1IXCA

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
294
structure length
289
Chain Sequence
b'MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLEIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSAKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR-type regulatory protein
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Dna binding protein
total genus 91
structure length 289
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ixcA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixcA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixcA02
4ZYEA 2K27A 1JHFA 1UTHA 3IWFA 4EGZA 3QUJA 5DVJA 3Q29A 1MH4A 4KDPA 1K6OA 3GFJA 3H06B 4MEYF 3HHHA 4F1UA 1FSEA 3KEIA 4MTDA 1MQGA 3PUZE 3LA3A 3QP5A 3DELB 1POTA 1F4KA 4CHUA 1GVCA 4ZS9A 3TQNA 1SD7A 1R5GA 1POY1 4AQ4A 2CW0F 4KMUX 3TOAA 2UXAA 2YU3A 1MPCA 5KCJA 1PP8F 2ZO4A 1LB9A 1QUKA 2FA5A 1L3LA 1YW7A 3IK6B 3SETA 3C9HA 4HTGA 4IO7A 4YKIA 4GYGA 1UCRA 1AMFA 2DE3A 4NTLA 3FATA 3LSTA 1QW0A 1N76A 1BI0A 1I6BA 2O6AA 3V8XB 1SVXB 1Y0UA 3O6BB 3PU5A 3RTRA 4F22A 5HS9A 2O3FA 1A8FA 1QJMA 1IRFA 1XDSA 4XRFA 3TDJA 3L7WA 4IHTA 1ZMGA 2I3WA 3T9XB 1MQJA 3TOBA 4XKPA 4DZ1A 4EF1A 2KLFA 5A2QZ 3K2DA 5CVVA 2FF4A 3K9TA 4UV9A 3OMBA 2EFPA 4ZYGA 3H3UA 5K5QA 2AIXA 2ZNSA 4M74A 3DF8A 1XSXA 1I5ZA 4GL0A 3U1DA 5LGNA 1VSOA 2HTJA 3E5UA 1XS5A 2DVCA 1H0MA 2V1XA 1SW1A 3G3ZA 3HSRA 4UUVA 2W7YA 4OMZA 4ONYA 1IN4A 1QUIA 3DLNA 3VLWA 3OO9A 3EQLF 2GQQA 1MGTA 2ZJ2A 2GA2A 4Q0CA 1ZHFA 3OSQA 4JK1X 4P11A 1EZPA 4PFTA 1TW2A 3P9IA 4OFLA 2A6HF 4F2OA 1ZRDA 3MC2A 3M7GA 1A04A 3CSBA 5HM4B 5J8CA 2ONRA 3MWMA 2VODA 3K00A 1LJ9A 1FP1D 1X3UA 1FCKA 2I49A 4R2FA 3ABTA 1B1HA 5ICGA 3F11A 3WGGA 3TTKA 2VBWA 1RYXA 3B6QA 4U2RA 4K2EA 3MAMA 4C1TA 3D5LA 5DEQA 2DWHA 4CYDA 2HEOA 4IRHA 4HV6A 4HZFA 5TP9B 2VBXA 3HPIA 5E20A 4Q30B 4RXLA 4RGUA 5K5RA 1B7UA 3O3KA 5AONA 3MPLA 4NF5A 1B2HA 1LB2A 2FNCA 4HQMA 1NNPA 1FQBA 4MHGA 2ZYMA 2GH9A 3MZ1A 1XHYA 2P6SA 3K2ZA 1GHCA 1RUNA 1RIOH 2OU2A 2HQ0A 4OFJA 3DPLC 4ISUA 1B59A 3T9HB 4P96A 1UQWA 3IL1B 3KP3A 1SD4A 4OOIA 1AWCA 1LCFA 4WX9A 3G3KA 4EUOA 3EPEA 4H5GA 4KCDA 3R6SA 4JXIA 2DLLA 4N0BA 1UHMA 2PG4A 2QLZA 4GF8A 2VOOA 1MY2A 3FXQA 4YG2F 3TPAA 3V8JA 3ABUA 2XHDA 1O7TA 3GZ6A 1BKAA 4G8MA 3CTAA 2YJPA 3QAXA 1QBJA 4P9UA 2QBYA 5LBQA 1EH3A 5K2YA 3WGIA 5LHIA 1B7HA 4JBZA 1KU3A 1IITA 1ZBMA 2XXPA 4G7OF 4YB6A 4HF2A 2O1LA 3VLVA 5ICTA 2KKOA 1RKMA 4KD5A 2YLNA 2V79A 4KN7X 4QFNA 3TTLA 1KYWA 3ODBA 5H8FA 5F6FA 3PMVA 4IRGA 3TZAA 3WTSC 1DOTA 3DP7A 2HOEA 2VD2A 2HGCA 3MVZA 2UZKA 2QL3A 3T9UA 3IO4A 3Q27A 2GWRA 4BQAA 3LQRA 4PETA 5E1XA 1P99A 2HFBA 2ETHA 2E1SA 3K6WA 4U1ZA 3TQWA 4QSEA 3RKWA 1TNSA 3OOPA 5I2KA 3O2PE 3LA2A 4FX0A 1GXQA 2F6GA 1LFHA 3RJPA 3MCZA 2STTA 4XKNA 1MXXA 1B4ZA 2H4IA 1GXPA 1FZPB 2RCBA 3C3WA 3IOVA 3ZN1A 2V9VA 4ELPA 1BIYA 1OYYA 3MP8A 1U5TA 4U0YA 1QO0D 2HZLA 3U1OA 5I59A 5ERIA 1R1TA 3TCHA 3SEYA 2PT1A 3TAJA 2A6EF 3M9AA 3FJMA 4U4XA 3ZMSA 3HRMA 1URGA 2O8XA 2XX9A 4G6DA 1HSLA 2ZMBA 4BDNA 4CXFA 3BKIB 2NNYA 5TJJA 5J6XA 1U2WA 4C1UA 1EZ9A 2QPQA 1NHAA 3SEUA 3CIJA 1ZLJA 4ESFA 1YFHA 4KFCA 4MF3A 5EEHA 3IC7A 2XVCA 3N6UA 3QOPA 4XSXF 1Q35A 5D6EA 4MH5A 4X9TA 2FBIA 1LAXA 4U21A 4ENKA 2ZFWA 4CGZA 1QZYA 5I58A 1ATGA 3W6KB 1USYH 2F5FA 2UXXA 4IJAA 3G3HA 1G3YA 1TLHB 4I0BA 3CLOA 3KZGA 1MJAA 2RINA 1R22A 2QQ9A 4RS8A 1LBBA 1ZGJA 2Q0OA 4KIBA 3ZMVA 2QSXA 1LAGE 3IB0A 2NYXA 4P0GA 3FVGA 4IO6A 1YO5C 3KGCA 4F18A 2MBFA 2ANJA 4EQBA 1MDMB 1P4WA 3F22A 3I0TA 3H6UA 5FTHA 4R8HA 2PMHA 4CICA 4OINF 3W9VA 1B5IA 4OMBA 4R73A 3FVOA 3RPWA 4F31B 5DTBA 1IXIA 3THIA 3WU1B 3DXJF 1JETA 1FTMA 1TFDA 5CRYA 2UVHA 4FEBA 1Y4CA 3SESA 3R0AA 1RYOA 1NH8A 1P2FA 4GIZA 4Z7EA 2PMUA 3CO6C 3G73A 1R9LA 2Y7RA 3IJOB 3PUXE 3C33A 5BMZA 3S9LC 2UYEA 5HS8A 2HXWA 4H67A 4F39A 1TNTA 4KA4A 2M8EA 2QWWA 3JW4A 2FRHA 2EA2A 4X1DA 2Z9OA 2DBBA 3GWZA 3OEMA 2HZKA 1IZ1A 1PDAA 3FJ7A 3WTZA 3C18A 2ZMEA 4F3SA 2DQLA 4XBFA 3WAFA 2COMA 4U7BA 4Z2YA 2GAUA 2ZXJA 2XKOA 1MM6A 3MQ0A 4LA9A 3F3XA 2ZBKA 4RY1A 4ECFA 2V6CA 1BIAA 2ZYNA 4TLMB 3ECOA 4ZZLA 3KZYA 3E3KA 1O3QA 2O1MA 4IO3A 2P0SA 1TW3A 2A68F 3DQVC 3VEPA 1URSA 2QJEA 3CO7C 2V93A 4F7ZA 3F8MA 4PQJA 4G68B 3V89B 4F2QA 4I62A 3IB1A 4EQQA 1A40A 1TWYA 4GFRA 5HOOA 2H6BA 5LEJA 4QSCA 1RUOA 2C6YA 4M9XA 3I54A 2E0SA 4DCYA 4KUMA 4OFOA 4A0ZA 3BOQA 5HS7A 2G29A 3TKYA 5DVIA 1L5TA 3IRRA 3WTVC 4KNYA 3HRUA 2YX7A 1USYE 3H6VA 5I84A 1B7ZA 3V4GA 4EM0B 3T1BA 1W7PB 2AL4A 4I2OA 1M5FA 1YW8A 3L6GA 1ODDA 4I9DA 5AIPA 4YIIA 2A61A 3M3KA 3KSXA 4NF5B 4HAMA 1XGOA 5H8QB 1FTKA 1ZJLA 3RT6B 2Z5UA 3ILTB 3WTXC 5AA4B 4ZYHA 2P6TA 4EXKA 2I58A 4YICA 4BHPA 4M9ZA 4EV0A 2V1UA 2QVOA 1PBPA 1IW7F 3DV8A 2HQNA 1J75A 3FXUA 2V3UA 2ZNUA 2RC9A 1G3SA 4HLYA 1T0KA 1CGPA 4FAJA 3S2WA 2XHKA 4YU0A 4EGYA 1F1ZA 2RC4A 2I0CA 2NS0A 1B6HA 1Y1ZA 1O7LA 5H8HA 1W7PD 4OHNA 3KP5A 2F5XA 3I71A 1LAHE 1IN7A 3K6VA 2R7DA 1SW2A 4M9SA 2QBYB 1IIWA 2F6PA 1OQHA 2F97A 4NHJA 5DCMA 3HSTA 1JEVA 2A07F 5K2XA 1ZAOA 2MC3A 2V84A 4R1HA 4IXAA 1OVBA 1P1OA 4UVAA 3IR1A 2VGQA 2K86A 4FHTA 1IUDA 4OIPF 2L4MA 1LBCA 5DDGA 1MXWA 4UVBA 5H8FB 5L9SA 4G94A 2Q88A 3BPVA 3TCFA 4KMFA 3OD7A 2BYVE 4R6YA 3K0VA 2DAOA 