3VXBA

Crystal structure of bxle from streptomyces thermoviolaceus opc-520
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
399
structure length
399
Chain Sequence
TITAMVYGDDAVKVQDKAASRFNASAEAKKANAKVKMERIPASDYPAKLRTAMGSPNAPDIFFNWGGGSIKAYKEAGQLVDLTDVIKSDEVLSTGFLPSVVAAGSLDGHEYGIPMRGMQPVLLFYNKSVFAEHKLTPPTTWDQLLDNVAKLKKAGVTPFALGGVEIWPELMWLEYLVDRIGGPQVFDKIRNGDASGWGDPAVLKAAQTVKQLVDEGAFGKGFSSVSYNNGGAPALLAKGKAGMHLMGSWEYSTQLGKFPDFAKKDLGWCAFPSFEGGAGDIRNVVGNPCNYWSVNARTGNKDGAIAFLRDCASEAYTKDLIDNGDVPTTTIAENMLDSSPNPEFAKFQYQLVQKAPNFTLSWDQAVDPDWQQPMLTEINKLFVGKSSPEQFVSALKGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Putative sugar-binding lipoprotein
publication title Crystal Structure of Xylooligosaccharide-Binding Protein from Streptomyces thermoviolaceus OPC-520: Dramatic Conformational Change with Ligand binding
rcsb
source organism Streptomyces thermoviolaceus
total genus 148
structure length 399
sequence length 399
ec nomenclature
pdb deposition date 2012-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vxbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vxbA02
5AE4A 1URSA 4ONYA 2O1MA 4DE8A 1MG1A 3FJGA 4YKKA 3MP1A 3L6GA 1I69A 2D5WA 3TAJA 2F34A 1N0TA 2RF1A 3K2DA 3HPIA 4FJPA 4HTGA 3BKIB 3CFXA 5JTYA 3H6TA 2NXOA 3MVYA 4OTEA 1MH3A 3TTMA 5I59B 3LR1A 4OVJA 1MQGA 2D21A 3FIRA 3LUYA 3K02A 3LSWA 4KCCA 5CMKA 3H06B 4ZZAA 1LFHA 3O97A 4ELQA 1IXIA 3HHFA 3PPQA 4KHZE 4RY1A 2R71A 1ZJLA 5H8HA 1MQHA 4FATA 4G2ZA 4QFKA 2RINA 3O6GA 4R2FA 2HZLA 2NWJA 4YMBA 4F29A 1MPBA 2DWAA 1XHYA 2HCAA 2V25A 2F36A 4QFOA 4IO7A 2Z8DA 1WVJA 3H6UA 3UK4A 1HSLA 4BDNA 3THIA 2I49A 2R9JA 3TDJA 5H8NB 2GH9A 4G68C 3VDFA 1MY1A 4G68A 4TQUQ 4PFYA 4QFLA 2X26A 2Y84A 1P1NA 3E4RA 1MQDA 1PB7A 1M5EA 1P1QA 5LOMA 3SEWA 1B1XA 1HSEA 3TELA 1LB8A 3EN3A 1B7HA 4F18A 3W9VA 5H8QA 4P0IA 5KCJB 4QSCA 3EHSA 4UA8A 3RTWB 3IOVA 1LAXA 3RPWA 1B5IA 4XIGQ 2Q2AA 4O3CA 3V89B 2REGA 2AL4A 3H3GA 2ZYOA 3FVOA 3OO8A 3TQLA 5HPQA 4F39A 1M5CA 4G8NA 3IJXB 3ECRA 1VE4A 1LLSA 3MUQA 2GHAA 5FHOA 3CIJA 3K0VA 3MVWA 3TCFA 4MFIA 4F3SA 3IX1A 2XXVA 2IEEA 4ISUA 4EQBA 1NNKA 4U1OA 4LONB 4YB6A 4F3GA 1ZIUA 3KSJA 3QUFA 3IOUA 1Q1KA 1VFDA 4BDRA 3FUZA 3H4ZA 5JEIA 3N6TA 3KZGA 4ELRA 2FNCA 3IO4A 1US5A 3EPEA 3A3CA 1PEBA 2OWTA 1Y3PA 1B5JA 4LZ7A 1NNPA 2QJEA 1MXVA 3LC8A 3FZVA 1MXZA 3KEIA 2DE4A 3MPLA 1JVYA 2B65A 1B3EA 1CB6A 1XS5A 4RK2A 1MRPA 3U1OA 1NH8A 2DWIA 2DXRA 1N84A 3TQWA 3E13X 3R26A 1PBPA 4LP2B 4U4SA 3TTNA 3RN8A 2UVGA 1IZ1A 4HCYA 3B6TA 3MPKA 4MBPA 4AB5A 2H9BA 2ZMBA 1MXYA 3KN7A 3RGYA 3F11A 4LVQA 5TP9B 3EF7A 1QJMA 1DTGA 4IGRA 5I58A 2I58A 1IXCA 2H25A 1BIYA 2ONSA 1JNFA 3PUXE 3ZKKA 4NF6A 1Y9UA 1OQHA 3CR9A 1YPNA 3K1PA 3PMVA 4Q0CA 1MXWA 3C33A 3KOSA 1L5TA 3ODBA 3TZAA 4ZEKA 3TFLA 3MVXA 1LBCA 3IAZA 2ESNA 2O84X 5EHMA 5AA4B 4I1DA 4RK9A 1ZTYA 3FASA 3B6WA 5DTBA 2OCUA 3T96B 2Q9TA 5DVFA 2Q88A 2A5TA 1AH5A 1CE2A 4BDOA 4YZZA 1JVXA 1S50A 3D4CA 3OO7A 2VGQA 2XXWA 1A8FA 1LGBC 1EZPA 2YJPA 1LAHE 3O2AA 1N7XA 3W15C 3FV1A 4YMAA 5AA2D 4DZ1A 1SBPA 2H5YA 4JBZA 4KYDA 4Z0IA 1TFAA 3JYRA 1IITA 4NF4B 1RYXA 3MAMA 5H8FA 1B7ZA 4EQ9A 4KYSA 2V93A 4EF1A 4DXBA 4PETA 2QMWA 4YU0A 4X9TA 3FGSA 2GFEA 5BUUA 2REJA 1A7LA 1PC3A 1JEVA 2QS2A 4KYEA 4F2OA 1TFDA 4GQOA 4XKRA 5FTIA 1R9LA 2DE3A 3MBPA 3VVFA 1H3DA 1DPEA 1QUJA 3QYTA 4F22A 3QSLA 4NWDA 1SW4A 3OOAA 5I2KB 4QRZA 2VP1A 3SEVA 2Y7RA 3KN8A 1DOTA 1MS7A 4PP0A 2Q8JA 4OFLA 5ICQA 1JW1A 3C36A 1RKMA 2THIA 5CM6A 5KDTB 3TMGA 1DTZA 2ZXTA 4F2QA 4ZDMA 1ZKBA 5AA1A 3K6WA 3H6WA 1A55A 2I0CA 1SYIA 4KD5A 3PPPA 1B0HA 1LFIA 3OELA 3I3VA 1B3FA 3MZ1A 1B9JA 5K2YA 2HZKA 4XKQA 1H44A 3RUMA 1O64A 3A3UA 1FQBA 5FTHA 3EHUA 4R74A 1UTHB 3K00A 1SW2A 4MLQA 4PFUA 4EXKA 3KG2A 1J1NA 2V84A 3I5OA 2DSFA 4EF2A 3SESA 4YAHX 2O51A 5ISUA 3S9MC 1USYE 2OZZA 1IQ7A 3N26A 2I0BA 3TTKA 4RNSA 5L8DA 2Z8EA 5CBSA 2YPNA 4R2BA 2XXUA 3SKPA 1EZOA 1QULA 2XXIA 4GFRA 1DMBA 3LSXA 1A99A 2YLNA 3SEXA 5HBCA 2F97A 1ZMGA 2ALUA 3GXAA 3FJMA 4R73A 4OWDA 3G3JA 5TPAB 3DELB 5CRYA 2DP8A 2ONKE 4DCXA 2W7YA 1PBQA 3V8XB 3MP8A 4OYVA 4OHNA 4WEPA 3M3LA 5I59A 2XXHA 3TPAA 1FW0A 4KFQA 2UYFA 3C34A 4IO2A 1H76A 3UA8A 5JTYB 1JW4A 1QW0A 3DM0A 2UVHA 4L17A 1P1OA 4OETA 3MP6A 2XXRA 1AL3A 3C4MA 3FXUA 1MY4A 3VVDA 3RT8A 4LATA 3MW0A 4OXVA 4ZEDA 4DIGA 5H8HB 5H8NA 4NF5A 4ELOA 4MH5A 2FA7A 4KCDA 2XXYA 2D3IA 4E0XA 4LQ2A 4GL0A 1B3HA 1POY1 1LAGE 4JWXA 2KLFA 3M3KA 4NE4A 1IXHA 4RA1A 4ESXA 4JSOA 3TUSA 3ZSFA 1DPPA 2DWHA 5I2NA 1OQGA 2UXAA 4XKNA 1B52A 1PB9A 2F6PA 5K2XA 1OLCA 1SVXB 2E1SA 1UIVA 2DYXA 2QRYA 4OFOA 4TLLB 3Q26A 4ND9A 4H0WA 4HW8A 3KSXA 4EQ7A 4XTCQ 3HO7A 3QIMA 5JK4A 3R6UA 3DP8A 3RY3A 4I9DA 2DVCA 1B5HA 1POTA 5H8QB 4PFWA 1FQFA 3EHTA 4ZS9A 3I6VA 4EXLA 4HCWA 1SDXA 4MLVA 3DLNA 4GRKA 4UACA 1N04A 1MQJA 4Q8RA 1FCKA 3OSRA 1JEUA 5L9OA 4H5FA 1UTBA 1LBBA 5EYFA 4E0WA 1ATGA 3IB1A 3S4UA 1SI1A 1MM7A 3KBRA 4C1UA 1R6ZA 5FHMA 1FTKA 3FXQA 1Y4TA 2XX8A 4I8CA 1M5FA 5I57A 3QXMA 5BWJA 3PGFA 2FYIA 3L6HA 3TCHA 4R9FA 2I4CA 4ZEFA 3LSFB 2XX9A 3ZS6A 3K01A 1SYHA 3SEUA 5DYHA 1NL5A 5I56A 1R9QA 2O1LA 4U4XA 4QF9A 1IEJA 3PMXA 2QL3A 1EZ9A 4NMYA 2PX1A 4NTLA 1IUDA 4LZ5A 4NF8A 1S9TA 2UVIA 4OFJA 3B7DA 4R6HA 4KPTA 3C9HA 2XXXA 2AYSA 4PQJA 1D9YA 4GXSB 2RC8A 1SI0A 4F3BA 5ITOA 5F7VA 2O6AA 4M1VA 1MQIA 1JQFA 2WKYA 4F31B 1GVCA 2X7PA 1BP5A 3O28A 1BTJA 1TWYA 2ONRA 2PT1A 1ELJA 3D4GA 3VXBA 3HV1A 1H45A 3PU5A 3S9NC 3FV2A 1BKAA 2Y7PA 2I3WA 3TTLA 4GWOA 3OD7A 2I4BA 3C32A 1P99A 3DP6A 1M5DA 3IJOB 1URGA 3R7XA 2RC9A 3T22A 5I58B 2QS3A 1B7UA 1YTVA 1QUIA 5DEXA 3U92A 4NF6B 4ZZEA 3QK6A 3U8QA 4ESWA 4N6PA 4R6YA 2Y7IA 1LFGA 3PUVE 1D9VA 4XXUA 2P2AA 4OENA 1WDNA 1PDAA 2F7BA 4ZECA 2DS9A 2A5TB 3EQ1A 3N6UA 4U2RA 4RJZA 2RKMA 3K6UA 3TEPA 3CI8A 1Z7NE 4RXLA 1LCFA 2QSXA 5AA2B 3GBBA 4DLDA 3H6VA 3UORA 3T9HB 4FEBA 3SERA 3W9WA 5ITPA 1M5BA 4WKMA 2Z8FA 2VD3A 2ABHA 3RLFE 2QPQA 4O3BA 1VFEA 5H8FB 1XOCA 3PPNA 2XXPA 1II5A 4O3AA 5B7DA 1Y20A 4ECFA 3N5LA 2OWSA 3Q27A 4P0GA 4G77A 1VR5A 4LUBA 5A5XB 4R75A 3MJNA 3T9VA 1UQWA 1N7WA 5L9SA 3K6XA 2F35A 2QS1A 3GZGA 4PE5B 4PFTA 3FVGA 1B51A 4GD5A 3VE1B 1OVTA 3DP4A 4DCYA 1Z7ME 4GIZA 2O7IA 1B6HA 4U21A 1GGGA 1Y3QA 3OXNA 3OSQA 1A40A 1S7YA 4EDPA 4R9GA 1US4A 2CZLA 1GV8A 1SQYA 3CVGA 1MPDA 4U23A 1N3XA 3Q25A 1F9BA 1R1NA 3CSGA 3RNNA 4THIA 3VV5A 3SETA 2O7UA 2XXQA 4NEDA 1YCJA 2PBWA 1DSNA 2HAVA 2ZNSA 4POXA 2AIXA 4I62A 4Z7EA 3K1NA 4ZEBA 1XVXA 1B2HA 3VFJA 4BDLA 2ZNTA 4IO6A 3UIFA 2O68A 1B3GA 3MVZA 1Y4CA 2HFBA 2F8DA 3KOTA 1B32A 5ELVA 2I48A 1B0LA 2H98A 2DQVA 4QFPA 3OO6A 3IOWA 4POWA 3HCQA 4ELPA 3ZKLA 1O63A 3H03A 1RYOA 1NNFA 1IXGA 4IO3A 3MQ9A 3GLBA 1MDP1 1MXXA 2V3TA 2RCAA 2BJJX 2XD3A 2G29A 5TPAA 2NVUB 1MXUA 5L9MA 4IY5A 3C35A 2ZYMA 3RTFB 3RT6B 3CRBA 3OEKA 3ONMA 1T0KA 4U1ZA 1Y3NA 4OEUA 3ILTB 3PMWA 1QVSA 4QSDA 3VLWA 3HN0A 4KQPA 4BLAA 2DWJA 1P1WA 2V3UA 4JWYA 2RC7A 2F7AA 2Q89A 5TU0A 3S9EA 3HSTA 1XT8A 3MZBA 3PUWE 2LAOA 4IB2A 4AQ4A 1MDQA 4GL8A 4JXIA 2PMSA 5HM4B 1O7TA 3KFMA 1QKBA 3A09A 4WXJA 5DVJA 3PUZE 4H8JA 1QUKA 2DOJA 1AOVA 1AMFA 3E3KA 4NF5B 2A5SA 1OIBA 4G68B 4Q5TA 3IL1B 4G8MA 5CMCA 3T9UA 1I6BA 4DXCA 3Q28A 3VLUA 3LBSA 1Y1ZA 1FTMA 5I84A 5KCJA 2ANJA 4ZE8A 1MH4A 4OERA 4QHQA 1EH3A 5I2NB 1XVYA 2IA4A 2B3BA 3N94A 2PVUA 1OMPA 3V5AA 5CI5A 5EHSA 1ZBMA 3MZ9A 4F3PA 4F19A 4RPNA 5H8SA 1AIVA 4OEVA 3S2VA 3G3HA 1NH7A 1I6QA 5DVIA 1H43A 2HAUA 1USYH 3HHGA 3FJ7A 3GBAA 4LA9A 3CG3A 1I6AA 2F78A 2GHBA 2P0SA 2O69A 4FE8A 3PPRA 4BDQA 3PV0E 3PD9A 5IKBA 5IAIA 1UTBB 5AA3A 1TT1A 4OZ9A 4JSDA 2Z22A 3FVKA 4H1XA 2VHAA 3O9PA 3PD8A 4H8IA 4NWCA 4AB6A 5I57B 2ZNUA 3WAEA 4N13A 4U22A 1FQCA 1QKAA 2XD2A 3FATA 2OJTA 2XXTA 4TLMB 1B4HA 2Y7WA 3FVNA 4EUOA 4IY6A 3G3KA 5CBRA 3AXFA 1GTKA 4H67A 3RQTA 5I56B 3UGWA 4GVOA 3K6VA 3KN3A 2UYEA 3JZJA 4Q30B 5M2VA 4RYAA 5B70A 3MC2A 3SEYA 3OEMA 2UVJA 4GF8A 4NF8B 4H6DA 4YICA 1JETA 5J1DA 1FQDA 4YKJA 4OESA 1MY2A 1OVBA 1UIUA 3G3GA 4IO4A 2P1SA 1A8EA 4H5GA 5CMBA 3VXCA 3OO9A 4QSEA 2F5XA 3T93B 1FQAA 4GOTA 5TP9A 3H7MA 1B3LA 4WEDA 3VVEA 1LB9A 3M3FA 2G93A 3KGCA 3JV9A 4FAJA 4G4PA 5F1QA 1A54A 3G3FA 3UP9A 2F7CA 3TKDA 5ICTA 1N76A 3S9LC 1NKXA 4C0RA 3K4UA 2PYYA 4X1BA 1URDA 3B6QA 3TCGA 5AA4A 1FTJA 2DVZA 3FXRA 3O66A 3V83A 4FORA 3LSLA 1FTOA 3PUYE 4OMBA 1BLFA 4DXUA 2NUVA 4MF3A 3O6IA 3CSBA 3TYHA 5CC2A 3PPOA 1IIWA 4GLIA 4YB7A 3U93A 1P1UA 5DEXB 3O6HA 3T66A 3O29A 2ZYKA 1LSTA 1PB8A 1B1HA 4FECA 5KZTA 2Y7KA 2QS4A 2B3FA 2CMOA 4RPOA 1YAEA 3K1MA 4YB5A 4LQ5A 3OMBA 5AA2A 3Q29A 3T9XB 4NF4A 1B58A 2HEUA 1ZLQA 2XX7A 1N3WA 3IB2A 2Q2CA 3U94A 2OK2A 2DE2A 3G3IA 4G8HA 1Q35A 4IGTA 2XHDA 1B46A 4N07A 4X48A 2DXYA 1B05A 3KJTA 1Y1MA 1KWHA 1XC1A 1MPCA 3IOTA 3M8UA 3VLVA 5FHNA 1NMUA 1SW1A 5A5XA 3WAFA 2H4IA 1FTLA 3CG1A 2ZYNA 4ZEIA 5I2KA 3G7WA 1FQEA 2RCBA 1LAFE 1GR2A 2R6GE 4F1YA 3KJ7A 4H65A 2H99A 4FEDA 4DDDA 4F1VA 3BFTA 5KDTA 4IO5A 2VD2A 1EU8A 4YKIA 3IO6A 4GXAA 2OBGA 3U72A 3UN6A 2X7QA 2M8CA 5DT6A 4BDMA 3IK6B 4X1DA 1JW5A 1MY0A 2HXWA 3IORA 2GRVA 4FIMA 2I3VA 1NFTA 4TOZA 4LZ8A 3USDA 2VOZA 2Z23A 2AL5A 4JB7A 3IR1A 4XKPA 3TTRA 4KI0E 1D3KA 1UTHA 4M4GA 4R72A 3MWBA 1MY3A 2PT2A 5CMMA 1SW5A 3CFZA 4KR5A 4F1UA 3BBRA 3FD3A 1OLAA 1WODA 1B4ZA 1MM6A 1VSOA 4R6KA 3TODA 1ANFA 2F6GA 3E9XA 4YKPA 1B40A 3CFLA 4JWOA 4C1TA 1ZU0A 2E0SA 2OLBA 4K3FA 4JDFA 3OENA 3C31A 2I6EA 1TXFA 3QAXA 4ZE9A 3IB0A 3P7IA 3QUJA 1LCTA 2QMXA 4HS7A 1HSJA 3SDFA 1NNTA 4OQOA 2V3QA 2NOOA 4P11A 3BFUA 1D4NA 3ILUB 1SD3A 2HQ0A 4QFNA
