2CEYA

Apo structure of siap
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
306
structure length
306
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport
molecule keywords PROTEIN HI0146
publication title Conservation of Structure and Mechanism in Primary and Secondary Transporters Exemplified by Siap, a Sialic Acid Binding Virulence Factor from Haemophilus Influenzae
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 116
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2006-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2ceyA00
4MNPA 4OVRA 4N91A 4PFIA 5IZZA 4P1EA 2CEYA 5IM2A 4OVPA 4XEQA 4PFBA 2CEXA 4PE3A 4YZZA 2WYPA 3GYYA 2ZZVA 4N6DA 4PDDA 2WYKA 4P8BA 4NN3A 3B50A 4P1LA 4P56A 4NAPA 4PF6A 4PDHA 4MCOA 4N15A 4N6KA 5LTCA 4UABA 4PETA 2VPNA 4XF5A 4MEVA 2WX9A 5I5PA 2XA5A 4P47A 4N17A 4XFEA 4PGPA 4PCDA 4NHBA 2XXKA 4X8RA 4N8GA 4OVSA 2XWVA 2ZZWA 4PBQA 2HZKA 4DI4B 2PFZA 3FXBA 4NF0A 4LN5A 5I7IA 4MNIA 4OANA 4YICA 4MIJA 2XWKA 4O7MA 4O94A 4N4UA 4MMPA 4PAKA 4PFRA 4OA4A 2V4CA 4N8YA 2VPOA 5CM6A 4MAGA 4MHFA 4PF8A 4X04A 3U65A 4MX6A 2HZLA 4MNCA 2XWIA 4PAFA 5IGAA 4NG7A 4NX1A 4PGNA 4PAIA 4OVQA 4PBHA 2PFYA 2XWOA 4O8MA 4NGUA 4PC9A 4P9KA 4OVTA 2ZZXA 4P3LA 4NQ8A 4DI3D 2HPGA
chains in the Genus database with same CATH superfamily
4GX6A 3GZGA 2QRYA 1LLSA 3E79A 3O29A 4E0XA 1Q1KA 1JW5A 4OFOA 1UTBA 4RK2A 3Q28A 2M8CA 2LAOA 2VGQA 1QW0A 2ZZVA 1TFDA 2UVGA 4R75A 1PBPA 1B46A 4N6PA 2L5VA 5EQ7A 3KBRA 1MPBA 1ZU0A 5LTCA 2NUVA 2XXIA 2ZMBA 2O69A 2WBDA 3MP6A 3K1MA 5T3JA 3PUXE 4H67A 3GBBA 3KGCA 5H8QA 3MW0A 5H8NB 2O7UA 3MZBA 4R9FA 1Y9UA 2ZNSA 1D9VA 1B0HA 1MY4A 3PU5A 4OETA 4H1XA 4HE1A 1BKAA 4YB5A 4RPOA 4ZZEA 3M3LA 4RYAA 4BDNA 3HFUA 1EH3A 4MAGA 2KLFA 1OLCA 2R8TA 3KN7A 5FTHA 1NUZA 4PAFA 2D21A 1D9YA 4NX1A 4F3GA 2Q89A 1LEVA 1TT1A 5DVFA 5CMMA 2XD2A 3T9HB 2GHBA 4O3CA 2R9JA 1AOVA 3B6WA 3FZVA 5IZZA 1FRPA 4QFOA 1XVYA 3H7MA 2PYYA 1FW0A 4OFJA 4OVPA 4NE4A 1II5A 3Q29A 4NF5B 2NVUB 2X26A 3LSWA 3H6VA 3FV2A 5FHNA 2WYKA 4F29A 1A7LA 4X1DA 1IZ1A 3PPOA 1IXHA 1OVBA 4UABA 4JB7A 1B3LA 1URSA 2FNCA 5M2VA 2Y7RA 4WEDA 3O28A 2Z23A 4NF6A 5FTIA 3ROJA 3TKDA 1HSJA 1EZPA 4F18A 4GRKA 3MBPA 2A5TB 4GWUA 4FJPA 4MIJA 1MY2A 2DS9A 2B4LA 2WBBA 1NH8A 2XX8A 1FSAA 2H99A 3IFAA 2I6EA 4XKNA 1I69A 3FVKA 4PFRA 2QMWA 4N13A 3ONMA 3R26A 3LUYA 2QL3A 3MC2A 4O3AA 2OZZA 5H8NA 1USYE 3T1BA 4GWOA 1ZLQA 3SDFA 5KCJA 1DPEA 2VD3A 3TYHA 4DCYA 1FQCA 3KSXA 4NGUA 4OVTA 1EZ9A 1MQDA 3TCHA 5B70A 3HO7A 4R2BA 3L6HA 4XKPA 2DWAA 3LV0A 2CMOA 2UYFA 1SBPA 1H76A 1GTKA 4F2OA 3PUZE 3S9LC 1LSTA 2JJKA 4ZECA 2QVVA 2HHMA 2Y7IA 4KCCA 4YMBA 4L17A 1MPCA 4G77A 3KFMA 1FQFA 3PD9A 4N6DA 3HCQA 4G68B 1ZMGA 2REGA 4LQ5A 3D1RA 3E78A 1POTA 1QULA 3LC8A 1RDXA 4TOZA 1QJMA 4FORA 2VPNA 3IK6B 2XXHA 4NMYA 4GF8A 4PFWA 2BJJX 2ZNTA 3PGFA 3BBRA 4GWXA 1FTLA 2XX9A 4DZ1A 3MP8A 2QS3A 1T0KA 3HHGA 3CSGA 3FUZA 2KQZA 4PBQA 4IGTA 2KR0A 5ET8A 1ZJLA 4AS4A 3QK6A 2F78A 4P11A 1VFDA 2E0SA 1D3KA 5L8DA 4R9GA 3I6VA 3N6TA 1PDAA 4BDLA 3LR1A 5AA2B 2FIEA 1YCJA 4GWZA 2O84X 4MFIA 5H8FB 5LOMA 4HS7A 4YMAA 1GR2A 1MY3A 1MY0A 2A5TA 2QJEA 4I3EA 1FBFA 3A3UA 3RLFE 2F7AA 4MLQA 4LZ7A 4PFBA 4I62A 2H98A 2DQVA 1IEJA 2F8DA 4PDDA 1B05A 1YTVA 2VP1A 1H3DA 5DYHA 2FBPA 4NTLA 4XF5A 3P7IA 3PPQA 1RYOA 3TTKA 2Z22A 2REJA 3Q25A 3O6GA 3IOWA 5IZ1A 2V3TA 1JW1A 3V8XB 4F19A 3C4MA 4IB2A 1RDYA 2D5WA 4XKRA 4U1OA 4ESWA 4ZEKA 2I58A 4E0WA 4LN5A 4NWCA 3RT8A 3IO4A 4X48A 3M3KA 1A55A 2GH9A 1KA1A 4KR5A 4PAKA 1L5TA 1NV6A 2V3UA 3C32A 3ECRA 5L9OA 1LAXA 4P0GA 1NV4A 1B0LA 2F6PA 2F34A 1IXGA 3K00A 2AL4A 4PQJA 1BP5A 3MZ9A 2HEUA 1HSLA 5B7DA 3JYRA 3B6QA 4DIGA 1AMFA 3CI8A 4O8MA 2QVRA 2XXTA 4H8IA 4IO2A 1MRPA 5BWJA 3OEKA 2ZYNA 2UVJA 3MUQA 5FHMA 1P1QA 4F31B 4EDPA 1UIVA 3H6UA 4OERA 3SZPA 2H25A 2BJIA 4XEQA 2Q2CA 3K6UA 2OJTA 3KEIA 4X1BA 2PVUA 4MLVA 3GYYA 4I8CA 1ATGA 4QSDA 2QS4A 1PB7A 3T93B 4OQOA 2OX3A 1RDZA 1LGBC 3U72A 4G8HA 3KOTA 2I3WA 2RCAA 1A54A 1CE2A 3PPNA 2WX9A 2Q9TA 3RPLA 1SPIA 2I4BA 1B40A 4N17A 3VV5A 5AA3A 1IMFA 3V83A 1B3EA 2RC9A 1FPEA 4JDFA 3ILUB 4U4SA 1Y3NA 3FXBA 1VSOA 4MBPA 1B4HA 1IMCA 2ZNUA 4G2ZA 3MVYA 3IL1B 3IOTA 3CFZA 2F7CA 