1GVCA

18kda n-ii domain fragment of duck ovotransferrin + nta
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
SYYAVAVVKKGTDFMIKDLRGKTSCHTGLGRSAGWNIPIGTLIHRGDIEWEGIESGSVEQAVAKFFSASCVPGATTEQKLCRQCKGDAKTKCLRNAPYSGYSGAFQCLKDGKGDVAFVKHTTVQENAPEEKDEYELLCLDGTRQPVDSYKTCNWARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mechanism of Iron Uptake by Transferrins: The X-Ray Structures of the 18 kDa Nii Domain Fragment of Duck Ovotransferrin and its Nitrilotriacetate Complex
pubmed doi rcsb
molecule tags Iron transport
molecule keywords OVOTRANSFERRIN
total genus 43
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2002-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1gvcA00
2O7UA 5FTHA 5B7DA 3P7IA 1LAXA 4YKIA 1MQIA 4HCYA 3QAXA 3WAEA 4NEDA 4WXJA 2F78A 1HSJA 4XXUA 4JWOA 4F22A 1P1WA 2F7BA 3O6HA 2IEEA 4RPNA 1LSTA 2VD3A 1CB6A 4TQUQ 5I56B 1USYH 2ABHA 1I6AA 3I3VA 4QFPA 2ZXTA 4ZE8A 3GXAA 1FW0A 3DP6A 3N5LA 1B2HA 1IEJA 3FZVA 3PPQA 5TU0A 2GHAA 3VE1B 3VXBA 3UK4A 1F9BA 3TYHA 4DZ1A 3TTMA 4EXKA 1O63A 3LSXA 3PPNA 2Y84A 3BFTA 4IO2A 4AB6A 4F3SA 4JDFA 4ZECA 2XXUA 1XVYA 3U92A 3V8XB 1GTKA 2IA4A 4IO5A 1VFEA 4PFWA 1ELJA 1NKXA 3N6UA 1SI1A 3LR1A 1DTZA 1IXGA 2OLBA 4Z0IA 1NH8A 2UVIA 4GRKA 3RY3A 3Q29A 3TPAA 2AIXA 3KJ7A 5EHSA 2FYIA 1ZKBA 5FTIA 1H44A 1IQ7A 4FEBA 2Z8DA 1NL5A 4R6HA 1SW5A 4KYSA 5BUUA 1Q35A 2XXYA 3GBBA 4G77A 3TTKA 5AA4B 3KN8A 1MY3A 3FUZA 4ZEIA 2R6GE 3KOSA 4YZZA 5H8QA 3T9XB 1MPCA 1FQDA 5CMBA 4KCCA 4EQBA 1DTGA 5L9OA 3MVZA 1URSA 1JW1A 1US4A 1MPDA 1XOCA 2V3TA 3G3FA 2O6AA 3TQWA 5LOMA 2A5SA 2P2AA 4F3GA 4ESWA 5A5XA 4R6KA 4BDOA 1A99A 2OWSA 3B6WA 2HEUA 2PMSA 1PBQA 4YB5A 1GV8A 1B1XA 3KN7A 3T9VA 5JEIA 2R71A 3MZ1A 4MH5A 1BIYA 3QUJA 3CG1A 3Q25A 1B3LA 1NNTA 5I58A 3U1OA 4OZ9A 5FHNA 2XX9A 3QK6A 4NF6B 3KFMA 4PFUA 2ZYNA 5AA2A 1I6QA 4BDNA 4OHNA 2DE3A 2H98A 4U2RA 1SVXB 3B7DA 4EXLA 4F31B 4OENA 3QXMA 4HCWA 1EU8A 3K01A 5H8FB 4AB5A 5J1DA 2O68A 3HHFA 2I6EA 1MXVA 3N94A 4G8NA 4LZ8A 2AYSA 5H8HA 4OFOA 2XXRA 4BDLA 5FHMA 1M5CA 2F8DA 3S9MC 4JWXA 1MXWA 3MZ9A 3ODBA 2NXOA 3JV9A 4JSOA 4X48A 3HHGA 2RCBA 3OSRA 4LATA 1LCFA 1OMPA 2D5WA 1H45A 3FV1A 1FQEA 1D4NA 2VOZA 3H6WA 3PUZE 4R73A 5K2XA 3IJOB 4EUOA 5IKBA 3GZGA 4RK2A 2O84X 5DVFA 1R1NA 3DM0A 3O29A 2DWHA 3IJXB 3FVGA 3LSFB 4OFJA 1DPEA 4DDDA 3BBRA 4X1DA 4QFOA 2DXRA 4DE8A 3PV0E 1UTHA 1DMBA 2QS1A 5JTYB 4H8JA 2F6PA 3MZBA 3OSQA 1FQCA 1BTJA 3M8UA 1PB7A 2DWAA 4O3CA 3HV1A 3U94A 3EHTA 4F19A 1ZJLA 1SQYA 5KDTA 1EZPA 4C1TA 1QVSA 4E0WA 1AIVA 4F29A 1OLAA 4KQPA 3KSXA 4R75A 3U8QA 1B4HA 1N3WA 1YPNA 3IK6B 3M3FA 3OMBA 1NNFA 4BDQA 1WODA 3CSBA 3PPRA 1LFIA 2A5TB 3C36A 1R9LA 4G2ZA 4NF8B 2F97A 