chains in the Genus database with same CATH superfamily
5AE4A 1URSA 4ONYA 3LUZA 2O1MA 4DE8A 1MG1A 3FJGA 4YKKA 3MP1A 3L6GA 1I69A 2D5WA 3TAJA 4P47A 1Q9DA 1LBZA 2F34A 1N0TA 2RF1A 3K2DA 3HPIA 4FJPA 1KA1A 4HTGA 3BKIB 3CFXA 5JTYA 3H6TA 2NXOA 3MVYA 5I5PA 4OTEA 4GBVA 1MH3A 3TTMA 5I59B 3LR1A 4OVJA 1MQGA 2D21A 3FIRA 3LUYA 3K02A 3LSWA 4KCCA 1FPGA 5CMKA 3H06B 4ZZAA 1LFHA 3O97A 4ELQA 1FBGA 1IXIA 3HHFA 3PPQA 4KHZE 4RY1A 2R71A 1ZJLA 5H8HA 1MQHA 4FATA 4G2ZA 4QFKA 2RINA 3O6GA 4R2FA 2HZLA 2NWJA 4YMBA 4F29A 1MPBA 2DWAA 1XHYA 2HCAA 3KC0A 2V25A 2F36A 4QFOA 4IO7A 2Z8DA 1WVJA 3H6UA 3UK4A 1HSLA 4BDNA 3THIA 2I49A 2R9JA 3TDJA 5H8NB 2FVZA 2GH9A 4G68C 3VDFA 1MY1A 4G68A 4TQUQ 4PFYA 4QFLA 2X26A 2Y84A 1P1NA 2QVRA 3E4RA 1MQDA 1PB7A 1M5EA 1P1QA 5LOMA 3SEWA 1B1XA 1HSEA 5F24A 3TELA 1LB8A 3EN3A 2CZIA 2VPNA 4JVCA 1B7HA 4F18A 3W9VA 5H8QA 4P0IA 5KCJB 4QSCA 3EHSA 4UA8A 3RTWB 3IOVA 1LAXA 3RPWA 1B5IA 4XIGQ 2HXRA 2Q2AA 4AS4A 2WEFA 4O3CA 4X04A 3V89B 2REGA 2AL4A 3H3GA 2ZYOA 3FVOA 3OO8A 3TQLA 5HPQA 4F39A 1M5CA 4G8NA 2Y5KA 3IJXB 3ECRA 5I7IA 1VE4A 1LLSA 3MUQA 2GHAA 5FHOA 3CIJA 3K0VA 3MVWA 3TCFA 1IMBA 1YYZA 2KR0A 4MFIA 4JVIA 4F3SA 3IX1A 2XXVA 4NQ8A 2P3VA 2IEEA 4ISUA 4EQBA 1NNKA 4U1OA 4LONB 4YB6A 4F3GA 4OVQA 1FTAA 1ZIUA 3KSJA 3QUFA 3IOUA 1Q1KA 3RPLB 1VFDA 4BDRA 4QBAA 3FUZA 3H4ZA 5JEIA 3N6TA 3KZGA 1FJ6A 4ELRA 4G61A 2FNCA 3IO4A 1US5A 3EPEA 1YZ0A 3A3CA 2ZZWA 1PEBA 2OWTA 1Y3PA 1B5JA 4LZ7A 1NNPA 2QJEA 4N6KA 1MXVA 3LC8A 3FZVA 1MXZA 3KEIA 2DE4A 3LV0A 4GWXA 3MPLA 1JVYA 2B65A 1B3EA 1CB6A 1XS5A 4RK2A 1MRPA 3U1OA 4MMPA 1NH8A 1IMEA 2DWIA 2DXRA 1N84A 2Y5LA 3TQWA 2P3NA 4GBWA 2WBBA 3E13X 3R26A 2L5VA 2QVUA 1PBPA 4LP2B 4U4SA 3TTNA 3RN8A 2UVGA 1IZ1A 4HCYA 3B6TA 3MPKA 4MBPA 4AB5A 2H9BA 2ZMBA 1MXYA 3KN7A 4GWWA 3RGYA 2XWIA 3F11A 4LVQA 5TP9B 4HXVA 3EF7A 1QJMA 5EYGA 1DTGA 4IGRA 5I58A 2I58A 1IXCA 1FJ9A 2H25A 1BIYA 5EQ9A 2ONSA 1JNFA 3PUXE 3ZKKA 4NF6A 1Y9UA 1OQHA 3CR9A 1YPNA 3K1PA 4OANA 3PMVA 4Q0CA 1MXWA 3C33A 3KOSA 1L5TA 5ET6A 3ODBA 3TZAA 4ZEKA 3TFLA 3MVXA 1LBCA 4NHBA 3IAZA 2ESNA 2O84X 5EHMA 5AA4B 4I1DA 4RK9A 1ZTYA 3FASA 3B6WA 5DTBA 2OCUA 3T96B 2Q9TA 5DVFA 2Q88A 5T3JA 1SPIA 2A5TA 1AH5A 1CE2A 1FPKA 4BDOA 4YZZA 1JVXA 1S50A 3D4CA 3OO7A 4MX6A 2VGQA 2XXWA 1EYKA 1VDWA 1A8FA 4PFRA 3GYYA 3E78A 2PCRA 1LGBC 1EZPA 1CNQA 2YJPA 1LAHE 3O2AA 1N7XA 1FBCA 3W15C 4AS5A 3FV1A 4YMAA 5AA2D 1SBPA 2H5YA 4DZ1A 4JBZA 4KYDA 4Z0IA 1TFAA 3JYRA 1IITA 4NF4B 1RYXA 3MAMA 5H8FA 4N8GA 1B7ZA 4KYSA 4PGPA 4XFEA 2V93A 4EF1A 4EQ9A 4DXBA 4PETA 2QMWA 4YU0A 5LDZA 4X9TA 3FGSA 2GFEA 5BUUA 2REJA 1A7LA 1NUWA 1K9ZA 1PC3A 1KZ8A 1JEVA 2QS2A 4KYEA 4F2OA 2XWOA 1TFDA 4GQOA 4XKRA 1FSAA 5FTIA 1R9LA 2DE3A 3MBPA 3VVFA 4IR8A 2ZZVA 1H3DA 1DPEA 1QUJA 3QYTA 4F22A 3A29A 3QSLA 2F3DA 4NWDA 2CEYA 1SW4A 3OOAA 5I2KB 4QRZA 1LEVA 2VP1A 3SEVA 2Y7RA 3KN8A 1DOTA 1MS7A 4PP0A 1AWBA 2Q8JA 4OFLA 5ICQA 1JW1A 3C36A 1NUZA 1RKMA 2THIA 1LBVA 2JJKA 5CM6A 5KDTB 3TMGA 1DTZA 2ZXTA 4F2QA 4ZDMA 1ZKBA 5AA1A 3K6WA 3H6WA 1A55A 2QFLA 2I0CA 1SYIA 2GQ1A 4KD5A 3PPPA 1B0HA 1LFIA 3OELA 3I3VA 1B3FA 3MZ1A 2FHYA 1B9JA 5K2YA 2HZKA 4XKQA 1H44A 3RUMA 1O64A 3A3UA 4PF8A 1FQBA 5FTHA 3EHUA 4R74A 1UTHB 4N8YA 4MNCA 3K00A 1SW2A 4MLQA 4PFUA 1EYJA 4EXKA 4H46A 3KG2A 1J1NA 2V84A 3I5OA 2DSFA 4EF2A 3SESA 4YAHX 1NV7A 1RDXA 2O51A 5ISUA 3S9MC 1USYE 2OZZA 4HE2A 1IQ7A 3N26A 4O7IA 2CZKA 2I0BA 3TTKA 4RNSA 5L8DA 2Z8EA 5CBSA 3E79A 4PFIA 2YPNA 4R2BA 4GX6A 2XXUA 3SKPA 1EZOA 1QULA 2XXIA 4GFRA 1DMBA 5IGAA 3LSXA 1A99A 4X8RA 4NX1A 2YLNA 3SEXA 5HBCA 2Q74A 2F97A 1ZMGA 2ALUA 3GXAA 3FJMA 4R73A 4OWDA 3G3JA 5TPAB 3DELB 5CRYA 2DP8A 2ONKE 1FBEA 4DCXA 2W7YA 1PBQA 3V8XB 3MP8A 4OYVA 4OHNA 4WEPA 3M3LA 5I59A 2XXHA 3TPAA 1FW0A 4KFQA 2UYFA 3C34A 4IO2A 1H76A 4GX3A 3UA8A 5JTYB 1JW4A 1QW0A 3DM0A 2UVHA 4L17A 1P1OA 1NV6A 4OETA 3MP6A 2XXRA 1AL3A 3C4MA 3FXUA 1MY4A 3VVDA 1NV1A 4P56A 3RT8A 4LATA 3MW0A 4LN5A 4OXVA 1NV5A 4ZEDA 4DIGA 5H8HB 5H8NA 4NF5A 4ELOA 4MH5A 2FA7A 3FXBA 4KCDA 2XXYA 2D3IA 4E0XA 4LQ2A 4GL0A 1B3HA 1POY1 1K9YA 1LAGE 4JWXA 2KLFA 3M3KA 4NF0A 5I3SA 4NE4A 1IXHA 4RA1A 4ESXA 4JSOA 4MJOA 3TUSA 2B4MA 4JVDA 3ZSFA 4N17A 1DPPA 2DWHA 5I2NA 2FIXA 1OQGA 2UXAA 4XKNA 1B52A 1PB9A 2F6PA 1IMAA 5K2XA 1OLCA 1SVXB 2E1SA 1UIVA 2DYXA 2QRYA 1NUXA 4OFOA 4TLLB 3Q26A 4ND9A 4H0WA 4HW8A 3KSXA 4EQ7A 4XTCQ 3HO7A 3QIMA 5JK4A 3R6UA 3DP8A 3RY3A 4I9DA 2DVCA 1B5HA 1POTA 5H8QB 3D1RA 4PFWA 2WYPA 1FQFA 3EHTA 4ZS9A 3I6VA 4EXLA 4HCWA 1SDXA 4MLVA 3DLNA 4GWZA 4N91A 4GRKA 4UACA 5ESYA 1N04A 1MQJA 4Q8RA 1FCKA 1RDYA 4N15A 3OSRA 1JEUA 5L9OA 1FBPA 4H5FA 1UTBA 1LBBA 5EYFA 4E0WA 1ATGA 3IB1A 3S4UA 1SI1A 1MM7A 3KBRA 4C1UA 1R6ZA 5FHMA 1FTKA 3FXQA 1Y4TA 2XX8A 4I8CA 1FPEA 3RYDA 1M5FA 5I57A 1LBXA 3QXMA 4XEQA 4I3YA 5BWJA 3PGFA 2FYIA 3L6HA 3TCHA 4R9FA 2I4CA 4ZEFA 3T0JA 3LSFB 4PAIA 2XX9A 3ZS6A 3K01A 1SYHA 4MEVA 4OA4A 3SEUA 5DYHA 1NL5A 5I56A 1R9QA 2O1LA 4U4XA 4QF9A 1IEJA 3PMXA 1NV3A 2QL3A 1EZ9A 4NMYA 2PX1A 4NTLA 1IUDA 4LZ5A 4NF8A 1S9TA 2UVIA 4OFJA 3B7DA 4R6HA 4KPTA 3C9HA 2XXXA 2AYSA 4PQJA 1D9YA 4GXSB 2RC8A 1SI0A 2QVVA 4F3BA 5ITOA 5F7VA 2O6AA 4M1VA 1MQIA 1JQFA 2WKYA 4F31B 1GVCA 2X7PA 1BP5A 3O28A 1BTJA 1TWYA 2ONRA 2PT1A 1ELJA 3D4GA 3VXBA 3HV1A 1H45A 4O8MA 3PU5A 3S9NC 1KA0A 5IZ1A 3FV2A 1BKAA 2Y7PA 2I3WA 5ET7A 3TTLA 4HE1A 4GWOA 3OD7A 2I4BA 1G0IA 3C32A 1P99A 3DP6A 1M5DA 3IJOB 1URGA 1FRPA 3R7XA 2RC9A 3T22A 5I58B 2QS3A 1B7UA 1FBDA 1QUIA 1YTVA 5DEXA 3U92A 4NF6B 1YXIA 4QXDA 4ZZEA 3QK6A 3U8QA 5FBPA 4ESWA 4N6PA 4R6YA 2Y7IA 1LFGA 3PUVE 1D9VA 4XXUA 2P2AA 4OENA 1WDNA 1PDAA 2F7BA 4MCOA 4ZECA 4NG7A 2DS9A 2A5TB 3EQ1A 3N6UA 4U2RA 4RJZA 2RKMA 2HHMA 3K6UA 3IFCA 3TEPA 4NN3A 3CI8A 1Z7NE 4RXLA 1LCFA 2QSXA 5AA2B 3GBBA 4DLDA 3KBZA 3H6VA 3UORA 3T9HB 4FEBA 3SERA 3W9WA 5ITPA 1M5BA 4WKMA 4NGUA 2Z8FA 3IFAA 2VD3A 2ABHA 3RLFE 4HE0A 2QPQA 4O3BA 2HPGA 1VFEA 5H8FB 1XOCA 3PPNA 2XXPA 1II5A 4O3AA 5B7DA 1Y20A 4ECFA 3N5LA 2OWSA 2R8TA 3Q27A 4P0GA 4G77A 1VR5A 4LUBA 4DI3D 4P8BA 5A5XB 4R75A 3ROJA 3MJNA 2KQZA 3T9VA 1DK4A 1UQWA 1JP4A 2XA5A 1N7WA 5L9SA 5IZ3B 3K6XA 2F35A 2QS1A 3GZGA 4PFTA 4PE5B 3FVGA 1B51A 3MSTA 4GD5A 3VE1B 1OVTA 2V4CA 4O94A 3DP4A 4DCYA 1Z7ME 4GIZA 2O7IA 1B6HA 4U21A 1GGGA 1Y3QA 3OXNA 5EQAA 3OSQA 4MIJA 1A40A 1S7YA 2XXKA 4EDPA 4R9GA 1US4A 2CZLA 1GV8A 1SQYA 4OVRA 3CVGA 1MPDA 4U23A 1N3XA 3Q25A 1F9BA 1R1NA 3CSGA 3RNNA 4THIA 4N6DA 3VV5A 3SETA 2O7UA 2XXQA 4NEDA 1YCJA 2PBWA 1DSNA 2HAVA 2ZNSA 4POXA 2AIXA 3SZPA 4I62A 4Z7EA 3K1NA 4ZEBA 1XVXA 1B2HA 3VFJA 4BDLA 2ZNTA 4IO6A 3UIFA 2O68A 1B3GA 3MVZA 4PTKA 1Y4CA 1IMDA 2HFBA 2F8DA 3KOTA 1B32A 5ELVA 2I48A 1B0LA 2H98A 2DQVA 4QFPA 4GWSA 3OO6A 3IOWA 2XWKA 4POWA 3HCQA 4ELPA 3ZKLA 1O63A 3H03A 1RYOA 1NNFA 1IXGA 4IO3A 3MQ9A 3GLBA 1MDP1 1MXXA 2V3TA 2RCAA 1FPDA 2BJJX 2XD3A 2G29A 5TPAA 2NVUB 1MXUA 5ET5A 5L9MA 4IY5A 3C35A 4OVPA 3ISPA 2ZYMA 3RTFB 1NUYA 4PDDA 3RT6B 3CRBA 5EQ8A 2VT5A 3OEKA 3ONMA 2Q8MA 3U65A 1T0KA 4U1ZA 5EYHA 1Y3NA 4PE3A 4OEUA 4PCDA 3ILTB 3PMWA 1QVSA 4QSDA 3VLWA 3HN0A 4KQPA 4BLAA 4OVSA 4H45A 2DWJA 2MKZA 2DDKA 4I40A 1P1WA 2V3UA 4JWYA 2RC7A 2F7AA 2Q89A 5TU0A 3S9EA 3HSTA 1XT8A 3MZBA 3PUWE 2LAOA 4IB2A 4O7MA 4AQ4A 4PBHA 1MDQA 4PF6A 4DI4B 4GL8A 4JXIA 2PMSA 5HM4B 1O7TA 3KFMA 1QKBA 3A09A 4WXJA 5DVJA 3PUZE 4H8JA 1QUKA 2DOJA 1AOVA 1AMFA 3E3KA 4NF5B 2A5SA 1OIBA 4G68B 4Q5TA 3IL1B 4G8MA 5CMCA 3T9UA 1INPA 1I6BA 4DXCA 3Q28A 3VLUA 3LBSA 1Y1ZA 2FIEA 1FTMA 5I84A 5KCJA 1DCUA 2ANJA 1FPFA 4ZE8A 1MH4A 4OERA 2WYKA 4QHQA 1EH3A 2FBPA 5I2NB 1XVYA 2IA4A 2B3BA 3CHGA 3N94A 2PVUA 1OMPA 3V5AA 5CI5A 5EHSA 1ZBMA 1FPLA 3MZ9A 1XI6A 4F3PA 3B50A 4F19A 1D9QA 4RPNA 4P1LA 5H8SA 1AIVA 4OEVA 3S2VA 3G3HA 