4KYSA 3QUFA 2Z8DA 4GWYA 2VPOA 5EQ9A 1MXVA 3ZKKA 2QS1A 2GRVA 3KC0A 3U65A 4MX6A 4AQ4A 4LVQA 3OSRA 1N7XA 2Z8EA 5I2KA 3KSJA 1IQ7A 3G7WA 4JVDA 5I2NA 1FCKA 2QSXA 2Z8FA 4ZEIA 2ZXTA 3U92A 2XWOA 3S9NC 5JTYB 3TUSA 2DOJA 5IKBA 5LDZA 1A8EA 2Y84A 5CMBA 3TELA 3H03A 1JP4A 3Q26A 4KI0E 5EQAA 3G3KA 4POWA 1MS7A 2F7BA 1QUJA 3TQLA 5IZ3A 4TLLB 4GD5A 4XIGQ 1AL3A 4OENA 2MKZA 4AB5A 3RY3A 4FAJA 1NH7A 3FJ7A 5DEXB 5TU0A 4P56A 2O6AA 4F22A 1YZ0A 4U1ZA 2O1MA 1JVYA 4R2FA 2XXRA 4YKPA 1FTKA 3GBAA 5H8HB 4GWWA 1MH3A 3MP1A 4FBPA 2XXKA 2IA4A 4JXIA 4EUOA 5JEIA 4EQ9A 2I4CA 3QAXA 4YB7A 1FTAA 1ELJA 4YKKA 4QSEA 1KWHA 1R6ZA 2CZKA 5TP9B 2GHAA 1N0TA 1LBYA 4OVJA 1QKBA 1NV0A 3KZGA 3FIRA 4ECFA 1H44A 3H4ZA 3UK4A 1M5DA 5A5XA 2ZYOA 3RTWB 2UVIA 5AA2D 2X7PA 3PMWA 1JQFA 3IB1A 2HCAA 1OQGA 4PGNA 4ZDMA 4GL0A 4PBHA 2THIA 1FTOA 4LATA 1TFAA 3RN8A 1XHYA 1FPGA 3FVOA 3L6GA 4H45A 1N3XA 1WDNA 4GVOA 1ZTYA 3EHUA 1NUXA 1M5FA 4DI3D 3TQWA 1Z7NE 4PTKA 4NF4B 4R73A 3SEWA 3TTLA 3RT6B 1B2HA 4GXAA 1AWBA 2VOZA 4UACA 2XX7A 4YKIA 4YAHX 4AB6A 3FXQA 2CZLA 3UGWA 4Z0IA 4PE3A 2HAVA 2HQ0A 4O3BA 3O2AA 3VVFA 3S4UA 2F36A 4OFLA 4IO3A 5I57A 4QFNA 3UA8A 1SDXA 4PF6A 2Q74A 5EQ8A 1GV8A 1UIUA 4RPNA 4MEVA 2Q88A 4N8GA 1QUIA 3VLVA 3WAFA 4OVSA 2CZHA 2XWVA 4KCDA 4POXA 5CI5A 5I7IA 1F9BA 2I49A 1B7HA 1PBQA 3S9MC 3KN3A 4MMPA 4OZ9A 1MXXA 3TZAA 4EF1A 1JEUA 3B6TA 1DSNA 3S9EA 4X04A 1N04A 3U93A 4FEDA 1OVTA 5F24A 3BIGA 1MQHA 4X9TA 2F6GA 4QFKA 2OBGA 4OMBA 5CMKA 4FATA 2Q8JA 1VR5A 1Y3PA 2B65A 3WAEA 2Y7WA 2AYSA 1FBPA 1FPFA 4N91A 2F97A 3ZS6A 1NV2A 2Y5LA 4FEBA 2ZYKA 3M3FA 2ESNA 1N84A 3KG2A 4XXUA 1YAEA 3DP4A 4ND9A 3FXRA 3H3GA 3FD3A 4JSDA 2CEXA 4GL8A 3A09A 4JWYA 3BIHA 1CB6A 3B7DA 4KXPA 1N3WA 3CRBA 3PMXA 1M5CA 3UN6A 2ONRA 1NNPA 2DWIA 4XTCQ 3T0JA 5J16A 3FATA 2O51A 4N15A 1DTZA 2FIXA 1P1OA 1QVSA 5JK4A 2PBWA 1MQIA 2NXOA 3IB0A 2RKMA 1IMBA 3K1PA 3R6UA 4ZE8A 3QUJA 4WXJA 1Y4TA 1B3FA 3QXMA 1B4ZA 2QS2A 1LBCA 3E9XA 4F1UA 1B1XA 1P99A 2NWJA 3CG1A 1MY1A 4TLMB 1QUKA 1H45A 1ANFA 1NKXA 2P2AA 1TXFA 1UTHB 5HBCA 4U4XA 4BDQA 4Q30B 4MHFA 3KJTA 1SD3A 2DVZA 4NF5A 1N76A 2DSFA 3DP6A 2NOOA 4RXLA 4NEDA 1Y4CA 3ILTB 3JZJA 2GFEA 3S2VA 4Q0CA 1NV3A 2I0CA 5I56B 2DWHA 2AL5A 3RYDA 5TPAB 1I6BA 4OVRA 2XXPA 3CVGA 4KPTA 1LB8A 3K6WA 3KBZA 2DE4A 3H6TA 2YPNA 4GX4A 3EF7A 1DCUA 1RKMA 5CBRA 2VT5A 3MJNA 3I3VA 3T96B 1FPDA 5CMCA 1FBDA 2AIXA 3AXFA 3V89B 4JVIA 4EXKA 5ET6A 4RJZA 3LBSA 2B3FA 4MH5A 4NAPA 4C1TA 4OTEA 3D4CA 1LFGA 4RNSA 5I5PA 1MXZA 1B32A 2V25A 4IGRA 4XFEA 3W9VA 3MSTA 4R6YA 1SI0A 1FBEA 3OMBA 3T22A 3FVGA 3C34A 2V93A 3THIA 3VFJA 3O97A 4JWXA 3G3HA 3O6IA 3CSBA 4N07A 4PFYA 3SEYA 1SW2A 1O63A 1FBGA 2P3NA 4O7IA 3C31A 2H5YA 4KYEA 4ZEBA 4OA4A 3K1NA 2XD3A 1LBVA 2Y7PA 4I1DA 5I3SA 1I6AA 1P1UA 3RQTA 4LUBA 2ONSA 1PB8A 2A5SA 1XT8A 1FPBA 1LCFA 4ZEFA 2XXYA 1BIYA 3K6XA 4G68A 4OVQA 1LB9A 4DLDA 3IJOB 4EQ7A 2PFYA 1J1NA 4K3FA 2DE3A 1NI9A 3CFLA 1LBBA 4LZ8A 1H43A 3ISPA 3CIJA 4QSCA 2XXQA 3N94A 4U2RA 1UTHA 2GQ1A 4ZEDA 3G3JA 4ONYA 1B7UA 5HPQA 4KQPA 3VLWA 4OEVA 3GXAA 4IR8A 1Q35A 2ABHA 1S50A 4QF9A 3W15C 1B5JA 2WKYA 4IO4A 2ZYMA 4EF2A 1LFIA 2O68A 3OOAA 2UXAA 5I59B 4H65A 2I48A 1S9TA 5AA2A 1SQYA 3VLUA 4X8RA 5H8FA 1R1NA 3MWBA 3VVEA 2PT1A 3FBPA 1UTBB 1A40A 3SETA 3IJXB 2G93A 3G3IA 3MZ1A 4YICA 3RUMA 1XI6A 2RF1A 1RYXA 1FPIA 4G61A 1FQAA 3EHSA 5CM6A 3MAMA 3TFLA 4BLAA 5CC2A 1BK4A 2XXXA 1FPLA 2QMXA 1R9LA 4HW8A 3HSTA 4NF8B 5H8QB 4KHZE 4FIMA 4PAIA 2F3DA 4F1VA 3E13X 1JVXA 3IORA 1FJ6A 1S7YA 4LP2B 1FJ9A 4WKMA 2D3IA 2CZIA 1A8FA 4KD5A 2PMSA 2UYEA 1EZOA 3MPLA 1MDP1 3MQ9A 3A3CA 4QBAA 1Q9DA 1Y1ZA 3IAZA 4RA1A 2IEEA 3MVWA 4IO5A 5EHMA 2HAUA 2DVCA 1O64A 3OSQA 4C1UA 1LBZA 4JBZA 1JEVA 4QXDA 4H8JA 1SI1A 4GWSA 3W9WA 2DWJA 1USYH 2ALUA 4PDHA 3PTYA 2RINA 5FBPA 1IMAA 3QYTA 4N6KA 3IO6A 3KOSA 4KYDA 5CBSA 2Q8MA 1GGGA 1DK4A 3QMFA 1PB9A 1IUDA 1NUYA 3H6WA 3IOUA 1FBCA 3PUWE 4DXCA 3VVDA 4U21A 4ELQA 3LSLA 2OWTA 5EYHA 5A5LA 3KJ7A 4G68C 2OWSA 3MVZA 3C33A 4ELPA 1G0HA 4EXLA 3DM0A 2VD2A 3GLBA 2DE2A 1LBWA 2DDKA 4OXVA 4WEPA 5CRYA 5I59A 2YJPA 5ICTA 1PEBA 3UIFA 1FTMA 4GLIA 2FVZA 3UORA 1NMUA 3R7XA 4NF6B 4OHNA 4Q5TA 4ELRA 3T66A 4DXUA 3C36A 2XXWA 3D4GA 3U1OA 2ZZXA 