2Q88A 4GWOA 1MY2A 3KSJA 1XT8A 4KCDA 4DCYA 3EPEA 4R6YA 1SYHA 3E3KA 3PPPA 1B0LA 1SD3A 4FJPA 1MDP1 3B6TA 3R26A 3VVDA 2ZMBA 1L5TA 2ALUA 3LC8A 1Q1KA 1FTJA 2XX8A 4ZZEA 3K00A 4PETA 3C31A 3PUWE 4LZ5A 1QKAA 3QYTA 1II5A 2I3WA 3GLBA 5ELVA 5H8NB 5I2NB 1N04A 1M5EA 4I62A 4XKNA 3E13X 3THIA 4DXCA 2F7CA 3C33A 4R74A 4BDMA 3MP8A 3C32A 3KN3A 1Z7NE 4WEDA 3IB1A 1B58A 1MQHA 1FTLA 1OVBA 3KBRA 4H1XA 3TCGA 1O64A 4LONB 1B3HA 2X7PA 2RCAA 4PP0A 4MLVA 2H4IA 3K6XA 3QIMA 1B51A 5EYFA 5HBCA 3TTRA 1MDQA 1MXZA 4K3FA 4Q30B 4DIGA 4X1BA 1GGGA 2HCAA 3K6UA 5AA2B 1BP5A 1Y3QA 2DE4A 3EN3A 4KR5A 1DPPA 3TCFA 4OYVA 3TFLA 4F2OA 4LA9A 4LZ7A 4ZZAA 5ITOA 2BJJX 1QUIA 1LAGE 1FQAA 1YTVA 2AL4A 1MM7A 3B6QA 3RUMA 2ZYOA 4Z7EA 1USYE 4PFYA 3TUSA 4BDRA 4R2BA 2OZZA 4GF8A 4RXLA 2REJA 4QFKA 3MWBA 3KZGA 4HS7A 1H3DA 1JEVA 1XC1A 2I48A 3G7WA 3V5AA 3FIRA 4NF4A 5L9MA 5ITPA 2RKMA 1Y1MA 2Y7KA 3IOUA 2OJTA 1Z7ME 4KD5A 1LBBA 1IIWA 1B7HA 1YAEA 1LLSA 4XKPA 3CVGA 5DEXB 4ZEFA 1B5IA 1B3EA 3MC2A 3PD9A 5ISUA 2QRYA 3FJMA 2Y7PA 5KCJA 4FATA 3PU5A 1AH5A 1Y20A 4H0WA 3CI8A 5I84A 3N26A 2GH9A 4E0XA 5CBRA 2DWJA 2FA7A 4OERA 5DVJA 4IY6A 3OELA 2NOOA 5JTYA 1A40A 5CBSA 1LB8A 2XD3A 4NTLA 1UTHB 1B6HA 2F5XA 4KHZE 3W9VA 4F1UA 1VR5A 3G3IA 2W7YA 4AQ4A 5F7VA 4R72A 3VVEA 2O7IA 5DEXA 2QMWA 3T96B 1OQGA 2ONKE 3PMWA 2FNCA 3G3HA 1JVXA 2I58A 2PVUA 2UYEA 2XXQA 4LQ5A 4O3AA 2Z22A 1DOTA 1N7WA 3K1NA 4LQ2A 1LGBC 4XTCQ 3SKPA 1Y9UA 3K0VA 1ZBMA 3CFLA 3SEWA 2ONRA 4IGRA 1P1NA 3MPKA 3IAZA 1B52A 1B32A 5DVIA 2Q8JA 1B4ZA 3Q27A 1NFTA 2XHDA 5KDTB 5H8HB 1AOVA 4ELOA 5H8FA 2F6GA 1I69A 1WVJA 2DSFA 4F1VA 3R7XA 4QF9A 2E0SA 2B3FA 1MRPA 2G93A 2YPNA 1ZTYA 3CR9A 1B7ZA 3FD3A 3MPLA 1JEUA 3R6UA 3QSLA 3RT8A 3LUYA 1MM6A 1P1UA 3UP9A 1POY1 2Z23A 5AA4A 3KJTA 4C1UA 4ISUA 2H99A 4POXA 3PUVE 5I58B 1PEBA 1LCTA 5DYHA 3MP6A 1B46A 3V83A 4ESXA 2OWTA 2DVCA 2DYXA 1URDA 1MXUA 1PB8A 4P0IA 5TPAA 3EHSA 1JVYA 4GLIA 3HSTA 2GRVA 4LUBA 2ZNSA 3H6VA 4UACA 4H67A 4KFQA 3T93B 2HAUA 2B3BA 3MUQA 4IO6A 4OEUA 1MY1A 4WEPA 1B5JA 4NF5A 3T9UA 1LFHA 4O3BA 3IOTA 1PB9A 4RJZA 3CIJA 3I5OA 3VV5A 3BKIB 3ZS6A 3MVXA 3IO6A 3LBSA 2Y7WA 4L17A 4MFIA 3O9PA 1QUJA 4BLAA 1IXIA 4C0RA 1NMUA 2HZKA 2Y7IA 3UORA 5CC2A 1FTMA 3IX1A 4GXAA 3W15C 1SYIA 2V25A 3Q26A 4GL0A 1S9TA 3H6UA 5CMKA 3ZSFA 4DXBA 1UTBB 2Q2AA 2DP8A 3ECRA 1Y1ZA 4IB2A 1H76A 1LAFE 3N6TA 2QSXA 3PPOA 1FQBA 3G3KA 3PUYE 4DLDA 4GL8A 4G4PA 4GFRA 2ESNA 2HZLA 2O69A 2DOJA 3SEVA 1MS7A 1MPBA 1MY4A 4QHQA 5CMMA 1TFDA 3U72A 4IO7A 5AA2D 1A8FA 4FAJA 2H9BA 1EZOA 2LAOA 3MQ9A 3IOWA 2Q9TA 4NWDA 5I59B 4JXIA 4U1ZA 2ONSA 2XXIA 3G3JA 1FQFA 4X9TA 1TWYA 2I49A 2DE2A 1M5BA 4LVQA 2F7AA 1IZ1A 4RA1A 5TP9B 3DP4A 2V93A 2QPQA 4RYAA 5JK4A 