1NH7A 1EYIA 1I6QA 2CEXA 5DVIA 1H43A 2HAUA 1NV2A 1USYH 3HHGA 3FJ7A 1IMFA 3GBAA 1RDZA 4LA9A 3CG3A 1I6AA 1NI9A 2F78A 2GHBA 2B4LA 2P0SA 3MYUA 2F3BA 2O69A 1G0HA 4FE8A 3PPRA 4BDQA 3PV0E 1NV0A 4FBPA 3PD9A 5IKBA 5IAIA 3RPLA 1UTBB 5EQ7A 5AA3A 1TT1A 4OZ9A 2PFZA 4JSDA 2Z22A 3FVKA 3PTYA 4H1XA 2VHAA 3O9PA 3PD8A 3FBPA 3QMFA 3HFUA 4H8IA 4NWCA 4AB6A 5I57B 2ZNUA 3WAEA 4N13A 4XF5A 4NAPA 4UABA 4U22A 1FQCA 1QKAA 4P9KA 2XD2A 3FATA 2OJTA 2XXTA 4TLMB 1B4HA 2Y7WA 4P3LA 5IZZA 3FVNA 4EUOA 4IY6A 3G3KA 5CBRA 3AXFA 1GTKA 4H67A 3RQTA 5I56B 4MNPA 3UGWA 4GVOA 3K6VA 3KN3A 2UYEA 3JZJA 4Q30B 5M2VA 4PBQA 4GWUA 4RYAA 5B70A 3MC2A 4OVTA 2CZHA 3SEYA 3OEMA 2UVJA 4GF8A 4NF8B 4H6DA 4YICA 1JETA 5J1DA 1FQDA 4YKJA 4OESA 1MY2A 1OVBA 1UIUA 3G3GA 4IO4A 2P1SA 4PAFA 1A8EA 4H5GA 5CMBA 3VXCA 2OWZA 3OO9A 4QSEA 2F5XA 3T93B 3T1BA 1FQAA 4GOTA 5TP9A 3H7MA 4N81A 4PGNA 1B3LA 3EKIA 4WEDA 3VVEA 1LB9A 3M3FA 2G93A 3KGCA 3JV9A 4FAJA 4MAGA 4G4PA 5F1QA 1A54A 3G3FA 4PAKA 1LBWA 2F7CA 3UP9A 1FPJA 3TKDA 5ICTA 5DW8A 1N76A 3S9LC 1NKXA 4C0RA 3K4UA 2PYYA 4X1BA 1URDA 3B6QA 3TCGA 5AA4A 1FTJA 2DVZA 3FXRA 3O66A 3V83A 4FORA 3LSLA 1FTOA 3PUYE 4MHFA 4OMBA 1BLFA 4DXUA 2NUVA 4MF3A 3O6IA 4PC9A 3CSBA 3TYHA 2WX9A 5CC2A 3PPOA 1FPIA 1IIWA 4GLIA 4YB7A 1P1UA 5DEXB 3U93A 3O6HA 3B8BA 3T66A 3O29A 2ZYKA 1LSTA 1PB8A 1B1HA 4FECA 5KZTA 2Y7KA 2QS4A 2B3FA 2CMOA 4RPOA 1YAEA 3K1MA 4YB5A 5ET8A 4LQ5A 3OMBA 5AA2A 4PFBA 3Q29A 3T9XB 4NF4A 1B58A 2HEUA 1ZLQA 4GX4A 3KC1A 2XX7A 1N3WA 3IB2A 2Q2CA 3U94A 1FPBA 2OX3A 2OK2A 2DE2A 3G3IA 4G8HA 1Q35A 4IGTA 4GWYA 2XHDA 1B46A 4N07A 4X48A 2DXYA 1BK4A 1B05A 3KJTA 1Y1MA 1KWHA 4N4UA 2BJIA 1XC1A 1MPCA 3IOTA 3M8UA 3VLVA 1DBZA 5FHNA 1NMUA 4PDHA 1SW1A 5A5XA 3WAFA 2H4IA 4MNIA 1FTLA 3CG1A 2ZYNA 4ZEIA 5I2KA 3G7WA 1FQEA 2RCBA 1LAFE 1GR2A 5IZ3A 3NOHA 4P1EA 2R6GE 4F1YA 3KJ7A 3BIHA 5IM2A 4H65A 5J16A 2H99A 4FEDA 4DDDA 4F1VA 3BFTA 5KDTA 4IO5A 2VD2A 1EU8A 4YKIA 3IO6A 4GXAA 2OBGA 3U72A 3UN6A 2X7QA 2ZZXA 1IMCA 2M8CA 5DT6A 4BDMA 3IK6B 4X1DA 1JW5A 1MY0A 2HXWA 3IORA 2GRVA 4FIMA 5LTCA 2I3VA 1FBHA 1QGXA 1NFTA 4TOZA 4LZ8A 3BIGA 3USDA 2VOZA 2Z23A 2AL5A 4JB7A 1LBYA 3IR1A 1FBFA 4XKPA 3TTRA 4KI0E 1D3KA 1UTHA 4M4GA 4I3EA 4R72A 3MWBA 1MY3A 2PT2A 5CMMA 1SW5A 3CFZA 4KXPA 4KR5A 4F1UA 3BBRA 3FD3A 2WBDA 1OLAA 1WODA 1B4ZA 1NV4A 1MM6A 5A5LA 1VSOA 4R6KA 3TODA 1ANFA 2F6GA 3E9XA 4YKPA 1B40A 3CFLA 4JWOA 4C1TA 1ZU0A 2E0SA 2OLBA 4K3FA 4JDFA 3OENA 3C31A 2I6EA 2VPOA 1TXFA 3QAXA 4ZE9A 2PFYA 3IB0A 3P7IA 3QUJA 1LCTA 2QMXA 4HS7A 1HSJA 3SDFA 1NNTA 4OQOA 2V3QA 2NOOA 4P11A 3BFUA 1D4NA 2XWVA 3ILUB 1SD3A 2HQ0A 4QFNA
chains in the Genus database with same CATH topology
5AE4A 1URSA 4ONYA 2O1MA 4DE8A 1MG1A 3FJGA 4YKKA 3MP1A 3L6GA 1I69A 2D5WA 3TAJA 2F34A 1N0TA 2RF1A 3K2DA 3HPIA 4FJPA 4HTGA 3BKIB 3CFXA 5JTYA 3H6TA 2NXOA 3MVYA 4OTEA 1MH3A 3TTMA 5I59B 3LR1A 4OVJA 1MQGA 2D21A 3FIRA 3LUYA 3K02A 3LSWA 4KCCA 5CMKA 3H06B 4ZZAA 1LFHA 3O97A 4ELQA 1IXIA 3HHFA 3PPQA 4KHZE 4RY1A 2R71A 1ZJLA 5H8HA 1MQHA 4FATA 4G2ZA 4QFKA 2RINA 3O6GA 4R2FA 2HZLA 2NWJA 4YMBA 4F29A 1MPBA 2DWAA 1XHYA 2HCAA 2V25A 2F36A 4QFOA 4IO7A 2Z8DA 1WVJA 3H6UA 3UK4A 1HSLA 4BDNA 3THIA 2I49A 2R9JA 3TDJA 5H8NB 2GH9A 4G68C 3VDFA 1MY1A 4G68A 4TQUQ 4PFYA 4QFLA 2X26A 2Y84A 1P1NA 3E4RA 1MQDA 1PB7A 1M5EA 1P1QA 5LOMA 3SEWA 1B1XA 1HSEA 3TELA 1LB8A 3EN3A 1B7HA 4F18A 3W9VA 5H8QA 4P0IA 5KCJB 4QSCA 3EHSA 4UA8A 3RTWB 3IOVA 1LAXA 3RPWA 1B5IA 4XIGQ 2Q2AA 4O3CA 3V89B 2REGA 2AL4A 3H3GA 2ZYOA 3FVOA 3OO8A 3TQLA 5HPQA 4F39A 1M5CA 4G8NA 3IJXB 3ECRA 1VE4A 1LLSA 3MUQA 2GHAA 5FHOA 3CIJA 3K0VA 3MVWA 3TCFA 4MFIA 4F3SA 3IX1A 2XXVA 2IEEA 4ISUA 4EQBA 1NNKA 4U1OA 4LONB 4YB6A 4F3GA 1ZIUA 3KSJA 3QUFA 3IOUA 1Q1KA 1VFDA 4BDRA 3FUZA 3H4ZA 5JEIA 3N6TA 3KZGA 4ELRA 2FNCA 3IO4A 1US5A 3EPEA 3A3CA 1PEBA 2OWTA 1Y3PA 1B5JA 4LZ7A 1NNPA 2QJEA 1MXVA 3LC8A 3FZVA 1MXZA 3KEIA 2DE4A 3MPLA 1JVYA 2B65A 1B3EA 1CB6A 1XS5A 4RK2A 1MRPA 3U1OA 1NH8A 2DWIA 2DXRA 1N84A 3TQWA 3E13X 3R26A 1PBPA 4LP2B 4U4SA 3TTNA 3RN8A 2UVGA 1IZ1A 4HCYA 3B6TA 3MPKA 4MBPA 4AB5A 2H9BA 2ZMBA 1MXYA 3KN7A 3RGYA 3F11A 4LVQA 5TP9B 3EF7A 1QJMA 1DTGA 4IGRA 5I58A 2I58A 1IXCA 2H25A 1BIYA 2ONSA 1JNFA 3PUXE 3ZKKA 4NF6A 1Y9UA 1OQHA 3CR9A 1YPNA 3K1PA 3PMVA 4Q0CA 1MXWA 3C33A 3KOSA 1L5TA 3ODBA 3TZAA 4ZEKA 3TFLA 3MVXA 1LBCA 3IAZA 2ESNA 2O84X 5EHMA 5AA4B 4I1DA 4RK9A 1ZTYA 3FASA 3B6WA 5DTBA 2OCUA 3T96B 2Q9TA 5DVFA 2Q88A 2A5TA 1AH5A 1CE2A 4BDOA 4YZZA 1JVXA 1S50A 3D4CA 3OO7A 2VGQA 2XXWA 1A8FA 1LGBC 1EZPA 2YJPA 1LAHE 3O2AA 1N7XA 3W15C 3FV1A 4YMAA 5AA2D 4DZ1A 1SBPA 2H5YA 4JBZA 4KYDA 4Z0IA 1TFAA 3JYRA 1IITA 4NF4B 1RYXA 3MAMA 5H8FA 1B7ZA 4EQ9A 4KYSA 2V93A 4EF1A 4DXBA 4PETA 2QMWA 4YU0A 4X9TA 3FGSA 2GFEA 5BUUA 2REJA 1A7LA 1PC3A 1JEVA 2QS2A 4KYEA 4F2OA 1TFDA 4GQOA 4XKRA 5FTIA 1R9LA 2DE3A 3MBPA 3VVFA 1H3DA 1DPEA 1QUJA 3QYTA 4F22A 3QSLA 4NWDA 1SW4A 3OOAA 5I2KB 4QRZA 2VP1A 3SEVA 2Y7RA 3KN8A 1DOTA 1MS7A 4PP0A 2Q8JA 4OFLA 5ICQA 1JW1A 3C36A 1RKMA 2THIA 5CM6A 5KDTB 3TMGA 1DTZA 2ZXTA 4F2QA 4ZDMA 1ZKBA 5AA1A 3K6WA 3H6WA 1A55A 2I0CA 1SYIA 4KD5A 3PPPA 1B0HA 1LFIA 3OELA 3I3VA 1B3FA 3MZ1A 1B9JA 5K2YA 2HZKA 4XKQA 1H44A 3RUMA 1O64A 3A3UA 1FQBA 5FTHA 3EHUA 4R74A 1UTHB 3K00A 1SW2A 4MLQA 4PFUA 4EXKA 3KG2A 1J1NA 2V84A 3I5OA 2DSFA 4EF2A 3SESA 4YAHX 2O51A 5ISUA 3S9MC 1USYE 2OZZA 1IQ7A 3N26A 2I0BA 3TTKA 4RNSA 5L8DA 2Z8EA 5CBSA 2YPNA 4R2BA 2XXUA 3SKPA 1EZOA 1QULA 2XXIA 4GFRA 1DMBA 3LSXA 1A99A 2YLNA 3SEXA 5HBCA 2F97A 1ZMGA 2ALUA 3GXAA 3FJMA 4R73A 4OWDA 3G3JA 5TPAB 3DELB 5CRYA 2DP8A 2ONKE 4DCXA 2W7YA 1PBQA 3V8XB 3MP8A 4OYVA 4OHNA 4WEPA 3M3LA 5I59A 2XXHA 3TPAA 1FW0A 4KFQA 2UYFA 3C34A 4IO2A 1H76A 3UA8A 5JTYB 1JW4A 1QW0A 3DM0A 2UVHA 4L17A 1P1OA 4OETA 3MP6A 2XXRA 1AL3A 3C4MA 3FXUA 1MY4A 3VVDA 3RT8A 4LATA 3MW0A 4OXVA 4ZEDA 4DIGA 5H8HB 5H8NA 4NF5A 4ELOA 4MH5A 2FA7A 4KCDA 2XXYA 2D3IA 4E0XA 4LQ2A 4GL0A 1B3HA 1POY1 1LAGE 4JWXA 2KLFA 3M3KA 4NE4A 1IXHA 4RA1A 4ESXA 4JSOA 3TUSA 3ZSFA 1DPPA 2DWHA 5I2NA 1OQGA 2UXAA 4XKNA 1B52A 1PB9A 2F6PA 5K2XA 1OLCA 1SVXB 2E1SA 1UIVA 2DYXA 2QRYA 4OFOA 4TLLB 3Q26A 4ND9A 4H0WA 4HW8A 3KSXA 4EQ7A 4XTCQ 3HO7A 3QIMA 5JK4A 3R6UA 3DP8A 3RY3A 4I9DA 2DVCA 1B5HA 1POTA 5H8QB 4PFWA 1FQFA 3EHTA 4ZS9A 3I6VA 4EXLA 4HCWA 1SDXA 4MLVA 3DLNA 4GRKA 4UACA 1N04A 1MQJA 4Q8RA 1FCKA 3OSRA 1JEUA 5L9OA 4H5FA 1UTBA 1LBBA 5EYFA 4E0WA 1ATGA 3IB1A 3S4UA 1SI1A 1MM7A 3KBRA 4C1UA 1R6ZA 5FHMA 1FTKA 3FXQA 1Y4TA 2XX8A 4I8CA 1M5FA 5I57A 3QXMA 5BWJA 3PGFA 2FYIA 3L6HA 3TCHA 4R9FA 2I4CA 4ZEFA 3LSFB 2XX9A 3ZS6A 3K01A 1SYHA 3SEUA 5DYHA 1NL5A 5I56A 1R9QA 2O1LA 4U4XA 4QF9A 1IEJA 3PMXA 2QL3A 1EZ9A 4NMYA 2PX1A 4NTLA 1IUDA 4LZ5A 4NF8A 1S9TA 2UVIA 4OFJA 3B7DA 4R6HA 4KPTA 3C9HA 2XXXA 2AYSA 4PQJA 1D9YA 4GXSB 2RC8A 1SI0A 4F3BA 5ITOA 5F7VA 2O6AA 4M1VA 1MQIA 1JQFA 2WKYA 4F31B 1GVCA 2X7PA 1BP5A 3O28A 1BTJA 1TWYA 2ONRA 2PT1A 1ELJA 3D4GA 3VXBA 3HV1A 1H45A 3PU5A 3S9NC 3FV2A 1BKAA 2Y7PA 2I3WA 3TTLA 4GWOA 3OD7A 2I4BA 3C32A 1P99A 3DP6A 1M5DA 3IJOB 1URGA 3R7XA 2RC9A 3T22A 5I58B 2QS3A 1B7UA 1YTVA 1QUIA 5DEXA 3U92A 4NF6B 4ZZEA 3QK6A 3U8QA 4ESWA 4N6PA 4R6YA 2Y7IA 1LFGA 3PUVE 1D9VA 4XXUA 2P2AA 4OENA 1WDNA 1PDAA 2F7BA 4ZECA 2DS9A 2A5TB 3EQ1A 3N6UA 4U2RA 4RJZA 2RKMA 3K6UA 3TEPA 3CI8A 1Z7NE 4RXLA 1LCFA 2QSXA 5AA2B 3GBBA 4DLDA 3H6VA 3UORA 3T9HB 4FEBA 3SERA 3W9WA 5ITPA 1M5BA 4WKMA 2Z8FA 2VD3A 2ABHA 3RLFE 2QPQA 4O3BA 1VFEA 5H8FB 1XOCA 3PPNA 2XXPA 1II5A 4O3AA 5B7DA 1Y20A 4ECFA 3N5LA 2OWSA 3Q27A 4P0GA 4G77A 1VR5A 4LUBA 5A5XB 4R75A 3MJNA 3T9VA 1UQWA 1N7WA 5L9SA 3K6XA 2F35A 2QS1A 3GZGA 4PE5B 4PFTA 3FVGA 1B51A 4GD5A 3VE1B 1OVTA 3DP4A 4DCYA 1Z7ME 4GIZA 2O7IA 1B6HA 4U21A 1GGGA 1Y3QA 3OXNA 3OSQA 1A40A 1S7YA 4EDPA 4R9GA 1US4A 2CZLA 1GV8A 1SQYA 3CVGA 1MPDA 4U23A 1N3XA 3Q25A 1F9BA 1R1NA 3CSGA 3RNNA 4THIA 3VV5A 3SETA 2O7UA 2XXQA 4NEDA 1YCJA 2PBWA 1DSNA 2HAVA 2ZNSA 4POXA 2AIXA 4I62A 4Z7EA 3K1NA 4ZEBA 1XVXA 1B2HA 3VFJA 4BDLA 2ZNTA 4IO6A 3UIFA 2O68A 1B3GA 3MVZA 1Y4CA 2HFBA 2F8DA 3KOTA 1B32A 5ELVA 2I48A 1B0LA 2H98A 2DQVA 4QFPA 3OO6A 3IOWA 4POWA 3HCQA 4ELPA 3ZKLA 1O63A 3H03A 1RYOA 1NNFA 1IXGA 4IO3A 3MQ9A 3GLBA 1MDP1 1MXXA 2V3TA 2RCAA 2BJJX 2XD3A 2G29A 5TPAA 2NVUB 1MXUA 5L9MA 4IY5A 3C35A 2ZYMA 3RTFB 3RT6B 3CRBA 3OEKA 3ONMA 1T0KA 4U1ZA 1Y3NA 4OEUA 3ILTB 3PMWA 1QVSA 4QSDA 3VLWA 3HN0A 4KQPA 4BLAA 2DWJA 1P1WA 2V3UA 4JWYA 2RC7A 2F7AA 2Q89A 5TU0A 3S9EA 3HSTA 1XT8A 3MZBA 3PUWE 2LAOA 4IB2A 4AQ4A 1MDQA 4GL8A 4JXIA 2PMSA 5HM4B 1O7TA 3KFMA 1QKBA 3A09A 4WXJA 5DVJA 3PUZE 4H8JA 1QUKA 2DOJA 1AOVA 