1IXCA

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
294
structure length
289
Chain Sequence
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLEIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR-type regulatory protein
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Dna binding protein
total genus 91
structure length 289
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ixcA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixcA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixcA02
1U78A 1BN5A 1IZ1A 4Z0IA 4EV0A 4QFOA 4GRKA 1KA8A 3TGNA 1MY4A 3RTWB 2XAHA 4HX4A 5KZTA 5D5VB 3TEPA 1K79A 1AOYA 1NH7A 4NMYA 2NXOA 3GLBA 2VP1A 3F8BA 2XKOA 3I6VA 2XXWA 4EUOA 1IUDA 4FATA 5I59B 1J7KA 1EH8A 2EV5A 2K02A 4ZZLA 4ELPA 3HRSA 5JVTA 3DELB 4F2OA 1OLAA 2LNBA 5JTYA 3K1MA 4QFLA 3TELA 2OK2A 2V93A 1B5HA 1Z7NE 2ZNSA 4QFPA 1BM9A 3Q28A 3S2WA 1HSLA 4KMUX 4KN7X 2FOKA 2DQRA 2RC7A 1B4AA 3ILUB 3KP5A 4XLPF 1H9TA 1LEAA 5IAIA 2DSFA 4GCVA 4HDVA 3GXAA 4L9NA 3QOPA 3PFIA 2I4CA 1FBUA 3RYPA 1XVYA 5H8FB 4GYIA 3FX3A 5TPAB 3GYHX 1LCFA 4Z7EA 1XS5A 3SEYA 2OQGA 3MWMA 3O2AA 1U6GA 1R1UA 4U88A 1XOCA 1MDMB 1C0WA 4M73A 4R6KA 1MXZA 4MLQA 2HZKA 1W7PA 5I58B 1S29A 3OOPA 2NAZA 2GQQA 4BQAA 1NFTA 2FSWA 4LJZF 5DYHA 4DLDA 4U22A 4WXCA 1VR5A 2ZJ2A 2NVUB 1FYLA 3MEXA 3DF8A 4CXFA 1Z9CA 2OCUA 4L9TA 2XAQA 4NWCA 4HLXA 4DQ2A 4OOIA 3KP2A 1REPC 4PETA 3LFKA 5ELVA 3IB1A 5CI5A 4G68C 2V79A 3DEUA 2NOOA 4N6PA 1HQCA 3JSPA 3C34A 1FSEA 4R6YA 2V6CA 3MZBA 1POTA 3U92A 4I62A 3BJOA 4JWOA 3JYRA 3RPQA 4KHZE 1LVAA 3PUVE 3WTWC 4A12A 1RKMA 2ZMEB 3F22A 4A0YA 5F1RA 3MUQA 1XT8A 5CMMA 3L6GA 4QSCA 1AIVA 2XKPA 4YG2F 5HS9A 4KFQA 1RUOA 2QS1A 2QRYA 3J80Z 4WK8F 3WTVC 3FIRA 2Z22A 2ONSA 2HFBA 4EXLA 1HXDA 3OO7A 1FBQA 4U7BA 1SFUA 2ESHA 5AIPA 2CGPA 2WV0A 1EZ9A 3K2ZA 1H43A 3GBBA 4JBZA 5FTHA 3W9WA 4ENNA 1OMIA 2ZBKA 3T9UA 3TDJA 3Q9SA 4Q48A 1DOTA 1B3GA 3QP6A 1LDKB 3WU0A 4GO1A 4JWXA 5IT3A 1II5A 4GWOA 5HLGA 4MTDA 4AQ4A 2L54A 2P0SA 3RDIA 5DTBA 3RKYA 5H6QA 2QZ8A 1B5IA 2H98A 3E6DA 2EFWA 2FNPA 3SESA 3BFUA 1UQWA 4F3SA 4HW0A 1CF7A 5K2XA 4RB1A 5BPDA 1RYOA 2H9BA 5FGMA 3E97A 4X48A 5DVJA 4CDGA 3WTTC 3H06B 2O8XA 1UHMA 2D2WA 4B8XA 3C33A 1MKMA 1FQAA 2RCAA 3IKTA 2VC1A 4A2UA 2UVGA 1D8KA 1T98A 3Q5FA 3GLXA 5BPIA 5KCJA 5CVRA 3LSLA 4R72A 4ONYA 2GH9A 1T6SA 1FX7A 3E3VA 2ETHA 1XSXA 1SW5A 3H6VA 3O6IA 4XKNA 2OJTA 3ZMSA 1N0TA 3WTUC 4BLAA 1WSUA 1POY1 3S9LC 1H45A 5I2NA 2VOPA 4M6XA 3RKXA 1VSOA 2QENA 5EHSA 2Y7IA 4L17A 3MZHA 3H3UA 2V84A 1PP7U 3BJAA 2YR2A 3HTSB 3V7SA 4PFUA 5LHGA 3KLNA 1HW1A 2O6GE 3SZTA 4BDRA 5DUIA 1MXYA 4EJOA 1LB9A 2ISZA 1LDJA 3ZKLA 1MDP1 4RAYA 2GFEA 5A5XB 2D1HA 4ENKA 2XX8A 4X1DA 4ESFA 5LEKA 3FJMA 3Q26A 2V1DA 3HRUA 4FX0A 1K7AA 1IRGA 2GZWA 2IA0A 2W57A 3TTMA 1G3SA 3TTRA 2HOEA 3PD8A 1PDAA 5F7VA 4H0WA 3KP7A 3QU3A 5HM4B 3KEQA 1MQJA 1J1NA 5D8KB 1NNFA 3L7WA 3O3KA 2P2AA 3VFZA 1B6AA 1NH8A 3EHTA 2IJLA 2HAVA 4IF4A 2QL3A 3G3HA 3GBAA 4ZEBA 4OEUA 2RQPA 3ODBA 3KFMA 4JSOA 3EPEA 4LMYA 4N13A 4BHBA 2NRAC 3OENA 1USTA 4L9JA 5ISUA 5LGTA 1EZPA 2X26A 3FD3A 1LB2A 1R9QA 3AAFA 1OQHA 4EQBA 2D21A 4LG0A 2RGVA 1ZG3A 3DLNA 3OSQA 5LEJA 2I6EA 4HTGA 2OWSA 3KSXA 3O2PE 3VODA 2ISYA 3HRTA 1MGTA 5E17F 2XXIA 3HSRA 3PU5A 2QPQA 4FHTA 4ZEFA 4L18B 1Y3QA 2O3FA 1B2HA 3CVGA 4E0XA 2XGXA 3PQJA 5DVIA 2QS2A 2YU3A 1IQ7A 5B7DA 3FM5A 4HOBA 1B58A 1XD7A 2RNJA 3PPQA 4P0GA 1ZRDA 3RY3A 2QSXA 2HYFA 2I48A 2UYFA 3ONMA 2XIGA 1IXIA 1I6XA 3EQLF 2QVOA 1ZN2A 1TQPA 4O6JA 3E9XA 5LRSA 3N26A 1ULYA 2KIMA 4RJZA 1QJMA 4YU0A 2LKPA 5DCMB 4I98B 3ZPLA 4PZJA 3GEZA 4U1OA 3D0SA 1G4DA 2QS4A 3QRFF 1U2WA 3HTUA 5H6RA 3Q9VA 2BJJX 2ZYOA 1I1SA 1LNWA 2P7CB 4MH5A 4ZE8A 4YFXF 3ZN0A 4MNUA 2FYIA 4GXSB 4YIFA 4EGYA 3BBRA 2F34A 3EDPA 3PUXE 1TBXA 3DQVC 3ECOA 4OXVA 4XKPA 1MXWA 2Q89A 3VXBA 1LFHA 1P1QA 1VTNC 2E7WA 2AXLA 4ELOA 1N7WA 4LP2B 3ZMDA 5I58A 1FBSA 4MFIA 1GVCA 3TODA 1IW7F 1UTBA 1R6ZA 5DUKA 4MF3A 1Y9UA 1Z7UA 1WI9A 4A5MA 4G7OF 4I7HA 4F3GA 4D0PA 1XMKA 1EH3A 3MBPA 1LFIA 3R6UA 1KQ9A 4R74A 4A5NA 1Y20A 1IXCA 4F29A 3JAMK 1MQIA 2XAFA 2OBGA 1E2XA 3EN3A 3SZPA 1IN6A 3K4UA 4ZYHA 3USDA 1LEBA 3G3ZA 2H94A 1YPNA 3QSLA 2ZMEA 3WAFA 1L0OC 4U2RA 1U5TB 4H5FA 4BYYA 4OEVA 4F1VA 1XDSA 3J81Z 2YPNA 3IL1B 3RUMA 2GHAA 4BDMA 4G77A 3WGIA 4ZEIA 1FQDA 4ZDMA 1ZJLA 3OXNA 1FYMA 4RS8A 2ZYKA 4Q8RA 1AH5A 3IB0A 2IPQX 2JZYA 3KJTA 2VBWA 3BDDA 1KQ0A 1UHWA 4OIOF 4KT5C 1SI1A 5AA3A 5KDTA 4RB2C 4NF4B 1B3HA 1U3EM 4PFTA 4U0WA 3PV0E 2A5TB 1BJAA 1B1HA 3AXFA 2QMXA 1BI1A 2HYGD 1D3KA 3FMQA 3GFLA 3NQOA 3H3ZA 4O5VA 3UN6A 4NWDA 4ZZAA 3RNNA 4POWA 3FASA 4U1ZA 4DCYA 1R00A 1UTHA 4OTEA 3FXRA 4YB5A 1FP1D 4ECFA 1HW2A 4JDFA 4DCXA 4UUVA 3CTAA 1FQEA 1IF1A 3C3WA 5ILSA 1XGMA 2HAUA 1NKXA 2DLLA 2XRNA 5HPQA 3S9EA 4GLIA 3HYIA 2H27A 1ZGAA 2WC2A 1MZBA 2MA3A 2I4BA 5JHUA 3VDFA 3RN8A 3IOWA 4UVCA 4HF1A 3MVZA 3QPHA 2F6PA 1YIOA 2FBIA 5I56A 3LA7A 3IO6A 5DD8A 3T9XB 1IXHA 4M4GA 4KIGA 4WXHA 4PCQA 3CSBA 4Q30B 1YAEA 3JZJA 1OQGA 1YW9A 2G9WA 3GFMA 3GZ5A 1DPPA 4EJWA 2B3FA 3KGCA 4P9UA 1SD4A 3R60A 1P4XA 4ELQA 2BYVE 4HZFA 2R6GE 1B9JA 4I1DA 4QRZA 3IR1A 3GFJA 5BS6A 4R9FA 1P6RA 3P9IA 3CUQA 4F2QA 1BIBA 