4MLQA 1R6ZA 1ATGA 2V3UA 4H65A 5I2KB 1TT1A 4EQ9A 3FVKA 1EH3A 2RF1A 2YLNA 1HSEA 1MQDA 4YU0A 2PX1A 3S2VA 3VLUA 4EDPA 3D4CA 3RT6B 5TP9A 2AL5A 1CE2A 1N0TA 1RYOA 1ZLQA 3EQ1A 4OQOA 3RGYA 4OXVA 4YKJA 2D3IA 4G8HA 4THIA 4GOTA 1T0KA 1XHYA 2DXYA 2VHAA 4ND9A 5CMCA 3PMXA 1HSLA 1MH3A 3TTNA 5I57B 3O2AA 3I6VA 2OBGA 2RINA 3OO8A 4KI0E 2GFEA 4R9GA 4YICA 4XKRA 2XXVA 1A54A 1AL3A 2F35A 4GD5A 1IITA 3FV2A 3UIFA 2DWIA 3FXRA 2ZNTA 1JQFA 3HPIA 4PE5B 3OOAA 1J1NA 4RNSA 1LB9A 4OEVA 1URGA 1B3FA 5A5XB 5FHOA 3TTLA 3OD7A 1B40A 3SEXA 3DP8A 2VGQA 2OCUA 3FJGA 3PUXE 3MBPA 4OVJA 4F1YA 2XXPA 1PBPA 4I9DA 1VFDA 1I6BA 3RTFB 4KYEA 1PC3A 3TODA 3K4UA 3O97A 4NMYA 3IORA 3M3KA 4ELRA 1VSOA 2ZNUA 3WAFA 3KGCA 1B5HA 2Z8EA 3H03A 3D4GA 5H8QB 1UIUA 4YB6A 4NWCA 4XKQA 4ZDMA 3TDJA 5I59A 4TLLB 3FGSA 4FE8A 3VDFA 3PGFA 3ILTB 5TPAB 4ZE9A 2QMXA 3ZKKA 1MQJA 3MAMA 3L6GA 1ZIUA 1RYXA 3PD8A 4JSDA 3PMVA 4OESA 3T66A 2PYYA 2P1SA 2CZLA 4QRZA 1Y3PA 1MXYA 1H43A 1UTBA 3TEPA 4TLMB 4N6PA 3SERA 4XIGQ 3TELA 1B9JA 2G29A 5H8SA 5HPQA 1XS5A 1Y4CA 4PFTA 1Y4TA 1NNPA 4YKPA 4OFLA 2THIA 4ONYA 2NVUB 1TXFA 4YAHX 3SEUA 3H06B 3HCQA 1BKAA 1JW4A 3BFUA 3JYRA 3O6IA 1B3GA 3SESA 3TAJA 4G8MA 4YMBA 2I4BA 4NF5B 1ANFA 2XX7A 3H3GA 3H4ZA 1OIBA 3K6WA 4ZEBA 4QFNA 3ZKLA 2HAVA 4IO3A 3LSWA 4P11A 3EF7A 5L8DA 5I56A 2H5YA 2YJPA 4QSDA 3GBAA 1FTOA 4I1DA 2HQ0A 3QUFA 2PT2A 2ZYKA 2Q2CA 3U93A 4G68C 4N13A 1P1QA 1LBCA 1N76A 3LSLA 3OEKA 4POWA 4F3PA 1MG1A 1TFAA 2O1MA 4M1VA 1GVCA 5AA3A 2UVJA 3HO7A 1RKMA 5DTBA 4U21A 1LFGA 3VFJA 4ELQA 3UN6A 2XXTA 1IXCA 2RC9A 3OEMA 4ECFA 3FASA 1ZU0A 3L6HA 2CMOA 3O28A 2DQVA 3AXFA 4EF1A 1AMFA 1VE4A 2XXWA 3F11A 1S7YA 1SW2A 1P1OA 1QW0A 4OMBA 4I8CA 4JWYA 1R9QA 3O6GA 2O1LA 4IGTA 3OXNA 3CRBA 4Q5TA 3VVFA 2DS9A 1IXHA 2V84A 3UA8A 4QFLA 3S9EA 4U1OA 2NUVA 4KPTA 3UGWA 2F34A 3MVYA 3O66A 3KOTA 4EQ7A 1MY0A 4FORA 4M4GA 4NF4B 4GIZA 1N84A 1FCKA 3ONMA 4HTGA 4U23A 4RPOA 3DELB 2DVZA 2PBWA 2P0SA 1N7XA 3KEIA 2M8CA 3OENA 1JETA 3USDA 2UYFA 5CRYA 3TMGA 4YMAA 3IOVA 1FTKA 1POTA 2QS3A 5AE4A 3H7MA 2KLFA 4OTEA 1B1HA 5I2KA 3TKDA 3H6TA 3CFXA 3IB2A 3S4UA 2O51A 3A09A 1A55A 1SDXA 2ANJA 4JB7A 1YCJA 4H8IA 5CI5A 5L9SA 4G68A 2R9JA 3E9XA 1GR2A 1UQWA 2QS4A 2RC8A 5KCJB 3RPWA 1OLCA 3HN0A 3IO4A 1US5A 4RK9A 1M5FA 3C4MA 1JW5A 5F1QA 3RNNA 4FECA 3OO9A 4GVOA 4OWDA 1SBPA 2E1SA 5I2NA 3E4RA 5H8NA 4DXUA 3K1MA 3IL1B 2I0BA 3W9WA 2VD2A 1IUDA 1A8EA 2V3QA 1N3XA 2OK2A 3EHUA 5CM6A 1D3KA 1D9VA 1MQGA 2B65A 2H25A 3TCHA 3MP1A 4R9FA 5EHMA 3T9HB 3VLWA 1KWHA 4FEDA 4YKKA 2NWJA 3Q28A 2QS2A 3RLFE 1MXXA 3FXQA 3T22A 2VP1A 2WKYA 4HW8A 5KZTA 3FVOA 1B7UA 3FATA 4F39A 4F18A 5DT6A 1SW1A 3ILUB 2I3VA 3FVNA 1O7TA 4IO4A 4NE4A 4GXSB 3DLNA 1PDAA 