1IXCA

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
294
structure length
289
Chain Sequence
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLEIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords LysR-type regulatory protein
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
total genus 91
structure length 289
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ixcA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixcA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixcA02
2QENA 3IOTA 1YG2A 1SBPA 4EJUA 1FYLA 1WODA 2B65A 3H7MA 4RB0A 5F1QA 4Z7EA 2CWEA 2JPCA 3DEUA 3LAPA 2NOOA 1RYOA 3K2ZA 3RN8A 1OVTA 5I59B 2GHAA 5FFZA 4ZH4F 2QL3A 3MZBA 1B7ZA 1A55A 1C0WA 1QKBA 2O0YA 2COMA 1I6BA 2QS3A 2FU4A 3DLNA 4LD5A 3LSWA 2BEOA 4RAYA 1VTNC 4ZYGA 1ONVA 1UHMA 4HLYA 4OYVA 1NNKA 3K1MA 5LHGA 2EA2A 4LB6B 2CO5A 4ZYDA 5EEGA 3RTWB 1TNSA 4MNUA 5H8QA 3CRBA 3M9AA 5DVJA 1USYH 4EMSA 2VE9A 1OQGA 2DBBA 1DPEA 1D5VA 4ELPA 4KIBA 1LBBA 4I7HA 2PMSA 2FEZA 3EN3A 5FLXK 2H4IA 3TTNA 3TAJA 1UQWA 1YW9A 5E8IA 4WXJA 4UVBA 2UVHA 4EJOA 1LB8A 3UGWA 5ELVA 3BJ6A 1U5TB 2Q88A 4TV7A 1WVJA 1MKMA 3WU1B 4OOIA 4EM1A 3EHUA 2F5XA 2DWJA 3IB1A 3GEZA 2HKXA 5E8GA 2VBXA 3BP8A 2AL5A 1TXFA 2O51A 4H1XA 5H8SA 4RGUA 1SVXB 2DVCA 1Y20A 3FJ7A 1XCVA 1MY0A 4LQ5A 4HDVA 1R1TA 3WE2A 3KE2A 4FIMA 3GXOA 1RNLA 4NEDA 4GXAA 4Q4ZF 1CF7B 1W7PB 3TOBA 4GFRA 4N9HA 2IVMA 4XBFA 1VE4A 4LZ5A 4AB5A 4ZECA 4IGTA 3ML6A 3P9CA 3T96B 3V8XB 1BIBA 2FNAA 4RB2C 4JBZA 1KQ8A 1NNFA 1H9TA 3GZ5A 4KA4A 2PI0A 2ZKZA 3TCGA 1DPPA 5I2NB 4S04A 3KZYA 4F22A 2HTSA 2HQNA 3SERA 1TFAA 3EHSA 1FQBA 3CR9A 1L0OC 5K5RA 4L9TA 1RUNA 4LVQA 3VLUA 1MDMA 4BDQA 2OA4A 2ZBKA 2D5WA 4IRGA 2EV5A 3PV0E 1B4HA 1ZLKA 5DYHA 5A2QK 3GFJA 4DCYA 3N6TA 3KN8A 3CO6C 4EJVA 3Q28A 5H8FA 1D9YA 3IC7A 2XXWA 2XAJA 5JK4A 3RQTA 3WU0A 3T9VA 4L0ZB 4MBPA 3UP9A 2ZYOA 4OINF 2YLNA 1B5JA 2K86A 4JBAA 5DT6A 1XVYA 4CO8A 3IOUA 1WRJA 2F5DA 3T9XB 1SD5A 3FV2A 4WX9A 2QYOA 3U94A 4JXIA 3C32A 4X9TA 3VXBA 4A6DA 2AIXA 4UNOA 2FF4A 4YKJA 4YIFA 2CSOA 3ELKA 5EEHA 2HTJA 1NMUA 5H8NB 1BIYA 1JW5A 1A8EA 1Y4TA 4Q5SF 1YLFA 4ELOA 3PFIA 1ULYA 4F31B 2G93A 3O28A 2H5YA 4FECA 5I2KB 3VVDA 1B46A 2A6HF 4CGZA 5I59A 1J7KA 4WEPA 1MXUA 2WKYA 1ZLQA 2NAZA 3IWFA 2F5FA 2H09A 2L54A 3GLXA 2HAUA 3I53A 1LDDA 4I9DA 3HUGA 3GYHX 4OXVA 1NL5A 4DCXA 3MWBA 2PJPA 5LLQA 3W15C 3GXAA 1KU2A 4IJAA 3WE3A 2G9WA 4YFNF 1IXCA 1B5HA 4WXDA 4R6HA 5I57B 1Q1HA 1TW2A 2XX9A 3MVYA 3F8FA 3M3FA 4FX4A 2DK5A 3DV8A 3I59B 5KZTA 3IB2A 1PDNC 4UV9A 2H25A 5J6XA 1M5FA 2Q9TA 2UXAA 2I3VA 5FHMA 1U5TA 2PEXA 5BPIA 2DP8A 2RC9A 1FNNA 4L5IA 5I56B 4I1DA 3K6WA 2MC3A 2KJBA 3SKPA 4QFOA 5KDTB 3O6BB 5D6EA 3DP6A 4EJWA 4NMYA 2PT1A 2QMXA 5D8LB 3LSTA 2A5SA 5CRYA 3H03A 3TTLA 4ZE9A 3Q9VA 1SW2A 4P9UA 4FORA 4HAMA 2DE2A 2ZFWA 2Y75A 4A0YA 2ZXTA 1DP7P 2MH9A 5DDGA 1NKXA 3DP8A 4KFQA 4YFKF 1GR2A 5LHHA 1CF7A 1W7PA 1LNWA 2DVZA 4QSCA 4R2BA 2B3FA 4HV6A 1E2XA 3HYIA 4KIFA 2L02A 1J9IA 3FX3A 1ZG1A 3FJGA 1LFGA 3W6KB 1LB2A 5I2NA 2CYYA 4DXBA 3K69A 3H6VA 3N5LA 4R6KA 3HPIA 2MH2A 4WWCA 3E6MA 2XHKA 3GW2A 1K6OA 2L4AA 3QOPA 2HZTA 1R9LA 4BHCA 1LEBA 1JHFA 4M4GA 3E5QA 4LUBA 2Q2AA 4MLQA 1MRPA 2K7LA 4GYGA 3PU5A 1GVJA 1SMYF 2F78A 4EUOA 2OWSA 4POWA 3K9TA 2ZNYA 2RC4A 3QK6A 4QFNA 1MD0A 1MQIA 3RLFE 3SETA 2CGPA 1ON1A 2GH9A 5F6FA 1BKAA 3IRQA 4KFCA 3UA8A 2XAHA 1SYHA 3TOAA 3DFGA 1SQYA 3N26A 2QLZA 4L17A 5E1WA 2HCAA 2V1UA 1XS5A 1FQDA 3C34A 2MLGA 3MP6A 5LEKA 4QFLA 2ETHA 1F9BA 3VLVA 4BLAA 2HGCA 1B3EA 2RKMA 3E3VA 2VONA 2PLYA 4NF8A 4BDRA 5BS6A 5H8NA 1PUEE 4DXCA 2IJLA 3ISPA 5FTIA 2QUFA 2W25A 3EUHA 4PDKA 3ZMVA 4EQQA 3DP7A 1UTBB 4G4PA 1MPBA 1R7JA 1FYMA 4G8NA 3T9HB 4IVNA 1MY4A 2DWAA 2VODA 5L9OA 3W6JB 3HOSA 4RNSA 3C1DA 3RKWA 2P6TA 1QPMA 1FCKA 3EYIA 1Y1ZA 5CJ9A 2DWIA 2YJPA 4LZ7A 4DLDA 4Y17A 1IEJA 3KCCA 3TTRA 1FQFA 3ECRA 2M8EA 4L18B 1LGBC 4RGXA 2OWTA 2E0SA 3EHTA 3OEMA 2RC8A 2A3SA 1T38A 1Z9CA 4IGRA 1Q1KA 3FXUA 2NVUB 1USSA 1ZGAA 4Q48A 2XXPA 3BPVA 2ELHA 4XKNA 5I57A 2IP2A 5CLSA 2V9VA 5D8KB 3KGCA 4U21A 3F3XA 5L3FA 4I01A 1TT1A 3TUSA 1H0MA 3RNNA 2F35A 1R1UA 3ZSFA 3IJXB 3I59A 3KEQA 4E70A 1DTZA 3B7DA 2RDPA 1P1OA 2Y84A 4CXFA 5JHUA 3K6UA 4G77A 2DQVA 2Y7PA 3RTFB 1LCTA 1ZG3A 2XKOA 1SDXA 2X4HA 4MF3A 2XXVA 3O97A 3QUJA 5I56A 4A6EA 1R1VA 1TWYA 1P4AA 1IITA 3TEPA 4HF0A 3DPLC 5FO5A 1AWCA 2O6GE 3GBAA 2XX8A 5KDTA 1S8NA 1U8RA 2XD2A 2I0CA 1TQMA 1KQ9A 4GOTA 4G7OF 4JWXA 4YB6A 4BDMA 1JEVA 3P7NA 2OZUA 3THIA 2CMOA 3FMQA 3SESA 2DW4A 2STTA 3IOVA 4QSDA 2FA5A 2TDXA 2RV8A 1HW1A 2PMHA 4P11A 4G8HA 3VXCA 4M9XA 3HOTA 1PBPA 1H9GA 1UIVA 4JK1X 2DWHA 1XD7A 3WTXC 1XDUA 4G8MA 1RZ4A 3U1OA 1IF1A 1LDKB 4C0RA 1LJ9A 4XLNF 3KZZA 2REJA 1MXWA 1F4KA 3QSLA 1FWZA 1J0RA 1HW5A 3L2CA 2O1LA 2FNPA 1FQEA 2H98A 2RKHA 1LFHA 5EHSA 3SEUA 4WXHA 3RIRA 1J59A 4ZZDA 3RDIA 3RI4A 1BC8C 1IXGA 3RPQA 4DDDA 2F8DA 1IN6A 5JVTA 5ICTA 1Z7UA 1N04A 1I1GA 1IUYA 3Q25A 4LONB 3PPQA 2A07F 4I62A 1FX7A 3ONMA 4NQWA 2STWA 1WKMA 2ZNZA 3RYPA 4M72A 4H0EA 1A40A 4KCCA 2GWRA 3V8LA 4KPTA 2Y7RA 2OBPA 3E6CC 4XKRA 4ZEBA 4NF6B 1P92A 1IIWA 5FHOA 4Q8RA 1GGGA 1QGPA 5LBQA 3KJ7A 2LDUA 4U22A 1MQHA 3C35A 1MJAA 