3WE2A 3VXBA 4EMSA 2VBYA 3VE1B 1MXUA 1RI7A 3QP6A 3BFTA 3KFMA 3REOA 1M5CA 5DD8A 3I64A 3TDZC 3CUQC 2P8TA 3LR1A 2GIVA 3LFKA 2FOKA 3R7XA 4HX8A 2QUFA 3J80K 4ENJA 2XAJA 2Y75A 3JAMK 3TUSA 2RNJA 1ON1A 1REPC 1JW1A 1T39A 2K4BA 3N26A 3QYTA 1IRGA 4ZEBA 4I02A 4G8NA 5I2KB 3TELA 2ZYOA 3L9FA 3A3UA 2OA4A 2W84A 1O3SA 1SQYA 3SEVA 5FFZA 5I2NA 5IT9Z 4Y17A 2W85A 4LGWA 2E7WA 1ZG5A 1GVJA 4B8XA 3KETA 1B6AA 3EUHA 4POXA 3FX3A 1HBXG 4LB6B 4U23A 3BPXA 4KHZE 3LWFA 1BI1A 3GFIA 3GZGA 4Y15A 5D6FA 3MP6A 4WEPA 3U2RA 2IEEA 5KDTB 3RUMA 1RZ4A 3KE2A 2FSWA 2UYFA 3GBAA 3CI8A 4AVPA 4KYEA 3DP6A 3BZ6A 2XKPA 1SFUA 4KIGA 3CFXA 5TRDA 2H09A 1R00A 2Y84A 1GGGA 2I0BA 1SMTA 1DPUA 1OMIA 3IB2A 4YMAA 3LA7A 3N6TA 4HW8A 5BUUA 2EV6A 3JZJA 1S3JA 1W5SA 3MZHA 2DWJA 2UVIA 2RVCA 3WG9A 2DQVA 2A5TB 1Z6RA 3R60A 1FLIA 1MXZA 3SEWA 5L8DA 1I6AA 1DP7P 2FNAA 2VXZA 3MAJA 1B3EA 5FTIA 2EFWA 2H5YA 3G3JA 4PGGA 2KJBA 2KRFA 4AB5A 1P1QA 3B6WA 4EM2A 4NF4B 1WVJA 3IKTA 3KSJA 3HSEA 3ULQB 5I58B 1Q1HA 2NUVA 2J5PA 3F72A 1R23A 2FXAA 2K02A 4HYEA 4G8HA 1MXVA 5ITOA 2Q2EA 5IKBA 3TO6A 3A09A 1N7XA 3MJNA 5KVRA 1AL3A 1Y1MA 3LAJA 4ND9A 1O7FA 3FZVA 1Y3QA 5AE4A 2HYFA 1AOYA 2L02A 2HWVA 1NNKA 4ZE8A 3S4UA 4E0WA 1M5EA 1UB9A 2DO7A 5FHOA 1PBQA 2VC0A 3DP4A 4F1YA 2FQ3A 3MZ9A 5H8SA 2HAVA 4UHTA 1FP2A 6PAXA 1MY4A 3QAHA 4P55A 3MEXA 3T8RA 1JXSA 2IVMA 4GXSB 2NNNA 1IXGA 3FJGA 1MJBA 4ESWA 5JTYA 3KP4A 2LAOA 3H3GA 2YR2A 3M8FA 1MQHA 1QKAA 2ZKZA 3MUQA 4H65A 1PDNC 1H9GA 3KJ7A 2GHAA 4H8JA 1Y4TA 1NMUA 1OYWA 1UIVA 1XVYA 3L2CA 5KK1A 1ZTYA 4H5FA 2XD3A 1D4NA 3V8KA 4G6QA 5CMMA 2DQRA 3GFMA 1IEJA 5CVIA 2H27A 5EYFA 2VT2A 3N4MA 1E2XA 2EFNA 2HKOA 3VFZA 1KGSA 3H4ZA 4D0PA 2GFEA 3B7DA 5IAIA 1YS6A 2P7CB 2UXNA 4G8XA 2AS5F 5CLSA 2Y7WA 4XKQA 2F7CA 2JSCA 2O7IA 5CMBA 1R1VA 5JFRA 1FW0A 4M71A 2Q9TA 2O61A 2XGXA 1KQ0A 3J81Z 3ZKKA 1K78A 4PFYA 5TU0A 1EV7A 2XX7A 1TT1A 3HTUA 4R9FA 3KLNA 1G3WA 4NF6A 1XSDA 4JWYA 4YB5A 2IPQX 5LRSA 5DT6A 4I7HA 3GYHX 2XXVA 3DM0A 4ZEIA 3PPOA 4CDGA 2B65A 2IP2A 3FVKA 2BGCA 1T6SA 1H44A 1BJAA 3M3LA 3H92A 4AIHA 3V7RA 2OWSA 5CVRA 4OMYA 3F21A 1W4MA 5ICFA 2PVUA 4ESJA 4N13A 4ESXA 1MY3A 2ACJA 4FT8A 2D3IA 4OU0A 1NFTA 3IO6A 2HCAA 5CBSA 2RQPA 1ZLQA 5I57A 2QS1A 2E7XA 2I4CA 4ELOA 3TDUC 3E4RA 4O3CA 5BOXA 4HA8A 4ZZAA 4OXVA 4E0XA 4ZH4F 1SD5A 4HF0A 2YPNA 1A8EA 4YFXF 5FD5A 3N97A 3OENA 2A3SA 1IN6A 1O3RA 2OBPA 4LLNA 1DPPA 5I56B 1G3TA 3K1NA 4RB0A 1Y20A 3CG3A 4AIJA 3I53A 4BDQA 1A55A 5H8NA 1LEAA 4N9HA 1ZREA 3K0LA 5H8HB 3SZTA 1Z05A 3WTUC 1LLSA 4RJZA 4ZZEA 4YKKA 3UA8A 4L18B 3I5OA 4WK8F 5DCMB 3RDIA 4BAYA 5LOMA 3GVAA 2QRYA 4BDLA 2M87A 1XGMA 1JW4A 4H6DA 4BDMA 1JE8A 2E1CA 2QS2A 3U94A 1HKQA 4NWCA 4CO8A 2HEUA 4GXOA 2WTEA 4GRKA 2XXRA 3F8CA 4QLCU 5LHHA 2RDPA 1Y9UA 3HHGA 1DUXC 4L5JA 4GGGA 1Z7UA 2XXIA 2IJLA 2P5LC 4M4GA 2Z8DA 3Q26A 1STZA 4BDRA 1B1BA 2X4HA 3FWEA 3S9NC 5E1ZB 3T5XA 1ZYRF 2QS4A 2L54A 3FMQA 2O7UA 1JW5A 5DD4A 2RCAA 3KN3A 3FV1A 4O3BA 2UWMA 2H99A 1XD7A 4UACA 3NRVA 3U92A 3VXCA 2XXQA 4P5OA 1F9BA 5F64A 2F5EA 1Q1KA 2CSOA 4PFUA 1IXCA 1CF7B 4LZ7A 4H0EA 3SHFA 3FUZA 2M1BA 4OTEA 1HW5A 1FQDA 1IUYA 1KQ8A 1QQIA 1YYVA 2OLBA 4HBLA 4G4PA 5EHMA 4HW0A 5FB2A 4RK2A 3OO6A 1N0TA 1D9YA 3UP9A 4WXHA 4F1VA 1KYZA 2FA7A 1UHWA 1FQFA 4A5MA 1R7JA 5CBRA 2ELHA 4G77A 1J7KA 3C1DA 1KU2A 3R26A 4QSDA 2ALUA 4OQOA 4L9JA 1P4AA 3K01A 3TQLA 2DPDA 1I1GA 5FD6A 4HDVA 5ICQA 3PMWA 1II5A 3H03A 2VE9A 3F6VA 4A5NA 5BPIA 2ZYKA 1YW9A 3PPNA 1HSTA 2H98A 2XXWA 1U6GA 2VT3A 2DK8A 3VODA 4DCXA 1R9QA 2G7UA 5HDKA 2G9WA 1KU7A 1MH3A 3I58A 1LVAA 4OYVA 4LQ5A 2I6EA 3TTMA 4ZE9A 4Z0IA 2D1VA 3O9PA 3ISPA 1D3KA 1HW1A 4OWDA 3QPHA 3S2VA 4B09A 4IO2A 1N3XA 4EXLA 4EJTA 1BOAA 3HN0A 3EETA 3CUQA 3V83A 1MPDA 4H0WA 1J59A 4KR5A 5JHUA 2YPRA 1J2XA 4KCCA 1S6LA 4UXNA 1A99A 1J9IA 4I09A 4WEDA 2QQAA 1UTHB 1U78A 2RV8A 3EYIA 4WWCA 3DPTA 1MG1A 1MKMA 5LEKA 2X26A 3USDA 3OOAA 4LUBA 1LQ1A 4HX7A 1LB8A 5A5XA 2HS5A 3FD3A 4N6PA 4F29A 3BP8A 4EF2A 2RGVA 5FLXK 4L9VA 1AIVA 4I98B 4OIQF 4ELQA 4U0VA 1S8NA 5DUKA 5D8KB 4N9IA 1ZG1A 5CMKA 1FY7A 1FTLA 1P92A 3O6IA 2XXHA 3ZKLA 5KCJB 1WSUA 3F8FA 3KFWX 3TTRA 3WE3A 2DS9A 1UIUA 3MVWA 4GD5A 1Z7ME 4KYSA 4YIFA 1U8RA 3FM3A 3ML6A 1NL5A 3BFUA 1FYMA 4MEXF 2R9JA 5LRRA 1D8JA 1R1NA 4G68C 4U4SA 3LSWA 2XAFA 3HOTA 5D5VB 4FEDA 5JI6A 3HOSA 5LLQA 3ERED 3GZ5A 2XV4S 1S29A 3HIFA 1PB8A 1IN8A 1MZBA 2QZ8A 5F7VA 3OSRA 5L3DA 3TFLA 2RKMA 2ADUA 3PPRA 2FBKA 3ECRA 3KG2A 1AOVA 2MD5A 4UVCA 2VD3A 1IQ7A 5F1QA 1USTA 5FHNA 3UN6A 3C35A 2ABHA 5HLHA 3Q28A 1M5BA 4NQWA 1J1NA 4KN4X 3RIRA 1B51A 3K1MA 4BXUA 4FORA 1Z9CA 5DVFA 5H20A 1DPRA 4S05A 4O5VA 2PN6A 3GLBA 1CE2A 1ZN2A 3KLOA 2I4BA 3Q25A 1O3TA 4POWA 2Q8KA 5D5WB 4R74A 3CSGA 2QMWA 2GHBA 3O66A 2O68A 2O6GE 3T9VA 4EJOA 2HAUA 3VOEA 4PE5B 4LK1F 5LGTA 3WTTC 2EK5A 4YKJA 5IT9K 5TPAA 2HYGD 1FOKA 4YKPA 3TEPA 5HDNA 1MD0A 1ANFA 2X7QA 4JWOA 2VE8A 2D5WA 3HTSB 2EV5A 2WKYA 5FFXA 3DFGA 4ETSA 5F1RA 1O57A 1YS7A 4XSZF 4PDKA 2IW5A 4GVOA 3ELKA 1NKXA 3E5QA 5HPQA 1FBSA 3B73A 1YTYA 2VOPA 2AL5A 4RAZA 3KN8A 4RA1A 3JTGA 3IOWA 1EH6A 3UGWA 3OXNA 4JDFA 3GO5A 1SAXA 1YIOA 1Z7NE 4HS7A 3RLFE 4YFNF 1R1UA 4QFKA 4G7HF 3ZPLA 2KIUA 1B3GA 2DU9A 3PGFA 2G7HA 4RGXA 3RKXA 