3S9NC 2D21A 5ICTA 1SI0A 2PT1A 2UXAA 4MF3A 2X26A 3IR1A 4H6DA 5K2YA 3TZAA 1JNFA 2XD2A 1SW4A 4IY5A 3A3UA 4MBPA 2F36A 3CFZA 3TQLA 1NNKA 4PQJA 4ELPA 3K02A 4TOZA 2QL3A 4F2QA 5BWJA 4H5FA 4Q8RA 1Y3NA 4ZEKA 2I4CA 3K1PA 4G68B 4JBZA 2XXHA 3RQTA 3MW0A 2Q89A 4R2FA 2GHBA 4U22A 3RN8A 2QJEA 2Z8FA 3MJNA 3OO6A 3C35A 1WDNA 1OVTA 4H5GA 4DCXA 3MVWA 3S9LC 5AA1A 3C9HA 3FJ7A 4GQOA 4UA8A 4RY1A 1QUKA 2I0CA 1NH7A 5B70A 5ICQA 1UIVA 5IAIA 4U4SA 3RTWB 2UVGA 4YB7A 3VLVA 3K2DA 1EZ9A 1ZMGA 2UVHA 1LAHE 3A3CA 3K6VA 2A5TA 1S50A 4NF8A 1QULA 2HFBA 1P99A 1QKBA 3G3GA 3OO7A 1B0HA 1BLFA 4U4XA 5M2VA 3CSGA 3SEYA 4P0GA 4LP2B 3CG3A 1MH4A 1QJMA 2X7QA 3C34A 4QSEA 3KG2A 2RC7A 4FIMA 3SDFA 1XVXA 3IB0A 1DSNA 4EF2A 4ZEDA 1A7LA 4F3BA 2XXXA 5HM4B 4ZS9A 3FXUA 4KYDA 3VXCA 4WKMA 1B05A 1D9YA 2HXWA 4N07A 3SETA 5I57A 2Y7RA 3V89B 4OETA 1M5DA 1OQHA 2ZYMA 3JZJA 4Q0CA 4QSCA 4NF6A 3M3LA 2REGA
chains in the Genus database with same CATH superfamily
2O7UA 4YKIA 3MYUA 2CEYA 2F78A 1P1WA 1LBXA 2IEEA 1XI6A 4ZE8A 3GXAA 1FW0A 3FZVA 4G61A 3TYHA 4EXKA 4IO2A 2Y84A 4X8RA 4AB6A 4F3SA 2XXUA 1GTKA 4PFWA 1ELJA 1NKXA 3LR1A 1NH8A 3RY3A 3Q29A 3TPAA 5EHSA 1NUYA 1ZKBA 1IQ7A 4FEBA 1SW5A 4G77A 2Q74A 1MY3A 1MPCA 1FQDA 5CMBA 1XOCA 1QGXA 2P2AA 4F3GA 2HEUA 4N15A 4MX6A 2XX9A 2KQZA 4OHNA 4F31B 4AB5A 3FBPA 5H8HA 1MXVA 5FHMA 1M5CA 1FBCA 3ODBA 2NXOA 4HE0A 3HHGA 4LATA 3PUZE 1OMPA 5K2XA 1FQEA 2O84X 3LUZA 2DWHA 4PAKA 4DDDA 4X1DA 3SZPA 5JTYB 3MZBA 3NOHA 4O3CA 1G0HA 4F19A 2Y5KA 1YZ0A 4F29A 1FPFA 1B4HA 3IK6B 3OMBA 1WODA 2A5TB 2Q88A 4GWOA 4XEQA 1SYHA 2FBPA 4FJPA 1B0LA 5ET7A 1L5TA 3LC8A 1Q1KA 1FTJA 3K00A 4LZ5A 3QYTA 3GLBA 4P1EA 1FBFA 1M5EA 2B4LA 4R74A 3C32A 1O64A 4MLVA 3K6XA 5HBCA 3TTRA 1Y3QA 3TCFA 4F2OA 4LA9A 1YTVA 3MWBA 3KZGA 3V5AA 3FIRA 4PTKA 2OJTA 4P56A 1B7HA 1YAEA 4XKPA 1IMBA 3CVGA 5DEXB 1B5IA 3MC2A 3PD9A 2QRYA 4IR8A 3FJMA 2Y7PA 4FATA 1FPEA 4N81A 4OERA 5JTYA 1A40A 2XD3A 4KHZE 4AQ4A 3VVEA 1NV7A 5DEXA 4JVDA 2ONKE 3PMWA 2FNCA 2I58A 2UYEA 3K0VA 3SEWA 1B52A 5ET8A 1B4ZA 1NFTA 2XHDA 2DSFA 3R7XA 4QF9A 4X04A 2YPNA 1JEUA 4DI3D 4OVQA 3QSLA 1MM6A 5I58B 3KC1A 1FJ6A 1LCTA 1B46A 2OWTA 2DVCA 1URDA 1JVYA 4GLIA 4PAIA 4MNIA 5I3SA 4UACA 1LFHA 2VPOA 3ZS6A 3IO6A 3LBSA 4PGPA 1IXIA 2Y7IA 3UORA 1LBWA 3IX1A 4GL0A 2Q2AA 3T1BA 4IB2A 4N6KA 3N6TA 4DLDA 4G4PA 3SEVA 4O8MA 1FPLA 1MS7A 1MPBA 4QHQA 4QBAA 1FQFA 1M5BA 1DK4A 1IZ1A 1NV0A 3DP4A 1R6ZA 1MQDA 1NUZA 4THIA 1T0KA 1XHYA 2DXYA 4I3EA 3TTNA 5I57B 4KI0E 3FV2A 2ZNTA 3TTLA 1LBYA 3SEXA 3DP8A 3FJGA 3RTFB 4KYEA 5H8QB 1B5HA 3H03A 4XKQA 4ZDMA 4NQ8A 4MNPA 1MQJA 2MKZA 3L6GA 1RYXA 2VPNA 5EYHA 2CZLA 1Y3PA 1MXYA 1DCUA 4H45A 3TEPA 1B9JA 1XS5A 4PFTA 4OFLA 3SEUA 1BKAA 