1IXCA

Crystal structure of cbnr, a lysr family transcriptional regulator
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
294
structure length
289
Chain Sequence
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLEIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Full-length LysR-type Transcriptional Regulator, CbnR: Unusual Combination of Two Subunit Forms and Molecular Bases for Causing and Changing DNA Bend
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Dna binding protein
molecule keywords LysR-type regulatory protein
total genus 91
structure length 289
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ixcA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixcA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixcA02
2FNAA 4I98B 3PUYE 2PBIA 1NFTA 3J81Z 1FBQA 4HBLA 2FA7A 2QRYA 3KOSA 1FT9A 2RQPA 1R9LA 2D1VA 1B3GA 2OJTA 4CYDA 2P7CB 4F1VA 4IXAA 3F11A 4KYEA 4HX4A 5FTHA 4OENA 1K79A 4MEYF 1R5HA 2DTRA 4GCVA 4RB3C 2NYXA 4XKNA 3A09A 1JQFA 2BV6A 3J80K 4HF0A 4H67A 1XC1A 4R9GA 1G3WA 1D3YA 2DI3A 1AIVA 4WXJA 3CR9A 4RS8A 3UORA 4ELRA 1JHFA 4R6KA 2V84A 2XAGA 3F8CA 2P5VA 2I0CA 3PD8A 4C1TA 5HS9A 3R0AA 2M45A 3CO7C 2XD3A 2V6CA 2UXXA 1NNFA 1WVJA 1D5VA 4HQEA 2K4BA 2CFXA 3QP5A 3D0SA 4P9FA 1L0OC 2O7UA 3RJPA 1B1HA 4NF4A 3VE1B 3T5XA 2DS9A 1B40A 4F1YA 4IGTA 3ONMA 2GXGA 1W5SA 2CYYA 3RNNA 4A0ZA 5D5VB 3RQTA 2XAQA 3V7SA 5FGMA 4GD5A 3MVZA 5HDGA 3GZ6A 2ACJA 2P2AA 4P0GA 4ENNA 3HSFA 3K1NA 3U93A 3PQJA 2GIVA 1PP8F 2K4JA 4F3GA 1XHYA 1OR7A 2JTVA 4M9SA 4MLVA 1PP7U 2Z8DA 2Y48A 2DOJA 3BPVA 2DPDA 2ZFWA 1B32A 1Z91A 4OTEA 1MH3A 4G2ZA 4KICA 3T9VA 3U92A 2ZCWA 2IW5A 3RGYA 4RB1A 1D8JA 3CVGA 4GXOA 3M9AA 3FF5A 3DF8A 2GAUA 4LK0F 2DE4A 2GQQA 3K0VA 4KA4A 5L9MA 3MBPA 4IJAA 3Q5FA 2EA4A 1RYOA 4M9ZA 3EHTA 1Z7NE 1B4ZA 4PQJA 4Q5SF 3ZKKA 3WTXC 1B0LA 4RA1A 1T0KA 2V3QA 1QUKA 4RGXA 1SBPA 3Q25A 4X48A 1SVXB 3N94A 1Z6TA 1R36A 2RVCA 5D8KB 5EHMA 1ZJLA 4JWOA 3RKWA 3E5QA 2I48A 4YAHX 1W5TA 1ZGJA 2YR2A 3TQWA 2O03A 5D4RA 3H4ZA 5DCMA 2P4WA 1OVTA 5EYFA 3VVEA 4THIA 1MDP1 4P0IA 3G3HA 4ONYA 4HZFA 4KMUX 3HRSA 3PMWA 3H3UA 4NQWA 4DXBA 3KOTA 1BIYA 2V79A 1LB8A 2B65A 1FW0A 2H98A 3I59B 1CF7B 1XMKA 5JK4A 3FMQA 2HQNA 1UHMA 4XIGQ 3MZHA 1IEJA 1I5ZA 4BYYA 2O61A 3UIFA 1YIOA 2H9BA 3LSXA 5ICEA 3T1BA 5E1ZB 2ZMEB 4FHTA 2FF4A 3KP6A 5F64A 3FD3A 1HSJA 1VFDA 1O3RA 2EK5A 5B70A 2VGQA 2IA2A 3V83A 1VTNC 2XXTA 4OFJA 3T96B 2NOOA 2P5KA 3HHFA 2FBHA 4F3SA 1S7AA 1TWYA 5IAIA 4KNYA 4GLIA 4H8JA 1GGGA 3O6IA 1QUJA 3U2RA 1BC7C 4QWQA 3G3JA 4HCYA 3TEPA 3FXRA 4DCYA 4PCQA 5I58A 1J5YA 4MNUA 2G93A 1SD3A 4G4PA 3V5AA 5CLSA 2D2WA 5CVIA 3GFJA 4DE8A 3HOTA 2WTEA 2DQRA 2XXVA 3LFKA 2XXXA 3M3FA 4HX8A 3BBRA 4XRFA 4KHZE 4HX7A 1RUNA 1FQAA 3CLOA 5F6FA 2PEXA 1GV8A 1TQPA 4DZ1A 5L8DA 3QU6A 2GFEA 3GW2A 5FFZA 3ISPA 2NNYA 4IY6A 2QSXA 4N13A 1IN7A 5KDTA 1FBUA 1IXHA 5EHSA 2Y75A 3OOAA 4E0WA 5H6QA 2F5FA 1OYIA 2ZNYA 5I56B 1B58A 1B9JA 2QLZA 1NH8A 2I49A 2DPUA 4LLNA 4ELQA 1QPMA 2RF1A 1J7KA 4A6DA 2Y7PA 4EJOA 4YG2F 3ZMUA 4F2QA 2E0SA 3ECHA 1OLAA 1QKAA 3GBBA 2X26A 2MA3A 1X3UA 1KWHA 1ULYA 4OU0A 4NB5A 2ZNZA 4F2OA 2IPQX 5CJ9A 3C31A 3O9PA 4K3FA 1N0TA 2XROA 2CG4A 5CMKA 5ICCA 3I58A 1MPDA 4O5VA 3K2DA 1A54A 3WU0A 1EZPA 1Z7ME 4YFNF 3HIFA 1JW4A 1M5EA 5FD5A 3BY6A 1M5CA 1TW3A 3SESA 3BJOA 2I3VA 3DPLC 4KYDA 4H6DA 1KQ8A 3DP6A 4AVPA 1W7PA 4UXNA 5FTIA 3QU3A 2B0LA 4OERA 4RGRA 4A5MA 1P1NA 4U4SA 2VC0A 1M5DA 1SAXA 3PPPA 4BH9A 4YKPA 2PN6A 5K2YA 3T9XB 1DP7P 4BDLA 1DPPA 3KN7A 3FMRA 4U22A 3B73A 4YMBA 3HHHA 3MWBA 1ZBMA 1W7PB 1BIBA 3FWEA 3HCQA 4I62A 2PT2A 5KCJB 3L6GA 2J5PA 3G73A 4QFPA 5J1DA 4MTDA 1D3KA 1EH6A 2W24A 1BIAA 4ON0A 1NNTA 1LFIA 3TTMA 4OZ9A 5AIPA 3WTZA 3EHSA 4IO2A 5DCFA 4LUBA 2CMOA 3CFXA 4X1DA 5I59A 1MDMB 1Z7UA 3IO4A 3K01A 1B9MA 4MQ9F 3C32A 5A2QZ 1QKBA 4RXLA 2KJCA 4GIZA 1QZZA 3U9GA 1FQFA 5M2VA 2Z8FA 3USDA 1NNPA 3RTWB 4G8NA 2Q8KA 3LA3A 2F7AA 5H8HB 2F5CA 2Q88A 2UVIA 3KJTA 4ASNA 2G9WA 2L01A 3ABTA 2PI0A 1MM7A 2FEZA 1SFXA 1JNFA 3HUGA 1QQIA 4XSZF 4EGYA 4DXUA 3CO6C 3Q28A 3T9UA 1PDAA 4EF2A 3A3UA 5LOMA 3BP8A 3TDUC 4KT5C 3E5UA 4EQ7A 5DVJA 4G8XA 3RPUA 3P7IA 1UQWA 2Q89A 4H5GA 3TTNA 1XCVA 2A5SA 1LQ1A 3CI8A 2NWJA 3LC8A 5ICQA 4EVIA 1E17A 2EA2A 1ATGA 4R73A 2GRVA 1IUDA 2A5YB 3RYPA 4NHJA 4MLQA 2HEUA 1HXDA 5L3CA 1FY7A 3AXFA 2VT3A 1QNTA 1IUYA 4KPTA 3HPIA 4LZ5A 3WTSC 5D5WB 3PPQA 5HLIA 1ZIUA 2Z5UA 3ZMVA 4WEPA 1OYYA 1R1VA 2EV6A 2D5WA 1OVBA 2PYYA 5DD8A 1AOVA 2Y7WA 3VFJA 1Z05A 2QENA 4I1DA 3K0LA 4JWYA 1LB9A 3TFLA 3U8QA 4L9VA 1TBXA 4UV8A 2REGA 1KU3A 2HYGD 4M4GA 2Q9TA 2R7FA 3TQNA 5BS6A 1KGSA 1VE4A 4HOBA 3GEZA 3T93B 2LF7A 3OO8A 4IHSA 4ZH4F 2IP2A 5JI6A 5HDKA 1MXYA 4EXKA 5ITOA 1DTGA 3PMXA 4OIRF 4RK9A 4F18A 4PGHA 5E1XA 5DUKA 2XVCA 2QMWA 3TCFA 4Y13A 5FD6A 1M5FA 1ZLJA 5DDGA 1IF1A 1LBCA 3TTRA 3TUSA 2QZ8A 3DP7A 3KSXA 4OHNA 2VP1A 1Y9UA 1XOCA 2XIGA 3O66A 3R0JA 4UACA 4GO1A 4TV7A 4P9UA 2A07F 3TZAA 1XVYA 4ZECA 3TDZC 3MAJA 4ESXA 5HM4B 3F8MA 2VBXA 2DE3A 2X4HA 2GH9A 3FVKA 3EYYA 1ZU0A 3BZ6A 1PC3A 4FAJA 3NRVA 2FSWA 4NWDA 1MM6A 4HA8A 5L3FA 1PBPA 3VFZA 3W9VA 3V7RA 2YPNA 1G6NA 2D45A 5L9SA 2DQLA 1LAXA 4I09A 2IA0A 3KCCA 1GR2A 5HVQC 4QFOA 