2CEYA

Apo structure of siap
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
306
structure length
306
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN HI0146
publication title Conservation of Structure and Mechanism in Primary and Secondary Transporters Exemplified by Siap, a Sialic Acid Binding Virulence Factor from Haemophilus Influenzae
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport
total genus 116
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2006-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2ceyA00
4OVTA 4P3LA 4NGUA 2WYPA 4MNPA 5IGAA 4LN5A 4YICA 3B50A 4PAKA 4PCDA 4XF5A 4MNCA 4MMPA 5CM6A 4OANA 4NQ8A 4PAIA 4MHFA 4MX6A 4PC9A 4O7MA 2XA5A 4NHBA 2WYKA 4MAGA 4PGPA 4N15A 2XWVA 4PF6A 4N6KA 4PDHA 3GYYA 4NG7A 5LTCA 4N4UA 4OVQA 4N8YA 2CEXA 5IM2A 5I5PA 4YZZA 4PFIA 2ZZXA 4NF0A 2XXKA 4PF8A 4NAPA 2ZZWA 3U65A 4N17A 4N8GA 2XWOA 4PDDA 4P47A 4O94A 4UABA 2CEYA 4PE3A 4MNIA 2PFZA 4PFBA 4X04A 4N6DA 4P56A 4MEVA 4X8RA 4PFRA 4PGNA 4OVRA 4PAFA 3FXBA 4OVSA 4N91A 2WX9A 4P1EA 4O8MA 4P1LA 4DI4B 4MCOA 2XWIA 5IZZA 4NX1A 2VPNA 2XWKA 2HZLA 4PBHA 4OA4A 4NN3A 4DI3D 5I7IA 2PFYA 4OVPA 4P9KA 2ZZVA 4PBQA 2HZKA 4XEQA 2VPOA 4MIJA 4PETA 4XFEA 2HPGA 4P8BA 2V4CA
chains in the Genus database with same CATH superfamily
4O3AA 3H7MA 3QXMA 4MNPA 1JEUA 1G0HA 1BK4A 4PAKA 3MC2A 1OLAA 1IIWA 2OBGA 3C32A 3HCQA 4JWYA 2P0SA 1D9YA 4OFOA 2X26A 1OVTA 3S2VA 1T0KA 4PGPA 1SW4A 4GL8A 1MY0A 4OHNA 1RKMA 3PPPA 2O68A 1UTBB 2CZKA 3P7IA 1AWBA 1EZ9A 2XX8A 3TTMA 3UIFA 4NAPA 4NF4B 1IXCA 4GRKA 4KYDA 4IO5A 4ELOA 3LR1A 1NI9A 3O6HA 3TUSA 3E79A 3HFUA 1SVXB 4JVCA 4YAHX 4GOTA 2QVUA 2QSXA 1FTJA 3ODBA 3RY3A 2WEFA 1ZBMA 1RYXA 4QBAA 5CC2A 4G68B 3H6WA 4ELQA 2NWJA 3RPLB 3FBPA 2HEUA 4P1EA 4KYEA 1FQBA 3KG2A 4I8CA 3PPRA 1XI6A 2PYYA 4G8NA 1BIYA 4ISUA 3TYHA 1AMFA 2HZLA 4PBHA 4DI3D 1LEVA 5AA1A 3S4UA 4JXIA 3KC0A 3TPAA 2HXWA 2DWIA 4KQPA 2B3FA 5AA2B 1IEJA 2H4IA 1SW1A 3E13X 4U1ZA 2QVRA 1FBDA 3GLBA 4MBPA 4MNCA 4I9DA 3KC1A 2F7BA 1B9JA 3RQTA 4NWCA 4RNSA 2XD2A 3RT6B 3QYTA 1O64A 2AL4A 5A5XA 4U23A 2D21A 1BLFA 2I58A 4POXA 5LOMA 1B46A 4EQ7A 3G3IA 3SERA 1R9QA 1ZU0A 3CSBA 2Q8JA 5DT6A 3HV1A 4X48A 4GLIA 3S9EA 5TP9B 2FA7A 5EQ7A 1INPA 1EH3A 3PGFA 4GWWA 4JWXA 2XXPA 3IR1A 3IFCA 1MPBA 2YLNA 1Y1ZA 3B6TA 5EHSA 3IB2A 2I0BA 1TT1A 1LBYA 3F11A 4O8MA 4G8MA 5I57B 4H8IA 2P3NA 3LUZA 5H8FB 3OD7A 4GD5A 4IO2A 1FSAA 3ZKKA 3GZGA 3KSJA 4X9TA 1J1NA 5DW8A 5HM4B 1A7LA 4LN5A 3A09A 2KLFA 4LP2B 5JK4A 4O7MA 2B3BA 4MAGA 4AS5A 1LBXA 3FGSA 4R6YA 3T22A 4R6HA 4OVQA 1PDAA 4KXPA 3PMXA 3O97A 1DSNA 4YZZA 1WDNA 2UVJA 2O1LA 5CI5A 1QW0A 2YPNA 4DCYA 1H3DA 3Q29A 1DPPA 4GXSB 3UGWA 4JB7A 3K00A 3LSLA 3GXAA 5IZ3A 3OOAA 1OLCA 4RK2A 2KR0A 5I2KA 1XC1A 4LZ7A 1IMFA 3FJ7A 1B58A 2QS4A 1FPFA 1NH8A 4WKMA 4X8RA 4OVJA 1S50A 4LZ5A 3KSXA 2ZNSA 1DCUA 2A5TB 5ICQA 4JSDA 4DLDA 2XXHA 4N91A 1M5DA 1I6BA 4NF6B 2O51A 4LUBA 2UYFA 4P0GA 4DI4B 3R7XA 1Z7NE 2WKYA 4L17A 1QJMA 1FPIA 1US4A 5KCJA 4U22A 4FJPA 5I58B 1GVCA 1B0HA 1FTLA 1MH4A 2PCRA 1B1HA 2NXOA 3HN0A 3KEIA 4P3LA 1D4NA 2Z8EA 3BKIB 3T96B 4PCDA 4DDDA 3PMWA 5CMKA 3K01A 2HAUA 4Q30B 3RNNA 4DCXA 4PC9A 4F3PA 1SYIA 2H9BA 4DIGA 4LA9A 3NOHA 3K6VA 1JP4A 1USYE 4N4UA 1MQHA 4AQ4A 5H8SA 4OWDA 5I59A 2DP8A 2F78A 2P2AA 2O69A 3DLNA 2VGQA 1FCKA 2Z23A 2CZIA 5FTIA 2P3VA 3O9PA 3CFZA 2Y7RA 5ELVA 4F19A 2RC9A 1MXWA 2FVZA 3T9XB 1P1QA 4PGNA 4EUOA 2NOOA 1QULA 3MVZA 4DZ1A 3RLFE 4ZECA 1VSOA 2O6AA 2WX9A 4F1VA 3LSXA 2GQ1A 1EU8A 5IZZA 4NX1A 4ZZAA 1B7ZA 2ZXTA 4DXBA 3EHSA 3G3FA 3OO8A 1Y3PA 2XHDA 5HBCA 1OQHA 3RYDA 2DWJA 4BDRA 3PUYE 3TTLA 4MJOA 3K1NA 1IMCA 2XXUA 1FPLA 2OZZA 1K9YA 5H8QA 2F7AA 3A3CA 3EQ1A 1DOTA 5A5XB 3MYUA 2V3QA 3FXQA 1R6ZA 4FE8A 4H67A 4YB7A 5K2XA 4N15A 1GV8A 2DOJA 1IXGA 1FPJA 1HSEA 3VVFA 1B5JA 3OEKA 4PFIA 4MLQA 4FAJA 3LBSA 2E1SA 2PX1A 4F22A 3C36A 1B3GA 2H98A 4IGRA 2AYSA 4UABA 1SI0A 4BDMA 1YYZA 3O6IA 3MZ9A 4R2BA 4GX4A 3O28A 4G4PA 5TPAA 4OZ9A 3MSTA 4YKPA 1LFGA 4R72A 5DVJA 1IMBA 3ILUB 3IK6B 3LC8A 1Y1MA 4ZZEA 4P1LA 2UXAA 3RUMA 4Z7EA 1FQAA 1EZPA 3WAFA 1IZ1A 5ITPA 3ROJA 4OVPA 2XXVA 2F35A 5ITOA 1F9BA 2QS1A 4R9FA 3IOTA 1FJ6A 1RDYA 