4I0AA 1MXYA 5EEGA 2V3TA 3CVGA 3U9GA 1G4DA 2XAGA 2EWNA 1GR2A 3RPQA 1QUJA 2RN7A 1IN5A 4KIFA 1ELJA 4LQ2A 4OVJA 3RI4A 3FMRA 2A5YB 3RT8A 1MRPA 3OEKA 4MQVA 5DCFA 2JRTA 3WGHA 3O97A 3KP2A 1YQAA 4WXJA 4HOBA 1P6RA 1TTYA 2PMSA 1Y3NA 4L5IA 2Y7IA 3QUFA 3P9CA 2I3VA 1S50A 4U22A 2ISYA 3L09A 3E13X 4M6XA 3I6VA 3JYRA 2EB7A 4BDOA 4M1VA 1ZARA 1D9VA 4BH9A 4NE4A 5D8LB 3K1PA 3ZP5A 1CB6A 2H9BA 4JSDA 2CGPA 3PD8A 4OZ9A 2ESNA 4ZZDA 1FQAA 2PT2A 2P1SA 5CVJA 1R6ZA 4AWXB 4L9NA 3LBSA 5DYHA 1D5VA 4DNCA 1HQCA 4QHQA 3PUVE 4LATA 2OZ6A 4EVIA 4OIOF 4PFWA 1NH7A 3E5XA 3HSFA 3CDHA 1ON2A 2QQBA 2F7AA 1ZLKA 1SMYF 4FIMA 3T22A 3NEUA 5ITPA 3RQTA 1XGNA 4EQ9A 2OBGA 2DPUA 2E1NA 4GXAA 1SYIA 5K5OA 4X1BA 1BP5A 2XRNA 4A6DA 3K6XA 3G3FA 1WKMA 4ENMA 2VBZA 1US4A 3FVNA 4NWDA 1P1NA 2PLYA 3IORA 4R9GA 5CYVA 1NNFA 1SD6A 3IOUA 3GBBA 1FYKA 1S7OA 4MBPA 5CMCA 1TFAA 1OYIA 3E97A 2XXUA 3MBPA 3BWGA 2XASA 1PP7U 1TXFA 5A2QK 2UVJA 3TCGA 4R75A 3R6UA 2XUBA 3SZPA 2O84X 1IXHA 2ONSA 3KCCA 1TQPA 3JV9A 3GLXA 3C34A 2M45A 2P5VA 1WDNA 2NAZA 2DE2A 1EZOA 3G3GA 2UVGA 1IF1A 3W6JB 1U5TB 2BV6A 3E6DA 2XROA 5I59B 4DLDA 3IL2A 4OEUA 2VOZA 4EDPA 5FGMA 2HDCA 3J81K 2DWAA 4NEDA 4IY5A 2Z8FA 3DKWA 2DSFA 1BI2A 5AA1A 1VTNC 3VVDA 3KP7A 4U7DA 2CYYA 3T8TA 2O51A 1WI9A 2GRVA 3IKVA 5LGUA 2A69F 4LB5A 5ISUA 4LG0A 4LLGF 4TQUQ 3VB2A 4RNSA 4AIKA 4PCQA 2LKPA 4ZEKA 1FTOA 2EFQA 3FMSA 2EA4A 5D4RA 2DWIA 3FV2A 3QU6A 4O3MA 3PPQA 4O3AA 4X48A 3MQ9A 5E8IA 4Q48A 1BBYA 2ESHA 2X0LA 1AH5A 3IRQA 4KPTA 4YFKF 2PX1A 2PFBA 3MZYA 2OK2A 3L6HA 5K1YA 2IA2A 2Z3YA 4DXUA 5A5XB 4JB7A 3RN8A 1ONVA 4ENNA 3SKPA 3E3VA 2DI3A 2ZNTA 2WWYA 5JEIA 3HO7A 1FPQA 4MNUA 4EJWA 3KEOA 4OEVA 1XC1A 1QKBA 5ILUA 5BS6A 3UORA 3PQJA 2VP1A 1S7YA 1XSVA 3VV5A 2V1DA 4EM1A 2IA4A 1OVTA 4IY6A 2FU4A 5B70A 5FO5A 2HFHA 3PV0E 4F19A 5DV5A 4JSOA 3FGSA 1Z91A 3PUYE 4UV8A 4ZDMA 3ROUA 1JQFA 1WQ2A 2NRAC 1FBUA 2K4JA 1MY0A 3SFZA 2XD2A 3RY3A 3RPUA 1FTJA 2XIGA 3UK4A 1MDMA 2PBWA 2AYSA 1N84A 1OQGA 5L9MA 2F5DA 1I1SA 1QVSA 5J1DA 1TBXA 2ZMEB 1B40A 2ZCWA 5FHMA 4ZEFA 2JPBA 3HCQA 1FT9A 3J80Z 1HKTA 4YB7A 1XMAA 5L3CA 4OENA 1ZRCA 4IO4A 4C0RA 3EF7A 3JAMZ 1B46A 1GTKA 4I1DA 1KQ9A 3QU3A 5HLGA 1PB7A 1FQEA 2P2AA 2LF7A 3ZMZA 1UTBA 4MTEA 3E9XA 2LSOA 1WRJA 5E8GA 3MWBA 2OZZA 3TGNA 1J5YA 2Q8JA 3S9MC 1B3FA 2CMOA 4UA8A 3FASA 1EH7A 3Q9SA 3CJNA 3P9KA 1PB9A 1MS7A 3LC8A 3WAEA 4PGHA 4IHSA 5J8FA 3OV8A 1P4XA 2NOOA 2RC8A 5TPAB 1LFIA 1BTJA 1MQIA 3HHFA 5DYMA 2NVUB 3QRFF 2HKXA 1T98A 3W15C 1DTGA 2Z22A 4NMYA 2W57A 4I01A 2Z8EA 5L3BA 4M73A 2R3SA 4XLNF 3G7WA 3C7JA 2HZTA 4HDUA 1F5TA 2B0LA 2Y7PA 1RNLA 4BHCA 1B52A 3FF5A 1FWZA 3I5UA 1QULA 2MH9A 4RB1A 3T0YA 4G68A 4IGRA 1YPNA 2GA1A 2M8CA 3V7CA 1A54A 1B3LA 1N3WA 4FECA 2Y0MA 3HV1A 4XXUA 3EQ1A 1VFDA 1BLFA 4GLIA 2DXRA 3CUOA 3K4UA 4WKMA 4I8CA 4F3PA 4A12A 3KBRA 3OO8A 4RAYA 1P1UA 3ECHA 2EJRA 1W7PA 1VE4A 5JVTA 4A6EA 4R6HA 4BLAA 1H9TA 1IXRC 3HUGA 3R61A 1R58A 2FE3A 1B5HA 1DPEA 5BQTA 4G7ZF 5H8QA 3VFJA 4WXCA 3H6WA 1V3FA 2TDXA 5AA4A 1ZRFA 3O29A 2L4AA 5L3GA 3F23A 2Q89A 5HDGA 4U88A 3R4KA 4Y13A 2F36A 4S04A 1FBQA 5BWJA 2HTSA 4RGRA 5L3EA 3IX1A 3WTWC 3QXMA 4MQ9F 3EYYA 1N7WA 1O64A 4RK9A 4DIGA 4AB6A 3MZBA 5JR3A 1OLCA 2FMLA 4ZYDA 2NWJA 1DSNA 4KT5C 3DEUA 4BYYA 3KEQA 3KJTA 1K79A 3KP6A 3M3FA 1KA8A 2RKHA 4IRIA 3OELA 5BPDA 4L17A 5L9OA 4LVQA 1HW2A 1TQIA 4WXDA 1FQCA 2H94A 4O6JA 3VVEA 3PFIA 1OLAA 2DP8A 2REGA 5CI5A 3NQOA 3HRTA 3ZMTA 4LONB 3AXFA 3FXRA 2CWEA 4LJZF 1VFEA 1B9JA 2Q2CA 3ZQ7A 2O0YA 1SYHA 4FE8A 4DDDA 1EH8A 4RB2C 1SI1A 3SQNA 3IJXB 2RC7A 1XB4A 2YX4A 2W25A 1JEUA 4KYDA 4PP0A 3ONMA 3TYHA 5L3FA 3EDPA 5I2NB 4DXCA 1GV8A 2G93A 5AA2A 3LAPA 2DE4A 3CR9A 3TKDA 2F78A 3FHZA 2M5WA 3H6TA 3K02A 1MPBA 4QFLA 1ULYA 1B0LA 2DK5A 3O28A 4FATA 2H6CA 2CO5A 3ZS6A 2OQRA 3U8QA 3SDFA 2GXGA 2OAZA 2PYYA 2KIMA 3Q9VA 4R72A 4QFPA 1XVXA 1XGSA 3D4CA 4DE8A 4F3GA 2DFIA 5H6QA 4G9YA 3ZN0A 3I4PA 3BROA 3LUYA 4R2BA 1YTVA 5H6RA 4OESA 2Z33A 4TV7A 4NF8A 1L0OC 1SFEA 1JVYA 1US5A 1B3HA 3GXAA 3VLUA 4G2ZA 3QSLA 4HLXA 1S9TA 5KDTA 3LSFB 4OIRF 4LG0B 2HQRA 4EQ7A 1DMBA 2OQGA 3SERA 1MDQA 1I6QA 4QFOA 4H1XA 4TOZA 3TO7A 2CFXA 1USSA 5ICCA 2L3DA 4WF2A 2AXLA 2RF1A 2FNPA 1OIBA 4LZ5A 5DEXA 4P0IA 3C32A 3GF2A 3K69A 1K7AA 2Y48A 2Z23A 3GW2A 4ESBA 1PEBA 3WU0A 1VR5A 3RNNA 2P4WA 2WV0A 5CVUA 2OZUA 4E70A 1MY1A 2JTVA 3PMXA 3CG1A 4KFQA 3L00A 3WTYC 3M8UA 3U72A 2A5TA 2F5CA 4BNCA 5HBCA 3EHTA 3ZSFA 4N07A 3HYIA 2Y7KA 4M72A 1QPMA 1OKRA 1D8KA 3B02A 2KJCA 2HR3A 3WODF 2H25A 3T96B 1IXSB 5AA3A 2F2EA 4L9TA 4NF4A 1XT8A 2REJA 5B7DA 4OERA 3PD9A 3QPTA 1XMKA 5D5XB 1WWXA 3E6MA 1I6XA 4MLQA 5JK4A 1D3YA 2V25A 1Z6TA 3I59A 1Y3PA 5JTYB 4ASNA 3BJ6A 4GWOA 2XX8A 4A0XA 2O69A 3IHUA 5E18F 2FBHA 5CJ9A 2MLKA 1OPCA 2BBYA 2F35A 2D2WA 3O2AA 1T0FA 1B4HA 3O6HA 2MA3A 2GZWA 3EN3A 3C36A 4TLLB 3V5AA 2STWA 5E17F 4H8IA 3OO7A 4RGSA 1JGSA 4LK0F 4Q5TA 4Q47A 4KICA 3B6TA 1B9NA 2IT0A 3RGYA 4LLLA 4GQOA 4LP2B 1BC8C 3J7AO 2LNBA 1YG2A 4IPAA 2J5OA 3GX4X 1NNTA 2KIFA 2L01A 1M5DA 1R36A 1UTBB 1ZU0A 5HVQC 2B3BA 5CM6A 1W5TA 3JSPA 2Q2AA 2XAQA 4UNOA 1XCBA 4U1OA 1T2KA 3MP1A 4EJVA 3D4GA 2QENA 4ZECA 4KQPA 1K78B 4L0YB 1FX7A 1LFGA 1B0HA 2LDUA 3AAFA 4NF6B 3MPKA 2V3QA 3Q5FA 