3WGGA 3R0AA 2DBBA 3IAZA 1OR7A 1Z05A 1ZU0A 1ANFA 2DAOA 2RC4A 3F3XA 5TP9B 3FATA 3TTLA 3UORA 4K3FA 1I1GA 4LD5A 2IRFG 2M1BA 3N97A 5LBQA 4EM2A 1WWXA 1QW0A 3WAEA 3N6TA 5ITPA 1F4KA 4KUMA 1FQFA 3CUOA 3F6VA 3TYHA 3THIA 3DFGA 4NEDA 4HF0A 5BUUA 3T9VA 3DM0A 4HW8A 3ZQ7A 3JTHA 3O29A 4RB3C 3FGSA 4IRHA 4HCYA 3QK6A 1K78A 3E5UA 2XX7A 3HCQA 4OFLA 1Z1DA 2A6HF 3RPUA 4WEPA 4KYEA 4PGHA 1EV7A 1IN8A 2ZKZA 4OHNA 3BP8A 4GL0A 2HQNA 2L4AA 4PQJA 2I0BA 5AA4B 3LSTA 5L8DA 3BPXA 4S05A 4DNCA 1MM7A 1Y4CA 2Y7PA 3ROUA 5LHIA 1HKQA 2F35A 3HHHA 1SMTA 1ON2A 2E7XA 1V3FA 2K27A 4RK9A 5FHMA 4NF6B 5M2VA 1MJBA 2VOZA 3GUDA 4EVIA 1S9TA 3RI4A 4QSDA 3IORA 5H8HB 4H67A 4RGUA 1USYH 2RVCA 3I4PA 2O7IA 4U0YA 1MY3A 1TTYA 4LB6B 1DUXC 1ZLQA 1MH3A 4JB7A 4GQOA 1LB8A 4KYWA 1SQYA 2KKOA 1J2XA 1SAXA 2F78A 1LJ9A 4NQWA 5ICGA 3K00A 2CO5A 4DZ1A 1XSVA 4HX8A 2H99A 2OZZA 1ODDA 2YX7A 1FC3A 5FD5A 1NMUA 3HUGA 1W5SA 4LUBA 1Z91A 3ZMZA 3UA8A 1SW2A 2FU4A 2AIXA 3I5UA 2RF1A 2Z99A 1GTKA 4FAJA 3C9HA 3H6TA 1D4NA 3I53A 4BAYA 1R1NA 3RIRA 3OEKA 2L01A 2VBYA 4Y15A 3E3KA 1OVTA 4LZ7A 4DXBA 5BWJA 4LQ5A 1B52A 2IP2A 4KQPA 3KFWX 3Q25A 2Z3YA 2H09A 3TTKA 4RXLA 5CJ9A 4FECA 5H8QB 5CBSA 2DP8A 3F11A 2IW5A 4H1XA 3HV1A 4IO5A 3CFXA 3KZGA 1B3LA 3KZYA 1SD6A 3PPPA 4ESJA 3IJXB 1ZAOA 4JK1X 4IB2A 2VE8A 3E6MA 5A2QZ 4LQ2A 4R1HA 3ILTB 2Z5UA 3CG1A 3LQRA 5ED4A 2KJCA 3ML6A 1V4RA 1FYKA 2PJPA 5DEXB 3MCZA 5L9SA 4IO7A 2CWEA 3WTXC 4FIMA 3I59B 5LRRA 1PBPA 4GFRA 3LQQA 4F19A 2O0YA 2HZLA 2TDXA 2JTVA 4AB6A 5AA2A 1Z7ME 2UVJA 2ZNZA 2X7QA 3TAJA 2R9JA 3B73A 3TDUC 2GRVA 1PBQA 1AWCA 3IL2A 2DWIA 4O3MA 2OWTA 2ESNA 1URDA 2HR3A 2DPUA 4UACA 3E5QA 1PB7A 3TUSA 4OIPF 3G3GA 1UFMA 2RC8A 4LGWA 2AS5F 1FTOA 4KICA 2GXBA 5FB2A 1N04A 3R0JA 1D9VA 4OINF 1DPEA 2ADUA 3HOSA 3C4MA 2RKMA 3DKWA 2UZKA 2P5LC 1US5A 3M7GA 4ZYEA 1A04A 1G3WA 3TKYA 2A5TA 4ESBA 4R79A 2YLNA 2CYYA 3H92A 2F8DA 3ZSFA 1B1XA 3FVNA 5DCFA 3DXJF 1MH4A 2G7HA 4KFCA 4Q4ZF 5CRYA 2M8EA 3M3FA 1XCBA 3M8EA 2F2EA 2M5WA 4XBFA 3OV8A 3CFZA 3TQLA 3GF2A 4P11A 2QJEA 1YS6A 2YJPA 2O03A 1MQHA 2RCBA 4O3CA 2MLKA 2Q2CA 4MEXF 3D4CA 4Q0CA 4M71A 1ZG5A 4LK1F 3K6UA 1T39A 5K1YA 3QPTA 2ZMBA 1AMFA 4E70A 4PFWA 4G94A 1B3FA 4G8MA 1B51A 4LLNA 2DK5A 5J8CA 2YX4A 3T8RA 1DP7P 1FQCA 2G29A 2XD2A 4OFOA 2IA2A 1B9NA 1IRFA 2G7UA 4FJPA 3C32A 1IXRC 2DE4A 3IOTA 1JEVA 4XTCQ 2PN6A 1MY1A 2C6YA 2V9VA 3MAJA 5B70A 1XHYA 2VXZA 1ATGA 3R4KA 4IO6A 1OYIA 3JW4A 2H25A 2ANJA 1NL5A 1U8RA 2K86A 5D4SA 1YFHA 2Z9OA 1SDXA 4I02A 4EJUA 3ELKA 3LUYA 1KWHA 4MGRA 4DXCA 2JT1A 2F7CA 1JXSA 2ELHA 1SYIA 3H6WA 2GIVA 4AWXB 2STTA 3K9TA 1ZRCA 3T8TA 2D5WA 2HKOA 5H8NA 2DE2A 5TP9A 5F6FA 3KN3A 2XXHA 1R23A 1JQFA 1NNPA 4LK0F 3FV1A 4G7ZF 2EFQA 1DTGA 4XKRA 1PC3A 3TCGA 4G9YA 1H0MA 1ZIUA 3PD9A 1FTJA 4IGTA 4NF5B 5DT6A 1EZOA 2CG4A 4NTLA 5L3DA 3U9GA 1Y0UA 3E6CC 2F7BA 4EM1A 1HSJA 2VHAA 2XXQA 3N94A 1O7FA 3VOEA 1QKAA 4UHTA 4XRFA 3TFLA 4CZZA 3KP4A 5E1XA 4R2BA 3CJNA 4AVPA 3H6UA 5FO5A 4BXUA 2CW0F 1BC7C 3QAXA 1BIYA 1Y3PA 1FY7A 3OO6A 4TOZA 4G2ZA 5HBCA 3WG9A 1XVXA 4O3BA 3SETA 5I57A 1LGBC 1L3LA 3DP7A 5ICEA 4BNCA 1QPMA 4GXOA 3VVDA 5AA4A 2COMA 1HKTA 1EU8A 5L3EA 2A3SA 2W25A 1DSNA 2K4JA 1N7XA 3T66A 2P6TA 5ICFA 5DD4A 1URSA 3ULQB 3T22A 1S6LA 3LA2A 2EFPA 5J1DA 2EB7A 2P7VB 3TDZC 3G73A 2PX1A 4RB0A 3RPWA 4TV7A 3G3IA 3C18A 4OENA 4BDLA 4M74A 3ECRA 4M72A 1MS7A 4OQOA 4HX7A 1YLFA 5FHNA 4XSXF 4IO2A 4NF8B 2Z23A 3K0VA 4HQEA 3TKDA 1R22A 2X0LA 4G8XA 2DS9A 1J75A 4POXA 3RT8A 2VT3A 1O7LA 2PBIA 3HPIA 1GGGA 4IO4A 3P9CA 2P8TA 4KDPA 4NE4A 4ASNA 4KMFA 2G93A 1R5GA 3G3KA 1B32A 4PE5B 4WX9A 3WGHA 3IOUA 4YAHX 4YKIA 3K0LA 4RYAA 1MG1A 3IC7A 2DOJA 2XUBA 4Z2YA 1A8EA 4ELRA 2OBPA 2VT2A 4A6EA 2Z8FA 2L4MA 1GHCA 4LFUA 3NRVA 4G6DA 5I2KB 2EK5A 5E18F 1MQGA 1Q1KA 3ZMTA 1MJAA 1EH7A 1I6QA 3K01A 2JRTA 2FE3A 4A6DA 3W15C 1O3RA 3RLFE 3J80K 2JPCA 3LSFB 3N4MA 3IKVA 3M8FA 3EHUA 3O6HA 1YW7A 2DW4A 4G8NA 4YMBA 3B6TA 2A6EF 4OERA 2CZLA 1BIAA 1JVXA 5I59A 2PBWA 3UIFA 3S9NC 1IUYA 4BHPA 1SVXB 2Y84A 2R7DA 1A55A 3OEMA 1G3YA 1B6HA 5LGNA 2FA5A 4IHSA 3PGFA 4AB5A 3RGYA 4YICA 2CMOA 2A61A 2EFNA 4L0YB 1FQBA 4F7ZA 1JW4A 4F1YA 1QUIA 3K6WA 2W84A 1OPCA 1T2KA 3N6UA 3K1NA 2ZXJA 3M9AA 1SW1A 2F5FA 1F1ZA 3T5XA 3TOBA 2XXYA 4ZEKA 3T0YA 3GW2A 4IRIA 2DWJA 4OFJA 4AIHA 5H8FA 4G68B 3E6BA 5F64A 5TPAA 3W9VA 2ZO4A 1XCVA 4RK2A 4A0ZA 2MH2A 3SDFA 5CVVA 2XHKA 1OYYA 5DDGA 1MDMA 2D45A 1CGPA 3QUJA 2RDPA 3RTRA 2PEXA 2PMUA 4QFNA 4EQ9A 3M1EA 4PDKA 1Y1MA 1Y3NA 2H5YA 1RI7A 2GA1A 3MFKA 3S9MC 4Y13A 1MY2A 3F23A 3WU1B 2DWAA 3VVEA 1R1TA 4TLLB 1B0LA 1GR2A 3FVGA 3BOQA 2P6SA 3GX4X 3C1DA 4BH9A 3O6GA 5IT9Z 4JQFA 5JTYB 3MVWA 3U1DA 4ESWA 3COAC 1USYE 1J0RA 4H65A 1LBBA 2H6BA 4UVAA 1L5TA 5CMBA 4CGZA 4OETA 3SXYA 2A69F 2ONKE 1R58A 2Z33A 4K2EA 2F5DA 1T38A 1SD3A 4KN4X 1SYHA 3C36A 5L3GA 2IVMA 4YB6A 3F72A 3CRBA 1SW4A 3G3FA 5BOXA 2PQ8A 4ZE9A 1B9MA 4I0BA 3TPAA 2EJRA 5E1ZB 4JXIA 1J59A 5FLXZ 4Q5TA 2O68A 1W5TA 3GZGA 3PUZE 3V8XB 2PLYA 2W85A 1XB4A 4EM0B 2HQ0A 4FEDA 2UVHA 5FHOA 1MPDA 4H0EA 1W7PB 3PQKA 1ZHFA 4NHJA 2NNNA 2VC0A 4HF2A 2QWWA 5AA1A 4UA8A 3KEOA 2V3TA 1R9LA 1TW2A 3K1PA 2FEZA 1JHFA 4MTEA 5LHHA 2VGQA 3T9HB 1XGOA 2DI3A 2JPBA 1UB9A 