1AMFA 3E3KA 4NF5B 2A5SA 1OIBA 4G68B 4Q5TA 3IL1B 4G8MA 5CMCA 3T9UA 1I6BA 4DXCA 3Q28A 3VLUA 3LBSA 1Y1ZA 1FTMA 5I84A 5KCJA 2ANJA 4ZE8A 1MH4A 4OERA 4QHQA 1EH3A 5I2NB 1XVYA 2IA4A 2B3BA 3N94A 2PVUA 1OMPA 3V5AA 5CI5A 5EHSA 1ZBMA 3MZ9A 4F3PA 4F19A 4RPNA 5H8SA 1AIVA 4OEVA 3S2VA 3G3HA 1NH7A 1I6QA 5DVIA 1H43A 2HAUA 1USYH 3HHGA 3FJ7A 3GBAA 4LA9A 3CG3A 1I6AA 2F78A 2GHBA 2P0SA 2O69A 4FE8A 3PPRA 4BDQA 3PV0E 3PD9A 5IKBA 5IAIA 1UTBB 5AA3A 1TT1A 4OZ9A 4JSDA 2Z22A 3FVKA 4H1XA 2VHAA 3O9PA 3PD8A 4H8IA 4NWCA 4AB6A 5I57B 2ZNUA 3WAEA 4N13A 4U22A 1FQCA 1QKAA 2XD2A 3FATA 2OJTA 2XXTA 4TLMB 1B4HA 2Y7WA 3FVNA 4EUOA 4IY6A 3G3KA 5CBRA 3AXFA 1GTKA 4H67A 3RQTA 5I56B 3UGWA 4GVOA 3K6VA 3KN3A 2UYEA 3JZJA 4Q30B 5M2VA 4RYAA 5B70A 3MC2A 3SEYA 3OEMA 2UVJA 4GF8A 4NF8B 4H6DA 4YICA 1JETA 5J1DA 1FQDA 4YKJA 4OESA 1MY2A 1OVBA 1UIUA 3G3GA 4IO4A 2P1SA 1A8EA 4H5GA 5CMBA 3VXCA 3OO9A 4QSEA 2F5XA 3T93B 1FQAA 4GOTA 5TP9A 3H7MA 1B3LA 4WEDA 3VVEA 1LB9A 3M3FA 2G93A 3KGCA 3JV9A 4FAJA 4G4PA 5F1QA 1A54A 3G3FA 3UP9A 2F7CA 3TKDA 5ICTA 1N76A 3S9LC 1NKXA 4C0RA 3K4UA 2PYYA 4X1BA 1URDA 3B6QA 3TCGA 5AA4A 1FTJA 2DVZA 3FXRA 3O66A 3V83A 4FORA 3LSLA 1FTOA 3PUYE 4OMBA 1BLFA 4DXUA 2NUVA 4MF3A 3O6IA 3CSBA 3TYHA 5CC2A 3PPOA 1IIWA 4GLIA 4YB7A 3U93A 1P1UA 5DEXB 3O6HA 3T66A 3O29A 2ZYKA 1LSTA 1PB8A 1B1HA 4FECA 5KZTA 2Y7KA 2QS4A 2B3FA 2CMOA 4RPOA 1YAEA 3K1MA 4YB5A 4LQ5A 3OMBA 5AA2A 3Q29A 3T9XB 4NF4A 1B58A 2HEUA 1ZLQA 2XX7A 1N3WA 3IB2A 2Q2CA 3U94A 2OK2A 2DE2A 3G3IA 4G8HA 1Q35A 4IGTA 2XHDA 1B46A 4N07A 4X48A 2DXYA 1B05A 3KJTA 1Y1MA 1KWHA 1XC1A 1MPCA 3IOTA 3M8UA 3VLVA 5FHNA 1NMUA 1SW1A 5A5XA 3WAFA 2H4IA 1FTLA 3CG1A 2ZYNA 4ZEIA 5I2KA 3G7WA 1FQEA 2RCBA 1LAFE 1GR2A 2R6GE 4F1YA 3KJ7A 4H65A 2H99A 4FEDA 4DDDA 4F1VA 3BFTA 5KDTA 4IO5A 2VD2A 1EU8A 4YKIA 3IO6A 4GXAA 2OBGA 3U72A 3UN6A 2X7QA 2M8CA 5DT6A 4BDMA 3IK6B 4X1DA 1JW5A 1MY0A 2HXWA 3IORA 2GRVA 4FIMA 2I3VA 1NFTA 4TOZA 4LZ8A 3USDA 2VOZA 2Z23A 2AL5A 4JB7A 3IR1A 4XKPA 3TTRA 4KI0E 1D3KA 1UTHA 4M4GA 4R72A 3MWBA 1MY3A 2PT2A 5CMMA 1SW5A 3CFZA 4KR5A 4F1UA 3BBRA 3FD3A 1OLAA 1WODA 1B4ZA 1MM6A 1VSOA 4R6KA 3TODA 1ANFA 2F6GA 3E9XA 4YKPA 1B40A 3CFLA 4JWOA 4C1TA 1ZU0A 2E0SA 2OLBA 4K3FA 4JDFA 3OENA 3C31A 2I6EA 1TXFA 3QAXA 4ZE9A 3IB0A 3P7IA 3QUJA 1LCTA 2QMXA 4HS7A 1HSJA 3SDFA 1NNTA 4OQOA 2V3QA 2NOOA 4P11A 3BFUA 1D4NA 3ILUB 1SD3A 2HQ0A 4QFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AE4 A;  1URS A;  4ONY A;  2O1M A;  4DE8 A;  1MG1 A;  3FJG A;  4YKK A;  3MP1 A;  3L6G A;  1I69 A;  2D5W A;  3TAJ A;  2F34 A;  1N0T A;  2RF1 A;  3K2D A;  3HPI A;  4FJP A;  4HTG A;  3BKI B;  3CFX A;  5JTY A;  3H6T A;  2NXO A;  3MVY A;  4OTE A;  1MH3 A;  3TTM A;  5I59 B;  3LR1 A;  4OVJ A;  1MQG A;  2D21 A;  3FIR A;  3LUY A;  3K02 A;  3LSW A;  4KCC A;  5CMK A;  3H06 B;  4ZZA A;  1LFH A;  3O97 A;  4ELQ A;  1IXI A;  3HHF A;  3PPQ A;  4KHZ E;  4RY1 A;  2R71 A;  1ZJL A;  5H8H A;  1MQH A;  4FAT A;  4G2Z A;  4QFK A;  2RIN A;  3O6G A;  4R2F A;  2HZL A;  2NWJ A;  4YMB A;  4F29 A;  1MPB A;  2DWA A;  1XHY A;  2HCA A;  2V25 A;  2F36 A;  4QFO A;  4IO7 A;  2Z8D A;  1WVJ A;  3H6U A;  3UK4 A;  1HSL A;  4BDN A;  3THI A;  2I49 A;  2R9J A;  3TDJ A;  5H8N B;  2GH9 A;  4G68 C;  3VDF A;  1MY1 A;  4G68 A;  4TQU Q;  4PFY A;  4QFL A;  2X26 A;  2Y84 A;  1P1N A;  3E4R A;  1MQD A;  1PB7 A;  1M5E A;  1P1Q A;  5LOM A;  3SEW A;  1B1X A;  1HSE A;  3TEL A;  1LB8 A;  3EN3 A;  1B7H A;  4F18 A;  3W9V A;  5H8Q A;  4P0I A;  5KCJ B;  4QSC A;  3EHS A;  4UA8 A;  3RTW B;  3IOV A;  1LAX A;  3RPW A;  1B5I A;  4XIG Q;  2Q2A A;  4O3C A;  3V89 B;  2REG A;  2AL4 A;  3H3G A;  2ZYO A;  3FVO A;  3OO8 A;  3TQL A;  5HPQ A;  4F39 A;  1M5C A;  4G8N A;  3IJX B;  3ECR A;  1VE4 A;  1LLS A;  3MUQ A;  2GHA A;  5FHO A;  3CIJ A;  3K0V A;  3MVW A;  3TCF A;  4MFI A;  4F3S A;  3IX1 A;  2XXV A;  2IEE A;  4ISU A;  4EQB A;  1NNK A;  4U1O A;  4LON B;  4YB6 A;  4F3G A;  1ZIU A;  3KSJ A;  3QUF A;  3IOU A;  1Q1K A;  1VFD A;  4BDR A;  3FUZ A;  3H4Z A;  5JEI A;  3N6T A;  3KZG A;  4ELR A;  2FNC A;  3IO4 A;  1US5 A;  3EPE A;  3A3C A;  1PEB A;  2OWT A;  1Y3P A;  1B5J A;  4LZ7 A;  1NNP A;  2QJE A;  1MXV A;  3LC8 A;  3FZV A;  1MXZ A;  3KEI A;  2DE4 A;  3MPL A;  1JVY A;  2B65 A;  1B3E A;  1CB6 A;  1XS5 A;  4RK2 A;  1MRP A;  3U1O A;  1NH8 A;  2DWI A;  2DXR A;  1N84 A;  3TQW A;  3E13 X;  3R26 A;  1PBP A;  4LP2 B;  4U4S A;  3TTN A;  3RN8 A;  2UVG A;  1IZ1 A;  4HCY A;  3B6T A;  3MPK A;  4MBP A;  4AB5 A;  2H9B A;  2ZMB A;  1MXY A;  3KN7 A;  3RGY A;  3F11 A;  4LVQ A;  5TP9 B;  3EF7 A;  1QJM A;  1DTG A;  4IGR A;  5I58 A;  2I58 A;  1IXC A;  2H25 A;  1BIY A;  2ONS A;  1JNF A;  3PUX E;  3ZKK A;  4NF6 A;  1Y9U A;  1OQH A;  3CR9 A;  1YPN A;  3K1P A;  3PMV A;  4Q0C A;  1MXW A;  3C33 A;  3KOS A;  1L5T A;  3ODB A;  3TZA A;  4ZEK A;  3TFL A;  3MVX A;  1LBC A;  3IAZ A;  2ESN A;  2O84 X;  5EHM A;  5AA4 B;  4I1D A;  4RK9 A;  1ZTY A;  3FAS A;  3B6W A;  5DTB A;  2OCU A;  3T96 B;  2Q9T A;  5DVF A;  2Q88 A;  2A5T A;  1AH5 A;  1CE2 A;  4BDO A;  4YZZ A;  1JVX A;  1S50 A;  3D4C A;  3OO7 A;  2VGQ A;  2XXW A;  1A8F A;  1LGB C;  1EZP A;  2YJP A;  1LAH E;  3O2A A;  1N7X A;  3W15 C;  3FV1 A;  4YMA A;  5AA2 D;  4DZ1 A;  1SBP A;  2H5Y A;  4JBZ A;  4KYD A;  4Z0I A;  1TFA A;  3JYR A;  1IIT A;  4NF4 B;  1RYX A;  3MAM A;  5H8F A;  1B7Z A;  4EQ9 A;  4KYS A;  2V93 A;  4EF1 A;  4DXB A;  4PET A;  2QMW A;  4YU0 A;  4X9T A;  3FGS A;  2GFE A;  5BUU A;  2REJ A;  1A7L A;  1PC3 A;  1JEV A;  2QS2 A;  4KYE A;  4F2O A;  1TFD A;  4GQO A;  4XKR A;  5FTI A;  1R9L A;  2DE3 A;  3MBP A;  3VVF A;  1H3D A;  1DPE A;  1QUJ A;  3QYT A;  4F22 A;  3QSL A;  4NWD A;  1SW4 A;  3OOA A;  5I2K B;  4QRZ A;  2VP1 A;  3SEV A;  2Y7R A;  3KN8 A;  1DOT A;  1MS7 A;  4PP0 A;  2Q8J A;  4OFL A;  5ICQ A;  1JW1 A;  3C36 A;  1RKM A;  2THI A;  5CM6 A;  5KDT B;  3TMG A;  1DTZ A;  2ZXT A;  4F2Q A;  4ZDM A;  1ZKB A;  5AA1 A;  3K6W A;  3H6W A;  1A55 A;  2I0C A;  1SYI A;  4KD5 A;  3PPP A;  1B0H A;  1LFI A;  3OEL A;  3I3V A;  1B3F A;  3MZ1 A;  1B9J A;  5K2Y A;  2HZK A;  4XKQ A;  1H44 A;  3RUM A;  1O64 A;  3A3U A;  1FQB A;  5FTH A;  3EHU A;  4R74 A;  1UTH B;  3K00 A;  1SW2 A;  4MLQ A;  4PFU A;  4EXK A;  3KG2 A;  1J1N A;  2V84 A;  3I5O A;  2DSF A;  4EF2 A;  3SES A;  4YAH X;  2O51 A;  5ISU A;  3S9M C;  1USY E;  2OZZ A;  1IQ7 A;  3N26 A;  2I0B A;  3TTK A;  4RNS A;  5L8D A;  2Z8E A;  5CBS A;  2YPN A;  4R2B A;  2XXU A;  3SKP A;  1EZO A;  1QUL A;  2XXI A;  4GFR A;  1DMB A;  3LSX A;  1A99 A;  2YLN A;  3SEX A;  5HBC A;  2F97 A;  1ZMG A;  2ALU A;  3GXA A;  3FJM A;  4R73 A;  4OWD A;  3G3J A;  5TPA B;  3DEL B;  5CRY A;  2DP8 A;  2ONK E;  4DCX A;  2W7Y A;  1PBQ A;  3V8X B;  3MP8 A;  4OYV A;  4OHN A;  4WEP A;  3M3L A;  5I59 A;  2XXH A;  3TPA A;  1FW0 A;  4KFQ A;  2UYF A;  3C34 A;  4IO2 A;  1H76 A;  3UA8 A;  5JTY B;  1JW4 A;  1QW0 A;  3DM0 A;  2UVH A;  4L17 A;  1P1O A;  4OET A;  3MP6 A;  2XXR A;  1AL3 A;  3C4M A;  3FXU A;  1MY4 A;  3VVD A;  3RT8 A;  4LAT A;  3MW0 A;  4OXV A;  4ZED A;  4DIG A;  5H8H B;  5H8N A;  4NF5 A;  4ELO A;  4MH5 A;  2FA7 A;  4KCD A;  2XXY A;  2D3I A;  4E0X A;  4LQ2 A;  4GL0 A;  1B3H A;  1POY 1;  1LAG E;  4JWX A;  2KLF A;  3M3K A;  4NE4 A;  1IXH A;  4RA1 A;  4ESX A;  4JSO A;  3TUS A;  3ZSF A;  1DPP A;  2DWH A;  5I2N A;  1OQG A;  2UXA A;  4XKN A;  1B52 A;  1PB9 A;  2F6P A;  5K2X A;  1OLC A;  1SVX B;  2E1S A;  1UIV A;  2DYX A;  2QRY A;  4OFO A;  4TLL B;  3Q26 A;  4ND9 A;  4H0W A;  4HW8 A;  3KSX A;  4EQ7 A;  4XTC Q;  3HO7 A;  3QIM A;  5JK4 A;  3R6U A;  3DP8 A;  3RY3 A;  4I9D A;  2DVC A;  1B5H A;  1POT A;  5H8Q B;  4PFW A;  1FQF A;  3EHT A;  4ZS9 A;  3I6V A;  4EXL A;  4HCW A;  1SDX A;  4MLV A;  3DLN A;  4GRK A;  4UAC A;  1N04 A;  1MQJ A;  4Q8R A;  1FCK A;  3OSR A;  1JEU A;  5L9O A;  4H5F A;  1UTB A;  1LBB A;  5EYF A;  4E0W A;  1ATG A;  3IB1 A;  3S4U A;  1SI1 A;  1MM7 A;  3KBR A;  4C1U A;  1R6Z A;  5FHM A;  1FTK A;  3FXQ A;  1Y4T A;  2XX8 A;  4I8C A;  1M5F A;  5I57 A;  3QXM A;  5BWJ A;  3PGF A;  2FYI A;  3L6H A;  3TCH A;  4R9F A;  2I4C A;  4ZEF A;  3LSF B;  2XX9 A;  3ZS6 A;  3K01 A;  1SYH A;  3SEU A;  5DYH A;  1NL5 A;  5I56 A;  1R9Q A;  2O1L A;  4U4X A;  4QF9 A;  1IEJ A;  3PMX A;  2QL3 A;  1EZ9 A;  4NMY A;  2PX1 A;  4NTL A;  1IUD A;  4LZ5 A;  4NF8 A;  1S9T A;  2UVI A;  4OFJ A;  3B7D A;  4R6H A;  4KPT A;  3C9H A;  2XXX A;  2AYS A;  4PQJ A;  