3R7XA 4LATA 5H8QB 1LAHE 3OELA 3QUJA 1HSEA 4ZEFA 2FMLA 4G68B 3ILUB 4WEDA 3CG1A 2EFWA 2DVZA 1YW7A 3PPRA 1IQ7A 4U0VA 1DMBA 4YICA 5AA4A 3LA2A 4OIQF 3B7DA 5LGNA 4AIHA 4G9YA 1SFEA 1ANFA 5LRRA 3RLFE 3QOPA 3K6XA 4AIKA 3HSTA 1YS7A 4UNOA 1BC8C 5JFRA 4LONB 3V4GA 2RV8A 4L5IA 4G68A 4YFKF 5J8FA 2O6GE 4FEBA 2H09A 1JEUA 3R4KA 2F6PA 3IOWA 3O6GA 4GYGA 1I6XA 3MJNA 2STTA 1I1GA 1N3WA 3QYTA 2VD2A 1F9BA 4GXAA 4EJTA 2EFQA 2DXYA 3I3VA 3EDPA 2I0BA 3ABUA 3IB1A 3ZQ7A 3C1DA 4EM2A 1TW2A 2XKOA 3CJNA 5F7VA 1B6HA 4NWCA 4O3CA 3JTHA 1R00A 2PMUA 5CVJA 3IL2A 3KP7A 4BHBA 4GGGA 1AH5A 1USTA 2CQKA 4Q47A 4ESFA 3H03A 1S8NA 3F22A 3RT8A 3JW4A 3O3KA 2ADUA 2EB7A 5FB2A 4R72A 4G77A 2QS3A 1EV7A 1H44A 1K78A 1KYWA 3WODF 2QVOA 2VOZA 3HO7A 4RB0A 4HYEA 3MUQA 5H8FB 2A68F 4M6YA 1U2WA 1N3XA 3N5LA 4YB6A 2OQRA 4PP0A 2DSFA 2H99A 2ONSA 3TO9A 1XB4A 2OK2A 3IORA 3GYHX 2OQGA 3ZS6A 4BHPA 4E0XA 1ON2A 3DKWA 3O29A 2D1HA 4FECA 3T66A 4JBZA 4D0PA 2F36A 1MXWA 1URGA 2Z3YA 1TXFA 3OO9A 2Y84A 3R26A 3WAFA 3DV8A 1SW2A 2CGPA 1SD6A 3WAEA 2QM3A 5D8LB 3WGIA 5BWJA 2E1CA 5HS7A 3O6BB 2DK5A 3DELB 1O64A 2C6YA 4IO3A 4EV0A 4Q4ZF 3ECRA 2VT2A 5DVIA 5IT9Z 4IO7A 1OQHA 2JRTA 1REPC 1EU8A 3FZVA 2M87A 3LAPA 2ZKZA 3IRRA 4DXCA 5A5XA 4OINF 3CTAA 1J2XA 2MH9A 2NAZA 1BOAA 2XV4S 4ECFA 4ETSA 1LDJA 3L2CA 4RPOA 1YW9A 4EDPA 3CSBA 3PUZE 2COMA 1RZ4A 3IB2A 2G7HA 3MCZA 2VOOA 5TP9A 1ZLQA 4G8MA 1Q35A 2IEEA 5CVRA 4OXVA 4KIFA 4EJUA 1FX7A 1B3LA 3KEOA 5DV5A 3RPWA 5E8GA 2RC9A 1XSDA 4YKIA 5CMCA 4KFQA 3U1OA 4GQOA 4LQ5A 3WTVC 1XD7A 1LB2A 4Q5TA 2ZYMA 1V3FA 1DTZA 2HAUA 1S29A 2ZO4A 3TDJA 3WE2A 3MP1A 3E6CC 4H0EA 1O3QA 4JDFA 3ECOA 5H8SA 4JXIA 4I7HA 3S9NC 4U2RA 1J75A 5KDTB 5CBRA 2RINA 4UHTA 2KRFA 1SDXA 2WKYA 1GVJA 3LSTA 3Q27A 3J7AO 3RDIA 3ZMZA 4FX4A 3JZJA 5I56A 4LZ7A 3I5OA 1FTJA 1TT1A 5BMZA 4RGUA 1HKTA 5HLHA 1ZG5A 1P4AA 4IVNA 2PT1A 2ZNUA 4F3PA 2X0LA 3MVXA 1O3SA 1ZRFA 1NHAA 1S7OA 2JSCA 5K1YA 2UYEA 4LP2B 5DTBA 2H25A 3PGFA 4R6YA 2H27A 2DK8A 5L3BA 1UFMA 1USYH 3MZ9A 3NEUA 3TCGA 3E6DA 2QYOA 2XX7A 4MF3A 1GVCA 4R79A 1MQHA 3C9HA 3V8KA 3B6WA 1B5HA 3ZMSA 2ETHA 3KJ7A 4FORA 3G3FA 1Z6RA 1LSTA 4ZZAA 1VR5A 5CVVA 2IA1A 2BJJX 1FSEA 3MZYA 4L18B 4QFNA 4YMAA 2W25A 1UTHA 5ITPA 1B5JA 1J59A 4IRGA 1BJAA 5JR3A 1VFEA 1WODA 1B7HA 3RTFB 4PZJA 2B3BA 2ONKE 2V3TA 2FQ3A 1H9TA 1OKRA 4UUVA 3IC7A 2FYIA 4U21A 3KFWX 2G7UA 1QGPA 4ZYDA 3OXNA 2PQ8A 1TQIA 1LBBA 1UTHB 5EEHA 3PUVE 5J6XA 1G3TA 1SD7A 4DCXA 3IR1A 2XX9A 5KCJA 3ERED 4I0AA 3GUDA 1DPRA 1SYHA 2XXPA 2E1SA 4MHGA 1MXXA 5JHUA 4JSOA 2PX1A 4EQ9A 1Q1KA 2AL4A 3QSLA 1JE8A 1WI9A 4OWDA 5TJJA 2V3UA 2UVGA 3COAC 1I6AA 4U0YA 2NS0A 2M1BA 1HW5A 4YIFA 5HBCA 4MQVA 1MDMA 2ESHA 2O68A 1D4NA 1XDUA 3LSWA 3E4RA 3MVYA 2V1DA 3VODA 2OWSA 3TAJA 3FATA 2KIMA 1R1UA 3K4UA 4HCWA 1NNKA 4Q8RA 5H8HA 3S2WA 4GRKA 2O84X 4KCCA 4F19A 3RTRA 2KLFA 3IWZA 2R3SA 1II5A 1N76A 4A0YA 3GX4X 3M3LA 4NE4A 3FJ7A 1Q1HA 4N9HA 3I6VA 1H3DA 4G68C 1B3FA 1R58A 2DFIA 1JGSA 4EMSA 1I69A 1EH7A 1O57A 3KP3A 1QVSA 4TLMB 4M72A 3KLOA 3PQKA 4YKJA 1ZLKA 4I9DA 5CBSA 1LJ9A 3P7NA 4OFLA 1Y4TA 3D4CA 3I5UA 4A2UA 4NF5A 4Y15A 1XDSA 3EQ1A 2LNBA 1POY1 5BPDA 1DDNA 2NNNA 2VBWA 2THIA 3DQVC 2K27A 3CFLA 4PFYA 2F7CA 1LLSA 3KSJA 3U1DA 1B3EA 6PAXA 5L3GA 1MQIA 1BI0A 1ZN2A 2YJPA 1FWZA 1P2FA 2VN2A 4R2FA 1LAFE 2R7DA 1SI1A 1YW8A 5ICFA 2V1XA 2HGCA 3HN0A 5ILSA 4DQ2A 3HRMA 3I54A 2F78A 4BDNA 1FPQA 5JTYB 2HZLA 2LDUA 5FO5A 2P0SA 4E70A 1H9GA 1Y0UA 3W9WA 3H3GA 3FGSA 5ICTA 1IRFA 2HKOA 1BTJA 4X1BA 3PUXE 5DEXA 3EYIA 3K6VA 3FV2A 4UVCA 2F34A 3JTGA 3C3WA 5AONA 3MW0A 1RKMA 4Z7EA 5JTYA 5TRDA 2IA4A 3O28A 3CUQA 3F6OA 4XKPA 4ZEDA 1TTYA 4M1VA 4A6EA 2ISZA 2DWJA 5L9OA 3KP2A 1XGOA 2Q2EA 5HS8A 3LAJA 3LSFB 1DPEA 3JAMK 2RDPA 4BNCA 3FMSA 3VLVA 2Q2CA 5DEXB 4F29A 1OMIA 1D9VA 5CMBA 3E3VA 2AXLA 3OD7A 1ONVA 1WSUA 1TNSA 3KBRA 3CUQB 3I0TA 1ZKBA 1WDNA 2ZMBA 3Q29A 1IN6A 2DW4A 1MY1A 2FBKA 2Z9OA 3IOVA 4JQFA 3EHUA 3DM0A 4UA8A 1QZYA 4QLCU 4OIPF 4IGRA 3RKXA 4F1UA 2DU9A 1MXZA 4GF8A 2L3DA 1MXUA 3K6UA 3QAHA 3K00A 1O7FA 3IKTA 2A5TA 4IF4A 1MS7A 5KZTA 2RN7A 2WC2A 4G6DA 2FU4A 2QS1A 3F23A 4OETA 5H8QA 3IO6A 2RKMA 1U78A 3P9IA 1B51A 2XAHA 5KK1A 3EF7A 3SXYA 1B52A 4LB5A 3L09A 1OQGA 3MZBA 3D5LA 4FIMA 5TU0A 3RPQA 1LAGE 3RY3A 4KMFA 5AA4B 1MG1A 2ZYKA 4GVOA 2FBIA 1YTVA 3PV0E 3QRFF 4PETA 1ZYRF 1G3YA 1JEVA 3OMBA 1F1ZA 2NVUB 1U8RA 3P9KA 2A61A 4OEVA 5DYMA 3L00A 1SMYF 4CZZA 3JSOA 2QWWA 4GXSB 4NF8A 3MWMA 3ZN1A 1PB8A 1XGNA 4GL8A 3TYHA 1SQYA 2R71A 1YTYA 5E1WA 3F8NA 1LCTA 4NEDA 5FFXA 5BQTA 1FQEA 1TFAA 3KETA 4NF8B 4HS7A 3RT6B 1NH7A 3UP9A 3IKVA 5ED4A 2UZKA 1N04A 4M73A 1I6BA 1S3JA 4H8IA 3QIMA 1STZA 3IB0A 4ISUA 4AQ4A 3QPTA 4R8HA 4QRZA 1BN5A 3FM3A 2VHAA 1JVYA 2QL3A 4HLXA 4RB2C 1IIWA 1FQDA 2VE9A 4XXUA 2ESNA 2ZNSA 1ON1A 3SQNA 1K78B 4OQOA 1XT8A 2XUBA 4HV5A 2F5EA 4BHCA 4AIJA 3DLNA 3TQLA 3H6VA 5H8FA 2K7LA 5FHOA 4Z2YA 2XXUA 3KZGA 4PGGA 1B0HA 4IPAA 4H0WA 3VXBA 4ZEKA 4FE8A 3P9CA 2HCAA 1P1WA 4XTCQ 4LD5A 3U94A 3LUYA 4A12A 1AOYA 4OFOA 1D8KA 3FXQA 4GFRA 5I57B 5LHHA 4U1OA 2GWRA 2RKHA 5LGUA 2OWTA 2M8CA 3TO6A 2H6BA 1MXVA 3M8EA 1H43A 5ERIA 4L0ZB 3RKYA 4OMYA 3BJAA 1D9YA 2XXQA 2HOEA 1Y1MA 2O69A 3CSGA 3PPNA 2DE2A 1RNLA 3QAXA 2Q2AA 4LQ2A 3TKDA 