3JV9A 3TTRA 5I2NA 4C0RA 4F1UA 3MPLA 1H76A 1FBEA 4HXVA 3RGYA 1VR5A 4H46A 1ZKBA 2XD3A 2XX9A 1SW2A 4F1YA 1B3EA 4O3CA 4OANA 5DVFA 4AB5A 1N7WA 4JVDA 4PAIA 3IB0A 3TQWA 1B3HA 2BJJX 4FECA 4GFRA 1LBBA 2XA5A 5H8HA 4P11A 4XKRA 1XVXA 4IR8A 4N81A 3U72A 1DBZA 3RPWA 2CEXA 1GTKA 5IZ3B 1EYIA 4M1VA 1NFTA 4OXVA 2ZZWA 1ZTYA 3TAJA 2R71A 4GWUA 1XOCA 4O3BA 4DXCA 1EZOA 2RC7A 2VD2A 2OX3A 4DXUA 1QGXA 5FTHA 2HHMA 4GX6A 1MXVA 3CR9A 5KDTA 4GXAA 4ZS9A 3T93B 3KN8A 1Q35A 4GWOA 5EHMA 4Q5TA 1KZ8A 2V3TA 3S9MC 4OETA 5KCJB 3LSFB 3FUZA 1CB6A 4YMAA 3IAZA 1B0LA 2VPNA 4OFJA 4QXDA 3BFTA 1B2HA 4YKJA 1LAXA 4I40A 3QAXA 3VLVA 5I7IA 3TKDA 4I3YA 3CG1A 4ELRA 3CIJA 1P1UA 2ZZVA 3FJMA 3K6UA 3C34A 3OELA 3N26A 4KFQA 1TWYA 1MS7A 2OWTA 5L8DA 3R6UA 1UTHA 1NUWA 3KBZA 2B65A 2AIXA 2HPGA 4LQ5A 2WYPA 4X1BA 2I6EA 5IGAA 2QVVA 5FHOA 2DXRA 2I3WA 2IA4A 1P1NA 4YB5A 5I59B 3H6TA 3K6WA 1B1XA 4TLLB 1B40A 4N6KA 1M5BA 5LTCA 2F3DA 4IO6A 4RPNA 2BJIA 3ZKLA 5DVIA 1IMEA 3FIRA 5F24A 5ESYA 3WAEA 1A40A 3IOWA 4H5FA 4F3BA 4U4XA 2A5SA 5H8NA 2CEYA 1B3FA 4JBZA 4ESWA 3KOTA 1CNQA 3HSTA 4MNIA 4F29A 2NVUB 4TOZA 2R9JA 4BLAA 1Y3NA 1II5A 1TFDA 4P56A 4ZEBA 2YJPA 1MY1A 1FQFA 4RK9A 4KCDA 4F2QA 3VVDA 5IKBA 3I5OA 1ATGA 1B4HA 2UYEA 1DK4A 1TXFA 4IY6A 1LCTA 3MVYA 3IO6A 3UORA 4HCYA 1AH5A 1FJ9A 3TODA 1SD3A 2F36A 4QSEA 4XIGQ 3C4MA 5J16A 5H8QB 2WBDA 4Q8RA 1MPDA 4OESA 2DDKA 3V89B 4EXLA 2ZYOA 1NNPA 4YICA 3B50A 4HE0A 1MY2A 1P99A 1SDXA 2O7IA 3VVEA 2RINA 4F3SA 3PV0E 4DE8A 2Z8DA 1SW5A 3K02A 4NE4A 4E0XA 4FORA 2ZNTA 1NV7A 4OQOA 4H8JA 4LATA 4N8YA 3H6UA 5EYGA 3T9VA 4FEBA 2REGA 1L5TA 4QFPA 5DTBA 1MQIA 3QSLA 3B8BA 3EN3A 4KI0E 3C35A 3TQLA 4N17A 4N8GA 3E3KA 3Q28A 1MXUA 3DELB 1LB9A 5TPAB 1JQFA 1B5HA 3K0VA 2L5VA 2R8TA 4X04A 1B52A 4GWYA 1NMUA 3FVOA 1WVJA 4PP0A 5A5LA 3KJ7A 3K4UA 5EYHA 3HHGA 3MWBA 5AA4A 5BUUA 2XXXA 3U92A 4KR5A 4ZEIA 2PVUA 2WBBA 1N7XA 2FYIA 4XKNA 2Y5KA 3IB1A 4RA1A 2VP1A 3UA8A 4NF8B 4MCOA 3Q26A 3MP6A 1UIVA 3SESA 3E78A 4ZE8A 1D9VA 2VOZA 4NN3A 2I4CA 1DTZA 2R6GE 1MDP1 1SPIA 1JW1A 4QRZA 1VFEA 5DYHA 4XFEA 4LONB 4NGUA 1DMBA 5H8HB 3KZGA 2NUVA 4MF3A 2IEEA 4MMPA 4QSCA 4GBVA 3RN8A 5I56A 2V3UA 1FPGA 4MX6A 4NHBA 3L6GA 3IX1A 4O7IA 4PF6A 3QK6A 3QMFA 1FBCA 1B4ZA 3M3FA 1PEBA 4H45A 3PPQA 4GWXA 2LAOA 3OO6A 1FBPA 4KHZE 3PUVE 2X7QA 5BWJA 1O63A 2M8CA 4ZEKA 4O94A 4GWSA 5KDTB 1N76A 2HFBA 3C33A 1DPEA 1XHYA 2H25A 4MFIA 1Y20A 2X7PA 4EDPA 1YTVA 4XKPA 3U93A 2GH9A 1HSLA 3FXBA 1IXHA 4RXLA 3PUZE 2QMXA 2OJTA 2Q8MA 3R26A 1S9TA 2RF1A 1ELJA 3MVXA 2GHBA 4ZE9A 1MPCA 1SQYA 4RYAA 1G0IA 4ESXA 4NTLA 2DSFA 2OLBA 2Q2AA 5K2YA 2Y7IA 2QRYA 1MQJA 1JNFA 4GQOA 1PB8A 3T9UA 1FPDA 1JEVA 4EQBA 1QVSA 5CMBA 4P8BA 1Z7ME 3SZPA 1MRPA 4OVTA 3TTKA 1JVYA 4WEPA 5L9OA 5EQAA 4ZEDA 3FVGA 4GF8A 4YB6A 1S7YA 3D4CA 2Z8FA 5DEXA 4HS7A 1H45A 4NWDA 1XS5A 3TCFA 3ECRA 4BDNA 1I6AA 4YU0A 3TELA 1FPEA 2XXTA 4AS4A 2DWAA 4GL0A 5H8NB 2I49A 2CZHA 3PUWE 3B7DA 4MH5A 1LSTA 1ZLQA 1NL5A 1KA1A 3BIHA 4NEDA 1NNFA 1N3XA 4PDDA 4P47A 3FASA 1M5FA 5M2VA 3MAMA 4IO3A 3MP8A 3G7WA 3W15C 2H99A 2Y7WA 1IMAA 1OVBA 1FPKA 3C9HA 3DP4A 4PQJA 1Y3QA 4OYVA 4OVRA 3EHUA 2DE2A 2G93A 4JDFA 2B4MA 5FHNA 4H65A 5ET5A 1NV3A 3PUXE 4F39A 4ZEFA 2F3BA 2XWKA 4OEVA 4G68C 2DVZA 4QF9A 5EQ8A 3OEMA 3BFUA 2OWSA 1O7TA 3RT8A 2QS3A 2UVHA 2QPQA 1B6HA 3N5LA 1Q9DA 4G61A 2Z22A 1NV6A 2V4CA 4C1UA 4JSOA 3MUQA 1MDQA 4NQ8A 1NUZA 2DS9A 2HXRA 1NV2A 2E0SA 3EF7A 1FBFA 4FIMA 1GR2A 3FVNA 4HE2A 3DP6A 1AOVA 3O6GA 4IO4A 1FTMA 1PB7A 3SEVA 4C1TA 4YKKA 2Q88A 3N6UA 2XXIA 1FTAA 1DTGA 3TTNA 4OMBA 5AE4A 1R1NA 3LSWA 2F5XA 1R9LA 3U8QA 2Y7KA 1NV0A 3FD3A 3OMBA 3W9WA 1YZ0A 3USDA 3BBRA 5AA4B 1HSJA 1MQGA 1Q1KA 3G3KA 4N6DA 2VHAA 1LBCA 3KFMA 2XXRA 2Q9TA 3IJOB 4FBPA 1LFHA 2FIEA 2OWZA 4IY5A 4YKIA 3EPEA 3MZ1A 1SBPA 2D5WA 5I2KB 4H6DA 4OVSA 3CFXA 1H44A 3CVGA 2O7UA 1B5IA 5CRYA 3HHFA 4BDLA 3PD8A 3K1PA 3FVKA 3IJXB 3SEUA 4LZ8A 1RYOA 3BIGA 4LVQA 1US5A 2DVCA 3N6TA 3SEYA 4GVOA 4OERA 1KWHA 5CBRA 2D3IA 1LFIA 2VT5A 1B7HA 4PETA 3CFLA 5I56B 3H3GA 3E9XA 4QSDA 2I0CA 5FBPA 4QHQA 1Y4TA 4QFKA 2PBWA 2HCAA 3Q25A 5CMCA 5HPQA 3KJTA 3FXRA 1LAGE 4F31B 4AB6A 1KA0A 5FHMA 5T3JA 3A29A 2XWVA 1XVYA 4OTEA 3OENA 4EXKA 5JTYA 5AA2D 