5ICQA 3K01A 4NQ8A 4EQBA 1B52A 1NL5A 4QFPA 3EN3A 1MXWA 5DVIA 3TMGA 4LQ2A 1M5EA 3QIMA 4LA9A 3BFTA 1SW4A 5DW8A 2CEYA 3V5AA 1YXIA 3F11A 5AE4A 5EYFA 4G4PA 4GOTA 1MQJA 1OMPA 4NF8A 1IITA 1LAFE 1LFHA 1D9QA 3TTRA 3ODBA 4PFTA 3CFXA 3DELB 5KCJB 1DOTA 4MF3A 1FQEA 4FECA 2DP8A 3K4UA 4LZ5A 1FTJA 4HE0A 2FHYA 1Y3QA 1B7ZA 1DBZA 2F5XA 3HN0A 1B5HA 3TODA 1NV1A 3MPKA 4AS5A 4KFQA 3QSLA 3NOHA 3E4RA 5DTBA 2HZKA 5JTYA 2XHDA 4PE5B 1CNQA 4PFUA 4O7MA 1M5BA 4HTGA 2PCRA 2P3VA 4GXSB 3TPAA 1MDQA 2Y5KA 4GQOA 2XXVA 2YLNA 1NV5A 5DVJA 1FPJA 1IIWA 1B9JA 3SKPA 2Q2AA 4F3SA 1SW5A 5ET7A 3H06B 1FQBA 3FVNA 4PP0A 1Y1MA 4F3BA 5DEXA 3PUVE 2R71A 1LAHE 3PUYE 2ONKE 3VXBA 1SYHA 3O66A 4MNPA 3OO6A 2P0SA 5H8HA 1QGXA 4BDMA 1B51A 1QKAA 3T9UA 3DLNA 3IOVA 4GBVA 4I3YA 3UP9A 5TP9A 3G3FA 3U8QA 2B3BA 5KZTA 4H46A 4NWDA 2ANJA 2R6GE 5K2XA 4LONB 2DYXA 3B8BA 1A99A 1MXYA 4M4GA 4PETA 5J1DA 1N7WA 3O6HA 3TTNA 2HXWA 2XA5A 4HXVA 4TQUQ 5L9MA 3CHGA 4HCWA 4IY5A 4PGPA 1FBHA 4MJOA 1JETA 2FYIA 4NHBA 3EQ1A 2I0BA 3PPPA 1IMEA 3M8UA 4C0RA 2G29A 2HFBA 1MH4A 4UA8A 4OYVA 3SEUA 1R9QA 3OO8A 1MQGA 1WVJA 4NF4A 4HCYA 3LSXA 1KA0A 1XC1A 1HSEA 4F2QA 3PPRA 2QPQA 3VDFA 2XXUA 3E3KA 5IGAA 1AIVA 1SVXB 1ZIUA 2F3BA 3FASA 3RPWA 1B3GA 5I58B 4HE2A 3ZKLA 4U22A 5ISUA 3OEMA 4GFRA 4PC9A 2OK2A 4P9KA 1NFTA 3TEPA 3IR1A 1ZBMA 1EYKA 4Z7EA 4R74A 2V3QA 1URGA 1XOCA 4FE8A 4PFIA 3BKIB 4P1EA 4IO6A 3FV1A 1IXCA 4OESA 1POY1 5I84A 1KZ8A 4RK9A 4OEUA 3MVXA 5BUUA 2I3VA 1Y20A 1NNKA 1LBXA 3ZSFA 1B3HA 2DXRA 1MPDA 4GBWA 4P47A 4PCDA 3SESA 3T9VA 1FQDA 1G0IA 3JV9A 4YB6A 5AA4B 4NF0A 1GVCA 1P1WA 4G8NA 3BFUA 3K2DA 4YKJA 4H6DA 2F35A 5H8SA 4O94A 4N4UA 1EU8A 1Z7ME 1YYZA 3U94A 2W7YA 3MYUA 5IAIA 3RPLB 1IXIA 2P1SA 4MNCA 3HV1A 2XWIA 2WEFA 3HPIA 3OD7A 2DXYA 3A29A 5F7VA 3N5LA 4RY1A 5AA1A 3FJMA 3RGYA 4XKQA 4P3LA 4R72A 3O9PA 1UQWA 4OWDA 2HPGA 5ESYA 4IO7A 3C9HA 1LAGE 2PX1A 2UVHA 5ITPA 3VE1B 4BDRA 3TCFA 5FHOA 5IM2A 1NUWA 4F39A 1VFEA 3EHTA 1MG1A 2O1LA 4U23A 3VXCA 4ISUA 3SERA 4YZZA 2RC8A 3LSFB 5I2KB 5I58A 4P8BA 4NN3A 2RCBA 4DCXA 3B50A 4JVCA 4QFLA 3TTMA 5K2YA 5I2NB 4ZS9A 1BLFA 4QRZA 3SEVA 4ZZAA 2QVUA 4DDDA 4I9DA 2H4IA 2OCUA 3OENA 1LCTA 3OELA 3G3GA 2HXRA 3I5OA 1B5IA 1MM6A 5KDTB 2V84A 5IZ3B 4DI4B 3IB2A 5I56A 5TPAA 4G8MA 1NNFA 2FA7A 1VDWA 5ITOA 1MM7A 2V4CA 4P0IA 4JSOA 1OLAA 3CG3A 3DP8A 3K6VA 2X7QA 1FPKA 1D4NA 1DMBA 3Q27A 1I6QA 4H5FA 1JNFA 2HZLA 1BTJA 3OXNA 1SYIA 3TDJA 4NG7A 2RC7A 2OLBA 1DTGA 3KN8A 1DPPA 1B1HA 4BDOA 4ESXA 5AA4A 1EYIA 4IY6A 4Q8RA 5EYGA 4GIZA 3PMVA 1XVXA 3PD8A 4JWOA 3RNNA 4F1YA 4QHQA 3EKIA 3FJGA 2OWZA 5A5XB 5ET5A 4N81A 2QFLA 3TAJA 1B6HA 2O7IA 3KC1A 1K9ZA 2PT2A 4YU0A 3RTFB 1JW4A 4ZE9A 2WYPA 4R6KA 3HHFA 3FXUA 3EPEA 3IX1A 1OIBA 3LUZA 3IFCA 3SEXA 3OO7A 3PV0E 4P1LA 1O7TA 1WODA 4DE8A 4MCOA 4H5GA 4GX3A 2E1SA 2VHAA 1EYJA 5EHSA 4H0WA 3C35A 1AH5A 1XS5A 1YPNA 5L9SA 1SW1A 1US4A 5F1QA 4F3PA 4I40A 1NNTA 2ZZWA 1URDA 2PFZA 4R6HA 3TCGA 3T9XB 5DT6A 5ELVA 4MNIA 4OANA 1K9YA 1OQHA 2XWKA 1B58A 2H9BA 1ZKBA 5I57B 4THIA 3K0VA 1US5A 4N8YA 1INPA 4ELOA 2B4MA 4PF8A 3N6UA 3OO9A 1IMDA 1NV7A 1PC3A 5HM4B 3USDA 5KDTA 1P1NA 1MXUA 1TWYA 3CR9A 3FGSA 4M1VA 2Y7KA 3K02A 4DXBA 3N26A 1VE4A
chains in the Genus database with same CATH topology
4MNPA 4GX6A 4OVRA 3KBZA 3E79A 2DE4A 1QGXA 4GX4A 1DCUA 3SZPA 2BJIA 4XEQA 4GBVA 2VT5A 4I3YA 1FPDA 3GYYA 1FBDA 2ZZVA 4H46A 4JVIA 2OX3A 1RDZA 2L5VA 3B8BA 5ET6A 5EQ7A 4NAPA 5LTCA 4PETA 5J1DA 2WX9A 5I5PA 2Q9TA 2WBDA 2XA5A 4HXVA 3RPLA 1SPIA 4N17A 3CHGA 4HCWA 5T3JA 4XFEA 4PGPA 1FBHA 1IMFA 4MJOA 4NHBA 3W9VA 3MSTA 1FPEA 1FBEA 1IMEA 3FXBA 4HE1A 1IMCA 1FBGA 4HCYA 2P3NA 4O7IA 4OA4A 1KA0A 1LBVA 4GWYA 2VPOA 5EQ9A 5I3SA 3HFUA 4MAGA 3KC0A 3U65A 2R8TA 2QPQA 4MX6A 1NUZA 4PAFA 5IGAA 4NX1A 1FPBA 2F3BA 1LEVA 4OVQA 4JVDA 2PFYA 4HE2A 2XWOA 4PC9A 4P9KA 2DE3A 5LDZA 1NI9A 3ISPA 1EYKA 2V3QA 1JP4A 4PFIA 5IZZA 1FRPA 5EQAA 4P1EA 2GQ1A 4OVPA 5IZ3A 4IR8A 2MKZA 1KZ8A 2WYKA 4P56A 1YZ0A 1LBXA 4UABA 4GBWA 4P47A 4PCDA 4GWWA 4FBPA 2XXKA 3ROJA 4X8RA 4F18A 1FTAA 1G0IA 3FBPA 2CZKA 4NF0A 4GWUA 1LBYA 1NV0A 4YICA 4MIJA 1XI6A 2B4LA 2WBBA 1FSAA 3IFAA 4O94A 4N4UA 1FPIA 4G61A 4PFRA 1YYZA 5CM6A 3MYUA 1BK4A 3RPLB 