1F5TA 1P4WA 3GXAA 3IL1B 2YU3A 2YX4A 4A0XA 4KN4X 3MQ9A 3FHZA 5K5OA 5HDNA 4LFUA 4FX0A 3U72A 1ODDA 2FOKA 5A5XB 4AD9A 5CI5A 2GXBA 1FQBA 2AYSA 4MFIA 5AE4A 3HHGA 1IXIA 2Z22A 2IT0A 3DP4A 5D6FA 2HFHA 4HQMA 2P1SA 1HSLA 2HXWA 3UA8A 2VOPA 4OMZA 3ZP5A 3CFZA 1W4MA 2O51A 2VBZA 1XVXA 2BGCA 5K2XA 3TPAA 5TP9B 1MH4A 4S04A 3MPKA 1U5TC 2X7QA 1YYVA 2Z8EA 4N6PA 1B7UA 4TLLB 3PU5A 5LEJA 4ZYGA 1JHHA 3CUOA 3DP8A 1QBJA 4DIGA 3NQOA 2TDXA 3RI4A 2DWIA 3DEUA 2HYFA 3FASA 5JEIA 4I02A 1A8EA 4G7ZF 3GXOA 2VBYA 1UCRA 3VB2A 3DFGA 3IJXB 4BDOA 2HQRA 1JW5A 2PMHA 4ESWA 3BDDA 4CHUA 2REJA 3GZ5A 1MY0A 1ZMGA 4R9FA 3W6KB 1TLHB 3S4UA 1MQJA 4WXDA 4FATA 4G8HA 4O3BA 3N97A 1PB9A 1N84A 1IAWA 1USYE 4PDKA 1HBXG 1R5GA 5ILUA 4M71A 1B3HA 2JT1A 3GWZA 2GHBA 3FM5A 3LWFA 1O7LA 4P5OA 3I53A 4ZE9A 4A5NA 1QUIA 4KUMA 1U3EM 3FX3A 4WKMA 4M6XA 3WGHA 2XRNA 5HLGA 1L5TA 3C18A 1BLFA 2XXIA 3HSEA 3VEPA 3W15C 3TCHA 4KIGA 2DP8A 4OVJA 2EJRA 3R6UA 4MGRA 2D3IA 4G7OF 2ONRA 3VVFA 5LLQA 3ZMDA 4EUOA 4JSDA 1URSA 2PVUA 3KZYA 3OOPA 5BOXA 3T0YA 4BAYA 4DLDA 1MQGA 2W57A 2OCUA 4IO6A 2DAOA 3TOAA 3MP8A 4Z0IA 1FLIA 1H76A 3G3IA 1SFUA 1OYWA 1K7AA 4UVBA 3THIA 2P8TA 1T2KA 4X9TA 3QP6A 4BLAA 4N9IA 3ML6A 3WTYC 5FLXK 1L3LA 4AWXB 2XXWA 2XXYA 2UWMA 4HLYA 2XAFA 4BDMA 4QSDA 3K69A 3OSQA 2H94A 1Z9CA 2ZXTA 4RAYA 4XLPF 1XSVA 3GFLA 3TGNA 1FOKA 5D5UB 4GWOA 2GA1A 1KA8A 1LCFA 1T0FA 2H5YA 4CXFA 4KYWA 1JETA 3BKIB 1MJ9A 1MD0A 3WTWC 1US4A 4ZE8A 2O8XA 2ALUA 3VXCA 1T38A 2LAOA 1KU7A 1IXGA 2QQAA 1MY3A 2MC3A 1P1UA 1U6GA 1JXSA 5K5RA 1SW5A 2XKPA 2I6EA 5DD4A 2MH2A 4UV9A 1R6ZA 4HF1A 1XCBA 2OA4A 2PJPA 1B4AA 3FJMA 4QSEA 1N7WA 3F21A 3FVGA 4LLLA 2V25A 5HPQA 1BM9A 3PMVA 5I2NA 5I84A 3F8FA 4YIIA 1Y3NA 5AA1A 4GOTA 2O1LA 5CC2A 1C0WA 3K2ZA 4O3MA 1O7TA 2HTJA 4L5JA 3S9LC 4B8XA 2RC8A 3WTTC 2F8DA 4F7ZA 3TO7A 5A2QK 4JWXA 3UK4A 4ND9A 4L9TA 4NF5B 1JW1A 1POTA 2FA5A 2OLBA 2A6HF 1YCJA 3SETA 2ZYOA 5I2NB 1LFHA 1EZOA 4MTEA 1KYZA 1B4HA 3ILTB 1XSXA 3OEMA 2UYFA 1ZGAA 4YU0A 5AA3A 3LR1A 1MY4A 3CRBA 4ZEBA 3G3GA 4AB6A 3EPEA 2IVMA 3REOA 1LEBA 3I64A 1UTBA 2I4CA 3KE2A 3SEYA 4HF2A 3JAMZ 1S9TA 1FBSA 3C33A 2GA2A 4EM0B 2HAVA 3FVOA 1B9NA 2DWHA 1FYLA 1ZARA 1AWCA 2I3WA 3TTLA 5AIQA 2JZYA 2LF8A 4EM1A 3HTSB 4U7BA 2WV0A 4LK1F 3OENA 4R6HA 4ZZLA 4KIBA 1ZRCA 3VLWA 5DEQA 3E6BA 3I4PA 2FNCA 4LA9A 3L9FA 3T9HB 2DBBA 1AL3A 3RIRA 2HQ0A 2DWAA 4NF6A 4ZEIA 2MLKA 5F1RA 2X7PA 2YLNA 3SFZA 3BROA 3G3KA 2XXRA 1IN4A 3FIRA 3W6JB 4YB7A 4WWCA 3IJOB 2F7BA 2UVHA 2RC4A 1P99A 4ENKA 4FT8A 2R6GE 2JPBA 1DSNA 2OAZA 3R61A 5FLXZ 3VLUA 4PFUA 4WXHA 5H20A 3BFUA 4XSXF 5KVRA 1NMUA 1KQ9A 2RC7A 4U7DA 3TOBA 3LBSA 5I2KB 2XHKA 4GL0A 1MPCA 2KIFA 4WX9A 4C1UA 1DUXC 2QS4A 2YPRA 3SEVA 1A8FA 4KD5A 1XGMA 3M8UA 1IXCA 3GZGA 2K86A 2O0YA 1SD4A 1BKAA 1FTLA 2A5TB 4C0RA 4YZZA 2ANJA 5I2KA 4DDDA 2MLGA 3KFMA 3K1PA 1OLCA 4HDVA 1G4DA 3C4MA 4WF2A 1FYMA 2Z23A 5D5XB 5E20A 2P5LC 2OD5A 4IRIA 2UVJA 2EV5A 2F6GA 4DNCA 4QFKA 3Q9SA 3T8RA 2KIUA 3MEXA 3H6UA 2NXOA 2UXNA 4BDRA 2R9JA 2P6SA 4GYIA 3N26A 1BI1A 1UHWA 3KP5A 5ILVA 1S7YA 3TODA 1FQCA 3J81K 1Y3QA 4HDUA 4POXA 1B59A 1MRPA 4RNSA 1MGTA 4FJPA 4RPNA 4N0BA 2F5DA 1P6RA 2ELHA 3B6QA 2MD5A 2XX8A 4EXLA 5AA2D 1IRGA 3F6VA 1EH8A 1AMFA 3D4GA 2PBWA 4Q0CA 4R75A 4KFCA 2XGXA 1IN8A 4KN7X 3H7MA 4CDGA 4OYVA 3MP6A 2ZJ2A 1J0RA 2M8EA 3IRQA 1RIOH 3HYIA 4Q30B 1PEBA 1HW2A 1BI2A 1W7PD 1WKMA 2BYVE 3LQQA 3RN8A 2CZLA 5CVUA 3GO5A 4RK2A 1FYKA 1A7LA 2AL5A 1I6QA 2OZZA 3I71A 1OPCA 2Q0OA 3IWFA 3GF2A 2QQ9A 1UB9A 3GLXA 2FE3A 2AIXA 3JYRA 4POWA 4ENJA 1IXSB 2M5WA 2DVCA 4G6QA 1CB6A 1JVXA 4L17A 1Z1DA 4HW8A 1SMTA 1GTKA 3LSLA 2EWNA 4IRHA 1P1OA 1B05A 3BJ6A 2PFBA 1A04A 3H92A 4F31B 5EEGA 4WXCA 5LEKA 2F97A 1YFHA 3CG3A 1HSTA 4BDQA 1SI0A 1NL5A 1A55A 5I57A 4JK1X 3M3KA 3SEWA 3F3XA 3SERA 4EF1A 5CRYA 2CW0F 3PUWE 2Y0MA 1ZH5A 2XXHA 4NF4B 3WE3A 3OO7A 4I01A 2OZ6A 4HAMA 1ZREA 2KKOA 4OEUA 2H4IA 2FNPA 5L3EA 1Y20A 1YPNA 4YKKA 4LMYA 2O7IA 1IITA 2DO7A 2ZXJA 2UXAA 2XAJA 1LFGA 1Y3PA 1FC3A 2V9VA 3A3CA 1EZ9A 3H06B 1HKQA 3IAZA 1YO5C 3CIJA 5TPAB 5CYVA 2YSRA 1BBYA 3PPOA 2HZTA 3C36A 2VODA 4N07A 2L54A 1PBQA 2EV0A 2FRHA 1A40A 1B2HA 1ZHFA 2QMXA 1R22A 4EJWA 1TNTA 1LVAA 2RGVA 4QSCA 3ELKA 4HTGA 5LGTA 4IB2A 3AAFA 4I2OA 5TPAA 3Q26A 3F8BA 2PLYA 2GZWA 3IX1A 1PUEE 3H6TA 2MBFA 3MPLA 2DYXA 2L4MA 2HFBA 4XKRA 2CWEA 3KZZA 5D4SA 4ESJA 1U5TA 1WQ2A 2NUVA 4PFWA 2VC1A 3T8TA 5IT9K 2BEOA 2QUFA 4M74A 1LDDA 2CSOA 3OV8A 4UVAA 4CICA 4FEDA 1P1QA 3SZTA 3ZN0A 3WGGA 4QF9A 3K6WA 2HDCA 1UIVA 1IZ1A 4JB7A 1R7JA 1B6AA 5DUIA 1U5TB 4CGZA 4KQPA 4ZS9A 1G3SA 1I27A 2PMSA 5LRSA 5ISUA 1YLFA 1FCKA 5B7DA 1B1XA 3MQ0A 5DCMB 2E7WA 4U4XA 4U88A 1P92A 2IRFG 3FXUA 4TOZA 1SW4A 3ROUA 3DPTA 3SHFA 4M9XA 4HV6A 1T98A 4OOIA 4L0YB 5LBQA 4EGZA 4KYSA 3M1EA 5DVFA 2VD3A 3K02A 4TQUQ 2FMYA 3MAMA 1B7ZA 3I59A 1CF7A 5J8CA 4RAZA 1US5A 5FHMA 4I0BA 3OO6A 1GXQA 3HTUA 4IO4A 1ZG3A 4WCGA 3V8XB 1OIBA 2F2EA 3KEIA 3MC2A 3KN3A 4RJZA 1FTKA 1J1NA 2ZMEA 3GFIA 2HWVA 3C7JA 3V8JA 3B02A 1OMPA 3TMGA 2I4BA 2A69F 3K9TA 4RGSA 2XD2A 1S6LA 2O3FA 3VVDA 3QUFA 4L9JA 3HOSA 1M5BA 4QHQA 3BFTA 2STWA 1NKXA 2V93A 5BUUA 2RNJA 4H65A 1CGPA 4I8CA 5FHNA 5I58B 1MJAA 1R9QA 3KGCA 5CM6A 1QULA 1SW1A 1R1NA 1PDNC 2VONA 