A;  3VXB A;  4DCY A;  5L9M A;  3RLF E;  5CM6 A;  5K2Y A;  4KCD A;  5CMB A;  1UTB B;  3BBR A;  1UTH A;  3G7W A;  1DSN A;  1MXV A;  3LSX A;  2Q9T A;  3TQW A;  3USD A;  3Q28 A;  4QRZ A;  1JW5 A;  1Y4T A;  3KSX A;  2PMS A;  4QFN A;  2QRY A;  3TDJ A;  1ZBM A;  4F18 A;  2O7U A;  2PBW A;  2LAO A;  4R9F A;  3K02 A;  1LBB A;  1MQJ A;  4HCY A;  3PMW A;  2B3B A;  1Q35 A;  2I3V A;  3OO9 A;  1QUJ A;  2RCB A;  2ALU A;  1YPN A;  2ZMB A;  3EQ1 A;  3OMB A;  3TFL A;  2VP1 A;  4XKQ A;  3CI8 A;  4Z0I A;  3VDF A;  4M4G A;  3ZS6 A;  2IEE A;  4EXL A;  1GTK A;  1FW0 A;  2DE3 A;  3FD3 A;  3I6V A;  5DTB A;  2NOO A;  2Z22 A;  3LR1 A;  1MXY A;  5IKB A;  5ISU A;  4DLD A;  4R9G A;  1B3F A;  1UTH B;  1M5C A;  2UVG A;  4BDQ A;  5ICQ A;  2HEU A;  3KJT A;  2ZNT A;  2H4I A;  3HST A;  3OXN A;  3EHU A;  4KYE A;  3MP8 A;  5H8H A;  3R7X A;  3UN6 A;  2XXV A;  4O3C A;  2ABH A;  3B6Q A;  4IB2 A;  1M5F A;  1JEV A;  1EZ9 A;  4N07 A;  3PUZ E;  4R72 A;  1UQW A;  2X7P A;  4XIG Q;  3RUM A;  5CI5 A;  3S2V A;  1ZJL A;  1EZO A;  1JVX A;  4MLV A;  1Y3Q A;  1RYX A;  2Y7K A;  1HSE A;  2PT1 A;  3WAE A;  2Y7W A;  1Z7N E;  1IIW A;  4K3F A;  4U4X A;  2XXQ A;  1H43 A;  4C0R A;  4YU0 A;  4RY1 A;  3FVO A;  1B4Z A;  4ND9 A;  3TKD A;  1MQH A;  3KOT A;  3QYT A;  4GXS B;  4KQP A;  4P0G A;  1IXI A;  2VD2 A;  3PPR A;  4U2R A;  4EDP A;  1B40 A;  3MZ9 A;  4BDO A;  3OEL A;  3ILT B;  1TXF A;  4G8H A;  2A5S A;  4NED A;  3U72 A;  1NNF A;  3KBR A;  4R2B A;  4MFI A;  4RYA A;  3I5O A;  2Z8F A;  1P1N A;  1JET A;  4G68 B;  4N6P A;  5EHS A;  1B0H A;  3K4U A;  4ZZE A;  2F7A A;  3TOD A;  1I6A A;  3CG1 A;  4L17 A;  3K6V A;  4WEP A;  1MQD A;  4R6H A;  3FXU A;  4YKP A;  5AA4 A;  1DMB A;  3OO6 A;  3N5L A;  1FCK A;  1N84 A;  2F7C A;  4GLI A;  4O3B A;  2AL5 A;  1A8F A;  2XXR A;  3PU5 A;  3S4U A;  3SET A;  3SEY A;  3TPA A;  3UK4 A;  1MY2 A;  4G68 A;  4G77 A;  1B7H A;  4OYV A;  3IOU A;  2DSF A;  2XXH A;  4KPT A;  2H99 A;  2GHB A;  4Z7E A;  5I84 A;  1R9L A;  1IZ1 A;  1B5H A;  1JEU A;  1JQF A;  1RKM A;  2DWI A;  5I58 A;  3H7M A;  3OEK A;  1TFD A;  1VFD A;  5B70 A;  3T96 B;  3KN3 A;  3Q26 A;  2OJT A;  3IJO B;  4RK2 A;  4TLM B;  2GFE A;  2Y84 A;  3TTN A;  1LBC A;  3ILU B;  5HM4 B;  2RIN A;  2GRV A;  4G8N A;  1SQY A;  3RQT A;  2UYE A;  3K1P A;  3VFJ A;  1PB8 A;  1POT A;  3DP6 A;  2OBG A;  3FXQ A;  4PE5 B;  4IGT A;  3WAF A;  3S9M C;  2F8D A;  3K6U A;  2Q2A A;  1MY1 A;  3O66 A;  3PGF A;  2XD2 A;  2DWH A;  5DYH A;  5EYF A;  5JTY A;  3K0V A;  1D9Y A;  3MVY A;  3N6U A;  1ATG A;  2V3Q A;  2DVC A;  2ZNS A;  2O1L A;  1NNP A;  1P1U A;  2R6G E;  2F35 A;  5H8H B;  1B6H A;  1ZU0 A;  3JV9 A;  4XKR A;  4X9T A;  5HPQ A;  3IJX B;  3OEN A;  4FJP A;  4ZS9 A;  4DZ1 A;  3TCH A;  5CC2 A;  3M8U A;  1Z7M E;  1MDP 1;  1UIV A;  2PX1 A;  2DXY A;  3MWB A;  3IB2 A;  2Z8E A;  3IOT A;  1B3E A;  4R73 A;  4ELQ A;  2DP8 A;  1BKA A;  3OSQ A;  3UIF A;  3CG3 A;  3KOS A;  4O3A A;  4F31 B;  3RTW B;  1ZIU A;  2DE2 A;  3K2D A;  1QVS A;  3F11 A;  2CZL A;  2E1S A;  2X26 A;  3IR1 A;  4PFW A;  3V83 A;  1US5 A;  3FZV A;  1PEB A;  1B9J A;  4IO2 A;  2OWS A;  4POX A;  2E0S A;  1VE4 A;  3FAS A;  3O2A A;  1BTJ A;  2VGQ A;  4LA9 A;  3SDF A;  2I6E A;  3PD8 A;  1B3H A;  3H6T A;  3S9L C;  2H98 A;  1B7Z A;  4NMY A;  4YB6 A;  2GHA A;  2I4C A;  3V5A A;  4PFT A;  3SKP A;  1S7Y A;  2RC9 A;  4YAH X;  4HTG A;  4GF8 A;  2O84 X;  4E0X A;  2F6P A;  3FVN A;  2XXT A;  3HPI A;  4FOR A;  1URS A;  3UP9 A;  4F2Q A;  4ZE9 A;  3VE1 B;  1M5B A;  4F22 A;  2HZK A;  3KJ7 A;  3CRB A;  3CSG A;  4GD5 A;  3T9H B;  1Y3P A;  3DP4 A;  3OOA A;  4LZ5 A;  1H44 A;  4P11 A;  5FTH A;  1B51 A;  3TMG A;  4MBP A;  1GVC A;  5I2N A;  3TEP A;  1B52 A;  3MP6 A;  4F1Y A;  1AMF A;  3RGY A;  4FEB A;  4NF4 A;  4UAC A;  3UGW A;  3TTK A;  4F19 A;  3H06 B;  2I0C A;  4LVQ A;  1FTO A;  2RC7 A;  4X1D A;  1Y20 A;  1MY4 A;  2A5T A;  3M3L A;  2DE4 A;  3QUJ A;  4AB5 A;  3T9X B;  4OEV A;  3HN0 A;  5FHO A;  1SW2 A;  3KFM A;  2NUV A;  3TCG A;  2UYF A;  3BKI B;  1ZMG A;  1Y4C A;  2QL3 A;  3FJG A;  1ZLQ A;  4NTL A;  1MY3 A;  4ESX A;  2VOZ A;  3PPP A;  1MXU A;  1URG A;  3RPW A;  2AYS A;  3H6V A;  1P99 A;  3RTF B;  5I58 B;  5H8F B;  3G3G A;  1ANF A;  5B7D A;  3O6I A;  4XKP A;  1XHY A;  2P0S A;  4LON B;  2Y7R A;  4PQJ A;  5TPA B;  2B65 A;  4R2F A;  1OIB A;  1LAF E;  1OVB A;  3PMV A;  4X1B A;  3U94 A;  2XXW A;  1JNF A;  5KDT A;  3IX1 A;  3LC8 A;  4Q30 B;  4YKJ A;  1LAX A;  4I1D A;  2HQ0 A;  3IO4 A;  2I49 A;  2VHA A;  3ONM A;  1GR2 A;  3FGS A;  4MLQ A;  3SES A;  5KDT B;  3PUV E;  1LB8 A;  4ZEK A;  4U22 A;  1SYH A;  1Q1K A;  3LSL A;  4FE8 A;  4F29 A;  1XVX A;  1SD3 A;  1TWY A;  2Q8J A;  1JW4 A;  4BDL A;  3KSJ A;  3FAT A;  5KCJ A;  3BFU A;  3MBP A;  4ZE8 A;  3SEU A;  3FJ7 A;  5CRY A;  3U92 