3PU5A

The crystal structure of a putative extracellular solute-binding protein from bordetella parapertussis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
322
structure length
322
Chain Sequence
LADDHIYVTSSGGSFLENVRKHMAEPFEKQSGVKVTLVPGTNPAHALKILSSRGTPPYDVAAFGGNDMYRLIRAKKLAQVDEKSVPSLADVPEKFKADWEGCGSLYDYSSVGIAYRPDKIQGGVKSWKEFVERTVAGEFGKQVFFNNLSSNVRGAEVLSMFGKIYGSGYGDIEASIATLERMKPHIFKFFTAFNDPVVLLTSGEGAIGPGWDGRTFIAEDSTKGMVKWVDPTEGAVSSGPVMAVVKGGKEDLAKAFMNYALGEEAQKAFCEAMYYGAVNRKVQYSEKLKHRLPSIDSVQLVDTALLIKNMSALLDLWNKRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords extracellular solute-binding protein
publication title The crystal structure of aa putative extracellular solute-binding protein from Bordetella parapertussis
rcsb
source organism Bordetella parapertussis
total genus 99
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3pu5A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3pu5A01
1GGGA 3HN0A 4XTCQ 4U4SA 3LC8A 3C32A 2O51A 2I3VA 3SKPA 3MPKA 4GXAA 5TPAA 4G77A 1S7YA 3H6UA 5K2XA 4U1ZA 3KSXA 2A5TA 1H45A 2FNCA 3BFTA 3PV0E 1AMFA 2O1LA 4KYSA 3U92A 2H9BA 3D4CA 4AB6A 4ZS9A 3VVFA 4WEPA 2M8CA 1ATGA 3TQWA 2H25A 1MPDA 5H8SA 1D4NA 5DVJA 1SQYA 5CMMA 3FGSA 3K6VA 5AA1A 2X7PA 2Y7KA 1TFAA 3E3KA 4F18A 3ILTB 2O84X 4JSOA 2DSFA 1MXUA 1O63A 2OBGA 3R7XA 1IXCA 5DEXA 2IEEA 4F1YA 2YLNA 5ICTA 1LAHE 4R74A 1UTHB 4IGRA 2F8DA 4YZZA 2KLFA 2Y7RA 5HM4B 4R2BA 2DXRA 2F35A 3K02A 2OJTA 3E13X 3TTLA 2HEUA 1ZIUA 1B05A 3MP8A 5A5XA 3M3LA 1BP5A 3S9NC 4KQPA 1MDP1 3IL1B 1B0LA 4YKKA 4F2QA 1NH7A 4N07A 4PFYA 4LONB 4OFJA 3PMWA 2Z8FA 2H98A 5L8DA 1B6HA 5KCJB 3E4RA 2A5TB 2RCBA 4DIGA 4N6PA 4F1VA 1R6ZA 3GZGA 4WEDA 3MAMA 3DP8A 1USYE 1POY1 1JNFA 1BTJA 2NWJA 4AQ4A 3T96B 3VFJA 3B6TA 1DTZA 1VR5A 4LQ2A 4Z0IA 4RJZA 3K1PA 1MS7A 5DEXB 1S50A 3AXFA 3G7WA 1URDA 3G3KA 1QUKA 3DM0A 3IB0A 3K0VA 4G8NA 5L9OA 1R1NA 5H8HA 1ZKBA 1M5BA 4U4XA 3KOTA 4RYAA 1B52A 3OEKA 1ANFA 4KD5A 1OQGA 5A5XB 1Y3NA 4PFUA 4QFLA 5KDTB 3FIRA 3L6GA 2VD3A 2GRVA 2ABHA 3QIMA 2DWJA 1N7WA 1B3HA 2D5WA 4P11A 4ISUA 4FORA 2CMOA 3HV1A 3K1MA 3CI8A 3MVYA 1DSNA 2GH9A 3B6WA 1MH3A 4KFQA 2UXAA 3UGWA 3KZGA 1LFHA 1FTKA 3HCQA 3U72A 3V5AA 4ELQA 2Q2CA 1IZ1A 2GHAA 5TU0A 3OXNA 1N84A 4AB5A 3RT6B 3R6UA 1H3DA 3MVXA 2DOJA 3PU5A 4ZECA 2QS3A 1LAXA 4G4PA 1QKAA 3PUYE 3PUZE 2HAUA 5EHMA 4LA9A 2D21A 3WAEA 3N5LA 2I48A 3U93A 2I49A 3ODBA 1MXZA 2Y7PA 3Q28A 4FATA 3TZAA 3VLUA 2DWHA 3G3IA 4R9GA 2F7AA 1HSLA 2XX7A 3OELA 4IO5A 3O66A 3TELA 1POTA 3LR1A 4U21A 4FEBA 4OEVA 2HFBA 1MQIA 3O2AA 4MBPA 3T9XB 3ZKLA 4HCYA 4OERA 3T9UA 4F1UA 2XXTA 5HPQA 3FV1A 4QF9A 3CG1A 2QMXA 4HCWA 1B4HA 4YKJA 4R75A 1OQHA 2ZYNA 1Z7NE 4RK9A 3M8UA 1MY0A 1IQ7A 2I0CA 1Y4TA 1XS5A 3WAFA 1B40A 3MC2A 3FUZA 3O6HA 4ZEDA 2QS4A 3PPNA 2DYXA 4R6KA 4GLIA 1DOTA 4POWA 4QFKA 3P7IA 4YKIA 1D3KA 3TCHA 3FVNA 1GR2A 3V83A 2DE3A 3MBPA 3TDJA 4RA1A 1P1OA 4QSDA 1FQEA 5CMBA 4OWDA 1M5FA 4BDRA 4ZEKA 4LUBA 2R6GE 3OO7A 1B0HA 5HBCA 2W7YA 4FJPA 3H6WA 4DCYA 4NE4A 1B46A 4NF4B 3DELB 2RF1A 3ECRA 3A09A 5CI5A 1JVXA 2XXYA 4ESXA 4QFOA 3MUQA 4ELRA 2V3QA 3ZSFA 3RN8A 2ZYMA 3OOAA 4TLMB 4YU0A 3SEVA 3LSWA 3TYHA 3GLBA 3OSRA 3C4MA 3HSTA 2XXUA 2HCAA 1JVYA 4PP0A 3CSBA 5ISUA 3CFLA 5I2NB 4MH5A 1IIWA 3ONMA 5AA4A 1FQBA 1ZBMA 1N7XA 1FQCA 5ITOA 5I56A 2OCUA 2PVUA 2QS1A 1MQGA 3MJNA 1XOCA 4DXCA 4F3PA 3LBSA 5CMCA 5I59A 2VD2A 3TTKA 1URGA 1IXHA 1B7HA 1B32A 3TFLA 4KCCA 2PT1A 3IOUA 5CMKA 1DMBA 2I4BA 1N3XA 1B5HA 3PUXE 4WKMA 4NF5A 3UN6A 1NFTA 2PBWA 1T0KA 3C9HA 5CRYA 2P2AA 5BWJA 4POXA 1GV8A 2V25A 3PPOA 3UK4A 3C36A 3RUMA 2Y84A 1UIVA 1B9JA 1XVXA 3ZKKA 3A3UA 2ONRA 4THIA 1R9LA 1S9TA 5CBSA 3Q27A 2DWAA 3RGYA 4X1DA 3PD8A 4OQOA 3RQTA 4NF8B 4RPNA 2AL4A 1PB8A 1US4A 1IXIA 2I0BA 1IITA 3FD3A 5H8QA 5I56B 4YKPA 3IOTA 4C1TA 3VE1B 4ZE9A 2YJPA 4U2RA 4DXBA 5DYHA 4YB5A 2OLBA 1UQWA 2O6AA 3QSLA 5I59B 1MQJA 1D9VA 1PC3A 2Q2AA 4Z7EA 3SEXA 4QHQA 3UA8A 2P1SA 4HW8A 3VDFA 1I6QA 2UVGA 2O7IA 5FHOA 3CFXA 4O3CA 3VXCA 3FJMA 3TKDA 2THIA 3UORA 4OMBA 5BUUA 1BIYA 2XX9A 1MXXA 3N26A 4YMAA 2IA4A 1MDQA 3EHTA 1B3GA 3OMBA 1LLSA 2Q88A 4O3AA 2QPQA 3N6UA 4QFNA 2O68A 2G29A 1EZOA 1MXWA 3H7MA 3K1NA 5JK4A 2DXYA 1SYIA 4G68A 4IB2A 4ZZAA 3I6VA 4GRKA 4KCDA 4H5GA 3RY3A 1OMPA 1YCJA 5I57A 5ITPA 2FYIA 1IXGA 2ONKE 2QRYA 5H8QB 4BDNA 1QULA 1B2HA 1ZMGA 2DE4A 2PYYA 4H5FA 5TPAB 3QYTA 4HS7A 4TQUQ 1SVXB 1SW1A 4QFPA 1PEBA 3IB2A 4KHZE 4ZEBA 3KN3A 1B5IA 1B7UA 2B3FA 3W9WA 4IGTA 1A8FA 4OFOA 4LQ5A 2VHAA 2HZLA 3SERA 2ZNUA 3KGCA 1B5JA 3K01A 3CSGA 4EQ7A 5J1DA 3KSJA 3T93B 1Q35A 3PUVE 4YB7A 3MZ9A 3MP1A 3N94A 4GL0A 2QL3A 3FVOA 3B7DA 1B7ZA 5I58A 3C33A 1AH5A 3SEYA 1GTKA 1SI0A 1Y3PA 4G8HA 4O3BA 2VP1A 4C1UA 4M1VA 1OVTA 4LATA 4RY1A 3PPRA 1OIBA 3K6WA 2XD2A 3FZVA 1NL5A 5DVIA 2ESNA 3W9VA 2RC8A 1NNTA 3C35A 2Z8EA 2DS9A 3THIA 1ZTYA 1CE2A 5I57B 3CG3A 3HHGA 4EDPA 3G3HA 1OVBA 4G68C 4F3SA 1A7LA 2R71A 3CRBA 4GFRA 1I6AA 2ZYKA 1P1QA 1LFIA 3IB1A 3U94A 3PPQA 4XXUA 5F7VA 1MPBA 2HQ0A 1HSJA 2I6EA 4I62A 3I3VA 4DE8A 4F3GA 3FVKA 3QAXA 3OO8A 4FAJA 4E0XA 4GL8A 4FE8A 1EZ9A 4C0RA 3ZS6A 2O69A 4IO7A 1B51A 3VLVA 5I58B 1WODA 1YPNA 1FTLA 2Z23A 3IJXB 2F7BA 4KYEA 1XC1A 5H8HB 2E0SA 3MZBA 3IOVA 3MVWA 2E1SA 2UYEA 1PBQA 1USYH 4F19A 2DP8A 3S9LC 2XXVA 1D9YA 1TXFA 2F5XA 4GF8A 2ZNTA 4NWCA 3CR9A 1I69A 3CVGA 4NTLA 3RT8A 1FW0A 3RTFB 1SW4A 3PPPA 4EQ9A 5AA2A 5AE4A 1B4ZA 3TTNA 4JSDA 1O64A 3TAJA 4ZDMA 4YICA 5LOMA 3C34A 1LBCA 1N0TA 4G8MA 2Z8DA 5EHSA 1N3WA 2RINA 2YPNA 2UVHA 2OWTA 4U22A 2V3TA 4F31B 4OEUA 4H67A 2PMSA 4FEDA 1FQDA 1M5CA 1VE4A 5KZTA 1MXVA 3S2VA 3Q25A 4OETA 4BDQA 1ZLQA 2AIXA 4F39A 4KPTA 5FHNA 2I58A 4GIZA 4OESA 4LVQA 3Q26A 4PQJA 3F11A 1TT1A 2DE2A 3H03A 2OK2A 1OLAA 3IO4A 4PFTA 4YMBA 2Z22A 4XKQA 1JEVA 4OTEA 4PE5B 1YAEA 1FTOA 4PETA 3K4UA 3KOSA 3IO6A 3CFZA 4F22A 3DP4A 1P99A 4I1DA 3IORA 4ELOA 4H8IA 3KEIA 3PGFA 3K6XA 4XKNA 1IUDA 1I6BA 4JWOA 5DTBA 1B58A 3O28A 4QSEA 1QKBA 4JDFA 3IOWA 3MPLA 2HXWA 2Q9TA 1JW4A 3QUFA 3A3CA 1XHYA 5TP9A 4ZEFA 1VFEA 1CB6A 5H8NA 1A40A 4U23A 4MLQA 3O9PA 2CZLA 1MM6A 2P0SA 3M3KA 1H44A 1JEUA 3RNNA 3SDFA 3KJ7A 1LB9A 3PMXA 4ZEIA 2Q8JA 4BDMA 1SW2A 2NVUB 3TQLA 3V8XB 4OENA 2XX8A 2ZMBA 1P1NA 3VXBA 3G3FA 2XXIA 1PB9A 1WDNA 3KG2A 1LSTA 2Y7IA 1QVSA 3SEWA 2OZZA 3FVGA 3CIJA 3L6HA 1URSA 2O7UA 4LZ8A 2RCAA 3TEPA 4R9FA 4XKPA 1LAGE 1KWHA 3FXUA 3EF7A 4UA8A 3O97A 1VSOA 3T9VA 1BKAA 2BJJX 2XXWA 3C31A 4NF6A 4F29A 4RNSA 1TWYA 2QJEA 3H06B 3JZJA 1N76A 1NH8A 2VOZA 1QW0A 4LP2B 4OYVA 1UTHA 4MFIA 4NWDA 1PDAA 2VGQA 2I4CA 4JB7A 1QJMA 4P0IA 5AA4B 1RYXA 5TP9B 3JV9A 4YAHX 5H8NB 3T9HB 3QXMA 4GVOA 4R73A 4JXIA 1Q1KA 4GOTA 1B3LA 2F34A 4IO3A 1JETA 5AA2D 3OD7A 5EYFA 1MM7A 3IX1A 5KCJA 5M2VA 3SETA 3VVEA 4NF5B 3S9MC 1L5TA 4NMYA 2B65A 1A54A 1SYHA 1JW1A 5L9MA 3PUWE 1NNPA 2GHBA 1PBPA 1OLCA 4DLDA 3K6UA 4GQOA 4ONYA 4DCXA 1AIVA 3FXRA 4LZ7A 2XD3A 1XT8A 1SDXA 4NF6B 1JQFA 3USDA 3VLWA 2HAVA 3MZ1A 4Q0CA 2ALUA 3IR1A 4DZ1A 1MRPA 1TFDA 1A8EA 3SEUA 2ZNSA 3TUSA 3ILUB 4OFLA 4P0GA 1EZPA 4R6YA 1LBBA 4EUOA 4U1OA 1NNFA 5DT6A 4QRZA 2D3IA 2Y7WA 1SI1A 2RKMA 5KDTA 3DP6A 1SBPA 3TMGA 1MY1A 3HHFA 4ND9A 4TOZA 4XKRA 3H3GA 2V93A 1B1HA 1US5A 3EHSA 5FHMA 1MQHA 1Y4CA 3KBRA 1WVJA 4IO4A 5F1QA 3K2DA 2XXHA 3KJTA 4RPOA 4ZE8A 2H99A 3E9XA 1O7TA 1MY4A 4OXVA 2PT2A 3DLNA 4RXLA 4H6DA 1SW5A 2A5SA 4OZ9A 3TTRA 3OO9A 3U1OA 3H6VA 3GXAA 4BLAA 4FIMA 4N13A 1A55A 5B70A 3H6TA 1II5A 5B7DA 2F36A 3KN7A 5FTIA 4Q5TA 3MWBA 1MH4A 4G68B 2H4IA 2NOOA 4F3BA 3W15C 1XVYA 1UTBA 3LUYA 4WXJA 1MQDA 5ICQA 3SESA 3G3GA 3S4UA 3T22A 4IY5A 5JEIA 2UYFA 4Q8RA 2PX1A 3JYRA 5FTHA 1Y1MA 2V84A 3OEMA 3IAZA 3TPAA 1QUJA 3EQ1A 3K00A 3QK6A 1FTJA 3PD9A 1LGBC 1RYOA 1HSEA 1Y3QA 4DXUA 4OVJA 2X7QA 3LSXA 4IO6A 4ELPA 3PMVA 4BDOA 3I5OA 1ZJLA 4EQBA 2DQVA 4H65A 3N6TA 4XIGQ 3MVZA 1P1UA 3FJ7A 4H8JA 3FATA 1F9BA 2WKYA 4JBZA 2X26A 2DWIA 4YB6A 3Q29A 4GD5A 2REJA 5CC2A 4OHNA 4JWYA 2NXOA 2XXRA 3OO6A 4TLLB 3FJGA 3MP6A 1IEJA 2F78A 2B3BA 4KYDA 2RC9A 4K3FA 3IK6B 1H76A 1BLFA 3H4ZA 3OENA 3LSLA 3EHUA 3VV5A 1UTBB 1B3FA 3KN8A 1FTMA 4RK2A 2LAOA 4NF4A 4ESWA 2FA7A 1EH3A 3FV2A 3TCGA 4PFWA 3EN3A 3BFUA 4X9TA 1EU8A 1GVCA 1Y9UA 2HZKA 1SD3A 4KI0E 1DPPA 3UP9A 1ELJA 2UVIA 2XXPA 2DVZA 1MY3A 3M3FA 3VVDA 1Z7ME 5I2NA 4X1BA 5DVFA 1UIUA 1B1XA 1A99A 4I9DA 1LCFA 1LAFE 2I3WA 1Y20A 1NKXA 1QUIA 3LSFB 1FQFA 5JTYA 3U8QA 1DPEA 3O6GA 1NMUA 4HTGA 4DDDA 4IO2A 5L9SA 4ECFA 4ZZEA 2ZXTA 2ZYOA 1P1WA 4E0WA 3HO7A 1R9QA 5I2KA 1YTVA 1J1NA 4EXKA 3R26A 4M4GA 2H5YA 1JW5A 3KFMA 2QMWA 2OWSA 4MF3A 5AA2B 2NUVA 3QUJA 3GBAA 4G2ZA 4H1XA 4QSCA 4L17A 3D4GA 1B3EA 1LFGA 4R72A 4R2FA 2AL5A 1ZU0A 4R6HA 5H8FA 4GXSB 1M5EA 3RTWB 5CBRA 4IY6A 1MG1A 4NF8A 4EF1A 3S9EA 5AA3A 4GWOA 2V3UA 4MLVA 3RPWA 2F6GA 2REGA 2Q89A 3HPIA 2AYSA 1Y1ZA 1PB7A 5ELVA 5I84A 2RC7A 4X48A 4EF2A 3FASA 1MY2A 4JWXA 5JTYB 1H43A 1VFDA 4H0WA 1RKMA 1NNKA 2UVJA 4LZ5A 2ONSA 2QSXA 2R9JA 2F97A 4I8CA 3TODA 4UACA 3MQ9A 5CM6A 5K2YA 3OSQA 1LB8A 2F6PA 3T66A 3G3JA 4BDLA 5IAIA 5I2KB 3EPEA 4EXLA 3FXQA 1AL3A 3TCFA 2GFEA 3GBBA 2O1MA 3TTMA 2XHDA 3O6IA 2ANJA 2G93A 2QS2A 2F7CA 1AOVA 3O29A 3B6QA 3IJOB 1FQAA 3UIFA 4KR5A 3RLFE 2XXQA 1DTGA 4F2OA 3BBRA 3MW0A 1MXYA 1M5DA 5IKBA 2DVCA 1MPCA 3BKIB 5H8FB 4Q30B 1FCKA 1N04A 4FECA 4NEDA 3V89B 1LCTA 2XXXA