4PF8A 1B05A 1PC3A 4FEDA 4OEUA 3N94A 4BDOA 2ABHA 3VE1B 2H5YA 2QJEA 3ZSFA 3T9HB 4YMBA 1FQCA 1JW5A 3AXFA 1UQWA 3M3KA 1LBVA 4PTKA 5KZTA 4NF5A 1A55A 4EF1A 2CMOA 5B7DA 1UIUA 3MW0A 4I62A 1BP5A 4IGTA 4G8HA 2Q2CA 3PPNA 4F3GA 4P0IA 2GHAA 3DP8A 4JWOA 4KPTA 3UN6A 1JVXA 1MM6A 5ICTA 5ET8A 5EQ9A 3TCGA 4U1OA 3TEPA 4R75A 1OMPA 2F8DA 3V8XB 3JZJA 5DEXB 3TDJA 4HW8A 3KOSA 3MJNA 4LQ2A 2QL3A 2RKMA 2G29A 2ZMBA 3IORA 3FV2A 2QMWA 1Y9UA 1MH3A 4RY1A 3T66A 3PU5A 3KN3A 3CI8A 2XXYA 3UP9A 2O84X 3V83A 4X1DA 3SDFA 4ND9A 4EQ9A 2DE3A 3VFJA 4H0WA 2V84A 2DQVA 1B32A 2RCAA 3CSGA 2PT2A 2VD3A 1QUKA 2ONSA 1MY4A 5ET7A 4KCCA 3ISPA 4OENA 3Q27A 4PFWA 1QUIA 2ONKE 3MBPA 3G3GA 2ZYNA 1JETA 4N13A 1LGBC 1D3KA 2PFZA 3A3UA 4PFBA 1YCJA 3KN7A 3VXBA 2F97A 3MPKA 1ZIUA 2UVIA 2F34A 1NNKA 3IOVA 1IUDA 2Y5LA 3S9NC 1AIVA 3H06B 4PAFA 5EYFA 1FBHA 3V5AA 1OQGA 4KD5A 2Y84A 2GRVA 2FHYA 4GBWA 2FBPA 3DM0A 1RDZA 4THIA 4OA4A 1N0TA 2Q89A 3HPIA 3GBAA 3T0JA 1P1OA 4MIJA 3C31A 4QFLA 2XX7A 4Q0CA 2REJA 3MP1A 2B4LA 1AL3A 3MZBA 5I2NB 4EF2A 4XTCQ 1LAHE 3PMVA 3M3LA 3TZAA 1IITA 2F6PA 4R74A 1B3LA 1YAEA 3LV0A 1MXZA 3M8UA 3ILTB 1ZJLA 4R6KA 5ISUA 4PDHA 3GYYA 1NV1A 3H03A 4BDQA 1LBWA 1NNTA 1MQDA 4FATA 1URDA 2AL5A 2PT1A 4G2ZA 2ZZXA 5IAIA 1N3WA 1LB8A 2XXKA 3KBRA 4PFTA 4RJZA 4ZDMA 1I69A 3U65A 3MVWA 4PFYA 3SKPA 3ONMA 1MY3A 1ZMGA 3SEXA 4OFLA 4U2RA 1UTBA 4WXJA 3UK4A 1QKBA 1POY1 3U94A 4NF4A 3OO9A 1M5EA 2CZLA 2RCBA 2XXWA 3FJGA 4ELPA 2Q74A 4IO7A 3K2DA 4R2FA 3PTYA 3VLUA 3O66A 1PB9A 4ONYA 1PBQA 1MXYA 1YXIA 1B51A 3D4GA 2O1MA 4G68A 4QFNA 3HO7A 3RPLA 4MLVA 3OXNA 1POTA 2V93A 4F2OA 1N84A 4P9KA 4WEDA 4PBQA 1BKAA 3CHGA 2I48A 4HE1A 1Y4CA 5L9MA 5CMMA 2VPOA 3TCHA 3I6VA 2P1SA 3IO4A 4GIZA 3S9LC 4UACA 2ESNA 1UTHB 3CG3A 1WODA 5AA2A 3TMGA 3QIMA 4RPOA 4N6PA 1QKAA 1URGA 3IL1B 4MHFA 5JTYB 1FBGA 4TLMB 3B6QA 5J1DA 2I4BA 1FQDA 3FV1A 4NG7A 2F6GA 4UA8A 1MM7A 3VV5A 5AA3A 5I5PA 3O29A 1LLSA 4XKQA 1IXIA 2KQZA 4NF0A 2I3VA 1B7UA 4PFUA 2DE4A 3EHTA 5LDZA 2HQ0A 3VDFA 1GGGA 3MQ9A 2XWOA 1A8EA 1URSA 1FRPA 4R73A 2DWHA 4I1DA 4JVIA 4NMYA 1A8FA 4PE3A 1FTKA 4NF5B 1H43A 3IFAA 1VE4A 1SI1A 3K6XA 1NKXA 1VFDA 4MEVA 1N04A 1M5CA 1MG1A 4PFRA 4U4SA 2V25A 1EYJA 5TP9A 3JYRA 5L9SA 1XT8A 2W7YA 1BTJA 1SYHA 1VDWA 3E4RA 4HCWA 1CE2A 3U1OA 5I3SA 4IB2A 2ZNUA 5IZ1A 3PPOA 3L6HA 1IMDA 1FQEA 5I57A 3RTFB 1NV5A 1FPBA 1PBPA 4G77A 5H8FA 4E0WA 1NV4A 5ET6A 5JEIA 1LBZA 4U21A 1RDXA 3T1BA 2F7CA 2FIXA 4H1XA 1A54A 3QUFA 3B6WA 4XF5A 3QUJA 1LAFE 3H6VA 5CM6A 3OSRA 3OSQA 3FATA 3SEWA 5F7VA 3EKIA 1TFAA 2ALUA 2WYKA 3OO7A 1QUJA 2ONRA 1JW4A 2MKZA 3RTWB 3TFLA 3H4ZA 5IM2A 5CBSA 1EYKA 3CRBA 1OIBA 3IOUA 1LCFA 2UVGA 2OK2A 2Y7PA 1FTOA 2JJKA 3LUYA 2QS2A 3G3HA 3VLWA 3PD9A 1K9ZA 5I84A 4KYSA 4R9GA 1A99A 4I3EA 4Z0IA 4K3FA 2GFEA 2OCUA 4M4GA 3ZS6A 2DXYA 3I3VA 5F1QA 3W9VA 4HTGA 3SETA 3FXUA 3GBBA 2DYXA 3K1MA 4XXUA 3THIA 2THIA 4F18A 4N07A 4NF8A 4H5GA 1NH7A 2PMSA 5TU0A 2XXQA 3G3JA 4ECFA 3FZVA 4QFOA 3O2AA 1D9QA 2ZYMA 2A5TA 2HAVA 2XWIA 2QFLA 2ZYKA 1FW0A 1NUXA 2FNCA 1I6QA 1P1WA 4TQUQ 2RC8A 3KGCA 2PFYA 4NF6A 3D1RA 1YPNA 1MXXA 4POWA 3VXCA 2HZKA 1NUYA 1ANFA 4XEQA 4GWZA 1USYH 4PE5B 1IQ7A 5B70A 4GX3A 5I58A 2ANJA
chains in the Genus database with same CATH topology
1FPLA 4NGUA 4MNPA 1K9YA 1G0HA 1BK4A 4PAKA 4MMPA 4GBVA 1FPGA 3MYUA 4MX6A 2V3QA 2DE3A 4NHBA 4PGPA 4N15A 4O7IA 4PF6A 3QMFA 1FPJA 1FBCA 4H45A 4PFIA 4GWXA 5ET7A 2CZKA 1AWBA 1FBPA 3ISPA 4NAPA 4O94A 4UABA 1YYZA 4GWSA 1NI9A 2PFZA 4PFBA 3E79A 3HFUA 4JVCA 4GX4A 2QVUA 2WEFA 2Y5LA 4QBAA 3MSTA 4PAFA 3FXBA 3RPLB 1FBHA 1IMBA 3FBPA 4P1EA 2Q8MA 4P1LA 2FHYA 4GBWA 2FBPA 1XI6A 1RDZA 1G0IA 2HZLA 4PBHA 4OA4A 4DI3D 3ROJA 4OVPA 1LEVA 3KC0A 1FPDA 3T0JA 1FJ6A 1RDYA 4MIJA 4F1UA 4P8BA 1FBEA 3SZPA 4OVTA 4HXVA 2QVRA 1FBDA 4H46A 2B4LA 5EQAA 4MNCA 4OANA 3KC1A 4JVDA 4PAIA 2XA5A 3LV0A 1FPEA 4IR8A 4N81A 4PDHA 3GYYA 1NV1A 1LBWA 1DBZA 4AS4A 2CEXA 5IZ3B 1EYIA 2CZHA 2ZZXA 4M1VA 2XXKA 2ZZWA 3U65A 1KA1A 3BIHA 4PDDA 4P47A 4GWUA 5EQ7A 1INPA 2OX3A 1IMAA 4GWWA 1FPKA 1QGXA 3IFCA 2HHMA 4GX6A 2Q74A 3PTYA 4OVRA 1KZ8A 2DE2A 2B4MA 1LBYA 1YXIA 5ET5A 4O8MA 1NV3A 2VPNA 4QXDA 2P3NA 3RPLA 2F3BA 2XWKA 3LUZA 2DVZA 4I40A 5EQ8A 