1FPLA 4MNCA 2XWIA 2WEFA 3T1BA 4PGNA 4PAIA 3A29A 2F3DA 4F1VA 4PBHA 1FJ6A 1FJ9A 1FPGA 4H45A 4NGUA 4OVTA 4P3LA 2CZIA 1NUXA 4DI3D 2HPGA 5ESYA 3LV0A 4PTKA 4QBAA 1Q9DA 1AWBA 2JJKA 2QVVA 5IM2A 1NUWA 2HHMA 4PE3A 4YZZA 1LBZA 4N6DA 4QXDA 4P8BA 4NN3A 3B50A 3D1RA 3E78A 4JVCA 4GWSA 3W9WA 1RDXA 4PDHA 4PF6A 2Q74A 3PTYA 5EQ8A 5FBPA 1IMAA 4N6KA 2VPNA 4MEVA 2QVUA 2Q8MA 1DK4A 3QMFA 4GWXA 2HXRA 4N8GA 1NUYA 4OVSA 2CZHA 5IZ3B 2XWVA 2KQZA 4PBQA 1FBCA 4DI4B 5I7IA 2KR0A 5EYHA 5ET8A 4AS4A 5A5LA 1VDWA 1G0HA 4MMPA 2V4CA 2DE2A 1LBWA 2DDKA 1FPKA 4X04A 2HZLA 5F24A 3BIGA 2FIEA 2FVZA 4NG7A 4X9TA 4GWZA 1EYIA 5EYGA 4I3EA 1FBFA 2ZZXA 4NQ8A 1FBPA 1FPFA 4N91A 3EKIA 1NV2A 2OWZA 2Y5LA 5ET5A 4N81A 2QFLA 5DW8A 2CEYA 1YXIA 3KC1A 1K9ZA 4PFBA 2CEXA 3BIHA 2WYPA 4KXPA 4PDDA 1D9QA 3LUZA 3IFCA 4P1LA 3T0JA 5J16A 2FBPA 4MCOA 4N15A 4XF5A 4GX3A 2FIXA 1EYJA 4HE0A 2FHYA 5JK4A 1DBZA 2F5XA 1IMBA 1NV1A 4AS5A 5IZ1A 3NOHA 4I40A 4F19A 2ZZWA 1RDYA 2HZKA 2PFZA 4F1UA 4LN5A 4MNIA 1CNQA 1K9YA 4OANA 2XWKA 4O7MA 1KA1A 2PCRA 2P3VA 2Y5KA 4PAKA 4N8YA 1INPA 1NV6A 1NV5A 1FPJA 2B4MA 4MHFA 4PF8A 2DVZA 1IMDA 1NV4A 1NV7A 5ET7A 4M1VA 1NV3A 4O8MA 2QVRA 3RYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MNP A;  4OVR A;  4N91 A;  4PFI A;  5IZZ A;  4P1E A;  2CEY A;  5IM2 A;  4OVP A;  4XEQ A;  4PFB A;  2CEX A;  4PE3 A;  4YZZ A;  2WYP A;  3GYY A;  2ZZV A;  4N6D A;  4PDD A;  2WYK A;  4P8B A;  4NN3 A;  3B50 A;  4P1L A;  4P56 A;  4NAP A;  4PF6 A;  4PDH A;  4MCO A;  4N15 A;  4N6K A;  5LTC A;  4UAB A;  4PET A;  2VPN A;  4XF5 A;  4MEV A;  2WX9 A;  5I5P A;  2XA5 A;  4P47 A;  4N17 A;  4XFE A;  4PGP A;  4PCD A;  4NHB A;  2XXK A;  4X8R A;  4N8G A;  4OVS A;  2XWV A;  2ZZW A;  4PBQ A;  2HZK A;  4DI4 B;  2PFZ A;  3FXB A;  4NF0 A;  4LN5 A;  5I7I A;  4MNI A;  4OAN A;  4YIC A;  4MIJ A;  2XWK A;  4O7M A;  4O94 A;  4N4U A;  4MMP A;  4PAK A;  4PFR A;  4OA4 A;  2V4C A;  4N8Y A;  2VPO A;  5CM6 A;  4MAG A;  4MHF A;  4PF8 A;  4X04 A;  3U65 A;  4MX6 A;  2HZL A;  4MNC A;  2XWI A;  4PAF A;  5IGA A;  4NG7 A;  4NX1 A;  4PGN A;  4PAI A;  4OVQ A;  4PBH A;  2PFY A;  2XWO A;  4O8M A;  4NGU A;  4PC9 A;  4P9K A;  4OVT A;  2ZZX A;  4P3L A;  4NQ8 A;  4DI3 D;  2HPG A; 
#chains in the Genus database with same CATH topology
 4GX6 A;  3GZG A;  2QRY A;  1LLS A;  3E79 A;  3O29 A;  4E0X A;  1Q1K A;  1JW5 A;  4OFO A;  1UTB A;  4RK2 A;  3Q28 A;  2M8C A;  2LAO A;  2VGQ A;  1QW0 A;  2ZZV A;  1TFD A;  2UVG A;  4R75 A;  1PBP A;  1B46 A;  4N6P A;  2L5V A;  5EQ7 A;  3KBR A;  1MPB A;  1ZU0 A;  5LTC A;  2NUV A;  2XXI A;  2ZMB A;  2O69 A;  2WBD A;  3MP6 A;  3K1M A;  5T3J A;  3PUX E;  4H67 A;  3GBB A;  3KGC A;  5H8Q A;  3MW0 A;  5H8N B;  2O7U A;  3MZB A;  4R9F A;  1Y9U A;  2ZNS A;  1D9V A;  1B0H A;  1MY4 A;  3PU5 A;  4OET A;  4H1X A;  4HE1 A;  1BKA A;  4YB5 A;  4RPO A;  4ZZE A;  3M3L A;  4RYA A;  4BDN A;  3HFU A;  1EH3 A;  4MAG A;  2KLF A;  1OLC A;  2R8T A;  3KN7 A;  5FTH A;  1NUZ A;  4PAF A;  2D21 A;  1D9Y A;  4NX1 A;  4F3G A;  2Q89 A;  1LEV A;  1TT1 A;  5DVF A;  5CMM A;  2XD2 A;  3T9H B;  2GHB A;  4O3C A;  2R9J A;  1AOV A;  3B6W A;  3FZV A;  5IZZ A;  1FRP A;  4QFO A;  1XVY A;  3H7M A;  2PYY A;  1FW0 A;  4OFJ A;  4OVP A;  4NE4 A;  1II5 A;  3Q29 A;  4NF5 B;  2NVU B;  2X26 A;  3LSW A;  3H6V A;  3FV2 A;  5FHN A;  2WYK A;  4F29 A;  1A7L A;  4X1D A;  1IZ1 A;  3PPO A;  1IXH A;  1OVB A;  4UAB A;  4JB7 A;  1B3L A;  1URS A;  2FNC A;  5M2V A;  2Y7R A;  4WED A;  3O28 A;  2Z23 A;  4NF6 A;  5FTI A;  3ROJ A;  3TKD A;  1HSJ A;  1EZP A;  4F18 A;  4GRK A;  3MBP A;  2A5T B;  4GWU A;  4FJP A;  4MIJ A;  1MY2 A;  2DS9 A;  2B4L A;  2WBB A;  1NH8 A;  2XX8 A;  1FSA A;  2H99 A;  3IFA A;  2I6E A;  4XKN A;  1I69 A;  3FVK A;  4PFR A;  2QMW A;  4N13 A;  3ONM A;  3R26 A;  3LUY A;  2QL3 A;  3MC2 A;  4O3A A;  2OZZ A;  5H8N A;  1USY E;  3T1B A;  4GWO A;  1ZLQ A;  3SDF A;  5KCJ A;  1DPE A;  2VD3 A;  3TYH A;  4DCY A;  1FQC A;  3KSX A;  4NGU A;  4OVT A;  1EZ9 A;  1MQD A;  3TCH A;  5B70 A;  3HO7 A;  4R2B A;  3L6H A;  4XKP A;  2DWA A;  3LV0 A;  2CMO A;  2UYF A;  1SBP A;  1H76 A;  1GTK A;  4F2O