1D9Y A;  4GXS B;  2RC8 A;  1SI0 A;  4F3B A;  5ITO A;  5F7V A;  2O6A A;  4M1V A;  1MQI A;  1JQF A;  2WKY A;  4F31 B;  1GVC A;  2X7P A;  1BP5 A;  3O28 A;  1BTJ A;  1TWY A;  2ONR A;  2PT1 A;  1ELJ A;  3D4G A;  3VXB A;  3HV1 A;  1H45 A;  3PU5 A;  3S9N C;  3FV2 A;  1BKA A;  2Y7P A;  2I3W A;  3TTL A;  4GWO A;  3OD7 A;  2I4B A;  3C32 A;  1P99 A;  3DP6 A;  1M5D A;  3IJO B;  1URG A;  3R7X A;  2RC9 A;  3T22 A;  5I58 B;  2QS3 A;  1B7U A;  1YTV A;  1QUI A;  5DEX A;  3U92 A;  4NF6 B;  4ZZE A;  3QK6 A;  3U8Q A;  4ESW A;  4N6P A;  4R6Y A;  2Y7I A;  1LFG A;  3PUV E;  1D9V A;  4XXU A;  2P2A A;  4OEN A;  1WDN A;  1PDA A;  2F7B A;  4ZEC A;  2DS9 A;  2A5T B;  3EQ1 A;  3N6U A;  4U2R A;  4RJZ A;  2RKM A;  3K6U A;  3TEP A;  3CI8 A;  1Z7N E;  4RXL A;  1LCF A;  2QSX A;  5AA2 B;  3GBB A;  4DLD A;  3H6V A;  3UOR A;  3T9H B;  4FEB A;  3SER A;  3W9W A;  5ITP A;  1M5B A;  4WKM A;  2Z8F A;  2VD3 A;  2ABH A;  3RLF E;  2QPQ A;  4O3B A;  1VFE A;  5H8F B;  1XOC A;  3PPN A;  2XXP A;  1II5 A;  4O3A A;  5B7D A;  1Y20 A;  4ECF A;  3N5L A;  2OWS A;  3Q27 A;  4P0G A;  4G77 A;  1VR5 A;  4LUB A;  5A5X B;  4R75 A;  3MJN A;  3T9V A;  1UQW A;  1N7W A;  5L9S A;  3K6X A;  2F35 A;  2QS1 A;  3GZG A;  4PE5 B;  4PFT A;  3FVG A;  1B51 A;  4GD5 A;  3VE1 B;  1OVT A;  3DP4 A;  4DCY A;  1Z7M E;  4GIZ A;  2O7I A;  1B6H A;  4U21 A;  1GGG A;  1Y3Q A;  3OXN A;  3OSQ A;  1A40 A;  1S7Y A;  4EDP A;  4R9G A;  1US4 A;  2CZL A;  1GV8 A;  1SQY A;  3CVG A;  1MPD A;  4U23 A;  1N3X A;  3Q25 A;  1F9B A;  1R1N A;  3CSG A;  3RNN A;  4THI A;  3VV5 A;  3SET A;  2O7U A;  2XXQ A;  4NED A;  1YCJ A;  2PBW A;  1DSN A;  2HAV A;  2ZNS A;  4POX A;  2AIX A;  4I62 A;  4Z7E A;  3K1N A;  4ZEB A;  1XVX A;  1B2H A;  3VFJ A;  4BDL A;  2ZNT A;  4IO6 A;  3UIF A;  2O68 A;  1B3G A;  3MVZ A;  1Y4C A;  2HFB A;  2F8D A;  3KOT A;  1B32 A;  5ELV A;  2I48 A;  1B0L A;  2H98 A;  2DQV A;  4QFP A;  3OO6 A;  3IOW A;  4POW A;  3HCQ A;  4ELP A;  3ZKL A;  1O63 A;  3H03 A;  1RYO A;  1NNF A;  1IXG A;  4IO3 A;  3MQ9 A;  3GLB A;  1MDP 1;  1MXX A;  2V3T A;  2RCA A;  2BJJ X;  2XD3 A;  2G29 A;  5TPA A;  2NVU B;  1MXU A;  5L9M A;  4IY5 A;  3C35 A;  2ZYM A;  3RTF B;  3RT6 B;  3CRB A;  3OEK A;  3ONM A;  1T0K A;  4U1Z A;  1Y3N A;  4OEU A;  3ILT B;  3PMW A;  1QVS A;  4QSD A;  3VLW A;  3HN0 A;  4KQP A;  4BLA A;  2DWJ A;  1P1W A;  2V3U A;  4JWY A;  2RC7 A;  2F7A A;  2Q89 A;  5TU0 A;  3S9E A;  3HST A;  1XT8 A;  3MZB A;  3PUW E;  2LAO A;  4IB2 A;  4AQ4 A;  1MDQ A;  4GL8 A;  4JXI A;  2PMS A;  5HM4 B;  1O7T A;  3KFM A;  1QKB A;  3A09 A;  4WXJ A;  5DVJ A;  3PUZ E;  4H8J A;  1QUK A;  2DOJ A;  1AOV A;  1AMF A;  3E3K A;  4NF5 B;  2A5S A;  1OIB A;  4G68 B;  4Q5T A;  3IL1 B;  4G8M A;  5CMC A;  3T9U A;  1I6B A;  4DXC A;  3Q28 A;  3VLU A;  3LBS A;  1Y1Z A;  1FTM A;  5I84 A;  5KCJ A;  2ANJ A;  4ZE8 A;  1MH4 A;  4OER A;  4QHQ A;  1EH3 A;  5I2N B;  1XVY A;  2IA4 A;  2B3B A;  3N94 A;  2PVU A;  1OMP A;  3V5A A;  5CI5 A;  5EHS A;  1ZBM A;  3MZ9 A;  4F3P A;  4F19 A;  4RPN A;  5H8S A;  1AIV A;  4OEV A;  3S2V A;  3G3H A;  1NH7 A;  1I6Q A;  5DVI A;  1H43 A;  2HAU A;  1USY H;  3HHG A;  3FJ7 A;  3GBA A;  4LA9 A;  3CG3 A;  1I6A A;  2F78 A;  2GHB A;  2P0S A;  2O69 A;  4FE8 A;  3PPR A;  4BDQ A;  3PV0 E;  3PD9 A;  5IKB A;  5IAI A;  1UTB B;  5AA3 A;  1TT1 A;  4OZ9 A;  4JSD A;  2Z22 A;  3FVK A;  4H1X A;  2VHA A;  3O9P A;  3PD8 A;  4H8I A;  4NWC A;  4AB6 A;  5I57 B;  2ZNU A;  3WAE A;  4N13 A;  4U22 A;  1FQC A;  1QKA A;  2XD2 A;  3FAT A;  2OJT A;  2XXT A;  4TLM B;  1B4H A;  2Y7W A;  3FVN A;  4EUO A;  4IY6 A;  3G3K A;  5CBR A;  3AXF A;  1GTK A;  4H67 A;  3RQT A;  5I56 B;  3UGW A;  4GVO A;  3K6V A;  3KN3 A;  2UYE A;  3JZJ A;  4Q30 B;  5M2V A;  4RYA A;  5B70 A;  3MC2 A;  3SEY A;  3OEM A;  2UVJ A;  4GF8 A;  4NF8 B;  4H6D A;  4YIC A;  1JET A;  5J1D A;  1FQD A;  4YKJ A;  4OES A;  1MY2 A;  1OVB A;  1UIU A;  3G3G A;  4IO4 A;  2P1S A;  1A8E A;  4H5G A;  5CMB A;  3VXC A;  3OO9 A;  4QSE A;  2F5X A;  3T93 B;  1FQA A;  4GOT A;  5TP9 A;  3H7M A;  1B3L A;  4WED A;  3VVE A;  1LB9 A;  3M3F A;  2G93 A;  3KGC A;  3JV9 A;  4FAJ A;  4G4P A;  5F1Q A;  1A54 A;  3G3F A;  3UP9 A;  2F7C A;  3TKD A;  5ICT A;  1N76 A;  3S9L C;  1NKX A;  4C0R A;  3K4U A;  2PYY A;  4X1B A;  1URD A;  3B6Q A;  3TCG A;  5AA4 A;  1FTJ A;  2DVZ A;  3FXR A;  3O66 A;  3V83 A;  4FOR A;  3LSL A;  1FTO A;  3PUY E;  4OMB A;  1BLF A;  4DXU A;  2NUV A;  4MF3 A;  3O6I A;  3CSB A;  3TYH A;  5CC2 A;  3PPO A;  1IIW A;  4GLI A;  4YB7 A;  3U93 A;  1P1U A;  5DEX B;  3O6H A;  3T66 A;  3O29 A;  2ZYK A;  1LST A;  1PB8 A;  1B1H A;  4FEC A;  5KZT A;  2Y7K A;  2QS4 A;  2B3F A;  2CMO A;  4RPO A;  1YAE A;  3K1M A;  4YB5 A;  4LQ5 A;  3OMB A;  5AA2 A;  3Q29 A;  3T9X B;  4NF4 A;  1B58 A;  2HEU A;  1ZLQ A;  2XX7 A;  1N3W A;  3IB2 A;  2Q2C A;  3U94 A;  2OK2 A;  2DE2 A;  3G3I A;  4G8H A;  1Q35 A;  4IGT A;  2XHD A;  1B46 A;  4N07 A;  4X48 A;  2DXY A;  1B05 A;  3KJT A;  1Y1M A;  1KWH A;  1XC1 A;  1MPC A;  3IOT A;  3M8U A;  3VLV A;  5FHN A;  1NMU A;  1SW1 A;  5A5X A;  3WAF A;  2H4I A;  1FTL A;  3CG1 A;  2ZYN A;  4ZEI A;  5I2K A;  3G7W A;  1FQE A;  2RCB A;  1LAF E;  1GR2 A;  2R6G E;  4F1Y A;  3KJ7 A;  4H65 A;  2H99 A;  4FED A;  4DDD A;  4F1V A;  3BFT A;  5KDT A;  4IO5 A;  2VD2 A;  1EU8 A;  4YKI A;  3IO6 A;  4GXA A;  2OBG A;  3U72 A;  3UN6 A;  2X7Q A;  2M8C A;  5DT6 A;  4BDM A;  3IK6 B;  4X1D A;  1JW5 A;  1MY0 A;  2HXW A;  3IOR A;  2GRV A;  4FIM A;  2I3V A;  1NFT A;  4TOZ A;  4LZ8 A;  3USD A;  2VOZ A;  2Z23 A;  2AL5 A;  4JB7 A;  3IR1 A;  4XKP A;  3TTR A;  4KI0 E;  1D3K A;  1UTH A;  4M4G A;  4R72 A;  3MWB A;  1MY3 A;  2PT2 A;  5CMM A;  1SW5 A;  3CFZ A;  4KR5 A;  4F1U A;  3BBR A;  3FD3 A;  1OLA A;  1WOD A;  1B4Z A;  1MM6 A;  1VSO A;  4R6K A;  3TOD A;  1ANF A;  2F6G A;  3E9X A;  4YKP A;  1B40 A;  3CFL A;  4JWO A;  4C1T A;  1ZU0 A;  2E0S A;  2OLB A;  4K3F A;  4JDF A;  3OEN A;  3C31 A;  2I6E A;  1TXF A;  3QAX A;  4ZE9 A;  3IB0 A;  3P7I A;  3QUJ A;  1LCT A;  2QMX A;  4HS7 A;  1HSJ A;  3SDF A;  1NNT A;  4OQO A;  2V3Q A;  2NOO A;  4P11 A;  3BFU A;  1D4N A;  3ILU B;  1SD3 A;  2HQ0 A;  4QFN A; 
#chains in the Genus database with same CATH topology
 5AE4 A;  1URS A;  4ONY A;  3LUZ A;  2O1M A;  4DE8 A;  1MG1 A;  3FJG A;  4YKK A;  3MP1 A;  3L6G A;  1I69 A;  2D5W A;  3TAJ A;  4P47 A;  1Q9D A;  1LBZ A;  2F34 A;  1N0T A;  2RF1 A;  3K2D A;  3HPI A;  4FJP A;  1KA1 A;  4HTG A;  3BKI B;  3CFX A;  5JTY A;  3H6T A;  2NXO A;  3MVY A;  5I5P A;  4OTE A;  4GBV A;  1MH3 A;  3TTM A;  5I59 B;  3LR1 A;  4OVJ A;  1MQG A;  2D21 A;  3FIR A;  3LUY A;  3K02 A;  3LSW A;  4KCC A;  1FPG A;  5CMK A;  3H06 B;  4ZZA A;  1LFH A;  3O97 A;  4ELQ A;  1FBG A;  1IXI A;  3HHF A;  3PPQ A;  4KHZ E;  4RY1 A;  2R71 A;  1ZJL A;  5H8H A;  1MQH A;  4FAT A;  4G2Z A;  4QFK A;  2RIN A;  3O6G A;  4R2F A;  2HZL A;  2NWJ A;  4YMB A;  4F29 A;  1MPB A;  2DWA A;  1XHY A;  2HCA A;  3KC0 A;  2V25 A;  2F36 A;  4QFO A;  4IO7 A;  2Z8D A;  1WVJ A;  3H6U A;  3UK4 A;  1HSL A;  4BDN A;  3THI A;  2I49 A;  2R9J A;  3TDJ A;  5H8N B;  2FVZ A;  2GH9 A;  4G68 C;  3VDF A;  1MY1 A;  4G68 A;  4TQU Q;  4PFY A;  4QFL A;  2X26 A;  2Y84 A;  1P1N A;  2QVR A;  3E4R A;  1MQD A;  1PB7 A;  1M5E A;  1P1Q A;  5LOM A;  3SEW A;  1B1X A;  1HSE A;  5F24 A;  3TEL A;  1LB8 A;  3EN3 A;  2CZI A;  2VPN A;  4JVC A;  1B7H A;  4F18 A;  3W9V A;  5H8Q A;  4P0I A;  5KCJ B;  4QSC A;  3EHS A;  4UA8 A;  3RTW B;  3IOV A;  1LAX A;  3RPW A;  1B5I A;  4XIG Q;  2HXR A;  2Q2A A;  4AS4 A;  2WEF A;  4O3C A;  4X04 A;  3V89 B;  2REG A;  2AL4 A;  3H3G A;  2ZYO A;  3FVO A;  3OO8 A;  3TQL A;  5HPQ A;  4F39 A;  1M5C A;  4G8N A;  2Y5K A;  3IJX B;  3ECR A;  5I7I A;  1VE4 A;  1LLS A;  3MUQ A;  2GHA A;  5FHO A;  3CIJ A;  3K0V A;  3MVW A;  3TCF A;  1IMB A;  1YYZ A;  2KR0 A;  4MFI A;  4JVI A;  4F3S A;  3IX1 A;  2XXV A;  4NQ8 A;  2P3V A;  2IEE A;  4ISU A;  4EQB A;  1NNK A;  4U1O A;  4LON B;  4YB6 A;  4F3G A;  4OVQ A;  1FTA A;  1ZIU A;  3KSJ A;  3QUF A;  3IOU A;  1Q1K A;  3RPL B;  1VFD A;  4BDR A;  4QBA A;  3FUZ A;  3H4Z A;  5JEI A;  3N6T A;  3KZG A;  1FJ6 A;  4ELR A;  4G61 A;  2FNC A;  3IO4 A;  1US5 A;  3EPE A;  1YZ0 A;  3A3C A;  2ZZW A;  1PEB A;  2OWT A;  1Y3P A;  1B5J A;  4LZ7 A;  1NNP A;  2QJE A;  4N6K A;  1MXV A;  3LC8 A;  3FZV A;  1MXZ A;  3KEI A;  2DE4 A;  3LV0 A;  