4C1TA 1JVYA 1XN7A 4HBLA 1R5HA 4WWCA 5ITOA 3LWFA 3R7XA 1B7HA 2GAUA 3H4ZA 2QM3A 1XMAA 4ZYGA 1MD0A 3WODF 1RIOH 4QF9A 4KA4A 1TQIA 1B40A 1H76A 4I0AA 3H3GA 3TOAA 3V8LA 2V3UA 1YQAA 5HS8A 1PB9A 2DQLA 3KN8A 4HCWA 2V25A 3O9PA 3T1BA 4IY5A 1O63A 4FT8A 1I6BA 2OLBA 4EQQA 3KP6A 1S7AA 4S04A 4QFKA 4F1UA 4GD5A 3BFTA 1P2FA 4GVOA 3TCFA 5HDGA 4P0IA 3K02A 4RGXA 1SI0A 1FTMA 4EMSA 4R73A 2QQ9A 1IITA 3SEXA 4HS7A 2UXNA 1HKSA 3EETA 4L0ZB 5ERIA 1G6NA 1RYXA 3L09A 4BHCA 3A3UA 2MH9A 1B59A 4G7HF 2K4BA 2Q0OA 3BJ6A 1D3YA 1LCTA 2AYSA 3DP6A 3TQWA 2Y7WA 3LAPA 5A5XA 5KVRA 5CVUA 1JEUA 2LDUA 2E0SA 2LF7A 1FWZA 4PFYA 2CFXA 1QZZA 1ZREA 2ZFWA 1WDNA 1BLFA 2UXAA 4OU0A 1IN4A 3MZ9A 4QHQA 5DV5A 1SFXA 3SEWA 1FCKA 1YYVA 1CF7B 2P1SA 1NHAA 4KNYA 4F3PA 3WE3A 3PMVA 2DU9A 2Y75A 3BPVA 1M5EA 3FVOA 1LSTA 4GIZA 4KR5A 5BQTA 2VODA 1IN7A 2OA4A 2OZ6A 1USSA 1JNFA 2O84X 1QUJA 3U93A 4KYSA 5L9MA 3CIJA 5KCJB 3HSTA 1SD5A 3Q27A 3QAHA 1B7ZA 4L5IA 4KYDA 3FHZA 4WCGA 2I49A 5L3CA 2VD3A 2M8CA 2IT0A 3EHSA 4XSZF 2HEOA 5ILUA 5I2NB 4L5JA 1MXVA 3I0TA 2XXPA 2LF8A 1B5JA 3TO6A 3K2DA 4GL8A 5I2KA 4AIJA 4B09A 3J81K 4KCDA 4DE8A 3SKPA 2E1NA 4IPAA 3IJOB 4ZECA 2FF4A 5K5RA 1P1OA 2HKXA 3P7IA 3FM3A 5HDKA 3M3KA 4EQ7A 1HBXG 3IO4A 2QLZA 1EH6A 1CB6A 2F36A 3CG3A 3HN0A 5F1QA 4Q5SF 3CSGA 4N0BA 3UK4A 3IHUA 3KZZA 2OZUA 1KU7A 2VOOA 2DXYA 5HVQC 4PGGA 4IVNA 1P92A 2B65A 4IRGA 4FX4A 4H8IA 2IEEA 2BGCA 4HDUA 1ZLJA 2CSOA 2L02A 4U0VA 1TXFA 2WTEA 2DT5A 4OIQF 1FT9A 5DCMA 1OYWA 3CO7C 3MPLA 2Q88A 3GVAA 1ONVA 3KOTA 1A8FA 3QIMA 1W7PD 4HA8A 2ZYNA 3WTSC 2XXTA 3IB2A 4N07A 4XXUA 3FF5A 1LDDA 3CLOA 3L6HA 1B7UA 4U23A 3QU6A 1GXPA 1QULA 1ZKBA 4LG0B 2HS5A 1A7LA 3QXMA 4R6HA 1HW5A 1P1UA 2LAOA 3IK6B 2MLGA 4NB5A 1OIBA 5D5WB 3FXQA 1D5VA 4KPTA 3SQNA 4EJTA 2EA4A 4EXKA 1US4A 4UV8A 5JI6A 3MPKA 2P5VA 2YSRA 2KIFA 1MQDA 1P4AA 4P96A 1TW3A 1DPUA 1A99A 5D6EA 1O64A 2RINA 5CYVA 2KRFA 3EYYA 1FLIA 4ZZDA 5HLIA 1MPCA 1H44A 1U5TA 3FWEA 3LSXA 4HAMA 1FTLA 1PB8A 3T93B 3B6WA 4ZEDA 3HO7A 3ZMVA 5E8GA 2O61A 4I01A 2QQBA 3NEUA 3FXUA 2STWA 3MZ1A 4WXJA 2BV6A 4YFKF 1YCJA 2UWMA 3RJPA 2DXRA 3FZVA 4Y17A 3E13X 2PFBA 2F5XA 3EQ1A 5CMCA 3MP1A 1M5DA 3CR9A 4NF4A 2GA2A 4CICA 1H3DA 1MXUA 1VFEA 1XSDA 4HYEA 1I5ZA 2XROA 2B0LA 3DPLC 2HZTA 1TNSA 2KIUA 2RC9A 3KBRA 2MD5A 2DK8A 4F22A 2EV6A 1J5YA 1YW8A 3EYIA 1UTBB 3S4UA 1MDQA 2O6AA 3OO9A 4H5GA 3TO9A 2OQRA 3U2RA 2VD2A 4LLLA 5KK1A 1QGPA 1BC8C 3GWZA 2DE3A 3F21A 1FW0A 5ILVA 1F9NA 3VE1B 1TFAA 2ONRA 2EWNA 4R2FA 2IA4A 2O7UA 4HLYA 4X9TA 2XAJA 2PT1A 5CVJA 1OLCA 3L00A 5K2YA 3SHFA 1BI0A 1UIVA 3BZ6A 1URGA 3F8MA 4MQVA 4EF1A 2Q2EA 2AL4A 2MBFA 2ACJA 4BDQA 3O6BB 3HRMA 4ZS9A 1ZH5A 5ICQA 1BKAA 4OVJA 4MEYF 3V89B 1X3UA 3GFIA 3U1OA 3Q29A 3F8CA 1PP8F 5D6FA 3LR1A 1FTKA 2IA1A 1LAGE 2Q8JA 2YPRA 2D3IA 3LBSA 3A09A 4N9HA 4BDOA 3I64A 4FEBA 2OD5A 3VV5A 5KDTB 1MY0A 2O51A 4CYDA 1MXXA 1LBCA 1W4MA 2XXXA 3W6KB 1G3TA 2FBKA 1KU2A 2WWYA 2PMSA 2PVUA 4IY6A 1D9YA 1U5TC 2FNCA 4ND9A 4M9SA 2EV0A 4XKQA 4JSDA 1WODA 3QYTA 2KLFA 3S2VA 1ON1A 2HEUA 3B6QA 2O1MA 5E20A 5EYFA 4QWQA 4GYGA 5EEGA 1UTHB 1LAXA 3DP4A 2A68F 1KQ8A 3MAMA 3PPNA 2F5CA 4OMZA 5A2QK 2F7AA 5L9OA 2AL5A 2FA7A 1JHHA 1FZPB 3VLUA 1FOKA 3V7CA 2V3QA 3O66A 3I5OA 1DDNA 3O28A 5JK4A 4GF8A 2PT2A 1BBYA 3FV2A 2CQKA 1WKMA 1Q35A 2L3DA 1JETA 1Z6RA 3HSEA 3IX1A 3V8KA 5I56B 1FSHA 1K6OA 4RNSA 4IXAA 1KYZA 3TZAA 3GZ6A 5LLQA 4LB5A 5DVFA 1J9IA 4LVQA 3RQTA 4RGSA 2UVIA 3B02A 5H8SA 5CM6A 2R7FA 1FPQA 4ZH4F 1SD7A 3EF7A 3BKIB 1VFDA 3RKWA 2HTSA 1JW1A 2QMWA 1XDUA 4IHTA 4NF6A 3GO5A 1TWYA 5CLSA 2FMLA 2Z8EA 5H8HA 4M9ZA 5HLHA 3JAMZ 3FVKA 3D4GA 1IXSB 1BP5A 3PPRA 4F18A 3BROA 1IIWA 3A3CA 3CUQB 3M8UA 3HHGA 2HXWA 2X7PA 1ZG1A 3DV8A 2XHDA 1LFGA 4GOTA 5D4RA 3R26A 2DO7A 1LLSA 4BDNA 2XASA 2NS0A 4U21A 4OMBA 1ZLKA 5TJJA 1N76A 3I54A 4MHGA 1BOAA 3MQ0A 1MRPA 1Q1HA 2DQVA 3G7WA 3RYRA 3O97A 4H8JA 1N3WA 4HV6A 3JTGA 2F6GA 1HSEA 4Q47A 4P55A 1B3EA 3VVFA 5J8FA 5CMKA 2XD3A 4WF2A 2XV4S 5HOOA 2WKYA 3WTZA 2FRHA 4E0WA 2VBZA 2K7LA 2ZYMA 4I8CA 3W6JB 1K78B 3P9KA 4UVBA 4ZZEA 5JR3A 1P4WA 2A5SA 4MBPA 1XGNA 5H8QA 3IRRA 5AONA 4O3AA 4DDDA 3MW0A 2DTRA 3DP8A 1JE8A 3MP8A 4F3BA 3I3VA 2REGA 2RN7A 1DPRA 3BWGA 1SFEA 3MVXA 3TTNA 5D5XB 4MQ9F 3CFLA 2V1XA 1SBPA 2R3SA 2VE9A 1XGSA 3TMGA 3K6VA 4XLNF 4X1BA 2ZXTA 5LOMA 4F31B 4RY1A 4IO3A 2RV8A 1ZBMA 5HDNA 2M87A 3UGWA 4MLVA 1KGSA 5DEXA 2Y7RA 1TLHB 2QYOA 4JWYA 1FP2A 4M9XA 1QBJA 4OYVA 5EHMA 3KLOA 5AIQA 2FNAA 2QBYB 3I59A 3H03A 3KG2A 3BY6A 5L3BA 4C1UA 2F97A 4QSEA 3LA3A 3J7AO 2DVZA 2QQAA 4YKKA 2QUFA 1NNKA 3JV9A 1YO5C 3ABUA 3VEPA 2NWJA 2VN2A 1A54A 1DMBA 3ZP5A 1A40A 1H9GA 4AD9A 1F5TA 1QQIA 1Y4TA 4R75A 3C7JA 2J5PA 4LATA 4KIBA 1YG2A 2BEOA 1QVSA 4UNOA 2DPDA 6PAXA 3MP6A 1NNTA 2EFOA 2B3BA 3I58A 4WXDA 1PDNC 2P4WA 4WKMA 1B4HA 2HDCA 5EEHA 3IOVA 1QO0D 1O3TA 2P5KA 2F5EA 4YZZA 4KIFA 3QP5A 5JFRA 5E8IA 3KJ7A 3ZN1A 5E1WA 4RPOA 4JBAA 5FTIA 3U8QA 1ZYRF 3KE2A 3F8FA 5HS7A 1TFDA 1ELJA 1ZTYA 3OELA 3ZKKA 1TT1A 3UP9A 4OIRF 3K6XA 2PMHA 1KU3A 1OMPA 4IGRA 5ICCA 4LA9A 4GGGA 1TNTA 1T0KA 3VXCA 3KSJA 2EA2A 1BI2A 2GXGA 4EJVA 2M30A 5BMZA 4R9GA 2O69A 2JSCA 4LZ5A 1TQMA 3PMXA 2ZCWA 2NUVA 5FFXA 1ZARA 3TO7A 2M45A 