2D45A 1P1WA 2IA0A 5ELVA 1J0RA 3V7SA 1LCTA 1B5JA 1FC3A 2ZNYA 3H7MA 2VC1A 3LSLA 2ZXTA 2DOJA 3LSXA 2QMXA 4L0ZB 3E6BA 4PZJA 4CZZA 4ON0A 2XAHA 2F8DA 1B05A 3DP8A 4EJUA 5IT3A 3KOSA 1OMPA 4HQEA 1YCJA 2ONKE 3QK6A 4YZZA 4BHBA 3EHSA 1XOCA 1FNNA 2WC2A 2XXXA 3RYPA 5ILVA 2P5KA 1JHHA 3BJAA 1SDXA 2FYIA 3I3VA 2BEOA 4RPOA 4JBAA 4OETA 5I57B 1QGPA 1H45A 4A2UA 5LHGA 1SFXA 3PQKA 4RB3C 1BI3A 1HXDA 3M8EA 4DQ2A 3M1EA 1LAFE 4QF9A 2GXBA 5E1WA 3GFLA 4IF4A 2FMYA 2FEZA 4KYWA 1LGBC 1R5HA 4IGTA 3TMGA 2F34A 1LDJA 1ZGAA 1KU9A 4GL8A 2ZNZA 2QS3A 4QWQA 4GCVA 1B4AA 2XXYA 5H8NB 3RYRA 1O63A 1V4RA 3N94A 2DTRA 2IA1A 2R7FA 1OR7A 2MH2A 1LEBA 4XKRA 3TODA 4IVNA 3TO9A 4YMBA 1EU8A 2JT1A 5TP9A 4GYIA 5AIQA 1SW4A 5D5UB 1S7AA 3BY6A 3LQQA 2OCUA 5FLXZ 4ELRA 3RTWB 1PC3A 1WODA 1ZG3A 4LZ8A 3IOTA 4HCWA 3W9WA 3JSOA 1SI0A 5I56A 5EHSA 2OWTA 4HF1A 2EV0A 1ZH5A 5D4SA 4LMYA 3GUDA 1BM9A 3F6OA 1QZZA 2QM3A 3ZMDA 1JVXA 2A5SA 5ED4A 1DTZA 1I27A 2LF8A 3RTFB 3F8BA 3GXOA 3S9EA 4P9FA 3KOTA 1U5TC 3D0SA 3T66A 2CG4A 3VDFA 2QYOA 4FX4A 1KWHA 3R0JA 4RPNA 1LNWA 1ZKBA 1SBPA 3P7NA 4Q4ZF 1FSHA 4XTCQ 3MVYA 1DDNA 4HV5A 1B1XA 1G6NA 2BE5F 4R6KA 3A3CA 2VONA 2R6GE 3T93B 2PJPA 4YAHX 4GOTA 3MW0A 3U93A 1IAWA 4THIA 2YSRA 1N04A 2ISZA 4XIGQ 2PBIA 1B58A 1Z1DA 5AA2B 2DVZA 2K7LA 1BN5A 1T38A 1HSJA 4Q5SF 2F7BA 2OJTA 4IO5A 4QRZA 1FYLA 4LD5A 5HLIA 5ICEA 4RYAA 4MFIA 2I48A 3PUWE 1BC7C 1SD3A 4Q8RA 3P7IA 5CC2A 1QNTA 1H43A 4F3BA 1F9NA 4KI0E 4ZEDA 4MLVA 1CF7A 1B9MA 4A0YA 3F8NA 4XLPF 3GEZA 1PUEE 1MQDA 3C31A 5KZTA 3HRSA 3KN7A 2DT5A 3IWZA 2MLGA 3TTNA 1XDUA 2X7PA 1E17A 3RKYA 1SW5A 3QIMA 4GO1A 1JNFA 2CQKA 1YLFA 4NF8B 1LDKB 2PEXA 2DW4A 1XN7A 4WCGA 2O03A 4U0WA 2PQ8A 3BBRA 3COAC 3JTHA 2OD5A 1MDP1 4M6YA 1U3EM 2DXYA 3CRBA 1LSTA 1HKSA 1ZIUA 3SEXA 2D21A 4IB2A 4DXBA 5AA2D 3SXYA 4R79A 1A7LA 1LDDA 4JQFA 3ILUB 2IRFG 3K6UA 2W24A 4FJPA 3CFLA 3CFZA 1HSEA 3CUQB 5DEXB 1B32A 1URDA 3BDDA 3MFKA 2XXTA 2NXOA 2R71A 1BIBA 2BJJX 5M2VA 2EFOA 2VHAA 3G3IA 4JWXA 1H76A 3VVFA 2CZLA 1MM7A 2JZYA 1I69A 3KZZA 3EHUA 3BJOA 3PPPA 2VN2A 1TQMA 3FIRA 3C4MA 5ILSA 4NB5A 5DUIA 2JPCA 3UIFA 3ZMUA 2THIA 2DYXA 1YAEA 2Z99A 4HCYA 4AD9A 2D1HA 4K3FA 3IAZA 1H3DA 3V8LA 4LFUA 2PI0A 4MGRA 1UFMA 1MJ9A 1C0WA 2B3FA 4HX4A 2M30A 2P7VB 3N5LA 3MVXA 3FM5A 1XCVA 3O6GA 3I59B 3H3ZA 3E6CC
chains in the Genus database with same CATH superfamily
4ZYEA 5FLMJ 2K27A 1JHFA 1UTHA 2DYXA 4YIRX 3A29A 4I3EA 3IWFA 2X48A 1RR7A 4EGZA 3QUJA 4AVZA 2ID6A 2ZB9A 5DVJA 3Q29A 1MH4A 4KDPA 1K6OA 4RAFA 3GFJA 3H06B 4MEYF 3HHHA 2LH9A 4F1UA 1FSEA 3QQAA 3DBRB 3KEIA 3VSLA 4MTDA 1MQGA 3PUZE 3HBLA 3LA3A 3CMEI 1LFUP 3QP5A 3DELB 1POTA 1F4KA 4CHUA 4CCOA 2RAEA 4XFEA 1GVCA 4ZS9A 3TQNA 1SD7A 2E60A 3S93A 1R5GA 1POY1 4P8BA 4AQ4A 2CW0F 2JVHA 4KMUX 2JSPA 3TOAA 2KDZA 2F3DA 4IOAF 2UXAA 2YU3A 1MPCA 5KCJA 1PP8F 1X2NA 2ZO4A 1LB9A 1QUKA 2F5VA 2FA5A 2Y69H 4HRIA 4DYQA 1L3LA 1YW7A 2CEYA 3IK6B 3FISA 3SETA 3C9HA 4HTGA 4C3HJ 2WV1A 4IO7A 4YKIA 4GYGA 1UCRA 3BLYA 1AMFA 2DOAA 2DE3A 4NTLA 3JR9A 3FATA 3LSTA 1QW0A 1N76A 1BI0A 1I6BA 2O6AA 3V8XB 1SVXB 1Y0UA 3O6BB 3RKQA 3PU5A 1NV0A 1MSEC 3RTRA 4NQWB 4II3A 4F22A 5HS9A 2O3FA 1A8FA 2IXSA 1QJMA 3DTIA 1IRFA 1XDSA 4XRFA 3OSFA 3TDJA 3L7WA 4AIDA 4IHTA 1ZMGA 2I3WA 2THIA 1MQJA 3T9XB 3TOBA 4IQ4A 4XKPA 4PAKA 3W3CA 4DZ1A 3OR2C 2ICWG 1RETA 4EF1A 2DTZA 5A2QZ 2KLFA 2CJJA 3K2DA 5CVVA 2FF4A 3K9TA 4UV9A 1FBFA 4NGUA 3OMBA 5GP9A 1ITYA 1FTOA 2DJIA 2EFPA 2QQ8A 4ZYGA 3H3UA 1YIJI 5K5QA 4BKXA 2VUMJ 2XPWA 2DFEA 2AIXA 2ZNSA 4M74A 2ZSHB 3DF8A 1XSXA 1I5ZA 3JRIA 4GL0A 4PFOA 3KIOA 3U1DA 2E5ZA 5LGNA 1VSOA 2HTJA 3E5UA 1XS5A 2DVCA 2FBPA 1H0MA 3BG9A 2V1XA 1SW1A 1GT0C 3G3ZA 1R5ID 4DIQA 3HSRA 4UUVA 2W7YA 4OMZA 4ONYA 1IN4A 3MN2A 2XGDA 1QUIA 3DLNA 3VLWA 3OO9A 3EQLF 2GQQA 1MGTA 2ZJ2A 2GA2A 4Q0CA 1ZHFA 3OSQA 3PNTA 4JK1X 5M5YJ 4P11A 1EZPA 4PFTA 1TW2A 2IGKA 3P9IA 4OFLA 3OY9A 2LLKA 1YE9A 2LTPA 2A6HF 4F2OA 1ZRDA 3MC2A 3M7GA 3AG3H 1YJ9I 1A04A 3PJRA 3CSBA 5HM4B 5J8CA 2ONRA 4BEHB 3MWMA 2NVQJ 2VODA 5T3JA 3K00A 3BG7A 1HLVA 1LJ9A 1FP1D 1X1BA 1X3UA 1FCKA 2I49A 4R2FA 3NAUA 3ABTA 1B1HA 5ICGA 3F11A 3WGGA 2MKZA 2DMPA 5DS9A 5B66C 3TTKA 2VBWA 1RYXA 2VIXA 2HXRA 2ZZWA 3B6QA 4U2RA 4K2EA 3MAMA 4C1TA 3LSMA 3D5LA 5DEQA 3M4OJ 1MBEA 3DBHB 2DWHA 3CJRB 1TWAJ 2ECBA 1NTCA 4CYDA 4F91B 3PIOF 2HEOA 4IRHA 1KA0A 4HV6A 4HZFA 5TP9B 2VBXA 3HPIA 1GV2A 5E20A 4Q30B 4RGUA 4RXLA 5K5RA 1B7UA 3O3KA 5AONA 3MPLA 4NF5A 1B2HA 1LB2A 1FBPA 2FNCA 4HQMA 1W0UA 1NNPA 5IYDJ 2JUGA 3PNVA 4MHGA 1FQBA 2O8KA 2ZYMA 2GH9A 1HF0A 1X1CA 3G2BA 3MZ1A 4UY8I 1XHYA 2P6SA 1FTTA 3K2ZA 1GHCA 1RUNA 1RIOH 2OU2A 3HOUJ 2HQ0A 2X9DA 4OFJA 3DPLC 4ISUA 4DI4B 1B59A 2O7OA 3CJTB 3T9HB 4GX6A 4P96A 4MMPA 1UQWA 3IL1B 3KP3A 1SD4A 4OOIA 1AWCA 1LCFA 4WX9A 3CF5F 3G3KA 2KHMA 3CQZJ 3EUHC 3EPEA 4EUOA 1NV1A 2BW3B 4H5GA 1V5FA 3FXOA 4KCDA 2OCEA 3R6SA 4JXIA 2DLLA 5EF6A 2XWKA 4M3FA 2JWTA 4N0BA 1UHMA 1IDYA 4N17A 2PG4A 4XKBA 2QLZA 2PFYA 4GF8A 2VOOA 2FOWA 1MY2A 3FXQA 4YG2F 3TPAA 3S14J 4IL6C 3V8JA 1D1CA 2R7OA 1FBEA 3HOVJ 3ABUA 2XHDA 3MKLA 3GZ6A 1O7TA 1BKAA 1LBZA 4HCYA 4G8MA 3UNGC 3CTAA 3HKZN 2YJPA 3QAXA 1QBJA 4P9UA 2QBYA 2AXTC 5LBQA 1EH3A 2DMNA 1W36D 4J19A 