A;  3PUZ E;  3S9L C;  1LST A;  2JJK A;  4ZEC A;  2QVV A;  2HHM A;  2Y7I A;  4KCC A;  4YMB A;  4L17 A;  1MPC A;  4G77 A;  3KFM A;  1FQF A;  3PD9 A;  4N6D A;  3HCQ A;  4G68 B;  1ZMG A;  2REG A;  4LQ5 A;  3D1R A;  3E78 A;  1POT A;  1QUL A;  3LC8 A;  1RDX A;  4TOZ A;  1QJM A;  4FOR A;  2VPN A;  3IK6 B;  2XXH A;  4NMY A;  4GF8 A;  4PFW A;  2BJJ X;  2ZNT A;  3PGF A;  3BBR A;  4GWX A;  1FTL A;  2XX9 A;  4DZ1 A;  3MP8 A;  2QS3 A;  1T0K A;  3HHG A;  3CSG A;  3FUZ A;  2KQZ A;  4PBQ A;  4IGT A;  2KR0 A;  5ET8 A;  1ZJL A;  4AS4 A;  3QK6 A;  2F78 A;  4P11 A;  1VFD A;  2E0S A;  1D3K A;  5L8D A;  4R9G A;  3I6V A;  3N6T A;  1PDA A;  4BDL A;  3LR1 A;  5AA2 B;  2FIE A;  1YCJ A;  4GWZ A;  2O84 X;  4MFI A;  5H8F B;  5LOM A;  4HS7 A;  4YMA A;  1GR2 A;  1MY3 A;  1MY0 A;  2A5T A;  2QJE A;  4I3E A;  1FBF A;  3A3U A;  3RLF E;  2F7A A;  4MLQ A;  4LZ7 A;  4PFB A;  4I62 A;  2H98 A;  2DQV A;  1IEJ A;  2F8D A;  4PDD A;  1B05 A;  1YTV A;  2VP1 A;  1H3D A;  5DYH A;  2FBP A;  4NTL A;  4XF5 A;  3P7I A;  3PPQ A;  1RYO A;  3TTK A;  2Z22 A;  2REJ A;  3Q25 A;  3O6G A;  3IOW A;  5IZ1 A;  2V3T A;  1JW1 A;  3V8X B;  4F19 A;  3C4M A;  4IB2 A;  1RDY A;  2D5W A;  4XKR A;  4U1O A;  4ESW A;  4ZEK A;  2I58 A;  4E0W A;  4LN5 A;  4NWC A;  3RT8 A;  3IO4 A;  4X48 A;  3M3K A;  1A55 A;  2GH9 A;  1KA1 A;  4KR5 A;  4PAK A;  1L5T A;  1NV6 A;  2V3U A;  3C32 A;  3ECR A;  5L9O A;  1LAX A;  4P0G A;  1NV4 A;  1B0L A;  2F6P A;  2F34 A;  1IXG A;  3K00 A;  2AL4 A;  4PQJ A;  1BP5 A;  3MZ9 A;  2HEU A;  1HSL A;  5B7D A;  3JYR A;  3B6Q A;  4DIG A;  1AMF A;  3CI8 A;  4O8M A;  2QVR A;  2XXT A;  4H8I A;  4IO2 A;  1MRP A;  5BWJ A;  3OEK A;  2ZYN A;  2UVJ A;  3MUQ A;  5FHM A;  1P1Q A;  4F31 B;  4EDP A;  1UIV A;  3H6U A;  4OER A;  3SZP A;  2H25 A;  2BJI A;  4XEQ A;  2Q2C A;  3K6U A;  2OJT A;  3KEI A;  4X1B A;  2PVU A;  4MLV A;  3GYY A;  4I8C A;  1ATG A;  4QSD A;  2QS4 A;  1PB7 A;  3T93 B;  4OQO A;  2OX3 A;  1RDZ A;  1LGB C;  3U72 A;  4G8H A;  3KOT A;  2I3W A;  2RCA A;  1A54 A;  1CE2 A;  3PPN A;  2WX9 A;  2Q9T A;  3RPL A;  1SPI A;  2I4B A;  1B40 A;  4N17 A;  3VV5 A;  5AA3 A;  1IMF A;  3V83 A;  1B3E A;  2RC9 A;  1FPE A;  4JDF A;  3ILU B;  4U4S A;  1Y3N A;  3FXB A;  1VSO A;  4MBP A;  1B4H A;  1IMC A;  2ZNU A;  4G2Z A;  3MVY A;  3IL1 B;  3IOT A;  3CFZ A;  2F7C A;  4KYS A;  3QUF A;  2Z8D A;  4GWY A;  2VPO A;  5EQ9 A;  1MXV A;  3ZKK A;  2QS1 A;  2GRV A;  3KC0 A;  3U65 A;  4MX6 A;  4AQ4 A;  4LVQ A;  3OSR A;  1N7X A;  2Z8E A;  5I2K A;  3KSJ A;  1IQ7 A;  3G7W A;  4JVD A;  5I2N A;  1FCK A;  2QSX A;  2Z8F A;  4ZEI A;  2ZXT A;  3U92 A;  2XWO A;  3S9N C;  5JTY B;  3TUS A;  2DOJ A;  5IKB A;  5LDZ A;  1A8E A;  2Y84 A;  5CMB A;  3TEL A;  3H03 A;  1JP4 A;  3Q26 A;  4KI0 E;  5EQA A;  3G3K A;  4POW A;  1MS7 A;  2F7B A;  1QUJ A;  3TQL A;  5IZ3 A;  4TLL B;  4GD5 A;  4XIG Q;  1AL3 A;  4OEN A;  2MKZ A;  4AB5 A;  3RY3 A;  4FAJ A;  1NH7 A;  3FJ7 A;  5DEX B;  5TU0 A;  4P56 A;  2O6A A;  4F22 A;  1YZ0 A;  4U1Z A;  2O1M A;  1JVY A;  4R2F A;  2XXR A;  4YKP A;  1FTK A;  3GBA A;  5H8H B;  4GWW A;  1MH3 A;  3MP1 A;  4FBP A;  2XXK A;  2IA4 A;  4JXI A;  4EUO A;  5JEI A;  4EQ9 A;  2I4C A;  3QAX A;  4YB7 A;  1FTA A;  1ELJ A;  4YKK A;  4QSE A;  1KWH A;  1R6Z A;  2CZK A;  5TP9 B;  2GHA A;  1N0T A;  1LBY A;  4OVJ A;  1QKB A;  1NV0 A;  3KZG A;  3FIR A;  4ECF A;  1H44 A;  3H4Z A;  3UK4 A;  1M5D A;  5A5X A;  2ZYO A;  3RTW B;  2UVI A;  5AA2 D;  2X7P A;  3PMW A;  1JQF A;  3IB1 A;  2HCA A;  1OQG A;  4PGN A;  4ZDM A;  4GL0 A;  4PBH A;  2THI A;  1FTO A;  4LAT A;  1TFA A;  3RN8 A;  1XHY A;  1FPG A;  3FVO A;  3L6G A;  4H45 A;  1N3X A;  1WDN A;  4GVO A;  1ZTY A;  3EHU A;  1NUX A;  1M5F A;  4DI3 D;  3TQW A;  1Z7N E;  4PTK A;  4NF4 B;  4R73 A;  3SEW A;  3TTL A;  3RT6 B;  1B2H A;  4GXA A;  1AWB A;  2VOZ A;  4UAC A;  2XX7 A;  4YKI A;  4YAH X;  4AB6 A;  3FXQ A;  2CZL A;  3UGW A;  4Z0I A;  4PE3 A;  2HAV A;  2HQ0 A;  4O3B A;  3O2A A;  3VVF A;  3S4U A;  2F36 A;  4OFL A;  4IO3 A;  5I57 A;  4QFN A;  3UA8 A;  1SDX A;  4PF6 A;  2Q74 A;  5EQ8 A;  1GV8 A;  