1IXCA

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
294
structure length
289
Chain Sequence
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLEIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Dna binding protein
molecule keywords LysR-type regulatory protein
total genus 91
structure length 289
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ixcA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixcA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixcA02
1FBUA 4YB7A 1TQPA 4ZEDA 3I59B 1FCKA 2P5VA 3KLNA 2LSOA 3S2WA 5K5RA 2ZXJA 2H9BA 3CG1A 2ZYKA 3QAXA 3S2VA 4EXLA 1N84A 3M1EA 1JETA 1SW4A 3BROA 1W5SA 3IK6B 2D3IA 5ITPA 1GVCA 4DXBA 2CYYA 2R6GE 3JAMZ 1ZREA 2ZO4A 1TXFA 2F78A 2KLFA 4IVNA 3WAEA 1L3LA 1Y9UA 3HHFA 3F21A 3GLBA 1YQAA 3CR9A 1BBYA 5JK4A 2NRAC 4FEDA 3OV8A 1LAGE 3TKYA 4O5VA 2HTSA 3TEPA 3O29A 1PP7U 1MRPA 3KGCA 4QSCA 1B52A 2RF1A 5I58B 4UVBA 3C7JA 3ELKA 1IRGA 2A5SA 2F5FA 1S29A 3ZMSA 2E1NA 2H6CA 1B5IA 5FLXZ 1EV7A 2MA3A 2EV5A 2OA4A 4BXUA 4LLNA 4A0XA 2XXQA 2EB7A 3JYRA 1JVYA 2Z8DA 4OFOA 3TFLA 4LLGF 3Q27A 3M3KA 5K2XA 4N0BA 1ON2A 2VT3A 5H8NB 1F5TA 5CMCA 3HTUA 5DUKA 4LA9A 3IWZA 3V7SA 3ECRA 2C6YA 3KEQA 5B70A 3GX4X 4WKMA 3TTRA 5CVJA 4M71A 3TPAA 5E1XA 4RS8A 2FBIA 5JR3A 2PMHA 1U8RA 4YU0A 2RCAA 2ESHA 1SW2A 1L5TA 1MY4A 5ERIA 1F9NA 5FHOA 4L0ZB 1OKRA 1M5BA 1POY1 1Z7ME 1PDNC 3LA3A 1UFMA 3K1NA 2ONRA 4LD5A 2K4JA 4YIFA 4ESFA 3WTYC 3T9UA 3TUSA 3SHFA 1I6QA 5HBCA 1IXRC 1BKAA 3IOUA 4RB2C 2BYVE 3CFXA 3PPQA 3B6WA 3TDJA 3F8NA 1WODA 2RC8A 4OENA 3CG3A 4MTDA 3I0TA 4N07A 2D45A 1ULYA 1OQHA 1FPQA 2V3TA 5DVJA 1P1QA 1LAXA 1GV8A 4GO1A 3E3VA 4KYWA 2ZCWA 2ADUA 1JEUA 2WTEA 3K4UA 4B8XA 4ONYA 5FHNA 3RQTA 3PUVE 3JAMK 4O3MA 2ABHA 1GR2A 1MXZA 2A69F 2RKHA 1XS5A 4Q8RA 1MXYA 1FQEA 2I4CA 1N3WA 4UACA 4ZE9A 2QS4A 1NFTA 2DQRA 5I56A 3CVGA 1Y1ZA 4H0WA 4WXDA 3K00A 3GO5A 1IUDA 2Y7KA 4X1DA 1T6SA 1QGPA 1B5HA 3MWBA 1TBXA 3TELA 2OCUA 1FZPB 4ESWA 4U21A 1A55A 1WDNA 3E5QA 2XX8A 3TAJA 1URSA 1M5DA 1IN4A 4WF2A 2L3DA 2YPNA 3SESA 3BPVA 5D5VB 2Q2AA 3OENA 2H6BA 3MVWA 4JDFA 2CWEA 4BDOA 2F35A 2XD3A 2PEXA 2DVZA 2Q89A 3THIA 2ELHA 3OEKA 2FNPA 5HLGA 4YKIA 5D6EA 1R23A 3HYIA 2G29A 2V1DA 5JI6A 1MXWA 3M8UA 5FHMA 2G9WA 4X9TA 2FXAA 1MY0A 4OFLA 2GAUA 3MUQA 4L5JA 1ZRFA 1B1XA 4CDGA 4POXA 2OWSA 4Q47A 1G3YA 1ANFA 1NNTA 4BDMA 5IAIA 3HO7A 3T9VA 2JPBA 4Z7EA 1J7KA 5E20A 2YLNA 3ZN1A 4I09A 2O6AA 4R9GA 1JGSA 5DTBA 4MHGA 4BH9A 5ICQA 4U22A 4JWXA 4XKQA 4GIZA 1SD7A 4P9UA 1XN7A 3J81Z 4PZJA 1S7AA 3P7NA 4IY5A 1IN8A 1YCJA 3RT8A 4X1BA 3E6BA 4TQUQ 4LQ2A 1XDUA 1I5ZA 1UHWA 1OIBA 4DLDA 3I58A 2QLZA 4EJUA 3ZKLA 1LFGA 4GYGA 3KN7A 5M2VA 3FJMA 3VLVA 1P4WA 5J1DA 5HS9A 1JQFA 1P99A 3QRFF 3KP5A 4A6EA 5DT6A 3PPPA 1BIYA 4JXIA 3SEXA 6PAXA 4N9HA 3OMBA 1QUIA 5D4RA 3KSXA 4GLIA 2P7VB 2F5EA 4GCVA 4H8IA 4BDQA 5I56B 3SEYA 4DNCA 3G3GA 2NS0A 4MNUA 3FHZA 2HYGD 1UQWA 2YJPA 1LSTA 3RJPA 5LGTA 1BM9A 2IJLA 2XXTA 2O1LA 1B1HA 2CMOA 1Y0UA 1U5TB 1O64A 4M1VA 5H8QB 2JT1A 4G94A 4F39A 2QUFA 1TWYA 3MVXA 3JSPA 4I1DA 2EA2A 3EYIA 4LK0F 2H98A 2PX1A 2XXVA 1FC3A 3WAFA 3SEWA 1TFAA 2ZJ2A 3TO7A 2PMUA 2QVOA 4TOZA 2QM3A 4O6JA 3N6UA 3QPHA 3VV5A 3TTNA 3GBBA 4NF8B 1CGPA 3KETA 2E7WA 4FX4A 4EVIA 1ZG1A 2CO5A 2VE8A 3R4KA 4KI0E 3GFIA 4L9TA 3R61A 3FVNA 2RC4A 3BPXA 2UVGA 2AL5A 1Y1MA 3V8LA 3VVFA 1XVXA 1ZN2A 1TT1A 3CUQA 1V4RA 3MFKA 1Z6RA 3JW4A 2GHAA 1KWHA 1KU9A 1IXSB 3C36A 2V79A 1B58A 4MLQA 1Z6TA 2VOOA 2VHAA 4HW8A 2KRFA 4R74A 1SAXA 4IGRA 3Q26A 5I59B 3I59A 1TQIA 3TQLA 3P9KA 4ZEBA 1SFUA 4KR5A 4G68A 2Y7PA 2DXRA 3Q9VA 4ISUA 2VXZA 1MXXA 3V5AA 4F1YA 5AA1A 2CZLA 2PQ8A 1YW7A 4JK1X 4YFNF 4QSEA 2XHKA 4EDPA 1OPCA 1PB7A 2QENA 4GGGA 2Q2EA 4UUVA 2EFQA 3LC8A 3MWMA 3R6UA 3FX3A 3MBPA 4IO4A 2FQ3A 4NF4A 3HSFA 4R79A 1D9YA 4OESA 1LVAA 1XGNA 2EJRA 3QXMA 1J0RA 2OJTA 4PFUA 3V4GA 2HAUA 1D5VA 1A04A 1K78B 2QS3A 4I0AA 2ZFWA 4LG0A 4OIRF 5I58A 2EK5A 4PGGA 1R00A 1S6LA 4HX8A 1YW9A 4KT5C 1MKMA 1S50A 2ONSA 3J80K 2AXLA 1RI7A 3LFKA 4RPNA 2RGVA 2XAGA 4Z0IA 1IUYA 4ZEKA 4IB2A 2FOKA 5ICTA 5IT9Z 4OXVA 1OQGA 1LCTA 3WTSC 1H43A 1SYIA 1DTGA 5JHUA 1POTA 4F31B 5LHGA 3CLOA 4Y13A 5I2KA 1Z1DA 3HIFA 1DOTA 2UWMA 2ZYNA 4DIGA 3ULQB 2F8DA 2DBBA 1D3KA 3FD3A 2VC1A 4G8NA 2DT5A 4O3CA 1PB9A 1XMAA 3U92A 3RTRA 1LQ1A 5KZTA 4I8CA 3CRBA 3BBRA 5H8NA 5CVRA 3SZTA 3ZP5A 3ODBA 4POWA 4OFJA 2QQBA 4G7HF 1DP7P 1HXDA 4EM2A 1FBSA 1Z05A 1MJAA 3R6SA 1REPC 1PB8A 4NF6A 1HBXG 4FT8A 3B7DA 1GVJA 3T9HB 3RI4A 2B0LA 4G7ZF 5JVTA 5HDKA 2UYFA 2GWRA 3EF7A 3S9LC 1MY3A 1Y3QA 1B3HA 2X7QA 2HYFA 2I58A 3DM0A 3O3KA 3CUQB 2PBWA 1SD5A 1LDJA 5LRSA 2DLLA 1ZIUA 1VR5A 4UA8A 1CF7B 2RCBA 1P92A 1A7LA 4ON0A 2CFXA 1IW7F 3IOWA 5A5XB 5KCJA 1MJ9A 4JWYA 3H4ZA 2ZKZA 3RYRA 3WODF 5J8FA 1T39A 2P6SA 1J9IA 2YX4A 2JPCA 4FE8A 1R58A 4CO8A 3BFTA 4M6YA 2KIUA 3SZPA 4NF8A 4HS7A 1T98A 2X7PA 5ICEA 4NF6B 3DP6A 4C0RA 2X0LA 4Y17A 3FM3A 2XGXA 4TLLB 3K02A 5LGNA 4ZH4F 2HQ0A 1A8EA 4KIBA 4YFXF 2Q2CA 1OYWA 2OBPA 2HR3A 1B3LA 1R5HA 4R2FA 3KFMA 2XX7A 4JBAA 2FBKA 2R3SA 1USTA 4KN4X 3LSXA 4HX7A 4BNCA 5I57B 3EHTA 4RB3C 1A54A 3J80Z 4LP2B 1GHCA 3E6DA 1ZGAA 1I1GA 3KJ7A 2O7IA 3MP1A 1HKQA 4YKKA 