5K2YA 3WGIA 5LHIA 1B7HA 2CS3A 4JBZA 1KU3A 4JP0A 1IITA 1ZBMA 2XXPA 2FD5A 4G7OF 4GWSA 2P0WA 4YB6A 4HF2A 2MC4A 2L2OA 2O1LA 3VLVA 5ICTA 2CQXA 2KKOA 1RKMA 2OTJI 2WY8Q 4KD5A 2YLNA 2V79A 4KN7X 3E1SA 5HODA 4QFNA 3JRHA 4I6ZA 3TTLA 1KYWA 3ODBA 5M5XJ 5H8FA 5J1RA 5F6FA 3PMVA 4IRGA 3TZAA 3WTSC 1DOTA 4FTHA 2K9SA 4XM3A 4JOMA 3NWSA 3DP7A 2HOEA 3BR3A 2VD2A 2HGCA 4ZYAA 3MVZA 2UZKA 2HDDA 2QL3A 3T9UA 2DODA 4N4UA 3IO4A 4MEVA 1IMEA 2X6OA 4W97A 4UUTA 1IO2A 1DGRM 2LFBA 3Q27A 2OF7A 2Q74A 4NQ8A 2GWRA 4BQAA 3LQRA 4PETA 5E1XA 1XC5A 3QYEA 1P99A 3BTLA 4NDLA 2HFBA 2ETHA 2E1SA 3K6WA 4U1ZA 3TQWA 4QSEA 3RKWA 1TNSA 3OIQA 3OOPA 4D7NA 5I2KA 4OA4A 4NAPA 2L9RA 3OYFA 4P9KA 3OYCA 1JGGA 4RM3A 3S17J 3O2PE 2R92J 3LA2A 1K4SA 4FX0A 2QCOA 1GXQA 1QHHD 5K7FA 2F6GA 4XR6A 1LFHA 1NUZA 1R4MB 3RJPA 3MCZA 5IP7J 2STTA 2WBMA 1OCTC 4XKNA 2PJRA 1MXXA 1B4ZA 2H4IA 1GXPA 3SEZA 1FZPB 3LSJA 1Z3YA 4IQJA 2RCBA 3PTYA 3C3WA 1FIAA 3IOVA 1UHSA 3ZN1A 2V9VA 4ELPA 1BIYA 1EYJA 1OYYA 1WJEA 1W1WE 3MP8A 1U5TA 4U0YA 1QO0D 2HZLA 4MAGA 1X1PA 1IC8A 5ERIA 4UABA 3U1OA 5I59A 1R1TA 3TCHA 4BBRJ 3SEYA 2PT1A 3TAJA 1NL5A 2A6EF 3H9GA 3M9AA 3OYJA 3FJMA 3JCUC 3ZMSA 4U4XA 2K40A 1NG6A 4I99C 3HRMA 5EYGA 2BY1A 1URGA 2O8XA 2XX9A 4PJ0C 1PVEA 5I7IA 4G6DA 1HSLA 2ZZXA 2ZMBA 4BDNA 4CXFA 3BKIB 5KDTB 2NNYA 5TJJA 5J6XA 1JUSA 1S9HA 1U2WA 1EZ9A 4C1UA 3BG6A 2QPQA 1NHAA 1UJ8A 1QA6A 1FOYA 3SEUA 3CIJA 1ZLJA 4ESFA 1YFHA 1VZ0A 2LD5A 4KFCA 1WCMJ 2HVSA 3BIGA 1SPIA 4MF3A 2ZFUA 1RESA 5EEHA 3IC7A 2GOMA 3JRAA 2XVCA 3N6UA 1T08B 3QOPA 4XSXF 5D6EA 4BQOA 1Q35A 4MH5A 2FBIA 2KZGA 2L7ZA 4X9TA 1LAXA 4U21A 2QA4I 4ENKA 2KFDA 2ZFWA 4CGZA 1QZYA 5I58A 1ATGA 3A01B 3AL0B 3W6KB 1USYH 2F5FA 1QVTA 2UXXA 3ZQFA 4IJAA 3G3HA 3A1YA 1G3YA 1TLHB 4I0BA 1LBWA 3CLOA 3KZGA 4UB6C 1MJAA 2A05A 2RINA 2H8WA 1R22A 2QQ9A 4RS8A 3CCQI 1LBBA 2BJIA 1ZGJA 2Q0OA 4KIBA 3ZMVA 1W5CC 2HDWA 1EYIA 2QSXA 1LAGE 1JT0A 3IB0A 5TGTA 2NYXA 4MIMA 4P0GA 1Y56A 2EZIA 3FVGA 5IPAA 4E7JA 4IO6A 1YO5C 3KGCA 4F18A 2MBFA 4P3LA 2ANJA 4EQBA 1MDMB 1P4WA 2FX0A 3F22A 3I0TA 3H6UA 5FTHA 4R8HA 2PMHA 4CICA 4OINF 3LNQA 1IDZA 3W9VA 1SVMA 1B5IA 4OMBA 4R73A 3FVOA 1MNDA 4UB8C 3RPWA 2DFHA 5DTBA 4F31B 3PM1A 1IXIA 3DTEA 3THIA 3WU1B 3DXJF 1JETA 4YRVA 1FTMA 1TFDA 5CRYA 2HQAA 3OWTA 3CMMA 4Y4RA 2DMUA 4UUSA 2UVHA 5KNLA 4FEBA 1Y4CA 4P1LA 3SESA 4FE7A 4DZPA 1FRPA 1OLTA 1YHQI 3R0AA 3MKWB 1RYOA 3HC7A 2KISA 1P2FA 4XMYA 1NH8A 4IOCF 4GIZA 4Z7EA 2PMUA 3CO6C 2UV1A 3G73A 1SANA 1R9LA 2Y7RA 3IJOB 3PUXE 3C33A 5BMZA 2B4MA 3S9LC 2UYEA 3S32A 1SC7A 2HPIA 5HS8A 4GBWA 4P56A 2HXWA 4H67A 4F39A 1TNTA 4KA4A 2M8EA 2QWWA 3GBGA 2FRHA 3JW4A 2EA2A 2ME0A 2R7XA 4MCOA 4X1DA 2ZC2A 2LKXA 2Z9OA 2DBBA 2Y9ZA 4M3EA 3FHNA 3GWZA 3HPHA 4BJTA 2HZKA 4A69C 3OEMA 2P3VA 1IZ1A 3ASOH 2UUZA 4G12A 1PDAA 3FJ7A 2NS7A 3WTZA 4XORA 2IGMA 3C18A 2PMZN 2ZMEA 4F3SA 2DQLA 4XBFA 4GX4A 3K10A 4AU7A 3WAFA 2COMA 4U7BA 2KR0A 1RDYA 4Z2YA 1E3OC 4II2A 4BS9A 3T0JA 3DBLB 2GAUA 2ZXJA 3FK7A 2E71A 3ZR8X 2XKOA 1MM6A 2R5YA 3MQ0A 1IG7A 4BE2A 4LA9A 3F3XA 2ZBKA 4RY1A 4ECFA 2V6CA 1BIAA 3OL4A 1LE8B 3I56I 2EZKA 4A3LJ 4IEJA 2ZYNA 4TLMB 3ECOA 4ZZLA 3H5AA 3DLAA 3KZYA 3RZDJ 3E3KA 1O3QA 3HEFA 2O1MA 2P0SA 4IO3A 1TW3A 2A68F 3DQVC 3VEPA 2CUFA 1URSA 2QJEA 5FKKA 3CO7C 2V93A 3GCMA 3F8MA 4F7ZA 2P3NA 4G68B 1OCCH 4O7MA 4PQJA 3V89B 4F2QA 4I62A 3IB1A 4EQQA 1A40A 1TWYA 4GFRA 5HOOA 1MBGA 2H6BA 5LEJA 3JRGA 4BL0B 4QSCA 1RUOA 2C6YA 4M9XA 3I54A 2E0SA 1QPIA 3UIFA 4DCYA 4KUMA 4S0HB 4OFOA 4MNIA 5GPAA 4A0ZA 3BOQA 5HS7A 4Y3OA 2G29A 3TKYA 2VJ5A 5DVIA 3BTCA 1L5TA 3IRRA 3WTVC 5DW8A 2X1EA 5B5EC 4KNYA 2LY1A 3HRUA 3B8BA 1LKXA 2YX7A 1USYE 3H6VA 5I84A 5IOYA 1B7ZA 1TT0A 3FKIJ 3V4GA 4EM0B 3T1BA 2KL4A 4OVSA 1W7PB 2DYRH 3EUAA 2AL4A 4AUXA 4I2OA 1M5FA 1YW8A 3BR1A 3EKIA 3L6GA 2HPGA 1ODDA 4I9DA 3HUGB 5AIPA 4YIIA 1FMVA 2A61A 3M3KA 3KSXA 3IH4A 4MHFA 4O8MA 4NF5B 4HAMA 1XGOA 5H8QB 1FTKA 5FROA 1ZJLA 1RDXA 3RT6B 2Z5UA 2GLOA 3ILTB 3WTXC 5AA4B 4ZYHA 2P6TA 4EXKA 2I58A 4YICA 4BHPA 4M9ZA 4EV0A 1I3QJ 1ZR4A 2V1UA 2QVOA 1R71A 4FQGA 1PBPA 4X0GA 1IW7F 3DV8A 1MIJA 2HQNA 3K4BA 5F0CA 3FXUA 1J75A 2V3UA 2ZNUA 2MSYA 1OCZH 3BCBA 4XLCA 2RC9A 1G3SA 4HLYA 1T0KA 1CGPA 4JVDA 3FK6A 1YITI 4FAJA 3S2WA 2XHKA 1H8AC 4QBAA 4YU0A 1B8IA 2LYCA 2M7BA 1NUXA 4EGYA 1F1ZA 2RC4A 2DA3A 2I0CA 2IAIA 2NS0A 2Z16A 2K3PA 2LR8A 1B6HA 1Y1ZA 3H9JA 3D5SC 2PCRA 1O7LA 5E79C 2HU9A 5H8HA 1W7PD 2V9KA 4OHNA 3KP5A 2F5XA 2FIEA 4N4NB 3I71A 1LAHE 1IN7A 2X6WA 3K6VA 1IUFA 3HJEA 2R7DA 3IAM2 2HPMA 4BY1J 3FXBA 1SW2A 4M9SA 2QBYB 1IIWA 2F6PA 2Q1ZB 1OQHA 2F97A 4NHJA 3FBNB 4N91A 5DCMA 3HSTA 1JEVA 2A07F 1JUPA 5K2XA 1ZAOA 2DA2A 2HVQA 5IYCJ 1JTYA 2MC3A 1ZTRA 2V84A 3HG9A 4R1HA 4IXAA 4E4HA 1OVBA 5IOZA 4UVAA 2XRLA 5E3LA 1TL8A 1P1OA 3IR1A 1VFCA 2VGQA 2K86A 2DDKA 4FHTA 5M5WJ 1IUDA 4G61A 3Q3SA 4OIPF 2L4MA 1LBCA 5DDGA 4L5EA 4UVBA 4N4OB 4ANJA 4G94A 1MXWA 3BR6A 2Q88A 5H8FB 2ZJRF 3BPVA 1NH3A 4KMFA 3OD7A 3TCFA 4IR8A 2BYVE 4NG7A 3K0VA 2DAOA 3WE2A 4C2UA 4EMSA 2JA7J 4R6YA 3VXBA 2VBYA 3VE1B 3QOEA 1MXUA 1RI7A 1P7IA 3QP6A 3OYAA 3BFTA 3KFMA 3REOA 1M5CA 5DD8A 3I64A 3TDZC 3CUQC 2P8TA 3LR1A 2GIVA 3LFKA 2FOKA 1D1BA 3R7XA 5FKOA 4HX8A 2QUFA 3J80K 