A;  2ONR A;  3CVG A;  2IA4 A;  1IQ7 A;  2UVI A;  3RY3 A;  3E9X A;  4NF6 A;  2QJE A;  4XKN A;  4IGR A;  1FQF A;  4KD5 A;  4ZED A;  3MVZ A;  5FTI A;  3V8X B;  1A55 A;  5TP9 A;  3PV0 E;  4OET A;  2A5T B;  1LLS A;  1O7T A;  2OK2 A;  4HCW A;  4YZZ A;  3TYH A;  4OTE A;  1B3L A;  2I4B A;  3O6G A;  4ZEF A;  4QFK A;  1GV8 A;  1TT1 A;  5JK4 A;  4H65 A;  2DOJ A;  3EN3 A;  4BDR A;  4E0W A;  1N7X A;  3L6G A;  3H03 A;  4YIC A;  1AIV A;  1LAG E;  4EF1 A;  4KCC A;  3C9H A;  1B1H A;  4JSD A;  1PDA A;  1RYO A;  2REJ A;  4JWY A;  3VVE A;  4DXU A;  3ZSF A;  4GIZ A;  3RN8 A;  1XT8 A;  5I56 A;  5I2K B;  2O6A A;  3TEL A;  1B58 A;  1USY H;  4I9D A;  5FHM A;  3VLV A;  1QJM A;  2QPQ A;  2B3F A;  4GXA A;  4NF5 A;  2R9J A;  4H5G A;  4WKM A;  1YTV A;  1YCJ A;  3THI A;  2PYY A;  3G3H A;  4JWO A;  5I2K A;  3D4G A;  1MXZ A;  3H6W A;  4F3B A;  1T0K A;  3W9W A;  4PET A;  1M5E A;  1M5D A;  3P7I A;  4NF5 B;  3L6H A;  4M1V A;  1LGB C;  2XHD A;  3MPK A;  4LP2 B;  4N13 A;  4GWO A;  1SDX A;  1SW4 A;  4QHQ A;  4GRK A;  1MG1 A;  4RXL A;  5H8Q B;  4F1U A;  1AL3 A;  3MZ1 A;  2QMW A;  5H8N B;  3N6T A;  5TPA A;  1QKA A;  2YJP A;  2UVH A;  3C33 A;  4R6K A;  5DT6 A;  3C31 A;  2NWJ A;  4FAJ A;  2HAV A;  1LFI A;  2V3U A;  3T9U A;  5BUU A;  4ELO A;  3JZJ A;  4G2Z A;  4BLA A;  5A5X B;  2HFB A;  4U1Z A;  4KHZ E;  5TP9 B;  3CFL A;  2XX8 A;  4YKK A;  3IL1 B;  5AA2 B;  2F7B A;  3S9N C;  1MY0 A;  2H25 A;  4AQ4 A;  4WXJ A;  1JVY A;  1II5 A;  4Q5T A;  1XS5 A;  1FQA A;  4YKI A;  4ZEB A;  1L5T A;  5DVJ A;  5L8D A;  4AB6 A;  4R75 A;  4RPO A;  2F36 A;  4OZ9 A;  4EQ9 A;  2QS1 A;  1LAH E;  5AA2 A;  1DOT A;  1YAE A;  4ZEI A;  3UA8 A;  1NH8 A;  4TLL B;  3TAJ A;  5DVI A;  3RT8 A;  3CR9 A;  3T93 B;  3LSF B;  5H8F A;  2BJJ X;  3W15 C;  2Q2C A;  4QSD A;  1B2H A;  2Q89 A;  3JYR A;  4FED A;  4DE8 A;  1PC3 A;  4F39 A;  5ELV A;  1H3D A;  5KZT A;  2V84 A;  1MRP A;  4OFO A;  2XXU A;  2QS4 A;  2VD3 A;  4KYS A;  1HSJ A;  4U23 A;  4ONY A;  3KZG A;  1LCF A;  4JB7 A;  3K6W A;  3U93 A;  5L9O A;  4G8M A;  2YPN A;  2YLN A;  1A54 A;  1KWH A;  1IXG A;  2HCA A;  2HAU A;  3A3C A;  2F5X A;  4JWX A;  4IO5 A;  3DM0 A;  5H8Q A;  3RNN A;  3G3J A;  4ISU A;  4OES A;  3VVF A;  3SEV A;  3FUZ A;  4EF2 A;  2XXI A;  3Q29 A;  1MH3 A;  1P1W A;  3HV1 A;  4F3S A;  2V25 A;  3W9V A;  3O28 A;  3O29 A;  2OCU A;  4DXC A;  2HZL A;  2D3I A;  4EQ7 A;  1EH3 A;  2V3T A;  2ZYM A;  3QXM A;  3PD9 A;  4GVO A;  4JSO A;  3HO7 A;  2QS3 A;  3Q27 A;  3QSL A;  4QFO A;  1B5I A;  5I57 B;  2DXR A;  4C1U A;  5J1D A;  3N94 A;  4XXU A;  4ZEC A;  2D21 A;  5HBC A;  1B7U A;  5I2N B;  4XTC Q;  3GBB A;  3DP8 A;  1LFG A;  2O69 A;  3D4C A;  3TTL A;  5I59 B;  5IAI A;  1D4N A;  5CBR A;  5JEI A;  1OMP A;  3QIM A;  1DPP A;  1MPC A;  3PPQ A;  4RJZ A;  4RNS A;  4ELP A;  1MM6 A;  4OHN A;  2XX7 A;  3I3V A;  4Q0C A;  4H6D A;  5H8N A;  4OFJ A;  2WKY A;  3QUF A;  4OVJ A;  4BDM A;  2Y7I A;  2OZZ A;  5A5X A;  3FVG A;  1MXX A;  3KGC A;  5ITO A;  3FV1 A;  1VFE A;  1N7W A;  3C32 A;  4TOZ A;  3HHG A;  3C4M A;  2XXP A;  3MQ9 A;  3T22 A;  4I8C A;  5I59 A;  3R26 A;  4H8I A;  1I6B A;  2DWJ A;  3H3G A;  4POW A;  1MQI A;  1OQG A;  2OLB A;  1P1O A;  2PT2 A;  3HHF A;  4IO4 A;  3TQL A;  4P0I A;  5CMC A;  1N76 A;  3K6X A;  3EF7 A;  1TFA A;  3QAX A;  4ECF A;  4YMA A;  1J1N A;  2OWT A;  5JTY B;  4RPN A;  1OLA A;  3PUW E;  2RC8 A;  1R1N A;  2QMX A;  4NF8 B;  1VR5 A;  2XD3 A;  2G29 A;  4IY5 A;  2RKM A;  3K1M A;  3O9P A;  3E3K A;  1WOD A;  1QKB A;  4QSE A;  3DLN A;  1OLC A;  4FAT A;  4NF8 A;  1B0L A;  1NL5 A;  4LAT A;  1ZTY A;  2FA7 A;  4QFP A;  4QSC A;  5DVF A;  3KG2 A;  1SYI A;  4HW8 A;  3T9V A;  1I69 A;  5EHM A;  4OXV A;  3C35 A;  3H4Z A;  1BLF A;  3FJM A;  3IB1 A;  3EPE A;  2REG A;  1PBP A;  3TTM A;  2AIX A;  4KI0 E;  2XX9 A;  2THI A;  4IO6 A;  2O51 A;  3EHT A;  2XXY A;  1ELJ A;  3PPN A;  2F78 A;  4THI A;  4LZ8 A;  3CIJ A;  2V93 A;  4IY6 A;  3BFT A;  1NKX A;  2PVU A;  2ZYO A;  4GFR A;  4H67 A;  4GQO A;  1MXW A;  1DTG A;  4QFL A;  1MM7 A;  3EHS A;  4BDN A;  3G3I A;  1D9V A;  2AL4 A;  2DVZ A;  4RA1 A;  1SI1 A;  3MVX A;  4OWD A;  4ZDM A;  2ANJ A;  5AA1 A;  5CMK A;  3IK6 B;  1NFT A;  1OQH A;  3C36 A;  4GL0 A;  1A8E A;  1CE2 A;  1DPE A;  1QUL A;  2I3W A;  3IOR A;  4R6Y A;  1MQG A;  1SI0 A;  2X7Q A;  4LQ5 A;  3IO6 A;  3FIR A;  1R9Q A;  3OEM A;  4EQB A;  1R6Z A;  3M3F A;  1N0T A;  3IOV A;  2R71 A;  4LZ7 A;  4NWC A;  5AA3 A;  2ONK E;  4GOT A;  1A99 A;  2CMO A;  1QW0 A;  3M3K A;  4IO7 A;  3TTR A;  5BWJ A;  3A3U A;  3S9E A;  5F1Q A;  3G3F A;  1B5J A;  2ZNU A;  4F2O A;  3IB0 A;  4PP0 A;  3A09 A;  1PBQ A;  1D3K A;  1FTM A;  5AA2 D;  5I57 A;  5ITP A;  3VLW A;  4RK9 A;  3ZKK A;  3U1O A;  3RT6 B;  1QUI A;  2RF1 A;  3H6U A;  4GL8 A;  4PFU A;  1S50 A;  4LUB