1B5IA 1MJBA 2V1UA 4ENMA 1ZRDA 4NTLA 1IXRC 2O6AA 2QBYB 5K5QA 2RCAA 3ODBA 4G94A 1URDA 3HSRA 3KEQA 3ZKLA 4LJZF 4ELPA 1FNNA 2J5OA 3C34A 4R1HA 1O3TA 4ESBA 3V8LA 3UGWA 3WU1B 3JV9A 2Y7KA 4NMYA 4R2BA 1F9NA 1ELJA 2EFNA 1LEAA 4F3BA 3JSPA 2QPQA 5LHIA 2WWYA 2QBYA 3GLBA 2NRAC 4BXUA 3TELA 2QJEA 2HEOA 4EJVA 1XMAA 1YAEA 2Z99A 4ELOA 3IOTA 1MZBA 2KJBA 2DT5A 1KU9A 4P96A 3ZMTA 1RI7A 4PFTA 5IKBA 1BP5A 3N6UA 1P4XA 1MDQA 3S9MC 3O2PE 3M7GA 3BPXA 2ABHA 3SDFA 4LLGF 3EQLF 4P55A 3KN8A 1TFDA 4YFXF 3ZPLA 1GXPA 3SEUA 1QO0D 4ZDMA 4LZ8A 4WK8F 1MPBA 2A6EF 2Z33A 4XLNF 3EUHA 4KI0E 4OESA 2M30A 1IN5A 4MH5A 1H0MA 2D21A 4ZZEA 4H5FA 5F1QA 1SD5A 1EH3A 5HOOA 3E6MA 1RYXA 3R60A 2JPCA 3K1MA 3QPHA 4ZYEA 1PB7A 2ZYNA 3L6HA 4EQQA 4R74A 4K2EA 4KCDA 2G29A 3E3KA 2YX7A 4F39A 3IHUA 1J9IA 3E9XA 3HV1A 1FSHA 3L7WA 4ZYHA 3UN6A 4O3AA 3Q9VA 3FVNA 2ISYA 3LA7A 2Y7IA 5BPIA 4AB5A 4U1ZA 3E13X 1DPUA 5CMMA 1UTBB 1MKMA 1A99A 2PG4A 1TQMA 4LVQA 3HRTA 2HS5A 5H8NB 2IJLA 2DQVA 1UIUA 5L3DA 3OSRA 4L9NA 4QFLA 2ZBKA 2EFPA 3GBAA 3IK6B 3KG2A 3B6TA 2HR3A 3V89B 1YQAA 1HKSA 2F5XA 3QXMA 2L02A 1Y1ZA 2OBPA 4U0WA 3SZPA 1T39A 5LHGA 1HW1A 5I59B 2AS5F 1CE2A 3VOEA 2F35A 3J80Z 4HW0A 1USSA 3RUMA 2HTSA 1XGSA 3G7WA 4XBFA 3WTUC 5H8NA 1MY2A 1YG2A 3PFIA 3EETA 4LG0A 1RUOA 3O97A 3MVWA 1B46A 3N4MA 4IY5A 2A3SA 3H6WA 3GFMA 4NF6B 2DXRA 5DT6A 2Y7RA 3VDFA 5E18F 2LSOA 4KR5A 3KLNA 3LQRA 2HZKA 1YS6A 5JVTA 4U23A 1XN7A 5E17F 2XHDA 2VE8A 3H3ZA 4LG0B 1FP2A 1KU2A 2DLLA 3CDHA 4XKQA 5ELVA 1IW7F 4MEXF 2FXAA 1O63A 2EFOA 4CO8A 3HRUA 1QJMA 4P11A 1FTMA 3IOUA 3MZ1A 3DXJF 3FJGA 1WWXA 4KDPA 2LKPA 4Q48A 2H6CA 2OZUA 2OU2A 3TTKA 3WG9A 4OMBA 5AA2B 2GHAA 2BBYA 2ZNTA 4YB5A 1V4RA 1F4KA 3CUQC 3S9EA 4B09A 2W7YA 1HQCA 3M8FA 4OIOF 2P6TA 1ZAOA 2OBGA 1BI3A 2E7XA 1FTOA 1KQ0A 1T6SA 1MQDA 4IO5A 2CO5A 1FZPB 1B1BA 2K02A 2W84A 3BOQA 3BWGA 4O6JA 5H6RA 3C35A 3E97A 5AA2A 3F72A 4LB6B 2VXZA 2Q8JA 1N7XA 2BE5F 2I58A 2HKXA 4LGWA 2E1NA 2L4AA 3R6SA 5IT3A 3T22A 4PE5B 3ZSFA 3E5XA 1H45A 5D6EA 1I1SA 2B3FA 3OEKA 1LGBC 3FUZA 5ICGA 4RY1A 3SEXA 5DYHA 4JBAA 3MFKA 1Y4CA 1DOTA 3KP4A 3EN3A 1ZG1A 2O1MA 1FP1D 4Y17A 2RCBA 3O2AA 4RYAA 3PD9A 2XASA 1SYIA 1GHCA 1E2XA 4BQAA 4ZZDA 3SKPA 4S05A 2QS2A 1QW0A 3FV1A 1LDKB 3V7CA 2P7VB 2W85A 3VV5A 1ZTYA 4H1XA 1XS5A 4EQBA 1LNWA 3QK6A 3GVAA 5E8IA 3N6TA 3S2VA 4F22A 1K6OA 3G3ZA 1VSOA 4G7HF 1R1TA 4IHTA 2QQBA 3ULQB 3O6HA 4MBPA 1S50A 1R23A 3RYRA 1WRJA 3TKYA
chains in the Genus database with same CATH superfamily
1V55H 2FNAA 4I98B 3OYNA 3PUYE 3NARA 2PBIA 1NFTA 3J81Z 5E3OA 1FBQA 4HBLA 3CJQB 4O94A 2CQNA 3AG1H 1AWBA 2LREA 2FA7A 2QRYA 3KOSA 1FT9A 2RQPA 1TZLA 1R9LA 2D1VA 1B3GA 1ZQ3P 4CYDA 2OJTA 2P7CB 4UABA 3BQYA 1WJ5A 1VQ6I 4F1VA 2Y0SN 4PFIA 4IXAA 3CP8A 4B3AA 3RZDJ 1EF4A 2PFYA 3F11A 4KYEA 3BG7A 2MSYA 1MNEA 4HX4A 3VDXA 4OENA 1K79A 5FTHA 4MEYF 1R5HA 1H8AC 2DTRA 4GCVA 4RB3C 1RKTA 5C4JJ 2NYXA 3AL0B 4XKNA 2W00A 5ET6A 3A09A 4Y7NJ 1JQFA 2BV6A 2QF7A 3J80K 9ANTA 4HF0A 1FTTA 4H67A 1KONA 3ROJA 1XC1A 4R9GA 1G3WA 3HDDA 1D3YA 1JP4A 2L2OA 2DI3A 1AIVA 4WXJA 3CR9A 4RS8A 3UORA 4ELRA 1JHFA 3GMEA 4R6KA 4QSCA 2V84A 1VZ0A 2XAGA 2P5VA 2DYSH 3F8CA 5JHFA 3OYEA 2I0CA 3PD8A 2GOXB 5FLMJ 1JKRC 5EYHA 4C1TA 5HS9A 3R0AA 2M45A 3CO7C 2XD3A 2V6CA 2UXXA 1OJLA 5CQEA 5C44J 1NNFA 1WVJA 1D5VA 4HQEA 4BL0B 2K4BA 3EUKL 2CFXA 3IUOA 4PJJA 3QP5A 3D0SA 3HOVJ 4P9FA 2VUMJ 1L0OC 2O7UA 4YELA 3RJPA 4W97A 1B1HA 4NF4A 3VE1B 5FKMA 2Y31A 3T5XA 1X1DA 2IGKA 1EYKA 2DS9A 1B40A 4OVPA 5IZ1A 4F1YA 4AVZA 4IGTA 1WGXA 2TCTA 3ONMA 2GXGA 1W5SA 2CYYA 2KQRA 4JOMA 2WB1A 3RNNA 4A0ZA 5D5VB 2OTJI 2YUSA 3H1CA 1UG0A 1IRXA 2XAQA 5IP6A 4PTKA 1PYVA 3V7SA 5FGMA 3RQTA 4GD5A 4P8BA 4D1QA 3PSFA 3G2BA 5HDGA 3MVZA 4NG7A 1MBHA 3GZ6A 2ACJA 2P2AA 3PNTA 4P0GA 4XLFA 4ENNA 3HSFA 3K1NA 3U93A 1MBKA 3FBNB 4NF0A 3A01B 3PQJA 2GIVA 3ZGKA 2GOMA 1PP8F 2K4JA 2QEXI 4F3GA 2VLAA 2HQ5A 1XHYA 1OR7A 2JTVA 4M9SA 4MLVA 1PP7U 5J47A 2Z8DA 2Y48A 3CZ6A 1K9ZA 2DOJA 4PC9A 4Z0IA 2Y9ZA 4CCJA 1NV0A 3BPVA 2DPDA 1T0FC 2ZFWA 3AFHA 2XPUA 1ITYA 1B32A 3RQIA 1RETA 1Z91A 4XIDA 4OTEA 1MH3A 4G2ZA 5ET5A 4KICA 2PMZN 2K5CA 3T9VA 3CCUI 5K7HA 3U92A 2ZCWA 2IW5A 3RGYA 1ETQA 5JLXA 3NAUA 4RB1A 1D8JA 2KZVA 3CVGA 4GXOA 3M9AA 1UZCA 3FF5A 3DF8A 2GAUA 4LK0F 2DE4A 2GQQA 2COBA 2R5YA 3K0VA 4KA4A 5L9MA 5HNHA 3FXKA 1W1WE 1ZGWA 4IJAA 3MBPA 2XPVA 3Q5FA 2EA4A 4HEA2 2Y69H 3DLAA 1RYOA 4M9ZA 3J7ZI 4BJ5C 2ZZWA 3EHTA 2LC2A 4HG2A 4CCOA 1B4ZA 5J3LA 4Q5SF 2YS9A 1Z7NE 4PQJA 3ZKKA 3WTXC 2LG4A 1B0LA 4RA1A 3OS0A 1T0KA 2V3QA 4HNTA 1QUKA 5IP9J 4RGXA 1SBPA 1TT0A 5HODA 3Q25A 4X48A 1SVXB 3N94A 1Z6TA 1R36A 2RVCA 5D8KB 5EHMA 4PJLA 3GTKJ 1ZJLA 4JWOA 1IMEA 3RKWA 3E5QA 2I48A 3HB9A 4YAHX 1D1BA 1W5TA 1ZGJA 2EZLA 2YR2A 3TQWA 5E3MA 2O03A 5D4RA 1NV6A 2X9DA 2JVGA 1V54H 2P4WA 5DCMA 3VYUB 1OVTA 3H4ZA 4THIA 5EYFA 3VVEA 1MDP1 2GHBA 4P0IA 1AU7A 5J16A 3G3HA 2EIKH 4ONYA 4HZFA 4KMUX 3HRSA 4LITA 3PMWA 4O8MA 4BJTA 3CCMI 3H3UA 4NQWA 4DXBA 2KL4A 2VIXA 3KOTA 1BIYA 2V79A 2ID6A 2Z1DA 3KZIC 1LB8A 2B65A 4OVSA 1FW0A 2H98A 3I59B 1CF7B 5EG0B 4JX5A 1XMKA 5JK4A 3OYIA 3FMQA 2DDKA 2HQNA 2ZSIB 1S7EA 1Q1VA 1UHMA 4RAGA 1VQ8I 4XIGQ 3MZHA 1IEJA 1I5ZA 4BYYA 2O61A 3UIFA 1YIOA 2H9BA 3LSXA 5ICEA 