5I7IA 4I3YA 4P9KA 2ZZVA 4PBQA 1FSAA 3CHGA 4HE1A 1NUWA 2QPQA 2VPOA 1Q9DA 3KBZA 4G61A 4X9TA 1NV6A 2HPGA 2V4CA 5DW8A 2WYPA 5IGAA 4LN5A 2QVVA 4NQ8A 1NUZA 5JK4A 4MHFA 4O7MA 2HXRA 1NV2A 1FBFA 1FBGA 4MAGA 4AS5A 5J1DA 4HE2A 1LBXA 4N6KA 4NG7A 5LTCA 2F3DA 4OVQA 4KXPA 5I5PA 4YZZA 2BJIA 1FTAA 1IMEA 2KQZA 4NF0A 5F24A 5ESYA 2DE4A 5LDZA 2F5XA 2XWOA 1NV0A 1FRPA 5IZ3A 2CEYA 3W9WA 4JVIA 1YZ0A 4PE3A 3IFAA 1CNQA 4MNIA 2KR0A 4N6DA 1IMFA 4P56A 2Q9TA 4MEVA 1FPFA 4FBPA 4X8RA 2FIEA 2OWZA 4PFRA 1DCUA 1EYJA 1DK4A 4OVSA 1VDWA 4HCWA 4N91A 4DI4B 5I3SA 4HCYA 1FPIA 5IZ1A 1FJ9A 1IMDA 3BIGA 5J16A 2WBDA 1NV5A 1FPBA 2PCRA 2VT5A 4PETA 1NV4A 5ET6A 2DDKA 5FBPA 1LBZA 4P3LA 1RDXA 3T1BA 2FIXA 4YICA 3B50A 4HE0A 4PCDA 4XF5A 5CM6A 4PC9A 3EKIA 1KA0A 2WYKA 3NOHA 5T3JA 3A29A 2XWVA 1NV7A 1JP4A 4N4UA 2MKZA 4N8YA 5IM2A 1EYKA 5EYGA 2CZIA 4PF8A 2JJKA 3B8BA 4N17A 4N8GA 2P3VA 1K9ZA 4I3EA 2L5VA 2R8TA 4X04A 4GWYA 4F19A 3W9VA 5A5LA 5EYHA 4F18A 2FVZA 1LBVA 4PTKA 4PGNA 2WBBA 2Y5KA 2WX9A 4F1VA 1D9QA 2GQ1A 4MCOA 2XWIA 5IZZA 4NX1A 2QFLA 1NUXA 3E78A 4NN3A 5ET8A 5EQ9A 2PFYA 3D1RA 3RYDA 1SPIA 2HZKA 1NUYA 4XEQA 4GWZA 4XFEA 4GX3A 4MJOA 1IMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVT A;  4P3L A;  4NGU A;  2WYP A;  4MNP A;  5IGA A;  4LN5 A;  4YIC A;  3B50 A;  4PAK A;  4PCD A;  4XF5 A;  4MNC A;  4MMP A;  5CM6 A;  4OAN A;  4NQ8 A;  4PAI A;  4MHF A;  4MX6 A;  4PC9 A;  4O7M A;  2XA5 A;  4NHB A;  2WYK A;  4MAG A;  4PGP A;  4N15 A;  2XWV A;  4PF6 A;  4N6K A;  4PDH A;  3GYY A;  4NG7 A;  5LTC A;  4N4U A;  4OVQ A;  4N8Y A;  2CEX A;  5IM2 A;  5I5P A;  4YZZ A;  4PFI A;  2ZZX A;  4NF0 A;  2XXK A;  4PF8 A;  4NAP A;  2ZZW A;  3U65 A;  4N17 A;  4N8G A;  2XWO A;  4PDD A;  4P47 A;  4O94 A;  4UAB A;  2CEY A;  4PE3 A;  4MNI A;  2PFZ A;  4PFB A;  4X04 A;  4N6D A;  4P56 A;  4MEV A;  4X8R A;  4PFR A;  4PGN A;  4OVR A;  4PAF A;  3FXB A;  4OVS A;  4N91 A;  2WX9 A;  4P1E A;  4O8M A;  4P1L A;  4DI4 B;  4MCO A;  2XWI A;  5IZZ A;  4NX1 A;  2VPN A;  2XWK A;  2HZL A;  4PBH A;  4OA4 A;  4NN3 A;  4DI3 D;  5I7I A;  2PFY A;  4OVP A;  4P9K A;  2ZZV A;  4PBQ A;  2HZK A;  4XEQ A;  2VPO A;  4MIJ A;  4PET A;  4XFE A;  2HPG A;  4P8B A;  2V4C A; 
#chains in the Genus database with same CATH topology
 4O3A A;  3H7M A;  3QXM A;  4MNP A;  1JEU A;  1G0H A;  1BK4 A;  4PAK A;  3MC2 A;  1OLA A;  1IIW A;  2OBG A;  3C32 A;  3HCQ A;  4JWY A;  2P0S A;  1D9Y A;  4OFO A;  2X26 A;  1OVT A;  3S2V A;  1T0K A;  4PGP A;  1SW4 A;  4GL8 A;  1MY0 A;  4OHN A;  1RKM A;  3PPP A;  2O68 A;  1UTB B;  2CZK A;  3P7I A;  1AWB A;  1EZ9 A;  2XX8 A;  3TTM A;  3UIF A;  4NAP A;  4NF4 B;  1IXC A;  4GRK A;  4KYD A;  4IO5 A;  4ELO A;  3LR1 A;  1NI9 A;  3O6H A;  3TUS A;  3E79 A;  3HFU A;  1SVX B;  4JVC A;  4YAH X;  4GOT A;  2QVU A;  2QSX A;  1FTJ A;  3ODB A;  3RY3 A;  2WEF A;  1ZBM A;  1RYX A;  4QBA A;  5CC2 A;  4G68 B;  3H6W A;  4ELQ A;  2NWJ A;  3RPL B;  3FBP A;  2HEU A;  4P1E A;  4KYE A;  1FQB A;  3KG2 A;  4I8C A;  3PPR A;  1XI6 A;  2PYY A;  4G8N A;  1BIY A;  4ISU A;  3TYH A;  1AMF A;  2HZL A;  4PBH A;  4DI3 D;  1LEV A;  5AA1 A;  3S4U A;  4JXI A;  3KC0 A;  3TPA A;  2HXW A;  2DWI A;  4KQP A;  2B3F A;  5AA2 B;  1IEJ A;  2H4I A;  1SW1 A;  3E13 X;  4U1Z A;  2QVR A;  1FBD A;  3GLB A;  4MBP A;  4MNC A;  4I9D A;  3KC1 A;  2F7B A;  1B9J A;  3RQT A;  4NWC A;  4RNS A;  2XD2 A;  3RT6 B;  3QYT A;  1O64 A;  2AL4 A;  5A5X A;  4U23 A;  2D21 A;  1BLF A;  2I58 A;  4POX A;  5LOM A;  1B46 A;  4EQ7 A;  3G3I A;  3SER A;  1R9Q A;  1ZU0 A;  3CSB A;  2Q8J A;  5DT6 A;  3HV1 A;  4X48 A;  4GLI A;  3S9E A;  5TP9 B;  2FA7 A;  5EQ7 A;  1INP A;  1EH3 A;  3PGF A;  4GWW A;  4JWX A;  2XXP A;  3IR1 A;  3IFC A;  1MPB A;  2YLN A;  1Y1Z A;  3B6T A;  5EHS A;  3IB2 A;  2I0B A;  1TT1 A;  1LBY A;  3F11 A;  4O8M A;  4G8M A;  5I57 B;  4H8I A;  2P3N A;  3LUZ A;  5H8F B;  3OD7 A;  4GD5 A;  4IO2 A;  1FSA A;  3ZKK A;  3GZG A;  3KSJ A;  4X9T A;  1J1N A;  5DW8 A;  5HM4 B;  1A7L A;  4LN5 A;  3A09 A;  2KLF A;  4LP2 B;  5JK4 A;  4O7M A;  2B3B A;  4MAG A;  4AS5 A;  1LBX A;  3FGS A;  4R6Y A;  3T22 A;  4R6H A;  