3USDA 2VOOA 1FTOA 2EA4A 2PQ8A 3MZYA 3DPTA 1BJAA 3IOWA 3IO6A 2VC0A 3FF5A 4PQJA 5F1RA 3GF2A 4UUVA 1B0HA 2V93A 3G73A 3ZMTA 4PCQA 3KLNA 4ELQA 2F36A 2ABHA 3K0LA 1OPCA 1UHWA 4RGSA 4YMBA 3HHHA 2NXOA 2XGXA 3K4UA 4GWOA 1R5GA 1BC7C 5CMCA 1SFUA 3BBRA 4AVPA 1CE2A 4IO6A 4ENJA 4JDFA 1BN5A 2DPUA 3KZGA 3WGGA 3EPEA 4JWYA 4U23A 2QRYA 4GD5A 5CVVA 2DFIA 2HR3A 3IRRA 1O57A 1HSTA 4ZEDA 1UTBA 4LFUA 2RCAA 1JXSA 3O2AA 2QPQA 4XRFA 5HDGA 1MQGA 1FTLA 3LUYA 3Q27A 2GA2A 2LNBA 3NRVA 1YW8A 3R0AA 3QPTA 2Z99A 4N6PA 2VT3A 4OIOF 4WF2A 1TQPA 4IO3A 2QZ8A 5CI5A 2Z22A 4F18A 3KEIA 4LATA 1MY3A 4HQEA 3LA7A 2E1SA 1SMTA 4ZEFA 2UYEA 4MGRA 2UXNA 4OFLA 2Q89A 4HX4A 3J80K 1UB9A 1FT9A 2F5EA 5BQTA 3KOTA 2E1NA 3CIJA 1R6ZA 4I09A 5DVFA 2RNJA 3IWZA 1U5TC 3NQOA 4Q30B 2O8XA 2M45A 4YAHX 4EV0A 4U4XA 2GQQA 2KIFA 3VVFA 2ZCWA 2P2AA 5H8FB 3TQLA 1S3JA 5L3EA 3G3JA 1WI9A 5FFXA 2XXXA 6PAXA 2JZYA 1YS6A 3OEKA 4HW8A 3RT8A 3SHFA 3B6TA 4U0YA 1R23A 5FD5A 2OCUA 3RYRA 5DUKA 5AE4A 4P0IA 3HTSB 2XV4S 5B7DA 2I3WA 2VD3A 4A5MA 4OMYA 1URGA 3BPXA 2FOKA 1K78B 4FHTA 4F2OA 3D4CA 1D3YA 3FVOA 2YR2A 1ZLJA 4ESJA 4KD5A 3CFLA 4ZEIA 2HEUA 1XC1A 5J8CA 2H9BA 5M2VA 4U4SA 1B59A 2OJTA 1FTKA 2F34A 2CZLA 4M71A 4I0BA 3BROA 4A0ZA 2X26A 3F11A 2DQLA 2K4JA 3VFJA 1ZYRF 3SZPA 3HSFA 3FVGA 1MXYA 2H6CA 1YFHA 2DT5A 3PUYE 4JB7A 1O3TA 1XT8A 3P9KA 1KU7A 3K0VA 5H8HB 2D1VA 4HX7A 5HDNA 2ZNTA 5L3CA 5EHMA 3LFKA 3OV8A 4YG2F 2P1SA 3VFZA 1EU8A 1LDJA 2A61A 4YKIA 3FXRA 3KP7A 3R26A 1GV8A 4WEDA 4U7DA 3NEUA 2EB7A 1A7LA 3M3LA 4I0AA 4D0PA 4A5NA 3E6BA 3B6WA 2XXTA 5E18F 2Z5UA 3ZN1A 1MM7A 3QP6A 4NF6A 4QWQA 4RB3C 4NF4A 3SDFA 3MQ0A 5E17F 1S9TA 3E97A 2WTEA 3KFWX 4WK8F 3BDDA 2P7CB 1ZG5A 4CYDA 1RYXA 3C31A 2CFXA 2DI3A 3QAHA 4KCDA 3O3KA 1PEBA 3ZS6A 2D1HA 2H94A 3U92A 2NRAC 1GTKA 1TBXA 3EYYA 2YU3A 4BNCA 2XROA 1JGSA 4JWOA 1IN5A 3WODF 3IJOB 3I71A 4I2OA 3H3UA 1YW7A 1UFMA 2Y7KA 2I0BA 1BBYA 3JSPA 4BAYA 3N6UA 2NS0A 2W57A 1KGSA 5JI6A 1B51A 3EF7A 2PMUA 4ZYHA 2G7HA 4H8JA 1GVCA 4DIGA 2VP1A 3KP5A 3RT6B 4E0WA 4HV5A 2Y7WA 4U1ZA 1B5IA 4KYDA 4Z0IA 5DYMA 1V4RA 1REPC 1D3KA 2YX7A 2Q8JA 1NH8A 3PUZE 1Y4CA 3J81Z 1B2HA 3B6QA 3VODA 1IUDA 4ONYA 3QU6A 1MH3A 2QQAA 3CUOA 1MS7A 2YX4A 3T0YA 3CLOA 4G7ZF 4F2QA 1T2KA 2HKOA 2MA3A 2DPDA 1B52A 3EDPA 1IXIA 1QJMA 1EV7A 2JRTA 4QLCU 3HN0A 3W9WA 1BTJA 1US5A 1FYKA 2R3SA 4EQ7A 5FD6A 2L4MA 2RC7A 3F6VA 4O5VA 4IO2A 4YB7A 5AA4B 3K01A 2WWYA 3E6DA 4K2EA 4YKKA 5DTBA 3KN3A 1O63A 1U3EM 2P5KA 4A12A 4RXLA 3JAMZ 3PQKA 1OYWA 3I64A 4KQPA 3V89B 5K1YA 1W4MA 2PT2A 5HM4B 2EFQA 5DD8A 3OELA 5D4SA 5CBRA 5KVRA 1J75A 5HLIA 4L5JA 4ESXA 2DS9A 3S2WA 4X48A 3ZPLA 3RY3A 3ZP5A 3GWZA 4TOZA 1LFIA 2HOEA 1ELJA 4R6YA 4KN7X 1A8FA 5LGTA 1MJBA 2RN7A 3H4ZA 2H27A 4U2RA 5K2XA 4G68B 4ENMA 1KU9A 1OMIA 1N0TA 3MZHA 1MY2A 2L01A 1K78A 3RPUA 4NF8B 4O3MA 3MAMA 1PBQA 1HSLA 1R00A 3TCFA 3M1EA 2R7FA 1IRGA 1YCJA 2RQPA 1DPUA 5LGNA 2KIUA 2CW0F 3PPOA 2UVGA 3SZTA 1MM6A 1YTVA 2OU2A 4OERA 4ZS9A 3E13X 4OESA 5IT9Z 4PFUA 4R9FA 1M5CA 1GHCA 1Z05A 5ICFA 4O3AA 3MQ9A 1J2XA 3ZMSA 1B05A 1SI1A 3TDJA 2ZJ2A 4L9JA 4F29A 4IY6A 3TKDA 2CG4A 3KLOA 5H8HA 3KP3A 3M8UA 3S4UA 1VFDA 3TDZC 4XSXF 3CTAA 3GZGA 1TNTA 2Y48A 4PZJA 2UYFA 3I3VA 4QFKA 2JT1A 3C9HA 2O6AA 4OEUA 2OD5A 1A54A 4UACA 5TU0A 3CJNA 2VC1A 3LWFA 2VOPA 2C6YA 5D5VB 3L9FA 4UA8A 1T39A 3GX4X 2I48A 2Z23A 1BLFA 3FIRA 1QNTA 2ONKE 3PD8A 3WGHA 5CMBA 3TO6A 2VGQA 2VBWA 2AYSA 1MG1A 3ILUB 4JSDA 5CM6A 4GCVA 4MFIA 2PN6A 1K7AA 5TPAB 1XGMA 2GHBA 3DM0A 4C1UA 4G9YA 4FEBA 3WGIA 5LRSA 4RGRA 2DO7A 3VEPA 4MEYF 3KP6A 1H44A 4H6DA 4RY1A 5FHNA 1N7WA 1IXRC 1N3XA 1MDP1 1NNTA 2IT0A 3RUMA 1B58A 1YO5C 1BI3A 2IA1A 2HWVA 4XLPF 1T0KA 4R9GA 2M1BA 4H8IA 3C4MA 3PMWA 1ZJLA 4F19A 4IB2A 2QS1A 3TKYA 1ANFA 3S9NC 1GXPA 4Q5TA 5IT9K 1LLSA 4EF2A 3G3FA 4TQUQ 3TO7A 5FB2A 3TYHA 3IL1B 2RINA 3LC8A 3FMRA 2JSCA 1VSOA 3A3CA 2EV0A 4AD9A 5ILUA 3WTTC 1QO0D 1MDQA 1DMBA 5AONA 2W84A 1DDNA 2OLBA 4IO5A 2H99A 4EDPA 4U0VA 2IA4A 5LRRA 1AOYA 4E0XA 2B3BA 3TDUC 2W7YA 4YICA 3ULQB 2P6SA 1B3GA 4M1VA 3PUXE 5K5QA 1EZOA 5ERIA 5CVUA 4A2UA 1LAXA 5D5XB 4HLXA 4R2FA 2D2WA 1ODDA 1B6HA 1OLCA 3ZMUA 1US4A 1I6AA 1ZKBA 1J1NA 4PFYA 1OYIA 1LAGE 4HF2A 1IXSB 5D5UB 4G6QA 5AA4A 3IKTA 2DQRA 5LHIA 1AIVA 2XXRA 3DQVC 3MVXA 2IRFG 5ILVA 4THIA 3S9EA 1I5ZA 2IA2A 3ZKKA 4BQAA 1F1ZA 3F8CA 1HKTA 3HIFA 1BI1A 3RKXA 1H45A 2F6PA 1M5EA 3WTVC 2Z3YA 1XHYA 3UORA 2V3TA 1QULA 2V3QA 2DLLA 2NWJA 2IW5A 4WCGA 1Y3PA 5DVIA 4LA9A 3Q9SA 1IAWA 1ZBMA 2J5OA 2EK5A 4EQBA 4POXA 3I5OA 4GRKA 4H67A 1Z6TA 4G68A 1P99A 2XAQA 1FSHA 1ZU0A 1OQHA 4P55A 3FM3A 4IPAA 3CUQB 1FSEA 1WQ2A 2EJRA 1RI7A 4G8XA 2QMWA 2X7QA 5CVRA 1NH7A 2GIVA 2UVJA 3TQWA 4LMYA 1GXQA 4G6DA 1G3SA 2V84A 3JW4A 2PX1A 4AQ4A 1AOVA 3V5AA 4H5GA 2V3UA 3V8KA 4YZZA 1T98A 3GFLA 1LB9A 1L3LA 5I58B 2R7DA 5CC2A 3U9GA 2X7PA 3EQ1A 3HHGA 5LEJA 3OOAA 3GVAA 3HRTA 4QRZA 1VFEA 3K02A 2FRHA 1Y0UA 4GLIA 4TLLB 3KP2A 3T9UA 4BXUA 1AH5A 3K6XA 4IHSA 3U93A 1R22A 3D5LA 3QP5A 1QUJA 2F2EA 2XXYA 3PGFA 4G7HF 1LVAA 2ZMBA 3IAZA 5DV5A 2YPRA 2D45A 4OETA 2HZLA 4HCYA 5BUUA 1XSVA 2NNYA 4OTEA 4EXLA 1JVYA 4N0BA 4OIQF 3V8JA 2XUBA 1ZTYA 4ESBA 1PB8A 4RK2A 1B7HA 1MPCA 3I4PA 5H20A 2O61A 