1UIU A;  4RPN A;  4MEV A;  2Q88 A;  4N8G A;  1QUI A;  3VLV A;  3WAF A;  4OVS A;  2CZH A;  2XWV A;  4KCD A;  4POX A;  5CI5 A;  5I7I A;  1F9B A;  2I49 A;  1B7H A;  1PBQ A;  3S9M C;  3KN3 A;  4MMP A;  4OZ9 A;  1MXX A;  3TZA A;  4EF1 A;  1JEU A;  3B6T A;  1DSN A;  3S9E A;  4X04 A;  1N04 A;  3U93 A;  4FED A;  1OVT A;  5F24 A;  3BIG A;  1MQH A;  4X9T A;  2F6G A;  4QFK A;  2OBG A;  4OMB A;  5CMK A;  4FAT A;  2Q8J A;  1VR5 A;  1Y3P A;  2B65 A;  3WAE A;  2Y7W A;  2AYS A;  1FBP A;  1FPF A;  4N91 A;  2F97 A;  3ZS6 A;  1NV2 A;  2Y5L A;  4FEB A;  2ZYK A;  3M3F A;  2ESN A;  1N84 A;  3KG2 A;  4XXU A;  1YAE A;  3DP4 A;  4ND9 A;  3FXR A;  3H3G A;  3FD3 A;  4JSD A;  2CEX A;  4GL8 A;  3A09 A;  4JWY A;  3BIH A;  1CB6 A;  3B7D A;  4KXP A;  1N3W A;  3CRB A;  3PMX A;  1M5C A;  3UN6 A;  2ONR A;  1NNP A;  2DWI A;  4XTC Q;  3T0J A;  5J16 A;  3FAT A;  2O51 A;  4N15 A;  1DTZ A;  2FIX A;  1P1O A;  1QVS A;  5JK4 A;  2PBW A;  1MQI A;  2NXO A;  3IB0 A;  2RKM A;  1IMB A;  3K1P A;  3R6U A;  4ZE8 A;  3QUJ A;  4WXJ A;  1Y4T A;  1B3F A;  3QXM A;  1B4Z A;  2QS2 A;  1LBC A;  3E9X A;  4F1U A;  1B1X A;  1P99 A;  2NWJ A;  3CG1 A;  1MY1 A;  4TLM B;  1QUK A;  1H45 A;  1ANF A;  1NKX A;  2P2A A;  1TXF A;  1UTH B;  5HBC A;  4U4X A;  4BDQ A;  4Q30 B;  4MHF A;  3KJT A;  1SD3 A;  2DVZ A;  4NF5 A;  1N76 A;  2DSF A;  3DP6 A;  2NOO A;  4RXL A;  4NED A;  1Y4C A;  3ILT B;  3JZJ A;  2GFE A;  3S2V A;  4Q0C A;  1NV3 A;  2I0C A;  5I56 B;  2DWH A;  2AL5 A;  3RYD A;  5TPA B;  1I6B A;  4OVR A;  2XXP A;  3CVG A;  4KPT A;  1LB8 A;  3K6W A;  3KBZ A;  2DE4 A;  3H6T A;  2YPN A;  4GX4 A;  3EF7 A;  1DCU A;  1RKM A;  5CBR A;  2VT5 A;  3MJN A;  3I3V A;  3T96 B;  1FPD A;  5CMC A;  1FBD A;  2AIX A;  3AXF A;  3V89 B;  4JVI A;  4EXK A;  5ET6 A;  4RJZ A;  3LBS A;  2B3F A;  4MH5 A;  4NAP A;  4C1T A;  4OTE A;  3D4C A;  1LFG A;  4RNS A;  5I5P A;  1MXZ A;  1B32 A;  2V25 A;  4IGR A;  4XFE A;  3W9V A;  3MST A;  4R6Y A;  1SI0 A;  1FBE A;  3OMB A;  3T22 A;  3FVG A;  3C34 A;  2V93 A;  3THI A;  3VFJ A;  3O97 A;  4JWX A;  3G3H A;  3O6I A;  3CSB A;  4N07 A;  4PFY A;  3SEY A;  1SW2 A;  1O63 A;  1FBG A;  2P3N A;  4O7I A;  3C31 A;  2H5Y A;  4KYE A;  4ZEB A;  4OA4 A;  3K1N A;  2XD3 A;  1LBV A;  2Y7P A;  4I1D A;  5I3S A;  1I6A A;  1P1U A;  3RQT A;  4LUB A;  2ONS A;  1PB8 A;  2A5S A;  1XT8 A;  1FPB A;  1LCF A;  4ZEF A;  2XXY A;  1BIY A;  3K6X A;  4G68 A;  4OVQ A;  1LB9 A;  4DLD A;  3IJO B;  4EQ7 A;  2PFY A;  1J1N A;  4K3F A;  2DE3 A;  1NI9 A;  3CFL A;  1LBB A;  4LZ8 A;  1H43 A;  3ISP A;  3CIJ A;  4QSC A;  2XXQ A;  3N94 A;  4U2R A;  1UTH A;  2GQ1 A;  4ZED A;  3G3J A;  4ONY A;  1B7U A;  5HPQ A;  4KQP A;  3VLW A;  4OEV A;  3GXA A;  4IR8 A;  1Q35 A;  2ABH A;  1S50 A;  4QF9 A;  3W15 C;  1B5J A;  2WKY A;  4IO4 A;  2ZYM A;  4EF2 A;  1LFI A;  2O68 A;  3OOA A;  2UXA A;  5I59 B;  4H65 A;  2I48 A;  1S9T A;  5AA2 A;  1SQY A;  3VLU A;  4X8R A;  5H8F A;  1R1N A;  3MWB A;  3VVE A;  2PT1 A;  3FBP A;  1UTB B;  1A40 A;  3SET A;  3IJX B;  2G93 A;  3G3I A;  3MZ1 A;  4YIC A;  3RUM A;  1XI6 A;  2RF1 A;  1RYX A;  1FPI A;  4G61 A;  1FQA A;  3EHS A;  5CM6 A;  3MAM A;  3TFL A;  4BLA A;  5CC2 A;  1BK4 A;  2XXX A;  1FPL A;  2QMX A;  1R9L A;  4HW8 A;  3HST A;  4NF8 B;  5H8Q B;  4KHZ E;  4FIM A;  4PAI A;  2F3D A;  4F1V A;  3E13 X;  1JVX A;  3IOR A;  1FJ6 A;  1S7Y A;  4LP2 B;  1FJ9 A;  4WKM A;  2D3I A;  2CZI A;  1A8F A;  4KD5 A;  2PMS A;  2UYE A;  1EZO A;  3MPL A;  1MDP 1;  3MQ9 A;  3A3C A;  4QBA A;  1Q9D A;  1Y1Z A;  3IAZ A;  4RA1 A;  2IEE A;  3MVW A;  4IO5 A;  5EHM A;  2HAU A;  2DVC A;  1O64 A;  3OSQ A;  4C1U A;  1LBZ A;  4JBZ A;  1JEV A;  4QXD A;  4H8J A;  1SI1 A;  4GWS A;  3W9W A;  2DWJ A;  1USY H;  2ALU A;  4PDH A;  3PTY A;  2RIN A;  5FBP A;  1IMA A;  3QYT A;  4N6K A;  3IO6 A;  3KOS A;  4KYD A;  5CBS A;  2Q8M A;  1GGG A;  1DK4 A;  3QMF A;  1PB9 A;  1IUD A;  1NUY A;  3H6W A;  3IOU A;  1FBC A;  3PUW E;  4DXC A;  3VVD A;  4U21 A;  4ELQ A;  3LSL A;  2OWT A;  5EYH A;  5A5L A;  3KJ7 A;  4G68 C;  2OWS A;  3MVZ A;  3C33 A;  4ELP A;  1G0H A;  4EXL A;  