4OVQ A;  1PDA A;  4KXP A;  3PMX A;  3O97 A;  1DSN A;  4YZZ A;  1WDN A;  2UVJ A;  2O1L A;  5CI5 A;  1QW0 A;  2YPN A;  4DCY A;  1H3D A;  3Q29 A;  1DPP A;  4GXS B;  3UGW A;  4JB7 A;  3K00 A;  3LSL A;  3GXA A;  5IZ3 A;  3OOA A;  1OLC A;  4RK2 A;  2KR0 A;  5I2K A;  1XC1 A;  4LZ7 A;  1IMF A;  3FJ7 A;  1B58 A;  2QS4 A;  1FPF A;  1NH8 A;  4WKM A;  4X8R A;  4OVJ A;  1S50 A;  4LZ5 A;  3KSX A;  2ZNS A;  1DCU A;  2A5T B;  5ICQ A;  4JSD A;  4DLD A;  2XXH A;  4N91 A;  1M5D A;  1I6B A;  4NF6 B;  2O51 A;  4LUB A;  2UYF A;  4P0G A;  4DI4 B;  3R7X A;  1Z7N E;  2WKY A;  4L17 A;  1QJM A;  1FPI A;  1US4 A;  5KCJ A;  4U22 A;  4FJP A;  5I58 B;  1GVC A;  1B0H A;  1FTL A;  1MH4 A;  2PCR A;  1B1H A;  2NXO A;  3HN0 A;  3KEI A;  4P3L A;  1D4N A;  2Z8E A;  3BKI B;  3T96 B;  4PCD A;  4DDD A;  3PMW A;  5CMK A;  3K01 A;  2HAU A;  4Q30 B;  3RNN A;  4DCX A;  4PC9 A;  4F3P A;  1SYI A;  2H9B A;  4DIG A;  4LA9 A;  3NOH A;  3K6V A;  1JP4 A;  1USY E;  4N4U A;  1MQH A;  4AQ4 A;  5H8S A;  4OWD A;  5I59 A;  2DP8 A;  2F78 A;  2P2A A;  2O69 A;  3DLN A;  2VGQ A;  1FCK A;  2Z23 A;  2CZI A;  5FTI A;  2P3V A;  3O9P A;  3CFZ A;  2Y7R A;  5ELV A;  4F19 A;  2RC9 A;  1MXW A;  2FVZ A;  3T9X B;  1P1Q A;  4PGN A;  4EUO A;  2NOO A;  1QUL A;  3MVZ A;  4DZ1 A;  3RLF E;  4ZEC A;  1VSO A;  2O6A A;  2WX9 A;  4F1V A;  3LSX A;  2GQ1 A;  1EU8 A;  5IZZ A;  4NX1 A;  4ZZA A;  1B7Z A;  2ZXT A;  4DXB A;  3EHS A;  3G3F A;  3OO8 A;  1Y3P A;  2XHD A;  5HBC A;  1OQH A;  3RYD A;  2DWJ A;  4BDR A;  3PUY E;  3TTL A;  4MJO A;  3K1N A;  1IMC A;  2XXU A;  1FPL A;  2OZZ A;  1K9Y A;  5H8Q A;  2F7A A;  3A3C A;  3EQ1 A;  1DOT A;  5A5X B;  3MYU A;  2V3Q A;  3FXQ A;  1R6Z A;  4FE8 A;  4H67 A;  4YB7 A;  5K2X A;  4N15 A;  1GV8 A;  2DOJ A;  1IXG A;  1FPJ A;  1HSE A;  3VVF A;  1B5J A;  3OEK A;  4PFI A;  4MLQ A;  4FAJ A;  3LBS A;  2E1S A;  2PX1 A;  4F22 A;  3C36 A;  1B3G A;  2H98 A;  4IGR A;  2AYS A;  4UAB A;  1SI0 A;  4BDM A;  1YYZ A;  3O6I A;  3MZ9 A;  4R2B A;  4GX4 A;  3O28 A;  4G4P A;  5TPA A;  4OZ9 A;  3MST A;  4YKP A;  1LFG A;  4R72 A;  5DVJ A;  1IMB A;  3ILU B;  3IK6 B;  3LC8 A;  1Y1M A;  4ZZE A;  4P1L A;  2UXA A;  3RUM A;  4Z7E A;  1FQA A;  1EZP A;  3WAF A;  1IZ1 A;  5ITP A;  3ROJ A;  4OVP A;  2XXV A;  2F35 A;  5ITO A;  1F9B A;  2QS1 A;  4R9F A;  3IOT A;  1FJ6 A;  1RDY A;  3JV9 A;  3TTR A;  5I2N A;  4C0R A;  4F1U A;  3MPL A;  1H76 A;  1FBE A;  4HXV A;  3RGY A;  1VR5 A;  4H46 A;  1ZKB A;  2XD3 A;  2XX9 A;  1SW2 A;  4F1Y A;  1B3E A;  4O3C A;  4OAN A;  5DVF A;  4AB5 A;  1N7W A;  4JVD A;  4PAI A;  3IB0 A;  3TQW A;  1B3H A;  2BJJ X;  4FEC A;  4GFR A;  1LBB A;  2XA5 A;  5H8H A;  4P11 A;  4XKR A;  1XVX A;  4IR8 A;  4N81 A;  3U72 A;  1DBZ A;  3RPW A;  2CEX A;  1GTK A;  5IZ3 B;  1EYI A;  4M1V A;  1NFT A;  4OXV A;  2ZZW A;  1ZTY A;  3TAJ A;  2R71 A;  4GWU A;  1XOC A;  4O3B A;  4DXC A;  1EZO A;  2RC7 A;  2VD2 A;  2OX3 A;  4DXU A;  1QGX A;  5FTH A;  2HHM A;  4GX6 A;  1MXV A;  3CR9 A;  5KDT A;  4GXA A;  4ZS9 A;  3T93 B;  3KN8 A;  1Q35 A;  4GWO A;  5EHM A;  4Q5T A;  1KZ8 A;  2V3T A;  3S9M C;  4OET A;  5KCJ B;  3LSF B;  3FUZ A;  1CB6 A;  4YMA A;  3IAZ A;  1B0L A;  2VPN A;  4OFJ A;  4QXD A;  3BFT A;  1B2H A;  4YKJ A;  1LAX A;  4I40 A;  3QAX A;  3VLV A;  5I7I A;  3TKD A;  4I3Y A;  3CG1 A;  4ELR A;  3CIJ A;  1P1U A;  2ZZV A;  3FJM A;  3K6U A;  3C34 A;  3OEL A;  3N26 A;  4KFQ A;  1TWY A;  1MS7 A;  2OWT A;  5L8D A;  3R6U A;  1UTH A;  1NUW A;  3KBZ A;  2B65 A;  2AIX A;  2HPG A;  4LQ5 A;  2WYP A;  4X1B A;  2I6E A;  5IGA A;  2QVV A;  5FHO A;  2DXR A;  2I3W A;  2IA4 A;  1P1N A;  4YB5 A;  5I59 B;  3H6T A;  3K6W A;  1B1X A;  4TLL B;  1B40 A;  4N6K A;  1M5B A;  5LTC A;  2F3D A;  4IO6 A;  4RPN A;  2BJI A;  3ZKL A;  5DVI A;  1IME A;  3FIR A;  5F24 A;  5ESY A;  3WAE A;  1A40 A;  3IOW A;  4H5F A;  4F3B A;  4U4X A;  2A5S A;  5H8N A;  2CEY A;  1B3F A;  4JBZ A;  4ESW A;  3KOT A;  1CNQ A;  3HST A;  4MNI A;  4F29 A;  2NVU B;  4TOZ A;  2R9J A;  4BLA A;  1Y3N A;  1II5 A;  1TFD A;  4P56 A;  4ZEB A;  2YJP A;  1MY1 A;  1FQF A;  4RK9 A;  4KCD A;  