chains in the Genus database with same CATH superfamily
1GGGA 4GWYA 3HN0A 4XTCQ 4U4SA 3LC8A 3C32A 2O51A 5IZZA 2I3VA 3SKPA 3MPKA 4GXAA 5TPAA 4G77A 1S7YA 3H6UA 5K2XA 4U1ZA 3KSXA 2A5TA 1H45A 2FNCA 3BFTA 3PV0E 4PE3A 1AMFA 4PF6A 2O1LA 4KYSA 3U92A 2H9BA 3D4CA 3CHGA 1QGXA 4AB6A 4ZS9A 3VVFA 4WEPA 2M8CA 1ATGA 3TQWA 2H25A 1MPDA 5H8SA 1D4NA 2XWOA 5DVJA 1SQYA 5CMMA 3FGSA 1IMBA 3K6VA 5AA1A 2X7PA 2Y7KA 1TFAA 3E3KA 4F18A 1NUWA 3ILTB 1D9QA 2O84X 4JSOA 2DSFA 1MXUA 1O63A 4HE1A 2OBGA 3R7XA 1IXCA 5DEXA 2IEEA 4F1YA 2YLNA 1IMEA 5ICTA 1LAHE 4R74A 1UTHB 4IGRA 2F8DA 4YZZA 2KLFA 2Y7RA 5HM4B 4R2BA 2DXRA 3BIHA 2F35A 2WX9A 3K02A 2OJTA 3E13X 3TTLA 2HEUA 1ZIUA 4GBWA 4OVSA 1B05A 3MP8A 5A5XA 3M3LA 2VPOA 4N17A 1BP5A 4DI4B 3S9NC 4KQPA 1JP4A 1MDP1 1EYJA 3IL1B 1B0LA 1LEVA 4YKKA 4F2QA 5EQ8A 1NH7A 4N07A 4PFYA 4LONB 4OFJA 3PMWA 2Z8FA 2H98A 5L8DA 4GWSA 1G0IA 1B6HA 5KCJB 3E4RA 2A5TB 2RCBA 4DIGA 4N6PA 4F1VA 1R6ZA 1FPLA 3GZGA 4WEDA 3MAMA 3DP8A 1USYE 1FPDA 1POY1 1JNFA 4HE2A 1BTJA 2NWJA 4AQ4A 3T96B 3VFJA 3B6TA 1DTZA 4HE0A 4PAIA 1VR5A 4LQ2A 4Z0IA 1FPFA 4RJZA 3K1PA 1MS7A 4KXPA 5DEXB 1S50A 3AXFA 2Y5KA 3G7WA 1URDA 3G3KA 1QUKA 3DM0A 3IB0A 3K0VA 4G8NA 5L9OA 1R1NA 5H8HA 4HXVA 5T3JA 1ZKBA 1M5BA 4U4XA 3KOTA 2CEYA 4RYAA 1B52A 3OEKA 1ANFA 1EYIA 4PTKA 4KD5A 4PAKA 1OQGA 5A5XB 1Y3NA 4PFUA 4QFLA 3T0JA 5KDTB 3FIRA 3L6GA 2VD3A 2GRVA 2ABHA 3QIMA 2DWJA 1N7WA 1B3HA 2D5WA 4P11A 2WEFA 4ISUA 4FORA 2CMOA 3HV1A 3K1MA 1CNQA 3CI8A 3MVYA 1DSNA 2GH9A 3B6WA 4QBAA 1MH3A 4KFQA 2UXAA 3UGWA 3KZGA 1LFHA 4PC9A 1FTKA 3HCQA 3U72A 3V5AA 4MJOA 2P3NA 4ELQA 2Q2CA 1IZ1A 2GHAA 1G0HA 5TU0A 3OXNA 1N84A 4AB5A 3RT6B 3R6UA 1H3DA 3MVXA 3NOHA 2DOJA 3PU5A 4ZECA 2QS3A 1LAXA 2KQZA 4G4PA 1QKAA 3PUYE 3RPLA 3PUZE 1RDYA 2HAUA 5EHMA 4LA9A 2D21A 3WAEA 3N5LA 4XF5A 2I48A 3U93A 2I49A 3ODBA 1MXZA 3LV0A 2Y7PA 3Q28A 4PGNA 4FATA 3TZAA 3VLUA 2DWHA 3G3IA 4R9GA 2F7AA 1HSLA 2XX7A 3OELA 4IO5A 5I7IA 3O66A 3TELA 1POTA 3LR1A 4U21A 4FEBA 4OEVA 2HFBA 1MQIA 3O2AA 4MBPA 3T9XB 4I3EA 3ZKLA 4HCYA 4OERA 3T9UA 4MMPA 4F1UA 2XXTA 5HPQA 3FV1A 4QF9A 3CG1A 2QMXA 4HCWA 1B4HA 4YKJA 4R75A 1OQHA 2ZYNA 1Z7NE 4H46A 4RK9A 3M8UA 1MY0A 1IQ7A 2I0CA 1Y4TA 1XS5A 3WAFA 4AS4A 1B40A 3MC2A 3FUZA 3O6HA 4ZEDA 2QS4A 3PPNA 2DYXA 4R6KA 4GLIA 1DOTA 1NUXA 4POWA 5EQ7A 4MX6A 4QFKA 3P7IA 4YKIA 4PDHA 1D3KA 3TCHA 3SZPA 1YYZA 3FVNA 1GR2A 1NV5A 3V83A 2FHYA 2DE3A 3MBPA 3TDJA 4RA1A 1P1OA 4N81A 4QSDA 1FQEA 3BIGA 5CMBA 5EYGA 3RPLB 4OWDA 1M5FA 4BDRA 4ZEKA 4LUBA 2R6GE 1BK4A 3OO7A 4P9KA 1B0HA 5HBCA 2W7YA 4FJPA 4NHBA 3H6WA 3B8BA 4DCYA 4NE4A 2ZZVA 1B46A 4NF4B 4PF8A 3DELB 2RF1A 3ECRA 3A09A 5CI5A 1JVXA 2XXYA 4IR8A 4ESXA 4QFOA 3MUQA 4ELRA 2V3QA 4GWUA 3ZSFA 3RN8A 2ZYMA 3OOAA 4MAGA 4TLMB 4OVTA 4YU0A 3SEVA 3LSWA 4GWXA 1NUZA 3TYHA 1DCUA 3GLBA 3OSRA 4OANA 3C4MA 3HSTA 2XXUA 2HCAA 1JVYA 4PP0A 5EYHA 3CSBA 3PTYA 5ISUA 3CFLA 5I2NB 4MH5A 1IIWA 3ONMA 5AA4A 1FQBA 1LBXA 1ZBMA 4P1LA 1N7XA 1FQCA 5ITOA 5I56A 2OCUA 2PVUA 2QS1A 2WYPA 1MQGA 5DW8A 3MJNA 1XOCA 4DXCA 4F3PA 3LBSA 5CMCA 1Q9DA 5I59A 5LTCA 2VD2A 3TTKA 1URGA 1IXHA 1B7HA 1B32A 3TFLA 4KCCA 2PT1A 3IOUA 5CMKA 5ET6A 1DMBA 2I4BA 1N3XA 1B5HA 1DBZA 3PUXE 4WKMA 4NF5A 3UN6A 1NFTA 2PBWA 1T0KA 3C9HA 5CRYA 2P2AA 5BWJA 4POXA 1GV8A 2V25A 3PPOA 3UK4A 3C36A 3RUMA 1FBGA 2Y84A 2XXKA 1UIVA 1B9JA 1XVXA 3ZKKA 3A3UA 2ONRA 4PFRA 4THIA 1R9LA 1S9TA 5CBSA 3Q27A 2DWAA 3RGYA 4X1DA 3PD8A 4OQOA 3RQTA 4NF8B 4RPNA 2AL4A 1PB8A 1US4A 1IMCA 1IXIA 2I0BA 1IITA 3FD3A 5H8QA 1FRPA 2HHMA 5I56B 4YKPA 3IOTA 4C1TA 3VE1B 4ZE9A 2YJPA 4U2RA 4DXBA 5DYHA 4YB5A 2OLBA 1UQWA 2O6AA 3QSLA 1FPBA 5I59B 1MQJA 1D9VA 1PC3A 2Q2AA 4Z7EA 3SEXA 4QHQA 3UA8A 2P1SA 2B4MA 4MHFA 1I6QA 3VDFA 4HW8A 2UVGA 2Q8MA 2O7IA 5FHOA 3CFXA 4O3CA 3VXCA 4NG7A 5A5LA 3FJMA 2CZKA 3TKDA 2THIA 1KA1A 3UORA 4OMBA 4N15A 5BUUA 5ET7A 1BIYA 2XX9A 1MXXA 5I5PA 3N26A 4NAPA 4YMAA 2IA4A 4N6KA 1MDQA 4JVIA 3EHTA 1B3GA 3OMBA 1NI9A 1LLSA 3D1RA 2Q88A 4O3AA 2QPQA 1KA0A 3N6UA 4DI3D 4GWZA 4QFNA 2O68A 2G29A 1EZOA 1MXWA 3H7MA 4NQ8A 3K1NA 2FVZA 5JK4A 2DXYA 1SYIA 4G68A 4IB2A 3KBZA 4MIJA 4ZZAA 4MCOA 3I6VA 4GRKA 4KCDA 4H5GA 3RY3A 1OMPA 1YCJA 5I57A 5ITPA 2FYIA 1IXGA 1NV2A 4OVRA 1NV7A 2ONKE 2QRYA 5H8QB 4BDNA 1QULA 1B2HA 2XWVA 1ZMGA 2DE4A 2PYYA 4H5FA 5TPAB 3QYTA 4HS7A 4TQUQ 1SVXB 1SW1A 4QFPA 1PEBA 3IB2A 4KHZE 4ZEBA 5IGAA 3KN3A 2CZHA 1B5IA 1B7UA 2B3FA 3W9WA 4IGTA 2HPGA 4PGPA 1A8FA 4OFOA 4OA4A 4LQ5A 2VHAA 5ET5A 2HZLA 4PBQA 3SERA 2ZNUA 1RDXA 3KGCA 2QVVA 1B5JA 3K01A 3CSGA 4EQ7A 5J1DA 3KSJA 3T93B 5F24A 1Q35A 3PUVE 4YB7A 3MZ9A 3MP1A 3N94A 4GL0A 2QL3A 3FVOA 3B7DA 1B7ZA 2WBBA 5I58A 3C33A 1INPA 1AH5A 3SEYA 1GTKA 1SI0A 1Y3PA 4G8HA 4O3BA 1LBZA 2VP1A 4C1UA 4M1VA 1OVTA 4LATA 4RY1A 3PPRA 1OIBA 3K6WA 2XD2A 3FZVA 1NL5A 4PDDA 5DVIA 2ESNA 3W9VA 2RC8A 1NNTA 3C35A 4N8YA 2Z8EA 2DS9A 3THIA 1ZTYA 1CE2A 5I57B 1FJ9A 3CG3A 3HHGA 4EDPA 3G3HA 1OVBA 4G68C 4OVPA 4F3SA 1A7LA 2R71A 3CRBA 4GFRA 4OVQA 1I6AA 2ZYKA 1P1QA 1LFIA 3IB1A 3U94A 3PPQA 3IFCA 4XXUA 5F7VA 1MPBA 2HQ0A 1HSJA 2I6EA 4I62A 3I3VA 3QMFA 4O8MA 2XWIA 4DE8A 4F3GA 3FVKA 3QAXA 1LBWA 3OO8A 4FAJA 4E0XA 4GL8A 4FE8A 1EZ9A 4C0RA 3ZS6A 2O69A 2P3VA 4IO7A 1B51A 3VLVA 5I58B 1WODA 1YPNA 1FTLA 5J16A 5EQAA 3ISPA 2Z23A 3IJXB 2F7BA 4KYEA 1XC1A 4GX3A 5H8HB 2E0SA 3MZBA 3IOVA 3MVWA 2E1SA 2UYEA 1PBQA 1USYH 4F19A 2DP8A 3S9LC 2XXVA 1D9YA 1TXFA 3E79A 2F5XA 4GF8A 4H45A 2ZNTA 4AS5A 2PFZA 4NWCA 4GX4A 3CR9A 1I69A 3CVGA 4NTLA 3RT8A 1FW0A 3RTFB 2ZZWA 1SW4A 3PPPA 4EQ9A 5AA2A 5AE4A 1B4ZA 3TTNA 4JSDA 1O64A 3TAJA 4ZDMA 4YICA 1DK4A 5LOMA 3C34A 4GX6A 1LBCA 1N0TA 4G8MA 2Z8DA 2QFLA 1N3WA 5EHSA 2RINA 2YPNA 1FBFA 2UVHA 2OWTA 4U22A 2V3TA 4F31B 4OEUA 5IZ3A 4H67A 2PMSA 4FEDA 1FQDA 1M5CA 1VE4A 4NN3A 1NV6A 5KZTA 1MXVA 3S2VA 3Q25A 4OETA 4BDQA 2VT5A 1ZLQA 2AIXA 4F39A 4KPTA 2V4CA 5FHNA 2I58A 4GIZA 4OESA 1FBEA 4LVQA 3Q26A 4PQJA 3F11A 3FXBA 1TT1A 2DE2A 3H03A 2OK2A 1OLAA 3IO4A 4PFTA 4YMBA 2Z22A 4XKQA 1JEVA 4OTEA 3IFAA 4PE5B 4N6DA 1YAEA 1FTOA 4PETA 3K4UA 3KOSA 3IO6A 3CFZA 4F22A 3DP4A 1P99A 4I1DA 1IMAA 3IORA 1FBDA 4ELOA 4H8IA 3KEIA 3PGFA 1FBHA 3K6XA 4XKNA 1IUDA 1I6BA 4JWOA 5DTBA 5LDZA 1B58A 3O28A 4QSEA 1QKBA 4JDFA 3IOWA 3MPLA 1NV4A 2HXWA 2Q9TA 1JW4A 3QUFA 3A3CA 1XHYA 5TP9A 3ROJA 4ZEFA 1VFEA 1CB6A 5H8NA 1A40A 5IM2A 4U23A 4MLQA 4XFEA 3O9PA 2CZLA 1MM6A 2P0SA 3M3KA 2WYKA 1H44A 2XWKA 1JEUA 3RNNA 3SDFA 1XI6A 1LB9A 3KJ7A 3PMXA 4ZEIA 2Q8JA 4BDMA 1SW2A 2NVUB 3TQLA 3V8XB 4OENA 4MNCA 2XX8A 4LN5A 2ZMBA 1P1NA 3VXBA 3G3FA 2XXIA 1PB9A 1WDNA 3KG2A 1LSTA 2XA5A 2Y7IA 1QVSA 3SEWA 2OZZA 3FVGA 3CIJA 3L6HA 1URSA 2O7UA 4LZ8A 2RCAA 3TEPA 4R9FA 4XKPA 1LAGE 1KWHA 3FXUA 3EF7A 2PCRA 1RDZA 4UA8A 3O97A 1VSOA 1FPJA 3T9VA 1BKAA 2BJJX 2XXWA 3C31A 4NF6A 4F29A 4RNSA 1LBVA 1TWYA 2QJEA 3H06B 3JZJA 1N76A 1NH8A 2VOZA 1QW0A 4LP2B 4OYVA 1UTHA 4MFIA 4NWDA 1PDAA 2VGQA 2JJKA 2I4CA 4JB7A 1QJMA 4P0IA 3A29A 4N91A 4GWWA 5AA4B 1RYXA 4NX1A 5TP9B 3JV9A 4YAHX 5H8NB 3T9HB 3QXMA 4GVOA 5FBPA 1FBCA 4R73A 4JXIA 1Q1KA 1NV3A 4GOTA 1B3LA 2F34A 4N8GA 2HXRA 4IO3A 1JETA 5AA2D 3OD7A 5EYFA 1MM7A 3IX1A 5KCJA 5M2VA 5ESYA 3SETA 3VVEA 4NF5B 3MYUA 2L5VA 1L5TA 4NMYA 3S9MC 2F3DA 4P56A 2B65A 1A54A 1SYHA 4QXDA 1JW1A 5L9MA 3PUWE 1NNPA 4O94A 2GHBA 1PBPA 1OLCA 2OX3A 4DLDA 3K6UA 4GQOA 4ONYA 1NV0A 4DCXA 1FPGA 1AIVA 3FXRA 4LZ7A 2XD3A 1XT8A 1SDXA 4NF6B 2B4LA 1JQFA 3USDA 3VLWA 2HAVA 3MZ1A 4Q0CA 2ALUA 3IR1A 4DZ1A 1MRPA 1TFDA 1A8EA 1K9ZA 3SEUA 2BJIA 2ZNSA 3TUSA 3ILUB 4OFLA 4P0GA 1EZPA 4R6YA 1LBBA 4EUOA 2F3BA 4U1OA 1NNFA 5DT6A 4QRZA 1FPIA 4NF0A 2D3IA 1KZ8A 2Y7WA 1SI1A 2RKMA 5KDTA 3DP6A 3T1BA 1SBPA 3TMGA 4MEVA 1MY1A 3HHFA 4ND9A 4TOZA 4XKRA 2FIXA 2V93A 3H3GA 1B1HA 1US5A 3EHSA 5FHMA 1MQHA 2FIEA 1Y4CA 3KBRA 1WVJA 4IO4A 5F1QA 3K2DA 2XXHA 3KJTA 4RPOA 4ZE8A 2H99A 4P47A 3E9XA 1O7TA 