4GWX A;  3MPL A;  1JVY A;  2B65 A;  1B3E A;  1CB6 A;  1XS5 A;  4RK2 A;  1MRP A;  3U1O A;  4MMP A;  1NH8 A;  1IME A;  2DWI A;  2DXR A;  1N84 A;  2Y5L A;  3TQW A;  2P3N A;  4GBW A;  2WBB A;  3E13 X;  3R26 A;  2L5V A;  2QVU A;  1PBP A;  4LP2 B;  4U4S A;  3TTN A;  3RN8 A;  2UVG A;  1IZ1 A;  4HCY A;  3B6T A;  3MPK A;  4MBP A;  4AB5 A;  2H9B A;  2ZMB A;  1MXY A;  3KN7 A;  4GWW A;  3RGY A;  2XWI A;  3F11 A;  4LVQ A;  5TP9 B;  4HXV A;  3EF7 A;  1QJM A;  5EYG A;  1DTG A;  4IGR A;  5I58 A;  2I58 A;  1IXC A;  1FJ9 A;  2H25 A;  1BIY A;  5EQ9 A;  2ONS A;  1JNF A;  3PUX E;  3ZKK A;  4NF6 A;  1Y9U A;  1OQH A;  3CR9 A;  1YPN A;  3K1P A;  4OAN A;  3PMV A;  4Q0C A;  1MXW A;  3C33 A;  3KOS A;  1L5T A;  5ET6 A;  3ODB A;  3TZA A;  4ZEK A;  3TFL A;  3MVX A;  1LBC A;  4NHB A;  3IAZ A;  2ESN A;  2O84 X;  5EHM A;  5AA4 B;  4I1D A;  4RK9 A;  1ZTY A;  3FAS A;  3B6W A;  5DTB A;  2OCU A;  3T96 B;  2Q9T A;  5DVF A;  2Q88 A;  5T3J A;  1SPI A;  2A5T A;  1AH5 A;  1CE2 A;  1FPK A;  4BDO A;  4YZZ A;  1JVX A;  1S50 A;  3D4C A;  3OO7 A;  4MX6 A;  2VGQ A;  2XXW A;  1EYK A;  1VDW A;  1A8F A;  4PFR A;  3GYY A;  3E78 A;  2PCR A;  1LGB C;  1EZP A;  1CNQ A;  2YJP A;  1LAH E;  3O2A A;  1N7X A;  1FBC A;  3W15 C;  4AS5 A;  3FV1 A;  4YMA A;  5AA2 D;  1SBP A;  2H5Y A;  4DZ1 A;  4JBZ A;  4KYD A;  4Z0I A;  1TFA A;  3JYR A;  1IIT A;  4NF4 B;  1RYX A;  3MAM A;  5H8F A;  4N8G A;  1B7Z A;  4KYS A;  4PGP A;  4XFE A;  2V93 A;  4EF1 A;  4EQ9 A;  4DXB A;  4PET A;  2QMW A;  4YU0 A;  5LDZ A;  4X9T A;  3FGS A;  2GFE A;  5BUU A;  2REJ A;  1A7L A;  1NUW A;  1K9Z A;  1PC3 A;  1KZ8 A;  1JEV A;  2QS2 A;  4KYE A;  4F2O A;  2XWO A;  1TFD A;  4GQO A;  4XKR A;  1FSA A;  5FTI A;  1R9L A;  2DE3 A;  3MBP A;  3VVF A;  4IR8 A;  2ZZV A;  1H3D A;  1DPE A;  1QUJ A;  3QYT A;  4F22 A;  3A29 A;  3QSL A;  2F3D A;  4NWD A;  2CEY A;  1SW4 A;  3OOA A;  5I2K B;  4QRZ A;  1LEV A;  2VP1 A;  3SEV A;  2Y7R A;  3KN8 A;  1DOT A;  1MS7 A;  4PP0 A;  1AWB A;  2Q8J A;  4OFL A;  5ICQ A;  1JW1 A;  3C36 A;  1NUZ A;  1RKM A;  2THI A;  1LBV A;  2JJK A;  5CM6 A;  5KDT B;  3TMG A;  1DTZ A;  2ZXT A;  4F2Q A;  4ZDM A;  1ZKB A;  5AA1 A;  3K6W A;  3H6W A;  1A55 A;  2QFL A;  2I0C A;  1SYI A;  2GQ1 A;  4KD5 A;  3PPP A;  1B0H A;  1LFI A;  3OEL A;  3I3V A;  1B3F A;  3MZ1 A;  2FHY A;  1B9J A;  5K2Y A;  2HZK A;  4XKQ A;  1H44 A;  3RUM A;  1O64 A;  3A3U A;  4PF8 A;  1FQB A;  5FTH A;  3EHU A;  4R74 A;  1UTH B;  4N8Y A;  4MNC A;  3K00 A;  1SW2 A;  4MLQ A;  4PFU A;  1EYJ A;  4EXK A;  4H46 A;  3KG2 A;  1J1N A;  2V84 A;  3I5O A;  2DSF A;  4EF2 A;  3SES A;  4YAH X;  1NV7 A;  1RDX A;  2O51 A;  5ISU A;  3S9M C;  1USY E;  2OZZ A;  4HE2 A;  1IQ7 A;  3N26 A;  4O7I A;  2CZK A;  2I0B A;  3TTK A;  4RNS A;  5L8D A;  2Z8E A;  5CBS A;  3E79 A;  4PFI A;  2YPN A;  4R2B A;  4GX6 A;  2XXU A;  3SKP A;  1EZO A;  1QUL A;  2XXI A;  4GFR A;  1DMB A;  5IGA A;  3LSX A;  1A99 A;  4X8R A;  4NX1 A;  2YLN A;  3SEX A;  5HBC A;  2Q74 A;  2F97 A;  1ZMG A;  2ALU A;  3GXA A;  3FJM A;  4R73 A;  4OWD A;  3G3J A;  5TPA B;  3DEL B;  5CRY A;  2DP8 A;  2ONK E;  1FBE A;  4DCX A;  2W7Y A;  1PBQ A;  3V8X B;  3MP8 A;  4OYV A;  4OHN A;  4WEP A;  3M3L A;  5I59 A;  2XXH A;  3TPA A;  1FW0 A;  4KFQ A;  2UYF A;  3C34 A;  4IO2 A;  1H76 A;  4GX3 A;  3UA8 A;  5JTY B;  1JW4 A;  1QW0 A;  3DM0 A;  2UVH A;  4L17 A;  1P1O A;  1NV6 A;  4OET A;  3MP6 A;  2XXR A;  1AL3 A;  3C4M A;  3FXU A;  1MY4 A;  3VVD A;  1NV1 A;  4P56 A;  3RT8 A;  4LAT A;  3MW0 A;  4LN5 A;  4OXV A;  1NV5 A;  4ZED A;  4DIG A;  5H8H B;  5H8N A;  4NF5 A;  4ELO A;  4MH5 A;  2FA7 A;  3FXB A;  4KCD A;  2XXY A;  2D3I A;  4E0X A;  4LQ2 A;  4GL0 A;  1B3H A;  1POY 1;  1K9Y A;  1LAG E;  4JWX A;  2KLF A;  3M3K A;  4NF0 A;  5I3S A;  4NE4 A;  1IXH A;  4RA1 A;  4ESX A;  4JSO A;  4MJO A;  3TUS A;  2B4M A;  4JVD A;  3ZSF A;  4N17 A;  1DPP A;  2DWH A;  5I2N A;  2FIX A;  1OQG A;  2UXA A;  4XKN A;  1B52 A;  1PB9 A;  2F6P A;  1IMA A;  5K2X A;  1OLC A;  1SVX B;  2E1S A;  1UIV A;  2DYX A;  2QRY A;  1NUX A;  4OFO A;  4TLL B;  3Q26 A;  4ND9 A;  4H0W A;  4HW8 A;  3KSX A;  4EQ7 A;  4XTC Q;  3HO7 A;  3QIM A;  5JK4 A;  3R6U A;  3DP8 A;  3RY3 A;  4I9D A;  2DVC A;  1B5H A;  1POT A;  5H8Q B;  3D1R A;  4PFW A;  2WYP A;  1FQF A;  3EHT A;  4ZS9 A;  3I6V A;  4EXL A;  4HCW A;  1SDX A;  4MLV A;  3DLN A;  4GWZ A;  4N91 A;  4GRK A;  4UAC A;  5ESY A;  1N04 A;  1MQJ A;  4Q8R A;  1FCK A;  1RDY A;  4N15 A;  3OSR A;  1JEU A;  5L9O A;  1FBP A;  4H5F A;  1UTB A;  1LBB A;  5EYF A;  4E0W A;  1ATG A;  3IB1 A;  3S4U A;  1SI1 A;  1MM7 A;  3KBR A;  4C1U A;  1R6Z A;  5FHM A;  1FTK A;  3FXQ A;  1Y4T A;  2XX8 A;  4I8C A;  1FPE A;  3RYD A;  1M5F A;  5I57 A;  1LBX A;  3QXM A;  4XEQ A;  4I3Y A;  5BWJ A;  3PGF A;  2FYI A;  3L6H A;  3TCH A;  4R9F A;  2I4C A;  4ZEF A;  3T0J A;  3LSF B;  4PAI A;  2XX9 A;  3ZS6 A;  3K01 A;  1SYH A;  4MEV A;  4OA4 A;  3SEU A;  5DYH A;  1NL5 A;  5I56 A;  1R9Q A;  2O1L A;  4U4X A;  4QF9 A;  1IEJ A;  3PMX A;  1NV3 A;  2QL3 A;  1EZ9 A;  4NMY A;  2PX1 A;  4NTL A;  1IUD A;  4LZ5 A;  4NF8 A;  1S9T A;  2UVI A;  4OFJ A;  3B7D A;  4R6H A;  4KPT A;  3C9H A;  2XXX A;  2AYS A;  4PQJ A;  1D9Y A;  4GXS B;  2RC8 A;  1SI0 A;  2QVV A;  4F3B A;  5ITO A;  5F7V A;  2O6A A;  4M1V A;  1MQI A;  1JQF A;  2WKY A;  4F31 B;  1GVC A;  2X7P A;  1BP5 A;  3O28 A;  1BTJ A;  1TWY A;  2ONR A;  2PT1 A;  1ELJ A;  3D4G A;  3VXB A;  3HV1 A;  1H45 A;  4O8M A;  3PU5 A;  3S9N C;  1KA0 A;  5IZ1 A;  3FV2 A;  1BKA A;  2Y7P A;  2I3W A;  5ET7 A;  3TTL A;  4HE1 A;  4GWO A;  3OD7 A;  2I4B A;  1G0I A;  3C32 A;  1P99 A;  3DP6 A;  1M5D A;  3IJO B;  1URG A;  1FRP A;  3R7X A;  2RC9 A;  3T22 A;  5I58 B;  2QS3 A;  1B7U A;  1FBD A;  1QUI A;  1YTV A;  5DEX A;  3U92 A;  4NF6 B;  1YXI A;  4QXD A;  4ZZE A;  3QK6 A;  3U8Q A;  5FBP A;  4ESW A;  4N6P A;  4R6Y A;  2Y7I A;  1LFG A;  3PUV E;  1D9V A;  4XXU A;  2P2A A;  4OEN A;  1WDN A;  1PDA A;  2F7B A;  4MCO A;  4ZEC A;  4NG7 A;  2DS9 A;  2A5T B;  3EQ1 A;  3N6U A;  4U2R A;  4RJZ A;  2RKM A;  2HHM A;  3K6U A;  3IFC A;  3TEP A;  4NN3 A;  3CI8 A;  1Z7N E;  4RXL A;  1LCF A;  2QSX A;  5AA2 B;  3GBB A;  4DLD A;  3KBZ A;  3H6V A;  3UOR A;  3T9H B;  4FEB A;  3SER A;  3W9W A;  5ITP A;  1M5B A;  4WKM A;  4NGU A;  2Z8F A;  3IFA A;  2VD3 A;  2ABH A;  3RLF E;  4HE0 A;  2QPQ A;  4O3B A;  2HPG A;  1VFE A;  5H8F B;  1XOC A;  3PPN A;  2XXP A;  1II5 A;  4O3A A;  5B7D A;  1Y20 A;  4ECF A;  3N5L A;  2OWS A;  2R8T A;  3Q27 A;  4P0G A;  4G77 A;  1VR5 A;  4LUB A;  4DI3 D;  4P8B A;  5A5X B;  4R75 A;  3ROJ A;  3MJN A;  2KQZ A;  3T9V A;  1DK4 A;  1UQW A;  1JP4 A;  2XA5 A;  1N7W A;  5L9S A;  5IZ3 B;  3K6X A;  2F35 A;  2QS1 A;  3GZG A;  4PFT A;  4PE5 B;  3FVG A;  1B51 A;  3MST A;  4GD5 A;  3VE1 B;  1OVT A;  2V4C A;  4O94 A;  3DP4 A;  4DCY A;  1Z7M E;  4GIZ A;  2O7I A;  1B6H A;  4U21 A;  1GGG A;  1Y3Q A;  3OXN A;  5EQA A;  3OSQ A;  4MIJ A;  1A40 A;  1S7Y A;  2XXK A;  4EDP A;  4R9G A;  1US4 A;  2CZL A;  1GV8 A;  1SQY A;  4OVR A;  3CVG A;  1MPD A;  4U23 A;  1N3X A;  3Q25 A;  1F9B A;  1R1N A;  3CSG A;  3RNN A;  4THI A;  4N6D A;  3VV5 A;  3SET A;  2O7U A;  2XXQ A;  4NED A;  1YCJ A;  2PBW A;  1DSN A;  2HAV A;  2ZNS A;  4POX A;  2AIX A;  3SZP A;  4I62 A;  4Z7E A;  3K1N A;  4ZEB A;  1XVX A;  1B2H A;  3VFJ A;  4BDL A;  2ZNT A;  4IO6 A;  3UIF A;  2O68 A;  1B3G A;  3MVZ A;  4PTK A;  1Y4C A;  1IMD A;  2HFB A;  2F8D A;  3KOT A;  1B32 A;  5ELV A;  2I48 A;  1B0L A;  2H98 A;  2DQV A;  4QFP A;  4GWS A;  3OO6 A;  3IOW A;  2XWK A;  4POW A;  3HCQ A;  4ELP A;  3ZKL A;  1O63 A;  3H03 A;  1RYO A;  1NNF A;  1IXG A;  4IO3 A;  3MQ9 A;  3GLB A;  1MDP 1;  1MXX A;  2V3T A;  2RCA A;  1FPD A;  2BJJ X;  2XD3 A;  2G29 A;  5TPA A;  2NVU B;  1MXU A;  5ET5 A;  5L9M A;  4IY5 A;  3C35 A;  4OVP A;  3ISP A;  2ZYM A;  3RTF B;  1NUY A;  4PDD A;  3RT6 B;  3CRB A;  5EQ8 A;  2VT5 A;  3OEK A;  3ONM A;  2Q8M A;  3U65 A;  1T0K A;  4U1Z A;  5EYH A;  1Y3N A;  4PE3 A;  4OEU A;  4PCD A;  3ILT B;  3PMW A;  1QVS A;  4QSD A;  3VLW A;  3HN0 A;  4KQP A;  4BLA A;  4OVS A;  4H45 A;  2DWJ A;  2MKZ A;  2DDK A;  4I40 A;  1P1W A;  2V3U A;  4JWY A;  2RC7 A;  2F7A A;  2Q89 A;  5TU0 A;  3S9E A;  3HST A;  1XT8 A;  3MZB A;  3PUW E;  2LAO A;  4IB2 A;  4O7M A;  4AQ4 A;  4PBH A;  1MDQ A;  4PF6 A;  4DI4 B;  4GL8 A;  4JXI A;  2PMS A;  5HM4 B;  1O7T A;  