2CEYA

Apo structure of siap
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
306
structure length
306
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation of Structure and Mechanism in Primary and Secondary Transporters Exemplified by Siap, a Sialic Acid Binding Virulence Factor from Haemophilus Influenzae
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport
molecule keywords PROTEIN HI0146
total genus 116
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2006-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2ceyA00
4MX6A 4UABA 3B50A 5CM6A 4PDHA 4O8MA 4MNIA 2VPNA 2WX9A 4MNPA 4N15A 2V4CA 4PF8A 5IM2A 2XWOA 4PETA 4N8YA 4NN3A 4MIJA 4XEQA 4MMPA 4PCDA 2WYKA 2CEXA 4X04A 4LN5A 2XWKA 5IGAA 4OVTA 4P1LA 4DI3D 2XA5A 4P47A 4N6KA 4P9KA 4XFEA 4NF0A 2VPOA 4NHBA 4NAPA 2XWIA 4PAIA 2ZZXA 4OVQA 4PE3A 4OA4A 5I7IA 4PGPA 4DI4B 4OVSA 2PFZA 4O94A 4YICA 4MNCA 4MCOA 4N4UA 5IZZA 4O7MA 4N8GA 2XXKA 4P8BA 4PAKA 4PF6A 4N17A 4MHFA 4XF5A 4OVRA 4NGUA 4NG7A 4NQ8A 4MAGA 4N6DA 5LTCA 4P1EA 4OANA 4P56A 4PBQA 5I5PA 2HZLA 4PAFA 2ZZVA 3FXBA 2ZZWA 4OVPA 2CEYA 4N91A 2XWVA 3U65A 4YZZA 3GYYA 4PFRA 4P3LA 2HZKA 4PFBA 4MEVA 4PC9A 4PBHA 4PDDA 4X8RA 4PFIA 4NX1A 2PFYA 2HPGA 2WYPA 4PGNA
chains in the Genus database with same CATH superfamily
4MF3A 4LQ2A 1EYJA 2R8TA 3FATA 3ONMA 4YB6A 4N13A 1M5BA 3TODA 4RPOA 3SDFA 3M3LA 4N8YA 5CMKA 3C33A 1MS7A 4OERA 1PC3A 4DXCA 2OZZA 1HSLA 3FASA 1WODA 4GWXA 4L17A 1IMCA 4TQUQ 1OLCA 4WEPA 1FTOA 5TP9A 2XHDA 4R75A 2DVCA 3K0VA 4IO4A 4MLVA 4N6PA 3TDJA 2XXYA 1JQFA 3FJMA 5H8NB 1MXYA 2XXQA 4O7MA 1SD3A 2XXVA 2VT5A 3LSXA 4OFJA 4GRKA 1FSAA 5I5PA 3PMXA 4QXDA 3TEPA 4BDRA 4RXLA 5JTYB 3IOWA 4KD5A 4HCYA 4OQOA 3IORA 4K3FA 2Z8DA 1LBWA 4POXA 4POWA 3PMWA 2ZYMA 1JVXA 2Y5KA 4X9TA 2DDKA 2NVUB 3OENA 5EYHA 2V3TA 4PFRA 4U22A 2DSFA 1IITA 3N94A 2HZKA 2V93A 4MEVA 3DELB 4WXJA 3TYHA 3EPEA 3GZGA 4X1BA 2I58A 1Y3NA 3RTWB 3UA8A 3VVDA 1ZKBA 5CM6A 4NF6A 2B4LA 1Z7ME 4QSEA 1NUZA 3PU5A 5KZTA 3V89B 3KSJA 2DXRA 3FJGA 3G3JA 4ZZEA 1SI1A 3E13X 3CHGA 2WBDA 2CEXA 4LN5A 5L9MA 1D9VA 4LUBA 4OYVA 5AA2D 4IO2A 2RC8A 4KCDA 5ELVA 1EU8A 4NHBA 3LSLA 4OVQA 2DYXA 3H03A 1N3XA 3K6UA 3JZJA 1P1WA 2XXIA 3S2VA 3VLVA 2F7AA 4IB2A 2AIXA 4TOZA 4EDPA 4XF5A 1US4A 3HO7A 3OOAA 4UACA 4WEDA 5IKBA 2DOJA 2DWAA 2QL3A 4OEUA 1H43A 1AWBA 2HZLA 4C1UA 2HEUA 3VDFA 1MM6A 4F19A 2QVVA 1T0KA 5TPAB 4EUOA 2CMOA 3ZSFA 3VE1B 2BJJX 1DMBA 1NV6A 4MBPA 3OSRA 2XX7A 3RPLA 4PC9A 4EQBA 3JYRA 5J16A 1Y1MA 4YMAA 4JB7A 1SW4A 1SYHA 1NUYA 2FIEA 1JVYA 4KR5A 5DT6A 4KXPA 3ECRA 3M8UA 3T93B 3TTNA 3QSLA 1UTHA 3QMFA 3LSFB 1IMAA 5JTYA 1I69A 4ECFA 4PFWA 4IO3A 4PETA 2LAOA 4N81A 2QPQA 1IXHA 1B5HA 2B3FA 3HSTA 1N7XA 1DBZA 4AB5A 2NUVA 2H5YA 4P9KA 2ALUA 5T3JA 3VLUA 2F7BA 3T96B 1MXZA 3H3GA 2O1MA 4ESXA 1EH3A 4FEBA 4RPNA 4KPTA 3K6WA 3QYTA 3IO4A 3BFTA 3PPOA 2QSXA 3MZ1A 4LA9A 3TQLA 2OX3A 2H98A 4HCWA 3RY3A 2HAVA 3I5OA 4YKJA 1KZ8A 3KC1A 1UIUA 4OEVA 1IMDA 3OEMA 2H4IA 4GXAA 4OVPA 3MW0A 1OQHA 1LAHE 2UYEA 2OWZA 4NF4B 4OTEA 4FATA 2B3BA 3TZAA 4YB7A 3BBRA 4EF2A 1S9TA 4R9FA 1YCJA 1VFEA 3FZVA 3S9NC 4GWOA 4MLQA 2I6EA 3OO9A 4X1DA 5JEIA 3C4MA 3N5LA 4IO7A 2V84A 5CMBA 5EQ9A 3IOVA 2V3QA 4PF8A 1LFGA 2D21A 3UORA 4R73A 2DE3A 4HXVA 4I1DA 4P0IA 4YKKA 1EZ9A 2XWKA 1Q1KA 4OENA 4P1LA 2XXTA 2I4BA 4PTKA 3KJTA 5EHMA 3O2AA 5FHNA 5I2KB 2Y7WA 3ZS6A 1JNFA 1LB9A 1ZBMA 4RY1A 1QKAA 1AOVA 3BFUA 2X26A 3H7MA 4OVSA 3PUXE 3ILTB 4O94A 3FXQA 2PVUA 1K9ZA 4O3CA 3OMBA 4F3SA 1G0HA 4MHFA 2RCAA 5AA4A 3Q26A 3BIGA 1B52A 3K6XA 1LBYA 3EHSA 5LOMA 2THIA 4OETA 1LEVA 5AA3A 1MQDA 1LSTA 2XXXA 3DP6A 2Q74A 3TUSA 1USYH 1A99A 4ZEKA 2ZZWA 1EYKA 1YXIA 2GHAA 4G4PA 1G0IA 4GVOA 2UYFA 4R72A 2F97A 1ZMGA 2HFBA 4ISUA 1R9LA 3CRBA 1JW4A 5IZ3B 3RLFE 1S7YA 4KYDA 1B0HA 3H6WA 3TAJA 3K02A 3RPWA 1N3WA 4MFIA 1LCTA 1B51A 4GXSB 4GF8A 4U4XA 3K1NA 2YPNA 1NMUA 5H8HB 4MNPA 3EN3A 3QXMA 5IAIA 1FJ6A 2JJKA 1MXVA 4PQJA 1MQGA 2B65A 3P7IA 3CG3A 2NXOA 1NV0A 5EQ8A 1PEBA 4H5GA 5DYHA 1M5FA 3KGCA 1Y4CA 4GIZA 3TPAA 4FBPA 3GBBA 3M3FA 3FXUA 3MQ9A 3MWBA 3TFLA 1FRPA 2AL4A 1UTHB 5M2VA 1B2HA 3VV5A 3FUZA 3E79A 4I3YA 2YJPA 1USYE 3FVGA 4ZEIA 2O84X 1LAXA 