5BPDA 2F5DA 3GVAA 5BOXA 1S7OA 2GA1A 1OYYA 3PGFA 4QFKA 1HSJA 4RNSA 3DP4A 1EU8A 3GZGA 1CE2A 2UVJA 3QSLA 5AA3A 3T9XB 2XX9A 1R1VA 5EYFA 3RTFB 5LEKA 5BPIA 2E1CA 1B7HA 4LATA 3KOSA 4RGUA 4MTEA 1KU7A 5AIQA 3R0JA 1O3RA 4HDUA 3IORA 4H6DA 2QZ8A 2DYXA 5LHHA 2B3FA 3V7CA 4U0YA 4M9ZA 2VBWA 4E70A 4KHZE 3CUOA 3R0AA 3C9HA 4YKPA 3TTKA 3FWEA 3B6QA 4THIA 3FMQA 3RN8A 1VFDA 1S3JA 1FQCA 4BYYA 4FORA 2L01A 4I62A 5CC2A 2XKPA 3DP8A 4HV6A 4KFQA 3HOSA 1LEAA 4IY6A 1B6AA 5ICGA 1XOCA 4KCCA 4ASNA 3SEUA 4LZ8A 4ESBA 3UN6A 4HF1A 4C1UA 2XAFA 5TJJA 1B3FA 2DPUA 3PPOA 1KYWA 3K2ZA 2FA7A 2YX7A 3QYTA 1LEBA 3RKWA 4QFPA 5CMMA 3C1DA 3BFUA 3C18A 4JWOA 1FP2A 4ZZLA 2FF4A 2FEZA 3KP3A 2CG4A 2XASA 1IZ1A 4LZ5A 2FRHA 2NAZA 5DEXB 2FSWA 4NHJA 1USYH 3O97A 1BOAA 3F8MA 1ZARA 1LAFE 3PUWE 3AXFA 4EQBA 1XDSA 1XGMA 3RKYA 3CO6C 5L3GA 4NWCA 4IGTA 3PPNA 2I0CA 4OOIA 2X4HA 1KQ8A 1G6NA 2L54A 5E17F 3FVKA 5K1YA 1B9JA 3MW0A 3RYPA 3SETA 3S9MC 3K6XA 3QAHA 3REOA 5JFRA 1NNFA 4TLMB 4L0YB 4S04A 5FO5A 2VODA 2XHDA 1EH8A 5L3BA 4A12A 1QVSA 1DPRA 3KEOA 3RTWB 2XVCA 4KYEA 4OERA 1U3EM 1I6BA 1HSLA 3TDZC 3KP4A 4M73A 1VE4A 2HKXA 2O68A 2M45A 3GZ6A 4OIQF 2Z99A 3QUJA 4S05A 1R7JA 1IAWA 3VOEA 3F6OA 1FTLA 1C0WA 1JW5A 4M74A 1FW0A 2Z9OA 3EYYA 2IRFG 1JNFA 2E1SA 2Y7RA 1IIWA 2F7AA 4HYEA 1XHYA 2QMXA 1LB9A 3H03A 1ON1A 3QUFA 3RPUA 4CZZA 4XSXF 2XUBA 1RNLA 2V3QA 3T96B 3WTVC 1TW3A 3S9NC 4UXNA 4CYDA 1Y4TA 4A2UA 4PCQA 3H92A 3FVOA 3BP8A 1Y20A 3SFZA 1QKBA 2XXWA 5B7DA 4Y15A 1EZPA 2GIVA 3MJNA 2EFPA 3WE3A 1H9GA 2W25A 3NEUA 1M5FA 5H8FA 2O0YA 4IRIA 1IXHA 4F2QA 2IA0A 2LNBA 1PBPA 5E8IA 1K78A 1EZOA 2F97A 1U5TC 2D2WA 5KDTB 4G6QA 3VXBA 2M5WA 3IB2A 4U7BA 4YZZA 4KCDA 2PMSA 3HUGA 1TNSA 2FMLA 2B65A 3L00A 2HWVA 4KQPA 3O6GA 1RZ4A 4DDDA 4P11A 4ZZAA 3DV8A 3OOPA 1T0FA 1H44A 2CSOA 2MD5A 3Q28A 5TPAB 2ZXTA 2ZBKA 2O3FA 5DD8A 2AS5F 4KICA 1R1NA 1Q1KA 4GXOA 1II5A 1ZLKA 5TRDA 4KYDA 4YG2F 2W57A 2PT2A 3IRQA 1FYLA 5JTYA 3MZBA 1FY7A 2QQAA 3PUYE 2A5YB 2IA4A 4ZZDA 5TP9B 1B32A 4ZYGA 1WI9A 2I6EA 2REJA 4OWDA 2VT2A 4L5IA 2MC3A 3E4RA 4Q30B 3G3JA 2D5WA 1HKSA 3I54A 3DPTA 1WQ2A 5IT3A 4ELOA 3R26A 4BAYA 3U9GA 4H0EA 2MLKA 1CB6A 5CVVA 1UTBB 3MVYA 4ZEFA 2H94A 2X26A 5FLXK 4KYSA 2RN7A 2XXXA 2V6CA 3VODA 2YR2A 1L0OC 1I6AA 1MG1A 2GXGA 1B0HA 3G3KA 2OWTA 3HRTA 3IKTA 1R22A 3TGNA 1YTVA 1BI0A 3ILUB 2V1UA 3QIMA 4R75A 2M30A 3T1BA 4OQOA 1UTHB 3FASA 3G3ZA 4WWCA 2M87A 2FA5A 1VTNC 4MQVA 1YLFA 2G7UA 3C35A 2Z5UA 5BWJA 3A3UA 3KLOA 4HTGA 1DPUA 3OD7A 2Q8KA 4X48A 4MEYF 3WGHA 1MQJA 2VP1A 4LZ7A 4XRFA 4RGXA 3T22A 1AIVA 3OELA 4OVJA 1EZ9A 3KE2A 2OZZA 1R6ZA 3CDHA 3UP9A 4ENKA 1K79A 2XXIA 3Q29A 3RNNA 3IJXB 1WSUA 1URGA 4ND9A 2ZNZA 3VXCA 2I0BA 4JSOA 4O3BA 3ZSFA 2H99A 3JSOA 3DLNA 3TMGA 1D3YA 2O8XA 1FTOA 4WXCA 3V7RA 5ILUA 5HOOA 2A61A 5AA2D 1JW4A 1O3QA 1USSA 3VEPA 2STWA 1BI2A 2TDXA 2UXAA 5F7VA 5DYMA 1Z91A 3TCGA 2EV6A 4KMFA 2VBYA 2O1MA 4IRGA 2R7DA 4PFWA 1W7PB 2AL4A 1TLHB 2F6GA 3MAMA 1OYIA 3OOAA 3V89B 1IXCA 2DE4A 2F36A 3JTGA 1B46A 5DEXA 3ERED 4U0WA 3FJGA 1YIOA 1QBJA 3V83A 5A2QZ 4XXUA 4ENMA 2ZMBA 1SBPA 3U93A 1LBCA 3D4CA 3KN8A 1B1BA 1HSTA 1M5EA 2GH9A 3UIFA 4UVCA 1O7FA 5TP9A 1XVYA 2P5KA 4ZS9A 2WC2A 5CVUA 4EM1A 3WGIA 4OYVA 4R9FA 3LUYA 3N97A 3K69A 4DXCA 2QRYA 5DVIA 2OQGA 5ITOA 3TZAA 1A40A 2DWJA 2BV6A 3M8FA 3ABUA 3B02A 2A6EF 2HAVA 2DSFA 2QL3A 4LFUA 4RXLA 4EMSA 4UHTA 5LEJA 4R6YA 3T8TA 3QU6A 3LAJA 1F4KA 4IF4A 3CUQC 3O2PE 2NNNA 3F72A 1IXIA 3VDFA 1MDMA 3EQ1A 4M9SA 2ZNTA 2HGCA 4WK8F 4I01A 2GRVA 4BDNA 2XXUA 4Q4ZF 2V25A 1ZRDA 2QPQA 4K2EA 1NL5A 5HDGA 4AQ4A 1MGTA 3ILTB 4QFNA 3CTAA 2DI3A 2ZNSA 2ESNA 4LG0B 1G3WA 1VFEA 1T0KA 2EV0A 4HF0A 1K6OA 4AIHA 3H3ZA 4G8XA 3LR1A 3BY6A 4XTCQ 4NWDA 4PETA 2AIXA 1XSVA 4RK2A 5ICFA 4Q5SF 4UV9A 1DSNA 1V3FA 3KP7A 2LDUA 3DXJF 3TOBA 2IA1A 3L6GA 1QW0A 3NRVA 2P6TA 4KNYA 5I2NA 5E1WA 4GXSB 2G93A 1GGGA 2L4MA 3LA7A 3G3FA 2RVCA 3CIJA 2PVUA 5EHSA 4YKJA 3WTWC 3O6BB 1B0LA 5F64A 2HQNA 4HX4A 3KZGA 3TTLA 3C33A 3S9EA 3W9WA 3MP6A 5CMBA 5I59A 3KP2A 5J6XA 4EUOA 3TTMA 1XCBA 4FJPA 4HLXA 1B6HA 4DCYA 5DVFA 4YB5A 1ZH5A 5L8DA 3TO6A 4QWQA 4R8HA 3L6HA 2WKYA 2HZLA 4F29A 1IRFA 5A2QK 4QSDA 2P7CB 1W7PA 1HW2A 1ONVA 1BTJA 3HRUA 4LLLA 1UTBA 5DEQA 2DQLA 1LFIA 4H5GA 1YPNA 2FNCA 5CI5A 1QZZA 4U23A 5H8SA 4KD5A 3DFGA 1B51A 1AH5A 1FTMA 1YW8A 1D8JA 2DW4A 4KUMA 5FD6A 1YTYA 1HKTA 1JVXA 4LK1F 2UZKA 3OO9A 1P4XA 4L18B 1YFHA 3IX1A 1P6RA 3TO9A 1NH7A 3K6VA 3GF2A 2OQRA 4MH5A 1MQGA 1OLAA 1SI0A 3O28A 2VGQA 4ZECA 1YO5C 2V3UA 3KG2A 3VFJA 2K86A 2O6GE 2QBYA 4A5MA 1SFEA 3ZMDA 4A5NA 1J2XA 2EWNA 3VLWA 4I7HA 4R72A 5DUIA 2XAHA 3HTSB 4KPTA 1BI3A 1N76A 4MEXF 1T38A 4F22A 2OK2A 3PUXE 4P0GA 3MVZA 1JE8A 2ACJA 1NNKA 4NTLA 4L9JA 2EFOA 3FF5A 4RA1A 2H25A 1TW2A 2OD5A 4AIJA 2M8CA 5H8FB 2O61A 3MQ0A 3U8QA 3W9VA 4A0YA 4RB0A 4XLNF 3QPTA 2VD2A 4MGRA 3K0LA 5FFXA 5ISUA 3CJNA 2ZYOA 1B05A 2QSXA 1P1NA 3VB2A 4AWXB 3VVEA 1BJAA 3GEZA 2V93A 3H6VA 1BIBA 3E5XA 2UVIA 4CHUA 5EEGA 2DP8A 3EQLF 3RGYA 1SQYA 4XKPA 3DKWA 4Q48A 3E5UA 3W15C 2V84A 2BBYA 1OVTA 1U2WA 1ZU0A 1B7ZA 4ENJA 3MAJA 2XIGA 2D1VA 3HN0A 1SW5A 1ZLQA 1HQCA 3VVDA 3C3WA 3OEMA 1KQ0A 3IHUA 2LF8A 1MZBA 5ICCA 3COAC 3LA2A 3DEUA 1MM6A 