3ERED 2I0CA 3E5XA 1E17A 4RAZA 1B0HA 4LZ8A 3P7NA 2Y48A 3MZYA 1R1VA 4YB7A 5AA2B 3IWFA 3OSRA 4OMYA 3SERA 5K5OA 3MC2A 1BI3A 2KJBA 1GXQA 4LLGF 3L2CA 3RT6B 1I27A 4H6DA 2XX9A 3HIFA 1RNLA 4CHUA 4EGZA 1KU9A 3ECHA 1HSTA 3U94A 5FD6A 2J5OA 1ZRFA 3PUWE 4LONB 1OKRA 3KETA 4ETSA 4YIIA 4DXUA 1ZGJA 1KYWA 4I9DA 1XC1A 4G6QA 1I69A 4YMAA 3CI8A 3B7DA 3VLVA 3L9FA 4YFNF 4THIA 3HSFA 1MM6A 4YKJA 4I09A 2I3WA 3LC8A 2REJA 1M5CA 2HGCA 2W24A 1S50A 2ABHA 4OZ9A 4WEDA 2H4IA 1M5BA 3VLWA 2DFIA 2ZNTA 3PUYE 2HWVA 4NF5A 1QZYA 1P1NA 3DPTA 3MQ9A 1WQ2A 1RZ4A 4HQMA 2D1VA 1S7OA 1N84A 4ZYDA 1STZA 1O3QA 4XIGQ 4EDPA 2R71A 3TQNA 4M6YA 1UIUA 5TU0A 1LAFE 5D8LB 2VONA 4P9FA 1IEJA 2HCAA 1GVJA 3M3LA 4AIKA 4TLMB 5J6XA 5CVIA 4L9VA 4KI0E 4F39A 1Z6TA 2BE5F 3CO6C 5ICTA 4UXNA 2BBYA 3ABTA 4R8HA 5DEQA 3QUFA 3REOA 2ZNYA 4ENMA 1GV8A 2W7YA 4ON0A 1OVBA 4KD5A 1S3JA 2I3VA 1WRJA 4YKPA 3C31A 4P5OA 1AOVA 2HTJA 3G3JA 3VB2A 4U4SA 3I71A 2GWRA 5AE4A 3FUZA 3SEUA 1CE2A 5FFZA 3V83A 3ZMUA 1S7YA 3MVYA 1AL3A 2LSOA 2GHBA 4A0XA 5D5UB 3FJ7A 1FNNA 2A07F 1SMYF 4G8HA 4G4PA 3D5LA 1MPBA 4U7DA 4TQUQ 5L3FA 4ENJA 3C35A 2NNYA 4M1VA 3U72A 4NF8A 3KCCA 4GXAA 3HOTA 5H8NB 5LGUA 3R6SA 2OU2A 3SEVA 1B46A 3E4RA 3V7RA 3OOAA 5H20A 5K5QA 1LQ1A 1P1WA 3EUHA 2QS3A 4EF2A 2X4HA 3WTYC 2UYEA 1I6AA 2E1SA 3F6OA 4HV5A 3MJNA 3RTFB 4RGRA 3KEIA 1JW5A 1ZMGA 2XXVA 1T0FA 1RUNA 2A5YB 4UV9A 1B05A 1YS7A 3LAJA 2DVCA 1IN5A 2DWHA 3GXOA 3LSWA 1B4ZA 1VE4A 5IT9K 2Q9TA 3KP3A 3PMWA 5I57B 2UXXA 4U4XA 2HQRA 4QLCU 1O57A 4IJAA 1YTYA 3H7MA 3PPOA 1P99A 2NYXA 1WVJA 2XVCA 3R61A 3CDHA 4RPNA 5I84A 4I2OA 2E1CA 2XAGA 3F8NA 1YTVA 3VFJA 2Y0MA 3V8JA 2DYXA 1PUEE 1R7JA 2XXUA 3KOSA 5IKBA 3N5LA 3V5AA 1JGSA 1UCRA 1PEBA 3SFZA 1QNTA 5AA2D 1B1BA 2ZNUA 3OD7A 2V1UA 4ESXA 3T96B 5FLXK 2O1LA 1D8JA 3ZS6A 4C0RA 2ALUA 2QBYA 4FORA 1MJ9A 2Q2AA 3WE2A 2FQ3A 5DYMA 3OMBA 3FJGA 5JEIA 4CO8A 4ISUA 2MC3A 2FMYA 3V4GA 4KCCA 5CC2A 2HFHA 3OO8A 3KN7A 2Q8KA 1R36A 1BTJA 2Y7KA 3MWBA 1N3XA 3TCHA 1QUKA 4OESA 2RKHA 2FXAA 2PYYA 4FE8A 1IAWA 1DTZA 1S8NA 2H6CA 2OAZA 2PG4A 3IWZA 4G68A 2XXRA 5CBRA 2I58A 4N9IA 3CUQC 1Y1ZA 4DIGA 3JSOA 1F9BA 1O7TA 4RA1A 3ISPA 2VBXA 3FMRA 1O3SA 5TRDA 3HHFA 4OWDA 1IXGA 3FMSA 1LAHE 1QKBA 1M5FA 2PI0A 3IRQA 2FBHA 2THIA 3K69A 2Z8DA 4PP0A
chains in the Genus database with same CATH superfamily
1FTTA 1U78A 1BN5A 1IZ1A 4Z0IA 4EV0A 2HVRA 4QFOA 2MFZA 1KA8A 2VJ5A 3TGNA 1MY4A 4GRKA 3RTWB 4B3XA 2XAHA 2VQCA 4HX4A 5J1YA 2CMPA 4AC0A 3VYSB 1IDZA 5KZTA 1ITYA 5D5VB 3TEPA 1K79A 1AOYA 3E0JB 2LY2A 1NH7A 2NXOA 4FQGA 2IAIA 2OV7A 3GLBA 4NMYA 2VP1A 3F8BA 1RKTA 4PK4A 2DA4A 1R71A 2FJ1A 2XKOA 5B1AH 2XXWA 3I6VA 4EUOA 1IUDA 4FATA 2PJRA 5I59B 1XX5A 2E1MC 3ZCOA 2BW3A 1J7KA 1EH8A 1GLNA 2HPIA 2L5QA 2EV5A 2K02A 4ZZLA 5LFAA 3HRSA 5JVTA 3DELB 4ELPA 1OLAA 2LNBA 4F2OA 5JTYA 3H36A 3TTKA 2DJNA 3K1MA 4QFLA 3TELA 2OK2A 1VQLI 2V93A 3EUKL 1TWHJ 1B5HA 2FX0A 4RBOA 3H9GA 4DJAA 1Z7NE 2ZNSA 4QFPA 1ZTRA 3FDYA 1BM9A 1AHDP 2X85A 3Q28A 4CZCA 3S2WA 1HSLA 1X58A 1UZCA 1TZLA 4IGRA 2F4IA 1Z3XA 4KMUX 4KN7X 2FOKA 2DQRA 3OYJA 4IHVA 4PCDA 2RC7A 1B4AA 5IZ3A 3ILUB 3KP5A 4XLPF 1H9TA 1LEAA 4O94A 5IAIA 2DSFA 4GCVA 3BG5A 4HDVA 3C2BA 4NC6A 2GBYA 3QOPA 4L9NA 4UUSA 3GXAA 4HXVA 3PFIA 2I4CA 5IZ1A 1Y56A 1FBUA 3RYPA 4W1UA 1XVYA 2JRMA 3FX3A 2F6CA 4GYIA 5H8FB 5TPAB 3GYHX 1LCFA 4Z7EA 1XS5A 3SEYA 3A1YA 2E60A 4FBPA 4AS4A 3OIQA 2OQGA 3MWMA 3O2AA 1U6GA 2F5VA 3KEYA 4A3MJ 1BL0A 1R1UA 4U88A 1XOCA 1MDMB 1C0WA 2HOTA 5IPAA 4M73A 5EZHA 4R6KA 1MXZA 2JJ7A 4MLQA 2HZKA 1W7PA 2BOLA 2LR8A 5I58B 1S29A 2CZKA 4PGPA 1LFBA 3OOPA 2NAZA 2GQQA 4BQAA 1VQ6I 2FSWA 4LJZF 5JLWA 4LIUA 2W48A 4WXCA 1NFTA 1VR5A 3KN3A 4U22A 4DLDA 2OTJI 2ZJ2A 2NVUB 1FYLA 3MEXA 3DF8A 4CXFA 2A5WA 4BEHA 5J1RA 2CUEA 1Z9CA 4L9TA 2XAQA 2OCUA 4HLXA 3TW7A 4DQ2A 4OOIA 1FBGA 3KP2A 1REPC 4N17A 4NWCA 3LFKA 4PETA 4ZYAA 3IB1A 2MGQA 4G68C 2V79A 5GADJ 3DPUA 3DEUA 2ZC2A 4BDZA 1LKXA 2NOOA 3LSMA 4N6PA 1HQCA 3MN2A 3JSPA 3C34A 1FSEA 4R6YA 1HDPA 2V6CA 3MZBA 1POTA 2P81A 3T0JA 3U92A 4BY1J 4I62A 4A3KJ 3BJOA 4JWOA 5A5LA 4FE4A 3JYRA 3BCBA 3RPQA 4KHZE 2CQNA 1LVAA 1W36D 3PUVE 2XB5A 3WTWC 1T0KA 2HZDA 3QPSA 4A12A 1RKMA 2ZMEB 3F22A 3DU5A 2JN6A 4A0YA 4FCYA 5F1RA 3MUQA 1XT8A 1N75A 1RPWA 1Y8QB 2MG4A 2OCEA 5CMMA 1QU3A 2XB0X 2ZZWA 3L6GA 4PDDA 4QSCA 1IMAA 1AIVA 2XKPA 1A6IA 4YG2F 5HS9A 3KBZA 1VQPI 2OWTA 4KFQA 4HSTA 1RUOA 2QS1A 3J80Z 2QRYA 4WK8F 3WTVC 1YITI 3K6GA 2VASA 2Z22A 3FIRA 3RQIA 2ONSA 2HFBA 1MBFA 4MJOA 4EXLA 1HXDA 3OO7A 1FBQA 4U7BA 2E71A 1SFUA 2X9DA 2ESHA 5AIPA 2CGPA 2WV0A 1EZ9A 3K2ZA 1H43A 2R8TA 3L2WA 3GBBA 4JBZA 4ENNA 5FTHA 1OMIA 2ZBKA 1B8IA 3T9UA 3TDJA 3Q9SA 2M0MA 4Q48A 3ZQCA 3HZJA 1DOTA 5LDZA 2X6WA 5FRMA 4HNUA 3A01A 1B3GA 5FKOA 4BXFA 3QP6A 1LDKB 3WU0A 3OYLA 4GO1A 4QIWN 4JWXA 5IT3A 5M5YJ 1II5A 5HLGA 4MTDA 4GWOA 4AQ4A 2L54A 2P0SA 3RDIA 1FPKA 5DTBA 3RKYA 3HGYA 2QZ8A 5H6QA 1B5IA 2H98A 4Y4RA 2DA3A 3E6DA 5CKTA 2EFWA 2FNPA 5HNHA 1HDDC 3SESA 3BFUA 1UQWA 4F3SA 4HW0A 1CF7A 5K2XA 4RB1A 5BPDA 1RYOA 1FEXA 5FGMA 2H9BA 3E97A 4X48A 5DVJA 4XKCA 1WPKA 5FKKA 4CDGA 3ABLH 3WTTC 3H06B 4IR8A 2O8XA 4Y52J 1UHMA 3OS0A 2D2WA 2KHMA 5GTHC 4B8XA 2XF5A 3C33A 