2QFLA 3T22A 4DCXA 4TLLB 3OXNA 1B3HA 3A29A 3E78A 4JVIA 1MY0A 1B7UA 3B6TA 4JWXA 1YAEA 4GWUA 4AQ4A 4G2ZA 3QAXA 4EXKA 3TCGA 3AXFA 3MP1A 4XKRA 3HHGA 2F35A 2M8CA 1A40A 4G68A 3RUMA 2QS1A 2ZYOA 4X8RA 2I4CA 1IMBA 3U93A 4PFIA 3A09A 1YTVA 4JBZA 2I3WA 1QUIA 2UXAA 1H76A 1UQWA 1Y3PA 3PPNA 1INPA 4THIA 2NOOA 4IY5A 2QMXA 4R6KA 5I2NB 2D5WA 1ZJLA 3G3KA 2E0SA 4YKPA 5I2NA 1URDA 5EQ7A 3TCHA 2QS4A 1N84A 4H0WA 4X48A 2FA7A 1NNPA 1XI6A 1MQHA 1VDWA 3ISPA 4FJPA 4NN3A 4MIJA 3V8XB 1UIVA 4U2RA 3S9MC 1MM7A 3V5AA 3UGWA 4KFQA 2E1SA 2V25A 3R26A 4NMYA 3EF7A 2P3VA 1IMEA 4PFTA 1PBPA 4LZ8A 5I7IA 3ROJA 5LDZA 4LZ7A 3IAZA 5IZZA 1A54A 3O6IA 4IR8A 3LSWA 3LR1A 3PMVA 1R1NA 5EYGA 4RK2A 4ZS9A 4PAFA 3SEVA 4F18A 1XS5A 4QHQA 3O29A 2VHAA 4U23A 1FTJA 4Z7EA 3G3FA 3OO7A 4N91A 3VVEA 3QUFA 2ZNUA 4H67A 1B7ZA 2RC7A 2PX1A 5ICTA 2RF1A 3D1RA 2VGQA 4H1XA 4YMBA 3PUZE 2HXWA 3MUQA 1LBXA 1B7HA 1MY3A 1NV5A 2HHMA 4GOTA 3E3KA 5CBRA 3PD9A 5CMCA 4FE8A 4AB6A 2XXHA 4M4GA 2RC9A 3SEWA 1H45A 5A5XB 3S9LC 1XHYA 2P1SA 1RDXA 3DLNA 1ZIUA 4QSCA 3C35A 5I59B 4GQOA 1FCKA 2Z23A 3IL1B 2XXWA 4EXLA 4ZEBA 4C1TA 3BIHA 4ELRA 2P0SA 4F22A 4IO5A 3C31A 3IX1A 5ITOA 2Y84A 2CZIA 5IZ3A 3EKIA 4FEDA 5DEXA 1NI9A 4QF9A 1FPEA 4N4UA 3R7XA 3KEIA 3MVZA 1B1XA 3BKIB 4HE0A 2ZYKA 2ESNA 1TFDA 2Z8EA 1TFAA 4OVRA 5EHSA 4ZE8A 4P1EA 1H44A 4MH5A 1NV1A 1VE4A 1FPBA 4DCYA 1MXXA 1FQCA 3SEYA 2QVRA 4GWWA 4EF1A 3G7WA 1B1HA 2ONSA 4ELPA 2ZXTA 3HCQA 4YZZA 1GVCA 1RYOA 1FTKA 3VVFA 1FTAA 3K1MA 3K1PA 3TQWA 1PDAA 4P0GA 1NUWA 1P1QA 3FD3A 5CC2A 3T9XB 2OCUA 2I0BA 4R2BA 5B70A 4XTCQ 3NOHA 4GBVA 1NL5A 2F6GA 1IXGA 1P99A 4MX6A 3S4UA 2KR0A 3KOSA 4IGTA 3SERA 4GLIA 1VFDA 4ESWA 4GWYA 1UTBA 2P3NA 3MVYA 2XD2A 4GX4A 1MG1A 2X7QA 4H8JA 3OD7A 1IMFA 4Q5TA 3SESA 4MJOA 1JW1A 4U1ZA 3ZKKA 4X04A 2AL5A 4KYSA 1MY2A 3O97A 2QJEA 1GGGA 1PB8A 3TTMA 2F8DA 4G8HA 4PAIA 4LZ5A 4Q30B 1PB9A 4F39A 1ANFA 2PFZA 4NF5A 2WBBA 1MXUA 4N8GA 4P8BA 3O6GA 1IXCA 2F5XA 5AA2A 4C0RA 2P2AA 4YU0A 1MDP1 1A7LA 4RNSA 1NV4A 2REJA 3KBZA 3I6VA 1JEUA 4NE4A 5BWJA 3T9UA 2DE4A 3Q29A 1LFHA 3K2DA 3MJNA 1RKMA 4H46A 4LP2B 2FHYA 5HM4B 2R9JA 2HAUA 2OBGA 1AIVA 1POTA 5H8FB 3A3UA 5K2XA 3C32A 2I48A 1US5A 3IB2A 4LATA 4F1VA 1M5EA 3W9WA 2HCAA 4TLMB 4H8IA 1H3DA 5CBSA 3SETA 1NV2A 3H6VA 1ELJA 4P11A 4QFNA 2A5TA 1QGXA 4PDHA 3VXBA 1HSJA 2VPNA 4BDOA 3OO8A 3B6QA 5IM2A 3IB1A 1B9JA 3FBPA 1LBCA 5K2YA 4OXVA 1B40A 1MY1A 3N6UA 4F2OA 4KI0E 2Q89A 3MYUA 2VOZA 5I58B 2W7YA 3CIJA 2ZNSA 4GWZA 1RDYA 2XA5A 4N6KA 4XKPA 4NF6B 4PP0A 2UVGA 3UK4A 4PE3A 5ICQA 4JWYA 3CFLA 4R6HA 1I6AA 5I56B 3PGFA 2V3UA 2Y7IA 4MNCA 3PUVE 3IFCA 2AYSA 2F78A 3H6UA 2XXKA 3PTYA 1LCFA 4O3AA 3KBRA 4RJZA 3CFZA 2UVIA 4QFKA 4PBQA 5ET8A 3HN0A 3CG1A 3KN3A 3TCFA 1B3EA 4RK9A 3KN7A 4DXUA 2HQ0A 3C36A 5KCJB 1ATGA 3FV1A 1BP5A 3CSGA 1NNFA 1WDNA 2DVZA 1CNQA 1XVXA 3U65A 3T0JA 3KJ7A 1LBBA 1SW5A 1MXWA 3K00A 3FVOA 4PBHA 2Y5LA 4ZDMA 1YPNA 5H8HA 4NX1A 3M3KA 1FPDA 3IK6B 3C34A 4IO6A 4M1VA 4UABA 2GH9A 3KZGA 4KHZE 2WX9A 2V4CA 2PT2A 1XVYA 1BK4A 1NUXA 4OWDA 3G3IA 3SZPA 3O28A 3SKPA 3G3HA 3B6WA 1D4NA 4FIMA 1NV3A 4F31B 1N7WA 1Z7NE 2Y7RA 1Y20A 4XXUA 1OIBA 1NKXA 4HTGA 4BLAA 2VPOA 1FBCA 3DP8A 2ZZXA 1Y9UA 4H5FA 2OWTA 4DI4B 4BDMA 2PT1A 2H99A 3JV9A 4QFPA 1S50A 2MKZA 5DVIA 5F7VA 3MP6A 4I3EA 1RYXA 5LTCA 4U21A 1IZ1A 4DXBA 2ZZVA 3FVNA 5I2KA 1D3KA 5KDTA 1DTGA 1DSNA 1ZLQA 1OMPA 4GX3A 3IOTA 1MY4A 4Q8RA 2RCBA 4KQPA 4HW8A 1LLSA 2O68A 4F1UA 3S9EA 2Q88A 2YLNA 3DM0A 4U4SA 2DP8A 4PDDA 2VD2A 4OHNA 2OJTA 4OZ9A 2XD3A 4UA8A 4ZECA 2PYYA 1GR2A 3IOUA 3KN8A 4O8MA 4MNIA 2O7IA 5EYFA 3B7DA 4DIGA 2PBWA 3RT8A 1Q35A 1SQYA 4PE5B 4QFLA 3U94A 3HV1A 3EHUA 4OFLA 1P1OA 1PB7A 3LV0A 4DLDA 5H8FA 3MPLA 3VXCA 2WYKA 3KOTA 1GTKA 3TMGA 5DEXB 3KG2A 4DI3D 3HFUA 5H8SA 3UN6A 4P47A 1POY1 5F1QA 3ZKLA 1Y1ZA 4NF0A 1QULA 4OA4A 1D9YA 3CVGA 1IUDA 3OSQA 3GBAA 1VSOA 4JVDA 2OLBA 3RPLB 4PFYA 4GX6A 2FVZA 3Q25A 3IB0A 1L5TA 4QSDA 1QUKA 1XOCA 1XT8A 5ESYA 5CRYA 3EHTA 3RNNA 1BKAA 3WAEA 4LVQA 1F9BA 1SPIA 3T9VA 1I6BA 5HPQA 2F3DA 1LAGE 3U72A 4P3LA 3U1OA 5AA4B 5L8DA 4FAJA 1Y4TA 2PCRA 1FTMA 5A5XA 1YYZA 2FBPA 1D9QA 4RA1A 3G3GA 3KSXA 1IQ7A 1PBQA 4YKIA 2Z22A 1CE2A 4G68C 3C9HA 5AE4A 2XWOA 