3T1BA 2R7SA 5E1ZB 4AUXA 2ZMEB 2VJJA 4FHTA 2FF4A 3GTJJ 2R4GA 3KP6A 5F64A 2ZJRF 3FD3A 1HSJA 1VFDA 5C4XJ 1O3RA 4HE2A 3DBRB 2EK5A 3I4MJ 5B70A 2VGQA 2IA2A 3V83A 3JRCA 1VTNC 2XXTA 4D7MA 5EG0A 3CCEI 4OFJA 3IAM2 4BDZA 2NOOA 1WH7A 3T96B 2P5KA 1X58A 3CF5F 2XGCA 4MFDA 3HHFA 2FBHA 4F3SA 1S7AA 1JJ6C 1TWYA 5IAIA 5EJCA 4KNYA 2CUJA 4XORA 4GLIA 1RRJA 4H8JA 1BR4A 1GGGA 3O6IA 4U87A 1QUJA 3U2RA 1BC7C 5EGOB 3S17J 4QWQA 3G3JA 4HCYA 3TEPA 2VKDA 3FXRA 4DCYA 4PCQA 5I58A 1J5YA 1BA5A 4MNUA 2G93A 1SD3A 4G4PA 1QVUA 3V5AA 2H1LA 2D2WA 5CLSA 2VPRA 1ETYA 5CVIA 4ZTFA 3GFJA 3RPLA 3HOTA 3VYTB 4DE8A 2BXZA 3G1OA 3H5AA 2WTEA 4N6PA 4CCLA 2DQRA 2XXVA 5EQ9A 3LFKA 3JRIA 2XXXA 3M3FA 3EPZA 2JMWA 4HX8A 4BY7J 3BBRA 4XRFA 1SVOA 1JKOC 4KHZE 4HX7A 1RUNA 1FQAA 3CLOA 5F6FA 2PEXA 1MMGA 4Z6YA 3OYFA 3TW7A 1FMVA 2QVUA 1TQPA 1MBEA 5IOYA 3CMEI 4DZ1A 4ABZA 5L8DA 3QU6A 2GFEA 3GW2A 5EGOA 5FFZA 4MNPA 3ISPA 2NNYA 4IY6A 3N05A 2QSXA 4N13A 2IGNA 1IN7A 1XMXA 5KDTA 1V5GA 1FBUA 1IXHA 3LL7A 3AL0C 5EHSA 2X85A 2Y75A 3OOAA 4I3EA 4E0WA 5H6QA 2F5FA 2VASA 3CQZJ 1OYIA 3OR1C 3HOYJ 2ZNYA 2WY7Q 5I56B 5EZHA 2CZKA 1WH5A 4YEJA 1B58A 1B9JA 2QLZA 1NH8A 2I49A 2DPUA 4LLNA 2KP6A 4ELQA 1QPMA 1YITI 3QYBA 2RF1A 2LR8A 1J7KA 2X1EA 4A6DA 3MKZA 2K3FA 2CU7A 2PJRB 2Y7PA 2OX3A 4DZJA 3C2GA 4EJOA 2QGUA 3M3YJ 2DA6A 4AIDA 3DBLB 2HVQA 2Q1ZB 3ZMUA 4YG2F 4F2QA 2E0SA 3ECHA 1OLAA 1POGA 1QKAA 3GBBA 2X26A 2MA3A 1X3UA 1KWHA 1HOMA 1ULYA 4OU0A 1N75A 4NB5A 1FOXA 2DDBA 2ZNZA 4F2OA 2IPQX 5CJ9A 1VQ7I 3K4CA 3C31A 3O9PA 4HE1A 4K3FA 2VKVA 1N0TA 2XROA 3K4LA 2CG4A 5CMKA 2CS3A 2HDWA 3I58A 4O5VA 5ICCA 1MPDA 3OS2A 2HQAA 3K2DA 2V26A 2QSHX 4X6AJ 3WU0A 1A54A 1EZPA 1Z7ME 4YFNF 3HIFA 1R71A 4XOTA 1JW4A 1M5EA 4B43A 5FD5A 4BE1A 1WJDA 3BY6A 1M5CA 2DYRH 2VQCA 1TW3A 4UB8C 3BJOA 2I3VA 3DPLC 3D1RA 4KYDA 3SESA 4H6DA 2XF7A 3HKZA 2IEKA 5FLVA 5FRMA 4AVPA 1W7PA 3DWLE 4D9JA 1KQ8A 3DP6A 4UXNA 5FTIA 3QU3A 2KISA 2M7AA 2EZKA 2B0LA 2H1KA 2Q8MA 4OERA 4RGRA 4A5MA 1BK4A 1P1NA 4U4SA 2VC0A 1M5DA 1SAXA 3PPPA 4BH9A 4NHBA 4YKPA 2PN6A 2MC4A 5K2YA 3T9XB 3LOCA 1UAAA 1DP7P 4DZPA 1DPPA 2JA2A 4BDLA 3BTCA 2VQHA 3FMRA 3KN7A 4U22A 3B73A 4YMBA 4RM2A 4IHXA 3HHHA 2A6TA 4DW6A 1ZBMA 1FOWA 3BR5A 3MWBA 1W7PB 2IS6A 1BIBA 3FWEA 3HCQA 4I62A 4UB6C 2PT2A 5KCJB 3L6GA 2J5PA 3G73A 2R93J 1GV8A 4QFPA 3LSJA 5J1DA 1V5FA 4MTDA 1D3KA 1EH6A 2W24A 2WAEA 3K70C 4CCNA 1BIAA 4ON0A 1NNTA 1LFIA 3TTMA 3D5SC 3SEZA 3GCMA 4OZ9A 1Y6IA 5AIPA 3WTZA 3EHSA 1DK4A 5JVGF 2KFDA 2XDVA 5DCFA 2R8TA 3HUGB 2CMOA 4IO2A 4LUBA 3CFXA 1QHGA 4YIRX 4X1DA 5I59A 2DFHA 1MDMB 1Z7UA 1GV5A 3F9KA 2E71A 2H8RA 4BY1J 1B9MA 4MQ9F 3IO4A 3K01A 3C32A 2NOJB 5A2QZ 1QKBA 1K4TA 1W0UA 4RXLA 2KJCA 4GIZA 1QZZA 5CPRB 3U9GA 1FBCA 1FQFA 2Z8FA 5M2VA 3USDA 1NNPA 4B47A 3RTWB 4G8NA 2Q8KA 3LA3A 1HC8A 2F7AA 5H8HB 1FPJA 2VKHA 2F5CA 2Q88A 2UVIA 3KJTA 1B8IA 4ASNA 3HGYA 2G9WA 2L01A 3S3OA 3ABTA 3ZR8X 2PI0A 1MM7A 3KC0A 2FEZA 1SFXA 1JNFA 3HUGA 1QQIA 4XSZF 4EGYA 5IP7J 4DXUA 4YRVA 3CO6C 4X1EA 3Q28A 2L7KA 2L9NA 4KJZA 2MG4A 1YI2I 1XS9A 4A3CJ 2OTLI 1PDAA 4M3FA 3A3UA 4EF2A 5LOMA 3BZKA 4BXFA 4FASD 5K7FA 3BP8A 3TDUC 1YJNI 4P56A 4N4OB 4KT5C 3HKZN 4W1UA 1SANA 3E5UA 4EQ7A 4CUGA 3VPRA 5DVJA 4G8XA 1XC5A 3RPUA 3P7IA 1Z3YA 1UQWA 2Q89A 1W5CC 4H5GA 3TTNA 1XCVA 2A5SA 1LQ1A 4IHYA 5DM6F 3CI8A 3LC8A 2NWJA 2ECCA 2M3AA 4EVIA 1E17A 5ICQA 2EA2A 1ATGA 4R73A 3UKGA 2GRVA 1IUDA 2A5YB 2WY8Q 3RYPA 2B9SA 2K40A 4NHJA 2V4CA 4GWZA 4MLQA 2HEUA 1HXDA 1IMDA 5L3CA 1FY7A 4F55A 3AXFA 2VT3A 1QNTA 3K6GA 1IUYA 4KPTA 1B3HA 3HPIA 4LZ5A 3WTSC 2HVRA 5D5WB 3PPQA 5HLIA 3A2KA 3PO2J 1SC7A 1ZIUA 2Z5UA 3ZMVA 4WEPA 1OYYA 1R1VA 2EV6A 1E0EA 5B1AH 2D5WA 1OVBA 3Q3SA 5DD8A 2PYYA 2LY2A 1AOVA 4X8RA 2Y7WA 3VFJA 1Z05A 2QENA 3K4KA 4RBOA 3FIWA 3PUBA 4B1RA 3K0LA 4I1DA 1LB9A 4JWYA 1LKXA 3TFLA 2NVTJ 3U8QA 4L9VA 1TBXA 3LMMA 4UV8A 3FXLA 2REGA 2O5RA 2OV7A 1KU3A 2JWTA 2HYGD 4M4GA 3ERMA 2Q9TA 2R7FA 3TQNA 2QKMB 2X6WA 5BS6A 1KGSA 1VNDA 2VPLA 1JTYA 1OLTA 1VE4A 1OISA 2JUGA 4E7KA 1YHQI 4HOBA 3UNGC 3GEZA 3T93B 2LF7A 1E3HA 2AQFA 1B72A 2L5VA 3WG7H 3OO8A 1IDZA 3BR3A 4G61A 4IHSA 4ZH4F 2DDAA 2IP2A 5JI6A 5HDKA 2R7ZJ 5GAEJ 1MXYA 3OIQA 4EXKA 5ITOA 1DTGA 5IZ3A 3PMXA 2FIEA 1OCOH 4NGUA 4FE4A 4OIRF 4RK9A 4F18A 2KHMA 4PGHA 5E1XA 5DUKA 1FEXA 2XVCA 3RZOJ 2QMWA 3TCFA 4Y13A 2MABA 3CF2A 2JA8J 2Z16A 2L7ZA 5FD6A 1M5FA 4PBQA 1ZLJA 2ICWG 5DDGA 1SEUA 1IF1A 1LBCA 3TTRA 3TUSA 2QZ8A 2Q2EB 3DP7A 2X6YA 3KSXA 4OHNA 3Q0WA 2VP1A 3OR2C 1I3AA 2XB5A 1Y9UA 1XOCA 1K4SA 2XIGA 3O66A 3R0JA 4IO6A 4GO1A 2NVQJ 4UACA 5IZ3B 4AC0A 4TV7A 4P9UA 1R9TJ 1IMCA 3ZCOA 2A07F 3TZAA 1XVYA 4ZECA 3TDZC 3MAJA 1AKHA 4ESXA 5HM4B 3F8MA 2VBXA 2HZDA 2X4HA 2DE3A 2GH9A 3FVKA 2QSFX 2KZGA 3EYYA 3BZ6A 2ME6A 1PC3A 1ZU0A 4FAJA 3NRVA 2FSWA 3I3LA 4NWDA 4GFBA 3W3CA 1MM6A 4HA8A 4MJOA 5L3FA 1PBPA 3VFZA 3W9VA 2JSPA 2B4MA 2LTPA 3V7RA 2YPNA 1G6NA 2NOGA 3BTIA 2D45A 4OVQA 5L9SA 2DQLA 1LAXA 1JI8A 1K61A 4I09A 2IA0A 3KCCA 1UELB 4ZDOA 4XN3A 2DT6A 1GR2A 5HVQC 3H9GA 2VJ5A 1EYJA 4QFOA 3BG6A 3R7XA 4LATA 5H8QB 3BG5A 3KEYA 3IV5A 1LAHE 3OELA 3QUJA 1BL0A 2B63J 4ZYAA 1HSEA 4ZEFA 2FMLA 4G68B 3ILUB 1M1EB 4WEDA 3CG1A 4N6DA 4RLFA 5GP9A 2EFWA 2DVZA 1YW7A 3PPRA 4Y52J 1IQ7A 