1FPBA 3T0JA 2I4BA 3H4ZA 3K6WA 2XWIA 4QFNA 3ZKLA 4P11A 4IO3A 4QSDA 1IMFA 2PT2A 2ZYKA 1P1QA 1LBCA 4F3PA 1GVCA 2UVJA 1RKMA 4PBQA 4ECFA 3OEMA 2RC9A 4GWWA 5IGAA 2CMOA 4EF1A 1S7YA 2FVZA 4JWYA 1R9QA 3VVFA 3OXNA 3CRBA 4KPTA 2F34A 2CZHA 4FORA 4M4GA 4GIZA 3ONMA 4U23A 3DELB 4YMAA 1FTKA 3H7MA 2KLFA 4OTEA 3CFXA 2O51A 1YCJA 5CI5A 2WEFA 2RC8A 3IO4A 5LDZA 4GX6A 4FECA 4OWDA 3W9WA 3TCHA 2B65A 2H25A 2R8TA 3MP1A 2HHMA 3T9HB 3VLWA 4PBHA 4NHBA 1MXXA 4XF5A 2WKYA 3FVOA 3LV0A 4MF3A 1JP4A 4ZECA 4GX4A 5KDTB 3CFZA 2I4CA 4JBZA 2XXHA 3RN8A 2XWVA 3CHGA 1OVTA 5AA1A 4GQOA 5ICQA 5B70A 2PFZA 5IAIA 3RTWB 1ZMGA 2A5TA 1P99A 1QKBA 3OO7A 4U4XA 1B0HA 3SEYA 3CG3A 3C34A 4FIMA 1XVXA 1A7LA 5HM4B 3FXUA 4KYDA 3VXCA 1B05A 1D9YA 2HXWA 4N07A 4OETA 3TODA 1MQIA 4HCYA 4NEDA 4WXJA 4XXUA 4F22A 2F7BA 4PE3A 2VD3A 2ABHA 1I6AA 3I3VA 2Q8MA 2GHAA 1O63A 3LSXA 4JDFA 1DTZA 4NG7A 2OLBA 2UVIA 1RDXA 2L5VA 5FTIA 1NL5A 4R6HA 4KYSA 5BUUA 5AA4B 2XWOA 4GBWA 4ZEIA 4YZZA 3T9XB 3RPLA 1JW1A 2V3TA 3KC0A 5A5XA 4YB5A 1PBQA 5JEIA 3KN7A 5AA2A 4MJOA 2QVVA 4P9KA 4EXLA 5J1DA 2O68A 3N94A 4G8NA 2AYSA 4OFOA 2XXRA 2F8DA 3JV9A 4JSOA 4X48A 2RCBA 4EUOA 4GRKA 4R73A 4ZZAA 5I2KA 3H6WA 3IJOB 3FVGA 3LSFB 4OFJA 1DPEA 4NN3A 1UTHA 2QS1A 4PDDA 2WYPA 4H8JA 1BTJA 1PB7A 2DWAA 3U94A 4E0WA 4R75A 1N3WA 2HPGA 4BDQA 1NNFA 3CSBA 3PPRA 1LFIA 4G2ZA 3C36A 4DCYA 1MY2A 1SD3A 4PC9A 3B6TA 3R26A 4N8YA 2ZMBA 5ET6A 3PUWE 1QKAA 3THIA 4WEDA 3IB1A 1OVBA 3KBRA 4P1LA 4LONB 4PDHA 5EYFA 4Q30B 4DIGA 1EYKA 1DPPA 3TFLA 5LTCA 4LZ7A 5ITOA 2BJJX 1MM7A 5F24A 3TUSA 2ZYOA 1USYE 1Q9DA 2FIEA 4O7IA 1JEVA 4PFIA 3G7WA 2Y7KA 3IOUA 5DW8A 1LLSA 4ZEFA 1B3EA 5ISUA 1FBPA 2QVUA 2PFYA 3PU5A 5KCJA 3CI8A 4E0XA 2DWJA 2XWKA 4IY6A 3OELA 2NOOA 1UTHB 1B6HA 2F5XA 2QMWA 2PVUA 2XXQA 3PTYA 2Z22A 4LQ2A 1ZBMA 2ONRA 4IGRA 4OVPA 1B32A 5DVIA 2F3BA 2F6GA 1I69A 2E0SA 1MRPA 4GWXA 1B7ZA 3RT8A 3UP9A 2Z23A 2GQ1A 3FXBA 4N6DA 4ESXA 1MXUA 1PB8A 3EHSA 3HSTA 2GRVA 4LUBA 1NV3A 1MY1A 1B5JA 1PB9A 4RJZA 3CIJA 3I5OA 3VV5A 3MVXA 4MFIA 3O9PA 4BLAA 2HZKA 1FTMA 4GXAA 3W15C 2V25A 2V4CA 2ZZVA 4HE1A 1Y1ZA 1LAFE 3PPOA 2ESNA 1IMEA 5AA2D 4GWSA 1TFDA 2H9BA 2LAOA 5EQ8A 3IOWA 4NWDA 4JXIA 4U1ZA 2ONSA 2XXIA 3KBZA 4MMPA 4OVTA 2DE2A 4RYAA 5I2KB 1HSEA 4YU0A 3S2VA 3VLUA 3RT6B 2FIXA 1RYOA 4OQOA 4OXVA 4GOTA 4ND9A 3PMXA 3I6VA 4R9GA 3OO8A 4YICA 2GFEA 4O94A 4XKRA 3UIFA 4MEVA 5T3JA 4PE5B 1K9ZA 5A5XB 4N4UA 1B40A 3MBPA 4F1YA 1PBPA 4I9DA 1I6BA 1VSOA 3D4GA 4NWCA 3VDFA 3PGFA 4ZE9A 2CZKA 3PD8A 4OESA 3T66A 1UTBA 3TELA 5HPQA 5H8SA 1SPIA 1Y4CA 2XXKA 2THIA 3HCQA 3SESA 1B3GA 4NF5B 1ANFA 3LSWA 2H5YA 3GBAA 1FBDA 2HQ0A 3QUFA 2Q2CA 3U93A 4G68C 5IZZA 3LSLA 4POWA 1MG1A 3HFUA 1LFGA 2XXTA 