4LZ8A 4O3CA 3TMGA 3Q5FA 2OK2A 4XKQA 5TPAA 3MW0A 1FLIA 4U1OA 1YS7A 2VXZA 5FGMA 3JV9A 1W5SA 1EH8A 5CBSA 1MQJA 1HBXG 4ENKA 1DUXC 4MH5A 1ZN2A 2DK8A 4IRIA 3QPHA 1QQIA 2BGCA 2I4BA 1S7OA 1O7FA 2QBYA 5DCMB 3VVEA 5J8FA 3IX1A 3R0JA 1PB7A 4F3SA 3MBPA 1LCFA 3U1DA 4FEDA 1ON2A 1FZPB 3PMVA 3DXJF 3K6VA 1S7YA 2ISZA 4RB1A 5JTYB 5IAIA 2FNCA 4HQMA 5F64A 1VR5A 4OFOA 5JFRA 1EH6A 1AMFA 4PP0A 3OO6A 1IW7F 2V1XA 4QHQA 2V25A 1HKQA 2P0SA 2VN2A 1SYIA 3H06B 2UVIA 3WAFA 4LK0F 4LK1F 4BDNA 4FE8A 1Y3QA 2XKPA 3VV5A 1Q35A 5IT3A 1R9QA 4JQFA 3EQLF 4OEVA 3C33A 4EM0B 1J5YA 2XHDA 4O6JA 1B1XA 1STZA 4GQOA 3IO4A 4NE4A 1HXDA 1M5BA 2QSXA 4F3BA 4IF4A 2J5PA 3P7IA 3F8BA 2A5TB 4NF4B 2E1CA 5HPQA 4B8XA 4LB5A 3C18A 3ZQ7A 4XIGQ 4UVAA 2HXWA 1USYE 1B3HA 2OZZA 5K5OA 3W9VA 4M6YA 4S05A 4AIJA 2HFBA 1LAHE 1OVBA 1JE8A 1OMPA 5HS7A 3PD9A 2O69A 1HSEA 3O6HA 4RJZA 5ICEA 4HTGA 1ZRCA 2UZKA 4RK9A 4RPOA 2HDCA 1D9VA 1G4DA 3GO5A 4M9SA 1ZIUA 2F5CA 3BJAA 1IRFA 3AAFA 2KLFA 3BFTA 3D4GA 2ONSA 2Z8EA 3CUQA 2X0LA 4UVCA 1MQDA 3FM5A 2F6GA 1IQ7A 5IKBA 3HRSA 1JW4A 1WDNA 4KNYA 1O7TA 2AXLA 2A6EF 3ZMDA 1P1NA 5I58A 1H76A 3M7GA 2DYXA 1ZAOA 4HA8A 1EZ9A 1PB9A 2V1DA 4R72A 4U7BA 3UK4A 1U78A 3I58A 4OVJA 3T1BA 4WKMA 3WG9A 2XRNA 1XMAA 3L7WA 1Z7NE 1SW1A 4N13A 3O29A 3LA3A 4MTDA 4HF1A 3GFMA 2FBIA 4GYIA 2BBYA 2FE3A 3CG1A 1P4WA 4ELRA 3REOA 4LG0B 4BH9A 4BHBA 3KETA 2GRVA 1FBQA 5KK1A 2MLKA 2Z8FA 3G3KA 3MP1A 1YQAA 5E1XA 1HQCA 5L9SA 1DTGA 1RIOH 2BV6A 3BZ6A 5HBCA 1K79A 3TQNA 2PVUA 2O3FA 3IORA 2DXYA 3VB2A 5JR3A 1MGTA 3T66A 2DE3A 3TZAA 1UCRA 3KG2A 3IB0A 1S29A 2ZXJA 5FTHA 3L6HA 2QQ9A 3U8QA 4KMFA 4BDLA 4M73A 1M5DA 4NB5A 4LP2B 5DCMA 4TLMB 4ESWA 1QW0A 1O64A 2VHAA 2W24A 4G2ZA 5FLXZ 3KP4A 2ZYMA 2YSRA 3R6UA 4JSOA 5CMKA 1Z91A 1EH7A 3QUFA 4CHUA 3SQNA 5JTYA 1H43A 1B9NA 3G3ZA 4CDGA 1A99A 2QWWA 4OMBA 1KWHA 1ZREA 2PBIA 1G3TA 3SEWA 2XXIA 2M8CA 4MLVA 4UV8A 5E20A 5AA2D 4F1YA 3KEOA 1FQAA 3WTWC 3FASA 2XXQA 2PBWA 1B1HA 2G29A 1XB4A 4IY5A 5BMZA 1TLHB 4GXSB 4F7ZA 2GAUA 4OFJA 2QS4A 5HS9A 3F21A 3G3HA 5DUIA 4CZZA 3BKIB 3MFKA 3IR1A 4CICA 3F6OA 3CSGA 3CDHA 4RYAA 5L9MA 2PYYA 3LSXA 1SFXA 3JSOA 4C1TA 2A5TA 1B6AA 1POTA 2Q2CA 2HFHA 1XDSA 3T8RA 5HVQC 2XAGA 1URSA 1SAXA 4F3PA 2D21A 3L6GA 5JEIA 3HV1A 2JTVA 4G68C 1QUIA 2ACJA 4GXOA 3BJOA 3OO7A 3FVKA 4B09A 1RUOA 4GL8A 2OZ6A 2ZMEA 2FQ3A 4R74A 5B70A 1TFDA 4MHGA 1B4ZA 4EQ9A 3LA2A 3CI8A 5ICCA 3K1PA 1D8JA 2ZYNA 1I69A 3K1NA 3PPPA 1SI0A 4RS8A 5A2QZ 3ZKLA 4H5FA 4ISUA 1ATGA 3L00A 4HYEA 1IN8A 2EFOA 5ILSA 1R36A 4PE5B 3WTUC 1N76A 4EF1A 5D4RA 3ZMZA 4PFWA 5L8DA 1I6QA 1B3FA 1MPDA 3V7RA 3HTUA 4L9NA 4EJTA 3H3ZA 2Z33A 1O3SA 4KYWA 5LOMA 2RVCA 2AL4A 2R9JA 2LKPA 3MPKA 2F7AA 4KICA 3CFXA 4UHTA 4GIZA 1N3WA 4LG0A 3MZ1A 3D0SA 1EZPA 4OU0A 3OO9A 4I8CA 3TTKA 2DTRA 3TGNA 3E3KA 5L3BA 4DXUA 2E7WA 1YPNA 3LQQA 2A5YB 5J1DA 1XMKA 4MQVA 4HX8A 2VOZA 3DKWA 3OMBA 2ESHA 1FY7A 3N97A 1KYZA 3ECHA 2ZNUA 3SEVA 3S9LC 1Y3NA 2DOJA 1U6GA 3RJPA 3OENA 1QVSA 3HSTA 1SD4A 1T6SA 2A69F 4GL0A 2KIMA 4F39A 2O7UA 2A68F 4M6XA 2ADUA 3CG3A 1IZ1A 1LEAA 4OMZA 4AIKA 2XXUA 5ICQA 1R5HA 4X1DA 1ZARA 2I49A 1B1BA 3WTSC 4K3FA 1H3DA 4OWDA 2QJEA 3O6IA 5D6FA 1YIOA 3FJMA 3HHFA 2FSWA 5ITPA 3KOSA 1XSDA 1R58A 3OSRA 5AA2B 4HOBA 2IPQX 3TPAA 3IL2A 1ZGJA 4ON0A 3ECOA 2RCBA 1BIAA 3TO9A 1USTA 4P96A 4NF5B 3N94A 3CFZA 3OSQA 2HYGD 3J7AO 3LR1A 5TP9B 1PP7U 2WV0A 1QZYA 1B7UA 3Q26A 3AXFA 1ZRDA 2XD3A 3SEXA 2JPBA 4PGHA 3H6UA 3J81K 4IO7A 1SD7A 4L0YB 1FW0A 5AA1A 1Y1MA 3R4KA 4ZEKA 3WTZA 2Y0MA 4HW0A 1Z7ME 3QAXA 2Q0OA 1G3YA 4AIHA 4ZE8A 3DF8A 3FVNA 3V7SA 1HKSA 5A5XB 5KCJB 2BYVE 4ENNA 4EVIA 3H6WA 1Y9UA 1S50A 4FT8A 2O84X 3T22A 3T93B 3FATA 3O6GA 4ASNA 1NNPA 4Z2YA 5DCFA 3G7WA 2DXRA 3MWMA 3KN7A 5H6RA 2F97A 1FPQA 2DAOA 3JAMK 1KYWA 3PUVE 3O66A 3R6SA 3CO7C 4F1VA 3QYTA 3JTHA 3R60A 2NNNA 3DP4A 3TELA 2FYIA 1WWXA 2VT2A 2R71A 3MJNA 3CUQC 5BPDA 2DE4A 3MC2A 5LGUA 3ILTB 2V79A 4BHPA 3MCZA 3M3KA 2CQKA 3LQRA 1XOCA 3FHZA 4KDPA 3A09A 3PPRA 3VLWA 2QBYB 3KJTA 1HSJA 4IHTA 2THIA 4R73A 4KN4X 2P4WA 1FBUA 4IRHA 1POY1 3TCHA 2EFPA 4AWXB 3SEYA 1WSUA 1O3QA 1MJ9A 1Z1DA 4OQOA 5CVJA 3FWEA 5DEXB 1R1NA 3GZ6A 3S2VA 3JTGA 3BFUA 3E4RA 1KU3A 1S7AA 3M8FA 3MPLA 4GF8A 5CYVA 3MUQA 3F22A 2HZKA 1OR7A 2IEEA 3K00A 1BOAA 3HSRA 4P0GA 3OXNA 5TRDA 2FMLA 2F7BA 4PETA 4FAJA 3FXQA 2QS2A 4ZDMA 3COAC 3FV1A 5CMMA 2FBKA 2GZWA 4N07A 4LLGF 2YPNA 1XGOA 1QUKA 3H6TA 2WC2A 4M74A 3GUDA 1B0LA 5H6QA 1SFEA 1MZBA 1LAFE 5AIPA 4OZ9A 3ERED 3WTYC 2L3DA 4ETSA 3JZJA 1P6RA 2LF7A 1FOKA 2P7VB 3F72A 2XIGA 3VOEA 3E5XA 3MVWA 2PFBA 5ITOA 4R1HA 4LLLA 3MP8A 3I5UA 1YTYA 1UIUA 1PP8F 3U72A 2O7IA 2GFEA 3TODA 2ONRA 3LSLA 3VE1B 3RGYA 1A04A 5HDKA 4EGYA 4ESFA 5EYFA 3V83A 2P8TA 2EFWA 5HS8A 5AA2A 4MEXF 1TQIA 3RKYA 4QSEA 3EETA 1G6NA 4I98B 3HRMA 2VBZA 1B40A 4OENA 1P2FA 1JNFA 5ISUA 4NF5A 2Y7IA 4YU0A 4PFTA 4GGGA 1JVXA 5TP9A 3T5XA 3FZVA 2R6GE 2MBFA 2I58A 3S9MC 4DQ2A 1AL3A 3RTRA 2GXBA 1UTHB 3G3GA 3LAJA 2FMYA 4U88A 5L3GA 4GVOA 2UXXA 4YMAA 3BOQA 4BYYA 3G3IA 5A5XA 4NTLA 5KCJA 4XKPA 3MZ9A 5I2KA 4KUMA 5HLHA 4EGZA 3PUWE 2EWNA 4FX0A 1JQFA 3UN6A 1FC3A 3N4MA 3OO8A 4F3GA 4YFXF 1LQ1A 1LSTA 2HEOA 2K27A 4Y15A 2FBHA 3FMSA 5L3DA 