2A5TA 5F1QA 2HEUA 5AA4A 4HOBA 2Z33A 5D5XB 5LGUA 1MH4A 1UTHA 4RGSA 1B4HA 1WKMA 2VC0A 3OO7A 5FFZA 4JBZA 2XAJA 3Q5FA 1N0TA 4P96A 4AD9A 4F3BA 5IT9K 1R1TA 1D9VA 2JZYA 4UVAA 1FBQA 5AIPA 4G77A 5L9OA 1ZLJA 3PUZE 3TODA 4ENNA 1TQMA 5A5XA 4GOTA 4LQ5A 3SXYA 2XXRA 2PJPA 3GWZA 3MZ9A 4EF2A 1FP1D 4ELRA 4KA4A 4PGHA 4DCXA 3VE1B 1MS7A 2DTRA 4BHPA 4ELPA 4F7ZA 2JRTA 4YICA 2FYIA 4NF5A 2M1BA 1AOVA 2DE3A 4EJTA 2RC9A 1TFDA 3MZ1A 2I49A 1MXVA 2DFIA 4LGWA 5D5WB 1MDQA 4FAJA 3WU1B 2EFNA 4GWOA 2Y7IA 4BHCA 2FBHA 1FLIA 3U1OA 3FM5A 2K27A 2NYXA 3F8CA 5HLIA 5BMZA 2Y7WA 4R6HA 2H27A 3F6VA 1MY2A 3BOQA 4OIPF 2NUVA 3H6UA 3DP7A 4G7OF 4HQEA 1H76A 1X3UA 5H8HB 3FIRA 4GL8A 3GLXA 2UYEA 4MBPA 3OO8A 4G8HA 4WCGA 2R7FA 4U4XA 3O2AA 1RUNA 4IO6A 1LAHE 2W84A 2IP2A 4G68B 2DQVA 4BHBA 2HCAA 4ZYHA 1Z9CA 1PDAA 5F6FA 3I71A 1I1SA 4P0IA 4HA8A 4M9XA 4HCYA 3RDIA 1XSDA 4KIGA 4EGYA 4OMYA 4MFIA 4XBFA 2Q8JA 1O57A 1ZGJA 3I4PA 5F1RA 5D4SA 3WTXC 4NMYA 1WRJA 4OEUA 2QWWA 4U88A 3K1MA 5BS6A 4EQQA 5ELVA 5HVQC 2CGPA 5DCFA 3B6TA 3D0SA 3N5LA 5FGMA 1DTZA 2OZUA 1UIVA 2W7YA 2VONA 3P7IA 4YFKF 1LFHA 4HZFA 4RK9A 2RKMA 5CJ9A 4OTEA 1I69A 3N26A 3PPRA 4NF4B 3T8RA 5CVIA 1B4ZA 3HHHA 5CLSA 4GVOA 1GXQA 1IN7A 1G3SA 4EF1A 3N4MA 3IO6A 3O9PA 5BUUA 3BJOA 3KCCA 4Z2YA 3FUZA 2DPDA 3DELB 2F7CA 4WXHA 2AYSA 1XCVA 4FATA 4BDRA 1US4A 3LSFB 2RV8A 1R9QA 3FGSA 3UA8A 4IO5A 4I02A 1DMBA 3H7MA 3RPWA 5LRRA 1IN5A 1UHMA 3A3CA 3RUMA 4DQ2A 1ZBMA 4PP0A 1O7LA 1D8KA 4P9FA 1MH3A 2L4AA 1Z7NE 2NWJA 3ECHA 2O51A 5KCJB 5I2KB 2E0SA 2VBZA 1OMIA 4BLAA 3CFZA 4G2ZA 3IB0A 4ZYEA 4OU0A 3GFJA 4IJAA 4I0BA 1MQDA 2H4IA 4F2OA 1XSXA 4XIGQ 3FMSA 2PG4A 2B3BA 1P1OA 1O63A 1ZYRF 2RNJA 1R9LA 1I6XA 3IOVA 1N7XA 5AA2B 2O7UA 1P4AA 3GXOA 1JXSA 3D4GA 2DK5A 4FEBA 3FV2A 5IKBA 2ONKE 2IPQX 4A0ZA 3RLFE 5D6FA 1ZHFA 1US5A 3DQVC 2Z22A 4LUBA 1W7PD 3MZHA 1S7YA 3PMWA 1EH3A 4OMZA 3J7AO 4WX9A 3K9TA 3FXUA 2QMWA 3WGGA 3KN3A 2QYOA 3KSJA 3OXNA 1DPEA 4M6XA 2GXBA 3KZYA 1UCRA 3IC7A 2YU3A 1H9TA 1MXUA 2BEOA 2QBYB 2GA2A 3QK6A 4U4SA 3ML6A 2PI0A 4AB5A 4R6KA 3MC2A 1Z7UA 4H67A 2Q0OA 5D5UB 3ECOA 1Q1HA 1IQ7A 4KN7X 3M9AA 2OLBA 5DCMB 3C31A 4H5FA 3FATA 1URDA 4L9VA 5HDNA 2LKPA 1MM7A 3HOTA 1ZKBA 2Z8EA 3RY3A 4EJOA 2A6HF 2VD3A 3EHSA 1MQHA 3E3KA 1ZG5A 3KBRA 4LB6B 2QS1A 4UV8A 1KA8A 2WV0A 3FXRA 3EHUA 4F3PA 3HRMA 3Q9SA 5AA2A 1SVXB 3GFMA 3L9FA 4M72A 5I84A 3HRSA 4N6PA 2H5YA 3I53A 3ONMA 2XV4S 4ESXA 2F5XA 3M3LA 5LBQA 4EGZA 1SW1A 2L02A 3O6IA 2R9JA 3PD8A 3IWFA 4NE4A 3IL1B 4OMBA 2PFBA 2NNYA 1A8FA 1U78A 3KP6A 2V9VA 4LMYA 1PEBA 3K0VA 3JV9A 4ESJA 1KU2A 5JTYB 1S8NA 2VBXA 3W6JB 2XXPA 5AE4A 1W5TA 3IL2A 3QOPA 4YMBA 3R60A 2KKOA 3SERA 3HHGA 2STTA 2GQQA 3V8JA 1GTKA 2DVCA 3ZMVA 4LONB 4DXUA 4A6DA 4QFOA 5H8HA 2W24A 5AA4B 3L09A 3IAZA 4IO7A 2XROA 2K4BA 3QP5A 3E9XA 3LBSA 1IITA 3CFLA 4LVQA 4I9DA 1NMUA 1JEVA 2MH9A 2HFBA 3WU0A 4XKNA 2BE5F 1ZAOA 5K5QA 3I64A 1BN5A 2A07F 5FTIA 4AVPA 4YAHX 3RKXA 3DPLC 2F5CA 4NQWA 1T2KA 3W6KB 5L3EA 2XD2A 1CF7A 3TDUC 3WE2A 1I27A 5CRYA 4IHTA 2HZTA 2KIFA 1RYOA 1SDXA 3IO4A 4H65A 1BIAA 4U1ZA 5H6RA 3U72A 2QS2A 4EQ9A 1LGBC 1O3SA 3BJ6A 2V1XA 4EXKA 1IEJA 2UXNA 3LSLA 4QF9A 1ZJLA 1D4NA 4R1HA 1AMFA 5CYVA 3LAPA 5H20A 1SMYF 5CM6A 3BWGA 3K6WA 3UORA 1PUEE 2HEOA 2I4BA 1BLFA 2UXXA 2ETHA 4YB6A 1IN6A 1KU3A 1YYVA 1PBQA 1QZYA 1XGSA 1OMPA 1XGOA 2DWHA 5FTHA 4M4GA 3KFWX 2REGA 4XLPF 3CI8A 3QP6A 4EJVA 4LJZF 3IB1A 3T66A 5CMKA 3B73A 1FOKA 3TQNA 3TQWA 1U5TA 4ECFA 5LLQA 3HCQA 1FNNA 2D1HA 4PQJA 5CBSA 5I2NB 1J75A 3V8XB 5TPAA 3U94A 5FB2A 5K5OA 2IVMA 3R7XA 2DO7A 2F7BA 2DAOA 5CBRA 3P9IA 3GZ5A 4FIMA 3KOTA 4EJWA 3UK4A 2HZKA 1XT8A 3AAFA 2QJEA 2JSCA 5L9MA 1KQ9A 1XC1A 2COMA 3USDA 3FVGA 4ELQA 2LF7A 5L3CA 2OAZA 2G7HA 5D8LB 1J1NA 1YS7A 3ROUA 3OSQA 2Y48A 1RKMA 4AB6A 5ILVA 2RINA 2VN2A 3MPKA 1QQIA 3MP8A 3TKDA 3HSEA 1MD0A 1MDP1 5E1ZB 4FECA 2ZMEB 1JW1A 1B40A 1XD7A 2XKOA 4U1OA 4RGRA 1SD6A 1SD4A 1P2FA 1TNTA 3DF8A 1MY1A 1SFXA 4IXAA 1HSEA 1B4AA 4HBLA 1LLSA 2ISZA 4PFTA 2P1SA 2VOZA 3E6CC 3S4UA 5H8QA 1FSHA 3PV0E 2DS9A 3E6MA 2YPRA 3EDPA 3GUDA 2Y0MA 1Y3NA 3P9CA 4RB1A 1TTYA 4F18A 2DWAA 5BQTA 2RDPA 2O84X 3GW2A 1QJMA 3QU3A 1YS6A 1LB8A 5LOMA 2A3SA 2O03A 3PMVA 1H45A 4KMUX 2NVUB 3PD9A 5KDTA 1EH6A 4RPOA 1O3TA 1NHAA 1USYE 4MF3A 4ETSA 1EH7A 3NQOA 2OBGA 2GHBA 2R71A 3FXQA 4NF5B 5LHIA 1M5CA 3CSBA 3ZKKA 3H6WA 4U2RA 4B09A 3PQJA 2O69A 2I48A 5DD4A 2WWYA 1B3EA 3EN3A 3M8EA 1P1UA 2HOEA 2HKOA 1IXGA 4GFRA 1NKXA 3I6VA 3GYHX 2FE3A 2Y84A 4PE5B 1QUJA 1Y3PA 2GZWA 1ELJA 2KJCA 2PYYA 3JZJA 4I2OA 5DCMA 3MCZA 1A99A 3F8FA 3F8BA 2MBFA 4K3FA 2Q9TA 2RQPA 1BP5A 5I57A 3F23A 2F34A 4BDLA 3SEVA 3MQ9A 3LWFA 3HSTA 4EV0A 1OVBA 3C4MA 1FTKA 1NNPA 4QLCU 3CO7C 2THIA 3BKIB 5EEHA 1JHFA 2P2AA 3TCFA 2OZ6A 2ANJA 4XSZF 3IRRA 2Q88A 1RIOH 2A5TB 1DDNA 1AWCA 2HFHA 3E97A 1J5YA 4NB5A 4UNOA 2K7LA 5L3DA 2F2EA 1QO0D 3IKVA 1E2XA 3TOAA 3HPIA 4WEDA 5KVRA 5HS7A 3I5UA 5HLHA 2EFWA 4H1XA 2LAOA 1MQIA 2DK8A 1N3XA 3G3HA 1N7WA 1AL3A 1B2HA 3ZMUA 3RIRA 5L3FA 1LNWA 4N13A 5K2YA 2GFEA 4H8JA 4PFYA 3EETA 2IEEA 4HQMA 1LB2A 1XMKA 3T93B 2OU2A 4XKRA 4E0XA 4IO2A 3LQRA 2CW0F 4P55A 4PDKA 3LSTA 1QUKA 2UVHA 5AONA 1H0MA 4LB5A 3L7WA 1YG2A 3T5XA 