1IXCA 1ZU0A 3AXFA 4OMBA 1VE4A 3F11A 4I8CA 5EQAA 3S9EA 3UA8A 2NUVA 3O66A 3KOTA 4NF4B 4HTGA 4RPOA 3KEIA 3OENA 2M8CA 2UYFA 5CRYA 2QS3A 3TKDA 3IB2A 4JB7A 2ANJA 2WYKA 4H8IA 2CZIA 1GR2A 5KCJB 3RPWA 4RK9A 1M5FA 1JW5A 4DI4B 4GVOA 5H8NA 2Y5LA 1NV4A 4DXUA 3IL1B 2OK2A 5CM6A 1MQGA 4P8BA 2NWJA 3FXQA 3FATA 5DT6A 3ILUB 3S9NC 1O7TA 1FSAA 2X26A 4H6DA 4PFRA 2XD2A 4OA4A 3TQLA 2F36A 4PQJA 4TOZA 3RQTA 2GHBA 2Z8FA 3MJNA 3MVWA 3S9LC 3C9HA 3FJ7A 1QUKA 2UVGA 3BIHA 2UVHA 3A3CA 4HE2A 3G3GA 5M2VA 1BLFA 3CSGA 4LP2B 1MH4A 1NV1A 3SDFA 3E78A 4EF2A 4F3BA 1EYJA 3SETA 4QSCA 4Q0CA 2ZYMA 3JZJA 1IMAA 2REGA 5FTHA 1LAXA 3QAXA 3WAEA 1HSJA 1IMDA 1LSTA 4TQUQ 5I56B 2ZZXA 5IZ3A 3IFCA 3N5LA 1B2HA 1IEJA 5TU0A 3VE1B 4DZ1A 3TTMA 3PPNA 1XVYA 3V8XB 2IA4A 1LBZA 4IO5A 1VFEA 3N6UA 4NAPA 1IXGA 4Z0IA 2AIXA 1NUXA 2Z8DA 4NGUA 1YYZA 3TTKA 2XXYA 3RYDA 2R6GE 5H8QA 4EQBA 5L9OA 1DTGA 3MVZA 1URSA 5EQ9A 1MPDA 3G3FA 3TQWA 5LOMA 2A5SA 4ESWA 4R6KA 1A99A 2OWSA 3B6WA 2XA5A 3T9VA 1B1XA 4MH5A 1BIYA 5I58A 3CG1A 1B3LA 4OZ9A 5FHNA 4NF6B 1I6QA 4BDNA 3QXMA 4HCWA 3K01A 3HHFA 2I6EA 4LZ8A 3S9MC 1MXWA 3MZ9A 3OSRA 1H45A 1D4NA 2VOZA 5IKBA 3GZGA 5DVFA 1R1NA 1FTAA 4QFOA 2DXRA 3PV0E 2DDKA 2F6PA 3OSQA 1FQCA 3EHTA 1EZPA 1AIVA 3KSXA 3M3FA 1BK4A 1FBGA 1R9LA 3EPEA 3E3KA 5I5PA 2ALUA 2JJKA 2XX8A 5H8NB 1II5A 4I62A 4DXCA 3E13X 3MP8A 1B58A 1MQHA 1FTLA 4H1XA 4PCDA 2CEXA 1B51A 1MDQA 4K3FA 4X1BA 1GGGA 3K6UA 4P3LA 1BP5A 2DE4A 3EN3A 4OYVA 1G0IA 1QUIA 3B6QA 1FQAA 3RUMA 4Z7EA 4R2BA 2OZZA 4GF8A 4RXLA 1H3DA 1XC1A 4NF4A 5L9MA 2RKMA 1Y1MA 4KD5A 1AH5A 1Y20A 4H0WA 2GH9A 2FA7A 5EQ7A 5IM2A 1LB8A 4NTLA 3W9VA 4F1UA 3G3IA 2W7YA 4R72A 3T96B 1OQGA 3G3HA 4AS5A 1DBZA 2BJIA 4O3AA 1DOTA 3K1NA 4XTCQ 3SKPA 3CFLA 3MPKA 4GX3A 3B50A 2Q8JA 3ISPA 4FBPA 1NI9A 5H8HB 4ELOA 1WVJA 4F1VA 2G93A 3FD3A 1ZTYA 3CR9A 3MPLA 3LUYA 1P1UA 1POY1 4POXA 3PUVE 2DYXA 5TPAA 2ZNSA 3H6VA 4H67A 2HAUA 3MUQA 4IO6A 4WEPA 4O3BA 3IOTA 2Y7WA 1FBEA 1NMUA 1K9YA 1S9TA 5CMKA 4DXBA 3ECRA 1FQBA 4GL8A 2HZLA 2DOJA 5CMMA 3U72A 1EZOA 1A8FA 3MQ9A 2Q9TA 5ESYA 5I59B 1TWYA 4LVQA 5TP9B 2V93A 2QPQA 1ATGA 2V3UA 2OWZA 4H65A 1TT1A 2RF1A 2PX1A 4HXVA 3D4CA 2AL5A 1CE2A 1ZLQA 4YKJA 2D3IA 1LBVA 2VHAA 4XFEA 3O2AA 2OBGA 2RINA 2XXVA 1A54A 1AL3A 4GD5A 1IITA 2WBBA 3FXRA 1JQFA 3HPIA 3OOAA 1J1NA 4RNSA 1LB9A 4OEVA 1URGA 2OCUA 4OVJA 3IORA 3M3KA 4ELRA 3WAFA 2Z8EA 1EYIA 5I59A 3TDJA 4TLLB 3FGSA 3MSTA 1ZIUA 4JSDA 3PMVA 2PYYA 2P1SA 5ET5A 4TLMB 3SERA 1Y4TA 1NNPA 3H06B 1JW4A 3O6IA 4G8MA 3H3GA 2XX7A 1OIBA 3D1RA 5IZ3B 2HAVA 4MAGA 5I56A 2YJPA 4N17A 3ROJA 1N76A 1TFAA 2O1MA 4M1VA 5AA3A 5DTBA 3HO7A 4U21A 3VFJA 4ELQA 3UN6A 3FASA 3O28A 2DQVA 1AMFA 1SW2A 3O6GA 4Q5TA 2DS9A 