1JW1A 4R8HA 2MD5A 3RPWA 1JEUA 1ZMGA 1FP2A 1OKRA 3O2PE 1B3LA 3LSFB 2BE5F 4U0WA 1ZRFA 4Y13A 4XXUA 1F5TA 2ANJA 4HCWA 1P1WA 4ZZAA 5ED4A 4EM2A 3H3GA 1U2WA 3HRUA 3PMXA 2NYXA 1S6LA 1IXHA 2ESNA 3Q29A 4OHNA 1DOTA 4M9ZA 2Q8KA 4IXAA 2I4CA 4R75A 1ZH5A 4LGWA 3LBSA 3E5UA 4QFPA 4OIRF 1FTJA 1YAEA 3KFMA 1TW3A 4KYSA 3QXMA 1X3UA 4H0WA 2KJCA 1SD3A 3JYRA 2HQRA 3GLBA 1XGSA 1OYYA 5E1ZB 4ZZLA 5HOOA 2FXAA 4IO4A 1FQCA 2NUVA 1PC3A 1DSNA 3R61A 1G3WA 3QIMA 1XCBA 2M87A 1MXVA 1QKAA 3CSBA 2KKOA 5DD4A 3FUZA 2XAFA 1EH3A 5DEXA 4NHJA 1OLAA 3I0TA 3E9XA 5D5WB 2VBYA 3PQJA 1P1UA 4KT5C 5CVIA 3CVGA 1N7XA 5AA3A 3MEXA 3V4GA 4HDUA 2E7XA 2EFNA 3KBRA 1RKMA 4DNCA 2O1MA 2HAVA 1ZHFA 3ZN0A 4LLNA 2ZO4A 4YKPA 1B9MA 3HCQA 3VDFA 2Q2EA 3FGSA 3A3UA 1XVXA 3ROUA 4RAZA 4KI0E 5DEQA 2XX7A 1E17A 3FD3A 1OIBA 3IK6B 4NWCA 2EV6A 3P9IA 1HW2A 3ABUA 1KA8A 3IHUA 2LSOA 1QZZA 3UIFA 1SW4A 1P1QA 1IN7A 3OD7A 2XVCA 1XGNA 5F7VA 1DPRA 2DU9A 1IN4A 1BI0A 1SD6A 2V6CA 4XSZF 2RGVA 3HO7A 4KHZE 2I6EA 3J80Z 1NFTA 2ZMEB 5H8QB 3ODBA 3WAEA 1CGPA 4P5OA 3BWGA 4MQ9F 5I84A 1B32A 3U2RA 1P4XA 2ALUA 3B02A 1MH4A 3TTMA 1L5TA 3ABTA 1BM9A 4BDOA 3SFZA 3IKVA 2GA1A 2PG4A 4LQ2A 5K2YA 4RA1A 4A0XA 2HS5A 2QQBA 2LF8A 4GO1A 2LAOA 4Q47A 2ZYKA 1B9JA 3QU3A 2F7CA 1YYVA 4WXCA 1N84A 3PPNA 3H92A 1UTHA 3C36A 4UXNA 2XASA 2QM3A 2P5VA 2IA0A 2D3IA 4ZYEA 4YIIA 4RPNA 5ICGA 3V7CA 1D4NA 3DELB 1LBCA 3SXYA 2B0LA 4HS7A 1I1SA 4EXKA 2M30A 4I02A 2K4BA 4KR5A 4KYEA 2G7UA 3HSEA 5BWJA 3F8MA 3B73A 1V3FA 2O03A 1O3RA 3TFLA 3BY6A 1W5TA 3MAJA 4Q0CA 3C7JA 5HLGA 1KQ0A 3M8EA 1BP5A 2Z8DA 4KMUX 4ND9A 4N9IA 1XN7A 4L9VA 2H6BA 4P9FA 1CB6A 2GXGA 1FP1D 5BOXA 4ECFA 4NWDA 3F8NA 2KRFA 2AS5F 1W7PD 1O7LA 2OAZA 2M5WA 4HZFA 4H65A 1SW5A 2P5LC 1II5A 2REGA 2QVOA 1MY1A 1NHAA 4OIPF 1FBSA 4MTEA 3KSXA 1MDMB 4DZ1A 3GBBA 3GFIA 1Z6RA 4YB5A 3KSJA 2VD2A 1B4AA 4LJZF 4FJPA 2HQ0A 2DSFA 2XXHA 1BI2A 1F9NA 1MXXA 3I6VA 4DE8A 2UWMA 2FA7A 2OQRA 3C3WA 3T8TA 2HYFA 1QBJA 2VE8A 1JHHA 2ISYA 5TJJA 1PDAA 1TTYA 4PGGA 4HBLA 1D8KA 3MVZA 4O3BA 2RF1A 3OOPA 1T0FA 2Z9OA 1XSXA 2K02A 2OQGA 3K2DA 3L09A 2W85A 4G94A 4X1BA 4QF9A 3QRFF 2BJJX 1I27A 2O68A 4F1UA 1JETA 2OBGA 2ZNSA 4FATA 1URDA 4R79A 5AIQA 3I54A 4XTCQ 1I6XA 3R7XA 1MXZA 3O9PA 4ZZEA 4AB6A 4KIGA 3F23A 1FTMA
chains in the Genus database with same CATH superfamily
1X1BA 2QENA 3IOTA 1YG2A 3SYTA 4EJUA 1FYLA 1SBPA 1WODA 2B65A 4C2TA 2TCTA 3H7MA 4RB0A 5F1QA 4Z7EA 2CWEA 2JPCA 3DEUA 3LAPA 2NOOA 1RYOA 3K2ZA 3L1PA 4XMYA 2IS2A 1OVTA 3RN8A 3RPLA 5I59B 2GHAA 2HPIA 5FFZA 4ZH4F 2QL3A 1ETVA 3MZBA 1B7ZA 1A55A 1C0WA 1QKBA 2O0YA 2COMA 1I6BA 1Q9DA 3HUGB 4GDFA 2QS3A 2FU4A 3DLNA 4FETA 2NOGA 1N25A 4LD5A 3LSWA 2BEOA 4RAYA 4IHYA 2LY1A 3I4NJ 1VTNC 4ZYGA 1X4OA 4X0GA 2B4MA 1ONVA 1UHMA 4HLYA 4OYVA 3W6VA 3FXOA 1X3ZB 1NNKA 1NV1A 3K1MA 5LHGA 2EA2A 4LB6B 2CO5A 4ZYDA 5EEGA 2DMPA 5B1AH 3GYYA 3RTWB 3BCBA 1TNSA 4MNUA 5H8QA 3L2WA 3CRBA 3M9AA 5DVJA 1USYH 4EMSA 2VE9A 4N81A 1OQGA 2DBBA 1DPEA 1D5VA 4P47A 4ELPA 4KIBA 1LBBA 4I7HA 2PMSA 2FEZA 3EN3A 5FLXK 2H4IA 3TTNA 3SDBA 4BEHA 3TAJA 1UQWA 1RDXA 1YW9A 5E8IA 4WXJA 4UVBA 2UVHA 4EJOA 2EH3A 1LB8A 3UGWA 3G6EI 1PVEA 5B1BH 5ELVA 1VZ0A 1H8AC 3BJ6A 3FBPA 1U5TB 4I3YA 2Q88A 4TV7A 3LSRA 1MKMA 1WVJA 1E3PA 3U65A 1BJZA 3WU1B 4OOIA 4EM1A 3EHUA 1GVDA 2F5XA 2DWJA 4IZZA 3IB1A 4AS4A 5C44J 3HFUA 3GEZA 2L7KA 2V9KA 2HKXA 5E8GA 2VBXA 3C2HA 3BP8A 5GTHC 2AL5A 1TXFA 2O51A 4H1XA 5H8SA 3PTYA 4RGUA 1VQ8I 1JGGA 2BY1A 2DYSH 1IMDA 1SVXB 2DVCA 1Y20A 3FJ7A 1XCVA 2IGKA 1MY0A 4LQ5A 2MSYA 4HDVA 1R1TA 3WE2A 3KE2A 4FIMA 3GXOA 1RNLA 4NEDA 4GXAA 5B66C 4Q4ZF 2W1OA 3H5AA 1CF7B 1W7PB 3TOBA 5GP9A 2QCOA 2IVMA 4N9HA 4XBFA 1VE4A 4GFRA 4LZ5A 4AB5A 3B6AA 2JUGA 4IGTA 4ZECA 3ML6A 3P9CA 3T96B 3V8XB 3KZIC 3AKZA 1BIBA 2FNAA 4RB2C 1ZQ3P 4JBZA 1KQ8A 1W0UA 1NNFA 1H9TA 3D1NI 3GZ5A 3IV5A 2H1LA 1WH7A 4KA4A 3A01B 2ZSHB 4LG3A 2PI0A 2ZKZA 2M0CA 3CJTB 4RDUA 4N6DA 1DPPA 3TCGA 4DI4B 5I2NB 3TEDA 2ID3A 4S04A 2LFBA 5T3JA 3KZYA 2LD5A 4F22A 2HTSA 2HQNA 2VKHA 3QWLA 3SERA 1TFAA 5ET6A 3EHSA 4FISA 1FQBA 2O8KA 2VIXA 3CR9A 1Y8QB 1L0OC 5IOZA 5EF6A 5K5RA 4E7HA 4PDDA 1GUUA 4L9TA 1RUNA 2M0MA 2WADA 4G61A 4LVQA 1OJLA 3M3YJ 3VLUA 1MDMA 2DFEA 4BDQA 2OA4A 2ZBKA 4ZTJA 4IRGA 3S1QJ 2D5WA 3Q3SA 2EV5A 3PV0E 4OVQA 1B4HA 1ZLKA 2DDAA 5A2QK 1H89C 2NS8A 3M4OJ 5DYHA 3GFJA 4BGDA 2W7NA 1K83J 4A3JJ 3N6TA 3KN8A 4DCYA 3CO6C 4EJVA 3Q28A 5H8FA 1D9YA 3IC7A 2XXWA 2XAJA 5JK4A 1RKTA 1U9NA 3KPHA 4XKVA 3RQTA 3LSGA 3WU0A 4BJ5C 1HCRA 3T9VA 4L0ZB 4MBPA 4A3MJ 2M34A 3UP9A 2ZYOA 2VPNA 4OINF 2YLNA 1B5JA 2K86A 1LUJB 4JBAA 1XVYA 5DT6A 4IGRA 4CO8A 3SDGA 2R7VA 3IOUA 1WRJA 2F5DA 3T9XB 1SD5A 3FV2A 1BK4A 4WX9A 2QYOA 1WCMJ 4E4HA 4JXIA 3C32A 3U94A 4X9TA 2XWOA 1AWBA 4A6DA 3VXBA 2AIXA 4UNOA 2FF4A 2WB1N 4YKJA 4YIFA 2CSOA 3ELKA 5EEHA 1XTAA 2HTJA 2PJRA 3DU6A 1NMUA 5H8NB 4E7IA 1BIYA 1JW5A 1A8EA 1Y4TA 1F43A 4Q5SF 4ZDLA 4GBWA 1WJAA 2UV1A 1YLFA 3OR1C 4ELOA 3PFIA 2OX3A 2R7ZJ 1ULYA 4F31B 2G93A 5EYHA 4C3IJ 3O28A 2H5YA 4FECA 1MNEA 2KR0A 5I2KB 3VVDA 1B46A 3FK6A 2A6HF 4CGZA 5I59A 5IZZA 2IS4A 4IO9F 1J7KA 4BS9A 1MXUA 4XLEA 1ZLQA 2NAZA 2WKYA 3IWFA 2F5FA 2H09A 2L54A 3GLXA 3GTOJ 1FIPA 3I53A 