3DM0 A;  2VD2 A;  3GLB A;  2DE2 A;  1LBW A;  2DDK A;  4OXV A;  4WEP A;  5CRY A;  5I59 A;  2YJP A;  5ICT A;  1PEB A;  3UIF A;  1FTM A;  4GLI A;  2FVZ A;  3UOR A;  1NMU A;  3R7X A;  4NF6 B;  4OHN A;  4Q5T A;  4ELR A;  3T66 A;  4DXU A;  3C36 A;  2XXW A;  3D4G A;  3U1O A;  2ZZX A;  5ICQ A;  3K01 A;  4NQ8 A;  4EQB A;  1B52 A;  1NL5 A;  4QFP A;  3EN3 A;  1MXW A;  5DVI A;  3TMG A;  4LQ2 A;  1M5E A;  3QIM A;  4LA9 A;  3BFT A;  1SW4 A;  5DW8 A;  2CEY A;  3V5A A;  1YXI A;  3F11 A;  5AE4 A;  5EYF A;  4G4P A;  4GOT A;  1MQJ A;  1OMP A;  4NF8 A;  1IIT A;  1LAF E;  1LFH A;  1D9Q A;  3TTR A;  3ODB A;  4PFT A;  3CFX A;  3DEL B;  5KCJ B;  1DOT A;  4MF3 A;  1FQE A;  4FEC A;  2DP8 A;  3K4U A;  4LZ5 A;  1FTJ A;  4HE0 A;  2FHY A;  1Y3Q A;  1B7Z A;  1DBZ A;  2F5X A;  3HN0 A;  1B5H A;  3TOD A;  1NV1 A;  3MPK A;  4AS5 A;  4KFQ A;  3QSL A;  3NOH A;  3E4R A;  5DTB A;  2HZK A;  5JTY A;  2XHD A;  4PE5 B;  1CNQ A;  4PFU A;  4O7M A;  1M5B A;  4HTG A;  2PCR A;  2P3V A;  4GXS B;  3TPA A;  1MDQ A;  2Y5K A;  4GQO A;  2XXV A;  2YLN A;  1NV5 A;  5DVJ A;  1FPJ A;  1IIW A;  1B9J A;  3SKP A;  2Q2A A;  4F3S A;  1SW5 A;  5ET7 A;  3H06 B;  1FQB A;  3FVN A;  4PP0 A;  1Y1M A;  4F3B A;  5DEX A;  3PUV E;  2R71 A;  1LAH E;  3PUY E;  2ONK E;  3VXB A;  1SYH A;  3O66 A;  4MNP A;  3OO6 A;  2P0S A;  5H8H A;  1QGX A;  4BDM A;  1B51 A;  1QKA A;  3T9U A;  3DLN A;  3IOV A;  4GBV A;  4I3Y A;  3UP9 A;  5TP9 A;  3G3F A;  3U8Q A;  2B3B A;  5KZT A;  4H46 A;  4NWD A;  2ANJ A;  2R6G E;  5K2X A;  4LON B;  2DYX A;  3B8B A;  1A99 A;  1MXY A;  4M4G A;  4PET A;  5J1D A;  1N7W A;  3O6H A;  3TTN A;  2HXW A;  2XA5 A;  4HXV A;  4TQU Q;  5L9M A;  3CHG A;  4HCW A;  4IY5 A;  4PGP A;  1FBH A;  4MJO A;  1JET A;  2FYI A;  4NHB A;  3EQ1 A;  2I0B A;  3PPP A;  1IME A;  3M8U A;  4C0R A;  2G29 A;  2HFB A;  1MH4 A;  4UA8 A;  4OYV A;  3SEU A;  1R9Q A;  3OO8 A;  1MQG A;  1WVJ A;  4NF4 A;  4HCY A;  3LSX A;  1KA0 A;  1XC1 A;  1HSE A;  4F2Q A;  3PPR A;  2QPQ A;  3VDF A;  2XXU A;  3E3K A;  5IGA A;  1AIV A;  1SVX B;  1ZIU A;  2F3B A;  3FAS A;  3RPW A;  1B3G A;  5I58 B;  4HE2 A;  3ZKL A;  4U22 A;  5ISU A;  3OEM A;  4GFR A;  4PC9 A;  2OK2 A;  4P9K A;  1NFT A;  3TEP A;  3IR1 A;  1ZBM A;  1EYK A;  4Z7E A;  4R74 A;  2V3Q A;  1URG A;  1XOC A;  4FE8 A;  4PFI A;  3BKI B;  4P1E A;  4IO6 A;  3FV1 A;  1IXC A;  4OES A;  1POY 1;  5I84 A;  1KZ8 A;  4RK9 A;  4OEU A;  3MVX A;  5BUU A;  2I3V A;  1Y20 A;  1NNK A;  1LBX A;  3ZSF A;  1B3H A;  2DXR A;  1MPD A;  4GBW A;  4P47 A;  4PCD A;  3SES A;  3T9V A;  1FQD A;  1G0I A;  3JV9 A;  4YB6 A;  5AA4 B;  4NF0 A;  1GVC A;  1P1W A;  4G8N A;  3BFU A;  3K2D A;  4YKJ A;  4H6D A;  2F35 A;  5H8S A;  4O94 A;  4N4U A;  1EU8 A;  1Z7M E;  1YYZ A;  3U94 A;  2W7Y A;  3MYU A;  5IAI A;  3RPL B;  1IXI A;  2P1S A;  4MNC A;  3HV1 A;  2XWI A;  2WEF A;  3HPI A;  3OD7 A;  2DXY A;  3A29 A;  5F7V A;  3N5L A;  4RY1 A;  5AA1 A;  3FJM A;  3RGY A;  4XKQ A;  4P3L A;  4R72 A;  3O9P A;  1UQW A;  4OWD A;  2HPG A;  5ESY A;  4IO7 A;  3C9H A;  1LAG E;  2PX1 A;  2UVH A;  5ITP A;  3VE1 B;  4BDR A;  3TCF A;  5FHO A;  5IM2 A;  1NUW A;  4F39 A;  1VFE A;  3EHT A;  1MG1 A;  2O1L A;  4U23 A;  3VXC A;  4ISU A;  3SER A;  4YZZ A;  2RC8 A;  3LSF B;  5I2K B;  5I58 A;  4P8B A;  4NN3 A;  2RCB A;  4DCX A;  3B50 A;  4JVC A;  4QFL A;  3TTM A;  5K2Y A;  5I2N B;  4ZS9 A;  1BLF A;  4QRZ A;  3SEV A;  4ZZA A;  2QVU A;  4DDD A;  4I9D A;  2H4I A;  2OCU A;  3OEN A;  1LCT A;  3OEL A;  3G3G A;  2HXR A;  3I5O A;  1B5I A;  1MM6 A;  5KDT B;  2V84 A;  5IZ3 B;  4DI4 B;  3IB2 A;  5I56 A;  5TPA A;  4G8M A;  1NNF A;  2FA7 A;  1VDW A;  5ITO A;  1MM7 A;  2V4C A;  4P0I A;  4JSO A;  1OLA A;  3CG3 A;  3DP8 A;  3K6V A;  2X7Q A;  1FPK A;  1D4N A;  1DMB A;  3Q27 A;  1I6Q A;  4H5F A;  1JNF A;  2HZL A;  1BTJ A;  3OXN A;  1SYI A;  3TDJ A;  4NG7 A;  2RC7 A;  2OLB A;  1DTG A;  3KN8 A;  1DPP A;  1B1H A;  4BDO A;  4ESX A;  5AA4 A;  1EYI A;  4IY6 A;  4Q8R A;  5EYG A;  4GIZ A;  3PMV A;  1XVX A;  3PD8 A;  4JWO A;  3RNN A;  4F1Y A;  4QHQ A;  3EKI A;  3FJG A;  2OWZ A;  5A5X B;  