4ENJA 1FOXA 2X1DA 2XAJA 2Y75A 5IY5H 3JAMK 3TUSA 2RNJA 1ON1A 2R5ZA 1REPC 5FRMA 1T39A 1JW1A 1VQKI 2K4BA 3N26A 3RPLA 1ETKA 5EG0B 1RR8C 3S2DJ 4HG2A 1OCPA 1IRGA 3QYTA 4ZEBA 5EQ7A 4I02A 4G8NA 5I2KB 4EEFG 3K6GA 5EYHA 3TELA 3VPRA 3L9FA 2ZYOA 2M9HA 4DYRA 5EDNA 1XPXA 3BR5A 1B72A 3U21A 2OA4A 2W84A 1O3SA 1LPQA 1XS9A 1SQYA 5FFZA 3A3UA 3B50A 2WYKA 5IT9Z 4Y17A 5F27A 2GBYA 5I2NA 2W85A 5GAEJ 4LGWA 2E7WA 1ZG5A 1GVJA 4B8XA 3KETA 3KC1A 1B6AA 3EUHA 4POXA 2CUZA 3I9V2 3FX3A 1HBXG 4LB6B 2PJRB 4U23A 4CUGA 3BPXA 1T95A 4KHZE 3LWFA 1BI1A 3GFIA 3GZGA 4Y15A 5D6FA 5EEAA 3MP6A 3U2RA 3OYMA 1CQTA 2IEEA 1RZ4A 3H5NA 2L5VA 3KE2A 4WEPA 3RUMA 2FSWA 2UYFA 3GBAA 3CI8A 1GV5A 4AVPA 4KYEA 1WPKA 3DP6A 3BZ6A 2XKPA 4HXVA 1TWCJ 1SFUA 3OYLA 1FPLA 4KIGA 3CFXA 5TRDA 2H09A 2R93J 1R00A 3VDXA 2Y84A 1GGGA 2I0BA 3D1NI 1SMTA 3PNYA 4MO7A 1DPUA 1OMIA 3B6AA 1QGXA 3IB2A 4YMAA 3LA7A 1G0IA 3N6TA 4HW8A 3U65A 5BUUA 3PMXA 2TCTA 2EV6A 1DU0A 3JZJA 1S3JA 1W5SA 3MZHA 2OTLI 3K2AA 2DWJA 2UVIA 2RVCA 3WG9A 2DQVA 4NC7A 2A5TB 1Z6RA 3R60A 3LL7A 1FLIA 1MXZA 5EZGA 3SEWA 1X3ZB 5L8DA 1I6AA 3PSIA 3AG1H 3SEQA 3L2QA 1AKHA 1DP7P 2FNAA 2VXZA 2XWVA 3MAJA 1VQ5I 1TZLA 1B3EA 2EFWA 3SDGA 2H5YA 5FTIA 3G3JA 4PGGA 3GTQJ 2F7AA 2HVRA 2KJBA 2KRFA 4AB5A 1P1QA 1EA3A 1IV8A 3B6WA 4EM2A 4NF4B 1WVJA 4GWYA 3MSTA 3IKTA 3H1CA 3KSJA 3HSEA 1IV6A 3ULQB 5H2FC 3OYIA 1Q1HA 2NUVA 5I58B 2J5PA 4XKWA 3F72A 1R23A 2FXAA 1IGNA 5LD2C 2BHZA 2DOFA 2K02A 4HYEA 4G8HA 1MXVA 4RAGA 5ITOA 3ZRGA 1QHGA 2Q2EA 3TO6A 3A09A 5IKBA 1N7XA 3MJNA 3GTKJ 1FSAA 4RLFA 5KVRA 3HDDA 4H4KC 1D0ZA 1AL3A 1Y1MA 3LAJA 1GUUA 4ND9A 1O7FA 9ANTA 5GAHJ 2MABA 3FZVA 1Y3QA 5AE4A 2HYFA 1AOYA 2L02A 2HWVA 3BQZA 3HZJA 1NNKA 4ZE8A 4AS5A 1HC8A 3S4UA 1M5EA 4E0WA 1BR2A 1UB9A 2VQCA 2DO7A 4XN0A 3WHBA 5FHOA 1PBQA 5HNHA 2VC0A 3GMEA 3DP4A 4F1YA 2FQ3A 3MZ9A 4H46A 5H8SA 2HAVA 1FJ9A 4OVPA 4UHTA 4B4CA 5A5LA 1FP2A 6PAXA 1MY4A 3QAHA 1IMBA 5C44J 2QVUA 2R4GA 3OIPA 4P55A 3MEXA 4QPQA 3T8RA 4UUSB 1JXSA 2IVMA 4IHXA 4GXSB 2NNNA 1IXGA 3FJGA 1MJBA 4ESWA 5GAGJ 5JTYA 3KP4A 1X2MA 1G59A 2LAOA 3H3GA 2YR2A 3M8FA 1MQHA 1QKAA 3ZCOA 2ZKZA 5JHFA 3OL3A 3MUQA 3HGGA 4H65A 4PF8A 2DA7A 1PDNC 3L2WA 3SDBA 1H9GA 3KJ7A 3CC7I 3FKJA 2GHAA 1YJWI 4H8JA 1Y4TA 1NMUA 1JTXA 1AU7A 3B6CA 3GTLJ 1OYWA 1UIVA 2AQEA 1PYVA 4XONA 1XVYA 2JN6A 3L2CA 5KK1A 1ZTYA 1WJAA 2XD3A 4EATA 1D4NA 4H5FA 3V8KA 4A3EJ 4G6QA 5CMMA 2DQRA 4OVQA 3GFMA 3ABMH 3K4CA 2E5NA 1IEJA 5CVIA 2H27A 5EQ8A 1X1DA 1POGA 5EYFA 2VT2A 2QFLA 3N4MA 1E2XA 2EFNA 2HKOA 1DU6A 4PBQA 3O8GA 3VFZA 1KGSA 1SAUA 2JMWA 5FKMA 4GWXA 1NV7A 3S1NJ 5FRNA 3H4ZA 4D0PA 1OR7C 3K4KA 2GFEA 3M3YJ 3B7DA 5IAIA 1YS6A 2M0MA 2P7CB 4PCDA 3LSRA 2UXNA 4G8XA 4B1RA 2VLAA 2AS5F 5CLSA 2Y7WA 4XKQA 1FIPA 2F7CA 1W36C 2RREA 2JSCA 2O7IA 5CMBA 1R1VA 5JFRA 3PO3J 1FPIA 1FW0A 4M71A 4PUSA 2Q9TA 2O61A 2XGXA 1KQ0A 2E1OA 3J81Z 3ZKKA 1GVDA 2JRMA 3J7YJ 1K78A 4PFYA 5TU0A 1EV7A 2XX7A 1Z21A 1TT1A 3HTUA 1YX3A 4R9FA 3KLNA 1G3WA 4XLHA 2KRCA 1XSDA 1YZ0A 4JWYA 4NF6A 2LKSA 3MKYB 4YB5A 2IPQX 5B3SH 5LRSA 2E1MB 5DT6A 3HOYJ 4I7HA 2PX9A 3AKZA 3K4MA 5F0HA 2PMZA 3GYHX 1FEXA 2XXVA 3DM0A 4ZEIA 1ZGWA 2KRHA 2WYPA 3PPOA 4XLAA 1MW7A 4CDGA 2B65A 2IP2A 2V1NA 3FVKA 3CMAI 4CCMA 2BGCA 1T6SA 1Y8RB 1PUFB 1BJAA 1H44A 3QODA 2MYSA 3M3LA 3ABLH 2L5QA 3H92A 4AIHA 3V7RA 1SVOA 2OWSA 5CVRA 4OMYA 3F21A 1W4MA 2K9QA 5ICFA 4ESJA 2PVUA 1X58A 4N13A 4ESXA 3HOZJ 1MY3A 2Y31A 4PJLA 2AO9A 2ACJA 3F0CA 4FT8A 2D3IA 3KYDB 1SEUA 4OU0A 5J1UA 3N05A 2M8GX 1NFTA 3IO6A 2HCAA 3VYRB 5CBSA 2RQPA 1ZLQA 2DDAA 5I57A 2QS1A 3PIPF 2E7XA 4E7SA 2GXAA 2I4CA 4ELOA 3TDUC 4Z6YA 3E4RA 4O3CA 5BOXA 4HA8A 1U8BA 3C2GA 3DEWA 4A3FJ 4OXVA 4ZZAA 4ZH4F 4E0XA 4HSRA 1SD5A 4HF0A 1N78A 1T56A 2NS8A 2OWZA 2YPNA 1A8EA 4YFXF 2P81A 5FD5A 1FPKA 3N97A 3OENA 2A3SA 1IN6A 1O3RA 2OBPA 1MMDA 4LLNA 1DPPA 5I56B 1G3TA 1WHUA 3K1NA 4RB0A 1Y20A 3CG3A 2VKEA 4AIJA 3I53A 4BDQA 5L9SA 1A55A 5H8NA 1LEAA 4N9HA 2EIJH 2TRTA 1ZREA 1JI8A 3K0LA 3MKZA 5H8HB 1UAAA 4ITVA 4Y52J 2LOOA 1Z05A 3SZTA 2FQ4A 3WTUC 5J3LA 1LLSA 4RJZA 4ZZEA 1VQLI 1FBDA 2WX9A 4YKKA 3UA8A 4L18B 3I5OA 4WK8F 1P7JA 2HXIA 1AHDP 5DCMB 3RDIA 4BAYA 5LOMA 3GVAA 2PFZA 2QRYA 4BDLA 2M87A 1XGMA 1JW4A 4H6DA 4PDDA 4BDMA 1JE8A 1XG1A 2ELKA 2E1CA 1K83J 4XOTA 2QS2A 2Y5LA 3U94A 1HKQA 1Z67A 4M3DA 3ZQHA 4NWCA 4CO8A 2HEUA 4GXOA 2WTEA 1LBXA 4GRKA 3OYGA 2XXRA 3F8CA 4RM2A 4PJMA 4PSWA 4QLCU 5LHHA 2RDPA 1Y9UA 3HHGA 1DUXC 4L5JA 4GGGA 1Z7UA 4XRSG 2XXIA 2IJLA 4CZCA 4E7IA 1ETVA 3VYUB 1YX5A 2P5LC 2Z8DA 1STZA 2V9PA 3Q26A 4M4GA 1B1BA 2X4HA 4BDRA 4BDYA 3FWEA 3S9NC 5E1ZB 4A3KJ 3T5XA 1ZYRF 2QS4A 2L54A 3FMQA 2O7UA 1JW5A 5DD4A 4XF5A 2RCAA 3KN3A 2OX3A 2O5RA 3FV1A 4XN3A 2UWMA 4O3BA 2H99A 1XD7A 4UACA 4CH7A 1VQPI 3NRVA 3U92A 1A6QA 1MNMC 2BOLA 3VXCA 2DOEA 5J4VA 2ZZVA 2XXQA 4P5OA 3CJQB 3S8PA 1F9BA 5F64A 2F5EA 4E7LA 3GTPJ 4MNCA 4HNTA 1Q1KA 2CSOA 4PFUA 1IXCA 1CF7B 1Q1VA 4RA2A 4H0EA 3SHFA 4LZ7A 1KA1A 3FUZA 2K85A 4GWWA 3LSIA 2EILH 2M1BA 3A02A 1UELB 3RQ4A 1HW5A 2R7WA 4OTEA 5JVGF 2KP6A 1FQDA 1IUYA 1MSFC 1KQ8A 1QQIA 2M4KA 1YYVA 1B72B 3HXLA 2OLBA 5FKNA 3QPSA 4PSXA 2EZLA 2V7FA 1FPDA 1NK3P 3UR3C 4HBLA 2IGOA 3MVPA 4JYKA 4G4PA 5EHMA 1Z77A 