1MY4A 4OXVA 2PT2A 3DLNA 4RXLA 1SPIA 4H6DA 1SW5A 2A5SA 4OZ9A 3TTRA 3OO9A 3U1OA 3H6VA 3GXAA 4BLAA 4FIMA 4N13A 1A55A 4PCDA 5B70A 4G61A 3H6TA 1II5A 5B7DA 2F36A 3KN7A 5FTIA 1NV1A 4NGUA 4Q5TA 3MWBA 1MH4A 2QVUA 4G68B 1VDWA 2H4IA 4P8BA 2NOOA 4F3BA 3W15C 1XVYA 1UTBA 3LUYA 4WXJA 1MQDA 5ICQA 3SESA 3G3GA 3S4UA 3T22A 4IY5A 5JEIA 2UYFA 4Q8RA 1FPKA 4FBPA 2PX1A 3JYRA 5FTHA 1FPEA 1IMFA 2VPNA 1Y1MA 2V84A 3OEMA 3IAZA 3TPAA 1QUJA 3EQ1A 3K00A 3QK6A 1FTJA 3PD9A 1LGBC 4P3LA 1RYOA 1HSEA 3KC0A 1Y3QA 2GQ1A 4DXUA 4OVJA 2X7QA 3LSXA 4IO6A 4ELPA 3PMVA 4BDOA 3I5OA 1ZJLA 4EQBA 2DQVA 4H65A 3N6TA 2KR0A 4XIGQ 3MVZA 4JVDA 1P1UA 4PBHA 3FJ7A 4H8JA 4N4UA 3FATA 1F9BA 2WKYA 4JBZA 2X26A 2DWIA 4YB6A 3Q29A 4GD5A 2REJA 5CC2A 4P1EA 4OHNA 4JWYA 1FTAA 1FBPA 2NXOA 2XXRA 3OO6A 4TLLB 3FJGA 3B50A 3MP6A 1IEJA 2F78A 2B3BA 4KYDA 2RC9A 4K3FA 3IK6B 1FJ6A 1H76A 1BLFA 3H4ZA 3OENA 3LSLA 3EHUA 3VV5A 1UTBB 1NUYA 1B3FA 3KN8A 1FTMA 2R8TA 4RK2A 2LAOA 4NF4A 4ESWA 2FA7A 1EH3A 2WBDA 3FV2A 3TCGA 4PFWA 3EN3A 3MSTA 3BFUA 4X9TA 1EU8A 4O7MA 1GVCA 1Y9UA 4I40A 3LUZA 2HZKA 1SD3A 4KI0E 4GBVA 1DPPA 3UP9A 1ELJA 2UVIA 2XXPA 2DVZA 1MY3A 3M3FA 3VVDA 1Z7ME 5I2NA 3HFUA 4X1BA 5DVFA 1UIUA 1YXIA 1B1XA 1A99A 4I9DA 1LCFA 4X04A 1LAFE 2I3WA 3RYDA 2MKZA 1Y20A 1NKXA 4XEQA 1QUIA 3LSFB 1FQFA 5JTYA 3U8QA 1DPEA 5I3SA 3O6GA 1NMUA 4HTGA 4DDDA 4PFIA 4IO2A 5L9SA 4ECFA 3E78A 4ZZEA 2ZXTA 2QVRA 5IZ1A 4UABA 2ZYOA 1P1WA 4E0WA 3HO7A 1R9QA 5I2KA 4MNPA 1YTVA 1J1NA 4EXKA 3R26A 2PFYA 4M4GA 2H5YA 1JW5A 3KFMA 3EKIA 2QMWA 2OWSA 4MF3A 5AA2B 2NUVA 3QUJA 2ZZXA 3GBAA 4G2ZA 4H1XA 4QSCA 4L17A 3D4GA 1B3EA 1LFGA 4R72A 4R2FA 2AL5A 1ZU0A 4R6HA 5H8FA 4GXSB 1M5EA 3RTWB 5CBRA 4IY6A 1MG1A 4NF8A 5IZ3B 4EF1A 3S9EA 5AA3A 4GWOA 2V3UA 3GYYA 4MLVA 3RPWA 2F6GA 2REGA 2FBPA 2OWZA 2Q89A 1YZ0A 3HPIA 2AYSA 1Y1ZA 1PB7A 5EQ9A 5ELVA 5I84A 2RC7A 4X48A 4EF2A 3FASA 4JVCA 1MY2A 4JWXA 5JTYB 1H43A 1VFDA 4H0WA 2Y5LA 1RKMA 1NNKA 2Q74A 2UVJA 4LZ5A 4PFBA 4I3YA 3KC1A 2ONSA 5ET8A 2QSXA 2R9JA 2F97A 1K9YA 4I8CA 3TODA 4UACA 3U65A 1IMDA 3MQ9A 4PAFA 5CM6A 5K2YA 1EYKA 3OSQA 1LB8A 2CEXA 2F6PA 3T66A 3G3JA 4BDLA 5IAIA 5I2KB 3EPEA 4EXLA 3FXQA 1AL3A 3TCFA 2GFEA 3GBBA 2O1MA 3TTMA 2XHDA 3O6IA 2ANJA 1LBYA 2G93A 2QS2A 2F7CA 1AOVA 3O29A 3B6QA 3IJOB 1FQAA 3UIFA 2DDKA 4KR5A 3RLFE 2XXQA 4MNIA 1DTGA 4F2OA 3BBRA 3MW0A 1MXYA 1M5DA 5IKBA 2DVCA 1MPCA 3BKIB 4X8RA 5H8FB 3FBPA 4Q30B 1FCKA 1AWBA 1N04A 4O7IA 2CZIA 4FECA 4NEDA 3V89B 1LCTA 2XXXA 1FSAA
chains in the Genus database with same CATH topology
1GGGA 3HN0A 4XTCQ 4U4SA 3LC8A 3C32A 2O51A 2I3VA 3SKPA 3MPKA 4GXAA 5TPAA 4G77A 1S7YA 3H6UA 5K2XA 4U1ZA 3KSXA 2A5TA 1H45A 2FNCA 3BFTA 3PV0E 1AMFA 2O1LA 4KYSA 3U92A 2H9BA 3D4CA 4AB6A 4ZS9A 3VVFA 4WEPA 2M8CA 1ATGA 3TQWA 2H25A 1MPDA 5H8SA 1D4NA 5DVJA 1SQYA 5CMMA 3FGSA 3K6VA 5AA1A 2X7PA 2Y7KA 1TFAA 3E3KA 4F18A 3ILTB 2O84X 4JSOA 2DSFA 1MXUA 1O63A 2OBGA 3R7XA 1IXCA 5DEXA 2IEEA 4F1YA 2YLNA 5ICTA 1LAHE 4R74A 1UTHB 4IGRA 2F8DA 4YZZA 2KLFA 2Y7RA 5HM4B 4R2BA 2DXRA 2F35A 3K02A 2OJTA 3E13X 3TTLA 2HEUA 1ZIUA 1B05A 3MP8A 5A5XA 3M3LA 1BP5A 3S9NC 4KQPA 1MDP1 3IL1B 1B0LA 4YKKA 4F2QA 1NH7A 4N07A 4PFYA 4LONB 4OFJA 3PMWA 2Z8FA 2H98A 5L8DA 1B6HA 5KCJB 3E4RA 2A5TB 2RCBA 4DIGA 4N6PA 4F1VA 1R6ZA 3GZGA 4WEDA 3MAMA 3DP8A 1USYE 1POY1 1JNFA 1BTJA 2NWJA 4AQ4A 3T96B 3VFJA 3B6TA 1DTZA 1VR5A 4LQ2A 4Z0IA 4RJZA 3K1PA 1MS7A 5DEXB 1S50A 3AXFA 3G7WA 1URDA 3G3KA 1QUKA 3DM0A 3IB0A 3K0VA 4G8NA 5L9OA 1R1NA 5H8HA 1ZKBA 1M5BA 4U4XA 3KOTA 4RYAA 1B52A 3OEKA 1ANFA 4KD5A 1OQGA 5A5XB 1Y3NA 4PFUA 4QFLA 5KDTB 3FIRA 3L6GA 2VD3A 2GRVA 2ABHA 3QIMA 2DWJA 1N7WA 1B3HA 2D5WA 4P11A 4ISUA 4FORA 2CMOA 3HV1A 3K1MA 3CI8A 3MVYA 1DSNA 2GH9A 3B6WA 1MH3A 4KFQA 2UXAA 3UGWA 3KZGA 1LFHA 1FTKA 3HCQA 3U72A 3V5AA 4ELQA 2Q2CA 1IZ1A 2GHAA 5TU0A 3OXNA 1N84A 4AB5A 3RT6B 3R6UA 1H3DA 3MVXA 2DOJA 3PU5A 4ZECA 2QS3A 1LAXA 4G4PA 1QKAA 3PUYE 3PUZE 2HAUA 5EHMA 4LA9A 2D21A 3WAEA 3N5LA 2I48A 3U93A 2I49A 3ODBA 1MXZA 2Y7PA 3Q28A 4FATA 3TZAA 3VLUA 2DWHA 3G3IA 4R9GA 2F7AA 1HSLA 2XX7A 3OELA 4IO5A 3O66A 3TELA 1POTA 3LR1A 4U21A 4FEBA 4OEVA 2HFBA 1MQIA 3O2AA 4MBPA 3T9XB 3ZKLA 4HCYA 4OERA 3T9UA 4F1UA 2XXTA 5HPQA 3FV1A 4QF9A 3CG1A 2QMXA 4HCWA 1B4HA 4YKJA 4R75A 1OQHA 2ZYNA 1Z7NE 4RK9A 3M8UA 1MY0A 1IQ7A 2I0CA 1Y4TA 1XS5A 3WAFA 1B40A 3MC2A 3FUZA 3O6HA 4ZEDA 2QS4A 3PPNA 2DYXA 4R6KA 4GLIA 1DOTA 4POWA 4QFKA 3P7IA 4YKIA 1D3KA 3TCHA 3FVNA 1GR2A 3V83A 2DE3A 3MBPA 3TDJA 4RA1A 1P1OA 4QSDA 1FQEA 5CMBA 4OWDA 1M5FA 4BDRA 4ZEKA 4LUBA 2R6GE 3OO7A 1B0HA 5HBCA 2W7YA 4FJPA 3H6WA 4DCYA 4NE4A 1B46A 4NF4B 3DELB 2RF1A 3ECRA 3A09A 5CI5A 1JVXA 2XXYA 4ESXA 4QFOA 3MUQA 4ELRA 2V3QA 3ZSFA 3RN8A 2ZYMA 3OOAA 4TLMB 4YU0A 3SEVA 3LSWA 3TYHA 3GLBA 3OSRA 3C4MA 3HSTA 2XXUA 2HCAA 1JVYA 4PP0A 3CSBA 5ISUA 3CFLA 5I2NB 4MH5A 1IIWA 3ONMA 5AA4A 1FQBA 1ZBMA 1N7XA 1FQCA 5ITOA 5I56A 2OCUA 2PVUA 2QS1A 1MQGA 3MJNA 1XOCA 4DXCA 4F3PA 3LBSA 5CMCA 5I59A 2VD2A 3TTKA 1URGA 1IXHA 1B7HA 1B32A 3TFLA 4KCCA 2PT1A 3IOUA 5CMKA 1DMBA 2I4BA 1N3XA 1B5HA 3PUXE 4WKMA 4NF5A 3UN6A 1NFTA 2PBWA 1T0KA 3C9HA 5CRYA 2P2AA 5BWJA 4POXA 1GV8A 2V25A 3PPOA 3UK4A 3C36A 3RUMA 2Y84A 1UIVA 1B9JA 1XVXA 3ZKKA 3A3UA 2ONRA 4THIA 1R9LA 1S9TA 5CBSA 3Q27A 2DWAA 3RGYA 4X1DA 3PD8A 4OQOA 3RQTA 4NF8B 4RPNA 2AL4A 1PB8A 1US4A 1IXIA 2I0BA 1IITA 3FD3A 5H8QA 5I56B 4YKPA 3IOTA 4C1TA 3VE1B 4ZE9A 2YJPA 4U2RA 4DXBA 5DYHA 4YB5A 2OLBA 1UQWA 2O6AA 3QSLA 5I59B 1MQJA 1D9VA 1PC3A 2Q2AA 4Z7EA 3SEXA 4QHQA 3UA8A 2P1SA 4HW8A 3VDFA 1I6QA 2UVGA 2O7IA 5FHOA 3CFXA 4O3CA 3VXCA 3FJMA 3TKDA 2THIA 3UORA 4OMBA 5BUUA 1BIYA 2XX9A 1MXXA 3N26A 4YMAA 2IA4A 1MDQA 3EHTA 1B3GA 3OMBA 1LLSA 2Q88A 4O3AA 2QPQA 3N6UA 4QFNA 2O68A 2G29A 1EZOA 1MXWA 3H7MA 3K1NA 5JK4A 2DXYA 1SYIA 4G68A 4IB2A 4ZZAA 3I6VA 4GRKA 4KCDA 4H5GA 3RY3A 1OMPA 1YCJA 5I57A 5ITPA 2FYIA 1IXGA 2ONKE 2QRYA 5H8QB 4BDNA 1QULA 1B2HA 1ZMGA 2DE4A 2PYYA 4H5FA 5TPAB 3QYTA 4HS7A 4TQUQ 1SVXB 1SW1A 4QFPA 1PEBA 3IB2A 4KHZE 4ZEBA 3KN3A 1B5IA 1B7UA 2B3FA 3W9WA 4IGTA 1A8FA 4OFOA 4LQ5A 2VHAA 2HZLA 3SERA 2ZNUA 3KGCA 1B5JA 3K01A 3CSGA 4EQ7A 5J1DA 3KSJA 3T93B 1Q35A 3PUVE 4YB7A 3MZ9A 3MP1A 3N94A 4GL0A 2QL3A 3FVOA 3B7DA 1B7ZA 5I58A 3C33A 1AH5A 3SEYA 1GTKA 1SI0A 1Y3PA 4G8HA 4O3BA 2VP1A 4C1UA 4M1VA 1OVTA 4LATA 4RY1A 3PPRA 1OIBA 3K6WA 2XD2A 3FZVA 1NL5A 5DVIA 2ESNA 3W9VA 2RC8A 1NNTA 3C35A 2Z8EA 2DS9A 3THIA 1ZTYA 1CE2A 5I57B 3CG3A 3HHGA 4EDPA 3G3HA 1OVBA 4G68C 4F3SA 1A7LA 2R71A 3CRBA 4GFRA 1I6AA 2ZYKA 1P1QA 1LFIA 3IB1A 3U94A 3PPQA 4XXUA 5F7VA 1MPBA 2HQ0A 1HSJA 2I6EA 4I62A 3I3VA 4DE8A 4F3GA 3FVKA 3QAXA 3OO8A 4FAJA 4E0XA 4GL8A 4FE8A 1EZ9A 4C0RA 3ZS6A 2O69A 4IO7A 1B51A 3VLVA 5I58B 1WODA 1YPNA 1FTLA 2Z23A 3IJXB 2F7BA 4KYEA 1XC1A 5H8HB 2E0SA 3MZBA 3IOVA 3MVWA 2E1SA 2UYEA 1PBQA 1USYH 4F19A 2DP8A 3S9LC 2XXVA 1D9YA 1TXFA 2F5XA 4GF8A 2ZNTA 4NWCA 3CR9A 1I69A 3CVGA 4NTLA 3RT8A 1FW0A 3RTFB 1SW4A 3PPPA 4EQ9A 5AA2A 5AE4A 1B4ZA 3TTNA 4JSDA 1O64A 3TAJA 4ZDMA 4YICA 5LOMA 3C34A 1LBCA 1N0TA 4G8MA 2Z8DA 5EHSA 1N3WA 2RINA 2YPNA 2UVHA 2OWTA 4U22A 2V3TA 4F31B 4OEUA 4H67A 2PMSA 4FEDA 1FQDA 1M5CA 1VE4A 5KZTA 1MXVA 3S2VA 3Q25A 4OETA 4BDQA 1ZLQA 2AIXA 4F39A 4KPTA 5FHNA 2I58A 4GIZA 4OESA 4LVQA 3Q26A 4PQJA 3F11A 1TT1A 2DE2A 3H03A 2OK2A 1OLAA 3IO4A 4PFTA 4YMBA 2Z22A 4XKQA 1JEVA 4OTEA 4PE5B 1YAEA 1FTOA 4PETA 3K4UA 3KOSA 3IO6A 3CFZA 4F22A 3DP4A 1P99A 4I1DA 3IORA 4ELOA 4H8IA 3KEIA 3PGFA 3K6XA 4XKNA 1IUDA 1I6BA 4JWOA 5DTBA 1B58A 3O28A 4QSEA 1QKBA 4JDFA 3IOWA 3MPLA 2HXWA 2Q9TA 1JW4A 3QUFA 3A3CA 1XHYA 5TP9A 4ZEFA 1VFEA 1CB6A 5H8NA 1A40A 4U23A 4MLQA 3O9PA 2CZLA 1MM6A 2P0SA 3M3KA 1H44A 1JEUA 3RNNA 3SDFA 3KJ7A 1LB9A 3PMXA 4ZEIA 2Q8JA 4BDMA 1SW2A 2NVUB 3TQLA 3V8XB 4OENA 2XX8A 2ZMBA 1P1NA 3VXBA 3G3FA 2XXIA 1PB9A 1WDNA 3KG2A 1LSTA 2Y7IA 1QVSA 3SEWA 2OZZA 3FVGA 3CIJA 3L6HA 1URSA 2O7UA 4LZ8A 2RCAA 3TEPA 4R9FA 4XKPA 1LAGE 1KWHA 3FXUA 3EF7A 4UA8A 3O97A 1VSOA 3T9VA 1BKAA 2BJJX 2XXWA 3C31A 4NF6A 4F29A 4RNSA 1TWYA 2QJEA 3H06B 3JZJA 1N76A 1NH8A 2VOZA 1QW0A 4LP2B 4OYVA 1UTHA 4MFIA 4NWDA 1PDAA 2VGQA 2I4CA 4JB7A 1QJMA 4P0IA 5AA4B 1RYXA 5TP9B 3JV9A 4YAHX 5H8NB 3T9HB 3QXMA 4GVOA 4R73A 4JXIA 1Q1KA 4GOTA 1B3LA 2F34A 4IO3A 1JETA 5AA2D 3OD7A 5EYFA 1MM7A 3IX1A 5KCJA 5M2VA 3SETA 3VVEA 4NF5B 3S9MC 1L5TA 4NMYA 2B65A 1A54A 1SYHA 1JW1A 5L9MA 3PUWE 1NNPA 2GHBA 1PBPA 1OLCA 4DLDA 3K6UA 4GQOA 4ONYA 4DCXA 1AIVA 3FXRA 4LZ7A 2XD3A 1XT8A 1SDXA 4NF6B 1JQFA 3USDA 3VLWA 2HAVA 3MZ1A 4Q0CA 2ALUA 3IR1A 4DZ1A 1MRPA 1TFDA 1A8EA 3SEUA 2ZNSA 