2HAUA 1LDDA 4IQJA 4I9DA 5GPCA 3HUGA 2W48A 5KHDA 4P8BA 3K2AA 1R9TJ 2HVQA 3DTIA 3GYHX 4Y3OA 1NL5A 4OXVA 4DCXA 2Y30A 3MWBA 2PJPA 1GV5A 3S93A 5LLQA 1K9YA 3W15C 3MKZA 3GXAA 3DBLB 3JRGA 1KU2A 2E19A 4IJAA 3WE3A 2FX0A 3PNVA 3LMMA 1X2NA 4B3AA 2G9WA 3KYDB 4YFNF 3JR9A 1IXCA 2JUCA 1B5HA 1VQ7I 4WXDA 2LK2A 4R6HA 5I57B 1MBHA 4GWXA 1Q1HA 1TW2A 4NN3A 3DTEA 2XX9A 3MVYA 2OCEA 3F8FA 3M3FA 2CU7A 2VB6A 1FBPA 1XG1A 2XF5A 2JJKA 4FX4A 2DK5A 3DV8A 2OUMA 3I59B 5KZTA 3PIOF 3IB2A 2LTPA 1PDNC 4UV9A 2PMZA 3BR3A 2F48A 4DGWB 5J6XA 2H25A 1M5FA 2Q9TA 4GX6A 2UXAA 2I3VA 5FHMA 1U5TA 2PEXA 5BPIA 2DP8A 2Y0SA 1FNNA 2X1EA 2RC9A 4JVDA 4L5IA 3OYDA 5I56B 4I1DA 3K6WA 1TWCJ 2DOFA 3ZXSA 2MC3A 3GTJJ 2KJBA 4NQ8A 5IYDJ 1MMGA 3BC8A 5IOYA 1LEVA 3SKPA 1LBWA 4PFOA 4QFOA 3O6BB 5D6EA 5KDTB 3DP6A 4EJWA 4C30A 4NMYA 2PT1A 5HLTA 2ZZVA 2LBFB 2RAEA 3HOZJ 5D8LB 3LSTA 2A5SA 3CP8A 2QMXA 5CRYA 1FPIA 3H03A 4MAGA 4AIDA 3TTLA 3HXLA 4ZE9A 3E7LA 5JVGF 3EKIA 3IFCA 3Q9VA 4M3GA 4P9UA 1SW2A 1XPXA 4FORA 4HAMA 2DE2A 1SFKA 2ZFWA 4IX7A 2KZVA 2Y75A 4A0YA 2ZJRF 2ZXTA 1DP7P 2MH9A 2DMTA 5DDGA 1NKXA 3DP8A 4YFKF 4KFQA 1GR2A 2BXZA 2IAIA 4FCYA 5LHHA 4XM3A 1CF7A 1W7PA 4HSTA 4N8YA 1LBZA 1LNWA 1BOBA 2DVZA 4QSCA 1NUZA 4R2BA 2B3FA 3HOWJ 4HV6A 5LDZA 1E2XA 3HYIA 4KIFA 2L02A 1J9IA 3FX3A 3A01A 1ZG1A 3FJGA 3L2RA 4N6KA 1LFGA 3W6KB 1LB2A 5I2NA 3OYEA 2CYYA 4JYKA 4GFBA 4DXBA 2EPFA 3K69A 3H6VA 3N5LA 4R6KA 1W1WE 2R5ZB 3HPIA 2MH2A 4OAYA 4WWCA 3RZDJ 3E6MA 3OYIA 2XHKA 3GW2A 3K7AJ 4E7JA 1K6OA 2L4AA 3QOPA 2HZTA 2K5CA 4BHCA 1LEBA 1R9LA 4S0HB 2WBMA 1JHFA 1YOVB 4M4GA 3HGGA 2R7UA 1ZGWA 3WG7H 1ZK8A 3E5QA 4CZCA 4LUBA 2M7AA 4F3BA 2Q2AA 4NQWB 2JQ7A 2CQNA 2NVXJ 3GZNB 1MRPA 2K7LA 4GYGA 3PIPF 1GVJA 3PU5A 3OYKA 5J40A 3S14J 1SMYF 2F78A 4EUOA 2OWSA 4POWA 3K9TA 3H0GJ 2OV7A 2ZNYA 2RC4A 1QRYA 2ZC2A 3QK6A 4QFNA 1MD0A 4XEQA 4EATA 2XPVA 1MQIA 3JRFA 1T0FC 5F04A 2HI3A 3RLFE 3SETA 2CGPA 1ON1A 2GH9A 5F6FA 1T08B 2ZJPF 1X1AA 3IRQA 5E3OA 1OCZH 4KFCA 1BKAA 2Q8MA 3UA8A 1ETXA 2XAHA 4BBRJ 3TOAA 1FTTA 1SYHA 3DFGA 1SQYA 3N26A 2QLZA 1W0TA 4L17A 5E1WA 2HCAA 1FPLA 3O8GA 2V1UA 1FQDA 1XS5A 2MLGA 2I5UA 3C34A 2V1NA 3MP6A 1KZHA 3QQAA 5LEKA 2VT5A 1NV0A 2ETHA 1F9BA 4NHBA 4QFLA 3VLVA 4BLAA 2HGCA 1B3EA 2RKMA 5EQ7A 2VXDA 3E3VA 2VONA 3IAS2 2PLYA 4NF8A 3QYEA 4BDRA 5BS6A 1JKPC 2NOJB 5H8NA 2BY2A 2L9SA 4B4CA 1PUEE 2Z1DA 1K6YA 4HXVA 4MEVA 5K7FA 2F4MB 4DXCA 1T33A 2IJLA 1ETKA 2QUFA 3ISPA 4XQFA 5FTIA 2ZXIA 2W25A 3EUHA 4PDKA 3ZMVA 4EQQA 1FSAA 3DP7A 5IZ3B 4GX4A 4BE2A 1UTBB 4G4PA 1MPBA 1R7JA 1FYMA 4G8NA 4XN0A 3T9HB 1G0IA 4IVNA 1MY4A 2DWAA 2VODA 5L9OA 3W6JB 3HOSA 4RNSA 3C1DA 3RKWA 2P6TA 1QPMA 1FCKA 3EYIA 1Y1ZA 5CJ9A 2DWIA 2YJPA 4LZ7A 4DLDA 4X1EA 4Y17A 1IEJA 3QMFA 3PUFA 3KCCA 5EG0B 2ZMEC 4II3A 3TTRA 5A5LA 1FQFA 3ECRA 2M8EA 3MZ8A 4L18B 1LGBC 4RGXA 3ASNH 4BE1A 1EYIA 2OWTA 3RCOA 2E0SA 3EHTA 2M4GA 3ZR8X 3OEMA 2RC8A 2A3SA 5EJCA 1Z9CA 1T38A 4Z6YA 1X19A 3FXUA 2NVUB 1GDTA 1USSA 4IHXA 1ZGAA 2CJJA 4Q48A 1Q1KA 2XXPA 3BPVA 2QEXI 2ELHA 1T95A 4XKNA 5I57A 2IP2A 5CLSA 2V9VA 2W82A 5D8KB 4DIQA 3KGCA 4U21A 1A6QA 3F3XA 2XGEA 4I01A 5L3FA 1TT1A 3TUSA 4PAFA 1YJWI 1H0MA 3RNNA 2F35A 3CCVI 1R1UA 3ZSFA 4OA4A 1X58A 3IJXB 3I59A 3KEQA 4E70A 1ZR4A 1DTZA 2RDPA 3B7DA 4X04A 1P1OA 4A3KJ 2E5ZA 2Y84A 4CXFA 5JHUA 3K6UA 4G77A 2HVRA 2DQVA 2Y7PA 1P7JA 3RTFB 2KHMA 1ZG3A 2XKOA 1LCTA 1SDXA 2X4HA 4MF3A 2CUZA 2VJJA 2XXVA 3O97A 3QUJA 5E3NA 4I99C 2Z16A 3AL0C 5I56A 3MN2A 4A6EA 1TWGJ 2IGNA 1R1VA 1TWYA 1P4AA 1IITA 3TEPA 4HF0A 3DPLC 1DQUA 5FO5A 1AWCA 2O6GE 1LBXA 3GBAA 2XX8A 5KDTA 1S8NA 1U8RA 2K9SA 2XD2A 3DKXA 4CH7A 2I0CA 1TQMA 3CESA 1KQ9A 1TT5B 2LBFA 3DTKA 4G7OF 4GOTA 4JWXA 4YB6A 4BDMA 1JEVA 3P7NA 2OZUA 3THIA 3LNQA 2CMOA 3NWTA 2G0EA 3BR1A 3FMQA 2IGOA 5DM6F 2CUEA 3SESA 2DW4A 2STTA 3IOVA 3CHGA 4QSDA 2FA5A 2TDXA 4RPOA 2RV8A 1HW1A 2PMHA 2AO9A 3PSIA 4P11A 1POGA 4G8HA 3VXCA 4M9XA 3HOTA 2Q74A 1PBPA 3CJQB 1H9GA 1UIVA 5EZGA 2XSDC 3CCRI 1VDWA 4JK1X 2JA7J 2DWHA 1XD7A 1ZTRA 3WTXC 1XDUA 4G8MA 1RZ4A 4XIDA 3U1OA 1IF1A 1S9HA 1LDKB 4C0RA 2KQRA 1LJ9A 4XLNF 3KZZA 2REJA 1MXWA 1F4KA 3QSLA 1FWZA 1J0RA 1HW5A 3G1OA 3L2CA 2FNPA 2O1LA 1FQEA 3A4CA 2H98A 3D5SC 2RKHA 1LFHA 5EHSA 2MG4A 3SEUA 4WXHA 1UHSA 2QKMB 2R5ZA 3RIRA 3K70D 4IHWA 4AC0A 1J59A 4ZZDA 4XL9A 3RDIA 3RI4A 4KPTA 2XRLA 2VQLA 1BC8C 4W1UA 3OYMA 1IXGA 4RAFA 3RPQA 4DDDA 2FUG2 1NH3A 1IN6A 5JVTA 2F8DA 5ICTA 1Z7UA 1E3OC 1I1GA 1IUYA 1N04A 3Q25A 4LONB 1JKRC 5M5XJ 3PPQA 2A07F 3CLQA 1NG7A 4I62A 1FX7A 3HPGA 4E7SA 3BR6A 4NQWA 1WKMA 2ZNZA 3DBRB 5J1RA 2STWA 3ONMA 4KT6A 3KC1A 3RYPA 1RPWA 2GIZA 3GTMJ 2ELJA 2EQRA 4M72A 4H0EA 1R4NB 2GWRA 3V8LA 3RZOJ 4D7MA 2OBPA 3E6CC 1A40A 2Y7RA 3LOCA 4XKRA 4ZEBA 4NF6B 1P92A 1IIWA 4ZYAA 5FHOA 4Q8RA 1FMVA 1GGGA 1QGPA 5LBQA 3KJ7A 3K4NA 2LDUA 3CMYA 1MQHA 4U22A 2X9DA 1MJAA 3C35A 4XLCA 2IBDA 3USDA 2VOOA 1FTOA 2HZDA 1SPIA 2EA4A 2PQ8A 2Y69H 3MZYA 1NI9A 1F36A 1BJAA 3DPTA 3IO6A 2VC0A 3FF5A 3TW7A 3IOWA 5F1RA 2WB1A 3CC2I 4PQJA 3GF2A 4UUVA 2DODA 4GBVA 1B0HA 1FOXA 1A31A 1OLTA 2V93A 3G73A 4CCLA 3ZMTA 4PCQA 3KLNA 4ELQA 1QGXA 3ROJA 4PGPA 2DA6A 3P5JA 2F36A 2ABHA 3K0LA 1OPCA 1UJ8A 1UHWA 4RGSA 4BE0A 4PAIA 