1KZHA 1Y8QB 4C30A 4HW0A 5FB2A 4RK2A 3OO6A 1N0TA 1NG7A 1D9YA 3UP9A 4WXHA 4ZDLA 1KYZA 3CCUI 2FA7A 4F1VA 1UHWA 4OAZA 1FQFA 4A5MA 4XICA 4N8GA 1R7JA 5CBRA 2ELHA 4E7HA 1J7KA 3BG5A 3C1DA 3AL0C 4G77A 1KU2A 1FPJA 3R26A 4QSDA 2ALUA 4DBRA 4OQOA 4L9JA 1P4AA 2VKDA 3K01A 3TQLA 2DPDA 1I1GA 5FD6A 4GWUA 4HDVA 1DBZA 5ICQA 3KBZA 3PMWA 1II5A 3H03A 5CKTA 2VE9A 3F6VA 1XX5A 3TW6A 4A5NA 1YW9A 5EGOA 5BPIA 2XF5A 1LBVA 2ZYKA 3PPNA 1HSTA 2H98A 2XXWA 1U6GA 2VT3A 2DK8A 3VODA 4DCXA 3A2KA 1R9QA 2G7UA 2QVVA 3FBIB 5HDKA 2G9WA 1RRJA 1KU7A 1MH3A 2L9VA 4CYCA 1K4TA 3LV0A 3I58A 1LVAA 1WFXA 4OYVA 4LQ5A 2I6EA 4JX5A 3TTMA 4ZE9A 2L0KA 4Z0IA 2D1VA 1T33A 3O9PA 5CC2A 3ISPA 3CCSI 1HW1A 3WU2C 3QPHA 1D3KA 4OWDA 4LITA 3S2VA 1TT5B 4OVTA 4B09A 4C2TA 3KYCB 2KQZA 4IO2A 3DCFA 1N3XA 5FJ8J 1YJNI 2CV2A 1APLC 1BOAA 3G1LA 4EJTA 3HN0A 5IP6A 4EXLA 3EETA 2R7VA 3CUQA 1S72I 3V83A 1MPDA 4H0WA 1J59A 4AYBA 4KR5A 5JHUA 2YPRA 3UKGA 1J2XA 1HDDC 4KCCA 1S6LA 4HSTA 4UXNA 2H1KA 3E79A 1LFBA 1A99A 3RSNA 1J9IA 4I09A 4WEDA 3IFCA 1XI6A 2I10A 2QQAA 1UTHB 3OMYA 2DFFA 2RV8A 1U78A 3EYIA 5LDZA 4I76A 4WWCA 3DPTA 1MG1A 2NXNB 1MKMA 5LEKA 2X26A 1BR1A 5ET6A 1DK4A 3USDA 3C2HA 2BY2A 3OOAA 3J7AY 1LQ1A 4HX7A 3K4JA 4LUBA 5ET5A 1LB8A 5A5XA 2HS5A 4B44A 3FD3A 2QEXI 1ETWA 4N81A 1TWGJ 1LUJB 4N6PA 2CRGA 4F29A 3BP8A 3OS1A 4EF2A 3JRDA 2RGVA 1S7EA 1WJFA 5FLXK 2FVZA 4Y7NJ 4L9VA 3OS0A 1AIVA 4I98B 1OCOH 4OIQF 4U0VA 4ELQA 1S8NA 5DUKA 1D0YA 4DBQA 2YU9J 5D8KB 4N9IA 1ZG1A 5CMKA 1FY7A 1FTLA 5J16A 1LEVA 1P92A 2LREA 2Z1DA 3O6IA 2XXHA 3AG2H 4X8RA 2M7AA 3ZKLA 5KCJB 1E0EA 1SFKA 2CQQA 1WSUA 3F8FA 3OSGA 3MYUA 4I3YA 4XRMA 1MMAA 3KFWX 3ZGKA 3TTRA 3BQYA 3WE3A 2DS9A 1UIUA 3MVWA 4GD5A 1Z7ME 4KYSA 2R7SA 2E2JJ 3VYTB 4I40A 4ZC3A 4YIFA 1U8RA 3FM3A 3ML6A 1K6YA 1SVLA 1FYMA 4BBSJ 3OYNA 2MGQA 3CZ6A 1WJCA 5LRRA 4MEXF 1R4NB 1D8JA 1R1NA 2R9JA 4G68C 3GZNB 2GIZA 3LSWA 2KPMA 2XAFA 2YS9A 3HOTA 5D5VB 2K5CA 4QPOA 4IO9F 3IFAA 4FEDA 3DU6A 5JI6A 3HOSA 5LLQA 3KYLA 2Y5KA 3ERED 3CC2I 1LBYA 4PE3A 1A36A 3GZ5A 3KEYA 2XV4S 1OQYA 1S29A 3EPZA 3HIFA 3IH2A 1PB8A 1IN8A 4M3BA 4A3GJ 3FBPA 4KXPA 1MZBA 2QZ8A 5F7VA 3QYFA 3OSRA 3Q0UA 5L3DA 2NOGA 3TFLA 2QGUA 2RKMA 2ADUA 4G6TB 3PPRA 2FBKA 3QPLA 3ECRA 3KG2A 4MIJA 1AOVA 4RDUA 3LSHA 3I4MJ 2MD5A 4FISA 4UVCA 2VD3A 5B1BH 1Z3XA 4XOPA 3E78A 1IQ7A 5F1QA 1USTA 2DCEA 3BR2A 5FHNA 3UN6A 4HNVA 3C35A 5FLVA 3ZQQA 5HLHA 2ABHA 3Q28A 1M5BA 4NQWA 1J1NA 2VKVA 4KN4X 4XK4A 3RIRA 1B51A 3K1MA 4BXUA 3TP3A 4FORA 4BY7J 1Z9CA 5DVFA 5H20A 1DPRA 4S05A 4O5VA 2PN6A 3GLBA 2DA6A 1ZN2A 1CE2A 3KLOA 2I4BA 3Q25A 1O3TA 5JLWA 3H36A 1R9TJ 4POWA 2Q8KA 1FPEA 5D5WB 2NVYJ 4R74A 3CSGA 2QMWA 2GHBA 3O66A 2ME6A 2O6GE 2O68A 3T9VA 4EJOA 2HAUA 2F3BA 3VOEA 4PE5B 2F6CA 2V26A 4LK1F 5LGTA 3WTTC 2EK5A 5E3NA 5IT9K 4A3JJ 4YKJA 4NBQA 2I5UA 3LSGA 2HYGD 1FOKA 4YKPA 5TPAA 3TEPA 4P47A 5HDNA 1MD0A 1Z7LA 4ZJZA 1ANFA 2X7QA 4JWOA 1EJ9A 2VE8A 1JJ6C 2IBDA 2XSDC 2D5WA 3HTSB 2VB6A 2CW8A 2EV5A 2WKYA 5FFXA 1OCRH 3DFGA 1O4XA 4DYCA 4ETSA 4CCNA 5F1RA 1IJWC 4PFPA 1O57A 5IP9J 4F55A 1YS7A 4XSZF 4PDKA 2IW5A 2CZKA 4GVOA 2V4JC 3ELKA 3LUZA 2XF7A 1NKXA 4IHWA 3HB9A 3ABKH 3E5QA 1YYZA 5HPQA 1IMAA 1FBSA 2VQLA 4J01A 3B73A 1YTYA 2VOPA 2AL5A 4RAZA 3KN8A 4RA1A 2WBBA 3JTGA 3OYDA 3IOWA 1EH6A 3UGWA 2VJ4A 2VXDA 3OXNA 3GO5A 1SAXA 4JDFA 1YIOA 1Z7NE 4HS7A 3RLFE 1JKPC 4YFNF 1R1UA 3K70D 1IRXA 4QFKA 4G7HF 3ZPLA 2KIUA 1B3GA 1MBHA 4BEHA 2DU9A 3PGFA 2G7HA 4RGXA 3RKXA 4I0AA 3HL2A 2EPFA 1MXYA 5EEGA 2V3TA 4ZTFA 3U9GA 3CVGA 2VASA 4BJ6C 2XAGA 4D5CA 1G4DA 2EWNA 1UG0A 3RPQA 5HNFA 1HCRA 2RN7A 1IN5A 1GR2A 4KIFA 1ELJA 1QUJA 1NK2P 4LQ2A 2JVGA 4OVJA 3RI4A 3FMRA 2A5YB 3RT8A 1MRPA 1ETQA 3S3MA 3ZQGA 2Q8MA 3BTIA 1VQ7I 1X1AA 3OEKA 4MQVA 3AFHA 3O8HA 5DCFA 4D5FA 4X1EA 2FIXA 2M0CA 2JRTA 3WGHA 3O97A 3KP2A 1YQAA 2R7ZJ 4WXJA 4HOBA 1P6RA 1TTYA 1BW5A 2PMSA 2ZJPF 4L5IA 1Y3NA 2WAQA 2Y7IA 4GX3A 3RZOJ 3QUFA 3P9CA 2NVTJ 4PGPA 1RPWA 1UZCA 1FJ6A 3H5RA 4A3BJ 2I3VA 1EF4A 1S50A 4U22A 1TC3C 2ISYA 3L09A 3E13X 4M6XA 1AWBA 4KT6A 3I6VA 4C3JJ 3JYRA 5IZZA 2EB7A 4BDOA 4M1VA 1ZARA 1D9VA 4BH9A 4NE4A 5D8LB 3K1PA 3ZP5A 1CB6A 2H9BA 4JSDA 2CGPA 3PD8A 4OZ9A 3L2VA 3DLLF 2ESNA 4ZZDA 2IEKA 1FQAA 2PT2A 2P1SA 4E7KA 4U87A 5CVJA 3W2WA 1G2HA 2ZSIB 1MBJA 2B7EA 1R6ZA 4AWXB 4L9NA 3LBSA 5DYHA 1D5VA 4DNCA 4H45A 1HQCA 1IMDA 3JRFA 4QHQA 3PUVE 4LATA 2OZ6A 4EVIA 4OIOF 1R6RA 4PFWA 1NH7A 3E5XA 3HSFA 3FXJA 3CDHA 1ETXA 1ON2A 1ORKA 2QQBA 5KAIC 4B47A 1ZLKA 1GLNA 1SMYF 3DPUA 2FJ1A 3DWLE 3NEUA 4W1UA 1NV4A 4FIMA 3T22A 5ITPA 3RQTA 1XGNA 4EQ9A 2OBGA 2DPUA 2F4IA 2E1NA 4MLOA 2F4OB 4GXAA 1SYIA 5K5OA 4X1BA 1BP5A 4XIDA 2XRNA 4A6DA 1WJBA 3K6XA 3G3FA 1WKMA 4ENMA 2VBZA 3NARA 4JX4A 3V42A 1US4A 3FVNA 1N75A 4N15A 3S3NA 1P1NA 5GTHC 3OYBA 2PLYA 1H45A 4NWDA 3IORA 3LFUA 2VPRA 3IV5A 4R9GA 5CYVA 4QIWN 1NNFA 2OPTA 1SD6A 3IOUA 3GBBA 1FYKA 1S7OA 3BR0A 4MBPA 5CMCA 1M1EB 2K3FA 3E0JB 1TFAA 1OYIA 3E97A 2XXUA 3MBPA 3BWGA 5C4JJ 2XASA 4P1WA 1PP7U 1TXFA 5A2QK 2UVJA 1F43A 4R75A 3R6UA 2XUBA 3TCGA 3SZPA 2O84X 1IXHA 2ONSA 3KCCA 1TQPA 3JV9A 3GLXA 1ZQ3P 2M45A 4E7ZA 1K9ZA 3C34A 4FASD 2P5VA 1WDNA 4NF0A 2NAZA 4BACA 2DE2A 1EZOA 3G3GA 3A03A 1A5JA 2UVGA 1IF1A 