2B4MA 1GV8A 3N6TA 2HXRA 3H6TA 2OK2A 1URGA 2L5VA 4JSOA 3USDA 3HHFA 4ZEFA 2XXRA 4DZ1A 1SDXA 1FPFA 3CI8A 4XFEA 1DK4A 2Q8MA 4FORA 3V83A 2H25A 2QRYA 4NAPA 2IA4A 1MH4A 4BDQA 1FBDA 3RTFB 1CB6A 1FQAA 1AH5A 3RN8A 4R74A 4N07A 4PAKA 3E4RA 1NNTA 3L6GA 4FECA 5CI5A 3MZ9A 1HSEA 2I3VA 4DDDA 4NG7A 3K01A 2DE2A 5I3SA 4N6DA 4F29A 3FXRA 4LQ5A 1O7TA 3W9VA 2Q2AA 1B6HA 1A8FA 5DVJA 2OWSA 3SEUA 4H65A 1QVSA 2DWIA 3TTKA 4U1OA 3U8QA 2FYIA 1FPIA 3RQTA 2QVUA 3O66A 1N04A 3PPRA 1FPKA 1ZU0A 5FBPA 4OESA 4LONB 2KLFA 1FBGA 3B50A 4YB5A 3H4ZA 1Q9DA 3RT6B 5H8QA 3TELA 1MQJA 2D3IA 1AL3A 1NH7A 1NV7A 2ZNTA 5KDTB 2VP1A 4F3PA 4NTLA 5H8QB 3ILUB 2BJIA 1B3FA 4QRZA 1QW0A 4ZZAA 3WAFA 3VFJA 3B8BA 3IJOB 4F2QA 1FTLA 1JW5A 1A55A 4GWSA 4I9DA 2Y7PA 4DE8A 5IGAA 1AMFA 2Q9TA 1II5A 4NWCA 5HBCA 1P1NA 1IXIA 1FBFA 2CZLA 2F3BA 2XX9A 1SYIA 4ONYA 4NF4A 1B5IA 3FIRA 1QKBA 1LBZA 4KYEA 5H8NA 4HE1A 4KCCA 3CFXA 4MAGA 3TTRA 4OANA 4P56A 1LAFE 1O64A 5J1DA 4R9GA 4R2FA 5ISUA 3FXBA 3RGYA 1OVBA 3TTLA 3O6HA 3I3VA 1IIWA 2DS9A 4E0XA 2XWVA 1LGBC 3IO6A 3UIFA 5FTIA 5TPAA 1FJ9A 3Q27A 1FPLA 2QS3A 1P1UA 1FPJA 2ANJA 5A5LA 1B0LA 4I62A 3CSBA 2FNCA 1FQDA 1LBVA 2F6PA 2WEFA 4PGNA 3IFAA 2WKYA 4I40A 4AS4A 4OVJA 4HE2A 3OEKA 4F1YA 2RINA 4QFOA 3Q28A 4JDFA 4JWOA 1MRPA 1NH8A 2ABHA 3ODBA 4NF8B 4XEQA 1NNKA 5ITPA 2VD3A 4MMPA 3TKDA 3MVXA 4PCDA 4NF8A 1SW2A 1FBPA 3VLWA 2I0CA 3FV2A 2F34A 1SVXB 3DP4A 2XWIA 1FBHA 4HS7A 4NEDA 3KC0A 1B05A 4PGPA 4F3BA 5BUUA 1DPEA 2ZYNA 3HPIA 3LUZA 2GQ1A 5ET5A 5I59A 1EZOA 1JETA 1FQEA 1K9YA 1VR5A 4N17A 2QMWA 4G68B 2A5SA 3R6UA 4NGUA 5JK4A 3MC2A 3T9HB 3PD8A 4EQ7A 1M5DA 1A8EA 2H9BA 3FJ7A 1KA0A 4ELOA 4PFUA 3LBSA 2Y7KA 1MPCA 3MP8A 3A3CA 4GBWA 3E9XA 1Y3QA 2R6GE 1DOTA 4OFOA 4ZE9A 3LUYA 1EZPA 1JEVA 3O9PA 4BDLA 3PPQA 3FVKA 1SBPA 4OMBA 1KA1A 1URSA 5AA1A 1TWYA 4GL8A 3IR1A 1B3LA 4G61A 4BDNA 2O69A 5IZ1A 4ELQA 1B46A 5I57B 1DTZA 1QUJA 1LB8A 2O6AA 1B4HA 2G93A 2O7UA 5I57A 1XC1A 2IEEA 3GLBA 5DTBA 3MZBA 1SW1A 3PUWE 5F24A 3PUYE 4EQ9A 5L9SA 4NWDA 1BTJA 1DPPA 2GRVA 1R9QA 3FGSA 1B32A 2FIXA 4ZEDA 5I84A 3PPPA 4OVTA 2PMSA 1QJMA 3THIA 2NWJA 1N0TA 1UTBB 3W15C 5FHOA 2A5TB 1FW0A 1O63A 1DCUA 4YICA 5L9OA 1YZ0A 4E0WA 3MBPA 4F3GA 5DW8A 4H6DA 4IY6A 1EYIA 3QK6A 1ZTYA 3KFMA 5DVFA 4NQ8A 5I58A 3OELA 3LC8A 2O51A 3K6VA 2CZKA 2DXYA 3PV0E 2F36A 2KQZA 4R6YA 5FTHA 1SI0A 4XIGQ 2X7PA 2CEYA 2XXPA 4NF5B 5EQAA 2DQVA 4WKMA 4ND9A 3GYYA 1MH3A 1J1NA 3IJXB 2RKMA 3D4GA 4O3BA 4Q0CA 3H06B 5AA2B 2UVJA 5TP9B 4RYAA 3CR9A 1B3GA 3GXAA 5TU0A 1RDZA 4XKNA 4JSDA 2WYPA 2R71A 3T1BA 3U92A 1B5JA 3QIMA 2DWHA 3EQ1A 4Z0IA 1JP4A 4JVCA 4N15A 5KCJA 2ONRA 4I8CA 2F7CA 1B58A 4JXIA 1MDQA 5CMMA 2XXUA 1KWHA 3SEXA 2DWJA 1WVJA 5ET6A 2O1LA 4G77A 1FPGA 2GHBA 3UP9A 3D4CA 1NFTA 1BIYA 1TT1A 5B7DA 1MPDA 4QBAA 1FQFA 1R6ZA 1I6QA 1BLFA 1MPBA 4XKQA 1FBEA 4GFRA 3MAMA 1IEJA 1TXFA 5ET7A 4MCOA 3OO6A 4G8MA 4AS5A 3L6HA 4PF6A 4G8NA 1OLAA 2ZMBA 2Q8JA 2XX8A 4GL0A 2ONKE 3N26A 5I56A 1N76A 2QS2A 2GFEA 5FHMA 4H45A 4YAHX 2I49A 1FQBA 1OVTA 2CZHA 4GD5A 1M5CA 1MQIA 4O7IA 1B4ZA 4PFBA 3T66A 2G29A 2REGA 3F11A 3MPKA 4IGRA 1LFIA 1OQGA 3MVWA 2PFYA 2HPGA 2Q2CA 3K4UA 3MSTA 2UVHA 3QUJA 2Z8FA 3RYDA
chains in the Genus database with same CATH topology
4M1VA 4HE2A 4MX6A 3B50A 4UABA 2KR0A 1QGXA 5CM6A 4PDHA 2B4LA 1JP4A 1EYJA 4JVCA 4O8MA 1D9QA 4MNIA 1Q9DA 2R8TA 2VPNA 2WX9A 4GWYA 3QMFA 1NUZA 4MNPA 4N15A 1NV7A 2V4CA 2V3QA 5EQ9A 5F24A 4PF8A 1FJ6A 1RDXA 1IMAA 5EQ7A 2P3NA 2JJKA 5IM2A 2XWOA 2B4MA 2BJIA 1BK4A 4GX4A 4PETA 1NUXA 3B8BA 3FBPA 1IMFA 4N81A 4N8YA 4NN3A 1XI6A 2QPQA 1VDWA 3ISPA 2HXRA 4MIJA 4XEQA 1NV0A 2DE3A 5EQ8A 3SZPA 4MJOA 2L5VA 2FIXA 3LV0A 4MMPA 4PCDA 4HXVA 3CHGA 2WBDA 2WYKA 4GWSA 2CEXA 3BIHA 3MYUA 4X04A 4LN5A 1FPGA 1FBPA 2XWKA 5ET6A 5IGAA 1DBZA 1NV3A 4GWZA 4OVTA 4P1LA 4DI3D 3HFUA 2Q9TA 1RDYA 2XA5A 4PTKA 4QBAA 4GWXA 4P47A 1FPFA 4N6KA 4P9KA 1IMCA 2CZIA 4XFEA 5IZ3A 1DK4A 3EKIA 2Q8MA 1FBFA 5T3JA 2P3VA 4NF0A 1IMEA 2VPOA 1FBCA 4NHBA 3IFAA 4NAPA 1FBEA 1FBHA 2XWIA 4FBPA 4PAIA 2ZZXA 4OVQA 2F3BA 1NI9A 4PE3A 4OA4A 5I7IA 1FBDA 3KC0A 1FPEA 4PGPA 3ROJA 4DI4B 4OVSA 5LDZA 2PFZA 4O94A 1DCUA 4YICA 5ET7A 3LUZA 4MCOA 2GQ1A 1YZ0A 1K9ZA 4MNCA 