4YMBA 3K4CA 3HHHA 2NXOA 2XGXA 5TISC 3K4UA 3I55I 4GWOA 1R5GA 1BC7C 4CYCB 5CMCA 5EEAA 1SFUA 3M1CA 3BBRA 3DU5A 4P1WA 4AVPA 1CE2A 4MO7A 4IO6A 4C9YA 4ENJA 1QHGA 4JDFA 2E1OA 1BN5A 2DPUA 1S7EA 3KZGA 2ZJQF 3WGGA 3EPEA 4JWYA 4U23A 2QRYA 4GD5A 5CVVA 1YYZA 2DFIA 1RESA 2HR3A 1O57A 3IRRA 1HSTA 2LP0A 5IZ3A 4ZEDA 4DZPA 1UTBA 4LFUA 2RCAA 1JXSA 3O2AA 1IV6A 4O7IA 2QPQA 2E5NA 4XRFA 5HDGA 3IP4B 4LIVA 1MQGA 1FTLA 3LUYA 2CW7A 3Q27A 3OIPA 1S72I 3S2DJ 2GA2A 2DT6A 2LNBA 2VQCA 3NRVA 4GWSA 1YW8A 3R0AA 3QPTA 2VPRA 2E1MB 2Z99A 4N6PA 2L9RA 2VT3A 2R7WA 4OIOF 3FIWA 4WF2A 5EG0A 1TQPA 4PJMA 4IO3A 2QZ8A 5CI5A 2F5VA 2Z22A 4F18A 3HOXJ 3CMMA 3KEIA 3JRDA 4LATA 1MY3A 4ZDPA 1UMQA 3LA7A 4HQEA 1PUFB 2R7TA 1P7IA 3ZQHA 4IKFA 1SMTA 3BZKA 1APLC 2QSGX 2UYEA 4MGRA 4ZEFA 2UXNA 4OFLA 2Q89A 2WEFA 2ECCA 4DZJA 3FKJA 4HX4A 1UB9A 1FT9A 2F5EA 5BQTA 3J80K 3KOTA 2E1NA 3CIJA 2XPUA 1R6ZA 4I09A 4OVPA 3ZCOA 5IP7J 1I6HJ 2ZZWA 2RNJA 3IWZA 5DVFA 1SANA 1U5TC 2DFFA 3NQOA 2XXKA 4Q30B 4E6KG 2O8XA 2M45A 1IRXA 4YAHX 4EV0A 4KXPA 4U4XA 2GQQA 2WBDA 2KIFA 3VVFA 2ZCWA 2P2AA 5H8FB 3TQLA 4OWRB 1S3JA 5L3EA 3G3JA 1WI9A 3VSKA 5FFXA 2R92J 2DYRH 3S8PA 6PAXA 1G0HA 2XXXA 3H9QA 1YJ9I 2JZYA 1YS6A 3OEKA 4HW8A 5EGOB 4J01A 3RT8A 3SHFA 5C4JJ 3B6TA 4U0YA 5HNFA 1R23A 3PNYA 5FD5A 2OCUA 3RYRA 5DUKA 5AE4A 4P0IA 2K40A 3HTSB 2XV4S 5B7DA 2I3WA 2VD3A 3ZQFA 1WZ2A 4A5MA 4OMYA 3HEFA 4QPOA 1URGA 3BPXA 5FJ8J 2FOKA 4PSWA 1K78B 4FHTA 4F2OA 2KDZA 3D4CA 1D3YA 2X51A 2GBYA 1ZLJA 2YR2A 4ESJA 3FVOA 4KD5A 3CFLA 3S3NA 1DBZA 4ZEIA 2HEUA 4GWYA 1XC1A 2HOAA 5J8CA 2H9BA 4PF8A 5M2VA 3BG3A 2FIEA 4U4SA 1B59A 2OJTA 2LH9A 2LYCA 1FTKA 2F34A 3KYCB 1LBVA 4M71A 2CZLA 1FIAA 2X6XA 3KEYA 3HG9A 4I0BA 1MSFC 3BROA 4A0ZA 4RM2A 2X26A 3F11A 2DQLA 2K4JA 3VYUB 3HDDA 2HDWA 3VFJA 1ZYRF 3SZPA 3OIQA 5FRNA 3HSFA 3FVGA 1MXYA 4BL0B 2H6CA 1YFHA 2DT5A 3IH2A 4E7LA 3PUYE 4JB7A 1O3TA 1XT8A 3P9KA 2VUMJ 1KU7A 3K0VA 5H8HB 2D1VA 4HX7A 4QPQA 5HDNA 2ZNTA 5L3CA 4XLAA 1LFBA 5EHMA 5DTDA 3JRCA 3LFKA 3OV8A 4YG2F 2P1SA 2EZHA 4PDHA 3VFZA 1EU8A 1NK3P 3QYBA 3MKLA 1LDJA 2A61A 4YKIA 3SJMA 3FXRA 3KP7A 2O9LA 1MNMC 3R26A 1GV8A 4WEDA 4U7DA 3NEUA 2EB7A 1A7LA 2R5YB 3M3LA 4A3FJ 4I0AA 4XKWA 4D0PA 4A5NA 3E6BA 2OTLI 1LPQA 3BG6A 3WHBA 5E18F 2Z5UA 3F0CA 3ZN1A 1MM7A 2XXTA 3B6WA 3QP6A 4NF6A 4QWQA 4RB3C 1YJNI 3PO3J 3MQ0A 2X7QA 4F55A 2XB5A 4NF4A 3SDFA 5E17F 1VQNI 4PBQA 4XICA 2GM4A 1BL0A 1S9TA 3E97A 2WTEA 3S2HJ 4JX6A 3KFWX 1LVKA 1K4TA 4WK8F 3BDDA 2H1KA 2P7CB 1ZG5A 3NOHA 4CYDA 1RYXA 2K9QA 3C31A 3LSJA 2CFXA 2DI3A 3QAHA 4KCDA 1FJLA 3O3KA 1IMFA 1PEBA 2D1HA 1ZIUA 3ZS6A 2H94A 3U92A 3FK7A 2NRAC 3C2BA 1GTKA 4RLFA 1TBXA 4ZC3A 4HSRA 3DWLE 3EYYA 5F08A 2YU3A 4NX1A 2HVSA 4BNCA 2K3FA 2XROA 3OYCA 1JGSA 4JWOA 4CYCA 1B8IB 1IN5A 4X8RA 5ET7A 3WODF 3IJOB 3CDIA 3I71A 4I2OA 3H3UA 1YW7A 1DU6A 1UFMA 1UG2A 2Y7KA 3JREA 2I0BA 1BBYA 2CS3A 2OPTA 4Y33A 4BAYA 3JSPA 1CNQA 3N6UA 2NS0A 2W57A 1KGSA 1Y1VJ 2I8DA 5JI6A 3GTPJ 3HB9A 3MVPA 1B51A 2EINH 3EF7A 2PMUA 2X48A 2G7HA 4ZYHA 4H8JA 1GVCA 4DIGA 4O7MA 2VP1A 3KC0A 1PYVA 3KP5A 3RT6B 4E0WA 4HV5A 2Y7WA 4U1ZA 1X1CA 1B5IA 4F93B 4KYDA 4Z0IA 1TWFJ 5DYMA 1X1DA 2OJED 1V4RA 2DMQA 4OAZA 3LL7A 2YX7A 1REPC 1D3KA 1NH8A 2DJIA 2WAEA 3VPRA 1Y4CA 1MBJA 5CQEA 3J81Z 2MKZA 1B2HA 3PUZE 5FBPA 3B6QA 3VODA 4LOCA 1IUDA 3LSIA 2KIQA 3QU6A 1MH3A 2QQAA 4ONYA 4Y7NJ 3CUOA 3OS1A 1MS7A 2YX4A 3T0YA 3CLOA 4I40A 4G7ZF 3PUBA 4F2QA 1PUFA 3Q0UA 1T2KA 4UY8I 4BDYA 1B72B 1FBFA 2HKOA 2MA3A 3K4JA 1R71A 3EDPA 2DPDA 1B52A 1IXIA 1QJMA 1EV7A 3HBLA 3NARA 5FKOA 2JRTA 4QLCU 3HN0A 3W9WA 1BTJA 1US5A 1FYKA 2KRCA 2R3SA 3H3VK 4EQ7A 5FD6A 4JP0A 2Y31A 2L4MA 2RC7A 3F6VA 4O5VA 4IO2A 4YB7A 3JRHA 3K01A 5AA4B 2WWYA 2VPLA 3E6DA 5CPRB 4K2EA 4YKKA 5DTBA 3KN3A 1O63A 4H45A 3ONQA 2B9SA 1Y6IA 2A6TA 1U3EM 1FJ9A 1JTYA 2P5KA 2BHZA 2BZTA 4A12A 3JAMZ 3PQKA 1OYWA 3I64A 4KQPA 4RXLA 3V89B 4BU2A 1Q1VA 1W4MA 5K1YA 1RRJA 2CUJA 2PT2A 1JUMA 2EFQA 5DD8A 3OELA 5HM4B 1V55H 5D4SA 3PNTA 5KVRA 2LREA 3FHNA 5HLIA 1J75A 4P3LA 5CBRA 4L5JA 4ESXA 5EGOA 2DS9A 3S2WA 4X48A 2IEKA 3FXMA 3ZPLA 2A05A 3RY3A 3ZP5A 3GWZA 4TOZA 4M6VA 2M3AA 1LFIA 1UELB 2HOEA 1ELJA 4R6YA 4KN7X 1A8FA 3PO2J 5LGTA 1MJBA 2RN7A 3H4ZA 2H27A 4U2RA 5IZ1A 5K2XA 4G68B 4ENMA 1KU9A 1OMIA 1UG0A 1N0TA 2KLOA 3MZHA 1O4XA 1SVMA 3IH3A 1MY2A 2L01A 1K78A 1VQPI 3RPUA 2JA6J 4NF8B 4RK9A 4O3MA 1IO2A 3MAMA 1PBQA 2YUSA 1R00A 4QIWN 2NXNB 1HSLA 3TCFA 4DI3D 3M1EA 2R7FA 1IRGA 1BW5A 1YCJA 2GXAA 2WAFA 2RQPA 1DPUA 5LGNA 2JVGA 2KIUA 2CW0F 3H35A 3PPOA 2P0WA 3BZCA 3FISA 1TZLA 1IMCA 2UVGA 3SZTA 1MM6A 1YTVA 2OU2A 2L5VA 4OERA 3E13X 4ZS9A 4OESA 1V54H 5IT9Z 2ELKA 2BJIA 1VQ4I 4PFUA 4R9FA 1M5CA 4NBQA 4F52A 3Q0VA 1GHCA 1IUFA 1Z05A 1TWAJ 3TL4X 5ICFA 5J4VA 3CD6I 1DK4A 3MQ9A 1J2XA 4O3AA 4OVSA 4OVTA 4BY7J 2F3DA 2Y5LA 3ZMSA 3QPSA 2K9MA 1B05A 1SI1A 1BR4A 3TDJA 2ZJ2A 2DTZA 1VQ5I 1JP4A 4L9JA 4F29A 2MW8A 4IY6A 2CG4A 3KLOA 1DGWY 4LITA 5H8HA 3TKDA 3KP3A 3M8UA 3S4UA 1VFDA 1CQTA 3TDZC 4XSXF 5J1UA 3CTAA 3GZGA 1TNTA 2Y48A 5IP6A 2BVLA 2QQ8A 3FDYA 4PZJA 2UYFA 3I3VA 4QFKA 3LUZA 2JT1A 5FROA 3C9HA 2O6AA 2CQXA 4NAPA 4OEUA 3KYLA 2OD5A 2L9VA 5IYBJ 1HOMA 1A54A 4UACA 1WJ5A 2R5YA 