3BZ6A 5TU0A 2HDCA 1DPPA 1ODDA 5DYHA 3WTUC 1MDMB 4G6DA 4GXAA 4RJZA 1KGSA 3Q25A 2IW5A 4YMAA 4R73A 5FD5A 1H3DA 1UIUA 4TV7A 3MZYA 5JEIA 3N94A 4N9IA 4U7DA 3IOTA 1S9TA 2PLYA 4CXFA 1E17A 3TCHA 2CQKA 2YSRA 4IPAA 3I3VA 3H3GA 3PMXA 3MEXA 1BC8C 2QQ9A 4OEVA 4F1UA 1MPBA 4RAYA 1XB4A 4GQOA 2FU4A 2IA2A 1PC3A 1R1UA 3U1DA 4G9YA 4OETA 4MQ9F 1LCFA 4NEDA 2XXHA 2E7XA 3SQNA 2XAQA 2J5PA 1MJBA 3ISPA 4DE8A 4ZZEA 3OSRA 2IT0A 3PU5A 3OO6A 4G8MA 3RT6B 1U6GA 3LQQA 3M7GA 3TYHA 4GYIA 3EPEA 3H06B 4D0PA 4HLYA 3WG9A 4IO3A 5DDGA 3WTTC 1P1WA 1RYXA 1W4MA 1OR7A 4FHTA 5KK1A 4E0WA 3V8KA 2PN6A 2DE2A 1QPMA 5ED4A 1SI1A 5E8GA 3ZN0A 2FNAA 3BJAA 1WWXA 3F3XA 2NOOA 3IR1A 3EUHA 2DOJA 2Y75A 4JSDA 1ZG3A 1HW1A 4DZ1A 4QFLA 1LDKB 1GXPA 1MPCA 2J5OA 3PFIA 3FZVA 4WEPA 3GBAA 1FQFA 1FWZA 1QNTA 4KFCA 1MPDA 2A68F 4HV5A 1KYZA 1FX7A 4GD5A 1SYHA 1AOYA 2D21A 2HTJA 2P4WA 4BQAA 3IJOB 1QULA 4HW0A 4ZYDA 2H09A 3I5OA 4Q5TA 4OZ9A 2W85A 1RUOA 3G73A 4FX0A 4ZDMA 4OIOF 4R2BA 4IRHA 4F3SA 1F9BA 2MH2A 1QKAA 3ZMTA 5E18F 4QRZA 4HAMA 1OLCA 2Z23A 1FT9A 3FMRA 3ZMZA 3U2RA 1UB9A 3M3FA 3HV1A 3UGWA 2NXOA 2PBIA 1FYMA 5HM4B 4YIIA 4O3AA 1BI1A 3ZS6A 2Z3YA 3T0YA 4EM0B 1N04A 1R36A 3MPLA 4HDVA 2MLGA 2P8TA 2VE9A 3VLUA 3SKPA 3J81K 3O66A 4F1VA 3G7WA 1NH8A 2HQRA 2DU9A 3VFZA 2BJJX 2JTVA 5ILSA 1G4DA 2ALUA 2K02A 1ZTYA 2P5LC 2ZNUA 3SDFA 4L9NA 5J8CA 1J59A 4JQFA 3H6TA 3O6HA 3ZPLA 2ZNYA 3BDDA 3LSWA 3WTZA 2I3VA 4RYAA 4ZEIA 4GRKA 1Y4CA 5HPQA 1SMTA 4GF8A 2DWIA 3FV1A 1K7AA 4WXJA 4OINF 3E13X 5EHMA 3KJTA 1B59A 3F22A 1B3GA 5DV5A 3GXAA 2KIMA 2VOPA 3CSGA 3H3UA 4OHNA 1FSEA 3KZZA 1G3TA 4C1TA 4MLVA 3RPQA 5H6QA 1LBBA 1SD3A 3L2CA 3HSRA 5D8KB 4CICA 3GFLA 3ZQ7A 3K1PA 1DUXC 1PP8F 1FTJA 4IHSA 1WVJA 2KJBA 3C34A 4F19A 1FQDA 1FQBA 2HS5A 4RY1A 4GL0A 1Q35A 1LJ9A 1YAEA 3G3IA 3ABTA 3KEIA 3N6TA 2ZYMA 1R5GA 3FJ7A 2ZMEA 1ATGA 1FYKA 1B9MA 4QHQA 1B7UA 1VSOA 2DXYA 3K6UA 2M8EA 4CGZA 1LDDA 5L9SA 4ZE8A 3JTHA 2FMYA 4HCWA 4U0VA 3A09A 2ISYA 4AIKA 1JHHA 4EQ7A 2P0SA 1FQAA 2XXYA 4G4PA 4P5OA 2F6PA 4Q0CA 1STZA 4JB7A 3PQKA 2EA4A 1B5JA 2RC7A 3K01A 2XRNA 1O7TA 5HS8A 4RAZA 3C32A 1F1ZA 1HW5A 4L17A 1B9NA 3D5LA 3K2DA 1ZRCA 1BC7C 1ZMGA 4F3GA 4I98B 4KIFA 4KDPA 2HXWA 2I3WA 2PT1A 2BGCA 1IF1A 2Z8FA 4HF2A 4G68C 3F11A
chains in the Genus database with same CATH superfamily
2E2JJ 1FBUA 4A3JJ 4YB7A 1UZCA 3LV0A 1TQPA 4ZEDA 3I59B 1FCKA 3DCFA 3DTKA 2P5VA 3KLNA 2LSOA 3S2WA 5K5RA 2ZXJA 2H9BA 3CG1A 2ZYKA 3QAXA 3S2VA 4EXLA 2R7XA 1N84A 1T33A 1PJRA 3M1EA 5EZHA 1JETA 1SW4A 1G8XA 3BROA 1W5SA 3VWBA 3IK6B 2OCCH 2D3IA 3JRFA 5ITPA 1GVCA 2DCEA 2CYYA 2X1EA 2CZIA 4DXBA 4N4UA 4PAKA 2R6GE 3FXMA 1A31A 3JRDA 3JAMZ 1ZREA 2ZO4A 1TXFA 2F78A 1T8IA 1FOXA 2KLFA 4IVNA 4LITA 3WAEA 1L3LA 1Y9UA 1ZTRA 1Z0XA 2WBDA 3HHFA 2BY1A 2VASA 3F21A 3GLBA 4C2UA 1YJNI 4IZZA 1WJFA 1YQAA 3HG9A 3CR9A 1BBYA 5JK4A 2NRAC 4FEDA 4V19K 3OV8A 1K83J 1LAGE 3TKYA 4KT6A 1MBHA 4O5VA 2HTSA 2ZZWA 3TEPA 1IMDA 1PP7U 1MRPA 1MNMC 3KGCA 3O29A 2WADA 3U1KA 4QSCA 1B52A 2RF1A 2CU7A 1S5LC 4UVBA 5I58B 3C7JA 3ELKA 5F0HA 1IRGA 2A5SA 3EKIA 2F5FA 2R93J 1S29A 3ZQGA 3J7AY 1ERDA 3ZMSA 2E1NA 2EINH 2H6CA 5FKOA 5FLXZ 1B5IA 2OJED 3KYLA 1EV7A 2MA3A 2DT7B 2EV5A 2OA4A 2ELJA 4BXUA 4A0XA 4LLNA 2XXQA 2EB7A 3JYRA 1FRPA 1JVYA 2Z8DA 4OFOA 3TFLA 4LLGF 4MCOA 3Q27A 4RA2A 1FBDA 3M3KA 5K2XA 2KISA 3IP4B 4N0BA 1ON2A 2VT3A 5H8NB 1F5TA 4BQOA 1JP4A 3CMAI 2DYRH 2X6XA 2OUMA 2V7FA 5CMCA 3HTUA 3CESA 5DUKA 4LA9A 2CRGA 3A01B 2FOWA 3IWZA 3V7SA 3ECRA 2C6YA 3KEQA 3KZIC 4PFBA 5B70A 3GX4X 1VQ7I 4WKMA 3K4LA 3MVPA 3TTRA 5CVJA 4M71A 3TPAA 5E1XA 5F0FA 4RS8A 2FBIA 5JR3A 2PMHA 2DDKA 2XF7A 1U8RA 4YU0A 3FIWA 2RCAA 2DMPA 2ESHA 1SW2A 1L5TA 3U65A 1MY4A 4D5CA 5ERIA 1F9NA 1NV7A 5FHOA 4L0ZB 1OKRA 4PDHA 2PMZA 4NC6A 3MYUA 2EQRA 1M5BA 1POY1 1Z7ME 1PDNC 3LA3A 3VYTB 3A2KA 2V4CA 4XRMA 1UFMA 3K1NA 5IM2A 2KZVA 2ONRA 4LD5A 2VJIA 2K4JA 3G1OA 4YIFA 4ESFA 3WTYC 3T9UA 3HOVJ 3FBPA 3TUSA 5EYHA 3SHFA 1I6QA 5HBCA 1IXRC 1X1AA 1BKAA 3IOUA 4RB2C 1SANA 2B9SA 1Z3XA 2BYVE 3OSFA 3EUKL 3CFXA 3PPQA 3B6WA 4DYCA 3TDJA 3VYUB 2R5YB 3F8NA 1BK4A 1D5YA 3SJMA 1WODA 2RC8A 4OENA 3CG3A 2VPNA 4MTDA 1P7IA 3I0TA 4N07A 2JA2A 3A4CA 2D45A 1ULYA 1OQHA 1FPQA 2MG4A 2V3TA 5CRYA 1P1QA 1LAXA 5DVJA 3E78A 1GV8A 4GO1A 3E3VA 4KYWA 1YXIA 1BW6A 2ZCWA 2ADUA 1D0XA 2DODA 2PJRA 4F52A 3HZJA 2MFZA 1JEUA 2P81A 2WTEA 3K4UA 4B8XA 4ONYA 2XA5A 3DTIA 3SDGA 1VZ0A 3IAM2 3OR1C 5FHNA 3PUVE 3RQTA 3OYKA 3JAMK 4O3MA 2ABHA 2DXIA 2EIKH 1GR2A 1MXZA 2A69F 2RKHA 5EGOA 4UUSB 1XS5A 3J7YJ 4Q8RA 2Q8MA 1MXYA 1FQEA 2I4CA 4IR8A 1N3WA 1YITI 1X1PA 4UACA 4PCDA 2QS4A 1NFTA 2DQRA 4ZE9A 3JRGA 2Y9ZA 3CVGA 5I56A 1Y1ZA 1MNDA 4H0WA 4BY1J 4WXDA 3K00A 2VJ4A 3GO5A 1IUDA 2Y7KA 4X1DA 1T6SA 3BTLA 3PSIA 1QGPA 1B5HA 3OYBA 3MWBA 1TBXA 3AG2H 3TELA 1S72I 1FZPB 2OCUA 2O9LA 4ESWA 1RESA 5LD2C 2VPLA 4U21A 4MNPA 1A55A 4EATA 1WDNA 3OYIA 4OFJA 3E5QA 2XX8A 3TAJA 1URSA 1M5DA 1IN4A 4WF2A 2L3DA 2YPNA 1DCUA 3SESA 3BPVA 1T0FC 5D5VB 2XGEA 2Q2AA 2B63J 3OENA 2H6BA 2B7EA 3K6GA 3MVWA 2OX3A 2CWEA 1NH3A 2F35A 2XD3A 4JDFA 4BDOA 2PEXA 2P3NA 3F9KA 2DVZA 4BQNA 4A3CJ 2Q89A 4XLFA 3A29A 1SFOJ 3THIA 1MBKA 2ELHA 2DFEA 3OS2A 4ZC3A 2HVRA 