5ET5A 3IFCA 4N4UA 2WBBA 1FRPA 5IZZA 4O7MA 1LBZA 4JVDA 2MKZA 2XXKA 4IR8A 4N8GA 4P8BA 3PTYA 3E79A 4PAKA 4AS5A 4HE0A 1K9YA 5DW8A 4PF6A 4N17A 4I3YA 1EYIA 1G0HA 2VT5A 2F5XA 4MHFA 4XF5A 2OX3A 4HE1A 4OVRA 3RPLB 4I3EA 3BIGA 4HCWA 4NGUA 4NG7A 5JK4A 1LBYA 4GX6A 2DE2A 4NQ8A 5EYGA 2FVZA 4MAGA 4N6DA 5I3SA 1FSAA 1NV4A 5LTCA 4P1EA 4OANA 3KBZA 4P56A 2QFLA 4PBQA 5I5PA 1AWBA 1LEVA 1NV1A 4QXDA 5ET8A 3W9VA 5J1DA 2HZLA 1KA0A 1KZ8A 3KC1A 2CZKA 4PAFA 3A29A 2ZZVA 3E78A 3FXBA 2DE4A 4JVIA 1FPBA 4F18A 4H45A 2KQZA 4F19A 2QVVA 2Q74A 4H46A 4HCYA 5ESYA 1IMDA 4GBWA 4GWUA 2ZZWA 1LBWA 4GX3A 4OVPA 1EYKA 1SPIA 2CEYA 1YXIA 2DVZA 2QVRA 4GWWA 4N91A 2FHYA 1G0IA 2CZHA 2F3DA 1CNQA 2Y5KA 4X9TA 2OWZA 4O7IA 2DDKA 2XWVA 3U65A 4YZZA 5EQAA 3T0JA 5EYHA 3GYYA 4PFRA 4F1UA 1FTAA 1NV6A 4P3LA 3D1RA 2HZKA 4PFBA 4MEVA 1FJ9A 3RPLA 4PC9A 1FPIA 4PBHA 1FPLA 4F1VA 2PCRA 2Y5LA 2QVUA 4PDDA 4X8RA 3W9WA 1LBXA 1NUWA 3T1BA 1IMBA 1KA1A 5IZ3B 1NV5A 4PFIA 5J16A 1FPJA 4G61A 2HHMA 4NX1A 1FPKA 1RDZA 2PFYA 2HPGA 5A5LA 1NV2A 5IZ1A 5FBPA 1NUYA 2FIEA 3MSTA 1LBVA 1YYZA 4KXPA 2FBPA 1FBGA 2WEFA 1INPA 2WYPA 3NOHA 4GBVA 1FPDA 4PGNA 3RYDA 4AS4A 4I40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MX6 A;  4UAB A;  3B50 A;  5CM6 A;  4PDH A;  4O8M A;  4MNI A;  2VPN A;  2WX9 A;  4MNP A;  4N15 A;  2V4C A;  4PF8 A;  5IM2 A;  2XWO A;  4PET A;  4N8Y A;  4NN3 A;  4MIJ A;  4XEQ A;  4MMP A;  4PCD A;  2WYK A;  2CEX A;  4X04 A;  4LN5 A;  2XWK A;  5IGA A;  4OVT A;  4P1L A;  4DI3 D;  2XA5 A;  4P47 A;  4N6K A;  4P9K A;  4XFE A;  4NF0 A;  2VPO A;  4NHB A;  4NAP A;  2XWI A;  4PAI A;  2ZZX A;  4OVQ A;  4PE3 A;  4OA4 A;  5I7I A;  4PGP A;  4DI4 B;  4OVS A;  2PFZ A;  4O94 A;  4YIC A;  4MNC A;  4MCO A;  4N4U A;  5IZZ A;  4O7M A;  4N8G A;  2XXK A;  4P8B A;  4PAK A;  4PF6 A;  4N17 A;  4MHF A;  4XF5 A;  4OVR A;  4NGU A;  4NG7 A;  4NQ8 A;  4MAG A;  4N6D A;  5LTC A;  4P1E A;  4OAN A;  4P56 A;  4PBQ A;  5I5P A;  2HZL A;  4PAF A;  2ZZV A;  3FXB A;  2ZZW A;  4OVP A;  2CEY A;  4N91 A;  2XWV A;  3U65 A;  4YZZ A;  3GYY A;  4PFR A;  4P3L A;  2HZK A;  4PFB A;  4MEV A;  4PC9 A;  4PBH A;  4PDD A;  4X8R A;  4PFI A;  4NX1 A;  2PFY A;  2HPG A;  2WYP A;  4PGN A; 
#chains in the Genus database with same CATH topology
 4MF3 A;  4LQ2 A;  1EYJ A;  2R8T A;  3FAT A;  3ONM A;  4YB6 A;  4N13 A;  1M5B A;  3TOD A;  4RPO A;  3SDF A;  3M3L A;  4N8Y A;  5CMK A;  3C33 A;  1MS7 A;  4OER A;  1PC3 A;  4DXC A;  2OZZ A;  1HSL A;  3FAS A;  1WOD A;  4GWX A;  4L17 A;  1IMC A;  4TQU Q;  1OLC A;  4WEP A;  1FTO A;  5TP9 A;  2XHD A;  4R75 A;  2DVC A;  3K0V A;  4IO4 A;  4MLV A;  4N6P A;  3TDJ A;  2XXY A;  1JQF A;  3FJM A;  5H8N B;  1MXY A;  2XXQ A;  4O7M A;  1SD3 A;  2XXV A;  2VT5 A;  3LSX A;  4OFJ A;  4GRK A;  1FSA A;  5I5P A;  3PMX A;  4QXD A;  3TEP A;  4BDR A;  4RXL A;  5JTY B;  3IOW A;  4KD5 A;  4HCY A;  4OQO A;  3IOR A;  4K3F A;  2Z8D A;  1LBW A;  4POX A;  4POW A;  3PMW A;  2ZYM A;  1JVX A;  2Y5K A;  4X9T A;  2DDK A;  2NVU B;  3OEN A;  5EYH A;  2V3T A;  4PFR A;  4U22 A;  2DSF A;  1IIT A;  3N94 A;  2HZK A;  2V93 A;  4MEV A;  3DEL B;  4WXJ A;  3TYH A;  3EPE A;  3GZG A;  4X1B A;  2I58 A;  1Y3N A;  3RTW B;  3UA8 A;  3VVD A;  1ZKB A;  5CM6 A;  4NF6 A;  2B4L A;  1Z7M E;  4QSE A;  1NUZ A;  3PU5 A;  5KZT A;  3V89 B;  3KSJ A;  2DXR A;  3FJG A;  3G3J A;  4ZZE A;  1SI1 A;  3E13 X;  3CHG A;  2WBD A;  2CEX A;  4LN5 A;  5L9M A;  1D9V A;  4LUB A;  4OYV A;  5AA2 D;  4IO2 A;  2RC8 A;  4KCD A;  5ELV A;  1EU8 A;  4NHB A;  3LSL A;  4OVQ A;  2DYX A;  3H03 A;  1N3X A;  3K6U A;  3JZJ A;  1P1W A;  2XXI A;  3S2V A;  3VLV A;  2F7A A;  4IB2 A;  2AIX A;  4TOZ A;  4EDP A;  4XF5 A;  1US4 A;  3HO7 A;  3OOA A;  4UAC A;  4WED A;  5IKB A;  2DOJ A;  2DWA A;  2QL3 A;  4OEU A;  1H43 A;  1AWB A;  2HZL A;  4C1U A;  2HEU A;  3VDF A;  1MM6 A;  4F19 A;  2QVV A;  1T0K A;  5TPA B;  4EUO A;  2CMO A;  3ZSF A;  3VE1 B;  2BJJ X;  1DMB A;  1NV6 A;  4MBP A;  3OSR A;  2XX7 A;  3RPL A;  4PC9 A;  4EQB A;  3JYR A;  5J16 A;  1Y1M A;  4YMA A;  4JB7 A;  1SW4 A;  1SYH A;  1NUY A;  2FIE A;  1JVY A;  4KR5 A;  5DT6 A;  