3TUSA 3ILUB 4OFLA 4P0GA 1EZPA 4R6YA 1LBBA 4EUOA 4U1OA 1NNFA 5DT6A 4QRZA 2D3IA 2Y7WA 1SI1A 2RKMA 5KDTA 3DP6A 1SBPA 3TMGA 1MY1A 3HHFA 4ND9A 4TOZA 4XKRA 3H3GA 2V93A 1B1HA 1US5A 3EHSA 5FHMA 1MQHA 1Y4CA 3KBRA 1WVJA 4IO4A 5F1QA 3K2DA 2XXHA 3KJTA 4RPOA 4ZE8A 2H99A 3E9XA 1O7TA 1MY4A 4OXVA 2PT2A 3DLNA 4RXLA 4H6DA 1SW5A 2A5SA 4OZ9A 3TTRA 3OO9A 3U1OA 3H6VA 3GXAA 4BLAA 4FIMA 4N13A 1A55A 5B70A 3H6TA 1II5A 5B7DA 2F36A 3KN7A 5FTIA 4Q5TA 3MWBA 1MH4A 4G68B 2H4IA 2NOOA 4F3BA 3W15C 1XVYA 1UTBA 3LUYA 4WXJA 1MQDA 5ICQA 3SESA 3G3GA 3S4UA 3T22A 4IY5A 5JEIA 2UYFA 4Q8RA 2PX1A 3JYRA 5FTHA 1Y1MA 2V84A 3OEMA 3IAZA 3TPAA 1QUJA 3EQ1A 3K00A 3QK6A 1FTJA 3PD9A 1LGBC 1RYOA 1HSEA 1Y3QA 4DXUA 4OVJA 2X7QA 3LSXA 4IO6A 4ELPA 3PMVA 4BDOA 3I5OA 1ZJLA 4EQBA 2DQVA 4H65A 3N6TA 4XIGQ 3MVZA 1P1UA 3FJ7A 4H8JA 3FATA 1F9BA 2WKYA 4JBZA 2X26A 2DWIA 4YB6A 3Q29A 4GD5A 2REJA 5CC2A 4OHNA 4JWYA 2NXOA 2XXRA 3OO6A 4TLLB 3FJGA 3MP6A 1IEJA 2F78A 2B3BA 4KYDA 2RC9A 4K3FA 3IK6B 1H76A 1BLFA 3H4ZA 3OENA 3LSLA 3EHUA 3VV5A 1UTBB 1B3FA 3KN8A 1FTMA 4RK2A 2LAOA 4NF4A 4ESWA 2FA7A 1EH3A 3FV2A 3TCGA 4PFWA 3EN3A 3BFUA 4X9TA 1EU8A 1GVCA 1Y9UA 2HZKA 1SD3A 4KI0E 1DPPA 3UP9A 1ELJA 2UVIA 2XXPA 2DVZA 1MY3A 3M3FA 3VVDA 1Z7ME 5I2NA 4X1BA 5DVFA 1UIUA 1B1XA 1A99A 4I9DA 1LCFA 1LAFE 2I3WA 1Y20A 1NKXA 1QUIA 3LSFB 1FQFA 5JTYA 3U8QA 1DPEA 3O6GA 1NMUA 4HTGA 4DDDA 4IO2A 5L9SA 4ECFA 4ZZEA 2ZXTA 2ZYOA 1P1WA 4E0WA 3HO7A 1R9QA 5I2KA 1YTVA 1J1NA 4EXKA 3R26A 4M4GA 2H5YA 1JW5A 3KFMA 2QMWA 2OWSA 4MF3A 5AA2B 2NUVA 3QUJA 3GBAA 4G2ZA 4H1XA 4QSCA 4L17A 3D4GA 1B3EA 1LFGA 4R72A 4R2FA 2AL5A 1ZU0A 4R6HA 5H8FA 4GXSB 1M5EA 3RTWB 5CBRA 4IY6A 1MG1A 4NF8A 4EF1A 3S9EA 5AA3A 4GWOA 2V3UA 4MLVA 3RPWA 2F6GA 2REGA 2Q89A 3HPIA 2AYSA 1Y1ZA 1PB7A 5ELVA 5I84A 2RC7A 4X48A 4EF2A 3FASA 1MY2A 4JWXA 5JTYB 1H43A 1VFDA 4H0WA 1RKMA 1NNKA 2UVJA 4LZ5A 2ONSA 2QSXA 2R9JA 2F97A 4I8CA 3TODA 4UACA 3MQ9A 5CM6A 5K2YA 3OSQA 1LB8A 2F6PA 3T66A 3G3JA 4BDLA 5IAIA 5I2KB 3EPEA 4EXLA 3FXQA 1AL3A 3TCFA 2GFEA 3GBBA 2O1MA 3TTMA 2XHDA 3O6IA 2ANJA 2G93A 2QS2A 2F7CA 1AOVA 3O29A 3B6QA 3IJOB 1FQAA 3UIFA 4KR5A 3RLFE 2XXQA 1DTGA 4F2OA 3BBRA 3MW0A 1MXYA 1M5DA 5IKBA 2DVCA 1MPCA 3BKIB 5H8FB 4Q30B 1FCKA 1N04A 4FECA 4NEDA 3V89B 1LCTA 2XXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GGG A;  3HN0 A;  4XTC Q;  4U4S A;  3LC8 A;  3C32 A;  2O51 A;  2I3V A;  3SKP A;  3MPK A;  4GXA A;  5TPA A;  4G77 A;  1S7Y A;  3H6U A;  5K2X A;  4U1Z A;  3KSX A;  2A5T A;  1H45 A;  2FNC A;  3BFT A;  3PV0 E;  1AMF A;  2O1L A;  4KYS A;  3U92 A;  2H9B A;  3D4C A;  4AB6 A;  4ZS9 A;  3VVF A;  4WEP A;  2M8C A;  1ATG A;  3TQW A;  2H25 A;  1MPD A;  5H8S A;  1D4N A;  5DVJ A;  1SQY A;  5CMM A;  3FGS A;  3K6V A;  5AA1 A;  2X7P A;  2Y7K A;  1TFA A;  3E3K A;  4F18 A;  3ILT B;  2O84 X;  4JSO A;  2DSF A;  1MXU A;  1O63 A;  2OBG A;  3R7X A;  1IXC A;  5DEX A;  2IEE A;  4F1Y A;  2YLN A;  5ICT A;  1LAH E;  4R74 A;  1UTH B;  4IGR A;  2F8D A;  4YZZ A;  2KLF A;  2Y7R A;  5HM4 B;  4R2B A;  2DXR A;  2F35 A;  3K02 A;  2OJT A;  3E13 X;  3TTL A;  2HEU A;  1ZIU A;  1B05 A;  3MP8 A;  5A5X A;  3M3L A;  1BP5 A;  3S9N C;  4KQP A;  1MDP 1;  3IL1 B;  1B0L A;  4YKK A;  4F2Q A;  1NH7 A;  4N07 A;  4PFY A;  4LON B;  4OFJ A;  3PMW A;  2Z8F A;  2H98 A;  5L8D A;  1B6H A;  5KCJ B;  3E4R A;  2A5T B;  2RCB A;  4DIG A;  4N6P A;  4F1V A;  1R6Z A;  3GZG A;  4WED A;  3MAM A;  3DP8 A;  1USY E;  1POY 1;  1JNF A;  1BTJ A;  2NWJ A;  4AQ4 A;  3T96 B;  3VFJ A;  3B6T A;  1DTZ A;  1VR5 A;  4LQ2 A;  4Z0I A;  4RJZ A;  3K1P A;  1MS7 A;  5DEX B;  1S50 A;  3AXF A;  3G7W A;  1URD A;  3G3K A;  1QUK A;  3DM0 A;  3IB0 A;  3K0V A;  4G8N A;  5L9O A;  1R1N A;  5H8H A;  1ZKB A;  1M5B A;  4U4X A;  3KOT A;  4RYA A;  1B52 A;  3OEK A;  1ANF A;  4KD5 A;  1OQG A;  5A5X B;  1Y3N A;  4PFU A;  4QFL A;  5KDT B;  3FIR A;  3L6G A;  2VD3 A;  2GRV A;  2ABH A;  3QIM A;  2DWJ A;  1N7W A;  1B3H A;  2D5W A;  4P11 A;  4ISU A;  4FOR A;  2CMO A;  3HV1 A;  3K1M A;  3CI8 A;  3MVY A;  1DSN A;  2GH9 A;  3B6W A;  1MH3 A;  4KFQ A;  2UXA A;  3UGW A;  3KZG A;  1LFH A;  1FTK A;  3HCQ A;  3U72 A;  3V5A A;  4ELQ A;  2Q2C A;  1IZ1 A;  2GHA A;  5TU0 A;  3OXN A;  1N84 A;  4AB5 A;  3RT6 B;  3R6U A;  1H3D A;  3MVX A;  2DOJ A;  3PU5 A;  4ZEC A;  2QS3 A;  1LAX A;  4G4P A;  1QKA A;  3PUY E;  3PUZ E;  2HAU A;  5EHM A;  4LA9 A;  2D21 A;  3WAE A;  3N5L A;  2I48 A;  3U93 A;  2I49 A;  3ODB A;  1MXZ A;  2Y7P A;  3Q28 A;  4FAT A;  3TZA A;  3VLU A;  2DWH A;  3G3I A;  4R9G A;  2F7A A;  1HSL A;  2XX7 A;  3OEL A;  4IO5 A;  3O66 A;  3TEL A;  1POT A;  3LR1 A;  4U21 A;  4FEB A;  4OEV A;  2HFB A;  1MQI A;  3O2A A;  4MBP A;  3T9X B;  3ZKL A;  4HCY A;  4OER A;  3T9U A;  4F1U A;  2XXT A;  5HPQ A;  3FV1 A;  4QF9 A;  3CG1 A;  2QMX A;  4HCW A;  1B4H A;  4YKJ A;  4R75 A;  1OQH A;  2ZYN A;  1Z7N E;  4RK9 A;  3M8U A;  1MY0 A;  1IQ7 A;  2I0C A;  1Y4T A;  1XS5 A;  3WAF A;  1B40 A;  3MC2 A;  3FUZ A;  3O6H A;  4ZED A;  2QS4 A;  3PPN A;  2DYX A;  4R6K A;  4GLI A;  1DOT A;  4POW A;  4QFK A;  3P7I A;  4YKI A;  1D3K A;  3TCH A;  3FVN A;  1GR2 A;  3V83 A;  2DE3 A;  3MBP A;  3TDJ A;  4RA1 A;  1P1O A;  4QSD A;  1FQE A;  5CMB A;  4OWD A;  1M5F A;  4BDR A;  4ZEK A;  4LUB A;  2R6G E;  3OO7 A;  1B0H A;  5HBC A;  2W7Y A;  4FJP A;  3H6W A;  4DCY A;  4NE4 A;  1B46 A;  4NF4 B;  3DEL B;  2RF1 A;  3ECR A;  3A09 A;  5CI5 A;  1JVX A;  2XXY A;  4ESX A;  4QFO A;  3MUQ A;  4ELR A;  2V3Q A;  3ZSF A;  3RN8 A;  2ZYM A;  3OOA A;  4TLM B;  4YU0 A;  3SEV A;  3LSW A;  3TYH A;  3GLB A;  3OSR A;  3C4M A;  3HST A;  2XXU A;  2HCA A;  1JVY A;  4PP0 A;  3CSB A;  5ISU A;  3CFL A;  5I2N B;  4MH5 A;  1IIW A;  3ONM A;  5AA4 A;  1FQB A;  1ZBM A;  1N7X A;  1FQC A;  5ITO A;  5I56 A;  2OCU A;  2PVU A;  2QS1 A;  1MQG A;  3MJN A;  1XOC A;  4DXC A;  4F3P A;  3LBS A;  5CMC A;  5I59 A;  2VD2 A;  3TTK A;  1URG A;  1IXH A;  1B7H A;  1B32 A;  3TFL A;  4KCC A;  2PT1 A;  3IOU A;  5CMK A;  1DMB A;  2I4B A;  1N3X A;  1B5H A;  3PUX E;  4WKM A;  4NF5 A;  3UN6 A;  1NFT A;  2PBW A;  1T0K A;  3C9H A;  5CRY A;  2P2A A;  5BWJ A;  4POX A;  1GV8 A;  2V25 A;  3PPO A;  3UK4 A;  3C36 A;  3RUM A;  2Y84 A;  1UIV A;  1B9J A;  1XVX A;  3ZKK A;  3A3U A;  2ONR A;  4THI A;  1R9L A;  1S9T A;  5CBS A;  3Q27 A;  2DWA A;  3RGY A;  4X1D A;  3PD8 A;  4OQO A;  3RQT A;  4NF8 B;  4RPN A;  2AL4 A;  1PB8 A;  1US4 A;  1IXI A;  2I0B A;  1IIT A;  3FD3 A;  5H8Q A;  5I56 B;  4YKP A;  3IOT A;  4C1T A;  3VE1 B;  4ZE9 A;  2YJP A;  4U2R A;  4DXB A;  5DYH A;  4YB5 A;  2OLB A;  1UQW A;  2O6A A;  3QSL A;  5I59 B;  1MQJ A;  1D9V A;  1PC3 A;  2Q2A A;  4Z7E A;  3SEX A;  4QHQ A;  3UA8 A;  2P1S A;  4HW8 A;  3VDF A;  1I6Q A;  2UVG A;  2O7I A;  5FHO A;  3CFX A;  4O3C A;  3VXC A;  3FJM A;  3TKD A;  2THI A;  3UOR A;  4OMB A;  5BUU A;  1BIY A;  2XX9 A;  1MXX A;  3N26 A;  4YMA A;  2IA4 A;  1MDQ A;  3EHT A;  1B3G A;  3OMB A;  1LLS A;  2Q88 A;  4O3A A;  2QPQ A;  3N6U A;  4QFN A;  2O68 A;  2G29 A;  1EZO A;  1MXW A;  3H7M A;  3K1N A;  5JK4 A;  2DXY A;  1SYI A;  4G68 A;  4IB2 A;  4ZZA A;  3I6V A;  4GRK A;  4KCD A;  4H5G A;  3RY3 A;  1OMP A;  1YCJ A;  5I57 A;  5ITP A;  2FYI A;  1IXG A;  2ONK E;  2QRY A;  5H8Q B;  4BDN A;  1QUL A;  1B2H A;  1ZMG A;  2DE4 A;  2PYY A;  4H5F A;  5TPA B;  3QYT A;  4HS7 A;  4TQU Q;  1SVX B;  1SW1 A;  4QFP A;  1PEB A;  3IB2 A;  4KHZ E;  4ZEB A;  3KN3 A;  1B5I A;  1B7U A;  2B3F A;  3W9W A;  4IGT A;  1A8F A;  4OFO A;  4LQ5 A;  2VHA A;  2HZL A;  3SER A;  2ZNU A;  3KGC A;  1B5J A;  3K01 A;  3CSG A;  4EQ7 A;  5J1D A;  3KSJ A;  3T93 B;  1Q35 A;  3PUV E;  4YB7 A;  3MZ9 A;  3MP1 A;  3N94 A;  4GL0 A;  2QL3 A;  3FVO A;  3B7D A;  1B7Z A;  5I58 A;  3C33 A;  1AH5 A;  3SEY A;  1GTK A;  1SI0 A;  1Y3P A;  4G8H A;  4O3B A;  2VP1 A;  4C1U A;  4M1V A;  1OVT A;  4LAT A;  4RY1 A;  3PPR A;  1OIB A;  3K6W A;  2XD2 A;  3FZV A;  1NL5 A;  5DVI A;  2ESN A;  3W9V A;  2RC8 A;  1NNT A;  3C35 A;  2Z8E A;  2DS9 A;  3THI A;  1ZTY A;  1CE2 A;  5I57 B;  3CG3 A;  3HHG A;  4EDP A;  3G3H A;  1OVB A;  4G68 C;  4F3S A;  1A7L A;  2R71 A;  3CRB A;  4GFR A;  1I6A A;  2ZYK A;  1P1Q A;  1LFI A;  3IB1 A;  3U94 A;  3PPQ A;  4XXU A;  5F7V A;  1MPB A;  2HQ0 A;  1HSJ A;  2I6E A;  4I62 A;  3I3V A;  4DE8 A;  4F3G A;  3FVK A;  3QAX A;  3OO8 A;  4FAJ A;  4E0X A;  4GL8 A;  4FE8 A;  1EZ9 A;  4C0R A;  3ZS6 A;  2O69 A;  4IO7 A;  1B51 