1IXHA 4QFLA 4U1OA 3UGWA 4EQ7A 1MY0A 1N84A 2DVZA 1N7XA 3GYYA 3TMGA 3IOVA 1POTA 1B1HA 3S4UA 3A09A 1A55A 5L9SA 4G68A 1OLCA 1FPGA 1US5A 5F1QA 3RNNA 3E79A 4O7MA 1KA0A 1SBPA 2E1SA 5I2NA 2FHYA 1D9VA 5EHMA 1KWHA 4YKKA 3Q28A 3RLFE 5KZTA 2VP1A 4F18A 1B7UA 4NE4A 1SW1A 2I3VA 3FVNA 5J16A 4GXSB 3DLNA 2VT5A 5ICTA 1SI0A 3IR1A 4MBPA 1NNKA 5BWJA 3K02A 4F2QA 2QL3A 1CNQA 4H5FA 4ZEKA 3A29A 4R2FA 1NV6A 3OO6A 4H5GA 4DCXA 4NX1A 4UA8A 2I0CA 1NV5A 1UIVA 3VLVA 3K2DA 5CMCA 1LAHE 3K6VA 1S50A 1QULA 2HFBA 2X7QA 4QSEA 3KG2A 2RC7A 4JVCA 3IB0A 4WKMA 1FPDA 2Y7RA 1RDZA 5AA2B 1M5DA 1OQHA 4GBVA 4YAHX 3M3LA 5B7DA 3P7IA 4JWOA 3O6HA 4UABA 4RPNA 1IMCA 1CB6A 1USYH 4QFPA 2ZXTA 3DP6A 2ZZWA 3PPQA 3VXBA 3UK4A 1F9BA 5AA4A 3BFTA 3U92A 2P3VA 1SI1A 5EYGA 2WX9A 3KJ7A 2FYIA 1H44A 1Q35A 3GBBA 3KN8A 3FUZA 3KOSA 4JVIA 4KCCA 4PF6A 1US4A 2O6AA 1FJ9A 4I3YA 4BDOA 2PMSA 1GV8A 2R71A 3MZ1A 3QUJA 3Q25A 1NNTA 3U1OA 3QK6A 3KFMA 4PFUA 2ZYNA 1AWBA 4QXDA 4U2RA 2DE3A 2H98A 1SVXB 3B7DA 4OENA 1EU8A 5H8FB 4BDLA 4JWXA 2WBDA 1NV2A 1LCFA 2D5WA 3FV1A 4OVSA 4RK2A 3DM0A 3O29A 3IJXB 3BBRA 1KZ8A 1DMBA 3M8UA 4I40A 3HV1A 1ZJLA 1SQYA 5KDTA 4C1TA 1QVSA 4OVRA 3B8BA 1OLAA 4KQPA 3U8QA 1YPNA 3U65A 4NF8B 2F97A 4KCDA 3KSJA 1XT8A 4R6YA 3PPPA 4P47A 1MDP1 3VVDA 4ZZEA 4PETA 3C31A 5ELVA 5I2NB 2I3WA 1N04A 4XKNA 2F7CA 3C33A 4BDMA 3KN3A 1Z7NE 3TCGA 1B3HA 2X7PA 2RCAA 4PP0A 2H4IA 3QIMA 1MXZA 1KA1A 2HCAA 4KR5A 1FRPA 1LAGE 2AL4A 4PFYA 4BDRA 2REJA 4QFKA 4HS7A 2I48A 5ITPA 1Z7ME 1LBBA 1IIWA 5I84A 3N26A 5CBRA 5DVJA 5CBSA 1VR5A 5F7VA 2O7IA 1JVXA 4LQ5A 1N7WA 1LGBC 1Y9UA 1P1NA 3IAZA 4KXPA 3Q27A 4AS4A 4GWZA 1AOVA 5H8FA 1D9QA 2B3FA 3BIGA 3R6UA 2B4MA 4NF0A 3KJTA 4C1UA 4ISUA 2H99A 1PEBA 5DYHA 5I7IA 3MP6A 3V83A 4P0IA 3T93B 4KFQA 2B3BA 4OEUA 4NF5A 3T9UA 3BKIB 3RPLB 4L17A 1QUJA 4C0RA 5CC2A 1SYIA 3Q26A 3H6UA 3ZSFA 1UTBB 2DP8A 1H76A 1FPJA 2QSXA 3G3KA 3PUYE 4GFRA 2O69A 1MY4A 4IO7A 4FAJA 3G3JA 4X9TA 2I49A 4LN5A 2F7AA 4RA1A 5JK4A 4MLQA 4EQ9A 3FVKA 1EH3A 4EDPA 2YLNA 5TP9A 1N0TA 3EQ1A 1RDYA 3RGYA 1FBHA 4G8HA 4PFBA 1HSLA 1MH3A 2F35A 2DWIA 3QMFA 1B3FA 5FHOA 3OD7A 2VGQA 3PUXE 2XXPA 1VFDA 1PC3A 3K4UA 3O97A 4NMYA 2ZNUA 3KGCA 1UIUA 4YB6A 4MIJA 4FE8A 3ILTB 5TPAB 2QMXA 3ZKKA 3MAMA 4QRZA 1LEVA 4MNCA 1H43A 4N6PA 4XIGQ 2G29A 2NVUB 4YKPA 4ONYA 1TXFA 4GWYA 3BFUA 3JYRA 3TAJA 2OX3A 4YMBA 4ZEBA 5L8DA 3EF7A 4OANA 1FTOA 2P3NA 4I1DA 4N13A 3OEKA 4PF8A 3L6HA 5A5LA 2XXWA 3IFAA 4DE8A 1P1OA 1QW0A 2HXRA 2O1LA 4IGTA 2V84A 3MVYA 1YXIA 5FBPA 1FCKA 2KR0A 2PBWA 2P0SA 3USDA 1JETA 4MCOA 5AE4A 3H6TA 1SDXA 2R9JA 5IZ1A 3E9XA 1UQWA 2QS4A 3HN0A 3C4MA 3OO9A 3E4RA 3K1MA 2I0BA 2VD2A 1IUDA 1A8EA 2V3QA 1N3XA 3EHUA 4PGNA 4H46A 1D3KA 4R9FA 4FEDA 1INPA 4HW8A 2QS2A 3T22A 4F39A 1VDWA 4IO4A 1PDAA 2D21A 2PT1A 2UXAA 5K2YA 3TZAA 1JNFA 4IY5A 1SW4A 3A3UA 4ELPA 4Q8RA 1Y3NA 1FPIA 3K1PA 4G68B 3EKIA 3MW0A 2QFLA 2Q89A 4U22A 2QJEA 3C35A 1WDNA 2F3DA 2PCRA 4RY1A 1NH7A 1NUWA 4U4SA 4YB7A 2QVRA 4GWUA 1FPKA 1EZ9A 4NF8A 4P0GA 1QJMA 1DSNA 4ZEDA 2XXXA 4ZS9A 4N91A 5I57A 4N8GA 4PAFA 4MHFA 3V89B 4NF6A