4F2Q A;  3VVD A;  5IKB A;  3I5O A;  1ATG A;  1B4H A;  2UYE A;  1DK4 A;  1TXF A;  4IY6 A;  1LCT A;  3MVY A;  3IO6 A;  3UOR A;  4HCY A;  1AH5 A;  1FJ9 A;  3TOD A;  1SD3 A;  2F36 A;  4QSE A;  4XIG Q;  3C4M A;  5J16 A;  5H8Q B;  2WBD A;  4Q8R A;  1MPD A;  4OES A;  2DDK A;  3V89 B;  4EXL A;  2ZYO A;  1NNP A;  4YIC A;  3B50 A;  4HE0 A;  1MY2 A;  1P99 A;  1SDX A;  2O7I A;  3VVE A;  2RIN A;  4F3S A;  3PV0 E;  4DE8 A;  2Z8D A;  1SW5 A;  3K02 A;  4NE4 A;  4E0X A;  4FOR A;  2ZNT A;  1NV7 A;  4OQO A;  4H8J A;  4LAT A;  4N8Y A;  3H6U A;  5EYG A;  3T9V A;  4FEB A;  2REG A;  1L5T A;  4QFP A;  5DTB A;  1MQI A;  3QSL A;  3B8B A;  3EN3 A;  4KI0 E;  3C35 A;  3TQL A;  4N17 A;  4N8G A;  3E3K A;  3Q28 A;  1MXU A;  3DEL B;  1LB9 A;  5TPA B;  1JQF A;  1B5H A;  3K0V A;  2L5V A;  2R8T A;  4X04 A;  1B52 A;  4GWY A;  1NMU A;  3FVO A;  1WVJ A;  4PP0 A;  5A5L A;  3KJ7 A;  3K4U A;  5EYH A;  3HHG A;  3MWB A;  5AA4 A;  5BUU A;  2XXX A;  3U92 A;  4KR5 A;  4ZEI A;  2PVU A;  2WBB A;  1N7X A;  2FYI A;  4XKN A;  2Y5K A;  3IB1 A;  4RA1 A;  2VP1 A;  3UA8 A;  4NF8 B;  4MCO A;  3Q26 A;  3MP6 A;  1UIV A;  3SES A;  3E78 A;  4ZE8 A;  1D9V A;  2VOZ A;  4NN3 A;  2I4C A;  1DTZ A;  2R6G E;  1MDP 1;  1SPI A;  1JW1 A;  4QRZ A;  1VFE A;  5DYH A;  4XFE A;  4LON B;  4NGU A;  1DMB A;  5H8H B;  3KZG A;  2NUV A;  4MF3 A;  2IEE A;  4MMP A;  4QSC A;  4GBV A;  3RN8 A;  5I56 A;  2V3U A;  1FPG A;  4MX6 A;  4NHB A;  3L6G A;  3IX1 A;  4O7I A;  4PF6 A;  3QK6 A;  3QMF A;  1FBC A;  1B4Z A;  3M3F A;  1PEB A;  4H45 A;  3PPQ A;  4GWX A;  2LAO A;  3OO6 A;  1FBP A;  4KHZ E;  3PUV E;  2X7Q A;  5BWJ A;  1O63 A;  2M8C A;  4ZEK A;  4O94 A;  4GWS A;  5KDT B;  1N76 A;  2HFB A;  3C33 A;  1DPE A;  1XHY A;  2H25 A;  4MFI A;  1Y20 A;  2X7P A;  4EDP A;  1YTV A;  4XKP A;  3U93 A;  2GH9 A;  1HSL A;  3FXB A;  1IXH A;  4RXL A;  3PUZ E;  2QMX A;  2OJT A;  2Q8M A;  3R26 A;  1S9T A;  2RF1 A;  1ELJ A;  3MVX A;  2GHB A;  4ZE9 A;  1MPC A;  1SQY A;  4RYA A;  1G0I A;  4ESX A;  4NTL A;  2DSF A;  2OLB A;  2Q2A A;  5K2Y A;  2Y7I A;  2QRY A;  1MQJ A;  1JNF A;  4GQO A;  1PB8 A;  3T9U A;  1FPD A;  1JEV A;  4EQB A;  1QVS A;  5CMB A;  4P8B A;  1Z7M E;  3SZP A;  1MRP A;  4OVT A;  3TTK A;  1JVY A;  4WEP A;  5L9O A;  5EQA A;  4ZED A;  3FVG A;  4GF8 A;  4YB6 A;  1S7Y A;  3D4C A;  2Z8F A;  5DEX A;  4HS7 A;  1H45 A;  4NWD A;  1XS5 A;  3TCF A;  3ECR A;  4BDN A;  1I6A A;  4YU0 A;  3TEL A;  1FPE A;  2XXT A;  4AS4 A;  2DWA A;  4GL0 A;  5H8N B;  2I49 A;  2CZH A;  3PUW E;  3B7D A;  4MH5 A;  1LST A;  1ZLQ A;  1NL5 A;  1KA1 A;  3BIH A;  4NED A;  1NNF A;  1N3X A;  4PDD A;  4P47 A;  3FAS A;  1M5F A;  5M2V A;  3MAM A;  4IO3 A;  3MP8 A;  3G7W A;  3W15 C;  2H99 A;  2Y7W A;  1IMA A;  1OVB A;  1FPK A;  3C9H A;  3DP4 A;  4PQJ A;  1Y3Q A;  4OYV A;  4OVR A;  3EHU A;  2DE2 A;  2G93 A;  4JDF A;  2B4M A;  5FHN A;  4H65 A;  5ET5 A;  1NV3 A;  3PUX E;  4F39 A;  4ZEF A;  2F3B A;  2XWK A;  4OEV A;  4G68 C;  2DVZ A;  4QF9 A;  5EQ8 A;  3OEM A;  3BFU A;  2OWS A;  1O7T A;  3RT8 A;  2QS3 A;  2UVH A;  2QPQ A;  1B6H A;  3N5L A;  1Q9D A;  4G61 A;  2Z22 A;  1NV6 A;  2V4C A;  4C1U A;  4JSO A;  3MUQ A;  1MDQ A;  4NQ8 A;  1NUZ A;  2DS9 A;  2HXR A;  1NV2 A;  2E0S A;  3EF7 A;  1FBF A;  4FIM A;  1GR2 A;  3FVN A;  4HE2 A;  3DP6 A;  1AOV A;  3O6G A;  4IO4 A;  1FTM A;  1PB7 A;  3SEV A;  4C1T A;  4YKK A;  2Q88 A;  3N6U A;  2XXI A;  1FTA A;  1DTG A;  3TTN A;  4OMB A;  5AE4 A;  1R1N A;  3LSW A;  2F5X A;  1R9L A;  3U8Q A;  2Y7K A;  1NV0 A;  3FD3 A;  3OMB A;  3W9W A;  1YZ0 A;  3USD A;  3BBR A;  5AA4 B;  1HSJ A;  1MQG A;  1Q1K A;  3G3K A;  4N6D A;  2VHA A;  1LBC A;  3KFM A;  2XXR A;  2Q9T A;  3IJO B;  4FBP A;  1LFH A;  2FIE A;  2OWZ A;  4IY5 A;  4YKI A;  3EPE A;  3MZ1 A;  1SBP A;  2D5W A;  5I2K B;  4H6D A;  4OVS A;  3CFX A;  1H44 A;  3CVG A;  2O7U A;  1B5I A;  5CRY A;  3HHF A;  4BDL A;  3PD8 A;  3K1P A;  3FVK A;  3IJX B;  3SEU A;  4LZ8 A;  1RYO A;  3BIG A;  4LVQ A;  1US5 A;  2DVC A;  3N6T A;  3SEY A;  4GVO A;  4OER A;  1KWH A;  5CBR A;  2D3I A;  1LFI A;  2VT5 A;  1B7H A;  4PET