A;  3VLV A;  5I58 B;  1WOD A;  1YPN A;  1FTL A;  2Z23 A;  3IJX B;  2F7B A;  4KYE A;  1XC1 A;  5H8H B;  2E0S A;  3MZB A;  3IOV A;  3MVW A;  2E1S A;  2UYE A;  1PBQ A;  1USY H;  4F19 A;  2DP8 A;  3S9L C;  2XXV A;  1D9Y A;  1TXF A;  2F5X A;  4GF8 A;  2ZNT A;  4NWC A;  3CR9 A;  1I69 A;  3CVG A;  4NTL A;  3RT8 A;  1FW0 A;  3RTF B;  1SW4 A;  3PPP A;  4EQ9 A;  5AA2 A;  5AE4 A;  1B4Z A;  3TTN A;  4JSD A;  1O64 A;  3TAJ A;  4ZDM A;  4YIC A;  5LOM A;  3C34 A;  1LBC A;  1N0T A;  4G8M A;  2Z8D A;  5EHS A;  1N3W A;  2RIN A;  2YPN A;  2UVH A;  2OWT A;  4U22 A;  2V3T A;  4F31 B;  4OEU A;  4H67 A;  2PMS A;  4FED A;  1FQD A;  1M5C A;  1VE4 A;  5KZT A;  1MXV A;  3S2V A;  3Q25 A;  4OET A;  4BDQ A;  1ZLQ A;  2AIX A;  4F39 A;  4KPT A;  5FHN A;  2I58 A;  4GIZ A;  4OES A;  4LVQ A;  3Q26 A;  4PQJ A;  3F11 A;  1TT1 A;  2DE2 A;  3H03 A;  2OK2 A;  1OLA A;  3IO4 A;  4PFT A;  4YMB A;  2Z22 A;  4XKQ A;  1JEV A;  4OTE A;  4PE5 B;  1YAE A;  1FTO A;  4PET A;  3K4U A;  3KOS A;  3IO6 A;  3CFZ A;  4F22 A;  3DP4 A;  1P99 A;  4I1D A;  3IOR A;  4ELO A;  4H8I A;  3KEI A;  3PGF A;  3K6X A;  4XKN A;  1IUD A;  1I6B A;  4JWO A;  5DTB A;  1B58 A;  3O28 A;  4QSE A;  1QKB A;  4JDF A;  3IOW A;  3MPL A;  2HXW A;  2Q9T A;  1JW4 A;  3QUF A;  3A3C A;  1XHY A;  5TP9 A;  4ZEF A;  1VFE A;  1CB6 A;  5H8N A;  1A40 A;  4U23 A;  4MLQ A;  3O9P A;  2CZL A;  1MM6 A;  2P0S A;  3M3K A;  1H44 A;  1JEU A;  3RNN A;  3SDF A;  3KJ7 A;  1LB9 A;  3PMX A;  4ZEI A;  2Q8J A;  4BDM A;  1SW2 A;  2NVU B;  3TQL A;  3V8X B;  4OEN A;  2XX8 A;  2ZMB A;  1P1N A;  3VXB A;  3G3F A;  2XXI A;  1PB9 A;  1WDN A;  3KG2 A;  1LST A;  2Y7I A;  1QVS A;  3SEW A;  2OZZ A;  3FVG A;  3CIJ A;  3L6H A;  1URS A;  2O7U A;  4LZ8 A;  2RCA A;  3TEP A;  4R9F A;  4XKP A;  1LAG E;  1KWH A;  3FXU A;  3EF7 A;  4UA8 A;  3O97 A;  1VSO A;  3T9V A;  1BKA A;  2BJJ X;  2XXW A;  3C31 A;  4NF6 A;  4F29 A;  4RNS A;  1TWY A;  2QJE A;  3H06 B;  3JZJ A;  1N76 A;  1NH8 A;  2VOZ A;  1QW0 A;  4LP2 B;  4OYV A;  1UTH A;  4MFI A;  4NWD A;  1PDA A;  2VGQ A;  2I4C A;  4JB7 A;  1QJM A;  4P0I A;  5AA4 B;  1RYX A;  5TP9 B;  3JV9 A;  4YAH X;  5H8N B;  3T9H B;  3QXM A;  4GVO A;  4R73 A;  4JXI A;  1Q1K A;  4GOT A;  1B3L A;  2F34 A;  4IO3 A;  1JET A;  5AA2 D;  3OD7 A;  5EYF A;  1MM7 A;  3IX1 A;  5KCJ A;  5M2V A;  3SET A;  3VVE A;  4NF5 B;  3S9M C;  1L5T A;  4NMY A;  2B65 A;  1A54 A;  1SYH A;  1JW1 A;  5L9M A;  3PUW E;  1NNP A;  2GHB A;  1PBP A;  1OLC A;  4DLD A;  3K6U A;  4GQO A;  4ONY A;  4DCX A;  1AIV A;  3FXR A;  4LZ7 A;  2XD3 A;  1XT8 A;  1SDX A;  4NF6 B;  1JQF A;  3USD A;  3VLW A;  2HAV A;  3MZ1 A;  4Q0C A;  2ALU A;  3IR1 A;  4DZ1 A;  1MRP A;  1TFD A;  1A8E A;  3SEU A;  2ZNS A;  3TUS A;  3ILU B;  4OFL A;  4P0G A;  1EZP A;  4R6Y A;  1LBB A;  4EUO A;  4U1O A;  1NNF A;  5DT6 A;  4QRZ A;  2D3I A;  2Y7W A;  1SI1 A;  2RKM A;  5KDT A;  3DP6 A;  1SBP A;  3TMG A;  1MY1 A;  3HHF A;  4ND9 A;  4TOZ A;  4XKR A;  3H3G A;  2V93 A;  1B1H A;  1US5 A;  3EHS A;  5FHM A;  1MQH A;  1Y4C A;  3KBR A;  1WVJ A;  4IO4 A;  5F1Q A;  3K2D A;  2XXH A;  3KJT A;  4RPO A;  4ZE8 A;  2H99 A;  3E9X A;  1O7T A;  1MY4 A;  4OXV A;  2PT2 A;  3DLN A;  4RXL A;  4H6D A;  1SW5 A;  2A5S A;  4OZ9 A;  3TTR A;  3OO9 A;  3U1O A;  3H6V A;  3GXA A;  4BLA A;  4FIM A;  4N13 A;  1A55 A;  5B70 A;  3H6T A;  1II5 A;  5B7D A;  2F36 A;  3KN7 A;  5FTI A;  4Q5T A;  3MWB A;  1MH4 A;  4G68 B;  2H4I A;  2NOO A;  4F3B A;  3W15 C;  1XVY A;  1UTB A;  3LUY A;  4WXJ A;  1MQD A;  5ICQ A;  3SES A;  3G3G A;  3S4U A;  3T22 A;  4IY5 A;  5JEI A;  2UYF A;  4Q8R A;  2PX1 A;  3JYR A;  5FTH A;  1Y1M A;  2V84 A;  3OEM A;  3IAZ A;  3TPA A;  1QUJ A;  3EQ1 A;  3K00 A;  3QK6 A;  1FTJ A;  3PD9 A;  1LGB C;  1RYO A;  1HSE A;  1Y3Q A;  4DXU A;  4OVJ A;  2X7Q A;  3LSX A;  4IO6 A;  4ELP A;  3PMV A;  4BDO A;  3I5O A;  1ZJL A;  4EQB A;  2DQV A;  4H65 A;  3N6T A;  4XIG Q;  3MVZ A;  1P1U A;  3FJ7 A;  4H8J A;  3FAT A;  1F9B A;  2WKY A;  4JBZ A;  2X26 A;  2DWI A;  4YB6 A;  3Q29 A;  4GD5 A;  2REJ A;  5CC2 A;  4OHN A;  4JWY A;  2NXO A;  2XXR A;  3OO6 A;  4TLL B;  3FJG A;  3MP6 A;  1IEJ A;  2F78 A;  2B3B A;  4KYD A;  2RC9 A;  4K3F A;  3IK6 B;  1H76 A;  1BLF A;  3H4Z A;  3OEN A;  3LSL A;  3EHU A;  3VV5 A;  1UTB B;  1B3F A;  3KN8 A;  1FTM A;  4RK2 A;  2LAO A;  4NF4 A;  4ESW A;  2FA7 A;  1EH3 A;  3FV2 A;  3TCG A;  4PFW A;  3EN3 A;  3BFU A;  4X9T A;  1EU8 A;  1GVC A;  1Y9U A;  2HZK A;  1SD3 A;  4KI0 E;  1DPP A;  3UP9 A;  1ELJ A;  2UVI A;  2XXP A;  2DVZ A;  1MY3 A;  3M3F A;  3VVD A;  1Z7M E;  5I2N A;  4X1B A;  5DVF A;  1UIU A;  1B1X A;  1A99 A;  4I9D A;  1LCF A;  1LAF E;  2I3W A;  1Y20 A;  1NKX A;  1QUI A;  3LSF B;  1FQF A;  5JTY A;  3U8Q A;  1DPE A;  3O6G A;  1NMU A;  4HTG A;  4DDD A;  4IO2 A;  5L9S A;  4ECF A;  4ZZE A;  2ZXT A;  2ZYO A;  1P1W A;  4E0W A;  3HO7 A;  1R9Q A;  5I2K A;  1YTV A;  1J1N A;  4EXK A;  3R26 A;  4M4G A;  2H5Y A;  1JW5 A;  3KFM A;  2QMW A;  2OWS A;  4MF3 A;  5AA2 B;  2NUV A;  3QUJ A;  3GBA A;  4G2Z A;  4H1X A;  4QSC A;  4L17 A;  3D4G A;  1B3E A;  1LFG A;  4R72 A;  4R2F A;  2AL5 A;  1ZU0 A;  4R6H A;  5H8F A;  4GXS B;  1M5E A;  3RTW B;  5CBR A;  4IY6 A;  1MG1 A;  4NF8 A;  4EF1 A;  3S9E A;  5AA3 A;  4GWO A;  2V3U A;  4MLV A;  3RPW A;  2F6G A;  2REG A;  2Q89 A;  3HPI A;  2AYS A;  1Y1Z A;  1PB7 A;  5ELV A;  5I84 A;  2RC7 A;  4X48 A;  4EF2 A;  3FAS A;  1MY2 A;  4JWX A;  5JTY B;  1H43 A;  1VFD A;  4H0W A;  1RKM A;  1NNK A;  2UVJ A;  4LZ5 A;  2ONS A;  2QSX A;  2R9J A;  2F97 A;  4I8C A;  3TOD A;  4UAC A;  3MQ9 A;  5CM6 A;  5K2Y A;  3OSQ A;  1LB8 A;  2F6P A;  3T66 A;  3G3J A;  4BDL A;  5IAI A;  5I2K B;  3EPE A;  4EXL A;  3FXQ A;  1AL3 A;  3TCF A;  2GFE A;  3GBB A;  2O1M A;  3TTM A;  2XHD A;  3O6I A;  2ANJ A;  2G93 A;  2QS2 A;  2F7C A;  1AOV A;  3O29 A;  3B6Q A;  3IJO B;  1FQA A;  3UIF A;  4KR5 A;  3RLF E;  2XXQ A;  1DTG A;  4F2O A;  3BBR A;  3MW0 A;  1MXY A;  1M5D A;  5IKB A;  2DVC A;  1MPC A;  3BKI B;  5H8F B;  4Q30 B;  1FCK A;  1N04 A;  4FEC A;  4NED A;  3V89 B;  1LCT A;  2XXX A; 
#chains in the Genus database with same CATH topology
 1GGG A;  4GWY A;  3HN0 A;  4XTC Q;  4U4S A;  3LC8 A;  3C32 A;  2O51 A;  5IZZ A;  2I3V A;  3SKP A;  3MPK A;  4GXA A;  5TPA A;  4G77 A;  1S7Y A;  3H6U A;  5K2X A;  4U1Z A;  3KSX A;  2A5T A;  1H45 A;  2FNC A;  3BFT A;  3PV0 E;  4PE3 A;  1AMF A;  4PF6 A;  2O1L A;  4KYS A;  3U92 A;  2H9B A;  3D4C A;  3CHG A;  1QGX A;  4AB6 A;  4ZS9 A;  3VVF A;  4WEP A;  2M8C A;  1ATG A;  3TQW A;  2H25 A;  1MPD A;  5H8S A;  1D4N A;  2XWO A;  5DVJ A;  1SQY A;  5CMM A;  3FGS A;  1IMB A;  3K6V A;  5AA1 A;  2X7P A;  2Y7K A;  1TFA A;  3E3K A;  4F18 A;  1NUW A;  3ILT B;  1D9Q A;  2O84 X;  4JSO A;  2DSF A;  1MXU A;  1O63 A;  4HE1 A;  2OBG A;  3R7X A;  1IXC A;  5DEX A;  2IEE A;  4F1Y A;  2YLN A;  1IME A;  5ICT A;  1LAH E;  4R74 A;  1UTH B;  4IGR A;  2F8D A;  4YZZ A;  2KLF A;  2Y7R A;  5HM4 B;  4R2B A;  2DXR A;  3BIH A;  2F35 A;  2WX9 A;  3K02 A;  2OJT A;  3E13 X;  3TTL A;  2HEU A;  1ZIU A;  4GBW A;  4OVS A;  1B05 A;  3MP8 A;  5A5X A;  3M3L A;  2VPO A;  4N17 A;  1BP5 A;  4DI4 B;  3S9N C;  4KQP A;  1JP4 A;  1MDP 1;  1EYJ A;  3IL1 B;  1B0L A;  1LEV A;  4YKK A;  4F2Q A;  5EQ8 A;  1NH7 A;  4N07 A;  4PFY A;  4LON B;  4OFJ A;  3PMW A;  2Z8F A;  2H98 A;  5L8D A;  4GWS A;  1G0I A;  1B6H A;  5KCJ B;  3E4R A;  2A5T B;  2RCB A;  4DIG A;  4N6P A;  4F1V A;  1R6Z A;  1FPL A;  3GZG A;  4WED A;  3MAM A;  3DP8 A;  1USY E;  1FPD A;  1POY 1;  1JNF A;  4HE2 A;  1BTJ A;  2NWJ A;  4AQ4 A;  3T96 B;  3VFJ A;  3B6T A;  1DTZ A;  4HE0 A;  4PAI A;  1VR5 A;  4LQ2 A;  4Z0I A;  1FPF A;  4RJZ A;  3K1P A;  1MS7 A;  4KXP A;  5DEX B;  1S50 A;  3AXF A;  2Y5K A;  3G7W A;  1URD A;  3G3K A;  1QUK A;  3DM0 A;  3IB0 A;  3K0V A;  4G8N A;  5L9O A;  1R1N A;  5H8H A;  4HXV A;  5T3J A;  1ZKB A;  1M5B A;  4U4X A;  3KOT A;  2CEY A;  4RYA A;  1B52 A;  3OEK A;  1ANF A;  1EYI A;  4PTK A;  4KD5 A;  4PAK A;  1OQG A;  5A5X B;  1Y3N A;  4PFU A;  4QFL A;  3T0J A;  5KDT B;  3FIR A;  3L6G A;  2VD3 A;  2GRV A;  2ABH A;  3QIM A;  2DWJ A;  1N7W A;  1B3H A;  2D5W A;  4P11 A;  2WEF A;  4ISU A;  4FOR A;  2CMO A;  3HV1 A;  3K1M A;  1CNQ A;  3CI8 A;  3MVY A;  1DSN A;  2GH9 A;  3B6W A;  4QBA A;  1MH3 A;  4KFQ A;  2UXA A;  3UGW A;  3KZG A;  1LFH A;  4PC9 A;  1FTK A;  