3OEKA 2FNPA 5HLGA 4YKIA 5D6EA 1R23A 1TT5B 1XG1A 1X2MA 2DA4A 4XEQA 3HYIA 2G29A 2V1DA 5JI6A 1MXWA 3M8UA 5FHMA 2G9WA 3LSRA 4X9TA 2FXAA 1MBJA 1MY0A 1DK4A 4OFLA 2GAUA 4GX3A 3MUQA 4L5JA 1ZRFA 2E2IJ 1B1XA 4CDGA 4POXA 2OWSA 4Q47A 1G3YA 1ANFA 1NNTA 4BDMA 5IAIA 5IYCJ 3HO7A 3T9VA 2JPBA 4Z7EA 5I5PA 1J7KA 5E20A 2YLNA 2NVTJ 2LLKA 3CQZJ 4NUBA 2NVYJ 1MBGA 2L7MP 3LSJA 3ZN1A 2HPGA 3WG7H 1TWGJ 4I09A 2O6AA 4R9GA 1JGSA 5DTBA 4MHGA 4BH9A 5ICQA 4U22A 1LPQA 1ZELA 4JWXA 2Q74A 4XKQA 2R7UA 4GIZA 1RDYA 2WAQA 1SD7A 4IL6C 1S9HA 4P9UA 1XN7A 3J81Z 2HPIA 4PZJA 1S7AA 3P7NA 3HOWJ 4Y7NJ 4IY5A 1IN8A 3JR9A 1YCJA 3RT8A 4X1BA 4ZJZA 3E6BA 1VFCA 4TQUQ 2QSHX 1XDUA 1I5ZA 1UHWA 1V55H 3WHCA 1OIBA 2BHYA 3I58A 2QLZA 1NV3A 2FIXA 4DLDA 4EJUA 2DFHA 3ZKLA 1LFGA 4D7MA 4GYGA 3KN7A 5M2VA 3FJMA 1WHUA 3VLVA 4BE1A 4PFPA 1P4WA 3S1QJ 3FXLA 5J1DA 2KDOA 3M8JA 5HS9A 1HCRA 1JQFA 1P99A 3QRFF 2HXOA 3HPGA 2DA1A 2KZGA 3KP5A 1JTYA 4A6EA 3PL8A 2QVRA 2E60A 2Z2SB 2OPTA 3H35A 3PIOF 3CD6I 5DT6A 3PPPA 3MKLA 1BIYA 4JXIA 3OS1A 3SEXA 3CZ6A 1YE9A 5EZGA 6PAXA 4N9HA 4HNTA 3OMBA 1QUIA 5D4RA 3KSXA 4GLIA 2P7VB 2F5EA 4GCVA 4H8IA 2WX9A 4BDQA 3D1NI 5I56B 4XNFA 4DNCA 3SEYA 2OC6A 1WJDA 1FPEA 3G3GA 2NS0A 4MNUA 4XOPA 4A3IJ 2X9DA 3FHZA 2HYGD 1UQWA 2YJPA 2DDBA 1LSTA 3RJPA 1BM9A 2IJLA 2ELKA 5LGTA 2O1LA 2XXTA 1B1HA 2CMOA 4C3IJ 1Y0UA 1U5TB 1O64A 4M1VA 5H8QB 2JT1A 4G94A 3ZGKA 2QUFA 1EJ9A 1TWYA 3JSPA 3MVXA 1X1DA 4I1DA 2EA2A 2QVUA 3TP0A 3EYIA 4LK0F 2H98A 2PX1A 2XXVA 2R7ZJ 1FC3A 5JLXA 4IQ4A 3WAFA 1JGGA 2E5NA 2B4MA 4NC8A 3SEWA 1TFAA 2ZJ2A 3TO7A 2PMUA 2QVOA 4TOZA 2QM3A 2Y9YA 2CJJA 4O6JA 4GDFA 1NI9A 3QPHA 3N6UA 3VV5A 1FPGA 3H5RA 1FSAA 1XMXA 2Z16A 3TTNA 3GBBA 4NF8B 1CGPA 2FD5A 3KETA 1WH5A 5DM7F 1XPXA 2E7WA 1N77A 3PUFA 4FX4A 3FBIB 1MNEA 4EVIA 2CO5A 4XICA 2K9NA 1ZG1A 2VE8A 1E3HA 3T0JA 1Z67A 3R4KA 3BTJA 5J1UA 3N05A 5FRMA 4KI0E 2M4GA 5EEAA 3GFIA 4L9TA 3R61A 3FVNA 2RC4A 3BPXA 2UVGA 1YYZA 2AL5A 1Y1MA 3OYDA 3V8LA 2LMDA 3VVFA 1XVXA 4B3AA 1RC9A 1ZN2A 4M3BA 2QSFX 1TT1A 4X04A 5ET7A 2W7NA 3CUQA 4GWWA 1E3PA 1V4RA 2IBDA 3MFKA 1Z6RA 3JW4A 4XQFA 2KHMA 1FPKA 1KU9A 1IXSB 1KWHA 2GHAA 3C36A 2V79A 3HOZJ 1B58A 4MLQA 2OTJI 1G2HA 1Z6TA 2VOOA 4MHFA 2VHAA 4HW8A 1BA5A 1D1AA 2KRFA 4R74A 1SAXA 1QA6A 3Q26A 1ETKA 4IGRA 2M3AA 1TQIA 3ASNH 3I59A 5I59B 2KMUA 3TQLA 2ECCA 3P9KA 4H45A 2HI3A 4Y4RA 3CCEI 5F0CA 4ZEBA 3M1CA 2DA6A 1SFUA 4KR5A 2X51A 4UY8I 9ANTA 4G68A 1NV4A 3PNYA 2Y7PA 1FIAA 4DIGA 2DXRA 3Q9VA 4ISUA 2VXZA 2Y30A 1MXXA 1YZ0A 3V5AA 4F1YA 1NV6A 5IYDJ 5AA1A 4RMNA 2PQ8A 2CZLA 1YW7A 4XLHA 1A6QA 4JK1X 2Y0SN 4YFNF 4QSEA 2XHKA 4EDPA 1OPCA 1TZLA 3OYAA 4BE0A 2QENA 4HG2A 1PB7A 4GGGA 2KFDA 2Q2EA 3H0DA 1Z3YA 4UUVA 2EFQA 1B72B 3MWMA 3LC8A 3FX3A 3MBPA 3R6UA 4IO4A 4O94A 2FQ3A 4NF4A 1HA8A 4GWSA 1D0ZA 3HSFA 4P1WA 4R79A 1FPLA 1R6RA 1D9YA 4OESA 1LVAA 1XGNA 2EJRA 3QXMA 1J0RA 2LY2A 2OJTA 4PFUA 3V4GA 2HAUA 1D5VA 3KC1A 2IS6A 2CMPA 1A04A 2M0MA 1K78B 2QS3A 4I0AA 2ZFWA 4LG0A 2E1MB 4OIRF 2DYSH 2BJIA 4NN3A 5I58A 2EK5A 3FKJA 1R00A 4PGGA 1S6LA 2BY3A 4JVCA 4HX8A 1YW9A 2DOAA 1MKMA 4KT5C 1S50A 3J80K 2ONSA 2AXLA 5B3SH 3VPRA 2X85A 2LBFA 3U21A 1RI7A 3LFKA 2CH0A 2RGVA 4L5EA 1ZR4A 2XAGA 4RPNA 4Z0IA 1IUYA 2W00A 5IOYA 4ZEKA 4IB2A 5FKLA 1QZEA 2FOKA 3LSIA 3CC7I 3WHBA 5ICTA 5I3SA 5IT9Z 4OXVA 1OQGA 1LCTA 1TWHJ 3WTSC 3HGGA 1H43A 3K10A 3CMMA 1SYIA 1DTGA 4PF8A 5JHUA 2VKEA 1POTA 4ZYAA 1B8IA 5LHGA 4F31B 3CLOA 4Y13A 1MMGA 5I2KA 1Z1DA 3HIFA 1MBFA 2UWMA 5K7FA 1DOTA 3ULQB 4CA0A 4IOAF 2F8DA 2DBBA 1D3KA 3LSLA 3FD3A 2RQQA 3OIPA 2Q2EB 5IYBJ 1FJLA 2VC1A 2V9PA 3VSLA 4G8NA 1OQYA 5CPRB 3JRIA 1N25A 5EYRA 2CUEA 2DT5A 2VUMJ 1PB9A 4O3CA 1XMAA 3U92A 3RTRA 1LQ1A 5KZTA 4I8CA 4JYKA 1NTCA 3CRBA 2CV1A 3BBRA 5H8NA 5CVRA 3SZTA 4HNVA 3ZP5A 3ODBA 4POWA 1LE8A 2ZB9A 2QQBA 1RR8C 2LP0A 4G7HF 1HXDA 1DP7P 3W2AA 4IKFA 2EIJH 4EM2A 2MKZA 1SFKA 1FBSA 2CUZA 5FBPA 1Z05A 1Y8RB 1MJAA 3R6SA 1REPC 4IEJA 4D9JA 1PB8A 4NF6A 1HBXG 1ZR2A 5EQAA 3CP2A 4FT8A 3B7DA 1MMDA 1PVEA 2L5QA 1GVJA 3T9HB 2MC4A 2B0LA 2K5CA 3RI4A 4FQGA 4G7ZF 5JVTA 2DA3A 5HDKA 4Y33A 2UYFA 2GWRA 3EF7A 3S9LC 1MY3A 1Y3QA 4E7IA 1B3HA 2JMWA 1Y6IA 2X7QA 3MSTA 1JJ6C 2HYFA 1W5CC 2I58A 3DM0A 2K85A 1BOBA 3MKZA 2JWTA 3O3KA 3CUQB 2PBWA 1SD5A 1LDJA 5LRSA 2DLLA 1ZIUA 3HM5A 1VR5A 2HZDA 4UA8A 4QXDA 1CF7B 1LBVA 2RCBA 3ABKH 3ROJA 1P92A 1VNDA 1A7LA 3KX2A 4ON0A 2CFXA 1IW7F 3IOWA 5A5XB 2JUCA 3BTCA 4MAGA 5KCJA 1NG6A 1MJ9A 2EH3A 4JWYA 3H4ZA 2K9MA 2ZKZA 1HDPA 3RYRA 3WODF 5J8FA 1T39A 2P6SA 1J9IA 3ZQCA 2YX4A 2IGOA 2YS9A 3X2QH 4CUGA 2JPCA 3GTGJ 2HOSA 4FE8A 1R5ID 1R58A 4CO8A 3BFTA 4M6YA 2KIUA 3SZPA 4NF8A 4HS7A 1T98A 4B44A 3BCBA 4N81A 3VYRB 2X7PA 5ICEA 3CHGA 4NF6B 3HKZN 4KQPA 3DP6A 4C0RA 2X0LA 4X0GA 4Y17A 1I3AA 2XGXA 3FM3A 3RQ4A 3Q0VA 3K02A 4TLLB 5LGNA 4HE0A 4ZH4F 2HQ0A 1A8EA 4KIBA 3FXOA 4YFXF 5M5XJ 1OYWA 2OBPA 2HR3A 1JKOC 1R5HA 1B3LA 3KFMA 4R2FA 2XX7A 4JBAA 2FBKA 1JJ8C 1W1WE 1USTA 2R3SA 4KN4X 3LSXA 2GLOA 2DOEA 4HX7A 5CQEA 1VQMI 4BNCA 5I57B 4DW6A 3CC4I 3EHTA 1FBCA 4RB3C 3K4CA 1H89C 3J80Z 1I6HJ 1A54A 4LP2B 2RNGA 1GHCA 3E6DA 1ZGAA 3ZCOA 3FBNB 4DBRA 1APLC 1I1GA 3KJ7A 2O7IA 4RAFA 1HKQA 3MP1A 4YKKA 3AKZA 5BPDA 