4KXP A;  3ECR A;  3M8U A;  3T93 B;  3TTN A;  3QSL A;  1UTH A;  3QMF A;  3LSF B;  1IMA A;  5JTY A;  1I69 A;  4ECF A;  4PFW A;  4IO3 A;  4PET A;  2LAO A;  4N81 A;  2QPQ A;  1IXH A;  1B5H A;  2B3F A;  3HST A;  1N7X A;  1DBZ A;  4AB5 A;  2NUV A;  2H5Y A;  4P9K A;  2ALU A;  5T3J A;  3VLU A;  2F7B A;  3T96 B;  1MXZ A;  3H3G A;  2O1M A;  4ESX A;  1EH3 A;  4FEB A;  4RPN A;  4KPT A;  3K6W A;  3QYT A;  3IO4 A;  3BFT A;  3PPO A;  2QSX A;  3MZ1 A;  4LA9 A;  3TQL A;  2OX3 A;  2H98 A;  4HCW A;  3RY3 A;  2HAV A;  3I5O A;  4YKJ A;  1KZ8 A;  3KC1 A;  1UIU A;  4OEV A;  1IMD A;  3OEM A;  2H4I A;  4GXA A;  4OVP A;  3MW0 A;  1OQH A;  1LAH E;  2UYE A;  2OWZ A;  4NF4 B;  4OTE A;  4FAT A;  2B3B A;  3TZA A;  4YB7 A;  3BBR A;  4EF2 A;  1S9T A;  4R9F A;  1YCJ A;  1VFE A;  3FZV A;  3S9N C;  4GWO A;  4MLQ A;  2I6E A;  3OO9 A;  4X1D A;  5JEI A;  3C4M A;  3N5L A;  4IO7 A;  2V84 A;  5CMB A;  5EQ9 A;  3IOV A;  2V3Q A;  4PF8 A;  1LFG A;  2D21 A;  3UOR A;  4R73 A;  2DE3 A;  4HXV A;  4I1D A;  4P0I A;  4YKK A;  1EZ9 A;  2XWK A;  1Q1K A;  4OEN A;  4P1L A;  2XXT A;  2I4B A;  4PTK A;  3KJT A;  5EHM A;  3O2A A;  5FHN A;  5I2K B;  2Y7W A;  3ZS6 A;  1JNF A;  1LB9 A;  1ZBM A;  4RY1 A;  1QKA A;  1AOV A;  3BFU A;  2X26 A;  3H7M A;  4OVS A;  3PUX E;  3ILT B;  4O94 A;  3FXQ A;  2PVU A;  1K9Z A;  4O3C A;  3OMB A;  4F3S A;  1G0H A;  4MHF A;  2RCA A;  5AA4 A;  3Q26 A;  3BIG A;  1B52 A;  3K6X A;  1LBY A;  3EHS A;  5LOM A;  2THI A;  4OET A;  1LEV A;  5AA3 A;  1MQD A;  1LST A;  2XXX A;  3DP6 A;  2Q74 A;  3TUS A;  1USY H;  1A99 A;  4ZEK A;  2ZZW A;  1EYK A;  1YXI A;  2GHA A;  4G4P A;  1G0I A;  4GVO A;  2UYF A;  4R72 A;  2F97 A;  1ZMG A;  2HFB A;  4ISU A;  1R9L A;  3CRB A;  1JW4 A;  5IZ3 B;  3RLF E;  1S7Y A;  4KYD A;  1B0H A;  3H6W A;  3TAJ A;  3K02 A;  3RPW A;  1N3W A;  4MFI A;  1LCT A;  1B51 A;  4GXS B;  4GF8 A;  4U4X A;  3K1N A;  2YPN A;  1NMU A;  5H8H B;  4MNP A;  3EN3 A;  3QXM A;  5IAI A;  1FJ6 A;  2JJK A;  1MXV A;  4PQJ A;  1MQG A;  2B65 A;  3P7I A;  3CG3 A;  2NXO A;  1NV0 A;  5EQ8 A;  1PEB A;  4H5G A;  5DYH A;  1M5F A;  3KGC A;  1Y4C A;  4GIZ A;  3TPA A;  4FBP A;  3GBB A;  3M3F A;  3FXU A;  3MQ9 A;  3MWB A;  3TFL A;  1FRP A;  2AL4 A;  1UTH B;  5M2V A;  1B2H A;  3VV5 A;  3FUZ A;  3E79 A;  4I3Y A;  2YJP A;  1USY E;  3FVG A;  4ZEI A;  2O84 X;  1LAX A;  2QFL A;  3T22 A;  4DCX A;  4TLL B;  3OXN A;  1B3H A;  3A29 A;  3E78 A;  4JVI A;  1MY0 A;  1B7U A;  3B6T A;  4JWX A;  1YAE A;  4GWU A;  4AQ4 A;  4G2Z A;  3QAX A;  4EXK A;  3TCG A;  3AXF A;  3MP1 A;  4XKR A;  3HHG A;  2F35 A;  2M8C A;  1A40 A;  4G68 A;  3RUM A;  2QS1 A;  2ZYO A;  4X8R A;  2I4C A;  1IMB A;  3U93 A;  4PFI A;  3A09 A;  1YTV A;  4JBZ A;  2I3W A;  1QUI A;  2UXA A;  1H76 A;  1UQW A;  1Y3P A;  3PPN A;  1INP A;  4THI A;  2NOO A;  4IY5 A;  2QMX A;  4R6K A;  5I2N B;  2D5W A;  1ZJL A;  3G3K A;  2E0S A;  4YKP A;  5I2N A;  1URD A;  5EQ7 A;  3TCH A;  2QS4 A;  1N84 A;  4H0W A;  4X48 A;  2FA7 A;  1NNP A;  1XI6 A;  1MQH A;  1VDW A;  3ISP A;  4FJP A;  4NN3 A;  4MIJ A;  3V8X B;  1UIV A;  4U2R A;  3S9M C;  1MM7 A;  3V5A A;  3UGW A;  4KFQ A;  2E1S A;  2V25 A;  3R26 A;  4NMY A;  3EF7 A;  2P3V A;  1IME A;  4PFT A;  1PBP A;  4LZ8 A;  5I7I A;  3ROJ A;  5LDZ A;  4LZ7 A;  3IAZ A;  5IZZ A;  1A54 A;  3O6I A;  4IR8 A;  3LSW A;  3LR1 A;  3PMV A;  1R1N A;  5EYG A;  4RK2 A;  4ZS9 A;  4PAF A;  3SEV A;  4F18 A;  1XS5 A;  4QHQ A;  3O29 A;  2VHA A;  4U23 A;  1FTJ A;  4Z7E A;  3G3F A;  3OO7 A;  4N91 A;  3VVE A;  3QUF A;  2ZNU A;  4H67 A;  1B7Z A;  2RC7 A;  2PX1 A;  5ICT A;  2RF1 A;  3D1R A;  2VGQ A;  4H1X A;  4YMB A;  3PUZ E;  2HXW A;  3MUQ A;  1LBX A;  1B7H A;  1MY3 A;  1NV5 A;  2HHM A;  4GOT A;  3E3K A;  5CBR A;  3PD9 A;  5CMC A;  4FE8 A;  4AB6 A;  2XXH A;  4M4G A;  2RC9 A;  3SEW A;  1H45 A;  5A5X B;  3S9L C;  1XHY A;  2P1S A;  1RDX A;  3DLN A;  1ZIU A;  4QSC A;  3C35 A;  5I59 B;  4GQO A;  1FCK A;  2Z23 A;  3IL1 B;  2XXW A;  4EXL A;  4ZEB A;  4C1T A;  3BIH A;  4ELR A;  2P0S A;  4F22 A;  4IO5 A;  3C31 A;  3IX1 A;  5ITO A;  2Y84 A;  2CZI A;  5IZ3 A;  