A;  3CFL A;  5I56 B;  3H3G A;  3E9X A;  4QSD A;  2I0C A;  5FBP A;  4QHQ A;  1Y4T A;  4QFK A;  2PBW A;  2HCA A;  3Q25 A;  5CMC A;  5HPQ A;  3KJT A;  3FXR A;  1LAG E;  4F31 B;  4AB6 A;  1KA0 A;  5FHM A;  5T3J A;  3A29 A;  2XWV A;  1XVY A;  4OTE A;  3OEN A;  4EXK A;  5JTY A;  5AA2 D;  4PF8 A;  1B05 A;  1PC3 A;  4FED A;  4OEU A;  3N94 A;  4BDO A;  2ABH A;  3VE1 B;  2H5Y A;  2QJE A;  3ZSF A;  3T9H B;  4YMB A;  1FQC A;  1JW5 A;  3AXF A;  1UQW A;  3M3K A;  1LBV A;  4PTK A;  5KZT A;  4NF5 A;  1A55 A;  4EF1 A;  2CMO A;  5B7D A;  1UIU A;  3MW0 A;  4I62 A;  1BP5 A;  4IGT A;  4G8H A;  2Q2C A;  3PPN A;  4F3G A;  4P0I A;  2GHA A;  3DP8 A;  4JWO A;  4KPT A;  3UN6 A;  1JVX A;  1MM6 A;  5ICT A;  5ET8 A;  5EQ9 A;  3TCG A;  4U1O A;  3TEP A;  4R75 A;  1OMP A;  2F8D A;  3V8X B;  3JZJ A;  5DEX B;  3TDJ A;  4HW8 A;  3KOS A;  3MJN A;  4LQ2 A;  2QL3 A;  2RKM A;  2G29 A;  2ZMB A;  3IOR A;  3FV2 A;  2QMW A;  1Y9U A;  1MH3 A;  4RY1 A;  3T66 A;  3PU5 A;  3KN3 A;  3CI8 A;  2XXY A;  3UP9 A;  2O84 X;  3V83 A;  4X1D A;  3SDF A;  4ND9 A;  4EQ9 A;  2DE3 A;  3VFJ A;  4H0W A;  2V84 A;  2DQV A;  1B32 A;  2RCA A;  3CSG A;  2PT2 A;  2VD3 A;  1QUK A;  2ONS A;  1MY4 A;  5ET7 A;  4KCC A;  3ISP A;  4OEN A;  3Q27 A;  4PFW A;  1QUI A;  2ONK E;  3MBP A;  3G3G A;  2ZYN A;  1JET A;  4N13 A;  1LGB C;  1D3K A;  2PFZ A;  3A3U A;  4PFB A;  1YCJ A;  3KN7 A;  3VXB A;  2F97 A;  3MPK A;  1ZIU A;  2UVI A;  2F34 A;  1NNK A;  3IOV A;  1IUD A;  2Y5L A;  3S9N C;  1AIV A;  3H06 B;  4PAF A;  5EYF A;  1FBH A;  3V5A A;  1OQG A;  4KD5 A;  2Y84 A;  2GRV A;  2FHY A;  4GBW A;  2FBP A;  3DM0 A;  1RDZ A;  4THI A;  4OA4 A;  1N0T A;  2Q89 A;  3HPI A;  3GBA A;  3T0J A;  1P1O A;  4MIJ A;  3C31 A;  4QFL A;  2XX7 A;  4Q0C A;  2REJ A;  3MP1 A;  2B4L A;  1AL3 A;  3MZB A;  5I2N B;  4EF2 A;  4XTC Q;  1LAH E;  3PMV A;  3M3L A;  3TZA A;  1IIT A;  2F6P A;  4R74 A;  1B3L A;  1YAE A;  3LV0 A;  1MXZ A;  3M8U A;  3ILT B;  1ZJL A;  4R6K A;  5ISU A;  4PDH A;  3GYY A;  1NV1 A;  3H03 A;  4BDQ A;  1LBW A;  1NNT A;  1MQD A;  4FAT A;  1URD A;  2AL5 A;  2PT1 A;  4G2Z A;  2ZZX A;  5IAI A;  1N3W A;  1LB8 A;  2XXK A;  3KBR A;  4PFT A;  4RJZ A;  4ZDM A;  1I69 A;  3U65 A;  3MVW A;  4PFY A;  3SKP A;  3ONM A;  1MY3 A;  1ZMG A;  3SEX A;  4OFL A;  4U2R A;  1UTB A;  4WXJ A;  3UK4 A;  1QKB A;  1POY 1;  3U94 A;  4NF4 A;  3OO9 A;  1M5E A;  2CZL A;  2RCB A;  2XXW A;  3FJG A;  4ELP A;  2Q74 A;  4IO7 A;  3K2D A;  4R2F A;  3PTY A;  3VLU A;  3O66 A;  1PB9 A;  4ONY A;  1PBQ A;  1MXY A;  1YXI A;  1B51 A;  3D4G A;  2O1M A;  4G68 A;  4QFN A;  3HO7 A;  3RPL A;  4MLV A;  3OXN A;  1POT A;  2V93 A;  4F2O A;  1N84 A;  4P9K A;  4WED A;  4PBQ A;  1BKA A;  3CHG A;  2I48 A;  4HE1 A;  1Y4C A;  5L9M A;  5CMM A;  2VPO A;  3TCH A;  3I6V A;  2P1S A;  3IO4 A;  4GIZ A;  3S9L C;  4UAC A;  2ESN A;  1UTH B;  3CG3 A;  1WOD A;  5AA2 A;  3TMG A;  3QIM A;  4RPO A;  4N6P A;  1QKA A;  1URG A;  3IL1 B;  4MHF A;  5JTY B;  1FBG A;  4TLM B;  3B6Q A;  5J1D A;  2I4B A;  1FQD A;  3FV1 A;  4NG7 A;  2F6G A;  4UA8 A;  1MM7 A;  3VV5 A;  5AA3 A;  5I5P A;  3O29 A;  1LLS A;  4XKQ A;  1IXI A;  2KQZ A;  4NF0 A;  2I3V A;  1B7U A;  4PFU A;  2DE4 A;  3EHT A;  5LDZ A;  2HQ0 A;  3VDF A;  1GGG A;  3MQ9 A;  2XWO A;  1A8E A;  1URS A;  1FRP A;  4R73 A;  2DWH A;  4I1D A;  4JVI A;  4NMY A;  1A8F A;  4PE3 A;  1FTK A;  4NF5 B;  1H43 A;  3IFA A;  1VE4 A;  1SI1 A;  3K6X A;  1NKX A;  1VFD A;  4MEV A;  1N04 A;  1M5C A;  1MG1 A;  4PFR A;  4U4S A;  2V25 A;  1EYJ A;  5TP9 A;  3JYR A;  5L9S A;  1XT8 A;  2W7Y A;  1BTJ A;  1SYH A;  1VDW A;  3E4R A;  4HCW A;  1CE2 A;  3U1O A;  5I3S A;  4IB2 A;  2ZNU A;  5IZ1 A;  3PPO A;  3L6H A;  1IMD A;  1FQE A;  5I57 A;  3RTF B;  1NV5 A;  1FPB A;  1PBP A;  4G77 A;  5H8F A;  4E0W A;  1NV4 A;  5ET6 A;  5JEI A;  1LBZ A;  4U21 A;  1RDX A;  3T1B A;  2F7C A;  2FIX A;  4H1X A;  1A54 A;  3QUF A;  3B6W A;  4XF5 A;  3QUJ A;  1LAF E;  3H6V A;  5CM6 A;  3OSR A;  3OSQ A;  3FAT A;  3SEW A;  5F7V A;  3EKI A;  1TFA A;  2ALU A;  2WYK A;  3OO7 A;  1QUJ A;  2ONR A;  1JW4 A;  2MKZ A;  