1MKMA 1FQAA 2RCAA 3IKTA 2VC1A 1T08B 4J00A 4A2UA 2UVGA 2H1LA 1D8KA 1T98A 3Q5FA 3ZQIA 3E7LA 3GLXA 5BPIA 5KCJA 5CVRA 1I6HJ 3LSLA 3GTQJ 4R72A 3J7AY 4ONYA 2GH9A 1T6SA 2R93J 1ACIA 3U65A 1FX7A 3E3VA 2ETHA 1XSXA 4RMNA 1SW5A 3H6VA 3O6IA 2OJTA 4XKNA 3GTPJ 2L7ZA 3ZMSA 2CFOA 5IZZA 1N0TA 3WTUC 4NF0A 2CQ7A 2K40A 2MSYA 4BLAA 1WSUA 1VQ5I 1POY1 3DEEA 1YYZA 1JGGA 4DYRA 4BL0B 2VQGA 3S9LC 1H45A 5I2NA 2VOPA 4M6XA 3RKXA 5E3LA 2QENA 1VSOA 5EHSA 1UG2A 1JTYA 1GVDA 2Y7IA 1ETKA 2LFBA 3MZHA 3H3UA 4RAFA 1PP7U 2V84A 4L17A 3OS1A 3BJAA 1NV2A 2YR2A 3HTSB 3D1RA 3V7SA 4PFUA 3HFUA 5LHGA 2Y0SN 4FETA 1Q9DA 3KLNA 1HW1A 3TL4X 2O6GE 3QYEA 3KC1A 3SZTA 4BDRA 4AIDA 5DUIA 4EJOA 5C4JJ 2ISZA 1LB9A 1MXYA 1LDJA 3ZKLA 1MDP1 2GIZA 4RAYA 1NV7A 5EG0A 2GFEA 3MKYB 5A5XB 2D1HA 4ENKA 2IGKA 2R5ZB 2XGCA 4C30A 3NWSA 2XX8A 4CCKA 4X1DA 2LC2A 4ESFA 3CQZJ 5EF6A 5LEKA 3FJMA 3Q26A 2V1DA 3HRUA 5M5XJ 1A35A 4FX0A 3CCSI 1LVKA 1K7AA 4PF8A 1IRGA 1RETA 2D5VA 2GZWA 2R92J 2W57A 2IA0A 2LK2A 2EZIA 4XK4A 2V6EA 3TTMA 1G3SA 3IFAA 3ZOBA 4X6AJ 3TTRA 2HOEA 4RDUA 4ABZA 1PDAA 3PD8A 5F7VA 3RQ4A 1OQYA 4MIMA 4H0WA 2RNGA 3KP7A 3QU3A 2JA2A 5HM4B 1Y0NA 3KEQA 1LBYA 1MQJA 2W00A 1J1NA 5D8KB 2JA5J 1NNFA 3L7WA 3CCQI 2HNHA 3O3KA 4RM3A 2MD0A 2P2AA 1ORKA 4B44A 3VFZA 1B6AA 4ZDLA 4C3IJ 1NH8A 2IJLA 3EHTA 2HDDA 4IF4A 2HAVA 2QL3A 3G3HA 3GBAA 3DTKA 4MEVA 4ZEBA 4OEUA 2RQPA 3ODBA 2F3DA 3KFMA 3RPLA 4JSOA 3EPEA 5DW8A 4LMYA 4N13A 3AFHA 4BHBA 1YRNA 3HEFA 3FK6A 2NRAC 4H4KC 3OENA 1USTA 2HU9A 4L9JA 5GAGJ 5LGTA 5ISUA 1B72A 2JSPA 1EZPA 5J16A 2X26A 3BR1A 4MFEA 3VPRA 3FD3A 1LB2A 3LMMA 1FPDA 1R9QA 2Y9ZA 2R7SA 3AAFA 1ENHA 1OQHA 2F3BA 2D21A 4LG0A 4A69C 4PFBA 2RGVA 5H2FC 1ZG3A 4EQBA 2O7OA 1TWFJ 3K10A 3DLNA 3OSQA 5LEJA 2I6EA 4HTGA 2DA5A 2OWSA 3KSXA 3KC0A 3O2PE 5EQ7A 1XS9A 3VODA 2ISYA 3HRTA 4AVZA 1MGTA 5E17F 2XXIA 1D5YA 3HSRA 3PU5A 2LBFA 1KA1A 2QPQA 3LV0A 4MNIA 4FHTA 3S3OA 4ZEFA 4DI4B 4L18B 1Y3QA 2O3FA 1B2HA 3CVGA 4E0XA 4GDFA 2XGXA 3PQJA 2K9NA 5DVIA 1HA8A 4HE2A 2QS2A 2YU3A 1BW5A 1IQ7A 3FM5A 5B7DA 3HB9A 4PFPA 4HOBA 4OAYA 1B58A 1XD7A 2RNJA 3PPQA 4P0GA 5EQ8A 1ZRDA 3AG2H 2O8KA 5JLXA 3OYAA 3RY3A 1W36C 2HYFA 2I48A 2QSXA 2UYFA 3ONMA 2LY9A 2XIGA 1IXIA 4A3IJ 1XG1A 2CZIA 1I6XA 3HBLA 3EQLF 2QVOA 1ZN2A 3CDLA 3UNGC 3AG4H 2R4GA 1TQPA 4O6JA 4DBRA 3E9XA 3AG3H 2L0KA 5LRSA 3N26A 1ULYA 3M07A 2KIMA 4JX4A 4RJZA 1QJMA 4YU0A 2LKPA 5DCMB 1NG7A 4BQOA 4I98B 3ZPLA 4PZJA 3GEZA 4PFRA 4U1OA 3D0SA 1U9NA 1G4DA 3OWTA 1U2WA 5H6RA 3HTUA 5EEAA 3PIOF 3QRFF 2QS4A 3Q9VA 2VPNA 2ZXHA 2BJJX 2Q1ZB 2ZYOA 5DYHA 1I1SA 1LNWA 2P7CB 4MH5A 2XGDA 4ZE8A 1GV5A 4YFXF 1OCTC 3ZN0A 2LVSA 3OR1C 4MNUA 2FYIA 4GXSB 4YIFA 4E4HA 4EGYA 3BBRA 3CESA 2F34A 3MSTA 3EDPA 3PUXE 3BTCA 1TBXA 2CV0A 2UUZA 5IYDJ 3DQVC 3ECOA 4OXVA 3I3LA 4DZPA 3LFUA 5K7ZA 3JREA 1MXWA 1P1QA 2Q89A 1VTNC 4XKPA 2E7WA 2AXLA 1MSFC 4ELOA 1N7WA 2CUFA 4LP2B 2WYPA 5FKMA 3TMOA 3ZMDA 5I58A 1FBSA 4MFIA 3K4NA 1GVCA 1Y39A 1IW7F 1UTBA 1R6ZA 5DUKA 3TODA 4PFOA 1PUFA 4MF3A 4XFEA 1Y9UA 1Z7UA 1WI9A 2BVMA 2OF7A 4A5MA 4F91B 4G7OF 4I7HA 1QHHD 2OUMA 4F3GA 4D0PA 4GWUA 3HPGA 1XMKA 2K85A 4B3AA 1EH3A 2DMTA 3MBPA 1LFIA 3R6UA 1KQ9A 2X51A 4R74A 1D1BA 4A5NA 1Y20A 4H45A 1IXCA 3IH2A 4F29A 5I7IA 3JAMK 1MQIA 2XAFA 2OBGA 1E2XA 2KQZA 5F27A 3EN3A 2EILH 2EZHA 2MW8A 3SZPA 1IN6A 3K4UA 4ZYHA 1FBCA 5IYBJ 3USDA 1Y6IA 1LEBA 3G3ZA 2H94A 1YPNA 3QSLA 2ZMEA 3WAFA 1L0OC 2I8DA 1U5TB 1FBEA 4H5FA 4BYYA 4U2RA 4GBWA 1WI3A 4OEVA 4F1VA 1TP4A 1XDSA 5K7FA 3J81Z 2B4MA 2A05A 3MD2A 4ZC3A 1OCRH 2YPNA 3IL1B 3RUMA 1FBHA 1SANA 4AYBN 2GHAA 4P56A 4BDMA 1Z0XA 4G77A 3WGIA 4ZEIA 1FQDA 3OYEA 4V19K 4ZDMA 1ZJLA 3OXNA 3LNQA 3VSLA 4CH7A 1FYMA 2X1EA 1G59A 1Q1VA 4RS8A 2ZYKA 1AH5A 3IB0A 4Q8RA 2Y31A 2IPQX 5KHDA 1BR4A 2JZYA 1SVMA 4HSRA 5TGTA 2VBWA 4ZJZA 2B4LA 3KJTA 3BDDA 1KQ0A 1UHWA 4OIOF 4KT5C 2M4GA 1SI1A 3P5JA 1SPIA 5AA3A 4N8GA 5KDTA 4RB2C 1X1AA 4NF4B 3A0HC 1U3EM 3S8PA 5IP6A 4U0WA 1B3HA 2A5TB 3ZQGA 3PV0E 1BJAA 2O9LA 1B1HA 3AXFA 2QMXA 1BI1A 2HYGD 3CCRI 1S5LC 4RAGA 2GM4A 2OTLI 2KL4A 1D3KA 3CP2A 3FMQA 3GFLA 3GCMA 3NQOA 3H3ZA 4O5VA 3UN6A 2MC4A 4NWDA 4ZZAA 3RNNA 4POWA 1NV5A 3FASA 4U1ZA 4HEA2 4DCYA 3JRFA 1R00A 1UTHA 1YX5A 3FXRA 4OTEA 1FP1D 4YB5A 2BHYA 2R7WA 4ECFA 1HW2A 2ZJPF 1SFOJ 4JDFA 4DCXA 4UUVA 4N4NB 1ETOA 3E79A 3CTAA 1NV1A 1FQEA 3W9WA 5ELVA 1IF1A 3C3WA 5ILSA 1XGMA 1BOBA 2HAUA 1NKXA 2XPUA 3L1PA 4C2TA 1I3AA 2L7KA 3B50A 3QOEA 1F43A 2DLLA 2XRNA 5HPQA 3S9EA 1NH3A 4GLIA 3HYIA 2H27A 2QKMB 1ZGAA 2Y0SA 2WC2A 1MZBA 2MA3A 2I4BA 3KZIC 5JHUA 3FKIJ 3VDFA 2DT6A 2H8RA 3RN8A 1MW7A 3IOWA 4UVCA 4HF1A 2AHQA 3MVZA 3QPHA 2M0CA 1YIOA 2FBIA 2F6PA 5I56A 3LA7A 3IO6A 1BR1A 5DD8A 4PC9A 3T9XB 1IXHA 4M4GA 4KIGA 4WXHA 4PCQA 3CSBA 4Q30B 1YAEA 3JZJA 1OQGA 1YW9A 2G9WA 3GFMA 3GZ5A 4DBQA 4EJWA 1DPPA 2B3FA 2MKZA 4JVCA 4DGWB 4P9UA 1SD4A 2MABA 1MMSA 3M4OJ 3KGCA 3R60A 1KZ8A 4X8RA 1P4XA 2KPMA 2BYVE 4HZFA 2R6GE 3GMEA 4IOAF 1B9JA 4HE0A 4ELQA 4I1DA 4QRZA 3OS2A 3IR1A 3GFJA 1SVLA 5BS6A 3W6VA 4R9FA 1P6RA 1ETQA 2EIKH 3P9IA 3WU2C 2FHYA 3CUQA 4M3DA 1BIBA 4N4UA 4F2QA 3WGGA 1UELB 2JVHA 2ZMEC 3R0AA 1IRZA 2DBBA 1NK2P 1OR7A 1Z05A 1ZU0A 3IAZA 1ANFA 4P47A 2DAOA 2LG4A 2RC4A 