2F5DA 3S8PA 1A5JA 3GVAA 5BOXA 1JKPC 1S7OA 2GXAA 2NS8A 4IHYA 2GA1A 1QGXA 4GFBA 1OYYA 3PGFA 4QFKA 1HSJA 3H1CA 4RNSA 4QBAA 3K4MA 3DP4A 1U9NA 1EU8A 4BDZA 1CE2A 3GZGA 5DW8A 3HB9A 5BNGA 4C3JJ 5K7HA 2UVJA 3QSLA 1T56A 3BR1A 5AA3A 3T9XB 3H5NA 2XX9A 1R1VA 3GTLJ 5EYFA 2KIQA 2KQRA 4YEJA 3RTFB 4BE2A 4E6KG 3FK7A 4IO9F 5LEKA 5BPIA 2E1CA 1B7HA 4LATA 1GDTA 3KOSA 2M8GX 4RGUA 1D9QA 4MTEA 1KU7A 3I9V2 5AIQA 3R0JA 1O3RA 4HDUA 3IORA 1NG7A 2QZ8A 2QKLB 3RPUD 4H46A 4H6DA 4XFEA 1K61A 5EQ7A 2DYXA 1V5GA 5LHHA 2B3FA 3V7CA 4U0YA 3B8BA 3CCMI 2X1CA 2UUZA 4M9ZA 2VBWA 4E70A 4KHZE 3CUOA 2ZSIB 3R0AA 3OYHA 2HVSA 3C9HA 4YKPA 3TTKA 3FWEA 3B6QA 4THIA 3FMQA 3RN8A 1VFDA 3CDIA 4JP0A 1S3JA 1FQCA 4BYYA 4YRVA 2L01A 3E79A 4FORA 4I62A 5CC2A 2XKPA 3BCAA 4HV6A 3J7ZI 3DP8A 5JHFA 3HOSA 4KFQA 1LEAA 3CCSI 1FPJA 4RDUA 4IY6A 1B6AA 3IUOA 5ICGA 1TT0A 3DBRB 1XOCA 4KCCA 4ASNA 3E0JB 3LSKA 4ESBA 4LZ8A 3SEUA 3UN6A 4HF1A 4C1UA 3DLAA 5H8FA 1QVUA 4UUTA 1WPKA 2XAFA 5TJJA 2JA5J 1B3FA 2DPUA 3PPOA 1LUJB 1KYWA 3K2ZA 1IUFA 3B6CA 4E7KA 5KCMA 2VKHA 3K70D 2FA7A 3AG4H 2ZJQF 2YX7A 3QYTA 1LEBA 3RKWA 4QFPA 5CMMA 3C1DA 3BFUA 4BGDA 4D7NA 3TW6A 3C18A 4JWOA 5DS9A 1FP2A 4ZZLA 2WEFA 2FF4A 1T95A 4X6AJ 3BR5A 2FEZA 3KP3A 2CG4A 2XASA 1IZ1A 1MSEC 2FRHA 2NAZA 2KDZA 4LZ5A 4PFIA 2ZXWH 5DEXB 3FDYA 2FSWA 4NHJA 1QPIA 2I10A 1USYH 2ZZXA 3O97A 1BOAA 3F8MA 1ZARA 1IRZA 1LAFE 3ABLH 3PUWE 3BZCA 1NK3P 3AXFA 1XDSA 1XGMA 2HU9A 4EQBA 1QRYA 3RKYA 1FOYA 3CO6C 3CDLA 4XONA 5L3GA 3S1MJ 4NWCA 4IGTA 3HEFA 2XB5A 2VQHA 3PPNA 2W48A 1POGA 2I0CA 1OCPA 1BR2A 4OOIA 1FMWA 2X4HA 1G6NA 1KQ8A 2L54A 1UHSA 3QWLA 5E17F 3FVKA 1SEUA 3JCUC 5K1YA 1B9JA 2CQXA 3MW0A 3RYPA 3SETA 3S9MC 3K6XA 2Y69H 3QAHA 3REOA 5J4VA 5JFRA 3DTEA 1NNFA 4TLMB 4L0YB 4S04A 5FO5A 2VODA 2XHDA 1EH8A 1J09A 5L3BA 4A12A 1QVSA 1DPRA 3KEOA 3RTWB 2XVCA 4A3FJ 4KYEA 4OERA 2ZJRF 3PSFA 1U3EM 3RCOA 1I6BA 1HSLA 5FRNA 4GWZA 3JRBA 3TDZC 3A01A 2L0KA 3KP4A 1VQ5I 4XLEA 4M73A 1VE4A 2HKXA 2O68A 2M45A 4XKWA 5FKKA 2Z99A 3GZ6A 4OIQF 3QUJA 4S05A 2XSDC 3D1RA 1R7JA 3RZDJ 1IAWA 2KR0A 2M7BA 1KA0A 3VOEA 3FVOA 3F6OA 2ZMEC 3L2QA 1FPFA 1K6YA 1FTLA 3GZNB 1C0WA 1JW5A 4F39A 4M74A 1FW0A 2Z9OA 3EYYA 2IRFG 1JNFA 1NUWA 2E1SA 2XWVA 3OYNA 3CMYA 2ZXHA 2Y7RA 1IIWA 2F7AA 4HYEA 4BJ5C 1XHYA 1LB9A 2QMXA 4LG3A 3H03A 3W2WA 1ON1A 4P1EA 3QUFA 3HKZA 3RPUA 4CZZA 4XSXF 2E1MC 1RNLA 2XUBA 4ANJA 4DIQA 1CQTA 1RDXA 2V3QA 3WTVC 1X1BA 3T96B 1TW3A 3QODA 3S9NC 4UXNA 2G0EA 4CYDA 2ME6A 5F27A 1Y4TA 4V2GA 4A2UA 2CV2A 4PCQA 3H92A 4ZDOA 3BP8A 1Y20A 3SFZA 1LBZA 1QKBA 1IO2A 4Y15A 2XXWA 2GIVA 2JRMA 1VQ8I 4PBQA 3MJNA 2EFPA 5B7DA 2XB0X 3OIOA 3WE3A 4HNUA 4DI3D 4MX6A 1H9GA 2W25A 2IAIA 3NEUA 2ICWG 1M5FA 3QQAA 2LREA 5IP7J 2O0YA 4IRIA 1GLNA 1IXHA 1FJ6A 4F2QA 2IA0A 5E3NA 2LNBA 1PBPA 4AS5A 5E8IA 1K78A 1EZOA 4EEFG 3LUZA 2F97A 1U5TC 2D2WA 5KDTB 2HNHA 4G6QA 4BU2A 4C2TA 4P8BA 4CCMA 2LH9A 4N8YA 2RREA 2R0QC 3PNTA 3VXBA 1KONA 3Q0WA 5C3EJ 2M5WA 3IB2A 4U7BA 4YZZA 4KCDA 2F6CA 2PMSA 1Y1VJ 3HUGA 4MO7A 1TNSA 2FMLA 5TISC 3L00A 2HWVA 4XN0A 3RSNA 1RZ4A 3S15J 2B65A 3O6GA 4AC0A 3ONMA 1X4PA 4GWUA 3DV8A 3OOPA 3HOUJ 1T0FA 4ZZAA 1YX3A 1H44A 5ET6A 3E7LA 4PGPA 2CSOA 2MD5A 3Q28A 1OCCH 5TPAB 5IPAA 2QVVA 1XX5A 2ZXTA 2ZBKA 2O3FA 3SFIA 5DD8A 1GVDA 2AS5F 2CFOA 1JTXA 2DDAA 4KICA 3TP3A 3RYDA 1R1NA 2XPWA 1Q1KA 4GXOA 1OFCX 1II5A 1ZLKA 5TRDA 2VQCA 5IGAA 4KYDA 4ZDPA 2M0CA 4YG2F 2W57A 1YJWI 2V26A 3IRQA 1FYLA 2PT2A 5JTYA 3MZBA 2Q1ZB 3CJQB 2JA6J 1FY7A 2QQAA 3P5JA 4M3EA 1JT0A 3PUYE 1Y56A 2A5YB 1YHQI 2IA4A 4ZZDA 5TP9B 1B32A 4ZYGA 3MVYA 1WI9A 4AYBA 2I6EA 2REJA 4OWDA 2PFZA 2VT2A 4L5IA 2MC3A 3E4RA 5IP9J 2I5UA 4Q30B 4W1UA 3ZQHA 2D5WA 3G3JA 4N4NB 1HKSA 3I54A 2LC2A 3FK6A 3DPTA 5GTHC 1WQ2A 1K9ZA 1H8AC 5FJ8J 5IT3A 4O7MA 2AHQA 4ELOA 3R26A 4BAYA 1VQOI 3U9GA 3OSGA 4H0EA 1YOVB 2MLKA 5CVVA 1OCOH 3BLYA 1ACIA 1JKRC 1CB6A 1KZ8A 1UTBB 2H94A 2X26A 4A3BJ 5FLXK 2VB6A 4ZEFA 4BKXA 4KYSA 2RN7A 2RAEA 2XXXA 2V6CA 3IH4A 4A69C 3UNGC 3VODA 2YR2A 4XLAA 1L0OC 1I6AA 1MG1A 2GXGA 5HNHA 1B0HA 2CQNA 2WBMA 3OYLA 3G3KA 4OWRB 4A3KJ 2OWTA 3HRTA 5EG0A 3IKTA 1R22A 3TGNA 4PE3A 1YTVA 1BI0A 4NQWB 3ILUB 2V1UA 3QIMA 4R75A 1HF0A 2M30A 2CEYA 4KISA 3T1BA 4OQOA 3G6EI 1UTHB 3FASA 1ETOA 3G3ZA 4WWCA 2M87A 2FA5A 3KIOA 1LFPA 1VTNC 4MQVA 1P9QC 1YLFA 2G7UA 3C35A 2Z5UA 5BWJA 3A3UA 3KLOA 2VIXA 4HTGA 1JKQC 1DPUA 3OD7A 3H3VK 2Q8KA 4X48A 5H2FC 4MEYF 5EQ8A 4XK4A 3WGHA 3CF5F 1MMSA 1MQJA 2VP1A 4XRFA 4LZ7A 4OVSA 4RGXA 4DBQA 3T22A 1AIVA 3OELA 1LE8B 4OVJA 1EZ9A 3KE2A 2OZZA 1R6ZA 3CDHA 3UP9A 3KPHA 1MMNA 2V9KA 4ENKA 1Y39A 1K79A 2XXIA 1SAUA 3IJXB 1UJ8A 2MGQA 1WSUA 1URGA 2CEXA 2ZNZA 4ND9A 4X8RA 3VXCA 2I0BA 2AO9A 4JSOA 4O3BA 3W6VA 1ETXA 5GAGJ 3ZSFA 2IXSA 2H99A 3H36A 3JSOA 3DLNA 5B1BH 1NV0A 3TMGA 1D3YA 2O8XA 1FTOA 4WXCA 3V7RA 5ILUA 1FBHA 2KL4A 5HOOA 2A61A 4M3GA 4P1LA 1JW4A 1O3QA 5F24A 5AA2D 2ZC2A 3G1LA 1USSA 2QSGX 3VEPA 1BI2A 2STWA 2TDXA 4I76A 2L7KA 2UXAA 5EDNA 5F7VA 5DYMA 1Z91A 3SZGA 2EV6A 4KMFA 3TCGA 2VBYA 4GBWA 2O1MA 4IRGA 2R7DA 4PFWA 1W7PB 2AL4A 3DKYA 1TLHB 2F6GA 3MAMA 1IJWC 1OYIA 5B66C 3OOAA 3F0CA 3I3LA 1P7JA 4OAYA 3L2WA 1IXCA 2DE4A 2F36A 3V89B 3JTGA 1B46A 