3RTW B;  3TFL A;  3H4Z A;  5IM2 A;  5CBS A;  1EYK A;  3CRB A;  1OIB A;  3IOU A;  1LCF A;  2UVG A;  2OK2 A;  2Y7P A;  1FTO A;  2JJK A;  3LUY A;  2QS2 A;  3G3H A;  3VLW A;  3PD9 A;  1K9Z A;  5I84 A;  4KYS A;  4R9G A;  1A99 A;  4I3E A;  4Z0I A;  4K3F A;  2GFE A;  2OCU A;  4M4G A;  3ZS6 A;  2DXY A;  3I3V A;  5F1Q A;  3W9V A;  4HTG A;  3SET A;  3FXU A;  3GBB A;  2DYX A;  3K1M A;  4XXU A;  3THI A;  2THI A;  4F18 A;  4N07 A;  4NF8 A;  4H5G A;  1NH7 A;  2PMS A;  5TU0 A;  2XXQ A;  3G3J A;  4ECF A;  3FZV A;  4QFO A;  3O2A A;  1D9Q A;  2ZYM A;  2A5T A;  2HAV A;  2XWI A;  2QFL A;  2ZYK A;  1FW0 A;  1NUX A;  2FNC A;  1I6Q A;  1P1W A;  4TQU Q;  2RC8 A;  3KGC A;  2PFY A;  4NF6 A;  3D1R A;  1YPN A;  1MXX A;  4POW A;  3VXC A;  2HZK A;  1NUY A;  1ANF A;  4XEQ A;  4GWZ A;  1USY H;  4PE5 B;  1IQ7 A;  5B70 A;  4GX3 A;  5I58 A;  2ANJ A; 
#chains in the Genus database with same CATH homology
 1FPL A;  4NGU A;  4MNP A;  1K9Y A;  1G0H A;  1BK4 A;  4PAK A;  4MMP A;  4GBV A;  1FPG A;  3MYU A;  4MX6 A;  2V3Q A;  2DE3 A;  4NHB A;  4PGP A;  4N15 A;  4O7I A;  4PF6 A;  3QMF A;  1FPJ A;  1FBC A;  4H45 A;  4PFI A;  4GWX A;  5ET7 A;  2CZK A;  1AWB A;  1FBP A;  3ISP A;  4NAP A;  4O94 A;  4UAB A;  1YYZ A;  4GWS A;  1NI9 A;  2PFZ A;  4PFB A;  3E79 A;  3HFU A;  4JVC A;  4GX4 A;  2QVU A;  2WEF A;  2Y5L A;  4QBA A;  3MST A;  4PAF A;  3FXB A;  3RPL B;  1FBH A;  1IMB A;  3FBP A;  4P1E A;  2Q8M A;  4P1L A;  2FHY A;  4GBW A;  2FBP A;  1XI6 A;  1RDZ A;  1G0I A;  2HZL A;  4PBH A;  4OA4 A;  4DI3 D;  3ROJ A;  4OVP A;  1LEV A;  3KC0 A;  1FPD A;  3T0J A;  1FJ6 A;  1RDY A;  4MIJ A;  4F1U A;  4P8B A;  1FBE A;  3SZP A;  4OVT A;  4HXV A;  2QVR A;  1FBD A;  4H46 A;  2B4L A;  5EQA A;  4MNC A;  4OAN A;  3KC1 A;  4JVD A;  4PAI A;  2XA5 A;  3LV0 A;  1FPE A;  4IR8 A;  4N81 A;  4PDH A;  3GYY A;  1NV1 A;  1LBW A;  1DBZ A;  4AS4 A;  2CEX A;  5IZ3 B;  1EYI A;  2CZH A;  2ZZX A;  4M1V A;  2XXK A;  2ZZW A;  3U65 A;  1KA1 A;  3BIH A;  4PDD A;  4P47 A;  4GWU A;  5EQ7 A;  1INP A;  2OX3 A;  1IMA A;  4GWW A;  1FPK A;  1QGX A;  3IFC A;  2HHM A;  4GX6 A;  2Q74 A;  3PTY A;  4OVR A;  1KZ8 A;  2DE2 A;  2B4M A;  1LBY A;  1YXI A;  5ET5 A;  4O8M A;  1NV3 A;  2VPN A;  4QXD A;  2P3N A;  3RPL A;  2F3B A;  2XWK A;  3LUZ A;  2DVZ A;  4I40 A;  5EQ8 A;  5I7I A;  4I3Y A;  4P9K A;  2ZZV A;  4PBQ A;  1FSA A;  3CHG A;  4HE1 A;  1NUW A;  2QPQ A;  2VPO A;  1Q9D A;  3KBZ A;  4G61 A;  4X9T A;  1NV6 A;  2HPG A;  2V4C A;  5DW8 A;  2WYP A;  5IGA A;  4LN5 A;  2QVV A;  4NQ8 A;  1NUZ A;  5JK4 A;  4MHF A;  4O7M A;  2HXR A;  1NV2 A;  1FBF A;  1FBG A;  4MAG A;  4AS5 A;  5J1D A;  4HE2 A;  1LBX A;  4N6K A;  4NG7 A;  5LTC A;  2F3D A;  4OVQ A;  4KXP A;  5I5P A;  4YZZ A;  2BJI A;  1FTA A;  1IME A;  2KQZ A;  4NF0 A;  5F24 A;  5ESY A;  2DE4 A;  5LDZ A;  2F5X A;  2XWO A;  1NV0 A;  1FRP A;  5IZ3 A;  2CEY A;  3W9W A;  4JVI A;  1YZ0 A;  4PE3 A;  3IFA A;  1CNQ A;  4MNI A;  2KR0 A;  4N6D A;  1IMF A;  4P56 A;  2Q9T A;  4MEV A;  1FPF A;  4FBP A;  4X8R A;  2FIE A;  2OWZ A;  4PFR A;  1DCU A;  1EYJ A;  1DK4 A;  4OVS A;  1VDW A;  4HCW A;  4N91 A;  4DI4 B;  5I3S A;  4HCY A;  1FPI A;  5IZ1 A;  1FJ9 A;  1IMD A;  3BIG A;  5J16 A;  2WBD A;  1NV5 A;  1FPB A;  2PCR A;  2VT5 A;  4PET A;  1NV4 A;  5ET6 A;  2DDK A;  5FBP A;  1LBZ A;  4P3L A;  1RDX A;  3T1B A;  2FIX A;  4YIC A;  3B50 A;  4HE0 A;  4PCD A;  4XF5 A;  5CM6 A;  4PC9 A;  3EKI A;  1KA0 A;  2WYK A;  3NOH A;  5T3J A;  3A29 A;  2XWV A;  1NV7 A;  1JP4 A;  4N4U A;  2MKZ A;  4N8Y A;  5IM2 A;  1EYK A;  5EYG A;  2CZI A;  4PF8 A;  2JJK A;  3B8B A;  4N17 A;  4N8G A;  2P3V A;  1K9Z A;  4I3E A;  2L5V A;  2R8T A;  4X04 A;  4GWY A;  4F19 A;  3W9V A;  5A5L A;  5EYH A;  4F18 A;  2FVZ A;  1LBV A;  4PTK A;  4PGN A;  2WBB A;  2Y5K A;  2WX9 A;  4F1V A;  1D9Q A;  2GQ1 A;  4MCO A;  2XWI A;  5IZZ A;  4NX1 A;  2QFL A;  1NUX A;  3E78 A;  4NN3 A;  5ET8 A;  5EQ9 A;  2PFY A;  3D1R A;  3RYD A;  1SPI A;  2HZK A;  1NUY A;  4XEQ A;  4GWZ A;  4XFE A;  4GX3 A;  4MJO A;  1IMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...