3F3XA 5TP9B 3FATA 3TTLA 3UORA 4XLAA 3F0CA 3U1KA 2GOXB 4HNTA 4PTKA 4K3FA 4XF5A 1I1GA 1FPFA 4LD5A 2IRFG 2M1BA 4NC7A 4P1EA 4JYKA 3N97A 5LBQA 4EM2A 2QSFX 1WWXA 1QW0A 4N6KA 3WAEA 2L7FP 3N6TA 5ITPA 1F4KA 4KUMA 1FQFA 3ABKH 3CUOA 3K4KA 3TYHA 3HOVJ 3THIA 3K2AA 3DFGA 4NEDA 5I56B 5E79C 4HF0A 4DIQA 5BUUA 3T9VA 3DM0A 4HW8A 3ZQ7A 3JTHA 3O29A 1RDZA 4XONA 4RB3C 4IRHA 3FGSA 4HCYA 2COBA 3QK6A 4CYCA 3I4MJ 1K78A 3E5UA 2XX7A 3FK7A 3HCQA 1Z1DA 2A6HF 3MMYB 3PNYA 3RPUA 4OFLA 4WEPA 5I3SA 4KYEA 4PGHA 1EV7A 2DMUA 4RA2A 1T95A 1IN8A 2M8GX 2ZKZA 3K4JA 3PFYA 4OHNA 4E7HA 4C9YA 3BP8A 4NX1A 4GL0A 2HQNA 2L4AA 4PQJA 2I0BA 5AA4B 3LSTA 2KZGA 5L8DA 2ZB9A 2KFDA 2L9VA 3BPXA 4II2A 2ZFUA 4S05A 4DNCA 1MM7A 1Y4CA 2Y7PA 3ROUA 5LHIA 1HKQA 2F35A 5LTCA 1TT0A 3HHHA 1SMTA 4IL6C 2XF6A 1ON2A 2E7XA 3CCLI 3OYKA 2H1KA 1V3FA 2K27A 4RK9A 3IAS2 5FHMA 2ZSIB 2FBPA 4NF6B 2Y30A 1MJBA 2VOZA 3GUDA 4EVIA 1S9TA 3RI4A 4QSDA 2IGOA 3IORA 5H8HB 4H67A 2R7OA 4RGUA 3H0DA 1USYH 4RM2A 2RVCA 3I4PA 3S3NA 2O7IA 4U0YA 4HG2A 3MZ8A 1MY3A 1TTYA 2ECBA 4LB6B 1DUXC 1ZLQA 1MH3A 5E3OA 1JT6A 4JB7A 4GQOA 1LB8A 4KYWA 1SQYA 2KKOA 5EQ9A 1J2XA 1SAXA 2F78A 1LJ9A 4NQWA 5F0CA 5ICGA 3B6CA 3ONQA 2CO5A 3FXJA 3K00A 4S0HB 4DZ1A 1XSVA 5EYHA 4HX8A 2H99A 2I5UA 1ZGWA 3KPHA 5EGOA 4ITVA 5K7HA 2OZZA 1Y8RB 1ODDA 2DMNA 2YX7A 3BTIA 1FC3A 3ZXSA 5FD5A 5J1UA 1NMUA 2WB1A 3HUGA 4KT6A 1NTCA 3ABMH 1HCRA 1W5SA 1K9YA 4LUBA 3FHNA 1Z91A 3ZMZA 4BDYA 1MBKA 3UA8A 1SW2A 2CQQA 2FU4A 1NUZA 2AIXA 1ZQ3P 3I5UA 1HOMA 2Z99A 2RF1A 1GTKA 4YELA 4FAJA 1JKOC 2VKDA 3C9HA 3H6TA 1D4NA 3BC8A 3I53A 4BAYA 4YRVA 1G2HA 1R1NA 3RIRA 3OEKA 2L01A 1P9QC 2M7AA 1OR7C 2VBYA 4Y15A 1OVTA 3E3KA 4LZ7A 4PE3A 4DXBA 2E2HJ 2X48A 5BWJA 4LQ5A 2CV1A 4E7IA 2IP2A 4A3FJ 1B52A 3KFWX 3Q25A 2RQQA 2Z3YA 1DQUA 2H09A 3GTMJ 3ERMA 2DDAA 2VI6A 5CJ9A 4A3GJ 1WH5A 4FECA 2DP8A 3F11A 4RXLA 5H8QB 5CBSA 2IW5A 4JP0A 1WGXA 3HV1A 4H1XA 4IO5A 4YEJA 3MYUA 1MBHA 3D5SC 2BXYA 3CFXA 3KZGA 3DTEA 4IQ4A 3X2QH 3CMEI 1B3LA 1DK4A 3KZYA 2WADA 1SD6A 3PPPA 4ESJA 2DXIA 1ZAOA 3IJXB 2JQ7A 4JK1X 1QZEA 1VQ4I 4IB2A 2ID3A 4XM3A 4IZZA 2VE8A 3RSNA 3E6MA 3CD6I 2NXNB 4PBHA 5A2QZ 4LQ2A 1YE9A 4R1HA 3ILTB 2Z5UA 2FQ4A 4A93J 3OOUA 4M3BA 3H5AA 3CG1A 1NUWA 3LQRA 3I56I 5ED4A 2WX9A 4XN3A 2KJCA 3TEDA 3ML6A 1V4RA 1FYKA 2PJPA 4ZDPA 3MCZA 5DEXB 2ZSHB 1FMVA 1WH7A 1AU7A 5L9SA 4AYBA 4IO7A 2CWEA 1JJ8C 4MHFA 3WTXC 4FIMA 5ET8A 3I59B 5LRRA 3GBGA 1PBPA 4C2MJ 4IKFA 3OYFA 1VDWA 4GFRA 3LQQA 4GFBA 4F19A 4KISA 2O0YA 2DA7A 4F93B 2HZLA 3SYTA 2P3VA 2TDXA 2JTVA 4JOMA 4AB6A 5AA2A 1Z7ME 4ZTJA 2OPTA 2UVJA 4CCNA 1FMWA 1K83J 2ZNZA 2K3PA 3OYGA 5EZGA 3ZQHA 2QF7A 1GT0C 2R9JA 4BBSJ 4UB8C 2X7QA 3B73A 3TAJA 3W2WA 3TDUC 2GRVA 4NC8A 2LY1A 1PBQA 1AWCA 3IL2A 2DWIA 2LKXA 4O3MA 1CNQA 3FXMA 3B8BA 1V55H 1R5ID 3BR5A 2DFFA 2EINH 2ESNA 3OL4A 4XKWA 2HR3A 5J4VA 2DPUA 1URDA 4UACA 3E5QA 1PB7A 1D0YA 3TUSA 3EPZA 4OIPF 3G3GA 1UFMA 5BNGA 5GTIC 2RC8A 4LGWA 2AS5F 1FTOA 4JVIA 4KICA 2GXBA 5FB2A 1N04A 3R0JA 1VQ9I 1D9VA 3AKZA 3HOUJ 4MCOA 4OINF 1DPEA 2ADUA 3HOSA 3C4MA 3UR3C 2RKMA 3DKWA 2UZKA 2P5LC 3BG9A 4F92B 1US5A 3M7GA 4JX5A 4ZYEA 1A04A 2JA8J 1G3WA 3TKYA 4B47A 2A5TA 4ESBA 4R79A 2YLNA 2CYYA 1W1WE 2Z2SB 3H92A 5CPRB 4KITB 2QEXI 2YU9J 3S1QJ 2F8DA 3TCGA 3ZSFA 4XOPA 3TP3A 1B1XA 3OYMA 2JUCA 3FVNA 5DCFA 3DXJF 2XGEA 4X04A 1MH4A 2G7HA 4KFCA 1FOWA 4Q4ZF 5CRYA 2IS2A 2M8EA 3M3FA 1XCBA 3M8EA 2F2EA 2M5WA 4XBFA 3OV8A 5J4YA 1NV4A 3CFZA 2K9LA 3GF2A 4I3YA 3TQLA 4P11A 2M7BA 2QJEA 1YS6A 1G0HA 1WFXA 2YJPA 2O03A 2L2OA 4A3CJ 1MQHA 2RCBA 4O3CA 3BG7A 3ZRGA 2BY2A 2MLKA 2Q2CA 4MEXF 4CCMA 3D4CA 2RAEA 3HJEA 4Q0CA 4M71A 4X0GA 1ZG5A 2O5RA 4LK1F 3K6UA 1T39A 5K1YA 3QPTA 2HPGA 1SFKA 4IX7A 2Y5LA 2ZMBA 3ROJA 1AMFA 4E70A 2IGNA 4G94A 1B3FA 4PFWA 5B1BH 4A3LJ 4G8MA 3CJTB 1B51A 4LLNA 2NOGA 2DK5A 1M1EB 2YX4A 3T8RA 5J8CA 1DP7P 1FQCA 2G29A 2XD2A 4OFOA 4BS9A 4GWYA 2IA2A 1B9NA 1IRFA 3L2VA 2G7UA 4NGUA 2JWTA 4FJPA 3G6EI 1LPQA 3C32A 1IXRC 4BACA 3S16J 2DE4A 3IOTA 1JEVA 4XTCQ 2PN6A 1MY1A 2C6YA 2V9VA 3MAJA 5B70A 1XHYA 2VXZA 3N94A 1ATGA 2WAQA 3R4KA 4IO6A 1TWCJ 1OYIA 2R7QA 3JW4A 2H25A 1T33A 2BJIA 2CJJA 1NL5A 2ANJA 3Q0WA 1U8RA 2K86A 5D4SA 2JUGA 2AQEA 1YFHA 2Z9OA 1SDXA 2HOAA 4I02A 4EJUA 3ELKA 3LUYA 1LBVA 4D1QA 3SJMA 4MGRA 1KWHA 5IP9J 4PAFA 4DXCA 1OCPA 2JT1A 5GPAA 2F7CA 1JXSA 2ELHA 1SYIA 3GZNB 3H6WA 2VKEA 2GIVA 4AWXB 2STTA 3K4BA 3K9TA 1V5EA 1ZRCA 3T8TA 2D5WA 2HKOA 4CA0A 5IY5H 2DE2A 5H8NA 5F6FA 5TP9A 3BQZA 1WJ5A 3FBNB 2DA6A 1R23A 3WHBA 2XXHA 2Y2ZA 1JQFA 1NNPA 4LK0F 5EYGA 3C2GA 3FV1A 1D1CA 4G7ZF 1WVRA 4J01A 2L7MP 2EFQA 4N4OB 4XMYA 1DTGA 4MLOA 4XKRA 5CQGA 3PNVA 1PC3A 4G9YA 1H0MA 1ZIUA 2KMUA 3CJQB 1LE8B 5GPCA 3PD9A 1FTJA 4IGTA 4NF5B 3OYCA 5DT6A 1EZOA 2X1DA 2CG4A 4NTLA 5L3DA 3U9GA 1Y0UA 3Q0VA 3WG7H 3E6CC 2F7BA 4Y3OA 4EM1A 1HSJA 4M3GA 1U0JA 2KRHA 3I55I 3S15J 2VHAA 1O7FA 3VOEA 2JVGA 4UHTA 4XRFA 2KQRA 3H5RA 4CZZA 5IOYA 1QKAA 3TFLA 3KP4A 5E1XA 1D1AA 1N77A 1FIPA 4PFTA 3CJNA 4AVPA 4R2BA 3H6UA 5FO5A 4BXUA 2CW0F 4XICA 1IMCA 1BC7C 1VQ8I 1DU6A 1BIYA 3QAXA 1Y3PA 2R7UA 4BJ6C 3CCEI 4J19A 2WBBA 1FY7A 2VKHA 3OO6A 4MMPA 4NN3A 4FTHA 4TOZA 4G2ZA 5HBCA 3WG9A 1XVXA 4O3BA 