A;  2UVJ A;  2W7Y A;  5DEX A;  1N04 A;  1UTB A;  2ESN A;  1FQE A;  1CB6 A;  1USY E;  4R74 A;  1SVX B;  2DWA A;  1ZKB A;  1Y9U A;  5H8S A;  2ZYK A;  4G68 C;  1IIT A;  2ZYN A;  2D5W A;  2FNC A;  4X48 A;  2Z23 A;  1PB7 A;  1PB9 A;  3MZB A;  3IAZ A;  1F9B A;  4FIM A;  2ZXT A;  1NNT A;  1OVT A;  2O1M A;  5TU0 A;  1Y1M A;  1FQD A;  2Z8D A;  2DQV A;  2F34 A;  3OO8 A;  3PUX E;  2G93 A;  3UOR A;  5AA4 B;  1EZP A;  1GGG A;  1S9T A;  1SW1 A;  1US4 A;  1NMU A;  4OEN A;  1POY 1;  4OEU A;  3KN8 A;  4EXK A;  3ECR A;  3G3K A;  1IXH A;  1NNK A;  2F6G A;  3B7D A;  3LSW A;  3MC2 A;  4OFL A;  5CMM A;  4H0W A;  3SEX A;  4F3P A;  1FTJ A;  1JW1 A;  4KYD A;  1B05 A;  3FV2 A;  2I58 A;  1N3X A;  4HS7 A;  1Y1Z A;  3MJN A;  4OQO A;  4F3G A;  1AH5 A;  4JBZ A;  3O97 A;  2Q88 A;  4DCX A;  2UXA A;  2DYX A;  1B4H A;  4LQ2 A;  4DXB A;  1NH7 A;  4OMB A;  2Y7P A;  3SEW A;  1WVJ A;  5F7V A;  4F1V A;  1XVY A;  3K1N A;  2RCA A;  3MAM A;  1I6Q A;  4I62 A;  3VV5 A;  4H8J A;  5AE4 A;  2GH9 A;  3VVD A;  4UA8 A;  4NF6 B;  4YMB A;  2KLF A;  3FVK A;  3V89 B;  4ELR A;  1MDQ A;  1O64 A;  1SW5 A;  3K00 A;  3R6U A;  3MW0 A;  4DDD A;  2H9B A;  3OD7 A;  3MPL A;  5M2V A;  1B32 A;  1IUD A;  3GXA A;  3O6H A;  1MPD A;  1HSL A;  3LUY A;  1LST A;  3HCQ A;  4U1O A;  4ESW A;  2FYI A;  4JDF A;  1FQB A;  4H1X A;  3CFX A;  1BIY A;  3GBA A;  4DIG A;  1O63 A;  1BP5 A;  3GZG A;  2I0B A;  3MVW A;  1VSO A;  2DS9 A;  4U21 A;  1DTZ A;  3B6T A;  3OO7 A;  4YB7 A; 
#chains in the Genus database with same CATH topology
 5LTC A;  1NV5 A;  5IGA A;  4YB5 A;  4JXI A;  3PUY E;  4C1T A;  4ZZA A;  1NV1 A;  2H5Y A;  3LBS A;  3LUZ A;  3C34 A;  4ZE8 A;  1NUY A;  5DEX B;  1A7L A;  4OVR A;  3E4R A;  2MKZ A;  3ZKL A;  4NE4 A;  1FJ6 A;  3IOW A;  4N8G A;  3MUQ A;  2P1S A;  3B6W A;  3TCF A;  4N15 A;  3Q25 A;  4JVD A;  4Q8R A;  1LFH A;  2M8C A;  3KEI A;  3T66 A;  4P8B A;  1IEJ A;  4PDH A;  4OAN A;  3G7W A;  3KSX A;  1ZBM A;  2LAO A;  1MQJ A;  1AWB A;  3OMB A;  4Z0I A;  2DE3 A;  5ISU A;  1MXY A;  2B4M A;  4DLD A;  4R9G A;  3KJT A;  2H4I A;  3HST A;  3UN6 A;  3B6Q A;  1UQW A;  1ZJL A;  4GX4 A;  2Y7W A;  4U4X A;  4K3F A;  2XXQ A;  4YU0 A;  3TKD A;  4GX3 A;  4F18 A;  1MQH A;  4O94 A;  2VD2 A;  3ILT B;  4G8H A;  2A5S A;  3KBR A;  4R2B A;  3I5O A;  4PBQ A;  4N6P A;  4ZZE A;  3K4U A;  1MQD A;  2CZI A;  5AA4 A;  3N5L A;  3S4U A;  1A8F A;  3PU5 A;  3SET A;  1MY2 A;  4G77 A;  4OYV A;  2DSF A;  4KPT A;  1JQF A;  2GFE A;  3ILU B;  2GRV A;  4G8N A;  2UYE A;  3K1P A;  1PB8 A;  4PE5 B;  2OBG A;  2XA5 A;  2F8D A;  4GBW A;  1MY1 A;  3PGF A;  2FIE A;  2XD2 A;  1YYZ A;  3K0V A;  1D9Y A;  1ATG A;  2ZNS A;  1NNP A;  4XKR A;  4X9T A;  3IJX B;  3M8U A;  1MDP 1;  1UIV A;  3IB2 A;  4PAK A;  1ZIU A;  2DE2 A;  4PFW A;  3IR1 A;  1US5 A;  3FZV A;  2OWS A;  3O2A A;  1B3H A;  4NMY A;  1SPI A;  2RC9 A;  2F6P A;  3HPI A;  1URS A;  3T9H B;  1GVC A;  1AMF A;  1FBH A;  4MMP A;  1EYJ A;  2KQZ A;  4LVQ A;  2A5T A;  4OEV A;  3HN0 A;  2UYF A;  1Y4C A;  2QL3 A;  3FJG A;  4PC9 A;  1URG A;  3RPW A;  3H6V A;  3RTF B;  5I58 B;  3G3G A;  5B7D A;  4XKP A;  1XHY A;  5LDZ A;  2B65 A;  1OIB A;  1LAF E;  1OVB A;  5IZ3 B;  5KDT A;  3LC8 A;  4Q30 B;  4I1D A;  4XF5 A;  1GR2 A;  3FGS A;  4MLQ A;  4N6K A;  1LB8 A;  4F29 A;  1SD3 A;  1TWY A;  3FAT A;  2CEY A;  5CRY A;  2ONR A;  4NAP A;  2UVI A;  2QJE A;  4IGR A;  3HFU A;  3V8X B;  3PV0 E;  1O7T A;  4H65 A;  3EN3 A;  5EQA A;  1LAG E;  1FBP A;  1RYO A;  4GIZ A;  5I56 A;  1USY H;  4I9D A;  4WKM A;  2R9J A;  1YCJ A;  5I2K A;  2PYY A;  1FRP A;  3D4G A;  1EYI A;  3H6W A;  3P7I A;  4OVS A;  2XHD A;  4F1U A;  1MG1 A;  2F3B A;  2QMW A;  3C31 A;  3T9U A;  1EYK A;  1FJ9 A;  4U1Z A;  4KHZ E;  2F7B A;  2H25 A;  1II5 A;  1XS5 A;  1FQA A;  2F36 A;  1LAH E;  4ZEI A;  5DVI A;  3RT8 A;  5H8F A;  4F39 A;  5KZT A;  2V84 A;  4X04 A;  2VD3 A;  4KYS A;  1K9Y A;  3KZG A;  4JB7 A;  1IXG A;  2HCA A;  2HAU A;  1IMA A;  3E78 A;  3RNN A;  4OES A;  1MH3 A;  3HV1 A;  4F3S A;  2OCU A;  2QS3 A;  3Q27 A;  3QSL A;  3N94 A;  1LFG A;  2O69 A;  5I59 B;  5JEI A;  2F3D A;  1OMP A;  1DBZ A;  1DPP A;  4Q0C A;  4BDM A;  2OZZ A;  1MXX A;  3FV1 A;  5I59 A;  2XXP A;  4H8I A;  4POW A;  3H3G A;  1MQI A;  3TQL A;  2OLB A;  1P1O A;  4IO4 A;  3K6X A;  3QAX A;  2OWT A;  5JTY B;  2RC8 A;  2QMX A;  2XD3 A;  2G29 A;  3K1M A;  1WOD A;  1QKB A;  4QFP A;  1SYI A;  5EHM A;  4OXV A;  3C35 A;  1IMD A;  3H4Z A;  3EPE A;  2REG A;  1PBP A;  1YXI A;  4KI0 E;  3TTM A;  2XX9 A;  2THI A;  3EHT A;  4THI A;  4LZ8 A;  3CIJ A;  2V93 A;  3BFT A;  4H67 A;  4GQO A;  3EHS A;  4BDN A;  3G3I A;  1D9V A;  2DVZ A;  1SI1 A;  2ANJ A;  3IK6 B;  3C36 A;  1DPE A;  4R6Y A;  5I5P A;  3OEM A;  1N0T A;  3IOV A;  2R71 A;  4GOT A;  2XWV A;  3TTR A;  3A09 A;  1FTM