3HCQ A;  3U72 A;  3V5A A;  4MJO A;  2P3N A;  4ELQ A;  2Q2C A;  1IZ1 A;  2GHA A;  1G0H A;  5TU0 A;  3OXN A;  1N84 A;  4AB5 A;  3RT6 B;  3R6U A;  1H3D A;  3MVX A;  3NOH A;  2DOJ A;  3PU5 A;  4ZEC A;  2QS3 A;  1LAX A;  2KQZ A;  4G4P A;  1QKA A;  3PUY E;  3RPL A;  3PUZ E;  1RDY A;  2HAU A;  5EHM A;  4LA9 A;  2D21 A;  3WAE A;  3N5L A;  4XF5 A;  2I48 A;  3U93 A;  2I49 A;  3ODB A;  1MXZ A;  3LV0 A;  2Y7P A;  3Q28 A;  4PGN A;  4FAT A;  3TZA A;  3VLU A;  2DWH A;  3G3I A;  4R9G A;  2F7A A;  1HSL A;  2XX7 A;  3OEL A;  4IO5 A;  5I7I A;  3O66 A;  3TEL A;  1POT A;  3LR1 A;  4U21 A;  4FEB A;  4OEV A;  2HFB A;  1MQI A;  3O2A A;  4MBP A;  3T9X B;  4I3E A;  3ZKL A;  4HCY A;  4OER A;  3T9U A;  4MMP A;  4F1U A;  2XXT A;  5HPQ A;  3FV1 A;  4QF9 A;  3CG1 A;  2QMX A;  4HCW A;  1B4H A;  4YKJ A;  4R75 A;  1OQH A;  2ZYN A;  1Z7N E;  4H46 A;  4RK9 A;  3M8U A;  1MY0 A;  1IQ7 A;  2I0C A;  1Y4T A;  1XS5 A;  3WAF A;  4AS4 A;  1B40 A;  3MC2 A;  3FUZ A;  3O6H A;  4ZED A;  2QS4 A;  3PPN A;  2DYX A;  4R6K A;  4GLI A;  1DOT A;  1NUX A;  4POW A;  5EQ7 A;  4MX6 A;  4QFK A;  3P7I A;  4YKI A;  4PDH A;  1D3K A;  3TCH A;  3SZP A;  1YYZ A;  3FVN A;  1GR2 A;  1NV5 A;  3V83 A;  2FHY A;  2DE3 A;  3MBP A;  3TDJ A;  4RA1 A;  1P1O A;  4N81 A;  4QSD A;  1FQE A;  3BIG A;  5CMB A;  5EYG A;  3RPL B;  4OWD A;  1M5F A;  4BDR A;  4ZEK A;  4LUB A;  2R6G E;  1BK4 A;  3OO7 A;  4P9K A;  1B0H A;  5HBC A;  2W7Y A;  4FJP A;  4NHB A;  3H6W A;  3B8B A;  4DCY A;  4NE4 A;  2ZZV A;  1B46 A;  4NF4 B;  4PF8 A;  3DEL B;  2RF1 A;  3ECR A;  3A09 A;  5CI5 A;  1JVX A;  2XXY A;  4IR8 A;  4ESX A;  4QFO A;  3MUQ A;  4ELR A;  2V3Q A;  4GWU A;  3ZSF A;  3RN8 A;  2ZYM A;  3OOA A;  4MAG A;  4TLM B;  4OVT A;  4YU0 A;  3SEV A;  3LSW A;  4GWX A;  1NUZ A;  3TYH A;  1DCU A;  3GLB A;  3OSR A;  4OAN A;  3C4M A;  3HST A;  2XXU A;  2HCA A;  1JVY A;  4PP0 A;  5EYH A;  3CSB A;  3PTY A;  5ISU A;  3CFL A;  5I2N B;  4MH5 A;  1IIW A;  3ONM A;  5AA4 A;  1FQB A;  1LBX A;  1ZBM A;  4P1L A;  1N7X A;  1FQC A;  5ITO A;  5I56 A;  2OCU A;  2PVU A;  2QS1 A;  2WYP A;  1MQG A;  5DW8 A;  3MJN A;  1XOC A;  4DXC A;  4F3P A;  3LBS A;  5CMC A;  1Q9D A;  5I59 A;  5LTC A;  2VD2 A;  3TTK A;  1URG A;  1IXH A;  1B7H A;  1B32 A;  3TFL A;  4KCC A;  2PT1 A;  3IOU A;  5CMK A;  5ET6 A;  1DMB A;  2I4B A;  1N3X A;  1B5H A;  1DBZ A;  3PUX E;  4WKM A;  4NF5 A;  3UN6 A;  1NFT A;  2PBW A;  1T0K A;  3C9H A;  5CRY A;  2P2A A;  5BWJ A;  4POX A;  1GV8 A;  2V25 A;  3PPO A;  3UK4 A;  3C36 A;  3RUM A;  1FBG A;  2Y84 A;  2XXK A;  1UIV A;  1B9J A;  1XVX A;  3ZKK A;  3A3U A;  2ONR A;  4PFR A;  4THI A;  1R9L A;  1S9T A;  5CBS A;  3Q27 A;  2DWA A;  3RGY A;  4X1D A;  3PD8 A;  4OQO A;  3RQT A;  4NF8 B;  4RPN A;  2AL4 A;  1PB8 A;  1US4 A;  1IMC A;  1IXI A;  2I0B A;  1IIT A;  3FD3 A;  5H8Q A;  1FRP A;  2HHM A;  5I56 B;  4YKP A;  3IOT A;  4C1T A;  3VE1 B;  4ZE9 A;  2YJP A;  4U2R A;  4DXB A;  5DYH A;  4YB5 A;  2OLB A;  1UQW A;  2O6A A;  3QSL A;  1FPB A;  5I59 B;  1MQJ A;  1D9V A;  1PC3 A;  2Q2A A;  4Z7E A;  3SEX A;  4QHQ A;  3UA8 A;  2P1S A;  2B4M A;  4MHF A;  1I6Q A;  3VDF A;  4HW8 A;  2UVG A;  2Q8M A;  2O7I A;  5FHO A;  3CFX A;  4O3C A;  3VXC A;  4NG7 A;  5A5L A;  3FJM A;  2CZK A;  3TKD A;  2THI A;  1KA1 A;  3UOR A;  4OMB A;  4N15 A;  5BUU A;  5ET7 A;  1BIY A;  2XX9 A;  1MXX A;  5I5P A;  3N26 A;  4NAP A;  4YMA A;  2IA4 A;  4N6K A;  1MDQ A;  4JVI A;  3EHT A;  1B3G A;  3OMB A;  1NI9 A;  1LLS A;  3D1R A;  2Q88 A;  4O3A A;  2QPQ A;  1KA0 A;  3N6U A;  4DI3 D;  4GWZ A;  4QFN A;  2O68 A;  2G29 A;  1EZO A;  1MXW A;  3H7M A;  4NQ8 A;  3K1N A;  2FVZ A;  5JK4 A;  2DXY A;  1SYI A;  4G68 A;  4IB2 A;  3KBZ A;  4MIJ A;  4ZZA A;  4MCO A;  3I6V A;  4GRK A;  4KCD A;  4H5G A;  3RY3 A;  1OMP A;  1YCJ A;  5I57 A;  5ITP A;  2FYI A;  1IXG A;  1NV2 A;  4OVR A;  1NV7 A;  2ONK E;  2QRY A;  5H8Q B;  4BDN A;  1QUL A;  1B2H A;  2XWV A;  1ZMG A;  2DE4 A;  2PYY A;  4H5F A;  5TPA B;  3QYT A;  4HS7 A;  4TQU Q;  1SVX B;  1SW1 A;  4QFP A;  1PEB A;  3IB2 A;  4KHZ E;  4ZEB A;  5IGA A;  3KN3 A;  2CZH A;  1B5I A;  1B7U A;  2B3F A;  3W9W A;  4IGT A;  2HPG A;  4PGP A;  1A8F A;  4OFO A;  4OA4 A;  4LQ5 A;  2VHA A;  5ET5 A;  2HZL A;  4PBQ A;  3SER A;  2ZNU A;  1RDX A;  3KGC A;  2QVV A;  1B5J A;  3K01 A;  3CSG A;  4EQ7 A;  5J1D A;  3KSJ A;  3T93 B;  5F24 A;  1Q35 A;  3PUV E;  4YB7 A;  3MZ9 A;  3MP1 A;  3N94 A;  4GL0 A;  2QL3 A;  3FVO A;  3B7D A;  1B7Z A;  2WBB A;  5I58 A;  3C33 A;  1INP A;  1AH5 A;  3SEY A;  1GTK A;  1SI0 A;  1Y3P A;  4G8H A;  4O3B A;  1LBZ A;  2VP1 A;  4C1U A;  4M1V A;  1OVT A;  4LAT A;  4RY1 A;  3PPR A;  1OIB A;  3K6W A;  2XD2 A;  3FZV A;  1NL5 A;  4PDD A;  5DVI A;  2ESN A;  3W9V A;  2RC8 A;  1NNT A;  3C35 A;  4N8Y A;  2Z8E A;  2DS9 A;  3THI A;  1ZTY A;  1CE2 A;  5I57 B;  1FJ9 A;  3CG3 A;  3HHG A;  4EDP A;  3G3H A;  1OVB A;  4G68 C;  4OVP A;  4F3S A;  1A7L A;  2R71 A;  3CRB A;  4GFR A;  4OVQ A;  1I6A A;  2ZYK A;  1P1Q A;  1LFI A;  3IB1 A;  3U94 A;  3PPQ A;  3IFC A;  4XXU A;  5F7V A;  1MPB A;  2HQ0 A;  1HSJ A;  2I6E A;  4I62 A;  3I3V A;  3QMF A;  4O8M A;  2XWI A;  4DE8 A;  4F3G A;  3FVK A;  3QAX A;  1LBW A;  3OO8 A;  4FAJ A;  4E0X A;  4GL8 A;  4FE8 A;  1EZ9 A;  4C0R A;  3ZS6 A;  2O69 A;  2P3V A;  4IO7 A;  1B51 A;  3VLV A;  5I58 B;  1WOD A;  1YPN A;  1FTL A;  5J16 A;  5EQA A;  3ISP A;  2Z23 A;  3IJX B;  2F7B A;  4KYE A;  1XC1 A;  4GX3 A;  5H8H B;  2E0S A;  3MZB A;  3IOV A;  3MVW A;  2E1S A;  2UYE A;  1PBQ A;  1USY H;  4F19 A;  2DP8 A;  3S9L C;  2XXV A;  1D9Y A;  1TXF A;  3E79 A;  2F5X A;  4GF8 A;  4H45 A;  2ZNT A;  4AS5 A;  2PFZ A;  4NWC A;  4GX4 A;  3CR9 A;  1I69 A;  3CVG A;  4NTL A;  3RT8 A;  1FW0 A;  3RTF B;  2ZZW A;  1SW4 A;  3PPP A;  4EQ9 A;  5AA2 A;  5AE4 A;  1B4Z A;  3TTN A;  4JSD A;  1O64 A;  3TAJ A;  4ZDM A;  4YIC A;  1DK4 A;  5LOM A;  3C34 A;  4GX6 A;  1LBC A;  1N0T A;  4G8M A;  2Z8D A;  2QFL A;  1N3W A;  5EHS A;  2RIN A;  2YPN A;  1FBF A;  2UVH A;  2OWT A;  4U22 A;  2V3T A;  4F31 B;  4OEU A;  5IZ3 A;  4H67 A;  2PMS A;  4FED A;  1FQD A;  1M5C A;  1VE4 A;  4NN3 A;  1NV6 A;  5KZT A;  1MXV A;  3S2V A;  3Q25 A;  4OET A;  4BDQ A;  2VT5 A;  1ZLQ A;  2AIX A;  4F39 A;  4KPT A;  2V4C A;  5FHN A;  2I58 A;  4GIZ A;  4OES A;  1FBE A;  4LVQ A;  3Q26 A;  4PQJ A;  3F11 A;  3FXB A;  1TT1 A;  2DE2 A;  3H03 A;  2OK2 A;  1OLA A;  3IO4 A;  4PFT A;  4YMB A;  2Z22 A;  4XKQ A;  1JEV A;  4OTE A;  3IFA A;  4PE5 B;  4N6D A;  1YAE A;  1FTO A;  4PET A;  3K4U A;  3KOS A;  3IO6 A;  3CFZ A;  4F22 A;  3DP4 A;  1P99 A;  4I1D A;  1IMA A;  3IOR A;  1FBD A;  4ELO A;  4H8I A;  3KEI A;  3PGF A;  1FBH A;  3K6X A;  4XKN A;  1IUD A;  1I6B A;  4JWO A;  5DTB A;  5LDZ A;  1B58 A;  3O28 A;  4QSE A;  1QKB A;  4JDF A;  3IOW A;  3MPL A;  1NV4 A;  2HXW A;  2Q9T A;  1JW4 A;  3QUF A;  3A3C A;  1XHY A;  5TP9 A;  3ROJ A;  4ZEF A;  1VFE A;  1CB6 A;  5H8N A;  1A40 A;  5IM2 A;  4U23 A;  4MLQ A;  4XFE A;  3O9P A;  2CZL A;  1MM6 A;  2P0S A;  3M3K A;  2WYK A;  1H44 A;  2XWK A;  1JEU A;  3RNN A;  3SDF A;  1XI6 A;  1LB9 A;  3KJ7 A;  3PMX A;  4ZEI A;  2Q8J A;  4BDM A;  1SW2 A;  2NVU B;  3TQL A;  3V8X B;  4OEN A;  4MNC A;  2XX8 A;  4LN5 A;  2ZMB A;  1P1N A;  3VXB A;  3G3F A;  2XXI A;  1PB9 A;  1WDN A;  3KG2 A;  1LST A;  2XA5 A;  2Y7I A;  1QVS A;  3SEW A;  2OZZ A;  3FVG A;  3CIJ A;  3L6H A;  1URS A;  2O7U A;  4LZ8 A;  2RCA A;  3TEP A;  4R9F A;  4XKP A;  1LAG E;  1KWH A;  3FXU A;  3EF7 A;  2PCR A;  1RDZ A;  4UA8 A;  3O97 A;  1VSO A;  1FPJ A;  3T9V A;  1BKA A;  2BJJ X;  2XXW A;  3C31 A;  4NF6 A;  4F29 A;  4RNS A;  1LBV A;  1TWY A;  2QJE A;  3H06 B;  3JZJ A;  1N76 A;  1NH8 A;  2VOZ A;  1QW0 A;  4LP2 B;  4OYV A;  1UTH A;  4MFI A;  4NWD A;  1PDA A;  2VGQ A;  2JJK A;  2I4C A;  4JB7 A;  1QJM A;  4P0I A;  3A29 A;  4N91 A;  4GWW A;  5AA4 B;  1RYX A;  4NX1 A;  5TP9 B;  3JV9 A;  4YAH X;  5H8N B;  3T9H B;  3QXM A;  4GVO A;  5FBP A;  1FBC A;  4R73 A;  4JXI A;  1Q1K A;  1NV3 A;  4GOT A;  1B3L A;  2F34 A;  4N8G A;  2HXR A;  4IO3 A;  1JET A;  5AA2 D;  3OD7 A;  5EYF A;  1MM7 A;  3IX1 A;  5KCJ A;  5M2V A;  5ESY A;  3SET A;  3VVE A;  4NF5 B;  3MYU A;  2L5V A;  1L5T A;  4NMY A;  3S9M C;  2F3D A;  4P56 A;  2B65 A;  1A54 A;  1SYH A;  4QXD A;  1JW1 A;  5L9M A;  3PUW E;  1NNP A;  4O94 A;  2GHB A;  1PBP A;  1OLC A;  2OX3 A;  4DLD