3KFM A;  1QKB A;  3A09 A;  4WXJ A;  5DVJ A;  3PUZ E;  4H8J A;  1QUK A;  2DOJ A;  1AOV A;  1AMF A;  3E3K A;  4NF5 B;  2A5S A;  1OIB A;  4G68 B;  4Q5T A;  3IL1 B;  4G8M A;  5CMC A;  3T9U A;  1INP A;  1I6B A;  4DXC A;  3Q28 A;  3VLU A;  3LBS A;  1Y1Z A;  2FIE A;  1FTM A;  5I84 A;  5KCJ A;  1DCU A;  2ANJ A;  1FPF A;  4ZE8 A;  1MH4 A;  4OER A;  2WYK A;  4QHQ A;  1EH3 A;  2FBP A;  5I2N B;  1XVY A;  2IA4 A;  2B3B A;  3CHG A;  3N94 A;  2PVU A;  1OMP A;  3V5A A;  5CI5 A;  5EHS A;  1ZBM A;  1FPL A;  3MZ9 A;  1XI6 A;  4F3P A;  3B50 A;  4F19 A;  1D9Q A;  4RPN A;  4P1L A;  5H8S A;  1AIV A;  4OEV A;  3S2V A;  3G3H A;  1NH7 A;  1EYI A;  1I6Q A;  2CEX A;  5DVI A;  1H43 A;  2HAU A;  1NV2 A;  1USY H;  3HHG A;  3FJ7 A;  1IMF A;  3GBA A;  1RDZ A;  4LA9 A;  3CG3 A;  1I6A A;  1NI9 A;  2F78 A;  2GHB A;  2B4L A;  2P0S A;  3MYU A;  2F3B A;  2O69 A;  1G0H A;  4FE8 A;  3PPR A;  4BDQ A;  3PV0 E;  1NV0 A;  4FBP A;  3PD9 A;  5IKB A;  5IAI A;  3RPL A;  1UTB B;  5EQ7 A;  5AA3 A;  1TT1 A;  4OZ9 A;  2PFZ A;  4JSD A;  2Z22 A;  3FVK A;  3PTY A;  4H1X A;  2VHA A;  3O9P A;  3PD8 A;  3FBP A;  3QMF A;  3HFU A;  4H8I A;  4NWC A;  4AB6 A;  5I57 B;  2ZNU A;  3WAE A;  4N13 A;  4XF5 A;  4NAP A;  4UAB A;  4U22 A;  1FQC A;  1QKA A;  4P9K A;  2XD2 A;  3FAT A;  2OJT A;  2XXT A;  4TLM B;  1B4H A;  2Y7W A;  4P3L A;  5IZZ A;  3FVN A;  4EUO A;  4IY6 A;  3G3K A;  5CBR A;  3AXF A;  1GTK A;  4H67 A;  3RQT A;  5I56 B;  4MNP A;  3UGW A;  4GVO A;  3K6V A;  3KN3 A;  2UYE A;  3JZJ A;  4Q30 B;  5M2V A;  4PBQ A;  4GWU A;  4RYA A;  5B70 A;  3MC2 A;  4OVT A;  2CZH A;  3SEY A;  3OEM A;  2UVJ A;  4GF8 A;  4NF8 B;  4H6D A;  4YIC A;  1JET A;  5J1D A;  1FQD A;  4YKJ A;  4OES A;  1MY2 A;  1OVB A;  1UIU A;  3G3G A;  4IO4 A;  2P1S A;  4PAF A;  1A8E A;  4H5G A;  5CMB A;  3VXC A;  2OWZ A;  3OO9 A;  4QSE A;  2F5X A;  3T93 B;  3T1B A;  1FQA A;  4GOT A;  5TP9 A;  3H7M A;  4N81 A;  4PGN A;  1B3L A;  3EKI A;  4WED A;  3VVE A;  1LB9 A;  3M3F A;  2G93 A;  3KGC A;  3JV9 A;  4FAJ A;  4MAG A;  4G4P A;  5F1Q A;  1A54 A;  3G3F A;  4PAK A;  1LBW A;  2F7C A;  3UP9 A;  1FPJ A;  3TKD A;  5ICT A;  5DW8 A;  1N76 A;  3S9L C;  1NKX A;  4C0R A;  3K4U A;  2PYY A;  4X1B A;  1URD A;  3B6Q A;  3TCG A;  5AA4 A;  1FTJ A;  2DVZ A;  3FXR A;  3O66 A;  3V83 A;  4FOR A;  3LSL A;  1FTO A;  3PUY E;  4MHF A;  4OMB A;  1BLF A;  4DXU A;  2NUV A;  4MF3 A;  3O6I A;  4PC9 A;  3CSB A;  3TYH A;  2WX9 A;  5CC2 A;  3PPO A;  1FPI A;  1IIW A;  4GLI A;  4YB7 A;  1P1U A;  5DEX B;  3U93 A;  3O6H A;  3B8B A;  3T66 A;  3O29 A;  2ZYK A;  1LST A;  1PB8 A;  1B1H A;  4FEC A;  5KZT A;  2Y7K A;  2QS4 A;  2B3F A;  2CMO A;  4RPO A;  1YAE A;  3K1M A;  4YB5 A;  5ET8 A;  4LQ5 A;  3OMB A;  5AA2 A;  4PFB A;  3Q29 A;  3T9X B;  4NF4 A;  1B58 A;  2HEU A;  1ZLQ A;  4GX4 A;  3KC1 A;  2XX7 A;  1N3W A;  3IB2 A;  2Q2C A;  3U94 A;  1FPB A;  2OX3 A;  2OK2 A;  2DE2 A;  3G3I A;  4G8H A;  1Q35 A;  4IGT A;  4GWY A;  2XHD A;  1B46 A;  4N07 A;  4X48 A;  2DXY A;  1BK4 A;  1B05 A;  3KJT A;  1Y1M A;  1KWH A;  4N4U A;  2BJI A;  1XC1 A;  1MPC A;  3IOT A;  3M8U A;  3VLV A;  1DBZ A;  5FHN A;  1NMU A;  4PDH A;  1SW1 A;  5A5X A;  3WAF A;  2H4I A;  4MNI A;  1FTL A;  3CG1 A;  2ZYN A;  4ZEI A;  5I2K A;  3G7W A;  1FQE A;  2RCB A;  1LAF E;  1GR2 A;  5IZ3 A;  3NOH A;  4P1E A;  2R6G E;  4F1Y A;  3KJ7 A;  3BIH A;  5IM2 A;  4H65 A;  5J16 A;  2H99 A;  4FED A;  4DDD A;  4F1V A;  3BFT A;  5KDT A;  4IO5 A;  2VD2 A;  1EU8 A;  4YKI A;  3IO6 A;  4GXA A;  2OBG A;  3U72 A;  3UN6 A;  2X7Q A;  2ZZX A;  1IMC A;  2M8C A;  5DT6 A;  4BDM A;  3IK6 B;  4X1D A;  1JW5 A;  1MY0 A;  2HXW A;  3IOR A;  2GRV A;  4FIM A;  5LTC A;  2I3V A;  1FBH A;  1QGX A;  1NFT A;  4TOZ A;  4LZ8 A;  3BIG A;  3USD A;  2VOZ A;  2Z23 A;  2AL5 A;  4JB7 A;  1LBY A;  3IR1 A;  1FBF A;  4XKP A;  3TTR A;  4KI0 E;  1D3K A;  1UTH A;  4M4G A;  4I3E A;  4R72 A;  3MWB A;  1MY3 A;  2PT2 A;  5CMM A;  1SW5 A;  3CFZ A;  4KXP A;  4KR5 A;  4F1U A;  3BBR A;  3FD3 A;  2WBD A;  1OLA A;  1WOD A;  1B4Z A;  1NV4 A;  1MM6 A;  5A5L A;  1VSO A;  4R6K A;  3TOD A;  1ANF A;  2F6G A;  3E9X A;  4YKP A;  1B40 A;  3CFL A;  4JWO A;  4C1T A;  1ZU0 A;  2E0S A;  2OLB A;  4K3F A;  4JDF A;  3OEN A;  3C31 A;  2I6E A;  2VPO A;  1TXF A;  3QAX A;  4ZE9 A;  2PFY A;  3IB0 A;  3P7I A;  3QUJ A;  1LCT A;  2QMX A;  4HS7 A;  1HSJ A;  3SDF A;  1NNT A;  4OQO A;  2V3Q A;  2NOO A;  4P11 A;  3BFU A;  1D4N A;  2XWV A;  3ILU B;  1SD3 A;  2HQ0 A;  4QFN A; 
#chains in the Genus database with same CATH homology
 5AE4 A;  1URS A;  4ONY A;  2O1M A;  4DE8 A;  1MG1 A;  3FJG A;  4YKK A;  3MP1 A;  3L6G A;  1I69 A;  2D5W A;  3TAJ A;  2F34 A;  1N0T A;  2RF1 A;  3K2D A;  3HPI A;  4FJP A;  4HTG A;  3BKI B;  3CFX A;  5JTY A;  3H6T A;  2NXO A;  3MVY A;  4OTE A;  1MH3 A;  3TTM A;  5I59 B;  3LR1 A;  4OVJ A;  1MQG A;  2D21 A;  3FIR A;  3LUY A;  3K02 A;  3LSW A;  4KCC A;  5CMK A;  3H06 B;  4ZZA A;  1LFH A;  3O97 A;  4ELQ A;  1IXI A;  3HHF A;  3PPQ A;  4KHZ E;  4RY1 A;  2R71 A;  1ZJL A;  5H8H A;  1MQH A;  4FAT A;  4G2Z A;  4QFK A;  2RIN A;  3O6G A;  4R2F A;  2HZL A;  2NWJ A;  4YMB A;  4F29 A;  1MPB A;  2DWA A;  1XHY A;  2HCA A;  2V25 A;  2F36 A;  4QFO A;  4IO7 A;  2Z8D A;  1WVJ A;  3H6U A;  3UK4 A;  1HSL A;  4BDN A;  3THI A;  2I49 A;  2R9J A;  3TDJ A;  5H8N B;  2GH9 A;  4G68 C;  3VDF A;  1MY1 A;  4G68 A;  4TQU Q;  4PFY A;  4QFL A;  2X26 A;  2Y84 A;  1P1N A;  3E4R A;  1MQD A;  1PB7 A;  1M5E A;  1P1Q A;  5LOM A;  3SEW A;  1B1X A;  1HSE A;  3TEL A;  1LB8 A;  3EN3 A;  1B7H A;  4F18 A;  3W9V A;  5H8Q A;  4P0I A;  5KCJ B;  4QSC A;  3EHS A;  4UA8 A;  3RTW B;  3IOV A;  1LAX A;  3RPW A;  1B5I A;  4XIG Q;  2Q2A A;  4O3C A;  3V89 B;  2REG A;  2AL4 A;  3H3G A;  2ZYO A;  3FVO A;  3OO8 A;  3TQL A;  5HPQ A;  4F39 A;  1M5C A;  4G8N A;  3IJX B;  3ECR A;  1VE4 A;  1LLS A;  3MUQ A;  2GHA A;  5FHO A;  3CIJ A;  3K0V A;  3MVW A;  3TCF A;  4MFI A;  4F3S A;  3IX1 A;  2XXV A;  2IEE A;  4ISU A;  4EQB A;  1NNK A;  4U1O A;  4LON B;  4YB6 A;  4F3G A;  1ZIU A;  3KSJ A;  3QUF A;  3IOU A;  1Q1K A;  1VFD A;  4BDR A;  3FUZ A;  3H4Z A;  5JEI A;  3N6T A;  3KZG A;  4ELR A;  2FNC A;  3IO4 A;  1US5 A;  3EPE A;  3A3C A;  1PEB A;  2OWT A;  1Y3P A;  1B5J A;  4LZ7 A;  1NNP A;  2QJE A;  1MXV A;  3LC8 A;  3FZV A;  1MXZ A;  3KEI A;  2DE4 A;  3MPL A;  1JVY A;  2B65 A;  1B3E A;  1CB6 A;  1XS5 A;  4RK2 A;  1MRP A;  3U1O A;  1NH8 A;  2DWI A;  2DXR A;  1N84 A;  3TQW A;  3E13 X;  3R26 A;  1PBP A;  4LP2 B;  4U4S A;  3TTN A;  3RN8 A;  2UVG A;  1IZ1 A;  4HCY A;  3B6T A;  3MPK A;  4MBP A;  4AB5 A;  2H9B A;  2ZMB A;  1MXY A;  3KN7 A;  3RGY A;  3F11 A;  4LVQ A;  5TP9 B;  3EF7 A;  1QJM A;  1DTG A;  4IGR A;  5I58 A;  2I58 A;  1IXC A;  2H25 A;  1BIY A;  2ONS A;  1JNF A;  3PUX E;  3ZKK A;  4NF6 A;  1Y9U A;  1OQH A;  3CR9 A;  1YPN A;  3K1P A;  3PMV A;  4Q0C A;  1MXW A;  3C33 A;  3KOS A;  1L5T A;  3ODB A;  3TZA A;  4ZEK A;  3TFL A;  3MVX A;  1LBC A;  3IAZ A;  2ESN A;  2O84 X;  5EHM A;  5AA4 B;  4I1D A;  4RK9 A;  1ZTY A;  3FAS A;  3B6W A;  5DTB A;  2OCU A;  3T96 B;  2Q9T A;  5DVF A;  2Q88 A;  2A5T A;  1AH5 A;  1CE2 A;  4BDO A;  4YZZ A;  1JVX A;  1S50 A;  3D4C A;  3OO7 A;  2VGQ A;  2XXW A;  1A8F A;  1LGB C;  1EZP A;  2YJP A;  1LAH E;  3O2A A;  1N7X A;  3W15 C;  3FV1 A;  4YMA A;  5AA2 D;  4DZ1 A;  1SBP A;  2H5Y A;  4JBZ A;  4KYD A;  4Z0I A;  1TFA A;  3JYR A;  1IIT A;  4NF4 B;  1RYX A;  3MAM A;  5H8F A;  1B7Z A;  4EQ9 A;  4KYS A;  2V93 A;  4EF1 A;  4DXB A;  4PET A;  2QMW A;  4YU0 A;  4X9T A;  3FGS A;  2GFE A;  5BUU A;  2REJ A;  1A7L A;  1PC3 A;  1JEV A;  2QS2 A;  4KYE A;  4F2O A;  1TFD A;  4GQO A;  4XKR A;  5FTI A;  1R9L A;  2DE3 A;  3MBP A;  3VVF A;  1H3D A;  1DPE A;  1QUJ A;  3QYT A;  4F22 A;  3QSL A;  4NWD A;  1SW4 A;  3OOA A;  5I2K B;  4QRZ A;  2VP1 A;  3SEV A;  2Y7R A;  3KN8 A;  1DOT A;  1MS7 A;  4PP0 A;  2Q8J A;  4OFL A;  5ICQ A;  1JW1 A;  3C36 A;  1RKM A;  2THI A;  5CM6 A;  5KDT B;  3TMG A;  1DTZ A;  2ZXT A;  4F2Q A;  4ZDM A;  1ZKB A;  5AA1 A;  3K6W A;  3H6W A;  1A55 A;  2I0C A;  1SYI A;  4KD5 A;  3PPP A;  1B0H A;  1LFI A;  3OEL A;  3I3V A;  1B3F A;  3MZ1 A;  1B9J A;  5K2Y A;  2HZK A;  4XKQ A;  1H44 A;  3RUM A;  1O64 A;  3A3U A;  1FQB A;  5FTH A;  3EHU A;  4R74 A;  1UTH B;  3K00 A;  1SW2 A;  4MLQ A;  4PFU A;  4EXK A;  3KG2 A;  1J1N A;  2V84 A;  3I5O