2BXYA 3S1NJ 3ERED 4U0WA 3FJGA 5DEXA 1YIOA 2GIZA 1EYJA 3SEZA 2WYKA 3HPHA 1QBJA 1OLTA 4E7HA 1JUPA 1TL8A 3V83A 5A2QZ 1NK2P 4ENMA 4XXUA 3CLQA 2ZMBA 1SBPA 4IQJA 1LBCA 3D4CA 3U93A 1W0TA 3KN8A 1B1BA 1HSTA 1M5EA 2GH9A 1FIPA 3UIFA 3C2BA 3FHNA 4UVCA 1O7FA 5TP9A 1XVYA 2P5KA 3ZQFA 4ZS9A 2WC2A 5CVUA 4EM1A 2KQZA 4CCOA 3WGIA 1KA1A 2DTZA 4OYVA 4R9FA 1IGNA 3LUYA 3GCMA 3N97A 2DMUA 4AM3A 5CKTA 3K69A 2KT0A 4DXCA 2FVZA 2QRYA 5DVIA 4QTRA 2OQGA 5ITOA 3TZAA 1A40A 2DWJA 2CQ7A 2BV6A 3M8FA 4CH7A 3ABUA 3B02A 2A6EF 4V2FA 2HAVA 3S16J 2DSFA 4LFUA 2QL3A 4EMSA 4UHTA 4RXLA 5LEJA 5GAEJ 1INPA 4R6YA 4JVIA 3T8TA 3S14J 3QU6A 3LAJA 1F4KA 5F08A 3S93A 1FPIA 3S32A 4IF4A 2VI6A 1Q1VA 3CUQC 3O2PE 4GX6A 2FBPA 2NNNA 3F72A 1IMFA 1IXIA 4GWXA 3VDFA 2WAFA 1MDMA 1JT6A 5J47A 3EQ1A 4N91A 4M9SA 4OANA 2ZNTA 2HGCA 2IEKA 4BQQA 4WK8F 2HOTA 4I01A 2WV1A 1VQ6I 2L7ZA 4BDYA 2DA5A 2ECBA 2GRVA 4BDNA 3IFAA 2XXUA 4Q4ZF 1ETYA 2V25A 4A3EJ 1ZRDA 1W36C 4K2EA 2QPQA 5E79C 5GTIC 5HDGA 3OYCA 1MGTA 3ASOH 3JRCA 1NL5A 4LQ2A 4AQ4A 2CW8A 3ILTB 4QFNA 3CTAA 2DI3A 2ZNSA 3C2HA 2ESNA 2K3PA 1G3WA 3BG7A 4LG0B 1VFEA 1T0KA 2EV0A 4HF0A 4JX4A 4BL0B 1K6OA 3NARA 2H1LA 4AIHA 3H3ZA 3BT9A 1V5EA 4G8XA 3LR1A 3W2VA 4HXVA 3BY6A 5M5WJ 4NHBA 4XTCQ 4NWDA 4PETA 5KAFC 1FEXA 3V42A 2AIXA 1XSVA 4RK2A 5ICFA 4BY7J 4Q5SF 4UV9A 1DSNA 2LTPA 1V3FA 1OCZH 3KP7A 2LDUA 3DXJF 3TOBA 2IA1A 1FTZA 3L6GA 1QW0A 3NRVA 2P6TA 4KNYA 2LFBA 3ERMA 5E1WA 4GXSB 5I2NA 2G93A 1GGGA 2L4MA 3LA7A 3G3FA 2RVCA 3CIJA 2PVUA 5EHSA 4YKJA 1F36A 3WTWC 3O6BB 2HXIA 5EQ9A 4MFDA 1B0LA 3IFCA 5F64A 2HQNA 2WY7Q 2ZFUA 3NWSA 4HX4A 3KZGA 4XF5A 3TTLA 3C33A 3S9EA 2CS3A 4J00A 3W9WA 3MP6A 3TL4X 5CMBA 5I59A 3KP2A 5J6XA 4EUOA 4M3DA 3TTMA 1XCBA 4FJPA 3HJEA 4HLXA 1DBZA 2O5RA 1B6HA 4DCYA 2OWZA 1X19A 1ZH5A 4YB5A 5DVFA 5L8DA 3TO6A 4QWQA 3LOCA 4R8HA 4MNCA 3L6HA 2WKYA 1Z7LA 1LVKA 2HZLA 1IRFA 5A2QK 4QSDA 4F29A 2P7CB 3W3CA 3G2BA 1W7PA 1HW2A 1LFBA 1ONVA 1BTJA 1O4XA 2L2OA 3HRUA 1UMQA 1DGWY 3OWTA 4LLLA 1UTBA 5DEQA 3GYYA 2BZTA 2DQLA 2ID6A 1LFIA 4H5GA 4UB8C 1YPNA 2F3DA 3DLLF 1BJZA 5GPAA 2FNCA 3HC7A 2YUSA 3NOHA 5CI5A 1QZZA 2K9QA 2DN0A 4FTHA 4U23A 2HDDA 1R71A 2PMZN 4KITB 5H8SA 4KD5A 4CSWA 3DFGA 3DU6A 1B51A 1AH5A 1FTMA 2OF7A 1YW8A 1D8JA 2DW4A 2EILH 4KUMA 1ETVA 5FD6A 1YTYA 1HKTA 1R4MB 3GTKJ 1IDZA 1JVXA 4LK1F 4BACA 3QPLA 4FE4A 2UZKA 3OO9A 1P4XA 4PJNA 4OAZA 3TMOA 4DZPA 3UKGA 2LK2A 1YFHA 4L18B 3IX1A 1P6RA 2DMQA 2ZYNA 3LSGA 3ONQA 3TO9A 1NH7A 3K6VA 1X1CA 3GF2A 2OQRA 5GAHJ 1MQGA 4MH5A 3M3YJ 3BZKA 1OLAA 2NVXJ 2HHMA 2GOXB 1NV5A 2FJ1A 4AVZA 1SI0A 3O28A 2VGQA 3G1MA 3G4SI 4ZECA 1YO5C 2V3UA 3KG2A 3VFJA 2F4OB 1TWAJ 4QIWN 4B43A 2A6TA 2K86A 2O6GE 2QBYA 2H8WA 4A5MA 1T08B 1SFEA 1IV8A 3ZMDA 5GP9A 1UG0A 4A5NA 3QPSA 1NUXA 1J2XA 2EWNA 3VLWA 1MSFC 3HUGB 4XMYA 4I7HA 3PTYA 4R72A 5DUIA 2XAHA 3HTSB 2L9SA 1BI3A 4KPTA 1N76A 1MIJA 4OVQA 1PUFB 4MEXF 1T38A 2AQFA 2W4SA 4F22A 2OK2A 3PUXE 4U87A 4E7ZA 1JE8A 2ACJA 3MVZA 4P0GA 1NNKA 4NTLA 4PSWA 4L9JA 2EFOA 3FF5A 2ME0A 4RA1A 2H25A 1TW2A 2OD5A 4M3FA 4AIJA 2M8CA 2O61A 4OA4A 5H8FB 4OVTA 5C4XJ 4RM2A 3MQ0A 3U8QA 1K4TA 2X1DA 3W9VA 4A0YA 4RB0A 4XLNF 4CZCA 3QPTA 2VD2A 4MGRA 3K0LA 5FFXA 5IY5H 3CJNA 3OYFA 2ZYOA 5ISUA 1B05A 2QSXA 4BJ6C 2EZKA 4KJZA 3VB2A 4AWXB 1P1NA 3VVEA 1BJAA 2QKMB 4FETA 3GEZA 3KC0A 2V93A 2LD5A 1BIBA 1ETQA 1I39A 3H6VA 3E5XA 2UVIA 4DOZA 4CHUA 5EEGA 3SDBA 2DP8A 2HXRA 3EQLF 4DGWB 3RGYA 5T3JA 1SQYA 1Y0NA 4XKPA 3DKWA 4Q48A 3E5UA 3W15C 2V84A 2BBYA 1OVTA 1U2WA 1ZU0A 1B7ZA 3S17J 5FKNA 4CYCB 4ENJA 3MAJA 2XIGA 4FBPA 2D1VA 3TEDA 3HN0A 1SW5A 1ZLQA 1HQCA 3VVDA 2L9VA 3C3WA 1JUMA 3CC2I 1W0UA 4F91B 1KQ0A 3OEMA 3IHUA 2LF8A 1MZBA 5ICCA 3COAC 1TWFJ 3LA2A 2JJKA 3DEUA 1MM6A 2A5TA 2E1OA 1U9OA 1U0JA 5F1QA 1DP3A 2HEUA 4GWYA 5AA4A 4HOBA 2M2EA 2Z33A 2H8RA 2PJRB 5D5XB 4XORA 1MH4A 5LGUA 2I8DA 1UTHA 1EA3A 4RGSA 1B4HA 2LR8A 1WKMA 2VC0A 3OO7A 5FFZA 3GTQJ 4JBZA 2XAJA 3Q5FA 1N0TA 2O8KA 2GBYA 4P96A 3L2UA 4AD9A 1IMEA 2B4LA 2HDWA 2LKXA 4F3BA 5IT9K 1R1TA 2WAEA 1D9VA 2M4KA 2JZYA 1DU0A 4UVAA 1FBQA 1W36D 2E36A 5AIPA 4G77A 5F04A 5KNLA 5L9OA 2CV0A 4F93B 1ZLJA 4PJMA 3PUZE 2V4JC 2KRCA 3TODA 2YU9J 4CCLA 4ENNA 1TQMA 4ZTJA 2CQQA 5A5XA 4GOTA 2VJ5A 4LQ5A 4N8GA 3SXYA 2XXRA 4XRSG 4NAPA 2PJPA 3GWZA 3MZ9A 4EF2A 1FP1D 2DT6A 4ELRA 4KA4A 4PGHA 3PJRA 3VE1B 4DCXA 1MS7A 2BVMA 2DTRA 4BHPA 5E3OA 4ELPA 4F7ZA 2JRTA 4YICA 1BL0A 2IS2A 2FYIA 4NF5A 2M1BA 1AOVA 2DE3A 1RKWA 3RNNA 2VXDA 4EJTA 2RC9A 4Z6YA 1TFDA 2DOFA 1WZ2A 2FIEA 3MZ1A 2BXZA 4BBSJ 2I49A 1MXVA 2DFIA 4C3HJ 4LGWA 5J1RA 3BG6A 5D5WB 1MDQA 3LMMA 3BIHA 4ABZA 4FAJA 1GV2A 3WU1B 2EFNA 4GWOA 2Y7IA 2LRDA 4BHCA 2FBHA 1FLIA 3U1OA 3PUBA 3FM5A 2K27A 4E4HA 2R7OA 2NYXA 3F8CA 5HLIA 5BMZA 2Y7WA 2GOMA 3BR3A 5JLWA 4MIJA 2QFLA 1D1CA 1NV2A 1U8BA 4R6HA 4XL9A 2H27A 3F6VA 3CP8A 2XSJC 3HDDA 1MY2A 3BOQA 1OCRH 3G71I 1V5FA 4OIPF 2NUVA 3H6UA 4DYRA 3DP7A 1EF4A 4G7OF 4HQEA 1H76A 1X3UA 5H8HB 3AFHA 3FIRA 4GL8A 3GLXA 2UYEA 4MBPA 3OO8A 4G8HA 3DEEA 4WCGA 2R7FA 4U4XA 4CYCA 3O2AA 1YX5A 2BW3B 4MEVA 1RUNA 2FX0A 1AKHB 3CCRI 1LAHE 4IO6A 2W84A 3LNQA 3CCQI 1Y8QB 2IP2A 2DQVA 4BHBA 2HCAA 4ZYHA 4G61A 4G68B 1E3OC 4GBVA 4JX5A 