3SETA 5I57A 3E1SA 1LGBC 1L3LA 3DP7A 5ICEA 5J40A 4BNCA 1QPMA 4GXOA 3NWTA 3VVDA 5AA4A 1VF9A 2COMA 1HKTA 1EU8A 5L3EA 2A3SA 3A29A 4XIDA 3VYTB 2W25A 1FOXA 1DSNA 1RR7A 2K4JA 1N7XA 1Z77A 3T66A 2P6TA 1FBPA 5ICFA 3PTYA 5DD4A 1URSA 1T8IA 3ULQB 3T22A 1S6LA 3LA2A 2EFPA 5J1DA 2EB7A 2P7VB 3CMAI 4FE7A 2OC6A 3TDZC 3G73A 2PX1A 4RB0A 1MXXA 3RPWA 2QVRA 2EZKA 3OIOA 4MFDA 4TV7A 3G3IA 3C18A 4KJZA 4OENA 3I4NJ 3HG9A 4BDLA 4M74A 3ECRA 4M72A 1MS7A 4OQOA 4HX7A 1OISA 1YLFA 5FHNA 2NOJB 1SEUA 3BT9A 4XSXF 4IO2A 4NF8B 2Z23A 3K0VA 4HQEA 4P3LA 1WJAA 1DGRM 3TKDA 1R22A 5I2NB 5CQEA 2X0LA 4G8XA 2DS9A 2GLOA 4YIRX 4RLFA 1J75A 4POXA 3ZR8X 3RT8A 3LSKA 1ZK8A 2VT3A 1O7LA 2PBIA 3HPIA 1IDYA 3CDIA 1GGGA 4CCLA 1MIJA 4MNPA 4IO4A 3P9CA 2P8TA 4KDPA 4NE4A 4ASNA 4KMFA 1RDYA 1R5GA 3HOWJ 1B32A 2G93A 3G3KA 4PE5B 4WX9A 3WGHA 1W5CC 1LUJB 3DKYA 3TP0A 2V9KA 1DU0A 1V5GA 4OAZA 3IOUA 1XMXA 1OLTA 2M9HA 1IJWC 1LBZA 4YAHX 4YKIA 1AKHB 3K0LA 4RYAA 1MG1A 2IXSA 3IC7A 1FJ6A 1EF4A 2DOJA 2XUBA 3HXLA 4Z2YA 1A8EA 4ELRA 2OBPA 2VT2A 4A6EA 2Z8FA 1FPIA 2EQRA 2L4MA 1GHCA 4LFUA 3NRVA 4G6DA 5I2KB 2EK5A 5E18F 4F55A 1MQGA 4JVDA 5EQAA 1Q1KA 3IP4B 3ZMTA 1MJAA 3FXKA 2R5YB 2X6OA 1EH7A 1I6QA 3K01A 1WHUA 2JRTA 3CMYA 1ETYA 2FE3A 4A6DA 3W15C 4UABA 1O3RA 4C3HJ 3RLFE 3J80K 2JPCA 3LSFB 3N4MA 3IKVA 3U21A 3M8FA 3EHUA 4LIVA 3O6HA 1YW7A 2DW4A 4G8NA 4YMBA 2OJED 3B6TA 2A6EF 1PYVA 4OERA 2CZLA 1BIAA 3HPHA 3OY9A 1JVXA 5I59A 3QPLA 5FROA 2PBWA 3UIFA 3S9NC 3OL3A 2CUJA 2HXIA 1IUYA 4CUGA 2KP6A 3CCYA 4BHPA 4D7MA 2CH0A 3BIHA 3CCJI 1SVXB 5EYRA 1LBWA 2Y84A 2R7DA 1A55A 3OEMA 1G3YA 4G6TB 1B6HA 1ZELA 3PUFA 3W3CA 4XQFA 5LGNA 2VUMJ 2FA5A 2M3AA 4IHSA 3B6AA 3MKLA 3PGFA 4M3FA 4AB5A 1WJEA 3RGYA 4YICA 2CS3A 2CMOA 2A61A 2EFNA 4L0YB 3H3VK 4F7ZA 1FQBA 1JW4A 4F1YA 1QUIA 1EKEA 3K6WA 2W84A 1OPCA 1MBJA 5B66C 5FLMJ 1T2KA 3K1NA 2ZXJA 3M9AA 1SW1A 2F5FA 3N6UA 3MKZA 1WJBA 1F1ZA 3T5XA 2GOMA 3TOBA 2XXYA 4ZEKA 2EPFA 3UKGA 3GYYA 3T0YA 2P0WA 3H0GJ 3GW2A 4IRIA 2VKVA 2DWJA 2VB6A 1NV0A 2WB1N 4OFJA 4AIHA 5H8FA 2LYCA 4G68B 3E6BA 3LOCA 5F64A 4A3BJ 3RZDJ 5TPAA 2ZO4A 3W9VA 3K4LA 4F3QA 1XCVA 4B4CA 4RK2A 4A0ZA 1X1BA 3FXOA 2MH2A 3S1RJ 2F48A 3SDFA 5CVVA 2XHKA 4QBAA 3IFCA 1OYYA 5DDGA 2WAFA 4Y33A 1MDMA 4PF6A 2VJ4A 2D45A 1CGPA 3QUJA 5E3NA 2RDPA 2NS8A 1OJLA 3RTRA 3OYNA 1JUPA 2PEXA 2PMUA 4QFNA 2N8GA 4EQ9A 4MNCA 3M1EA 4PDKA 4BJTA 1DCUA 1Y1MA 1Y3NA 2H5YA 1RI7A 2GA1A 3GTLJ 3MFKA 5IGAA 3S9MC 4Y13A 4V2GA 2AXTC 1MY2A 2K9MA 1IO2A 2L9NA 3F23A 1A5JA 2KR0A 3WU1B 3K7AJ 4QPQA 2E19A 2DWAA 1D9QA 3EUAA 3BZCA 5DS9A 1R1TA 3VVEA 4TLLB 1B0LA 1GR2A 3FVGA 3BOQA 2P6SA 3GX4X 4IHWA 3QWLA 2PJRB 1BA5A 2HYJA 2VIXA 2VLAA 2BW3B 1HC8A 3HM5A 3C1DA 4BH9A 3O6GA 3S2DJ 3QYFA 2YUSA 4JQFA 5IT9Z 1IMBA 2CEXA 3MVWA 5JTYB 3E78A 3U1DA 4ESWA 5M2VA 2YS9A 3COAC 1MBEA 2JA6J 1USYE 1J0RA 2WV1A 3LSRA 4H65A 1IRXA 1LBBA 2H6BA 4UVAA 1GUUA 4BXXJ 1L5TA 5CMBA 4CGZA 4OETA 3SXYA 2A69F 1S7EA 2ONKE 1R58A 2Z33A 2ZZVA 4K2EA 2F5DA 1T38A 1SD3A 2PMZN 1FPBA 3BTLA 4KN4X 1SYHA 3D1NI 3C36A 5IZ3B 5L3GA 2IVMA 3M8JA 4YB6A 3F72A 3CRBA 3PNTA 2LP0A 4UUSB 5C4XJ 1SW4A 3EKIA 3G3FA 2B9SA 5BOXA 2PQ8A 3TW6A 4ZE9A 1QA6A 1B9MA 4I0BA 1W0UA 3TPAA 2EJRA 5E1ZB 4G61A 1J59A 4JXIA 5FLXZ 4Q5TA 2MYSA 2HVSA 2O68A 1W5TA 5IOZA 3GZGA 3PUZE 3V8XB 1JKRC 2PLYA 2W85A 2ICWG 4PFIA 1XB4A 4EM0B 4E7LA 2HQ0A 1JKPC 2UVHA 2XWVA 3IAM2 4FEDA 1MPDA 2DMPA 5FHOA 4H0EA 1W7PB 3PQKA 1ZHFA 4NHJA 2NNNA 2K5CA 2VC0A 4HF2A 2QWWA 5AA1A 1P7JA 1VQNI 1YJNI 4UA8A 2RREA 3KEOA 1H88C 1WZ2A 1R9LA 1TW2A 2V3TA 3K1PA 2FEZA 4XLCA 1JHFA 1MMNA 4MTEA 5LHHA 4BEHB 2QFLA 2VGQA 2OWZA 4XL9A 1VI0A 5FJ8J 3T9HB 1XGOA 2DI3A 2JPBA 4OWRB 2XC7A 1UB9A 3HL2A 2NVTJ 1U9OA 3LSIA 1JVYA 4C1TA 1XN7A 2F4OB 1R5HA 4HBLA 4WWCA 5ITOA 3LWFA 3R7XA 5GP9A 3CCMI 1B7HA 2GAUA 1I50J 3H4ZA 2QM3A 1XMAA 3CZ6A 4ZYGA 3G1MA 1MD0A 3WODF 1RIOH 4QF9A 4KA4A 5C44J 1FTZA 1TQIA 2WYKA 1B40A 1H76A 4I0AA 3H3GA 3TOAA 3V8LA 5GAHJ 1YQAA 5HS8A 1PB9A 2DQLA 2V3UA 3KN8A 4HCWA 5ET6A 2V25A 3O9PA 2FOWA 3T1BA 1O63A 4IY5A 4FT8A 2Q2EB 1I6BA 4DW6A 4EQQA 3KP6A 1S7AA 1UAAA 4UB6C 3F9KA 4S04A 2OLBA 4QFKA 4F1UA 1YJWI 4GD5A 3BFTA 3TBIA 1P2FA 1OMPA 4GVOA 1IV8A 2CRGA 5HDGA 3AL0B 3K02A 2ZXWH 4MO7A 2VJJA 4RGXA 4P0IA 2Y69H 4LOCA 1SI0A 1FTMA 3DBRB 4EMSA 4R73A 2BZTA 3RYDA 2QQ9A 1IITA 4ANJA 2LTPA 1HF0A 5EDNA 3BQYA 3SEXA 4HS7A 3N05A 2UXNA 1HKSA 1EA3A 3EETA 5ERIA 4L0ZB 1G6NA 3SEZA 1FPJA 1RYXA 2L5VA 3L09A 1FBFA 1JKQC 4HPQA 5ICQA 4BHCA 3OYHA 3A3UA 2MH9A 1TC3C 1B59A 4G7HF 1RKWA 2K4BA 3A01B 2Q0OA 4GX6A 1OCOH 3BJ6A 4MAGA 1D3YA 2ID6A 1LCTA 2AYSA 1IC8A 3DP6A 2K9SA 3TQWA 2Y7WA 3LSGA 3LAPA 5KVRA 5A5XA 5CVUA 4XRSG 4HE1A 2R5ZA 2L9SA 1V54H 1JEUA 4Y7NJ 1IMFA 2LDUA 2WAQN 2E0SA 1TWGJ 2LF7A 1FWZA 4I99C 5J3LA 4PFYA 2CFXA 1QZZA 1Z67A 2ZFWA 1ZREA 1WDNA 2DJIA 1BLFA 2UXAA 4OU0A 1IN4A 3MZ9A 4XR6A 4PJLA 1SFXA 5DV5A 4QHQA 1QRYA 1FCKA 3SEWA 1YYVA 1CF7B 2DOEA 2P1SA 1NHAA 4A3JJ 4KNYA 3JRAA 4F3PA 2FUG2 3WE3A 3PMVA 2DU9A 2Y75A 3BPVA 1M5EA 2Z1DA 1LSTA 2M4KA 3FVOA 4GIZA 4KR5A 5BQTA 2DA1A 1VZ0A 2VODA 2XXKA 4E7SA 1IN7A 2OA4A 2OZ6A 2XSDC 3DU6A 1IMDA 1USSA 1J09A 1YI2I 4NBQA 1JNFA 3PSIA 2O84X 1QUJA 3U93A 4KYSA 5L9MA 3CIJA 5KCJB 3HSTA 5I5PA 1IV6A 5IP7J 5JHFA 1SD5A 5ESYA 3Q27A 3QAHA 2WAEA 1B7ZA 4L5IA 4KYDA 1YJ9I 4BU2A 4H46A 3FHZA 4WCGA 2M34A 2W82A 2I49A 5L3CA 4LITA 2M8CA 2VD3A 2IT0A 3EHSA 4XSZF 3SEQA 3WHCA 1SVOA 5ILUA 1NG6A 4I76A 4L5JA 2HEOA 1K9ZA 4NUBA 1MXVA 1R4MB 3I0TA 2XXPA 2LF8A 4D5CA 3TO6A 1XC5A 1YX3A 5IYCJ 2W7NA 4AIJA 3JRGA 1B5JA 3K2DA 5I2KA 1MMDA 4B09A 3J81K 4KCDA 2TRTA 4DE8A 3SKPA 2E1NA 2R5YA 5B5EC 1R4NB 4IPAA 3IJOB 4ZECA 2KIQA 1FOYA 2FF4A 5K5RA 1P1OA 2HKXA 3P7IA 4O7IA 3FM3A 5HDKA 3M3KA 4NHBA 4EQ7A 1HBXG 1A36A 3IO4A 2QLZA 1BK4A 1EH6A 1CB6A 2FVZA 5EG0B 2F36A 4XKBA 3CG3A 4PJMA 4PUSA 3HN0A 5F1QA 3L2QA 4Q5SF 3CSGA 4N0BA 5M3FJ 4I3EA 1VQ7I 3UK4A 3IHUA 2IEKA 4LN5A 3KZZA 3Q3SA 2OZUA 3CCUI 1KU7A 2VOOA 3GTKJ 2DXYA 5HVQC 1UMQA 4PGGA 4IVNA 3CC2I 2AO9A 1P92A 2CW7A 2V7FA 2B65A 4IRGA 4FX4A 4H8IA 4EATA 2HVQA 2IEEA 2BGCA 4CCJA 4HDUA 3A03A 1ZLJA 2CSOA 2H8WA 3ZQLA 2L02A 4U0VA 5FRNA 2WTEA 2DT5A 5HLTA 1TXFA 4MX6A 4OIQF 1FT9A 2AQFA 2JK3A 5DCMA 4B48A 4GWXA 1OYWA 3RCOA 1FPEA 1P7IA 3CO7C 2Q88A 3GVAA 3MPLA 2KRCA 3JCUC 1ONVA 3KOTA 1A8FA 3QIMA 3OMYA 4N6DA 1W7PD 3JR9A 4HA8A 5F0FA 4BJ5C 1MMGA 2E5ZA 2ZYNA 1LEVA 3RPLB 3WTSC 2XXTA 1YRNB 3IB2A 3HOZJ 4N07A 4XXUA 4C2UA 1B72B 4B43A 1TL8A 3FF5A 3FXBA 5GAEJ 1LDDA 3CLOA 2FD5A 2M2EA 3A0BC 1XTAA 3L6HA 2OCCH 1B7UA 3M3YJ 4U23A 3QU6A 1GXPA 1QULA 2KISA 1ZKBA 4LG0B 2HS5A 1A7LA 3V42A 2K9QA 1VFCA 3QXMA 3HKZN 3NOHA 4IEJA 3LSPA 4R6HA 4AU7A 1INPA 2CQXA 1HW5A 1N78A 1P1UA 2LAOA 2MLGA 3IK6B 4NB5A 2CV2A 1OIBA 4AM3A 5D5WB 1YOVB 3VWBA 3FXQA 2LBFB 1D5VA 2PMZA 4KPTA 3SQNA 5M5WJ 4EJTA 4M3EA 3CHGA 1T0FC 2EA4A 2VQLA 1US4A 4UV8A 4EXKA 5JI6A 2BY3A 3DEWA 1JP4A 4BKXA 2EIMH 2X1CA 3MPKA 2P5VA 2YSRA 2KIFA 1R9TJ 3CF5F 1MQDA 1P4AA 3O8HA 4P96A 1TW3A 1RR8C 1DPUA 1A99A 5D6EA 1O64A 2RINA 4NAPA 5CYVA 1ZR4A 2KRFA 3EYYA 2R7VA 1JI8A 1FLIA 4ZZDA 5HLIA 2CU7A 4QSHA 1MPCA 2CEYA 1H44A 1U5TA 3FWEA 2NVQJ 3LSXA 4HAMA 1FTLA 3QYBA 1PB8A 2EIJH 1ERDA 3T93B 3B6WA 1TWAJ 4ZEDA 3HO7A 3ZMVA 4OVQA 5E8GA 2O61A 4I01A 3GTOJ 2WBDA 1NV3A 2QQBA 3NEUA 3FXUA 2STWA 3MZ1A 4D5FA 2CUZA 4WXJA 2BV6A 4YFKF 1YCJA 4DYCA 4GBVA 3KIOA 4Z6YA 3S1NJ 2B63J 2UWMA 3RJPA 2DXRA 3FZVA 4Y17A 3E13X 2PFBA 2NVYJ 2F5XA 3EQ1A 5CMCA 3MP1A 1M5DA 2IGMA 3CR9A 4NF4A 2GA2A 4CICA 1H3DA 1MXUA 4II3A 5ET7A 3J7ZI 1VFEA 1PJRA 3OYDA 1ETVA 2XDVA 1XSDA 3DBLB 4O7MA 4HYEA 1I5ZA 2KDOA 2XROA 1POGA 2QA4I 2HXOA 1FJLA 2VPRA 2B0LA 2PX9A 3DPLC 1K4SA 2HZTA 1E3HA 2XWOA 1TNSA 3ZGKA 3SFIA 1QGXA 2VT5A 2KIUA 2RC9A 3BIGA 2MD5A 3KBRA 2DK8A 3KYCB 4F22A 3S93A 2EV6A 3PO3J 1LFPA 1J5YA 1YW8A 2E35A 3EYIA 4NQ8A 1FSAA 1UTBB 3S4UA 5F08A 3K69A 1MDQA 1PUFB 4BE0A 2O6AA 3OO9A 4H5GA 3TO9A 4IHXA 2Q8MA 3BG3A 2OQRA 2FIXA 4N8YA 1XI6A 3U2RA 2VD2A 4LLLA 5KK1A 2GQ1A 1JTXA 1QGPA 1BC8C 3GWZA 3PL8A 2DE3A 3F21A 1FW0A 5ILVA 1F9NA 1QPIA 3VE1B 5JVGF 1X2NA 1TFAA 2ONRA 2EWNA 4R2FA 2IA4A 3FKJA 1VQOI 3H1CA 4XRMA 4HLYA 2O7UA 4X9TA 2DTZA 3OIPA 1YZ0A 2XAJA 2QVVA 2PT1A 5CVJA 1OLCA 2DCEA 3L00A 5K2YA 3SHFA 1BI0A 3PSFA 1G0IA 3BZ6A 1UIVA 3F8MA 1URGA 1R6RA 4MQVA 5C3EJ 4EF1A 2Q2EA 2E2IJ 2AL4A 2MBFA 2ACJA 4BDQA 3C2HA 2KLOA 3HRMA 3O6BB 1ZH5A 1BKAA 4ZS9A 4OVJA 3BR6A 4MEYF 3V89B 1X3UA 2VQHA 3GFIA 3U1OA 3Q29A 2LKSA 3F8CA 1PP8F 5D6FA 3LR1A 1FTKA 2IA1A 1LAGE 3CC4I 3FISA 4PBQA 2YPRA 2Q8JA 3VDXA 2D3IA 3LBSA 3A09A 4N9HA 4I6ZA 4BDOA 3I64A 3S3MA 4FEBA 2R0QC 2OD5A 1QHGA 2QGUA 3VV5A 1IGNA 5KDTB 1MY0A 2O51A 1E3PA 4CYDA 4ZDOA 1W4MA 1IMEA 1LBCA 3W6KB 1G3TA 2FBKA 2ME6A 1KU2A 2WWYA 2PMSA 2PVUA 2XXXA 1X3WB 3G1OA 1D9YA 4IY6A 1U5TC 4BUPA 2FNCA 3K4MA 4L5EA 4ND9A 4M9SA 1ZKGA 2EV0A 3SDGA 4XKQA 4JSDA 3HDDA 1WODA 3QYTA 3DWLE 3SZGA 2KLFA 4QPOA 3ASNH 4E7ZA 1ON1A 2HEUA 3B6QA 3S2VA 2DYRH 2O1MA 3PO2J 5E20A 5EYFA 3LL7A 4QWQA 4GYGA 5EEGA 1UTHB 3IH3A 4ZTFA 4XLFA 1A31A 2ELJA 3JRIA 1LAXA 3DP4A 2A68F 1KQ8A 3MAMA 3PPNA 1OCCH 2F5CA 4OMZA 5A2QK 1R49A 2F7AA 5L9OA 3GTGJ 2AL5A 3BR0A 2FA7A 1JHHA 4UY8I 9ANTA 1FZPB 1Z7LA 3VLUA 1FOKA 3V7CA 2V3QA 3O66A 3I5OA 1DDNA 3O28A 5JK4A 3H5NA 1Z3YA 2X6XA 1EYKA 2PT2A 4GF8A 1BBYA 2QQ8A 3W2VA 2VL8A 3FV2A 2CQKA 1WKMA 5TISC 1Q35A 1ETWA 1DGWY 1QVTA 2WBMA 2L3DA 2I10A 4V2FA 1PVEA 1JETA 1Z6RA 4QXDA 1FTAA 3HSEA 2WEFA 2LOOA 3DCFA 3V8KA 3IX1A 3VYUB 3BTJA 4X1EA 1K6OA 3CC7I 4DZJA 1FSHA 4IXAA 2HQAA 1KYZA 4RNSA 3TZAA 3GZ6A 5LLQA 4LB5A 2Y5KA 5DVFA 1J9IA 1MNEA 4LVQA 3RQTA 4RGSA 2UVIA 3B02A 5H8SA 3I9V2 5CM6A 2R7FA 1FPQA 4ZH4F 1SD7A 3EF7A 3BKIB 3ZQFA 1VFDA 3RKWA 5B3SH 2HTSA 3K4CA 1JW1A 2QMWA 1XDUA 3QQAA 4IHTA 4NF6A 3GO5A 1TWYA 5CLSA 2FMLA 3A2KA 2Z8EA 5H8HA 4M9ZA 5HLHA 3JAMZ 3FVKA 3D4GA 1IXSB 1NI9A 1BP5A 3PPRA 4F18A 3BROA 3NARA 4QTRA 3CUQB 2EH3A 3S14J 1IIWA 2XWIA 3HHGA 3A3CA 3M8UA 4P1LA 2HXWA 2X7PA 1ZG1A 2XF7A 3MKWB 3DV8A 1XPXA 1LFGA 2XHDA 5D4RA 4GOTA 3R26A 3CLQA 1VNDA 2DO7A 1LLSA 4BDNA 2XASA 4OA4A 2NS0A 2VPOA 5FKNA 4OMBA 1ZLKA 4U21A 3AL0C 5TJJA 1N76A 3G71I 1BR2A 3I54A 4XNFA 4NNJA 1BOAA 3Q0UA 3MQ0A 4MHGA 1Q1HA 1MRPA 2DQVA 3G7WA 3RYRA 3O97A 1MMAA 4H8JA 1N3WA 4HV6A 3JTGA 2F6GA 4OVPA 1HSEA 4Q47A 4P55A 1B3EA 3G2BA 3VVFA 5J8FA 5CMKA 3D5RC 2XD3A 4WF2A 2XV4S 1FRPA 3BZKA 5HOOA 2XWKA 4BBRJ 4PJNA 4GRIA 3GTJJ 2WKYA