4U0VA 1DMBA 4YICA 1K6YA 2XGDA 5AA4A 3LA2A 4OIQF 3B7DA 5LGNA 4AIHA 4G9YA 2WEFA 1SFEA 1ANFA 5LRRA 2KT0A 3RLFE 3JCUC 3QOPA 3K6XA 4GWXA 3GTMJ 4AIKA 3HSTA 1YS7A 4UNOA 1BC8C 5JFRA 4LONB 3V4GA 2RV8A 3BCBA 4L5IA 3U1KA 2ZZXA 4G68A 4YFKF 4HNUA 5J8FA 5EQ7A 2BXYA 2O6GE 2HPGA 1D1AA 4X04A 2DMUA 4IOCF 4FEBA 2H09A 1JEUA 3R4KA 2F6PA 3IOWA 5I3SA 1FPKA 3O6GA 2WA0A 4GYGA 4LN5A 1I6XA 3MJNA 2STTA 3WU2C 1I1GA 1TWHJ 1OCRH 1N3WA 4DI3D 4B3XA 3QYTA 2VD2A 1F9BA 4GXAA 4EJTA 1TWCJ 2EFQA 2DXYA 3I3VA 3EDPA 2XB0X 3PIOF 2I0BA 3A01A 3ABUA 3IB1A 3ZQ7A 3C1DA 4D5FA 1LVKA 1TW2A 2EPFA 2XKOA 3CJNA 4EM2A 1FTZA 1B6HA 5F7VA 5IGAA 4NWCA 4J19A 4O3CA 3JTHA 1R00A 2PMUA 3B50A 5CVJA 3IL2A 3KP7A 4BHBA 1T95A 4AM3A 1Z21A 4FETA 4GGGA 1NK2P 1AH5A 1USTA 2CQKA 4Q47A 4ESFA 3DU6A 3H03A 1S8NA 3F22A 3RT8A 4ZC3A 3JW4A 3O3KA 3D5RC 3QODA 2ADUA 2AHQA 2EB7A 3BG9A 3W2VA 5GAHJ 4IQ4A 5FB2A 4R72A 4G77A 2QS3A 1EV7A 1H44A 1K78A 2X1DA 1KYWA 3EUAA 3WODF 1FPBA 2QVOA 1D0XA 2VOZA 2EQRA 3HO7A 4RB0A 4HYEA 3MUQA 4MHFA 3H3VK 1Y0NA 5H8FB 2A68F 4M6YA 1U2WA 2IBDA 2LY1A 1JT0A 2R7UA 1N3XA 3N5LA 4YB6A 2OQRA 4F3QA 4PP0A 1W36D 4H46A 5LTCA 2LBFA 2VPOA 2DSFA 2H99A 4AS5A 2ONSA 3TO9A 3CCRI 1F36A 1NV7A 1XB4A 2OK2A 3IORA 3GYHX 2OQGA 3ZS6A 4RM3A 1T33A 4OAYA 4BHPA 4E0XA 1FTOA 1ON2A 4E7ZA 3DKWA 3O29A 2D1HA 1MBGA 4FECA 1RC9A 4PDHA 4JBZA 3ZQHA 4D0PA 2NXNB 3BR1A 3SDGA 2Z3YA 1MXWA 1TXFA 1URGA 2F36A 2HHMA 2Y84A 3OO9A 3R26A 2LBFB 3WAFA 4XM3A 4ZJZA 3DV8A 1APLC 1SW2A 2CGPA 4M3EA 1SD6A 1Y1WJ 3H36A 2QM3A 1R4MB 2HXIA 5D8LB 1QZEA 5HS7A 3O6BB 3WGIA 2DK5A 5GTHC 2E1CA 1O64A 2KR0A 3DELB 2C6YA 4IO3A 3JRGA 4EV0A 4Q4ZF 3ECRA 1X2NA 2VT2A 5DVIA 2LOOA 2LH9A 5IT9Z 2EZIA 4II2A 1OQHA 4IO7A 2JRTA 4QPOA 1REPC 1EU8A 3FZVA 4BXXJ 2M87A 3LAPA 2ZKZA 3IRRA 1JUSA 4DXCA 5A5XA 4OINF 1A31A 3M1CA 4IOAF 3CTAA 1J2XA 2MH9A 2NAZA 1BOAA 2XV4S 4ECFA 2FJ1A 2EILH 2VJIA 4ETSA 3PJRA 1LDJA 1FIAA 4PFPA 3L2CA 1IJWC 2E36A 4RPOA 3W6VA 1YW9A 4EDPA 3G6EI 3CSBA 1I6HJ 3PUZE 2COMA 5LFAA 1RZ4A 3TW6A 3IB2A 2G7HA 3H0GJ 2V9KA 3MCZA 2VOOA 5TP9A 1FBGA 1ZLQA 4Y3OA 3IFAA 1Q35A 4G8MA 4M3DA 3PIPF 5CVRA 2IEEA 4OXVA 4KIFA 3CHGA 4EJUA 1FX7A 1B3LA 3KEOA 5DV5A 3RPWA 4RMNA 5E8GA 3W2WA 3LSRA 5K7ZA 2RC9A 1X2MA 4IX7A 1XSDA 5CMCA 4YKIA 4KFQA 3U1OA 4GQOA 1U9NA 4LQ5A 3WTVC 3A0HC 5FKLA 1XD7A 3ZXSA 3MZ8A 1LB2A 4N4NB 4GX4A 4Q5TA 5J1UA 2ZYMA 1DQUA 2HPIA 1V3FA 1INPA 1DTZA 2HAUA 3EN3A 1S29A 1S72I 2ZO4A 3TDJA 3WE2A 3MP1A 4QSHA 3E6CC 4H0EA 1XPXA 1O3QA 4JDFA 5EYRA 3ECOA 5H8SA 4JXIA 1QHHD 4I7HA 1PUFB 3S9NC 2HVSA 1FTAA 4U2RA 2DOFA 1CNQA 1J75A 1OQYA 5KDTB 5KAIC 5CBRA 4D7NA 1IRZA 1NV3A 2RINA 4AYBA 4UHTA 2KRFA 2M4KA 2Y2ZA 1SDXA 2WKYA 1GVJA 3LSTA 3Q27A 3J7AO 3RDIA 3ZMZA 4FX4A 3JZJA 5I56A 4LZ7A 5F08A 3HBLA 1E3OC 3I5OA 1FTJA 1TT1A 1XX5A 1RDZA 5BMZA 3GYYA 4GX6A 4RGUA 2LD5A 1HKTA 5HLHA 1ZG5A 1P4AA 4IVNA 2PT1A 1PUFA 4PJ0C 2X0LA 2ZNUA 3MVXA 4F3PA 1O3SA 4XRMA 4FE7A 4B48A 1ZRFA 2KRHA 1NHAA 1S7OA 2JSCA 5K1YA 2MFZA 2BZTA 4CYCA 3L1PA 4I6ZA 2UYEA 4LP2B 5DTBA 2H25A 3PGFA 2JQ7A 4R6YA 2H27A 3DLLF 2DK8A 3CCVI 5L3BA 1UFMA 4UUTA 3X2QH 1USYH 2E2HJ 3FXOA 2LMDA 3MZ9A 4N81A 3PM1A 3NEUA 3S3MA 3TCGA 4N91A 3E6DA 1SFKA 2QYOA 2XX7A 1RDXA 4C9YA 4MF3A 4R79A 4IR8A 1GVCA 1HA8A 1MQHA 3C9HA 3V8KA 3B6WA 4NC8A 1B5HA 3CC4I 4NC6A 3ZMSA 2ETHA 2FBPA 3KJ7A 4FORA 2Y9YA 1Z6RA 3G3FA 3FKJA 4XR6A 1BJZA 1LSTA 4ZZAA 3DTIA 1VR5A 5CVVA 2IA1A 2BJJX 3CDLA 1FSEA 2DFFA 3MZYA 3CC7I 4L18B 4QFNA 4YMAA 1R4NB 2W25A 2GXAA 1UTHA 5ITPA 2WYKA 1MMDA 1B5JA 1J59A 3L2VA 1G0IA 1K83J 1XTAA 1BJAA 4IRGA 5JR3A 1QPIA 1VFEA 1B7HA 2ZXWH 1Y8QB 1WODA 4N8YA 4PZJA 2B3BA 2ONKE 2V3TA 4MEVA 1YX5A 3RTFB 2DT7B 3S15J 2FQ3A 1H9TA 1OCTC 1OKRA 2QSGX 3IC7A 4UUVA 2FYIA 4U21A 3KFWX 2G7UA 3I56I 1QGPA 2UV1A 3MN2A 4ZYDA 1EKEA 3OXNA 2DN0A 2PQ8A 1TQIA 1LBBA 5B66C 2W7NA 5EEHA 1UTHB 3PUVE 5J6XA 1G3TA 1SD7A 3IH4A 3HOWJ 4DCXA 2VXDA 3IR1A 2XX9A 5KCJA 3ERED 4I0AA 2MYSA 3GUDA 2BW3B 1DPRA 1SYHA 2XXPA 1VQ4I 2E1SA 4MHGA 2XWIA 3KIOA 1MXXA 5JHUA 4GWWA 2PX1A 4JSOA 4EQ9A 1Q1KA 2AL4A 3QSLA 1JE8A 1WI9A 1WI3A 4OWDA 5TJJA 3MKWB 5BNGA 2V3UA 2UVGA 4HNVA 3LSKA 3COAC 1I6AA 1BW6A 2CH0A 4LIVA 3F0CA 4NC7A 5E3NA 2NS0A 2M1BA 1HW5A 4U0YA 1VQ9I 1ETVA 4YIFA 5HBCA 3BT9A 4MQVA 4E7HA 1MDMA 4BGDA 2ESHA 2O68A 3WHCA 1D4NA 1XDUA 2WBMA 3OYLA 3LSWA 3E4RA 2E60A 1FPDA 3K2AA 3MVYA 2BW3A 2V1DA 3VODA 2OWSA 3TAJA 3FATA 2KIMA 1MNDA 3ASNH 1R1UA 2FQ4A 2ME0A 4ANJA 3K4UA 1NNKA 2Y30A 1GV2A 3S2WA 3OSFA 3HOZJ 2O84X 4GRKA 4HCWA 4KCCA 5H8HA 4F19A 2JVHA 3RTRA 2KLFA 3IWZA 2ZXHA 1WJAA 2R3SA 3CCYA 1II5A 1N76A 2PCRA 4A0YA 3GX4X 3M3LA 4NE4A 3FJ7A 1Q1HA 4N9HA 3I6VA 2KIQA 1H3DA 4BE0A 4HRIA 4PJMA 4G68C 1B3FA 3Q0UA 1R58A 2DFIA 1JGSA 4EMSA 3OSGA 1EH7A 1I69A 1O57A 3KP3A 4NDLA 1QVSA 1GUUA 4TLMB 4M72A 3DTEA 4RDUA 3KLOA 3PQKA 1NH3A 4YKJA 3CJTB 4BEHA 1ZLKA 4I9DA 5CBSA 1LJ9A 3P7NA 4OFLA 1Y4TA 2XPWA 2VB6A 3E7LA 3D4CA 3I5UA 4A2UA 2R92J 1KA0A 4NF5A 4Y15A 1XDSA 3HOUJ 3EQ1A 1T08B 2LNBA 4C3IJ 4A3LJ 3MKYB 4A69C 1POY1 5BPDA 1DDNA 2NNNA 2VBWA 3ZQQA 2THIA 3DQVC 2K27A 3CFLA 3HFUA 4PFYA 2F7CA 5IZZA 1LLSA 3KSJA 3U1DA 5IYDJ 1B3EA 6PAXA 5L3GA 4DOZA 1MQIA 1BI0A 1ZN2A 2YJPA 1FWZA 1P2FA 2VN2A 3DKXA 2F4MB 4IO9F 2FX0A 