A;  1KA0 A;  1FPJ A;  4RK9 A;  4PFU A;  4LUB A;  2W7Y A;  4FBP A;  2ESN A;  1CB6 A;  4GWZ A;  5H8S A;  4G68 C;  2D5W A;  5TU0 A;  1Y1M A;  2ZZX A;  5AA4 B;  4OEU A;  1US4 A;  4EXK A;  3KN8 A;  5CMM A;  3LSW A;  3B7D A;  4GWS A;  1FBD A;  1FTJ A;  3FV2 A;  2I58 A;  1Y1Z A;  3MJN A;  5I7I A;  1AH5 A;  1NH7 A;  4OMB A;  3PTY A;  1XVY A;  2RCA A;  4UA8 A;  3FVK A;  1SW5 A;  3OD7 A;  1B32 A;  1LST A;  4ESW A;  4JDF A;  2CEX A;  4IR8 A;  4MIJ A;  1BP5 A;  3MVW A;  2I0B A;  4OA4 A;  3TEP A;  3UGW A;  4YB7 A;  2QSX A;  1LCT A;  2ONS A;  4U4S A;  1QGX A;  4G4P A;  4QF9 A;  1H76 A;  1MH4 A;  4MF3 A;  5I56 B;  2F97 A;  3MP1 A;  3K01 A;  4WED A;  3ODB A;  4PGP A;  3SER A;  3TZA A;  1MPB A;  3ROJ A;  4OER A;  1N3W A;  3CFZ A;  1EU8 A;  4MCO A;  2CZH A;  4PFY A;  4NX1 A;  3VXC A;  3U8Q A;  2XXX A;  1XOC A;  3OSR A;  4IO3 A;  1IMB A;  5K2X A;  4DCY A;  1XC1 A;  5L9M A;  3RLF E;  5CM6 A;  2WBD A;  4KCD A;  1UTB B;  1UTH A;  2VPN A;  3Q28 A;  1JW5 A;  2PMS A;  2O7U A;  4R9F A;  1DTZ A;  3KBZ A;  3A29 A;  4OVP A;  4HCY A;  2B3B A;  2RCB A;  2ALU A;  3CI8 A;  3I6V A;  1FPK A;  5ICQ A;  2HEU A;  2ZNT A;  3EHU A;  1M5F A;  1EZ9 A;  1NV6 A;  3PUZ E;  3S2V A;  2X7P A;  1EZO A;  1Y3Q A;  3WAE A;  1H43 A;  4RY1 A;  4ND9 A;  2QVV A;  3KOT A;  4HE1 A;  4KQP A;  3PPR A;  4EDP A;  1FPB A;  4BDO A;  3OEL A;  3U72 A;  4RYA A;  1P1N A;  1B0H A;  1I6A A;  3CG1 A;  3FXU A;  3U65 A;  4YKP A;  1FCK A;  4GLI A;  4O3B A;  3SEY A;  1B7H A;  2XXH A;  2H99 A;  1JEU A;  2DWI A;  3OEK A;  3Q26 A;  5HM4 B;  1LBC A;  2RIN A;  3DP6 A;  3FXQ A;  4IGT A;  3K6U A;  2DWH A;  2V3Q A;  5H8H B;  2FVZ A;  2R6G E;  2F35 A;  1B6H A;  3JV9 A;  4ZS9 A;  4DZ1 A;  4R73 A;  2Z8E A;  3IOT A;  3CG3 A;  3RTW B;  2ZZW A;  1Q9D A;  3V83 A;  4POX A;  5A5L A;  2VGQ A;  3PD8 A;  4YB6 A;  1B7Z A;  3V5A A;  1S7Y A;  4YAH X;  4E0X A;  2O84 X;  3UP9 A;  3VE1 B;  3KJ7 A;  5L9S A;  3OOA A;  4MBP A;  4OVT A;  3MP6 A;  4NF4 A;  2Q8M A;  3TTK A;  4F19 A;  1FTO A;  1RDZ A;  3T9X B;  2NUV A;  3BKI B;  4NTL A;  2VOZ A;  3O6I A;  2P0S A;  3PMV A;  1JNF A;  3IX1 A;  2BJI A;  4YKJ A;  3RPL B;  1LAX A;  4X8R A;  2I49 A;  5KDT B;  1FBC A;  3PUV E;  4U22 A;  1SYH A;  4BDL A;  3MBP A;  5ET5 A;  3E9X A;  1FPL A;  4XKN A;  1FQF A;  3ISP A;  3MVZ A;  1A55 A;  5TP9 A;  3CHG A;  2A5T B;  1LLS A;  4YZZ A;  1B3L A;  2KR0 A;  3O6G A;  1IME A;  1TT1 A;  1KZ8 A;  2DOJ A;  1DK4 A;  4N4U A;  1N7X A;  4YIC A;  4KCC A;  2REJ A;  1D9Q A;  5FHM A;  1QJM A;  2QPQ A;  4GXA A;  4NF5 A;  4PFB A;  4GWW A;  3RPL A;  3THI A;  4PAF A;  1FSA A;  4F3B A;  1LBW A;  1MXZ A;  1M5E A;  4M1V A;  4LP2 B;  4GWO A;  5H8Q B;  4RXL A;  1AL3 A;  3MZ1 A;  5TPA A;  2YJP A;  2UVH A;  4XFE A;  5DT6 A;  5BUU A;  2HAV A;  4ELO A;  4BLA A;  1FBF A;  5AA2 B;  3S9N C;  4AQ4 A;  1JVY A;  4Q5T A;  2R8T A;  4YKI A;  4ZEB A;  2QFL A;  5DVJ A;  5L8D A;  4R75 A;  3UA8 A;  3TAJ A;  2BJJ X;  1B2H A;  1FBE A;  3JYR A;  4FED A;  1H3D A;  5L9O A;  3D1R A;  3GYY A;  4G8M A;  1FPF A;  4JWX A;  5H8Q A;  4ISU A;  5ESY A;  3FUZ A;  3O28 A;  1EH3 A;  2ZYM A;  4QFO A;  5I57 B;  2DXR A;  4QXD A;  2D21 A;  5HBC A;  3GBB A;  3DP8 A;  4NF0 A;  2XX7 A;  3I3V A;  4OVJ A;  2Y7I A;  3KGC A;  5ITO A;  1VFE A;  1N7W A;  3C32 A;  3T22 A;  4MHF A;  4I8C A;  4I3E A;  2PT2 A;  5CMC A;  4I3Y A;  4PFI A;  1OLA A;  1R1N A;  4NF8 B;  3E3K A;  5DVF A;  2FA7 A;  1I69 A;  4AS4 A;  4P1E A;  2AIX A;  3PPN A;  1ELJ A;  2ZYO A;  4QFL A;  3MVX A;  5EYH A;  1CE2 A;  2I3W A;  3IO6 A;  2VT5 A;  3FIR A;  1R6Z A;  3M3K A;  3A3U A;  5F1Q A;  1PBQ A;  3EKI A;  2WBB A;  5ITP A;  1LEV A;  3RT6 B;  4GL8 A;  1S50 A;  1FQE A;  4R74 A;  1SVX B;  2DWA A;  1ZKB A;  3FBP A;  2ZYK A;  1IIT A;  2ZYN A;  2FNC A;  4X48 A;  2Z23 A;  3MZB A;  1F9B A;  2O1M A;  5FBP A;  1FQD A;  3PUX E;  2DQV A;  2FHY A;  1SW1 A;  1POY 1;  3ECR A;  3G3K A;  1NUZ A;  1NNK A;  2F6G A;  3T0J A;  1JW1 A;  1N3X A;  4OQO A;  4F3G A;  3O97 A;  2Q88 A;  4DXB A;  2Y7P A;  1NV0 A;  1XI6 A;  3V89 B;  3B8B A;  4DDD A;  5EQ8 A;  5EQ9 A;  5M2V A;  5IZZ A;  3GXA A;  1MPD A;  3CFX A;  4DIG A;  1O63 A;  2DS9 A;  4U21 A;  1FQC A;  1FTL A;  4NWD A;  1H45 A;  4KR5 A;  4TQU Q;  1MS7 A;  5CBS A;  1LB9 A;  2QVU A;  3DEL B;  4H5F A;  4AS5 A;  1AOV A;  1B46 A;  2O7I A;  4FEC A;  5LOM A;  2NVU B;  2HHM A;  4PDD A;  1A40 A;  4NF4 B;  4PF6 A;  3N26 A;  5KCJ B;  2PCR A;  4GBV A;  1FTK A;  1URD A;  3E13 X;  1Y3N A;  5CMB A;  3LSX A;  1MXV A;  4QRZ A;  4QFN A;  3TDJ A;  2QRY A;  2PBW A;  1LBZ A;  3K02 A;  2PFY A;  2I3V A;  1RDX A;  1QUJ A;  1FPG A;  3EQ1 A;  3TFL A;  2VP1 A;  4XKQ A;  3VDF A;  4M4G A;  5IM2 A;  4GWX A;  1FW0 A;  3FD3 A;  5DTB A;  3LR1 A;  5IKB A;  1B3F A;  1UTH B;  2UVG A;  4BDQ A;  4HE0 A;  4NGU A;  3OXN