5ET5 A;  4N81 A;  2QFL A;  3TAJ A;  1B6H A;  2O7I A;  3KC1 A;  1K9Z A;  2PT2 A;  4YU0 A;  3RTF B;  1JW4 A;  4ZE9 A;  2WYP A;  4R6K A;  3HHF A;  3FXU A;  3EPE A;  3IX1 A;  1OIB A;  3LUZ A;  3IFC A;  3SEX A;  3OO7 A;  3PV0 E;  4P1L A;  1O7T A;  1WOD A;  4DE8 A;  4MCO A;  4H5G A;  4GX3 A;  2E1S A;  2VHA A;  1EYJ A;  5EHS A;  4H0W A;  3C35 A;  1AH5 A;  1XS5 A;  1YPN A;  5L9S A;  1SW1 A;  1US4 A;  5F1Q A;  4F3P A;  4I40 A;  1NNT A;  2ZZW A;  1URD A;  2PFZ A;  4R6H A;  3TCG A;  3T9X B;  5DT6 A;  5ELV A;  4MNI A;  4OAN A;  1K9Y A;  1OQH A;  2XWK A;  1B58 A;  2H9B A;  1ZKB A;  5I57 B;  4THI A;  3K0V A;  1US5 A;  4N8Y A;  1INP A;  4ELO A;  2B4M A;  4PF8 A;  3N6U A;  3OO9 A;  1IMD A;  1NV7 A;  1PC3 A;  5HM4 B;  3USD A;  5KDT A;  1P1N A;  1MXU A;  1TWY A;  3CR9 A;  3FGS A;  4M1V A;  2Y7K A;  3K02 A;  4DXB A;  3N26 A;  1VE4 A; 
#chains in the Genus database with same CATH homology
 4MNP A;  4GX6 A;  4OVR A;  3KBZ A;  3E79 A;  2DE4 A;  1QGX A;  4GX4 A;  1DCU A;  3SZP A;  2BJI A;  4XEQ A;  4GBV A;  2VT5 A;  4I3Y A;  1FPD A;  3GYY A;  1FBD A;  2ZZV A;  4H46 A;  4JVI A;  2OX3 A;  1RDZ A;  2L5V A;  3B8B A;  5ET6 A;  5EQ7 A;  4NAP A;  5LTC A;  4PET A;  5J1D A;  2WX9 A;  5I5P A;  2Q9T A;  2WBD A;  2XA5 A;  4HXV A;  3RPL A;  1SPI A;  4N17 A;  3CHG A;  4HCW A;  5T3J A;  4XFE A;  4PGP A;  1FBH A;  1IMF A;  4MJO A;  4NHB A;  3W9V A;  3MST A;  1FPE A;  1FBE A;  1IME A;  3FXB A;  4HE1 A;  1IMC A;  1FBG A;  4HCY A;  2P3N A;  4O7I A;  4OA4 A;  1KA0 A;  1LBV A;  4GWY A;  2VPO A;  5EQ9 A;  5I3S A;  3HFU A;  4MAG A;  3KC0 A;  3U65 A;  2R8T A;  2QPQ A;  4MX6 A;  1NUZ A;  4PAF A;  5IGA A;  4NX1 A;  1FPB A;  2F3B A;  1LEV A;  4OVQ A;  4JVD A;  2PFY A;  4HE2 A;  2XWO A;  4PC9 A;  4P9K A;  2DE3 A;  5LDZ A;  1NI9 A;  3ISP A;  1EYK A;  2V3Q A;  1JP4 A;  4PFI A;  5IZZ A;  1FRP A;  5EQA A;  4P1E A;  2GQ1 A;  4OVP A;  5IZ3 A;  4IR8 A;  2MKZ A;  1KZ8 A;  2WYK A;  4P56 A;  1YZ0 A;  1LBX A;  4UAB A;  4GBW A;  4P47 A;  4PCD A;  4GWW A;  4FBP A;  2XXK A;  3ROJ A;  4X8R A;  4F18 A;  1FTA A;  1G0I A;  3FBP A;  2CZK A;  4NF0 A;  4GWU A;  1LBY A;  1NV0 A;  4YIC A;  4MIJ A;  1XI6 A;  2B4L A;  2WBB A;  1FSA A;  3IFA A;  4O94 A;  4N4U A;  1FPI A;  4G61 A;  4PFR A;  1YYZ A;  5CM6 A;  3MYU A;  1BK4 A;  3RPL B;  1FPL A;  4MNC A;  2XWI A;  2WEF A;  3T1B A;  4PGN A;  4PAI A;  3A29 A;  2F3D A;  4F1V A;  4PBH A;  1FJ6 A;  1FJ9 A;  1FPG A;  4H45 A;  4NGU A;  4OVT A;  4P3L A;  2CZI A;  1NUX A;  4DI3 D;  2HPG A;  5ESY A;  3LV0 A;  4PTK A;  4QBA A;  1Q9D A;  1AWB A;  2JJK A;  2QVV A;  5IM2 A;  1NUW A;  2HHM A;  4PE3 A;  4YZZ A;  1LBZ A;  4N6D A;  4QXD A;  4P8B A;  4NN3 A;  3B50 A;  3D1R A;  3E78 A;  4JVC A;  4GWS A;  3W9W A;  1RDX A;  4PDH A;  4PF6 A;  2Q74 A;  3PTY A;  5EQ8 A;  5FBP A;  1IMA A;  4N6K A;  2VPN A;  4MEV A;  2QVU A;  2Q8M A;  1DK4 A;  3QMF A;  4GWX A;  2HXR A;  4N8G A;  1NUY A;  4OVS A;  2CZH A;  5IZ3 B;  2XWV A;  2KQZ A;  4PBQ A;  1FBC A;  4DI4 B;  5I7I A;  2KR0 A;  5EYH A;  5ET8 A;  4AS4 A;  5A5L A;  1VDW A;  1G0H A;  4MMP A;  2V4C A;  2DE2 A;  1LBW A;  2DDK A;  1FPK A;  4X04 A;  2HZL A;  5F24 A;  3BIG A;  2FIE A;  2FVZ A;  4NG7 A;  4X9T A;  4GWZ A;  1EYI A;  5EYG A;  4I3E A;  1FBF A;  2ZZX A;  4NQ8 A;  1FBP A;  1FPF A;  4N91 A;  3EKI A;  1NV2 A;  2OWZ A;  2Y5L A;  5ET5 A;  4N81 A;  2QFL A;  5DW8 A;  2CEY A;  1YXI A;  3KC1 A;  1K9Z A;  4PFB A;  2CEX A;  3BIH A;  2WYP A;  4KXP A;  4PDD A;  1D9Q A;  3LUZ A;  3IFC A;  4P1L A;  3T0J A;  5J16 A;  2FBP A;  4MCO A;  4N15 A;  4XF5 A;  4GX3 A;  2FIX A;  1EYJ A;  4HE0 A;  2FHY A;  5JK4 A;  1DBZ A;  2F5X A;  1IMB A;  1NV1 A;  4AS5 A;  5IZ1 A;  3NOH A;  4I40 A;  4F19 A;  2ZZW A;  1RDY A;  2HZK A;  2PFZ A;  4F1U A;  4LN5 A;  4MNI A;  1CNQ A;  1K9Y A;  4OAN A;  2XWK A;  4O7M A;  1KA1 A;  2PCR A;  2P3V A;  2Y5K A;  4PAK A;  4N8Y A;  1INP A;  1NV6 A;  1NV5 A;  1FPJ A;  2B4M A;  4MHF A;  4PF8 A;  2DVZ A;  1IMD A;  1NV4 A;  1NV7 A;  5ET7 A;  4M1V A;  1NV3 A;  4O8M A;  2QVR A;  3RYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...