1Z9CA 1VDWA 1PDAA 5F6FA 3I71A 1I1SA 4P0IA 1FMVA 4HA8A 4M9XA 4LIUA 4B4CA 3RDIA 4AU7A 3CMEI 1XSDA 1XS9A 4HCYA 3OYEA 3GBGA 5IZ1A 4KIGA 1ETWA 4EGYA 4P56A 4OMYA 3FXJA 4MFIA 4XBFA 1G0IA 2Q8JA 1O57A 1ZGJA 3BTIA 3I4PA 5F1RA 5D4SA 5B5EC 3WTXC 3CCLI 3IH3A 4F55A 3OMYA 1WRJA 3JRHA 2KP6A 2IS1A 1E0EA 4NMYA 3BQZA 2QWWA 4OEUA 4U88A 3K1MA 5BS6A 2A5WA 4EQQA 3KYCB 2R5ZA 1K9YA 5ELVA 5HVQC 2CGPA 5DCFA 3DPUA 3B6TA 3D0SA 3N5LA 3ZQQA 5FGMA 4AUXA 3MKWB 1DTZA 1WJ5A 2OZUA 3RQIA 2L5VA 3WU2C 1JI8A 1UELB 2VPRA 4BXXJ 1UIVA 4DDDA 2W7YA 2VONA 3P7IA 4YFKF 1IV6A 1LFHA 4HZFA 3PM1A 4RK9A 4HPQA 5CJ9A 2RKMA 2EBIA 4OTEA 1I69A 3N26A 1IG7A 1DQUA 3PPRA 1B72A 1WJEA 4NF4B 3AG3H 5IP6A 3T8RA 5CVIA 1B4ZA 3HHHA 3Q0UA 5CLSA 4GVOA 1GXQA 1IN7A 1G3SA 4GRIA 3N4MA 3IO6A 3O9PA 4EF1A 5BUUA 3BJOA 3KCCA 2F5VA 1RPWA 4Z2YA 3FUZA 4PAFA 2E5ZA 2DPDA 3DELB 2F7CA 5ET5A 4WXHA 4BEHA 1XCVA 2AYSA 4FATA 4BDRA 1US4A 4RBOA 4AS4A 2PX9A 3LSFB 2RV8A 1R9QA 3FGSA 4N17A 4PJ0C 3UA8A 4IO5A 4I02A 4J19A 1DMBA 3H7MA 4O7IA 5LRRA 1TWCJ 1IN5A 2FQ4A 4PSXA 3RPWA 1UHMA 4XR6A 3A3CA 4F3QA 3OL3A 4DQ2A 4A3DJ 3RUMA 2QEXI 1ZBMA 4PP0A 1O7LA 1D8KA 3PFYA 1MH3A 1SVMA 4P9FA 2ZJPF 2K9LA 2L4AA 1Z7NE 1BR4A 2QCOA 4P47A 3CCVI 2NWJA 3ECHA 2O51A 2HQAA 5KCJB 4YIRX 5I2KB 2E0SA 2VBZA 1RETA 1OMIA 4BLAA 3CFZA 4G2ZA 3IB0A 4ZYEA 4OU0A 5HODA 3GFJA 2IS4A 4IJAA 4I0BA 1MQDA 2H4IA 4F2OA 1XSXA 4G6TB 3A1YA 2E2HJ 1XTAA 4XIGQ 3FMSA 2PG4A 2NOGA 2B3BA 1P1OA 2R7SA 1VQPI 3OY9A 3HOYJ 1IMBA 1O63A 3ESWB 1VF9A 1ZYRF 2EZIA 1I6XA 2RNJA 3DBHB 1FBPA 1R9LA 1XI6A 3IOVA 4CCNA 1N7XA 4PJLA 5AA2B 2O7UA 1P4AA 2XDVA 3D5RC 3GXOA 2DK5A 1JXSA 3D4GA 2DA2A 3FV2A 5IKBA 4UABA 2ONKE 2IPQX 4XLCA 4A0ZA 3RLFE 5M3FJ 4IHXA 5D6FA 1ZHFA 1US5A 3DQVC 2Z22A 2JK3A 2HOAA 4LUBA 3FKIJ 1W7PD 3MZHA 1S7YA 4E7JA 1EH3A 2TRTA 3PMWA 2V6EA 3GLLA 4OMZA 4WX9A 3J7AO 3K9TA 3FXUA 2QMWA 3HBLA 3WGGA 3KN3A 2QYOA 3KSJA 3OXNA 1DPEA 4BEHB 4M6XA 2GXBA 5C4JJ 4IX7A 3KZYA 1UCRA 3IC7A 2YU3A 1H9TA 1MXUA 3OYMA 2BEOA 2QBYB 2GA2A 3QK6A 4U4SA 2DMTA 3ML6A 4C2MJ 2PI0A 4AB5A 4R6KA 3MC2A 1Z7UA 2JVGA 3M4OJ 1WH7A 5EF6A 4H67A 2Q0OA 5D5UB 3NWTA 2K40A 1GV5A 3ECOA 2DJIA 1Q1HA 1IQ7A 4KN7X 3M9AA 2OLBA 5DCMB 3C31A 4H5FA 5IZ3B 3FATA 2VQLA 4DYQA 2Y31A 2N8GA 4L9VA 5HDNA 2LKPA 3PIPF 3OYGA 3HOTA 1HOMA 1MM7A 1URDA 1ZKBA 2ZZVA 4EJOA 2A6HF 2VD3A 3EHSA 1MQHA 3E3KA 2VQGA 2Z8EA 1NV1A 2P0WA 1ZG5A 2MSYA 3KBRA 1WVRA 4LB6B 2QS1A 4UV8A 1KA8A 3FXRA 2WV0A 3EHUA 4F3PA 3HRMA 3Q9SA 2R7VA 5AA2A 4MNIA 1SVXB 3GFMA 3L9FA 3L1PA 3DEWA 4M72A 3MKYB 3HRSA 5I84A 4N6PA 3HGYA 3I53A 4QSHA 1UG2A 2F4MB 2XV4S 4NBQA 3ZOBA 2H5YA 2BY0A 3OL4A 4XKBA 2F5XA 3M3LA 4ESXA 1PYVA 5LBQA 4EGZA 1X4OA 3I56I 5KHDA 1SW1A 2L02A 3O6IA 2R9JA 3PD8A 3IWFA 4NE4A 3IL1B 4OMBA 2PFBA 2NNYA 1A8FA 1U78A 3KP6A 2V9VA 4LMYA 2CUFA 1FBEA 1PEBA 3K0VA 3JV9A 4ESJA 2JUGA 1KU2A 1MBEA 2QQ8A 4DI4B 5JTYB 4NNJA 1S8NA 2VBXA 3W6JB 2XXPA 4XOTA 5AE4A 1W5TA 1JUSA 3IL2A 2EPFA 3QOPA 3CCUI 1V54H 3R60A 4BS9A 2KKOA 4PGNA 1KZHA 4YMBA 3SERA 3HHGA 1AKHA 2STTA 2GQQA 4BJTA 3V8JA 5J16A 1GTKA 2DVCA 3ZMVA 4LONB 2TCTA 3H9JA 3ZQIA 4A6DA 4AIDA 4QFOA 4DXUA 5H8HA 2W24A 5AA4B 3L09A 1SVOA 3IAZA 4IO7A 4PFRA 2XROA 2K4BA 5M3MJ 1X58A 3QP5A 3E9XA 3LBSA 2R7QA 1IITA 4B47A 3CFLA 4LVQA 4I9DA 1NMUA 1JEVA 2MH9A 5TGTA 2HFBA 3RPLA 3WU0A 4XKNA 2BE5F 3S2HJ 1ZAOA 4LIVA 5K5QA 2JQ7A 3I64A 1BN5A 3OYJA 2A07F 5FTIA 4AVPA 4FISA 2M9HA 3AG1H 1BR1A 2LY1A 3RKXA 1Q9DA 4YAHX 1DGRM 3DPLC 1R49A 2F5CA 4NQWA 5M5YJ 1T2KA 1AWBA 3W6KB 2Y5LA 3K4JA 5L3EA 2XD2A 5CQGA 1CF7A 4B1RA 3TDUC 3WE2A 1I27A 1OJLA 1IC8A 2HZTA 2KIFA 4IHTA 1RYOA 1SDXA 3IO4A 1F43A 5GADJ 1BIAA 2VPOA 4XM3A 4H65A 4U1ZA 3CF2A 5H6RA 3K70C 2QS2A 3U72A 1LGBC 4EQ9A 1O3SA 3BJ6A 2V1XA 4EXKA 1IEJA 2UXNA 3B50A 2X48A 1ZJLA 3ZR8X 1ENHA 4R1HA 1AMFA 1D4NA 1IMCA 1FPBA 2R7RA 3RKQA 5CYVA 3LAPA 3TW7A 3K2AA 5H20A 2IGNA 2OCEA 1SMYF 2HVQA 5CM6A 3AL0C 5EJCA 1QU3A 5IZZA 3BWGA 3K6WA 3IV5A 3CJRB 2UV1A 3UORA 1PUEE 2HEOA 2I4BA 4YELA 1BLFA 2UXXA 2ETHA 4HSTA 4YB6A 5I7IA 1Z77A 4PK4A 1IN6A 1KU3A 1WJBA 1YYVA 2XPVA 5DTDA 1PBQA 1QZYA 1XGSA 4HSRA 1OMPA 4NQ8A 5GPCA 1XGOA 2KRHA 1A6IA 4QPOA 3O8GA 2DWHA 4M4GA 5FTHA 3KFWX 2REGA 4MLOA 4XLPF 3CI8A 2NOJB 2E34A 2WB1N 3QP6A 2AXTC 3NAUA 3O8HA 4EJVA 4LJZF 3IB1A 1CNQA 3T66A 5CMKA 5LDZA 4NC7A 3B73A 2D5VA 1FOKA 3TQNA 2LVSA 3TQWA 1ITYA 4MJOA 2WA0A 1U5TA 4ZTFA 4ECFA 5LLQA 3HCQA 1FNNA 2D1HA 4PQJA 5CBSA 1IRXA 5E3MA 2VKVA 3SEQA 5I2NB 4NGUA 1J75A 3V8XB 5TPAA 3U94A 5FB2A 4IHWA 5K5OA 3GMEA 2IVMA 2XF5A 3R7XA 3JREA 2DO7A 2F7BA 2DAOA 4OVPA 5CBRA 3P9IA 3GZ5A 4FIMA 1WFXA 3KOTA 3E1SA 2JSPA 4EJWA 4JVDA 2HZKA 3UK4A 1XT8A 3AAFA 2QJEA 2JSCA 4NX1A 1UAAA 5L9MA 1KQ9A 4HEA2 2COMA 1XC1A 2L9NA 3CJTB 3USDA 3DU5A 2WY8Q 3FVGA 2FUG2 4ELQA 2LF7A 5L3CA 2OAZA 2G7HA 5D8LB 3GTMJ 4PF6A 1J1NA 2MYSA 3UR3C 1YS7A 3ROUA 3OSQA 2Y48A 1RKMA 4AB6A 3HFUA 4PFOA 2E19A 4I3YA 5ILVA 3CCYA 2RINA 1MMAA 2VN2A 2CZHA 3MPKA 1QQIA 3MP8A 3TKDA 3HSEA 2X6YA 1MD0A 2X6OA 3B6AA 5IOZA 5K7ZA 1MDP1 5E1ZB 4FECA 2ZMEB 1JW1A 1B40A 1FJ9A 3S2DJ 1XD7A 2XKOA 3K4KA 3GTPJ 4U1OA 3GTJJ 4N15A 2O7OA 3LSMA 4ITVA 4IHVA 4RGRA 1SD6A 1SD4A 3FXBA 1VI0A 2CUJA 3MZ8A 1P2FA 1TNTA