A;  4KYE A;  5H8H A;  4IB2 A;  1JEV A;  3RUM A;  1JVX A;  2Y7K A;  2PT1 A;  4PAI A;  1Z7N E;  1IIW A;  4HW8 A;  3QYT A;  4U2R A;  4GXS B;  4P0G A;  1IXI A;  4KXP A;  3MZ9 A;  1TXF A;  4NED A;  1NNF A;  4MFI A;  4G68 B;  4HE2 A;  2OX3 A;  2F7A A;  4P47 A;  4WEP A;  4R6H A;  1NV2 A;  2F7C A;  3UK4 A;  3TPA A;  5IZ3 A;  2JJK A;  2GHB A;  1K9Z A;  5I58 A;  1VFD A;  5B70 A;  1CNQ A;  3T96 B;  2OJT A;  2Y84 A;  3TTN A;  1SQY A;  1INP A;  3VFJ A;  1POT A;  1JP4 A;  4H46 A;  2Q2A A;  5ET8 A;  5EYF A;  3MVY A;  2DVC A;  1P1U A;  1ZU0 A;  3OEN A;  5CC2 A;  3TCH A;  4UAB A;  2DXY A;  3MWB A;  1B3E A;  2DP8 A;  1BKA A;  3OSQ A;  3KOS A;  1QVS A;  2CZL A;  2E1S A;  1FBG A;  1PEB A;  1B9J A;  4IO2 A;  4MX6 A;  4N6D A;  4LA9 A;  5T3J A;  3FVN A;  4FOR A;  1M5B A;  3CRB A;  3CSG A;  4P11 A;  5FTH A;  1B51 A;  1NV4 A;  3QMF A;  1B52 A;  4FEB A;  4UAC A;  3FXB A;  3H06 B;  2I0C A;  2RC7 A;  1Y20 A;  3M3L A;  2DE4 A;  3QUJ A;  4AB5 A;  5FHO A;  1SW2 A;  3KFM A;  2WEF A;  3TCG A;  1ZMG A;  3IFA A;  1MXU A;  1NV3 A;  2AYS A;  1P99 A;  1ANF A;  4N8Y A;  2Y7R A;  4PQJ A;  5TPA B;  4R2F A;  4X1B A;  1NUW A;  2OWZ A;  2HQ0 A;  3IO4 A;  2VHA A;  1LBV A;  3ONM A;  4N81 A;  3SES A;  5I3S A;  4MAG A;  4FE8 A;  1XVX A;  2Q8J A;  1JW4 A;  5KCJ A;  3BFU A;  4PF8 A;  3SEU A;  3FJ7 A;  1IQ7 A;  3RY3 A;  4ZED A;  4OET A;  3TYH A;  2OK2 A;  4ZEF A;  4BDR A;  2WX9 A;  3H03 A;  2Y5K A;  1B1H A;  1PDA A;  4DXU A;  3VVE A;  3RN8 A;  2O6A A;  3TEL A;  4N17 A;  1B58 A;  3VLV A;  3MYU A;  2B3F A;  4H5G A;  1T0K A;  4P1L A;  3MST A;  3KC0 A;  3W9W A;  1M5D A;  4GWY A;  1SW4 A;  4QHQ A;  1YZ0 A;  3N6T A;  1QKA A;  4FAJ A;  3C33 A;  2V3U A;  3JZJ A;  2HFB A;  5TP9 B;  3IL1 B;  1MY0 A;  4WXJ A;  4PGN A;  1L5T A;  4OZ9 A;  5AA2 A;  1IMC A;  1NH8 A;  4TLL B;  3T93 B;  1BK4 A;  3CR9 A;  4QSD A;  2Q89 A;  4DE8 A;  1PC3 A;  5ELV A;  4OFO A;  1MRP A;  2XXU A;  4MEV A;  4PBH A;  4ONY A;  5EYG A;  1LCF A;  2ZZV A;  2YPN A;  2YLN A;  1KWH A;  4IO5 A;  3IFC A;  3VVF A;  3SEV A;  4O7I A;  3Q29 A;  1P1W A;  3RYD A;  3O29 A;  4EQ7 A;  2HZL A;  2D3I A;  4GVO A;  3PD9 A;  4JSO A;  3HO7 A;  4C1U A;  4DI3 D;  5I2N B;  4XTC Q;  3D4C A;  2P3V A;  4JVI A;  1MPC A;  4RJZ A;  3PPQ A;  2VPO A;  5BWJ A;  4H6D A;  5H8N A;  4OFJ A;  2WKY A;  4P3L A;  4TOZ A;  3HHG A;  3C4M A;  3R26 A;  1OQG A;  3BIH A;  4P0I A;  1N76 A;  3EF7 A;  4RPN A;  4I40 A;  4IY5 A;  2RKM A;  3O9P A;  3DLN A;  4FAT A;  4NF8 A;  1NL5 A;  4QSC A;  4PCD A;  3T9V A;  4NG7 A;  1BLF A;  2XXY A;  2PVU A;  4GFR A;  1MXW A;  1DTG A;  2AL4 A;  4ZDM A;  4OWD A;  4GL0 A;  3IOR A;  1SI0 A;  2X7Q A;  4NWC A;  2CMO A;  1QW0 A;  4IO7 A;  1B5J A;  2ZNU A;  3IB0 A;  4PP0 A;  1D3K A;  3ZKK A;  2RF1 A;  3H6U A;  2UVJ A;  1N04 A;  1USY E;  4PTK A;  1IMF A;  1PB7 A;  1PB9 A;  2ZXT A;  1NNT A;  1OVT A;  2Z8D A;  1EZP A;  2F34 A;  3OO8 A;  3UOR A;  2G93 A;  4OEN A;  5J16 A;  4N91 A;  1IXH A;  4OFL A;  4H0W A;  3SEX A;  4F3P A;  4KYD A;  1B05 A;  4HS7 A;  4GWU A;  4DCX A;  2UXA A;  2DYX A;  4LQ2 A;  1WVJ A;  5F7V A;  3MAM A;  3VV5 A;  1G0H A;  4H8J A;  2GH9 A;  3VVD A;  4YMB A;  2KLF A;  1MDQ A;  1O64 A;  3R6U A;  5F24 A;  4G61 A;  3MPL A;  1HSL A;  3LUY A;  4U1O A;  1FQB A;  4H1X A;  1BIY A;  2WYK A;  1VSO A;  3B6T A;  4NN3 A;  3PMX A;  1B3G A;  4MJO A;  3VLU A;  2XWI A;  4MH5 A;  1FPD A;  1WDN A;  2O68 A;  2P2A A;  1FPI A;  1SBP A;  4F1V A;  3AXF A;  5H8N B;  2NXO A;  3QK6 A;  3TUS A;  3GLB A;  5ICT A;  1UIU A;  3FXR A;  3KN7 A;  4EUO A;  1LBX A;  1QUK A;  2HXW A;  1IXC A;  1B1X A;  1P1Q A;  3CSB A;  5FHN A;  3PPO A;  4KFQ A;  2I48 A;  3VXB A;  2QS2 A;  5K2Y A;  4MNI A;  1LBY A;  3BBR A;  1DSN A;  3USD A;  2Q9T A;  3TQW A;  1Y4T A;  1LBB A;  1DCU A;  3PMW A;  1Q35 A;  3OO9 A;  1YPN A;  2ZMB A;  3ZS6 A;  2IEE A;  4EXL A;  1GTK A;  4O7M A;  2NOO A;  2Z22 A;  1M5C A;  3MP8 A;  3R7X A;  2XXV A;  4O3C A;  2ABH A;  4R72 A;  4N07 A;  4XIG Q;  5CI5 A;  4MLV A;  1RYX A;  1HSE A;  5IZ1 A;  2HXR A;  4C0R A;  3FVO A;  1B4Z A;  4DI4 B;  1B40 A;  2Z8F A;  5EHS A;  1JET A;  3TOD A;  4L17 A;  3K6V A;  2HPG A;  1DMB A;  3OO6 A;  1N84 A;  2AL5 A;  2XXR A;  4G68 A;  3OO7 A;  3IOU A;  4Z7E A;  5I84 A;  1R9L A;  1IZ1 A;  1B5H A;  1RKM A;  3H7M A;  1TFD A;  3KN3 A;  3IJO B;  4RK2 A;  4TLM B;  3RQT A;  3S9M C;  3WAF A;  3O66 A;  4O8M A;  5DYH A;  5JTY A;  3N6U A;  2O1L A;  5HPQ A;  4FJP A;  1Z7M E;  2PX1 A;  4ELQ A;  4MNC A;  3UIF A;  4O3A A;  4F31 B;  3K2D A;  3F11 A;  2X26 A;  2GQ1 A;  2E0S A;  1VE4 A;  3FAS A;  3SDF A;  1BTJ A;  2I6E A;  3H6T A;  3S9L C;  2H98 A;  3LV0 A;  2GHA A;  2I4C A;  4PFT A;  3SKP A;  4HTG A;  4GF8 A;  2XXT A;  2CZK A;  4F2Q A;  4ZE9 A;  2HZK A;  4GD5 A;  1KA1 A;  1Y3P A;  3DP4 A;  4LZ5 A;  3TMG