A;  3K6U A;  4GQO A;  4ONY A;  1NV0 A;  4DCX A;  1FPG A;  1AIV A;  3FXR A;  4LZ7 A;  2XD3 A;  1XT8 A;  1SDX A;  4NF6 B;  2B4L A;  1JQF A;  3USD A;  3VLW A;  2HAV A;  3MZ1 A;  4Q0C A;  2ALU A;  3IR1 A;  4DZ1 A;  1MRP A;  1TFD A;  1A8E A;  1K9Z A;  3SEU A;  2BJI A;  2ZNS A;  3TUS A;  3ILU B;  4OFL A;  4P0G A;  1EZP A;  4R6Y A;  1LBB A;  4EUO A;  2F3B A;  4U1O A;  1NNF A;  5DT6 A;  4QRZ A;  1FPI A;  4NF0 A;  2D3I A;  1KZ8 A;  2Y7W A;  1SI1 A;  2RKM A;  5KDT A;  3DP6 A;  3T1B A;  1SBP A;  3TMG A;  4MEV A;  1MY1 A;  3HHF A;  4ND9 A;  4TOZ A;  4XKR A;  2FIX A;  2V93 A;  3H3G A;  1B1H A;  1US5 A;  3EHS A;  5FHM A;  1MQH A;  2FIE A;  1Y4C A;  3KBR A;  1WVJ A;  4IO4 A;  5F1Q A;  3K2D A;  2XXH A;  3KJT A;  4RPO A;  4ZE8 A;  2H99 A;  4P47 A;  3E9X A;  1O7T A;  1MY4 A;  4OXV A;  2PT2 A;  3DLN A;  4RXL A;  1SPI A;  4H6D A;  1SW5 A;  2A5S A;  4OZ9 A;  3TTR A;  3OO9 A;  3U1O A;  3H6V A;  3GXA A;  4BLA A;  4FIM A;  4N13 A;  1A55 A;  4PCD A;  5B70 A;  4G61 A;  3H6T A;  1II5 A;  5B7D A;  2F36 A;  3KN7 A;  5FTI A;  1NV1 A;  4NGU A;  4Q5T A;  3MWB A;  1MH4 A;  2QVU A;  4G68 B;  1VDW A;  2H4I A;  4P8B A;  2NOO A;  4F3B A;  3W15 C;  1XVY A;  1UTB A;  3LUY A;  4WXJ A;  1MQD A;  5ICQ A;  3SES A;  3G3G A;  3S4U A;  3T22 A;  4IY5 A;  5JEI A;  2UYF A;  4Q8R A;  1FPK A;  4FBP A;  2PX1 A;  3JYR A;  5FTH A;  1FPE A;  1IMF A;  2VPN A;  1Y1M A;  2V84 A;  3OEM A;  3IAZ A;  3TPA A;  1QUJ A;  3EQ1 A;  3K00 A;  3QK6 A;  1FTJ A;  3PD9 A;  1LGB C;  4P3L A;  1RYO A;  1HSE A;  3KC0 A;  1Y3Q A;  2GQ1 A;  4DXU A;  4OVJ A;  2X7Q A;  3LSX A;  4IO6 A;  4ELP A;  3PMV A;  4BDO A;  3I5O A;  1ZJL A;  4EQB A;  2DQV A;  4H65 A;  3N6T A;  2KR0 A;  4XIG Q;  3MVZ A;  4JVD A;  1P1U A;  4PBH A;  3FJ7 A;  4H8J A;  4N4U A;  3FAT A;  1F9B A;  2WKY A;  4JBZ A;  2X26 A;  2DWI A;  4YB6 A;  3Q29 A;  4GD5 A;  2REJ A;  5CC2 A;  4P1E A;  4OHN A;  4JWY A;  1FTA A;  1FBP A;  2NXO A;  2XXR A;  3OO6 A;  4TLL B;  3FJG A;  3B50 A;  3MP6 A;  1IEJ A;  2F78 A;  2B3B A;  4KYD A;  2RC9 A;  4K3F A;  3IK6 B;  1FJ6 A;  1H76 A;  1BLF A;  3H4Z A;  3OEN A;  3LSL A;  3EHU A;  3VV5 A;  1UTB B;  1NUY A;  1B3F A;  3KN8 A;  1FTM A;  2R8T A;  4RK2 A;  2LAO A;  4NF4 A;  4ESW A;  2FA7 A;  1EH3 A;  2WBD A;  3FV2 A;  3TCG A;  4PFW A;  3EN3 A;  3MST A;  3BFU A;  4X9T A;  1EU8 A;  4O7M A;  1GVC A;  1Y9U A;  4I40 A;  3LUZ A;  2HZK A;  1SD3 A;  4KI0 E;  4GBV A;  1DPP A;  3UP9 A;  1ELJ A;  2UVI A;  2XXP A;  2DVZ A;  1MY3 A;  3M3F A;  3VVD A;  1Z7M E;  5I2N A;  3HFU A;  4X1B A;  5DVF A;  1UIU A;  1YXI A;  1B1X A;  1A99 A;  4I9D A;  1LCF A;  4X04 A;  1LAF E;  2I3W A;  3RYD A;  2MKZ A;  1Y20 A;  1NKX A;  4XEQ A;  1QUI A;  3LSF B;  1FQF A;  5JTY A;  3U8Q A;  1DPE A;  5I3S A;  3O6G A;  1NMU A;  4HTG A;  4DDD A;  4PFI A;  4IO2 A;  5L9S A;  4ECF A;  3E78 A;  4ZZE A;  2ZXT A;  2QVR A;  5IZ1 A;  4UAB A;  2ZYO A;  1P1W A;  4E0W A;  3HO7 A;  1R9Q A;  5I2K A;  4MNP A;  1YTV A;  1J1N A;  4EXK A;  3R26 A;  2PFY A;  4M4G A;  2H5Y A;  1JW5 A;  3KFM A;  3EKI A;  2QMW A;  2OWS A;  4MF3 A;  5AA2 B;  2NUV A;  3QUJ A;  2ZZX A;  3GBA A;  4G2Z A;  4H1X A;  4QSC A;  4L17 A;  3D4G A;  1B3E A;  1LFG A;  4R72 A;  4R2F A;  2AL5 A;  1ZU0 A;  4R6H A;  5H8F A;  4GXS B;  1M5E A;  3RTW B;  5CBR A;  4IY6 A;  1MG1 A;  4NF8 A;  5IZ3 B;  4EF1 A;  3S9E A;  5AA3 A;  4GWO A;  2V3U A;  3GYY A;  4MLV A;  3RPW A;  2F6G A;  2REG A;  2FBP A;  2OWZ A;  2Q89 A;  1YZ0 A;  3HPI A;  2AYS A;  1Y1Z A;  1PB7 A;  5EQ9 A;  5ELV A;  5I84 A;  2RC7 A;  4X48 A;  4EF2 A;  3FAS A;  4JVC A;  1MY2 A;  4JWX A;  5JTY B;  1H43 A;  1VFD A;  4H0W A;  2Y5L A;  1RKM A;  1NNK A;  2Q74 A;  2UVJ A;  4LZ5 A;  4PFB A;  4I3Y A;  3KC1 A;  2ONS A;  5ET8 A;  2QSX A;  2R9J A;  2F97 A;  1K9Y A;  4I8C A;  3TOD A;  4UAC A;  3U65 A;  1IMD A;  3MQ9 A;  4PAF A;  5CM6 A;  5K2Y A;  1EYK A;  3OSQ A;  1LB8 A;  2CEX A;  2F6P A;  3T66 A;  3G3J A;  4BDL A;  5IAI A;  5I2K B;  3EPE A;  4EXL A;  3FXQ A;  1AL3 A;  3TCF A;  2GFE A;  3GBB A;  2O1M A;  3TTM A;  2XHD A;  3O6I A;  2ANJ A;  1LBY A;  2G93 A;  2QS2 A;  2F7C A;  1AOV A;  3O29 A;  3B6Q A;  3IJO B;  1FQA A;  3UIF A;  2DDK A;  4KR5 A;  3RLF E;  2XXQ A;  4MNI A;  1DTG A;  4F2O A;  3BBR A;  3MW0 A;  1MXY A;  1M5D A;  5IKB A;  2DVC A;  1MPC A;  3BKI B;  4X8R A;  5H8F B;  3FBP A;  4Q30 B;  1FCK A;  1AWB A;  1N04 A;  4O7I A;  2CZI A;  4FEC A;  4NED A;  3V89 B;  1LCT A;  2XXX A;  1FSA A; 
#chains in the Genus database with same CATH homology
 1GGG A;  3HN0 A;  4XTC Q;  4U4S A;  3LC8 A;  3C32 A;  2O51 A;  2I3V A;  3SKP A;  3MPK A;  4GXA A;  5TPA A;  4G77 A;  1S7Y A;  3H6U A;  5K2X A;  4U1Z A;  3KSX A;  2A5T A;  1H45 A;  2FNC A;  3BFT A;  3PV0 E;  1AMF A;  2O1L A;  4KYS A;  3U92 A;  2H9B A;  3D4C A;  4AB6 A;  4ZS9 A;  3VVF A;  4WEP A;  2M8C A;  1ATG A;  3TQW A;  2H25 A;  1MPD A;  5H8S A;  1D4N A;  5DVJ A;  1SQY A;  5CMM A;  3FGS A;  3K6V A;  5AA1 A;  2X7P A;  2Y7K A;  1TFA A;  3E3K A;  4F18 A;  3ILT B;  2O84 X;  4JSO A;  2DSF A;  1MXU A;  1O63 A;  2OBG A;  3R7X A;  1IXC A;  5DEX A;  2IEE A;  4F1Y A;  2YLN A;  5ICT A;  1LAH E;  4R74 A;  1UTH B;  4IGR A;  2F8D A;  4YZZ A;  2KLF A;  2Y7R A;  5HM4 B;  4R2B A;  2DXR A;  2F35 A;  3K02 A;  2OJT A;  3E13 X;  3TTL A;  2HEU A;  1ZIU A;  1B05 A;  3MP8 A;  5A5X A;  3M3L A;  1BP5 A;  3S9N C;  4KQP A;  1MDP 1;  3IL1 B;  1B0L A;  4YKK A;  4F2Q A;  1NH7 A;  4N07 A;  4PFY A;  4LON B;  4OFJ A;  3PMW A;  2Z8F A;  2H98 A;  5L8D A;  1B6H A;  5KCJ B;  3E4R A;  2A5T B;  2RCB A;  4DIG A;  4N6P A;  4F1V A;  1R6Z A;  3GZG A;  4WED A;  3MAM A;  3DP8 A;  1USY E;  1POY 1;  1JNF A;  1BTJ A;  2NWJ A;  4AQ4 A;  3T96 B;  3VFJ A;  3B6T A;  1DTZ A;  1VR5 A;  4LQ2 A;  4Z0I A;  4RJZ A;  3K1P A;  1MS7 A;  5DEX B;  1S50 A;  3AXF A;  3G7W A;  1URD A;  3G3K A;  1QUK A;  3DM0 A;  3IB0 A;  3K0V A;  4G8N A;  5L9O A;  1R1N A;  5H8H A;  1ZKB A;  1M5B A;  4U4X A;  3KOT A;  4RYA A;  1B52 A;  3OEK A;  1ANF A;  4KD5 A;  1OQG A;  5A5X B;  1Y3N A;  4PFU A;  4QFL A;  5KDT B;  3FIR A;  3L6G A;  2VD3 A;  2GRV A;  2ABH A;  3QIM A;  2DWJ A;  1N7W A;  1B3H A;  2D5W A;  4P11 A;  4ISU A;  4FOR A;  2CMO A;  3HV1 A;  3K1M A;  3CI8 A;  3MVY A;  1DSN A;  2GH9 A;  3B6W A;  1MH3 A;  4KFQ A;  2UXA A;  3UGW A;  3KZG A;  1LFH A;  1FTK A;  3HCQ A;  3U72 A;  3V5A A;  4ELQ A;  2Q2C A;  1IZ1 A;  2GHA A;  5TU0 A;  3OXN A;  1N84 A;  4AB5 A;  3RT6 B;  3R6U A;  1H3D A;  3MVX A;  2DOJ A;  3PU5 A;  4ZEC A;  2QS3 A;  1LAX A;  4G4P A;  1QKA A;  3PUY E;  3PUZ E;  2HAU A;  5EHM A;  4LA9 A;  2D21 A;  3WAE A;  3N5L A;  2I48 A;  3U93 A;  2I49 A;  3ODB A;  1MXZ A;  2Y7P A;  3Q28 A;  4FAT A;  3TZA A;  3VLU A;  2DWH A;  3G3I A;  4R9G A;  2F7A A;  1HSL A;  2XX7 A;  3OEL A;  4IO5 A;  3O66 A;  3TEL A;  1POT A;  3LR1 A;  4U21 A;  4FEB A;  4OEV A;  2HFB A;  1MQI A;  3O2A A;  4MBP A;  3T9X B;  3ZKL A;  4HCY A;  4OER A;  3T9U A;  4F1U A;  2XXT A;  5HPQ A;  3FV1 A;  4QF9 A;  3CG1 A;  2QMX A;  4HCW A;  1B4H A;  4YKJ A;  4R75 A;  1OQH A;  2ZYN A;  1Z7N E;  4RK9 A;  3M8U A;  1MY0 A;  1IQ7 A;  2I0C A;  1Y4T A;  1XS5 A;  3WAF A;  1B40 A;  3MC2 A;  3FUZ A;  3O6H A;  4ZED A;  2QS4 A;  3PPN A;  2DYX A;  4R6K A;  4GLI A;  1DOT A;  4POW A;  4QFK A;  3P7I A;  4YKI A;  1D3K A;  3TCH A;  3FVN A;  1GR2 A;  3V83 A;  2DE3 A;  3MBP A;  3TDJ A;  4RA1 A;  1P1O A;  4QSD A;  1FQE A;  5CMB A;  4OWD A;  1M5F A;  4BDR A;  4ZEK A;  4LUB A;  2R6G E;  3OO7 A;  1B0H A;  5HBC A;  2W7Y A;  4FJP A;  3H6W A;  4DCY A;  4NE4 A;  1B46 A;  4NF4 B;  3DEL B;  2RF1 A;  3ECR A;  3A09 A;  5CI5 A;  1JVX A;  2XXY A;  4ESX A;  4QFO A;  3MUQ A;  4ELR A;  2V3Q A;  3ZSF A;  3RN8 A;  2ZYM A;  3OOA A;  4TLM B;  4YU0 A;  3SEV A;  3LSW A;  3TYH A;  3GLB A;  3OSR A;  3C4M A;  3HST A;  2XXU A;  2HCA A;  1JVY A;  4PP0 A;  3CSB A;  5ISU A;  3CFL A;  5I2N B;  4MH5 A;  1IIW A;  3ONM A;  5AA4 A;  1FQB A;  1ZBM A;  1N7X A;  1FQC A;  5ITO A;  5I56 A;  2OCU A;  2PVU A;  2QS1 A;  1MQG A;  3MJN A;  1XOC A;  4DXC A;  4F3P A;  3LBS A;  5CMC A;  5I59 A;  2VD2 A;  3TTK A;  1URG A;  1IXH A;  1B7H A;  1B32 A;  3TFL A;  4KCC A;  2PT1 A;  3IOU A;  5CMK A;  1DMB A;  2I4B A;  1N3X A;  1B5H A;  3PUX E;  4WKM A;  4NF5 A;  3UN6 A;  1NFT A;  2PBW A;  1T0K A;  3C9H A;  5CRY A;  2P2A A;  5BWJ A;  4POX A;  1GV8 A;  2V25 A;  3PPO A;  3UK4 A;  3C36 A;  