4DBRA 5TU0A 1HF0A 2NS7A 1WJEA 2VC1A 3CJNA 3LWFA 3CJRB 2AQEA 1FBHA 2VOPA 2C6YA 4M3EA 5D5VB 4N4OB 3L2UA 3A29A 3LSHA 4PBHA 4NDLA 4Y52J 4FBPA 3L9FA 4XKBA 4UA8A 1T39A 3GX4X 1DP3A 2I48A 1BLFA 2Z23A 1QNTA 2ONKE 3FIRA 4PJNA 3WGHA 3PD8A 5CMBA 3TO6A 2VGQA 2VBWA 2AYSA 1R5ID 1G59A 1MG1A 3ILUB 4XONA 4JSDA 4B48A 5F0CA 5CM6A 4GCVA 2X6OA 3RQ4A 4HPQA 4MFIA 4CA0A 3H5NA 2M2EA 2PN6A 1K7AA 5TPAB 1XGMA 2GHBA 3DM0A 4C1UA 1FBCA 4G9YA 1U8BA 3CMEI 4FEBA 2L7ZA 3WGIA 5LRSA 4RGRA 5KAFC 3S3MA 2DO7A 3VEPA 5GTIC 4IL6C 3KP6A 4MEYF 5GAHJ 1H44A 1B8IA 4H6DA 4RY1A 1QA6A 5FHNA 1N7WA 1IXRC 1N3XA 1WVRA 1MDP1 1NNTA 2IT0A 2KISA 4B47A 2XWVA 3RUMA 2CZKA 1B58A 1YO5C 4AM3A 1BI3A 5KNLA 2IA1A 2V4JC 2HWVA 4XLPF 2QA4I 1T0KA 2ECBA 4R9GA 1WJBA 2M1BA 2V4CA 1ENHA 4H8IA 3C4MA 3PMWA 1ZJLA 4J00A 4F19A 4IB2A 2QS1A 3TKYA 2DA7A 1ANFA 3S9NC 1GXPA 4Q5TA 5IT9K 1LLSA 4EF2A 4MLOA 3G3FA 4TQUQ 3TO7A 5FB2A 3S15J 3TYHA 1Y39A 3IL1B 4I6ZA 2RINA 2DA5A 2VI6A 4YELA 1FPFA 3CCUI 3FMRA 3LC8A 2JSCA 1VSOA 3A3CA 2EV0A 3CF2A 4AD9A 5ILUA 3WTTC 1QO0D 4BBSJ 1MDQA 1DMBA 5AONA 1BR2A 2W84A 2RNGA 1QZEA 1DDNA 2OLBA 4IO5A 2H99A 4EDPA 4U0VA 5EZHA 2R7OA 3WU2C 3TW6A 1TT0A 2IA4A 5LRRA 1AOYA 5FKKA 4E0XA 2ZB9A 4MIMA 2B3BA 3TDUC 1MNDA 1V5EA 2W7YA 4YICA 4RM3A 3ULQB 2P6SA 4UB8C 1B3GA 4M1VA 1B72A 3PUXE 2V26A 2AQFA 5K5QA 2R4GA 5ERIA 5CVUA 2JK3A 4A2UA 1YIJI 1LAXA 4OVRA 5D5XB 1EZOA 4MNCA 4HLXA 4R2FA 1OFCX 1ODDA 2D2WA 4NC8A 3ZMUA 1FEXA 1B6HA 1OLCA 1US4A 1I6AA 3BG7A 1ZKBA 1J1NA 2M4KA 4PFYA 4U87A 1OYIA 1LAGE 4HF2A 1SVLA 1GLNA 1IXSB 5D5UB 4AUXA 4G6QA 5AA4A 3E0JB 3IKTA 2DQRA 5LHIA 1A5JA 2XXRA 1AIVA 3DQVC 3MVXA 1I3QJ 2IRFG 1WGXA 5ILVA 1HDPA 1YX3A 1HLVA 4THIA 4NG7A 3S9EA 1I5ZA 2IA2A 2F4OB 4BQAA 3ZKKA 1F1ZA 2DN0A 3F8CA 1HKTA 3HIFA 4PFIA 1BI1A 3RKXA 1IDZA 1H45A 4UABA 5H2FC 2F6PA 1M5EA 1K4SA 5E3LA 4M3DA 2Z3YA 3WTVC 1XHYA 3UORA 1A35A 1KONA 1A36A 2V3TA 1QULA 1JJ6C 2V3QA 2DLLA 3E79A 2NWJA 3GTQJ 2IW5A 4WCGA 4JX5A 1Y3PA 3IFAA 5DVIA 1YZ0A 4LA9A 3AG2H 2XWKA 5LD2C 3Q9SA 1IAWA 2CMPA 2OTJI 1ZELA 1ZBMA 2J5OA 2EK5A 4EQBA 4POXA 3I5OA 5C3EJ 3FXBA 4GRKA 4H67A 1D1BA 1Z6TA 2HNHA 4G68A 1P99A 2XAQA 1FSHA 1ZU0A 1OQHA 2BOLA 3H0DA 4P55A 3OMYA 2L7MP 3FM3A 4IPAA 1Z3XA 3CUQB 3K4BA 1FSEA 1WQ2A 2EJRA 1RI7A 4G8XA 3DKYA 2QMWA 5CVRA 1NH7A 1OCPA 2GIVA 1Y1WJ 2UVJA 3TQWA 4LMYA 1T56A 1GXQA 4G6DA 1G3SA 5EDNA 3JW4A 2PX1A 2V84A 4AQ4A 3V5AA 1AOVA 4H5GA 3I9V2 3V8KA 2V3UA 4YZZA 4B1RA 1SVOA 1T98A 3GFLA 1LB9A 1L3LA 3S17J 3BIHA 2CFOA 3JRAA 3CMAI 5I58B 2R7DA 5CC2A 3FBNB 5GAGJ 2OC6A 4QBAA 4CSWA 3U9GA 2X7PA 3EQ1A 3HHGA 1ZR2A 2I10A 4A3CJ 5LEJA 1EF4A 2KZGA 3OOAA 2LKXA 1FTAA 3A0BC 3GVAA 1FBGA 3HRTA 4QRZA 1VFEA 3K02A 2FRHA 4IEJA 3SEQA 1Y0UA 4GLIA 4TLLB 3KP2A 1Z77A 4IOAF 4BXUA 1AH5A 3K6XA 4XF5A 3T9UA 4IHSA 3U93A 1R22A 4Y4RA 3D5LA 1JUSA 2CZHA 3QP5A 1QUJA 2F2EA 2K9NA 2XXYA 3PGFA 4G7HF 2R7QA 3OYGA 1JTXA 2FD5A 1LVAA 1X4PA 5E79C 2ZMBA 3IAZA 5DV5A 2YPRA 5K7HA 1SEUA 2D45A 4N4UA 4OETA 2HZLA 4HCYA 5BUUA 1QHHD 1XSVA 4XLHA 4BKXA 2NNYA 4OTEA 4EXLA 1JVYA 4N0BA 1FPBA 2F4IA 2L9NA 2DA2A 3V8JA 4OIQF 1FPGA 4FE4A 2XUBA 1ZTYA 1V5GA 3D1RA 4ESBA 1PB8A 5FLMJ 1B7HA 1MPCA 4RK2A 3I4PA 5H20A 2O61A 4LZ8A 2DCEA 4O3CA 3G1LA 3ABLH 3TMGA 3Q5FA 2OK2A 4XKQA 5TPAA 3MW0A 1FLIA 4U1OA 4PFBA 1YS7A 2VXZA 1MBKA 3DEWA 1EH8A 1W5SA 5FGMA 3V42A 3JV9A 1MQJA 5CBSA 1HBXG 3U21A 4ZDOA 4ENKA 1DUXC 4MH5A 1ZN2A 2DK8A 4IRIA 3QPHA 4XN3A 1QQIA 4V2FA 2BGCA 2JSPA 2I4BA 1S7OA 2FIXA 1O7FA 2BY0A 4E7KA 5DCMB 2QBYA 3VVEA 5J8FA 2KQZA 4PFRA 3K10A 3IX1A 3R0JA 1PB7A 4F3SA 3DPUA 3BTJA 3MBPA 5BNGA 3H9GA 3CC4I 1LCFA 3U1DA 4FEDA 1ON2A 5GADJ 1FZPB 3PMVA 4BQQA 1A6IA 3BTCA 3DXJF 4MHFA 1NG6A 1S5LC 3K6VA 1S7YA 2ISZA 4RB1A 4CCOA 5JTYB 3LSMA 4XK4A 4V19K 5HODA 2E1MC 5F0HA 1JJ8C 3HOVJ 1NV4A 2FNCA 5IAIA 4HQMA 5F64A 3OYBA 1VR5A 4OFOA 4BXXJ 5JFRA 2ZFUA 1IMEA 1WPKA 1EH6A 1AMFA 4PP0A 3OO6A 3BR0A 1IW7F 2V1XA 3DCFA 4G12A 2ME6A 1HKQA 3H9JA 2V25A 4QHQA 2R7SA 2VN2A 2P0SA 1SYIA 3H06B 3RPUD 2UVIA 3WAFA 4B43A 4LK0F 4F3QA 4JX4A 3J7AY 4LK1F 4BDNA 3FXJA 4V2GA 3MC2A 4F92B 2Q8JA 4CCNA 2BXYA 1NK2P 1Y3QA 4FE8A 2CH0A 2XKPA 4N15A 3VV5A 4NC7A 1Q35A 5IT3A 4ZTFA 2R7XA 3AG3H 1R9QA 3BTLA 4JQFA 3EQLF 3GBGA 2DXIA 4OEVA 3OOUA 3VYTB 1SFOJ 2F3BA 5J47A 1WFXA 4EM0B 3C33A 1J5YA 2XHDA 5EQAA 4O6JA 1B1XA 2MGQA 1STZA 4GQOA 3IO4A 4NE4A 1HXDA 1M5BA 2QSXA 2JJ7A 2EIMH 1MBFA 3AG4H 4IF4A 2J5PA 3RKQA 1XS9A 2E2IJ 3P7IA 3F8BA 2A5TB 4NF4B 3BIGA 4MNPA 2E1CA 1MBEA 5HPQA 4B8XA 4LB5A 3C18A 3ZQ7A 9ANTA 1I3AA 4L5EA 4XIGQ 4UVAA 2HXWA 1USYE 4HE2A 1B3HA 2OZZA 2W4SA 2DMUA 2JWTA 3CDLA 5K5OA 3W9VA 3ZQLA 4M6YA 4S05A 2CW8A 4AIJA 1XI6A 1RETA 2HFBA 3BCAA 4A69C 2LVSA 1LAHE 1YI2I 1OVBA 1IGNA 3ZQQA 1JE8A 1OMPA 5HS7A 3PD9A 3H1CA 1OQYA 1UAAA 2O69A 2WV1A 2HXIA 1KZ8A 1HSEA 3O6HA 4RJZA 5ICEA 4HTGA 3DLLF 2UZKA 1ZRCA 3K70C 5J4YA 3I3LA 4RA2A 3SZGA 1G4DA 3GO5A 4M9SA 2HDCA 2F5CA 3BJAA 2E2HJ 1IRFA 2KFDA 2P81A 3AAFA 2WA0A 2XF6A 2KLFA 3BFTA 3D4GA 2ONSA 2Z8EA 4A3LJ 2KMUA 3CUQA 2X0LA 4P9KA 4UVCA 1MQDA 3FM5A 2JRMA 2F6GA 3JRIA 2XGDA 1IQ7A 5IKBA 2PX9A 3HRSA 1JW4A 1WDNA 4KNYA 3QPLA 1O7TA 2AXLA 4IR8A 5LFAA 3E1SA 2A6EF 4RMNA 2R8TA 1PJRA 1OISA 