A;  1H44 A;  5I2N A;  1RDY A;  4F1Y A;  3RGY A;  4X1D A;  1MY4 A;  4JVC A;  1ZLQ A;  1MY3 A;  4ESX A;  3PPP A;  5H8F B;  4LON B;  3U94 A;  2QVR A;  2XXW A;  1NI9 A;  4PE3 A;  4ZEK A;  3LSL A;  1Q1K A;  4HXV A;  4MNP A;  3KSJ A;  2FIX A;  1VDW A;  3U92 A;  3CVG A;  2IA4 A;  4NF6 A;  4KD5 A;  4QBA A;  5FTI A;  4HCW A;  4OTE A;  2I4B A;  4QFK A;  1GV8 A;  5JK4 A;  4E0W A;  3L6G A;  1AIV A;  4EF1 A;  3C9H A;  4JSD A;  5ET7 A;  4NHB A;  4JWY A;  3ZSF A;  1XT8 A;  5I2K B;  1YTV A;  3G3H A;  4JWO A;  4PET A;  4NF5 B;  3L6H A;  1LGB C;  3MPK A;  4N13 A;  1SDX A;  4GRK A;  2NWJ A;  4F22 A;  4R6K A;  1LFI A;  4G2Z A;  5A5X B;  3SZP A;  3CFL A;  2XX8 A;  4YKK A;  1FPE A;  4AB6 A;  3BIG A;  4EQ9 A;  2QS1 A;  1DOT A;  1YAE A;  3LSF B;  5DW8 A;  3W15 C;  2Q2C A;  1FTA A;  4LN5 A;  2FBP A;  4U23 A;  2QS4 A;  1HSJ A;  3K6W A;  3U93 A;  1A54 A;  3A3C A;  2F5X A;  3DM0 A;  3G3J A;  4EF2 A;  2XXI A;  1G0I A;  1NV7 A;  2V25 A;  3W9V A;  4DXC A;  2V3T A;  3QXM A;  2PFZ A;  1B5I A;  5J1D A;  4XXU A;  4ZEC A;  1B7U A;  3TTL A;  5IAI A;  1D4N A;  5CBR A;  3QIM A;  3KC1 A;  4ELP A;  4RNS A;  1MM6 A;  4OHN A;  2V4C A;  5A5X A;  3QUF A;  4P9K A;  3MQ9 A;  1I6B A;  2DWJ A;  3HHF A;  4P56 A;  1TFA A;  4ECF A;  4YMA A;  1J1N A;  3PUW E;  4PFR A;  1VR5 A;  4QSE A;  1OLC A;  2L5V A;  1B0L A;  4LAT A;  1ZTY A;  3KG2 A;  3E79 A;  3FJM A;  3IB1 A;  4IO6 A;  2O51 A;  2F78 A;  1NUX A;  4IY6 A;  1NKX A;  1MM7 A;  4H45 A;  2P3N A;  4RA1 A;  5AA1 A;  5CMK A;  1NFT A;  1OQH A;  1A8E A;  1QUL A;  1MQG A;  4LQ5 A;  5ET6 A;  4EQB A;  1R9Q A;  2B4L A;  2XWK A;  3M3F A;  5AA3 A;  4LZ7 A;  2ONK E;  1A99 A;  3S9E A;  3G3F A;  4F2O A;  2XXK A;  5AA2 D;  5I57 A;  3VLW A;  3U1O A;  1QUI A;  3B50 A;  5DEX A;  1UTB A;  1Y9U A;  2XWO A;  3IAZ A;  4FIM A;  5EQ7 A;  2DDK A;  1GGG A;  1S9T A;  1NMU A;  3MC2 A;  4NQ8 A;  4JBZ A;  2Y5L A;  1B4H A;  3SEW A;  3K1N A;  1I6Q A;  2Q74 A;  4I62 A;  5AE4 A;  4NF6 B;  4ELR A;  3K00 A;  3MW0 A;  3T1B A;  2H9B A;  3NOH A;  1IUD A;  3O6H A;  4XEQ A;  3HCQ A;  2FYI A;  4GX6 A;  2WYP A;  3GBA A;  3GZG A;  4OVQ A;  3FVG A;  4RPO A; 
#chains in the Genus database with same CATH homology
 2QSX A;  1LCT A;  2ONS A;  1FQC A;  3PMX A;  4U4S A;  4JXI A;  1B3G A;  4YB5 A;  3PUY E;  1FTL A;  4C1T A;  4ZZA A;  3VLU A;  2H5Y A;  1H45 A;  3LBS A;  4KR5 A;  4NWD A;  4MH5 A;  1WDN A;  2O68 A;  4G4P A;  2P2A A;  3C34 A;  1H76 A;  4QF9 A;  1MH4 A;  1SBP A;  4TQU Q;  3AXF A;  1MS7 A;  1A7L A;  4MF3 A;  2NXO A;  3QK6 A;  5DEX B;  3GLB A;  1LB9 A;  5CBS A;  5I56 B;  2F97 A;  3TUS A;  3E4R A;  5ICT A;  3MP1 A;  3K01 A;  1UIU A;  3DEL B;  4WED A;  3FXR A;  3KN7 A;  4H5F A;  4NE4 A;  3IOW A;  3ODB A;  3ZKL A;  4EUO A;  3SER A;  3TZA A;  1QUK A;  1MPB A;  3MUQ A;  2HXW A;  1AOV A;  2P1S A;  3B6W A;  1B46 A;  2O7I A;  1IXC A;  4FEC A;  3TCF A;  3Q25 A;  5LOM A;  2NVU B;  4OER A;  4Q8R A;  1LFH A;  1B1X A;  1P1Q A;  3CSB A;  1A40 A;  4NF4 B;  1N3W A;  2M8C A;  3CFZ A;  1EU8 A;  3KEI A;  5L9S A;  3N26 A;  4PFY A;  3VXC A;  5KCJ B;  3U8Q A;  2XXX A;  1XOC A;  3OSR A;  5FHN A;  3PPO A;  4IO3 A;  1FTK A;  1URD A;  3E13 X;  4KFQ A;  1Y3N A;  5K2X A;  1XC1 A;  1IEJ A;  2I48 A;  3T66 A;  2QS2 A;  3VXB A;  4DCY A;  5L9M A;  3RLF E;  5CM6 A;  5K2Y A;  4KCD A;  5CMB A;  1UTB B;  3BBR A;  1UTH A;  3G7W A;  1DSN A;  1MXV A;  3LSX A;  2Q9T A;  3TQW A;  3USD A;  3Q28 A;  4QRZ A;  1JW5 A;  1Y4T A;  3KSX A;  2PMS A;  4QFN A;  2QRY A;  3TDJ A;  1ZBM A;  4F18 A;  2O7U A;  2PBW A;  2LAO A;  4R9F A;  3K02 A;  1LBB A;  1MQJ A;  4HCY A;  3PMW A;  2B3B A;  1Q35 A;  2I3V A;  3OO9 A;  1QUJ A;  2RCB A;  2ALU A;  1YPN A;  2ZMB A;  3EQ1 A;  3OMB A;  3TFL A;  2VP1 A;  4XKQ A;  3CI8 A;  4Z0I A;  3VDF A;  4M4G A;  3ZS6 A;  2IEE A;  4EXL A;  1GTK A;  1FW0 A;  2DE3 A;  3FD3 A;  3I6V A;  5DTB A;  2NOO A;  2Z22 A;  3LR1 A;  1MXY A;  5IKB A;  5ISU A;  4DLD A;  4R9G A;  1B3F A;  1UTH B;  1M5C A;  2UVG A;  4BDQ A;  5ICQ A;  2HEU A;  3KJT A;  2ZNT A;  2H4I A;  3HST A;  3OXN A;  3EHU A;  4KYE A;  3MP8 A;  5H8H A;  3R7X A;  3UN6 A;  2XXV A;  4O3C A;  2ABH A;  3B6Q A;  4IB2 A;  1M5F A;  1JEV A;  1EZ9 A;  4N07 A;  3PUZ E;  4R72 A;  1UQW A;  2X7P A;  4XIG Q;  3RUM A;  5CI5 A;  3S2V A;  1ZJL A;  1EZO A;  1JVX A;  4MLV A;  1Y3Q A;  1RYX A;  2Y7K A;  1HSE A;  2PT1 A;  3WAE A;  2Y7W A;  1Z7N E;  1IIW A;  4K3F A;  4U4X A;  2XXQ A;  1H43 A;  4C0R A;  4YU0 A;  4RY1 A;  3FVO A;  1B4Z A;  4ND9 A;  3TKD A;  1MQH A;  3KOT A;  3QYT A;  4GXS B;  4KQP A;  4P0G A;  1IXI A;  2VD2 A;  3PPR A;  4U2R A;  4EDP A;  1B40 A;  3MZ9 A;  4BDO A;  3OEL A;  3ILT B;  1TXF A;  4G8H A;  2A5S A;  4NED A;  3U72 A;  1NNF A;  3KBR A;  4R2B A;  4MFI A;  4RYA A;  3I5O A;  2Z8F A;  1P1N A;  1JET A;  4G68 B;  4N6P A;  5EHS A;  1B0H A;  3K4U A;  4ZZE A;  2F7A A;  3TOD A;  1I6A A;  3CG1 A;  4L17 A;  3K6V A;  4WEP A;  1MQD A;  4R6H A;  3FXU A;  4YKP A;  5AA4 A;  1DMB A;  3OO6 A;  3N5L A;  1FCK A;  1N84 A;  2F7C A;  4GLI A;  4O3B A;  2AL5 A;  1A8F A;  2XXR A;  3PU5 A;  3S4U A;  3SET A;  3SEY A;  3TPA A;  3UK4 A;  1MY2 A;  4G68 A;  4G77 A;  1B7H A;  4OYV A;  3IOU A;  2DSF A;  2XXH A;  4KPT A;  2H99 A;  2GHB A;  4Z7E A;  5I84 A;  1R9L A;  1IZ1 A;  1B5H A;  1JEU A;  1JQF A;  1RKM A;  2DWI A;  5I58 A;  3H7M A;  3OEK A;  1TFD A;  1VFD A;  5B70 A;  3T96 B;  3KN3 A;  3Q26 A;  2OJT A;  3IJO B;  4RK2 A;  4TLM B;  2GFE A;  2Y84 A;  3TTN A;  1LBC A;  3ILU B;  5HM4 B;  2RIN A;  2GRV A;  4G8N A;  1SQY A;  3RQT A;  2UYE A;  3K1P A;  3VFJ A;  1PB8 A;  1POT A;  3DP6 A;  2OBG A;  3FXQ A;  4PE5 B;  4IGT A;  3WAF A;  3S9M C;  2F8D A;  3K6U A;  2Q2A A;  1MY1 A;  3O66 A;  3PGF A;  2XD2 A;  2DWH A;  5DYH A;  5EYF A;  5JTY A;  3K0V A;  1D9Y A;  3MVY A;  3N6U A;  1ATG A;  2V3Q A;  2DVC A;  2ZNS A;  2O1L A;  1NNP A;  1P1U A;  2R6G E;  2F35 A;  5H8H B;  1B6H A;  1ZU0 A;  3JV9 A;  4XKR A;  4X9T A;  5HPQ A;  3IJX B;  3OEN A;  4FJP A;  4ZS9 A;  4DZ1 A;  3TCH A;  5CC2 A;  3M8U A;  1Z7M E;  1MDP 1;  1UIV A;  2PX1 A;  2DXY A;  3MWB A;  3IB2 A;  2Z8E A;  3IOT A;  1B3E A;  4R73 A;  4ELQ A;  2DP8 A;  1BKA A;  3OSQ A;  3UIF A;  3CG3 A;  3KOS A;  4O3A A;  4F31 B;  3RTW B;  1ZIU A;  2DE2 A;  3K2D A;  1QVS A;  3F11 A;  2CZL A;  2E1S A;  2X26 A;  3IR1 A;  4PFW A;  3V83 A;  1US5 A;  3FZV A;  1PEB A;  1B9J A;  4IO2 A;  2OWS A;  4POX A;  2E0S A;  1VE4 A;  3FAS A;  3O2A A;  1BTJ A;  2VGQ A;  4LA9 A;  3SDF A;  2I6E A;  3PD8 A;  1B3H A;  3H6T A;  3S9L C;  2H98 A;  1B7Z A;  4NMY A;  4YB6 A;  2GHA A;  2I4C A;  3V5A A;  4PFT A;  3SKP A;  1S7Y A;  2RC9 A;  4YAH X;  4HTG A;  4GF8 A;  2O84 X;  4E0X A;  2F6P A;  3FVN A;  2XXT A;  3HPI A;  4FOR A;  1URS A;  3UP9 A;  4F2Q A;  4ZE9 A;  3VE1 B;  1M5B A;  4F22 A;  2HZK A;  3KJ7 A;  3CRB A;  3CSG A;  4GD5 A;  3T9H B;  1Y3P A;  3DP4 A;  3OOA A;  4LZ5 A;  1H44 A;  4P11 A;  5FTH A;  1B51 A;  3TMG A;  4MBP A;  1GVC A;  5I2N A;  3TEP A;  1B52 A;  3MP6 A;  4F1Y A;  1AMF A;  3RGY A;  4FEB A;  4NF4 A;  4UAC A;  3UGW A;  3TTK A;  4F19 A;  3H06 B;  2I0C A;  4LVQ A;  1FTO A;  2RC7 A;  4X1D A;  1Y20 A;  1MY4 A;  2A5T A;  3M3L A;  2DE4 A;  3QUJ A;  4AB5 A;  3T9X B;  4OEV A;  3HN0 A;  5FHO A;  1SW2 A;  3KFM A;  2NUV A;  3TCG A;  2UYF A;  3BKI B;  1ZMG A;  1Y4C A;  2QL3 A;  3FJG A;  1ZLQ A;  4NTL A;  1MY3 A;  4ESX A;  2VOZ A;  3PPP A;  1MXU A;  1URG A;  3RPW A;  2AYS A;  3H6V A;  1P99 A;  3RTF B;  5I58 B;  5H8F B;  3G3G A;  1ANF A;  5B7D A;  3O6I A;  4XKP A;  1XHY A;  2P0S A;  4LON B;  2Y7R A;  4PQJ A;  5TPA B;  2B65 A;  4R2F A;  1OIB A;  1LAF E;  1OVB A;  3PMV A;  4X1B A;  3U94 A;  2XXW A;  1JNF A;  5KDT A;  3IX1 A;  3LC8 A;  4Q30 B;  4YKJ A;  1LAX A;  4I1D A;  2HQ0 A;  3IO4 A;  2I49 A;  2VHA A;  3ONM A;  1GR2 A;  3FGS A;  4MLQ A;  3SES A;  5KDT B;  3PUV E;  1LB8 A;  4ZEK A;  4U22 A;  1SYH A;  1Q1K A;  3LSL A;  4FE8 A;  4F29 A;  1XVX A;  1SD3 A;  1TWY A;  2Q8J A;  1JW4 A;  4BDL A;  3KSJ A;  3FAT A;  5KCJ A;  3BFU A;  3MBP A;  4ZE8 A;  3SEU A;  3FJ7 A;  5CRY A;  3U92 A;  2ONR A;  3CVG A;  2IA4 A;  1IQ7 A;  2UVI A;  3RY3 A;  3E9X A;  4NF6 A;  2QJE A;  4XKN A;  4IGR A;  1FQF A;  4KD5 A;  4ZED A;  3MVZ A;  5FTI A;  3V8X B;  1A55 A;  5TP9 A;  3PV0 E;  4OET A;  2A5T B;  1LLS A;  1O7T A;  2OK2 A;  4HCW A;  4YZZ A;  3TYH A;  4OTE A;  1B3L A;  2I4B A;  3O6G A;  4ZEF A;  4QFK A;  1GV8 A;  1TT1 A;  5JK4 A;  4H65 A;  2DOJ A;  3EN3 A;  4BDR A;  4E0W A;  1N7X A;  3L6G A;  3H03 A;  4YIC A;  1AIV A;  1LAG E;  4EF1 A;  4KCC A;  3C9H A;  1B1H A;  4JSD A;  1PDA A;  1RYO A;  2REJ A;  4JWY A;  3VVE A;  4DXU A;  3ZSF A;  4GIZ A;  3RN8 A;  1XT8 A;  5I56 A;  5I2K B;  2O6A A;  3TEL A;  1B58 A;  1USY H;  4I9D A;  5FHM A;  3VLV A;  1QJM A;  2QPQ A;  2B3F A;  4GXA A;  4NF5 A;  2R9J A;  4H5G A;  4WKM A;  1YTV A;  1YCJ A;  3THI A;  2PYY A;  3G3H A;  4JWO A;  5I2K A;  3D4G A;  1MXZ A;  3H6W A;  4F3B A;  1T0K A;  3W9W A;  4PET A;  1M5E A;  1M5D A;  3P7I A;  4NF5 B;  3L6H A;  4M1V A;  1LGB C;  2XHD A;  3MPK A;  4LP2 B;  4N13 A;  4GWO A;  1SDX A;  1SW4 A;  4QHQ A;  4GRK A;  1MG1 A;  4RXL A;  5H8Q B;  4F1U A;  1AL3 A;  3MZ1 A;  2QMW A;  5H8N B;  3N6T A;  5TPA A;  1QKA A;  2YJP A;  2UVH A;  3C33 A;  4R6K A;  5DT6 A;  3C31 A;  2NWJ A;  4FAJ A;  2HAV A;  1LFI A;  2V3U A;  3T9U A;  5BUU A;  4ELO A;  3JZJ A;  4G2Z A;  4BLA A;  5A5X B;  2HFB A;  4U1Z A;  4KHZ E;  5TP9 B;  3CFL A;  2XX8 A;  4YKK A;  3IL1 B;  5AA2 B;  2F7B A;  3S9N C;  1MY0 A;  2H25 A;  4AQ4 A;  4WXJ A;  1JVY A;  1II5 A;  4Q5T A;  1XS5 A;  1FQA A;  4YKI A;  4ZEB A;  1L5T A;  5DVJ A;  5L8D A;  4AB6 A;  4R75 A;  4RPO A;  2F36 A;  4OZ9 A;  4EQ9 A;  2QS1 A;  1LAH E;  5AA2 A;  1DOT A;  1YAE A;  4ZEI A;  3UA8 A;  1NH8 A;  4TLL B;  3TAJ A;  5DVI A;  3RT8 A;  3CR9 A;  3T93 B;  3LSF B;  5H8F A;  2BJJ X;  3W15 C;  2Q2C A;  4QSD A;  1B2H A;  2Q89 A;  3JYR A;  4FED A;  4DE8 A;  1PC3 A;  4F39 A;  5ELV A;  1H3D A;  5KZT A;  2V84 A;  1MRP A;  4OFO A;  2XXU A;  2QS4 A;  2VD3 A;  4KYS A;  1HSJ A;  4U23 A;  4ONY A;  3KZG A;  1LCF A;  4JB7 A;  3K6W A;  3U93 A;  5L9O A;  4G8M A;  2YPN A;  2YLN A;  1A54 A;  1KWH A;  1IXG A;  2HCA A;  2HAU A;  3A3C A;  2F5X A;  4JWX A;  4IO5 A;  3DM0 A;  5H8Q A;  3RNN A;  3G3J A;  4ISU A;  4OES A;  3VVF A;  3SEV A;  3FUZ A;  4EF2 A;  2XXI A;  3Q29 A;  1MH3 A;  1P1W A;  3HV1 A;  4F3S A;  2V25 A;  3W9V A;  3O28 A;  3O29 A;  2OCU A;  4DXC A;  2HZL A;  2D3I A;  4EQ7 A;  1EH3 A;  2V3T A;  2ZYM A;  3QXM A;  3PD9 A;  4GVO A;  4JSO A;  3HO7 A;  2QS3 A;  3Q27 A;  3QSL A;  4QFO A;  1B5I A;  5I57 B;  2DXR A;  4C1U A;  5J1D A;  3N94 A;  4XXU A;  4ZEC A;  2D21 A;  5HBC A;  1B7U A;  5I2N B;  4XTC Q;  3GBB A;  3DP8 A;  1LFG A;  2O69 A;  3D4C A;  3TTL A;  5I59 B;  5IAI A;  1D4N A;  5CBR A;  5JEI A;  1OMP A;  3QIM A;  1DPP A;  1MPC A;  3PPQ A;  4RJZ A;  4RNS A;  4ELP A;  1MM6 A;  4OHN A;  2XX7 A;  3I3V A;  4Q0C A;  4H6D A;  5H8N A;  4OFJ A;  2WKY A;  3QUF A;  4OVJ A;  4BDM A;  2Y7I A;  2OZZ A;  5A5X A;  3FVG A;  1MXX A;  3KGC A;  5ITO A;  3FV1 A;  1VFE A;  1N7W A;  3C32 A;  4TOZ A;  3HHG A;  3C4M A;  2XXP A;  3MQ9 A;  3T22 A;  4I8C A;  5I59 A;  3R26 A;  4H8I A;  1I6B A;  2DWJ A;  3H3G A;  4POW A;  1MQI A;  1OQG A;  2OLB A;  1P1O A;  2PT2 A;  3HHF A;  4IO4 A;  3TQL A;  4P0I A;  5CMC A;  1N76 A;  3K6X A;  3EF7 A;  1TFA A;  3QAX A;  4ECF A;  4YMA A;  1J1N A;  2OWT A;  5JTY B;  4RPN A;  1OLA A;  3PUW E;  2RC8 A;  1R1N A;  2QMX A;  4NF8 B;  1VR5 A;  2XD3 A;  2G29 A;  4IY5 A;  2RKM A;  3K1M A;  3O9P A;  3E3K A;  1WOD A;  1QKB A;  4QSE A;  3DLN A;  1OLC A;  4FAT A;  4NF8 A;  1B0L A;  1NL5 A;  4LAT A;  1ZTY A;  2FA7 A;  4QFP A;  4QSC A;  5DVF A;  3KG2 A;  1SYI A;  4HW8 A;  3T9V A;  1I69 A;  5EHM A;  4OXV A;  3C35 A;  3H4Z A;  1BLF A;  3FJM A;  3IB1 A;  3EPE A;  2REG A;  1PBP A;  3TTM A;  2AIX A;  4KI0 E;  2XX9 A;  2THI A;  4IO6 A;  2O51 A;  3EHT A;  2XXY A;  1ELJ A;  3PPN A;  2F78 A;  4THI A;  4LZ8 A;  3CIJ A;  2V93 A;  4IY6 A;  3BFT A;  1NKX A;  2PVU A;  2ZYO A;  4GFR A;  4H67 A;  4GQO A;  1MXW A;  1DTG A;  4QFL A;  1MM7 A;  3EHS A;  4BDN A;  3G3I A;  1D9V A;  2AL4 A;  2DVZ A;  4RA1 A;  1SI1 A;  3MVX A;  4OWD A;  4ZDM A;  2ANJ A;  5AA1 A;  5CMK A;  3IK6 B;  1NFT A;  1OQH A;  3C36 A;  4GL0 A;  1A8E A;  1CE2 A;  1DPE A;  1QUL A;  2I3W A;  3IOR A;  4R6Y A;  1MQG A;  1SI0 A;  2X7Q A;  4LQ5 A;  3IO6 A;  3FIR A;  1R9Q A;  3OEM A;  4EQB A;  1R6Z A;  3M3F A;  1N0T A;  3IOV A;  2R71 A;  4LZ7 A;  4NWC A;  5AA3 A;  2ONK E;  4GOT A;  1A99 A;  2CMO A;  1QW0 A;  3M3K A;  4IO7 A;  3TTR A;  5BWJ A;  3A3U A;  3S9E A;  5F1Q A;  3G3F A;  1B5J A;  2ZNU A;  4F2O A;  3IB0 A;  4PP0 A;  3A09 A;  1PBQ A;  1D3K A;  1FTM A;  5AA2 D;  5I57 A;  5ITP A;  3VLW A;  4RK9 A;  3ZKK A;  3U1O A;  3RT6 B;  1QUI A;  2RF1 A;  3H6U A;  4GL8 A;  4PFU A;  1S50 A;  4LUB A;  2UVJ A;  2W7Y A;  5DEX A;  1N04 A;  1UTB A;  2ESN A;  1FQE A;  1CB6 A;  1USY E;  4R74 A;  1SVX B;  2DWA A;  1ZKB A;  1Y9U A;  5H8S A;  2ZYK A;  4G68 C;  1IIT A;  2ZYN A;  2D5W A;  2FNC A;  4X48 A;  2Z23 A;  1PB7 A;  1PB9 A;  3MZB A;  3IAZ A;  1F9B A;  4FIM A;  2ZXT A;  1NNT A;  1OVT A;  2O1M A;  5TU0 A;  1Y1M A;  1FQD A;  2Z8D A;  2DQV A;  2F34 A;  3OO8 A;  3PUX E;  2G93 A;  3UOR A;  5AA4 B;  1EZP A;  1GGG A;  1S9T A;  1SW1 A;  1US4 A;  1NMU A;  4OEN A;  1POY 1;  4OEU A;  3KN8 A;  4EXK A;  3ECR A;  3G3K A;  1IXH A;  1NNK A;  2F6G A;  3B7D A;  3LSW A;  3MC2 A;  4OFL A;  5CMM A;  4H0W A;  3SEX A;  4F3P A;  1FTJ A;  1JW1 A;  4KYD A;  1B05 A;  3FV2 A;  2I58 A;  1N3X A;  4HS7 A;  1Y1Z A;  3MJN A;  4OQO A;  4F3G A;  1AH5 A;  4JBZ A;  3O97 A;  2Q88 A;  4DCX A;  2UXA A;  2DYX A;  1B4H A;  4LQ2 A;  4DXB A;  1NH7 A;  4OMB A;  2Y7P A;  3SEW A;  1WVJ A;  5F7V A;  4F1V A;  1XVY A;  3K1N A;  2RCA A;  3MAM A;  1I6Q A;  4I62 A;  3VV5 A;  4H8J A;  5AE4 A;  2GH9 A;  3VVD A;  4UA8 A;  4NF6 B;  4YMB A;  2KLF A;  3FVK A;  3V89 B;  4ELR A;  1MDQ A;  1O64 A;  1SW5 A;  3K00 A;  3R6U A;  3MW0 A;  4DDD A;  2H9B A;  3OD7 A;  3MPL A;  5M2V A;  1B32 A;  1IUD A;  3GXA A;  3O6H A;  1MPD A;  1HSL A;  3LUY A;  1LST A;  3HCQ A;  4U1O A;  4ESW A;  2FYI A;  4JDF A;  1FQB A;  4H1X A;  3CFX A;  1BIY A;  3GBA A;  4DIG A;  1O63 A;  1BP5 A;  3GZG A;  2I0B A;  3MVW A;  1VSO A;  2DS9 A;  4U21 A;  1DTZ A;  3B6T A;  3OO7 A;  4YB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...