3RUM A;  2Y84 A;  1UIV A;  1B9J A;  1XVX A;  3ZKK A;  3A3U A;  2ONR A;  4THI A;  1R9L A;  1S9T A;  5CBS A;  3Q27 A;  2DWA A;  3RGY A;  4X1D A;  3PD8 A;  4OQO A;  3RQT A;  4NF8 B;  4RPN A;  2AL4 A;  1PB8 A;  1US4 A;  1IXI A;  2I0B A;  1IIT A;  3FD3 A;  5H8Q A;  5I56 B;  4YKP A;  3IOT A;  4C1T A;  3VE1 B;  4ZE9 A;  2YJP A;  4U2R A;  4DXB A;  5DYH A;  4YB5 A;  2OLB A;  1UQW A;  2O6A A;  3QSL A;  5I59 B;  1MQJ A;  1D9V A;  1PC3 A;  2Q2A A;  4Z7E A;  3SEX A;  4QHQ A;  3UA8 A;  2P1S A;  4HW8 A;  3VDF A;  1I6Q A;  2UVG A;  2O7I A;  5FHO A;  3CFX A;  4O3C A;  3VXC A;  3FJM A;  3TKD A;  2THI A;  3UOR A;  4OMB A;  5BUU A;  1BIY A;  2XX9 A;  1MXX A;  3N26 A;  4YMA A;  2IA4 A;  1MDQ A;  3EHT A;  1B3G A;  3OMB A;  1LLS A;  2Q88 A;  4O3A A;  2QPQ A;  3N6U A;  4QFN A;  2O68 A;  2G29 A;  1EZO A;  1MXW A;  3H7M A;  3K1N A;  5JK4 A;  2DXY A;  1SYI A;  4G68 A;  4IB2 A;  4ZZA A;  3I6V A;  4GRK A;  4KCD A;  4H5G A;  3RY3 A;  1OMP A;  1YCJ A;  5I57 A;  5ITP A;  2FYI A;  1IXG A;  2ONK E;  2QRY A;  5H8Q B;  4BDN A;  1QUL A;  1B2H A;  1ZMG A;  2DE4 A;  2PYY A;  4H5F A;  5TPA B;  3QYT A;  4HS7 A;  4TQU Q;  1SVX B;  1SW1 A;  4QFP A;  1PEB A;  3IB2 A;  4KHZ E;  4ZEB A;  3KN3 A;  1B5I A;  1B7U A;  2B3F A;  3W9W A;  4IGT A;  1A8F A;  4OFO A;  4LQ5 A;  2VHA A;  2HZL A;  3SER A;  2ZNU A;  3KGC A;  1B5J A;  3K01 A;  3CSG A;  4EQ7 A;  5J1D A;  3KSJ A;  3T93 B;  1Q35 A;  3PUV E;  4YB7 A;  3MZ9 A;  3MP1 A;  3N94 A;  4GL0 A;  2QL3 A;  3FVO A;  3B7D A;  1B7Z A;  5I58 A;  3C33 A;  1AH5 A;  3SEY A;  1GTK A;  1SI0 A;  1Y3P A;  4G8H A;  4O3B A;  2VP1 A;  4C1U A;  4M1V A;  1OVT A;  4LAT A;  4RY1 A;  3PPR A;  1OIB A;  3K6W A;  2XD2 A;  3FZV A;  1NL5 A;  5DVI A;  2ESN A;  3W9V A;  2RC8 A;  1NNT A;  3C35 A;  2Z8E A;  2DS9 A;  3THI A;  1ZTY A;  1CE2 A;  5I57 B;  3CG3 A;  3HHG A;  4EDP A;  3G3H A;  1OVB A;  4G68 C;  4F3S A;  1A7L A;  2R71 A;  3CRB A;  4GFR A;  1I6A A;  2ZYK A;  1P1Q A;  1LFI A;  3IB1 A;  3U94 A;  3PPQ A;  4XXU A;  5F7V A;  1MPB A;  2HQ0 A;  1HSJ A;  2I6E A;  4I62 A;  3I3V A;  4DE8 A;  4F3G A;  3FVK A;  3QAX A;  3OO8 A;  4FAJ A;  4E0X A;  4GL8 A;  4FE8 A;  1EZ9 A;  4C0R A;  3ZS6 A;  2O69 A;  4IO7 A;  1B51 A;  3VLV A;  5I58 B;  1WOD A;  1YPN A;  1FTL A;  2Z23 A;  3IJX B;  2F7B A;  4KYE A;  1XC1 A;  5H8H B;  2E0S A;  3MZB A;  3IOV A;  3MVW A;  2E1S A;  2UYE A;  1PBQ A;  1USY H;  4F19 A;  2DP8 A;  3S9L C;  2XXV A;  1D9Y A;  1TXF A;  2F5X A;  4GF8 A;  2ZNT A;  4NWC A;  3CR9 A;  1I69 A;  3CVG A;  4NTL A;  3RT8 A;  1FW0 A;  3RTF B;  1SW4 A;  3PPP A;  4EQ9 A;  5AA2 A;  5AE4 A;  1B4Z A;  3TTN A;  4JSD A;  1O64 A;  3TAJ A;  4ZDM A;  4YIC A;  5LOM A;  3C34 A;  1LBC A;  1N0T A;  4G8M A;  2Z8D A;  5EHS A;  1N3W A;  2RIN A;  2YPN A;  2UVH A;  2OWT A;  4U22 A;  2V3T A;  4F31 B;  4OEU A;  4H67 A;  2PMS A;  4FED A;  1FQD A;  1M5C A;  1VE4 A;  5KZT A;  1MXV A;  3S2V A;  3Q25 A;  4OET A;  4BDQ A;  1ZLQ A;  2AIX A;  4F39 A;  4KPT A;  5FHN A;  2I58 A;  4GIZ A;  4OES A;  4LVQ A;  3Q26 A;  4PQJ A;  3F11 A;  1TT1 A;  2DE2 A;  3H03 A;  2OK2 A;  1OLA A;  3IO4 A;  4PFT A;  4YMB A;  2Z22 A;  4XKQ A;  1JEV A;  4OTE A;  4PE5 B;  1YAE A;  1FTO A;  4PET A;  3K4U A;  3KOS A;  3IO6 A;  3CFZ A;  4F22 A;  3DP4 A;  1P99 A;  4I1D A;  3IOR A;  4ELO A;  4H8I A;  3KEI A;  3PGF A;  3K6X A;  4XKN A;  1IUD A;  1I6B A;  4JWO A;  5DTB A;  1B58 A;  3O28 A;  4QSE A;  1QKB A;  4JDF A;  3IOW A;  3MPL A;  2HXW A;  2Q9T A;  1JW4 A;  3QUF A;  3A3C A;  1XHY A;  5TP9 A;  4ZEF A;  1VFE A;  1CB6 A;  5H8N A;  1A40 A;  4U23 A;  4MLQ A;  3O9P A;  2CZL A;  1MM6 A;  2P0S A;  3M3K A;  1H44 A;  1JEU A;  3RNN A;  3SDF A;  3KJ7 A;  1LB9 A;  3PMX A;  4ZEI A;  2Q8J A;  4BDM A;  1SW2 A;  2NVU B;  3TQL A;  3V8X B;  4OEN A;  2XX8 A;  2ZMB A;  1P1N A;  3VXB A;  3G3F A;  2XXI A;  1PB9 A;  1WDN A;  3KG2 A;  1LST A;  2Y7I A;  1QVS A;  3SEW A;  2OZZ A;  3FVG A;  3CIJ A;  3L6H A;  1URS A;  2O7U A;  4LZ8 A;  2RCA A;  3TEP A;  4R9F A;  4XKP A;  1LAG E;  1KWH A;  3FXU A;  3EF7 A;  4UA8 A;  3O97 A;  1VSO A;  3T9V A;  1BKA A;  2BJJ X;  2XXW A;  3C31 A;  4NF6 A;  4F29 A;  4RNS A;  1TWY A;  2QJE A;  3H06 B;  3JZJ A;  1N76 A;  1NH8 A;  2VOZ A;  1QW0 A;  4LP2 B;  4OYV A;  1UTH A;  4MFI A;  4NWD A;  1PDA A;  2VGQ A;  2I4C A;  4JB7 A;  1QJM A;  4P0I A;  5AA4 B;  1RYX A;  5TP9 B;  3JV9 A;  4YAH X;  5H8N B;  3T9H B;  3QXM A;  4GVO A;  4R73 A;  4JXI A;  1Q1K A;  4GOT A;  1B3L A;  2F34 A;  4IO3 A;  1JET A;  5AA2 D;  3OD7 A;  5EYF A;  1MM7 A;  3IX1 A;  5KCJ A;  5M2V A;  3SET A;  3VVE A;  4NF5 B;  3S9M C;  1L5T A;  4NMY A;  2B65 A;  1A54 A;  1SYH A;  1JW1 A;  5L9M A;  3PUW E;  1NNP A;  2GHB A;  1PBP A;  1OLC A;  4DLD A;  3K6U A;  4GQO A;  4ONY A;  4DCX A;  1AIV A;  3FXR A;  4LZ7 A;  2XD3 A;  1XT8 A;  1SDX A;  4NF6 B;  1JQF A;  3USD A;  3VLW A;  2HAV A;  3MZ1 A;  4Q0C A;  2ALU A;  3IR1 A;  4DZ1 A;  1MRP A;  1TFD A;  1A8E A;  3SEU A;  2ZNS A;  3TUS A;  3ILU B;  4OFL A;  4P0G A;  1EZP A;  4R6Y A;  1LBB A;  4EUO A;  4U1O A;  1NNF A;  5DT6 A;  4QRZ A;  2D3I A;  2Y7W A;  1SI1 A;  2RKM A;  5KDT A;  3DP6 A;  1SBP A;  3TMG A;  1MY1 A;  3HHF A;  4ND9 A;  4TOZ A;  4XKR A;  3H3G A;  2V93 A;  1B1H A;  1US5 A;  3EHS A;  5FHM A;  1MQH A;  1Y4C A;  3KBR A;  1WVJ A;  4IO4 A;  5F1Q A;  3K2D A;  2XXH A;  3KJT A;  4RPO A;  4ZE8 A;  2H99 A;  3E9X A;  1O7T A;  1MY4 A;  4OXV A;  2PT2 A;  3DLN A;  4RXL A;  4H6D A;  1SW5 A;  2A5S A;  4OZ9 A;  3TTR A;  3OO9 A;  3U1O A;  3H6V A;  3GXA A;  4BLA A;  4FIM A;  4N13 A;  1A55 A;  5B70 A;  3H6T A;  1II5 A;  5B7D A;  2F36 A;  3KN7 A;  5FTI A;  4Q5T A;  3MWB A;  1MH4 A;  4G68 B;  2H4I A;  2NOO A;  4F3B A;  3W15 C;  1XVY A;  1UTB A;  3LUY A;  4WXJ A;  1MQD A;  5ICQ A;  3SES A;  3G3G A;  3S4U A;  3T22 A;  4IY5 A;  5JEI A;  2UYF A;  4Q8R A;  2PX1 A;  3JYR A;  5FTH A;  1Y1M A;  2V84 A;  3OEM A;  3IAZ A;  3TPA A;  1QUJ A;  3EQ1 A;  3K00 A;  3QK6 A;  1FTJ A;  3PD9 A;  1LGB C;  1RYO A;  1HSE A;  1Y3Q A;  4DXU A;  4OVJ A;  2X7Q A;  3LSX A;  4IO6 A;  4ELP A;  3PMV A;  4BDO A;  3I5O A;  1ZJL A;  4EQB A;  2DQV A;  4H65 A;  3N6T A;  4XIG Q;  3MVZ A;  1P1U A;  3FJ7 A;  4H8J A;  3FAT A;  1F9B A;  2WKY A;  4JBZ A;  2X26 A;  2DWI A;  4YB6 A;  3Q29 A;  4GD5 A;  2REJ A;  5CC2 A;  4OHN A;  4JWY A;  2NXO A;  2XXR A;  3OO6 A;  4TLL B;  3FJG A;  3MP6 A;  1IEJ A;  2F78 A;  2B3B A;  4KYD A;  2RC9 A;  4K3F A;  3IK6 B;  1H76 A;  1BLF A;  3H4Z A;  3OEN A;  3LSL A;  3EHU A;  3VV5 A;  1UTB B;  1B3F A;  3KN8 A;  1FTM A;  4RK2 A;  2LAO A;  4NF4 A;  4ESW A;  2FA7 A;  1EH3 A;  3FV2 A;  3TCG A;  4PFW A;  3EN3 A;  3BFU A;  4X9T A;  1EU8 A;  1GVC A;  1Y9U A;  2HZK A;  1SD3 A;  4KI0 E;  1DPP A;  3UP9 A;  1ELJ A;  2UVI A;  2XXP A;  2DVZ A;  1MY3 A;  3M3F A;  3VVD A;  1Z7M E;  5I2N A;  4X1B A;  5DVF A;  1UIU A;  1B1X A;  1A99 A;  4I9D A;  1LCF A;  1LAF E;  2I3W A;  1Y20 A;  1NKX A;  1QUI A;  3LSF B;  1FQF A;  5JTY A;  3U8Q A;  1DPE A;  3O6G A;  1NMU A;  4HTG A;  4DDD A;  4IO2 A;  5L9S A;  4ECF A;  4ZZE A;  2ZXT A;  2ZYO A;  1P1W A;  4E0W A;  3HO7 A;  1R9Q A;  5I2K A;  1YTV A;  1J1N A;  4EXK A;  3R26 A;  4M4G A;  2H5Y A;  1JW5 A;  3KFM A;  2QMW A;  2OWS A;  4MF3 A;  5AA2 B;  2NUV A;  3QUJ A;  3GBA A;  4G2Z A;  4H1X A;  4QSC A;  4L17 A;  3D4G A;  1B3E A;  1LFG A;  4R72 A;  4R2F A;  2AL5 A;  1ZU0 A;  4R6H A;  5H8F A;  4GXS B;  1M5E A;  3RTW B;  5CBR A;  4IY6 A;  1MG1 A;  4NF8 A;  4EF1 A;  3S9E A;  5AA3 A;  4GWO A;  2V3U A;  4MLV A;  3RPW A;  2F6G A;  2REG A;  2Q89 A;  3HPI A;  2AYS A;  1Y1Z A;  1PB7 A;  5ELV A;  5I84 A;  2RC7 A;  4X48 A;  4EF2 A;  3FAS A;  1MY2 A;  4JWX A;  5JTY B;  1H43 A;  1VFD A;  4H0W A;  1RKM A;  1NNK A;  2UVJ A;  4LZ5 A;  2ONS A;  2QSX A;  2R9J A;  2F97 A;  4I8C A;  3TOD A;  4UAC A;  3MQ9 A;  5CM6 A;  5K2Y A;  3OSQ A;  1LB8 A;  2F6P A;  3T66 A;  3G3J A;  4BDL A;  5IAI A;  5I2K B;  3EPE A;  4EXL A;  3FXQ A;  1AL3 A;  3TCF A;  2GFE A;  3GBB A;  2O1M A;  3TTM A;  2XHD A;  3O6I A;  2ANJ A;  2G93 A;  2QS2 A;  2F7C A;  1AOV A;  3O29 A;  3B6Q A;  3IJO B;  1FQA A;  3UIF A;  4KR5 A;  3RLF E;  2XXQ A;  1DTG A;  4F2O A;  3BBR A;  3MW0 A;  1MXY A;  1M5D A;  5IKB A;  2DVC A;  1MPC A;  3BKI B;  5H8F B;  4Q30 B;  1FCK A;  1N04 A;  4FEC A;  4NED A;  3V89 B;  1LCT A;  2XXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...