4XOPA 3ZMDA 1P1NA 5I58A 2K3PA 2DOAA 1H76A 2H8RA 3M7GA 3ZRGA 3OYNA 3QODA 3OYHA 4YRVA 2DYXA 2O5RA 1ZAOA 4HA8A 1EZ9A 1PB9A 3ABKH 4UUSB 3PJRA 2V1DA 2O7OA 4C2UA 4R72A 4U7BA 2DJNA 4MFDA 5FKNA 3HKZN 1IMBA 3UK4A 1U78A 3I58A 4OVJA 1G8XA 3T1BA 2CEYA 5CKTA 4WKMA 3WG9A 2XRNA 1D5YA 1XMAA 3L7WA 3OWTA 1Z7NE 1SW1A 4N13A 3O29A 3LA3A 4MTDA 4HF1A 3GFMA 2FBIA 4XORA 4GYIA 2BBYA 1OCOH 2FE3A 4X6AJ 3CG1A 1P4WA 3OL3A 4ELRA 3REOA 1K9ZA 4XRMA 4LG0B 4BH9A 4BHBA 3KETA 2GRVA 1FBQA 5KK1A 2MLKA 3HL2A 2Z8FA 3G3KA 3MP1A 1YQAA 4QSHA 4D1QA 2VASA 5E1XA 1HQCA 1YHQI 1DTGA 5L9SA 1RIOH 2BV6A 3BZ6A 5HBCA 2WY7Q 3TQNA 1K79A 2PVUA 4DJAA 2O3FA 2MC4A 3IORA 2DXYA 3VB2A 1OCRH 4GWZA 5JR3A 1MGTA 3T66A 1I50J 2DE3A 2KL4A 3TZAA 1UCRA 3KG2A 4ZJZA 1FBEA 1NV3A 3IB0A 5I5PA 1OCTC 3CCQI 2MFZA 5J3LA 1AU7A 1S29A 4XOTA 2ZXJA 1P9QC 4D9JA 3OYJA 1NUWA 3L6HA 5FTHA 2QQ9A 2QSFX 2VL8A 3U8QA 1XC5A 1WHUA 4KMFA 4BDLA 4M73A 5DM7F 1M5DA 4NB5A 4LP2B 1MMAA 3LV0A 5DCMA 1ETYA 4TLMB 4ESWA 1QW0A 1O64A 2VHAA 2W24A 4G2ZA 3NAUA 5FLXZ 3KP4A 4IOCF 4HNVA 3HM5A 2YSRA 4CCJA 4A93J 2ZYMA 3R6UA 4JSOA 5CMKA 1Z91A 2VKEA 2DOEA 1EH7A 1RC9A 3QUFA 3L2VA 4CHUA 2Y9YA 4PK4A 3SQNA 3VYRB 1NV2A 5JTYA 5F27A 2ZSIB 1VQMI 1H43A 1B9NA 3G3ZA 4CDGA 1ITYA 1A99A 3K4LA 2Z2SB 2QWWA 3HC7A 5JLXA 1AHDP 4OMBA 1KWHA 1ZREA 2PBIA 1G3TA 3SEWA 2XXIA 2M8CA 1Y56A 4MLVA 1EJ9A 4UV8A 1E3HA 5E20A 5AA2D 4F1YA 3KEOA 3VWBA 1FQAA 3WTWC 3FASA 2XXQA 2WY8Q 3GLLA 2VJ5A 4G6TB 4D5CA 3CCSI 1ZKGA 2PBWA 4A3IJ 1B1HA 2G29A 3K6GA 3PM1A 1XB4A 4IY5A 1VQKI 5BMZA 1TLHB 4GXSB 4F7ZA 2QSHX 2GAUA 2XPWA 4OFJA 2QS4A 5HS9A 3F21A 3G3HA 5DUIA 3MYUA 2QF7A 4CZZA 1QPIA 3BKIB 4NUBA 3MFKA 1LFPA 2TRTA 3IR1A 2RQQA 4CICA 2ID6A 3F6OA 3CSGA 3CDHA 4RYAA 2CEXA 5L9MA 1JKQC 2PYYA 4JVCA 3LSXA 5ESYA 1SFXA 3JSOA 4C1TA 2A5TA 2CV1A 1B6AA 1POTA 4XLFA 1EYKA 3QYFA 2Q2CA 2HFHA 1XDSA 3T8RA 5DS9A 5HVQC 2XAGA 1URSA 1SAXA 2A5WA 3PFYA 2R7RA 4GWUA 2D21A 3BQZA 3L6GA 4F3PA 3TP3A 5JEIA 2WYPA 3HOUJ 3OR2C 3HV1A 1EA3A 1R4MB 2JTVA 4G68C 1QUIA 2ACJA 4GXOA 3BJOA 4BDZA 4BXFA 3FVKA 3OO7A 4B09A 1RUOA 3ZQIA 2OZ6A 4GL8A 4N91A 1M1EB 1SC7A 2ZMEA 2FQ3A 4IQ4A 2XWIA 3X2QH 1JUPA 4R74A 3DLAA 5C4XJ 2PFZA 5B70A 1TFDA 4MHGA 1B4ZA 4EQ9A 3LA2A 3CI8A 5ICCA 3UR3C 3K1PA 1D8JA 2ZYNA 1WI3A 3EUHC 3K1NA 1I69A 3PPPA 1SI0A 4RS8A 5A2QZ 3ZKLA 4H5FA 3M8JA 1FPEA 3TP0A 1VNDA 4J19A 4ISUA 1ETOA 1QVUA 3BLYA 1ATGA 3L00A 4HYEA 1IN8A 3S3OA 2EFOA 5ILSA 1LFUP 1ACIA 1R36A 1V5FA 4PE5B 2HYJA 3WTUC 2HDDA 1N76A 5HNHA 1EYJA 4EF1A 2LY9A 3ZMZA 5D4RA 3VDXA 4UUSA 1I6QA 4PFWA 1B3FA 5L8DA 1NUXA 4AYBN 4BQOA 1MPDA 3V7RA 3HTUA 4L9NA 4EJTA 3H3ZA 1RR7A 2Z33A 1O3SA 4UB6C 4KYWA 2XF7A 1ERDA 2RVCA 2AL4A 2R9JA 3B8BA 2L7FP 1FTZA 5LOMA 2QVVA 2LKPA 1E0EA 3PSFA 4DYQA 5FKMA 5FLVA 2HQAA 3MPKA 4GX3A 2IXSA 2F7AA 4KICA 3CFXA 4UHTA 1FOYA 4NNJA 4GIZA 4UUTA 1IDYA 1MBGA 4LG0A 1N3WA 3D0SA 3MZ1A 2BW3B 1EZPA 4OU0A 2HPMA 3OO9A 4I8CA 3TTKA 2DTRA 3TGNA 3E3KA 5L3BA 4DXUA 2DA3A 2E7WA 3FKIJ 1FBDA 1YPNA 3LQQA 4MMPA 5IPAA 2A5YB 4KCCA 1XMKA 4MQVA 5J1DA 1FRPA 1AKHB 3JCUC 4HX8A 2VOZA 1YRNB 3DKWA 5F1JA 3GTGJ 2WX9A 3OMBA 2ESHA 1QU3A 1FY7A 3N97A 1KYZA 3ECHA 2ZNUA 3SEVA 4PCDA 3S9LC 1Y3NA 4FTHA 2DOJA 2DA1A 1U6GA 3RJPA 3OENA 1QVSA 5EQ8A 3HSTA 1SD4A 1T6SA 2A69F 4GL0A 2KIMA 3EUKL 2O7UA 2A68F 4F39A 1D1AA 1RDYA 3CCYA 3BG5A 4M6XA 2ADUA 1FPJA 1IZ1A 4HEA2 3CG3A 1LEAA 4OMZA 4AIKA 2XXUA 5ICQA 1R5HA 4X1DA 1ZARA 2R0QC 2I49A 1B1BA 3S16J 3BT9A 3WTSC 5IYCJ 1H3DA 4K3FA 4NGUA 3CZ6A 4OWDA 2FOWA 2QJEA 3O6IA 1SAUA 4CCKA 5D6FA 2B7EA 1YIOA 4ANJA 3FJMA 3HHFA 2FSWA 3WHCA 1IRZA 5ITPA 1U9OA 2JVHA 1XSDA 2WAQN 3OYAA 1R58A 3KOSA 3G71I 3OSRA 5AA2B 1D0ZA 3MMYB 4HOBA 2IPQX 3TPAA 3IL2A 1ZGJA 2VJIA 2VKDA 5F0FA 3ECOA 4ON0A 5KAIC 2RCBA 1ORKA 2V7FA 2JA8J 1BIAA 3TO9A 1USTA 4A3DJ 4P96A 4PE3A 4O8MA 4NF5B 3N94A 3CFZA 1TL8A 3OSQA 1JI8A 3QOEA 5DW8A 2HYGD 5CQGA 2EZKA 3B6CA 3W2VA 3J7AO 3LR1A 5TP9B 1PP7U 2WV0A 4FQGA 1QZYA 2XB0X 1B7UA 3Q26A 3AXFA 1EKEA 1ZRDA 2XD3A 3SEXA 2JPBA 4PGHA 4NC6A 2HPGA 3H6UA 3J81K 4IO7A 1SD7A 4L0YB 3RSNA 3LSPA 5J16A 1FW0A 5AA1A 3MSTA 1D0XA 1Y1MA 3B50A 3SFIA 3R4KA 4ZEKA 3KX2A 3PL8A 3WTZA 3IUOA 4B3XA 2JA2A 2Y0MA 4HW0A 2HOTA 2LLKA 4P56A 2HU9A 1Z7ME 3QAXA 2Q0OA 1K61A 1G3YA 3H5RA 4AIHA 4ZE8A 3DF8A 3FVNA 3V7SA 1HKSA 5A5XB 5KCJB 3ZQCA 2BYVE 2P3NA 4ENNA 4EVIA 3H6WA 1Y9UA 1RKWA 3K4MA 1S50A 4C3JJ 4FT8A 2CV0A 2KPMA 2O84X 4PGNA 3FATA 3O6GA 3T22A 3T93B 4ASNA 1NNPA 2VJ4A 4Z2YA 1KA0A 2BY3A 5DCFA 3G7WA 2DXRA 5IY5H 3MWMA 3KN7A 5H6RA 2F97A 1FPQA 2DAOA 3JAMK 1KYWA 1YX5A 3PUVE 2MD0A 2QVUA 3R6SA 3O66A 3CO7C 4F1VA 2E34A 4YEJA 1MIJA 3KIOA 4AU7A 3QYTA 3JTHA 3R60A 2NNNA 3OL4A 3DP4A 3TELA 2FYIA 4WEPA 1WWXA 2VT2A 2R71A 3MJNA 3CUQC 2LC2A 5BPDA 4BQNA 1FPDA 1Z3YA 3S1NJ 5LGUA 2DE4A 3ILTB 2V79A 4BHPA 3MCZA 3OYLA 3M3KA 1NUYA 2CQKA 3LQRA 2LG4A 1XOCA 4RLQA 1R49A 3FHZA 4C3HJ 3L2QA 3LSKA 1FMWA 2GOMA 4KDPA 3A09A 3PPRA 3KBZA 1ETQA 3VLWA 2QBYB 3W2AA 3KJTA 1MMNA 4LN5A 1HSJA 3OY9A 4IHTA 2THIA 1RR8C 4R73A 4KN4X 2P4WA 5B3SH 1FBUA 3HKZA 4IRHA 4XFEA 4HG2A 3OSFA 1POY1 4JVIA 3TCHA 2E2JJ 1NV7A 2DT7B 2EFPA 4AWXB 1YE9A 3SEYA 1WSUA 1O3QA 1MJ9A 1Z1DA 2QKLB 2XSJC 1INPA 4OQOA