3EKI A;  4FED A;  5DEX A;  1NI9 A;  4QF9 A;  1FPE A;  4N4U A;  3R7X A;  3KEI A;  3MVZ A;  1B1X A;  3BKI B;  4HE0 A;  2ZYK A;  2ESN A;  1TFD A;  2Z8E A;  1TFA A;  4OVR A;  5EHS A;  4ZE8 A;  4P1E A;  1H44 A;  4MH5 A;  1NV1 A;  1VE4 A;  1FPB A;  4DCY A;  1MXX A;  1FQC A;  3SEY A;  2QVR A;  4GWW A;  4EF1 A;  3G7W A;  1B1H A;  2ONS A;  4ELP A;  2ZXT A;  3HCQ A;  4YZZ A;  1GVC A;  1RYO A;  1FTK A;  3VVF A;  1FTA A;  3K1M A;  3K1P A;  3TQW A;  1PDA A;  4P0G A;  1NUW A;  1P1Q A;  3FD3 A;  5CC2 A;  3T9X B;  2OCU A;  2I0B A;  4R2B A;  5B70 A;  4XTC Q;  3NOH A;  4GBV A;  1NL5 A;  2F6G A;  1IXG A;  1P99 A;  4MX6 A;  3S4U A;  2KR0 A;  3KOS A;  4IGT A;  3SER A;  4GLI A;  1VFD A;  4ESW A;  4GWY A;  1UTB A;  2P3N A;  3MVY A;  2XD2 A;  4GX4 A;  1MG1 A;  2X7Q A;  4H8J A;  3OD7 A;  1IMF A;  4Q5T A;  3SES A;  4MJO A;  1JW1 A;  4U1Z A;  3ZKK A;  4X04 A;  2AL5 A;  4KYS A;  1MY2 A;  3O97 A;  2QJE A;  1GGG A;  1PB8 A;  3TTM A;  2F8D A;  4G8H A;  4PAI A;  4LZ5 A;  4Q30 B;  1PB9 A;  4F39 A;  1ANF A;  2PFZ A;  4NF5 A;  2WBB A;  1MXU A;  4N8G A;  4P8B A;  3O6G A;  1IXC A;  2F5X A;  5AA2 A;  4C0R A;  2P2A A;  4YU0 A;  1MDP 1;  1A7L A;  4RNS A;  1NV4 A;  2REJ A;  3KBZ A;  3I6V A;  1JEU A;  4NE4 A;  5BWJ A;  3T9U A;  2DE4 A;  3Q29 A;  1LFH A;  3K2D A;  3MJN A;  1RKM A;  4H46 A;  4LP2 B;  2FHY A;  5HM4 B;  2R9J A;  2HAU A;  2OBG A;  1AIV A;  1POT A;  5H8F B;  3A3U A;  5K2X A;  3C32 A;  2I48 A;  1US5 A;  3IB2 A;  4LAT A;  4F1V A;  1M5E A;  3W9W A;  2HCA A;  4TLM B;  4H8I A;  1H3D A;  5CBS A;  3SET A;  1NV2 A;  3H6V A;  1ELJ A;  4P11 A;  4QFN A;  2A5T A;  1QGX A;  4PDH A;  3VXB A;  1HSJ A;  2VPN A;  4BDO A;  3OO8 A;  3B6Q A;  5IM2 A;  3IB1 A;  1B9J A;  3FBP A;  1LBC A;  5K2Y A;  4OXV A;  1B40 A;  1MY1 A;  3N6U A;  4F2O A;  4KI0 E;  2Q89 A;  3MYU A;  2VOZ A;  5I58 B;  2W7Y A;  3CIJ A;  2ZNS A;  4GWZ A;  1RDY A;  2XA5 A;  4N6K A;  4XKP A;  4NF6 B;  4PP0 A;  2UVG A;  3UK4 A;  4PE3 A;  5ICQ A;  4JWY A;  3CFL A;  4R6H A;  1I6A A;  5I56 B;  3PGF A;  2V3U A;  2Y7I A;  4MNC A;  3PUV E;  3IFC A;  2AYS A;  2F78 A;  3H6U A;  2XXK A;  3PTY A;  1LCF A;  4O3A A;  3KBR A;  4RJZ A;  3CFZ A;  2UVI A;  4QFK A;  4PBQ A;  5ET8 A;  3HN0 A;  3CG1 A;  3KN3 A;  3TCF A;  1B3E A;  4RK9 A;  3KN7 A;  4DXU A;  2HQ0 A;  3C36 A;  5KCJ B;  1ATG A;  3FV1 A;  1BP5 A;  3CSG A;  1NNF A;  1WDN A;  2DVZ A;  1CNQ A;  1XVX A;  3U65 A;  3T0J A;  3KJ7 A;  1LBB A;  1SW5 A;  1MXW A;  3K00 A;  3FVO A;  4PBH A;  2Y5L A;  4ZDM A;  1YPN A;  5H8H A;  4NX1 A;  3M3K A;  1FPD A;  3IK6 B;  3C34 A;  4IO6 A;  4M1V A;  4UAB A;  2GH9 A;  3KZG A;  4KHZ E;  2WX9 A;  2V4C A;  2PT2 A;  1XVY A;  1BK4 A;  1NUX A;  4OWD A;  3G3I A;  3SZP A;  3O28 A;  3SKP A;  3G3H A;  3B6W A;  1D4N A;  4FIM A;  1NV3 A;  4F31 B;  1N7W A;  1Z7N E;  2Y7R A;  1Y20 A;  4XXU A;  1OIB A;  1NKX A;  4HTG A;  4BLA A;  2VPO A;  1FBC A;  3DP8 A;  2ZZX A;  1Y9U A;  4H5F A;  2OWT A;  4DI4 B;  4BDM A;  2PT1 A;  2H99 A;  3JV9 A;  4QFP A;  1S50 A;  2MKZ A;  5DVI A;  5F7V A;  3MP6 A;  4I3E A;  1RYX A;  5LTC A;  4U21 A;  1IZ1 A;  4DXB A;  2ZZV A;  3FVN A;  5I2K A;  1D3K A;  5KDT A;  1DTG A;  1DSN A;  1ZLQ A;  1OMP A;  4GX3 A;  3IOT A;  1MY4 A;  4Q8R A;  2RCB A;  4KQP A;  4HW8 A;  1LLS A;  2O68 A;  4F1U A;  3S9E A;  2Q88 A;  2YLN A;  3DM0 A;  4U4S A;  2DP8 A;  4PDD A;  2VD2 A;  4OHN A;  2OJT A;  4OZ9 A;  2XD3 A;  4UA8 A;  4ZEC A;  2PYY A;  1GR2 A;  3IOU A;  3KN8 A;  4O8M A;  4MNI A;  2O7I A;  5EYF A;  3B7D A;  4DIG A;  2PBW A;  3RT8 A;  1Q35 A;  1SQY A;  4PE5 B;  4QFL A;  3U94 A;  3HV1 A;  3EHU A;  4OFL A;  1P1O A;  1PB7 A;  3LV0 A;  4DLD A;  5H8F A;  3MPL A;  3VXC A;  2WYK A;  3KOT A;  1GTK A;  3TMG A;  5DEX B;  3KG2 A;  4DI3 D;  3HFU A;  5H8S A;  3UN6 A;  4P47 A;  1POY 1;  5F1Q A;  3ZKL A;  1Y1Z A;  4NF0 A;  1QUL A;  4OA4 A;  1D9Y A;  3CVG A;  1IUD A;  3OSQ A;  3GBA A;  1VSO A;  4JVD A;  2OLB A;  3RPL B;  4PFY A;  4GX6 A;  2FVZ A;  3Q25 A;  3IB0 A;  1L5T A;  4QSD A;  1QUK A;  1XOC A;  1XT8 A;  5ESY A;  5CRY A;  3EHT A;  3RNN A;  1BKA A;  3WAE A;  4LVQ A;  1F9B A;  1SPI A;  3T9V A;  1I6B A;  5HPQ A;  2F3D A;  1LAG E;  3U72 A;  4P3L A;  3U1O A;  5AA4 B;  5L8D A;  4FAJ A;  1Y4T A;  2PCR A;  1FTM A;  5A5X A;  1YYZ A;  2FBP A;  1D9Q A;  4RA1 A;  3G3G A;  3KSX A;  1IQ7 A;  1PBQ A;  4YKI A;  2Z22 A;  1CE2 A;  4G68 C;  3C9H A;  5AE4 A;  2XWO A;  2B4M A;  1GV8 A;  3N6T A;  2HXR A;  3H6T A;  2OK2 A;  1URG A;  2L5V A;  4JSO A;  3USD A;  3HHF A;  4ZEF A;  2XXR A;  4DZ1 A;  1SDX A;  1FPF A;  3CI8 A;  4XFE A;  1DK4 A;  2Q8M A;  4FOR A;  3V83 A;  2H25 A;  2QRY A;  4NAP A;  2IA4 A;  1MH4 A;  4BDQ A;  1FBD A;  3RTF B;  1CB6 A;  1FQA A;  1AH5 A;  3RN8 A;  4R74 A;  4N07 A;  4PAK A;  3E4R A;  1NNT A;  3L6G A;  4FEC A;  5CI5 A;  3MZ9 A;  1HSE A;  2I3V A;  4DDD A;  4NG7 A;  3K01 A;  2DE2 A;  5I3S A;  4N6D A;  4F29 A;  3FXR A;  4LQ5 A;  1O7T A;  3W9V A;  2Q2A A;  1B6H A;  1A8F A;  5DVJ A;  2OWS A;  3SEU A;  4H65 A;  1QVS A;  2DWI A;  3TTK A;  4U1O A;  3U8Q A;  2FYI A;  1FPI A;  3RQT A;  2QVU A;  3O66 A;  1N04 A;  3PPR A;  1FPK A;  1ZU0 A;  5FBP A;  4OES A;  4LON B;  2KLF A;  1FBG A;  3B50 A;  4YB5 A;  3H4Z A;  1Q9D A;  3RT6 B;  5H8Q A;  3TEL A;  1MQJ A;  2D3I A;  1AL3 A;  1NH7 A;  1NV7 A;  2ZNT A;  5KDT B;  2VP1 A;  4F3P A;  4NTL A;  5H8Q B;  3ILU B;  2BJI A;  1B3F A;  4QRZ A;  1QW0 A;  4ZZA A;  3WAF A;  3VFJ A;  3B8B A;  3IJO B;  4F2Q A;  1FTL A;  1JW5 A;  1A55 A;  4GWS A;  4I9D A;  2Y7P A;  4DE8 A;  5IGA A;  1AMF A;  2Q9T A;  1II5 A;  4NWC A;  5HBC A;  1P1N A;  1IXI A;  1FBF A;  2CZL A;  2F3B A;  2XX9 A;  1SYI A;  4ONY A;  4NF4 A;  1B5I A;  3FIR A;  1QKB A;  1LBZ A;  4KYE A;  5H8N A;  4HE1 A;  4KCC A;  3CFX A;  4MAG A;  3TTR A;  4OAN A;  4P56 A;  1LAF E;  1O64 A;  5J1D A;  4R9G A;  4R2F A;  5ISU A;  3FXB A;  3RGY A;  1OVB A;  3TTL A;  3O6H A;  3I3V A;  1IIW A;  2DS9 A;  4E0X A;  2XWV A;  1LGB C;  3IO6 A;  3UIF A;  5FTI A;  5TPA A;  1FJ9 A;  3Q27 A;  1FPL A;  2QS3 A;  1P1U A;  1FPJ A;  2ANJ A;  5A5L A;  1B0L A;  4I62 A;  3CSB A;  2FNC A;  1FQD A;  1LBV A;  2F6P A;  2WEF A;  4PGN A;  3IFA A;  2WKY A;  4I40 A;  4AS4 A;  4OVJ A;  4HE2 A;  3OEK A;  4F1Y A;  2RIN A;  4QFO A;  3Q28 A;  4JDF A;  4JWO A;  1MRP A;  1NH8 A;  2ABH A;  3ODB A;  4NF8 B;  4XEQ A;  1NNK A;  5ITP A;  2VD3 A;  4MMP A;  3TKD A;  3MVX A;  4PCD A;  4NF8 A;  1SW2 A;  1FBP A;  3VLW A;  2I0C A;  3FV2 A;  2F34 A;  1SVX B;  3DP4 A;  2XWI A;  1FBH A;  4HS7 A;  4NED A;  3KC0 A;  1B05 A;  4PGP A;  4F3B A;  5BUU A;  1DPE A;  2ZYN A;  3HPI A;  3LUZ A;  2GQ1 A;  5ET5 A;  5I59 A;  1EZO A;  1JET A;  1FQE A;  1K9Y A;  1VR5 A;  4N17 A;  2QMW A;  4G68 B;  2A5S A;  3R6U A;  4NGU A;  5JK4 A;  3MC2 A;  3T9H B;  3PD8 A;  4EQ7 A;  1M5D A;  1A8E A;  2H9B A;  3FJ7 A;  1KA0 A;  4ELO A;  4PFU A;  3LBS A;  2Y7K A;  1MPC A;  3MP8 A;  3A3C A;  4GBW A;  3E9X A;  1Y3Q A;  2R6G E;  1DOT A;  4OFO A;  4ZE9 A;  3LUY A;  1EZP A;  1JEV A;  3O9P A;  4BDL A;  3PPQ A;  3FVK A;  1SBP A;  4OMB A;  1KA1 A;  1URS A;  5AA1 A;  1TWY A;  4GL8 A;  3IR1 A;  1B3L A;  4G61 A;  4BDN A;  2O69 A;  5IZ1 A;  4ELQ A;  1B46 A;  5I57 B;  1DTZ A;  1QUJ A;  1LB8 A;  2O6A A;  1B4H A;  2G93 A;  2O7U A;  5I57 A;  1XC1 A;  2IEE A;  3GLB A;  5DTB A;  3MZB A;  1SW1 A;  3PUW E;  5F24 A;  3PUY E;  4EQ9 A;  5L9S A;  4NWD A;  1BTJ A;  1DPP A;  2GRV A;  1R9Q A;  3FGS A;  1B32 A;  2FIX A;  4ZED A;  5I84 A;  3PPP A;  4OVT A;  2PMS A;  1QJM A;  3THI A;  2NWJ A;  1N0T A;  1UTB B;  3W15 C;  5FHO A;  2A5T B;  1FW0 A;  1O63 A;  1DCU A;  4YIC A;  5L9O A;  1YZ0 A;  4E0W A;  3MBP A;  4F3G A;  5DW8 A;  4H6D A;  4IY6 A;  1EYI A;  3QK6 A;  1ZTY A;  3KFM A;  5DVF A;  4NQ8 A;  5I58 A;  3OEL A;  3LC8 A;  2O51 A;  3K6V A;  2CZK A;  2DXY A;  3PV0 E;  2F36 A;  2KQZ A;  4R6Y A;  5FTH A;  1SI0 A;  4XIG Q;  2X7P A;  2CEY A;  2XXP A;  4NF5 B;  5EQA A;  2DQV A;  4WKM A;  4ND9 A;  3GYY A;  1MH3 A;  1J1N A;  3IJX B;  2RKM A;  3D4G A;  4O3B A;  4Q0C A;  3H06 B;  5AA2 B;  2UVJ A;  5TP9 B;  4RYA A;  3CR9 A;  1B3G A;  3GXA A;  5TU0 A;  1RDZ A;  4XKN A;  4JSD A;  2WYP A;  2R71 A;  3T1B A;  3U92 A;  1B5J A;  3QIM A;  2DWH A;  