A;  2DSF A;  4EF2 A;  3SES A;  4YAH X;  2O51 A;  5ISU A;  3S9M C;  1USY E;  2OZZ A;  1IQ7 A;  3N26 A;  2I0B A;  3TTK A;  4RNS A;  5L8D A;  2Z8E A;  5CBS A;  2YPN A;  4R2B A;  2XXU A;  3SKP A;  1EZO A;  1QUL A;  2XXI A;  4GFR A;  1DMB A;  3LSX A;  1A99 A;  2YLN A;  3SEX A;  5HBC A;  2F97 A;  1ZMG A;  2ALU A;  3GXA A;  3FJM A;  4R73 A;  4OWD A;  3G3J A;  5TPA B;  3DEL B;  5CRY A;  2DP8 A;  2ONK E;  4DCX A;  2W7Y A;  1PBQ A;  3V8X B;  3MP8 A;  4OYV A;  4OHN A;  4WEP A;  3M3L A;  5I59 A;  2XXH A;  3TPA A;  1FW0 A;  4KFQ A;  2UYF A;  3C34 A;  4IO2 A;  1H76 A;  3UA8 A;  5JTY B;  1JW4 A;  1QW0 A;  3DM0 A;  2UVH A;  4L17 A;  1P1O A;  4OET A;  3MP6 A;  2XXR A;  1AL3 A;  3C4M A;  3FXU A;  1MY4 A;  3VVD A;  3RT8 A;  4LAT A;  3MW0 A;  4OXV A;  4ZED A;  4DIG A;  5H8H B;  5H8N A;  4NF5 A;  4ELO A;  4MH5 A;  2FA7 A;  4KCD A;  2XXY A;  2D3I A;  4E0X A;  4LQ2 A;  4GL0 A;  1B3H A;  1POY 1;  1LAG E;  4JWX A;  2KLF A;  3M3K A;  4NE4 A;  1IXH A;  4RA1 A;  4ESX A;  4JSO A;  3TUS A;  3ZSF A;  1DPP A;  2DWH A;  5I2N A;  1OQG A;  2UXA A;  4XKN A;  1B52 A;  1PB9 A;  2F6P A;  5K2X A;  1OLC A;  1SVX B;  2E1S A;  1UIV A;  2DYX A;  2QRY A;  4OFO A;  4TLL B;  3Q26 A;  4ND9 A;  4H0W A;  4HW8 A;  3KSX A;  4EQ7 A;  4XTC Q;  3HO7 A;  3QIM A;  5JK4 A;  3R6U A;  3DP8 A;  3RY3 A;  4I9D A;  2DVC A;  1B5H A;  1POT A;  5H8Q B;  4PFW A;  1FQF A;  3EHT A;  4ZS9 A;  3I6V A;  4EXL A;  4HCW A;  1SDX A;  4MLV A;  3DLN A;  4GRK A;  4UAC A;  1N04 A;  1MQJ A;  4Q8R A;  1FCK A;  3OSR A;  1JEU A;  5L9O A;  4H5F A;  1UTB A;  1LBB A;  5EYF A;  4E0W A;  1ATG A;  3IB1 A;  3S4U A;  1SI1 A;  1MM7 A;  3KBR A;  4C1U A;  1R6Z A;  5FHM A;  1FTK A;  3FXQ A;  1Y4T A;  2XX8 A;  4I8C A;  1M5F A;  5I57 A;  3QXM A;  5BWJ A;  3PGF A;  2FYI A;  3L6H A;  3TCH A;  4R9F A;  2I4C A;  4ZEF A;  3LSF B;  2XX9 A;  3ZS6 A;  3K01 A;  1SYH A;  3SEU A;  5DYH A;  1NL5 A;  5I56 A;  1R9Q A;  2O1L A;  4U4X A;  4QF9 A;  1IEJ A;  3PMX A;  2QL3 A;  1EZ9 A;  4NMY A;  2PX1 A;  4NTL A;  1IUD A;  4LZ5 A;  4NF8 A;  1S9T A;  2UVI A;  4OFJ A;  3B7D A;  4R6H A;  4KPT A;  3C9H A;  2XXX A;  2AYS A;  4PQJ A;  1D9Y A;  4GXS B;  2RC8 A;  1SI0 A;  4F3B A;  5ITO A;  5F7V A;  2O6A A;  4M1V A;  1MQI A;  1JQF A;  2WKY A;  4F31 B;  1GVC A;  2X7P A;  1BP5 A;  3O28 A;  1BTJ A;  1TWY A;  2ONR A;  2PT1 A;  1ELJ A;  3D4G A;  3VXB A;  3HV1 A;  1H45 A;  3PU5 A;  3S9N C;  3FV2 A;  1BKA A;  2Y7P A;  2I3W A;  3TTL A;  4GWO A;  3OD7 A;  2I4B A;  3C32 A;  1P99 A;  3DP6 A;  1M5D A;  3IJO B;  1URG A;  3R7X A;  2RC9 A;  3T22 A;  5I58 B;  2QS3 A;  1B7U A;  1YTV A;  1QUI A;  5DEX A;  3U92 A;  4NF6 B;  4ZZE A;  3QK6 A;  3U8Q A;  4ESW A;  4N6P A;  4R6Y A;  2Y7I A;  1LFG A;  3PUV E;  1D9V A;  4XXU A;  2P2A A;  4OEN A;  1WDN A;  1PDA A;  2F7B A;  4ZEC A;  2DS9 A;  2A5T B;  3EQ1 A;  3N6U A;  4U2R A;  4RJZ A;  2RKM A;  3K6U A;  3TEP A;  3CI8 A;  1Z7N E;  4RXL A;  1LCF A;  2QSX A;  5AA2 B;  3GBB A;  4DLD A;  3H6V A;  3UOR A;  3T9H B;  4FEB A;  3SER A;  3W9W A;  5ITP A;  1M5B A;  4WKM A;  2Z8F A;  2VD3 A;  2ABH A;  3RLF E;  2QPQ A;  4O3B A;  1VFE A;  5H8F B;  1XOC A;  3PPN A;  2XXP A;  1II5 A;  4O3A A;  5B7D A;  1Y20 A;  4ECF A;  3N5L A;  2OWS A;  3Q27 A;  4P0G A;  4G77 A;  1VR5 A;  4LUB A;  5A5X B;  4R75 A;  3MJN A;  3T9V A;  1UQW A;  1N7W A;  5L9S A;  3K6X A;  2F35 A;  2QS1 A;  3GZG A;  4PE5 B;  4PFT A;  3FVG A;  1B51 A;  4GD5 A;  3VE1 B;  1OVT A;  3DP4 A;  4DCY A;  1Z7M E;  4GIZ A;  2O7I A;  1B6H A;  4U21 A;  1GGG A;  1Y3Q A;  3OXN A;  3OSQ A;  1A40 A;  1S7Y A;  4EDP A;  4R9G A;  1US4 A;  2CZL A;  1GV8 A;  1SQY A;  3CVG A;  1MPD A;  4U23 A;  1N3X A;  3Q25 A;  1F9B A;  1R1N A;  3CSG A;  3RNN A;  4THI A;  3VV5 A;  3SET A;  2O7U A;  2XXQ A;  4NED A;  1YCJ A;  2PBW A;  1DSN A;  2HAV A;  2ZNS A;  4POX A;  2AIX A;  4I62 A;  4Z7E A;  3K1N A;  4ZEB A;  1XVX A;  1B2H A;  3VFJ A;  4BDL A;  2ZNT A;  4IO6 A;  3UIF A;  2O68 A;  1B3G A;  3MVZ A;  1Y4C A;  2HFB A;  2F8D A;  3KOT A;  1B32 A;  5ELV A;  2I48 A;  1B0L A;  2H98 A;  2DQV A;  4QFP A;  3OO6 A;  3IOW A;  4POW A;  3HCQ A;  4ELP A;  3ZKL A;  1O63 A;  3H03 A;  1RYO A;  1NNF A;  1IXG A;  4IO3 A;  3MQ9 A;  3GLB A;  1MDP 1;  1MXX A;  2V3T A;  2RCA A;  2BJJ X;  2XD3 A;  2G29 A;  5TPA A;  2NVU B;  1MXU A;  5L9M A;  4IY5 A;  3C35 A;  2ZYM A;  3RTF B;  3RT6 B;  3CRB A;  3OEK A;  3ONM A;  1T0K A;  4U1Z A;  1Y3N A;  4OEU A;  3ILT B;  3PMW A;  1QVS A;  4QSD A;  3VLW A;  3HN0 A;  4KQP A;  4BLA A;  2DWJ A;  1P1W A;  2V3U A;  4JWY A;  2RC7 A;  2F7A A;  2Q89 A;  5TU0 A;  3S9E A;  3HST A;  1XT8 A;  3MZB A;  3PUW E;  2LAO A;  4IB2 A;  4AQ4 A;  1MDQ A;  4GL8 A;  4JXI A;  2PMS A;  5HM4 B;  1O7T A;  3KFM A;  1QKB A;  3A09 A;  4WXJ A;  5DVJ A;  3PUZ E;  4H8J A;  1QUK A;  2DOJ A;  1AOV A;  1AMF A;  3E3K A;  4NF5 B;  2A5S A;  1OIB A;  4G68 B;  4Q5T A;  3IL1 B;  4G8M A;  5CMC A;  3T9U A;  1I6B A;  4DXC A;  3Q28 A;  3VLU A;  3LBS A;  1Y1Z A;  1FTM A;  5I84 A;  5KCJ A;  2ANJ A;  4ZE8 A;  1MH4 A;  4OER A;  4QHQ A;  1EH3 A;  5I2N B;  1XVY A;  2IA4 A;  2B3B A;  3N94 A;  2PVU A;  1OMP A;  3V5A A;  5CI5 A;  5EHS A;  1ZBM A;  3MZ9 A;  4F3P A;  4F19 A;  4RPN A;  5H8S A;  1AIV A;  4OEV A;  3S2V A;  3G3H A;  1NH7 A;  1I6Q A;  5DVI A;  1H43 A;  2HAU A;  1USY H;  3HHG A;  3FJ7 A;  3GBA A;  4LA9 A;  3CG3 A;  1I6A A;  2F78 A;  2GHB A;  2P0S A;  2O69 A;  4FE8 A;  3PPR A;  4BDQ A;  3PV0 E;  3PD9 A;  5IKB A;  5IAI A;  1UTB B;  5AA3 A;  1TT1 A;  4OZ9 A;  4JSD A;  2Z22 A;  3FVK A;  4H1X A;  2VHA A;  3O9P A;  3PD8 A;  4H8I A;  4NWC A;  4AB6 A;  5I57 B;  2ZNU A;  3WAE A;  4N13 A;  4U22 A;  1FQC A;  1QKA A;  2XD2 A;  3FAT A;  2OJT A;  2XXT A;  4TLM B;  1B4H A;  2Y7W A;  3FVN A;  4EUO A;  4IY6 A;  3G3K A;  5CBR A;  3AXF A;  1GTK A;  4H67 A;  3RQT A;  5I56 B;  3UGW A;  4GVO A;  3K6V A;  3KN3 A;  2UYE A;  3JZJ A;  4Q30 B;  5M2V A;  4RYA A;  5B70 A;  3MC2 A;  3SEY A;  3OEM A;  2UVJ A;  4GF8 A;  4NF8 B;  4H6D A;  4YIC A;  1JET A;  5J1D A;  1FQD A;  4YKJ A;  4OES A;  1MY2 A;  1OVB A;  1UIU A;  3G3G A;  4IO4 A;  2P1S A;  1A8E A;  4H5G A;  5CMB A;  3VXC A;  3OO9 A;  4QSE A;  2F5X A;  3T93 B;  1FQA A;  4GOT A;  5TP9 A;  3H7M A;  1B3L A;  4WED A;  3VVE A;  1LB9 A;  3M3F A;  2G93 A;  3KGC A;  3JV9 A;  4FAJ A;  4G4P A;  5F1Q A;  1A54 A;  3G3F A;  3UP9 A;  2F7C A;  3TKD A;  5ICT A;  1N76 A;  3S9L C;  1NKX A;  4C0R A;  3K4U A;  2PYY A;  4X1B A;  1URD A;  3B6Q A;  3TCG A;  5AA4 A;  1FTJ A;  2DVZ A;  3FXR A;  3O66 A;  3V83 A;  4FOR A;  3LSL A;  1FTO A;  3PUY E;  4OMB A;  1BLF A;  4DXU A;  2NUV A;  4MF3 A;  3O6I A;  3CSB A;  3TYH A;  5CC2 A;  3PPO A;  1IIW A;  4GLI A;  4YB7 A;  3U93 A;  1P1U A;  5DEX B;  3O6H A;  3T66 A;  3O29 A;  2ZYK A;  1LST A;  1PB8 A;  1B1H A;  4FEC A;  5KZT A;  2Y7K A;  2QS4 A;  2B3F A;  2CMO A;  4RPO A;  1YAE A;  3K1M A;  4YB5 A;  4LQ5 A;  3OMB A;  5AA2 A;  3Q29 A;  3T9X B;  4NF4 A;  1B58 A;  2HEU A;  1ZLQ A;  2XX7 A;  1N3W A;  3IB2 A;  2Q2C A;  3U94 A;  2OK2 A;  2DE2 A;  3G3I A;  4G8H A;  1Q35 A;  4IGT A;  2XHD A;  1B46 A;  4N07 A;  4X48 A;  2DXY A;  1B05 A;  3KJT A;  1Y1M A;  1KWH A;  1XC1 A;  1MPC A;  3IOT A;  3M8U A;  3VLV A;  5FHN A;  1NMU A;  1SW1 A;  5A5X A;  3WAF A;  2H4I A;  1FTL A;  3CG1 A;  2ZYN A;  4ZEI A;  5I2K A;  3G7W A;  1FQE A;  2RCB A;  1LAF E;  1GR2 A;  2R6G E;  4F1Y A;  3KJ7 A;  4H65 A;  2H99 A;  4FED A;  4DDD A;  4F1V A;  3BFT A;  5KDT A;  4IO5 A;  2VD2 A;  1EU8 A;  4YKI A;  3IO6 A;  4GXA A;  2OBG A;  3U72 A;  3UN6 A;  2X7Q A;  2M8C A;  5DT6 A;  4BDM A;  3IK6 B;  4X1D A;  1JW5 A;  1MY0 A;  2HXW A;  3IOR A;  2GRV A;  4FIM A;  2I3V A;  1NFT A;  4TOZ A;  4LZ8 A;  3USD A;  2VOZ A;  2Z23 A;  2AL5 A;  4JB7 A;  3IR1 A;  4XKP A;  3TTR A;  4KI0 E;  1D3K A;  1UTH A;  4M4G A;  4R72 A;  3MWB A;  1MY3 A;  2PT2 A;  5CMM A;  1SW5 A;  3CFZ A;  4KR5 A;  4F1U A;  3BBR A;  3FD3 A;  1OLA A;  1WOD A;  1B4Z A;  1MM6 A;  1VSO A;  4R6K A;  3TOD A;  1ANF A;  2F6G A;  3E9X A;  4YKP A;  1B40 A;  3CFL A;  4JWO A;  4C1T A;  1ZU0 A;  2E0S A;  2OLB A;  4K3F A;  4JDF A;  3OEN A;  3C31 A;  2I6E A;  1TXF A;  3QAX A;  4ZE9 A;  3IB0 A;  3P7I A;  3QUJ A;  1LCT A;  2QMX A;  4HS7 A;  1HSJ A;  3SDF A;  1NNT A;  4OQO A;  2V3Q A;  2NOO A;  4P11 A;  3BFU A;  1D4N A;  3ILU B;  1SD3 A;  2HQ0 A;  4QFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...