1D9QA 1UMQA 4R2FA 4N6KA 2WAFA 1LAFE 2R7DA 2XC7A 1SI1A 1YW8A 5ICFA 3FDYA 3FBIB 2V1XA 2HGCA 1KZHA 3S1MJ 3HN0A 5ILSA 4DQ2A 2D5VA 3HRMA 3I54A 2V7FA 2F78A 4BDNA 1BW5A 1FPQA 5JTYB 3OY9A 2LDUA 5FO5A 2IS1A 2HZLA 4O7MA 4PAFA 3ZQCA 2P0SA 2W82A 4E70A 4UY8I 3BZCA 1H9GA 1WFXA 1Y0UA 2DOAA 3W9WA 3H3GA 2P3NA 3DPUA 3FGSA 5ICTA 1X4PA 1IRFA 2HKOA 1BTJA 2R7QA 1VQLI 3CCJI 1FBDA 5FKNA 4X1BA 3PUXE 4IHVA 5DEXA 1U9OA 2Y5LA 2DJNA 3EYIA 2WAQA 2JA5J 3FV2A 4UVCA 1ZTRA 2F34A 3JTGA 3K6VA 3C3WA 5AONA 3MW0A 3VYRB 1RKMA 4Z7EA 5JTYA 5TRDA 2E1MC 3H5NA 3M4OJ 2AXTC 1N78A 2IA4A 3O28A 4H45A 3CUQA 3F6OA 1LFUP 4XKPA 1ETKA 3GTGJ 4ZEDA 1TTYA 4M1VA 3C2BA 4A6EA 2G0EA 4AU7A 2ISZA 2DWJA 5L9OA 3KP2A 1XGOA 2Q2EA 3FXJA 5HS8A 3LAJA 3LSFB 1DPEA 3JAMK 2RDPA 2M4GA 4BNCA 3FMSA 1IUFA 2F3BA 2Q2CA 5DEXB 3VLVA 4F29A 4PAIA 1OMIA 1D9VA 1FPEA 3FHNA 5CMBA 3PTYA 1JUPA 2P81A 2DMNA 3CC2I 3E3VA 2AXLA 2ECBA 1TWFJ 3OD7A 1ONVA 2JN6A 1WSUA 1AKHB 1TNSA 2JUCA 5FKKA 3CUQB 3KBRA 3I0TA 1ZKBA 4IHWA 1WDNA 2ZMBA 3Q29A 1IN6A 2DW4A 1MY1A 2FBKA 2PMZA 2Z9OA 3IOVA 4JQFA 4A3MJ 3EHUA 2L7FP 4HPQA 3DM0A 4UA8A 1QZYA 2OCEA 4QLCU 4OIPF 4IGRA 3RKXA 4F1UA 2M7BA 2DU9A 1MXZA 3H35A 4GF8A 2L3DA 2XF5A 1MXUA 4LG3A 3K6UA 3QAHA 1YYZA 3K00A 4V19K 1O7FA 4IZZA 3IKTA 2A5TA 4IF4A 1MS7A 5KZTA 3K7AJ 3PNVA 2WC2A 2RN7A 1E3PA 2FU4A 4G6DA 2QS1A 3F23A 4OETA 4ZDLA 5H8QA 3IO6A 2RKMA 3PUFA 3P9IA 1U78A 1B51A 2FHYA 2XAHA 5KK1A 3CD6I 3EF7A 3SXYA 3L2WA 1B52A 2VKEA 3IH2A 3MKLA 4LB5A 3L09A 1OQGA 2KQZA 2DA3A 3ZRGA 3MZBA 3D5LA 2VL8A 2K9LA 3A29A 4FIMA 5TU0A 2IS4A 4A3DJ 2BOLA 1YOVB 3RPQA 3S14J 1LAGE 1NV5A 5B1BH 1QVTA 4KMFA 2BVLA 1MG1A 2ZYKA 3LFUA 2OPTA 4GVOA 3RY3A 5AA4B 4KITB 2I8DA 3SFIA 2FBIA 4FBPA 2LP0A 1YTVA 3PV0E 3QRFF 4PETA 1ZYRF 1G3YA 1JEVA 1NG7A 1F1ZA 4MIMA 1IMAA 3OMBA 4P3LA 3ASOH 2NVUB 1U8RA 1T8IA 3P9KA 2A61A 4OEVA 2O7OA 4A3JJ 4BBSJ 5DYMA 3D1NI 2WBDA 3L00A 1SAUA 1SMYF 4CZZA 3JSOA 2QWWA 5E79C 3FXBA 3FK6A 4GXSB 3MWMA 4NF8A 3ESWB 1BR1A 1DP3A 4MNCA 3HZJA 1QGXA 4PF6A 3ZN1A 1PB8A 1XGNA 2OF7A 4GL8A 3OOUA 3TYHA 1SQYA 2R71A 1YTYA 3K4BA 5E1WA 3F8NA 1LCTA 4NEDA 3OYMA 5FFXA 2ELJA 2CW8A 2LK2A 2Z2SB 5KAFC 2DJIA 5J1RA 3BTJA 5BQTA 1FQEA 2NS8A 1TFAA 4DYQA 3KETA 1D5YA 4NF8B 1NUZA 4HS7A 5EYGA 2DODA 3GZNB 2AQEA 1NH7A 3RT6B 4A3GJ 3UP9A 3IKVA 5ED4A 2UZKA 3JRAA 2XRLA 4M73A 4IEJA 1N04A 1I6BA 1S3JA 4H8IA 5J4VA 3QIMA 2R5ZA 1R5ID 1STZA 2F48A 3IB0A 4ISUA 1Z3XA 3QPTA 4AQ4A 4R8HA 4QRZA 1WJFA 1BN5A 3FM3A 2DA4A 5ET8A 3OWTA 2B7EA 2VHAA 1JVYA 2QL3A 4HLXA 1P7IA 4RB2C 1IIWA 2VE9A 1FQDA 4XQFA 4XXUA 2ESNA 2ZNSA 1ON1A 1V5EA 3SQNA 1K78B 4OQOA 1XT8A 5FBPA 2E2IJ 2XUBA 4HV5A 2F5EA 2OCCH 3BR2A 4BHCA 4AIJA 3DLNA 3TQLA 3H6VA 5H8FA 3L2UA 4PFBA 2K7LA 2GLOA 5FHOA 4Z2YA 2XXUA 3KZGA 4PGGA 2HYJA 2FD5A 2QCOA 5B5EC 1B0HA 4IPAA 2QFLA 1FSAA 3E0JB 4H0WA 3VXBA 3SEQA 4ZEKA 4FE8A 3P9CA 2HCAA 1P1WA 4XTCQ 4LD5A 3U94A 1SFOJ 3LUYA 4PBHA 4A12A 4XKVA 1AOYA 3V42A 4OFOA 3QOEA 1D8KA 3FXQA 4EATA 4GFRA 5I57B 1YXIA 4F92B 5LHHA 5DTDA 2GWRA 2RKHA 4BS9A 5LGUA 4U1OA 5J1YA 5TGTA 4NNJA 4XNFA 2OWTA 2M8CA 4V2FA 3TO6A 1ZKGA 2H6BA 1MXVA 3IFCA 3M8EA 1H43A 4FISA 5ERIA 4L0ZB 3RKYA 4OMYA 1BR2A 2R7WA 1D0YA 3BJAA 1D9YA 2XXQA 2HOEA 5DS9A 3AKZA 1Y1MA 2O69A 3CSGA 3PPNA 4P1WA 3S16J 1FPLA 2DE2A 1RNLA 1RKWA 2Q2AA 3QAXA 4LQ2A 1F5TA 1P4WA 3GXAA 3TKDA 3IL1B 2KDZA 2YU3A 2YX4A 2A05A 2L7MP 4A0XA 1IV6A 4KN4X 3W2AA 4NAPA 4G12A 4PGPA 3MQ9A 3FHZA 5K5OA 5HDNA 4LFUA 4FX0A 3U72A 1ODDA 1LPQA 2FOKA 2F3DA 5A5XB 2L0KA 4AD9A 1WCMJ 5CI5A 1ZR2A 2K9MA 2GXBA 1TL8A 1FQBA 2AYSA 4MFIA 3HHGA 1IXIA 2VT5A 5AE4A 4XRSG 2Z22A 2IT0A 4MAGA 3DP4A 2F6CA 5D6FA 2HFHA 4HQMA 2P1SA 3DBHB 1HSLA 2HXWA 3UA8A 4A3FJ 2VOPA 4OMZA 3ZP5A 3MMYB 1W4MA 3CFZA 4CSWA 3JRDA 2O51A 3K4JA 2VBZA 4QTRA 1NTCA 1XVXA 2BGCA 2NS7A 2CW7A 4GBWA 5K2XA 5TP9B 3TPAA 1MH4A 4S04A 5IY5H 1U5TC 3S93A 1YYVA 4C3HJ 3S1QJ 2X7QA 2Z8EA 3MPKA 3BG3A 5E3LA 1LFPA 1O4XA 1B7UA 4TLLB 3PU5A 5LEJA 4ZYGA 3LNQA 1JHHA 3CUOA 1IV8A 3DP8A 1HLVA 1QBJA 4P1EA 4DIGA 3NQOA 2TDXA 4NBQA 3RI4A 2DWIA 3DEUA 2HYFA 4DYRA 3FASA 5JEIA 1IMBA 4I02A 1A8EA 4G7ZF 2ZZVA 3EKIA 3GXOA 2YU9J 1ETXA 2VBYA 1UCRA 3VB2A 3DFGA 3IJXB 4BDOA 2HQRA 3LSIA 3ABMH 1JW5A 5F04A 2PMHA 4XLCA 4DBRA 5IPAA 4C2UA 1FBEA 1LBVA 4ESWA 4PSWA 3BDDA 4CHUA 3L2RA 2CQXA 2REJA 5ET7A 3GZ5A 1AHDP 1MY0A 3BR6A 1YRNB 1ZMGA 4R9FA 3W6KB 1TLHB 2WYPA 4ZDPA 4BE2A 3BIHA 3S4UA 1MQJA 4WXDA 2JA7J 4FATA 1UG2A 1FBHA 2FVZA 4G8HA 3ZOBA 4KT6A 3HEFA 4O3BA 2XSDC 2WBBA 3N97A 1PB9A 4NN3A 2E35A 1EJ9A 4N15A 1N84A 3A4CA 1IAWA 3S2DJ 1USYE 3LUZA 4PDKA 1HBXG 1R5GA 2K3PA 5ILUA 4M71A 1ERDA 2JT1A 2ZMEC 3GWZA 3FM5A 3LWFA 1O7LA 4P5OA 3I53A 4V2GA 3JRHA 1ZR4A 4JVCA 4A5NA 4ZE9A 1QUIA 4CYCB 1YE9A 4KUMA 1U3EM 3FX3A 4WKMA 4M6XA 3WGHA 3AG3H 2XRNA 5HLGA 1L5TA 3C18A 1BLFA 2XXIA 4N17A 1LEVA 2XSJC 1A5JA 4PK4A 1KZ8A 3HSEA 3VEPA 3W15C 2R7TA 3AG2H 3TCHA 4KIGA 2DP8A 2L5QA 3QPSA 2DCEA 2EJRA 5F0HA 3R6UA 4OVJA 4MGRA 2D3IA 2OJED 2DTZA 3OYAA 4G7OF 2ONRA 2QVRA 3VVFA 5LLQA 3ZMDA 1VQNI 4JSDA 4EUOA 3KBZA 1URSA 2PVUA 3KZYA 2Y5KA 5EQAA 3TL4X 3OOPA 4EEFG 4PGNA 5BOXA 1OCZH 4BQNA 3T0YA 4A3KJ 4BAYA 4DLDA 1MQGA 3RCOA 2W57A 2OCUA 4J00A 2DAOA 3TOAA 2WX9A 3MP8A 2FOWA 2RREA 