3EQ1 A;  4Z0I A;  1JP4 A;  4JVC A;  4N15 A;  5KCJ A;  2ONR A;  4I8C A;  2F7C A;  1B58 A;  4JXI A;  1MDQ A;  5CMM A;  2XXU A;  1KWH A;  3SEX A;  2DWJ A;  1WVJ A;  5ET6 A;  2O1L A;  4G77 A;  1FPG A;  2GHB A;  3UP9 A;  3D4C A;  1NFT A;  1BIY A;  1TT1 A;  5B7D A;  1MPD A;  4QBA A;  1FQF A;  1R6Z A;  1I6Q A;  1BLF A;  1MPB A;  4XKQ A;  1FBE A;  4GFR A;  3MAM A;  1IEJ A;  1TXF A;  5ET7 A;  4MCO A;  3OO6 A;  4G8M A;  4AS5 A;  3L6H A;  4PF6 A;  4G8N A;  1OLA A;  2ZMB A;  2Q8J A;  2XX8 A;  4GL0 A;  2ONK E;  3N26 A;  5I56 A;  1N76 A;  2QS2 A;  2GFE A;  5FHM A;  4H45 A;  4YAH X;  2I49 A;  1FQB A;  1OVT A;  2CZH A;  4GD5 A;  1M5C A;  1MQI A;  4O7I A;  1B4Z A;  4PFB A;  3T66 A;  2G29 A;  2REG A;  3F11 A;  3MPK A;  4IGR A;  1LFI A;  1OQG A;  3MVW A;  2PFY A;  2HPG A;  2Q2C A;  3K4U A;  3MST A;  2UVH A;  3QUJ A;  2Z8F A;  3RYD A; 
#chains in the Genus database with same CATH homology
 4M1V A;  4HE2 A;  4MX6 A;  3B50 A;  4UAB A;  2KR0 A;  1QGX A;  5CM6 A;  4PDH A;  2B4L A;  1JP4 A;  1EYJ A;  4JVC A;  4O8M A;  1D9Q A;  4MNI A;  1Q9D A;  2R8T A;  2VPN A;  2WX9 A;  4GWY A;  3QMF A;  1NUZ A;  4MNP A;  4N15 A;  1NV7 A;  2V4C A;  2V3Q A;  5EQ9 A;  5F24 A;  4PF8 A;  1FJ6 A;  1RDX A;  1IMA A;  5EQ7 A;  2P3N A;  2JJK A;  5IM2 A;  2XWO A;  2B4M A;  2BJI A;  1BK4 A;  4GX4 A;  4PET A;  1NUX A;  3B8B A;  3FBP A;  1IMF A;  4N81 A;  4N8Y A;  4NN3 A;  1XI6 A;  2QPQ A;  1VDW A;  3ISP A;  2HXR A;  4MIJ A;  4XEQ A;  1NV0 A;  2DE3 A;  5EQ8 A;  3SZP A;  4MJO A;  2L5V A;  2FIX A;  3LV0 A;  4MMP A;  4PCD A;  4HXV A;  3CHG A;  2WBD A;  2WYK A;  4GWS A;  2CEX A;  3BIH A;  3MYU A;  4X04 A;  4LN5 A;  1FPG A;  1FBP A;  2XWK A;  5ET6 A;  5IGA A;  1DBZ A;  1NV3 A;  4GWZ A;  4OVT A;  4P1L A;  4DI3 D;  3HFU A;  2Q9T A;  1RDY A;  2XA5 A;  4PTK A;  4QBA A;  4GWX A;  4P47 A;  1FPF A;  4N6K A;  4P9K A;  1IMC A;  2CZI A;  4XFE A;  5IZ3 A;  1DK4 A;  3EKI A;  2Q8M A;  1FBF A;  5T3J A;  2P3V A;  4NF0 A;  1IME A;  2VPO A;  1FBC A;  4NHB A;  3IFA A;  4NAP A;  1FBE A;  1FBH A;  2XWI A;  4FBP A;  4PAI A;  2ZZX A;  4OVQ A;  2F3B A;  1NI9 A;  4PE3 A;  4OA4 A;  5I7I A;  1FBD A;  3KC0 A;  1FPE A;  4PGP A;  3ROJ A;  4DI4 B;  4OVS A;  5LDZ A;  2PFZ A;  4O94 A;  1DCU A;  4YIC A;  5ET7 A;  3LUZ A;  4MCO A;  2GQ1 A;  1YZ0 A;  1K9Z A;  4MNC A;  5ET5 A;  3IFC A;  4N4U A;  2WBB A;  1FRP A;  5IZZ A;  4O7M A;  1LBZ A;  4JVD A;  2MKZ A;  2XXK A;  4IR8 A;  4N8G A;  4P8B A;  3PTY A;  3E79 A;  4PAK A;  4AS5 A;  4HE0 A;  1K9Y A;  5DW8 A;  4PF6 A;  4N17 A;  4I3Y A;  1EYI A;  1G0H A;  2VT5 A;  2F5X A;  4MHF A;  4XF5 A;  2OX3 A;  4HE1 A;  4OVR A;  3RPL B;  4I3E A;  3BIG A;  4HCW A;  4NGU A;  4NG7 A;  5JK4 A;  1LBY A;  4GX6 A;  2DE2 A;  4NQ8 A;  5EYG A;  2FVZ A;  4MAG A;  4N6D A;  5I3S A;  1FSA A;  1NV4 A;  5LTC A;  4P1E A;  4OAN A;  3KBZ A;  4P56 A;  2QFL A;  4PBQ A;  5I5P A;  1AWB A;  1LEV A;  1NV1 A;  4QXD A;  5ET8 A;  3W9V A;  5J1D A;  2HZL A;  1KA0 A;  1KZ8 A;  3KC1 A;  2CZK A;  4PAF A;  3A29 A;  2ZZV A;  3E78 A;  3FXB A;  2DE4 A;  4JVI A;  1FPB A;  4F18 A;  4H45 A;  2KQZ A;  4F19 A;  2QVV A;  2Q74 A;  4H46 A;  4HCY A;  5ESY A;  1IMD A;  4GBW A;  4GWU A;  2ZZW A;  1LBW A;  4GX3 A;  4OVP A;  1EYK A;  1SPI A;  2CEY A;  1YXI A;  2DVZ A;  2QVR A;  4GWW A;  4N91 A;  2FHY A;  1G0I A;  2CZH A;  2F3D A;  1CNQ A;  2Y5K A;  4X9T A;  2OWZ A;  4O7I A;  2DDK A;  2XWV A;  3U65 A;  4YZZ A;  5EQA A;  3T0J A;  5EYH A;  3GYY A;  4PFR A;  4F1U A;  1FTA A;  1NV6 A;  4P3L A;  3D1R A;  2HZK A;  4PFB A;  4MEV A;  1FJ9 A;  3RPL A;  4PC9 A;  1FPI A;  4PBH A;  1FPL A;  4F1V A;  2PCR A;  2Y5L A;  2QVU A;  4PDD A;  4X8R A;  3W9W A;  1LBX A;  1NUW A;  3T1B A;  1IMB A;  1KA1 A;  5IZ3 B;  1NV5 A;  4PFI A;  5J16 A;  1FPJ A;  4G61 A;  2HHM A;  4NX1 A;  1FPK A;  1RDZ A;  2PFY A;  2HPG A;  5A5L A;  1NV2 A;  5IZ1 A;  5FBP A;  1NUY A;  2FIE A;  3MST A;  1LBV A;  1YYZ A;  4KXP A;  2FBP A;  1FBG A;  2WEF A;  1INP A;  2WYP A;  3NOH A;  4GBV A;  1FPD A;  4PGN A;  3RYD A;  4AS4 A;  4I40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...