4DJAA 4XLEA 3W6JB 1U5TB 2BV6A 2L9SA 5EGOB 3E6DA 4AYBN 2CFOA 2XROA 5EQAA 2XAUA 3BCAA 4C2MJ 4DLDA 5I59B 1R49A 3IL2A 4OEUA 2VOZA 2JA2A 4EDPA 5FGMA 2HDCA 3J81K 2DWAA 1T0FC 4NEDA 4IY5A 2Z8FA 2Y0SA 3DKWA 2DMQA 3ONQA 1BI2A 4PK4A 5LFAA 4V19K 1VTNC 2DSFA 5AA1A 3VVDA 2RNGA 3KP7A 4U7DA 2F4MB 4GRIA 3S2HJ 2CYYA 3T8TA 1K61A 2O51A 1WI9A 2MG4A 3IKVA 5KHDA 2A69F 5LGUA 4LB5A 1HOMA 2GRVA 2HXOA 3MMYB 5ISUA 4M3GA 4LG0A 4LLGF 4TQUQ 2KIQA 3VB2A 4RNSA 4AIKA 4PCQA 5F0FA 2LKPA 4ZEKA 1UG2A 2EFQA 2Y9YA 3FIWA 3FMSA 3SFIA 2EA4A 2BY3A 5D4RA 3A0HC 3QU6A 1A35A 4O3MA 2DWIA 3FV2A 3PPQA 4O3AA 3I55I 4X48A 2WA0A 2QSHX 3MQ9A 2LP0A 5E8IA 1RKTA 4Q48A 1BBYA 3CP2A 4X6AJ 2ESHA 2X0LA 1AH5A 3IRQA 4KPTA 2CW7A 4YFKF 2PX1A 4MNPA 2DN0A 4QSHA 1ZR2A 3ZQIA 2PFBA 2VT5A 3MZYA 2OK2A 3L6HA 3D5RC 5K1YA 2N8GA 3OYEA 2IA2A 2Z3YA 4PTKA 4DXUA 5A5XB 4JB7A 3RN8A 1MMGA 1NI9A 2X6YA 5EYRA 2E2HJ 5EQ9A 1ONVA 4ENNA 1UMQA 1DP3A 4A3IJ 3SKPA 3CLQA 3E3VA 2DI3A 2V6EA 2ZNTA 3CHGA 2VI6A 3HOXJ 2WWYA 5JEIA 3HO7A 5HLTA 1FPQA 2R7TA 1X3WB 2BHYA 4MNUA 4EJWA 3KEOA 3S1RJ 1XC1A 4OEVA 3P5JA 1QKBA 5ILUA 5BS6A 2GQ1A 3UORA 3PQJA 1Y6IA 2VP1A 1S7YA 4JX6A 1XSVA 3VV5A 2V1DA 3I3LA 3A01A 4EM1A 2IA4A 2XSJC 3LSKA 2FU4A 1OVTA 4IY6A 5IM2A 5B70A 4FETA 5FO5A 2HFHA 2E35A 3PV0E 4F19A 5DV5A 4JSOA 4IX7A 2CU7A 3FGSA 1Z91A 1BW6A 2LK2A 3PUYE 2M34A 5FBPA 1I39A 2XC7A 2COBA 4UV8A 5M3MJ 4ZDMA 3ROUA 4OVRA 2IS4A 1JQFA 1WQ2A 1NV6A 2NRAC 1FBUA 2K4JA 1MY0A 2XF6A 3SFZA 4GWZA 4F3QA 2XD2A 3RY3A 1K9YA 1BOBA 3RPUA 1WH7A 2OC6A 2XIGA 2E1MC 1FTJA 3S1MJ 3BZCA 4C9YA 1H89C 2VPLA 4BJ5C 4BE1A 1MDMA 3UK4A 2DYSH 2PBWA 2AYSA 3DEEA 1N84A 1OQGA 5L9MA 1AA7A 2F5DA 3OYKA 1I1SA 1T8IA 2HZDA 4BQNA 1QVSA 2MD0A 3TMOA 4GFBA 5J1DA 1TBXA 2ELJA 2ZMEB 1QU3A 1B40A 2QVRA 2ZCWA 1Y1VJ 2K9LA 3HOWJ 1ACIA 5FHMA 2JPBA 2QSFX 3HCQA 4ZEFA 1FT9A 3J80Z 1HKTA 4YB7A 1XMAA 5L3CA 4OENA 1ZRCA 3F9KA 3CC4I 4IO4A 4C0RA 1IRZA 2R5YB 3JAMZ 1B46A 1GTKA 3EF7A 1KQ9A 4I1DA 3QU3A 5DM6F 5HLGA 2HYJA 1PB7A 1FQEA 5IZ1A 2P2AA 2LF7A 2LY9A 3MD2A 3ZMZA 1YRNA 1UTBA 4MTEA 3K7AJ 1INPA 5GTIC 3M07A 3E9XA 4JVCA 2LSOA 1WRJA 3CDIA 5E8GA 3MWBA 3HM5A 2OZZA 2XB0X 3TGNA 1J5YA 3EUKL 3JRBA 2Q8JA 2BVMA 3S9MC 1B3FA 2CMOA 4UA8A 3FASA 1EH7A 3Q9SA 3CJNA 3P9KA 2Z2SB 1MS7A 1PB9A 1ETOA 3LC8A 1MMSA 3WAEA 4PDHA 4PGHA 2DJNA 4IHSA 2E2IJ 3DU5A 5J8FA 3OV8A 1P4XA 3CESA 2NOOA 4XNFA 2DT6A 2RC8A 1P9QC 2EIKH 3FDYA 4OAYA 3GTOJ 1BA5A 3GYYA 4PBHA 5TPAB 1LFIA 4LG3A 1J09A 2LRDA 3BZKA 1VQ9I 1BTJA 1MQIA 3HHFA 5DYMA 2NVUB 3QRFF 2HKXA 1KONA 1T98A 1DTGA 3SJMA 2Z22A 2QKLB 4QXDA 4NMYA 1VNDA 3W15C 2W57A 3TEDA 4I01A 1LE8A 2Z8EA 1SFOJ 4V2FA 4M73A 2R3SA 5L3BA 4XLNF 3QYBA 3M1CA 1G0HA 1VQ8I 3G7WA 3C7JA 1FJLA 5I5PA 2HZTA 4HDUA 1JP4A 1F5TA 2B0LA 2Y7PA 1RNLA 4BHCA 3GTGJ 3FF5A 1FWZA 3I5UA 1B52A 2MH9A 1QULA 1W0TA 4A3CJ 4RB1A 3BIHA 2ZXIA 3T0YA 3CMYA 3CCMI 4G68A 4IGRA 1YPNA 2GA1A 1XTAA 2M8CA 1FTZA 3V7CA 4ABZA 2VPOA 2WAQN 1A54A 1B3LA 1EKEA 2BXZA 1N3WA 4NC8A 1VF9A 1IMCA 1FOWA 2Y0MA 3HV1A 4FECA 4XXUA 2LVSA 2WY7Q 3LMMA 3QMFA 1S5LC 3EQ1A 1CNQA 1VFDA 1LVKA 4CSWA 1X4PA 1BLFA 4GLIA 1I50J 4V2GA 3CUOA 2DXRA 2WB1A 3K4UA 2XXKA 3PFYA 1FPFA 2H1LA 4WKMA 1D0XA 2M2EA 4I8CA 4F3PA 4A12A 4PFRA 2R7UA 3KBRA 3OO8A 4RAYA 2VQGA 1H88C 1P1UA 3ECHA 2EJRA 5KAFC 3JRCA 3RYDA 1W7PA 3ZOBA 1VE4A 5JVTA 4A6EA 1B8IB 4R6HA 4BLAA 1H9TA 1IXRC 3H0GJ 1G8XA 1MMNA 4B43A 3HUGA 3R61A 1R58A 4PAFA 2FE3A 4XKCA 1B5HA 4N8YA 1QZEA 1DPEA 5BQTA 4G7ZF 1YI2I 5H8QA 3VFJA 4WXCA 2EH3A 3H6WA 2EQRA 1V3FA 2BVLA 1JUMA 2OUMA 2TDXA 5AA4A 3BTJA 1ZRFA 1MBFA 1VQ6I 2KQRA 3O29A 2LBFA 2L4AA 2A5WA 5DTDA 5L3GA 3G4SI 4LIVA 3F23A 2W82A 5HDGA 4U88A 2Q89A 3R4KA 4BU2A 5CQGA 4Y13A 2RQQA 5I3SA 2F36A 4S04A 1FBQA 2W4SA 4XLFA 5BWJA 2HTSA 4RGRA 5L3EA 3IX1A 4B48A 2CMPA 3WTWC 3QXMA 4MQ9F 3EYYA 5DM7F 3HGYA 3GLLA 3SZGA 1N7WA 2XGCA 1NUWA 1O64A 4RK9A 4DIGA 3RCOA 1FMWA 3PUBA 4PJNA 4AB6A 3MZBA 5JR3A 1OLCA 2FMLA 4ZYDA 1U9OA 2NWJA 1DSNA 2CV0A 4KT5C 4P1EA 3DEUA 4BYYA 2LY2A 3SYTA 4F92B 3KEQA 1EYKA 3KJTA 1K79A 1BJZA 3KP6A 3M3FA 1KA8A 2RKHA 4IRIA 4PAIA 2K9MA 3OELA 5BPDA 4L17A 2QKMB 5L9OA 4LVQA 1HW2A 1TQIA 3Q0VA 1OFCX 4WXDA 3X2QH 4HNUA 1FQCA 2JJ7A 3H3VK 2H94A 2K9NA 2M3AA 4O6JA 3VVEA 3PFIA 5TISC 1ENHA 1F36A 2CV1A 1OLAA 2DP8A 2REGA 5CI5A 3NQOA 3HRTA 3ZMTA 4LONB 3AXFA 5E3OA 3FXRA 5GPCA 4D9JA 2CWEA 2X85A 2GOXB 4LJZF 1VFEA 1B9JA 3M8JA 2Q2CA 1TWFJ 3ZQ7A 3FXMA 2O0YA 2R5ZB 1SYHA 4FE8A 4DDDA 3S16J 3RPLB 1EH8A 4RB2C 3A0BC 3DKYA 4LIUA 1HA8A 1SI1A 3SQNA 3IJXB 3FXLA 2RC7A 1XB4A 2CQNA 2YX4A 2M4GA 2W25A 2Y0SN 3OR1C 2CUJA 1JEUA 1VQNI 4KYDA 5EJCA 3ONMA 4PP0A 5L3FA 3EDPA 3TYHA 5I2NB 2YUSA 4DXCA 4A3MJ 2L7FP 1GV8A 2KMUA 2G93A 3CCLI 1VQOI 3LAPA 2DE4A 3CR9A 1JKQC 3TKDA 3L2UA 2F78A 5AA2A 2KLOA 3FHZA 2M5WA 3H6TA 2DA4A 1ZKGA 3K02A 1MPBA 4QFLA 1ULYA 1B0LA 2H8RA 2IS6A 5J4YA 5IZ3A 2DK5A 4FE4A 3O28A 4FATA 2H6CA 2CO5A 4MJOA 5B1AH 2OQRA 3ZS6A 3U8QA 2Y30A 3SDFA 5J47A 1V5EA 2GXGA 2OAZA 4AM3A 4KISA 2PYYA 4Y33A 3CDLA 2KIMA 3Q9VA 5EG0A 4QFPA 5CQEA 4R72A 1D1AA 1ZK8A 1XGSA 2E36A 1XVXA 3D4CA 4DE8A 3WG7H 2XB5A 4F3GA 2W7NA 2DFIA 5H6QA 4G9YA 3ZN0A 2HNHA 3I4PA 3BROA 3W2VA 3LUYA 4R2BA 1U9NA 1YTVA 2DA5A