1HCRA 4XLAA 2LKXA 1X3WB 5F0CA 1FLIA 1A6IA 1H76A 4D5CA 2HPMA 3G3IA 1SFUA 2B4LA 1VQMI 1MBJA 1OYWA 1K7AA 4UVBA 3THIA 3A1YA 3KC1A 2P8TA 1SVLA 3KX2A 1T2KA 4X9TA 3G4SI 3QP6A 3CCQI 1X1PA 4BLAA 4N9IA 5KHDA 3ML6A 3MVPA 3WTYC 2VQGA 5FLXK 1L3LA 1NUYA 5ESYA 4AWXB 2XXWA 1KA1A 2XXYA 2UWMA 2K9QA 4HLYA 2XAFA 2BJIA 4BDMA 4QSDA 3K69A 3OSQA 3MSTA 2H94A 3T66A 1Z9CA 1D0ZA 1QU3A 2ZXTA 4RAYA 4XLPF 1XSVA 3GFLA 1X3ZB 2KLOA 1YX3A 3TGNA 1FOKA 2HNHA 4OWRB 4PCDA 5D5UB 4GWOA 4LOCA 3LSMA 2GA1A 1KA8A 1LCFA 2I5UA 1T0FA 3PFYA 2H5YA 4CXFA 4OA4A 4XEQA 4KYWA 1JETA 1TP4A 1MJ9A 1MD0A 3WTWC 1US4A 3BKIB 4ZE8A 2HXRA 2O8XA 3LSGA 2ALUA 1WJBA 1XG1A 1T38A 2LAOA 1KU7A 3VXCA 1IXGA 2QQAA 1MY3A 1WJCA 2MC3A 1P1UA 1X1AA 3K4MA 1U6GA 3B8BA 4N4UA 1JXSA 2RNGA 3SYTA 5K5RA 2CQ7A 3RYDA 1LFBA 4C2TA 1SW5A 2XKPA 4F91B 2L9RA 2I6EA 1NV1A 3QYFA 5DD4A 3S32A 5IKBA 2MH2A 4UV9A 1T56A 1R6ZA 2HU9A 4HF1A 1XCBA 2OA4A 2PJPA 1ORKA 1B4AA 3FJMA 4QSEA 4NUBA 3CMYA 1N7WA 3F21A 3FVGA 4LLLA 3SZGA 4B4CA 1FOYA 3VWBA 3FXMA 2V25A 1ETOA 3PSIA 2V4JC 1BM9A 3PMVA 4OVTA 3JRBA 2VQLA 5HPQA 5I2NA 5I84A 3F8FA 4YIIA 3BTLA 5IYCJ 4II3A 1Y3NA 1NG6A 5AA1A 1U0JA 4GOTA 2O1LA 5CC2A 1C0WA 3K2ZA 4O3MA 1O7TA 3HXLA 2P0WA 4PUSA 2HTJA 4L5JA 4XN0A 2OC6A 3A03A 4BEHB 4A3BJ 3S9LC 4B8XA 2RC8A 3WTTC 1FJ6A 2F8DA 4F7ZA 3TO7A 4MLOA 5A2QK 2XA5A 4JWXA 2LFBA 4L9TA 4ND9A 3UK4A 4NF5B 1JW1A 5KNLA 1POTA 2FA5A 1GDTA 5C3EJ 2OLBA 2A6HF 1YCJA 4P9KA 3SETA 2ZYOA 5I2NB 3CLQA 2E5NA 1LFHA 3U65A 1EZOA 4CCMA 4MTEA 3VYSB 1KYZA 3RSNA 1B4HA 3ILTB 1XSXA 3OEMA 2UYFA 1ZGAA 4I40A 4YU0A 3T9UA 5AA3A 1ACIA 4GWSA 3LR1A 1MY4A 3CRBA 2L9VA 4ZEBA 1RDYA 1MMAA 3G3GA 4AB6A 1R49A 2MGQA 4CZCA 3EPEA 2IVMA 3REOA 1LEBA 1MIJA 3I64A 1UTBA 4IQJA 2I4CA 3KE2A 3SEYA 1I50J 4HF2A 2BY0A 3JAMZ 3E79A 1S9TA 1FJLA 1FBSA 3C33A 2GA2A 4EM0B 2HAVA 3WAEA 3BC8A 3FVOA 1B9NA 3S2HJ 2DWHA 1FYLA 2IS2A 3GTPJ 1ZARA 2M0CA 4GX3A 5IM2A 1HDPA 3HJEA 1AWCA 4F93B 2I3WA 2CUZA 1VQKI 3TTLA 4RA2A 5AIQA 1ENHA 2EZHA 2JZYA 1X1CA 2LF8A 4EM1A 3HTSB 1MMNA 4U7BA 2WV0A 4JYKA 4LK1F 3OENA 4R6HA 5FROA 4ZZLA 4KIBA 1ZRCA 3CCLI 3VLWA 5DEQA 3E6BA 3I4PA 2FNCA 3JREA 4LA9A 3L9FA 3KPHA 3TP3A 2R0QC 3T9HB 3OYBA 2DA5A 2DBBA 2DXIA 1AL3A 3RIRA 2HQ0A 1LBZA 2CEYA 2DWAA 4NF6A 2H8WA 2VPNA 4ZEIA 2MLKA 1ZELA 4M6VA 2BY2A 5F1RA 2X7PA 2YLNA 3SFZA 3BROA 3HPGA 3G3KA 2XXRA 1TWGJ 1IN4A 1G2HA 3FIRA 3W6JB 4YB7A 4WWCA 1S5LC 4OANA 1F43A 2F7BA 2UVHA 2RC4A 3IJOB 1P99A 4ENKA 4FT8A 2R6GE 1JGGA 1EYIA 2JJKA 2JPBA 1DSNA 2OAZA 3R61A 5FLXZ 5F0FA 1R6RA 5JLWA 1Q9DA 3VLUA 4PFUA 4WXHA 5H20A 2A5WA 4PJNA 4XSXF 5KVRA 3BFUA 1NMUA 2JA6J 1KQ9A 2HXOA 2RC7A 4U7DA 3TOBA 2ELKA 2CV2A 3LBSA 1NUXA 2XHKA 4GL0A 5I2KB 1MPCA 4JVDA 2KIFA 4WX9A 2GQ1A 1DUXC 2QS4A 4C1UA 5CKTA 2YPRA 3SEVA 1A8FA 1J09A 2GBYA 1XGMA 4KD5A 3M8UA 1IXCA 2M9HA 3DTKA 4CCKA 3GZGA 2K86A 2O0YA 1SD4A 1BKAA 1FTLA 2A5TB 4C0RA 4YZZA 2ANJA 4XICA 1H89C 5I2KA 2Y0SA 4DDDA 2MLGA 4A3EJ 2QVVA 1Z77A 3K1PA 1OLCA 4HDVA 1G4DA 3KFMA 3C4MA 4WF2A 1FIPA 1FYMA 2Z23A 5D5XB 5E20A 3BR0A 2OD5A 2P5LC 1IG7A 4RAFA 4IRIA 2UVJA 1FPFA 2EIJH 2EV5A 4XLEA 3ONQA 2R7OA 2F6GA 4DNCA 3S3NA 4QFKA 2IXSA 3Q9SA 3T8RA 2KIUA 3MEXA 3H6UA 3GTQJ 2NXOA 4ITVA 2WADA 2CZHA 2UXNA 1MBFA 4PFOA 5HLTA 1IC8A 2DA7A 2WAQN 3FISA 4XK4A 4BDRA 2R9JA 2P6SA 3HOXJ 2EINH 4GYIA 3H9QA 1BI1A 1UHWA 3KP5A 1ETWA 5ILVA 3RKQA 1S7YA 3N26A 3TODA 3I9V2 1FQCA 2F5VA 3J81K 1MNMC 2M2EA 1LE8B 1Y3QA 4PFRA 3OYCA 4HDUA 2PX9A 4POXA 1B59A 5EQ8A 1MRPA 4N8GA 4RNSA 4BQOA 1MGTA 4FJPA 4RPNA 4N0BA 3B6AA 1I39A 2F5DA 5F1JA 5M5XJ 1P6RA 4PAKA 2ELHA 2GM4A 1X1BA 3B6QA 2MD5A 2XX8A 4P47A 4EXLA 1OFCX 5AA2D 1IRGA 5GTIC 4OAZA 3F6VA 5F27A 1EH8A 1AMFA 3D4GA 1P7JA 2GIZA 2PBWA 4Q0CA 2DMQA 4R75A 4KFCA 3CESA 3A0BC 2DA2A 2E34A 2XGXA 2W4SA 5LDZA 3OIOA 1IN8A 4KN7X 3H7MA 4CDGA 3H9JA 4GWUA 4OYVA 3MP6A 2X6XA 2ZJ2A 1J0RA 2M8EA 3IRQA 1RR8C 1RIOH 3HYIA 4Q30B 2EBIA 3TEDA 1HW2A 1PEBA 2R5ZB 1BI2A 1W7PD 1WKMA 2BYVE 3LQQA 3RQ4A 5M3MJ 1DCUA 3RN8A 3OS1A 2X51A 2CZLA 4UUSB 4GWYA 2W1OA 5CVUA 3GO5A 1YRNA 4RK2A 3IP4B 3M07A 5GPCA 2NVXJ 1FMWA 1UHSA 2M0MA 3KYCB 1FYKA 3CMMA 1A7LA 1I6QA 2AL5A 2ZJQF 2OZZA 3I71A 5J40A 4MO7A 1OPCA 2Q0OA 3IWFA 3G1LA 3GF2A 2QQ9A 1UB9A 3GLXA 4PF8A 2FE3A 2AIXA 3JYRA 4A93J 3SDBA 4ENJA 2CQQA 4POWA 1IXSB 3H0DA 2M5WA 4CH7A 2DVCA 4G6QA 4E7JA 4UUSA 3K10A 4DGWB 1GT0C 2HOTA 1CB6A 1JVXA 4L17A 1Z1DA 5FRNA 1JT6A 2DMTA 4M3BA 4HW8A 3LSPA 1SMTA 1JKPC 1GTKA 2XXKA 2EWNA 3LSLA 4IRHA 1Y1VJ 1P1OA 3E1SA 1B05A 3BJ6A 2PFBA 1N25A 5CQGA 1A04A 2E5ZA 3H92A 5EEGA 4WXCA 5LEKA 2F97A 1YFHA 3CG3A 1HSTA 4F31B 5BWJA 4BDQA 1SI0A 1NL5A 1A55A 2CEXA 5I57A 4AYBN 1IDYA 4JK1X 2MW8A 3TP0A 3M3KA 3SEWA 1JKQC 4BDYA 3F3XA 4DI4B 3SERA 4EF1A 5CRYA 3VSKA 1JUMA 4QBAA 2M8GX 3OYKA 2WV1A 1A35A 2CW0F 2M34A 3PUWE 2Y0MA 1ZH5A 2XXHA 4NF4B 4QXDA 2V1NA 3WE3A 3OO7A 1VFCA 4I01A 2OZ6A 4HAMA 1ZREA 2KKOA 4OEUA 2EIMH 2H4IA 2FNPA 4C2MJ 5L3EA 4E7LA 1VQPI 4C30A 2KPMA 1OR7C 3GBGA 1Y20A 1YPNA 1YJWI 4J01A 4LMYA 4IKFA 3NOHA 2O7IA 4MMPA 4YKKA 1IITA 2DO7A 2ZXJA 2CV0A 2UXAA 2XAJA 4HSRA 1LFGA 4LIUA 1Y3PA 1FC3A 2V9VA 1DU6A 1EZ9A 3A3CA 3H06B 1HKQA 3IAZA 4BJ6C 1YO5C 3QPLA 3CIJA 2JRMA 2L9SA 5CYVA 5TPAB 2YSRA 1BBYA 3S8PA 1VDWA