chains in the Genus database with same CATH topology
2O7UA 5FTHA 5B7DA 3P7IA 1LAXA 4YKIA 1MQIA 4HCYA 3QAXA 3WAEA 4NEDA 4WXJA 2F78A 1HSJA 4XXUA 4JWOA 4F22A 1P1WA 2F7BA 3O6HA 2IEEA 4RPNA 1LSTA 2VD3A 1CB6A 4TQUQ 5I56B 1USYH 2ABHA 1I6AA 3I3VA 4QFPA 2ZXTA 4ZE8A 3GXAA 1FW0A 3DP6A 3N5LA 1B2HA 1IEJA 3FZVA 3PPQA 5TU0A 2GHAA 3VE1B 3VXBA 3UK4A 1F9BA 3TYHA 4DZ1A 3TTMA 4EXKA 1O63A 3LSXA 3PPNA 2Y84A 3BFTA 4IO2A 4AB6A 4F3SA 4JDFA 4ZECA 2XXUA 1XVYA 3U92A 3V8XB 1GTKA 2IA4A 4IO5A 1VFEA 4PFWA 1ELJA 1NKXA 3N6UA 1SI1A 3LR1A 1DTZA 1IXGA 2OLBA 4Z0IA 1NH8A 2UVIA 4GRKA 3RY3A 3Q29A 3TPAA 2AIXA 3KJ7A 5EHSA 2FYIA 1ZKBA 5FTIA 1H44A 1IQ7A 4FEBA 2Z8DA 1NL5A 4R6HA 1SW5A 4KYSA 5BUUA 1Q35A 2XXYA 3GBBA 4G77A 3TTKA 5AA4B 3KN8A 1MY3A 3FUZA 4ZEIA 2R6GE 3KOSA 4YZZA 5H8QA 3T9XB 1MPCA 1FQDA 5CMBA 4KCCA 4EQBA 1DTGA 5L9OA 3MVZA 1URSA 1JW1A 1US4A 1MPDA 1XOCA 2V3TA 3G3FA 2O6AA 3TQWA 5LOMA 2A5SA 2P2AA 4F3GA 4ESWA 5A5XA 4R6KA 4BDOA 1A99A 2OWSA 3B6WA 2HEUA 2PMSA 1PBQA 4YB5A 1GV8A 1B1XA 3KN7A 3T9VA 5JEIA 2R71A 3MZ1A 4MH5A 1BIYA 3QUJA 3CG1A 3Q25A 1B3LA 1NNTA 5I58A 3U1OA 4OZ9A 5FHNA 2XX9A 3QK6A 4NF6B 3KFMA 4PFUA 2ZYNA 5AA2A 1I6QA 4BDNA 4OHNA 2DE3A 2H98A 4U2RA 1SVXB 3B7DA 4EXLA 4F31B 4OENA 3QXMA 4HCWA 1EU8A 3K01A 5H8FB 4AB5A 5J1DA 2O68A 3HHFA 2I6EA 1MXVA 3N94A 4G8NA 4LZ8A 2AYSA 5H8HA 4OFOA 2XXRA 4BDLA 5FHMA 1M5CA 2F8DA 3S9MC 4JWXA 1MXWA 3MZ9A 3ODBA 2NXOA 3JV9A 4JSOA 4X48A 3HHGA 2RCBA 3OSRA 4LATA 1LCFA 1OMPA 2D5WA 1H45A 3FV1A 1FQEA 1D4NA 2VOZA 3H6WA 3PUZE 4R73A 5K2XA 3IJOB 4EUOA 5IKBA 3GZGA 4RK2A 2O84X 5DVFA 1R1NA 3DM0A 3O29A 2DWHA 3IJXB 3FVGA 3LSFB 4OFJA 1DPEA 4DDDA 3BBRA 4X1DA 4QFOA 2DXRA 4DE8A 3PV0E 1UTHA 1DMBA 2QS1A 5JTYB 4H8JA 2F6PA 3MZBA 3OSQA 1FQCA 1BTJA 3M8UA 1PB7A 2DWAA 4O3CA 3HV1A 3U94A 3EHTA 4F19A 1ZJLA 1SQYA 5KDTA 1EZPA 4C1TA 1QVSA 4E0WA 1AIVA 4F29A 1OLAA 4KQPA 3KSXA 4R75A 3U8QA 1B4HA 1N3WA 1YPNA 3IK6B 3M3FA 3OMBA 1NNFA 4BDQA 1WODA 3CSBA 3PPRA 1LFIA 2A5TB 3C36A 1R9LA 4G2ZA 4NF8B 2F97A 2Q88A 4GWOA 1MY2A 3KSJA 1XT8A 4KCDA 4DCYA 3EPEA 4R6YA 1SYHA 3E3KA 3PPPA 1B0LA 1SD3A 4FJPA 1MDP1 3B6TA 3R26A 3VVDA 2ZMBA 1L5TA 2ALUA 3LC8A 1Q1KA 1FTJA 2XX8A 4ZZEA 3K00A 4PETA 3C31A 3PUWE 4LZ5A 1QKAA 3QYTA 1II5A 2I3WA 3GLBA 5ELVA 5H8NB 5I2NB 1N04A 1M5EA 4I62A 4XKNA 3E13X 3THIA 4DXCA 2F7CA 3C33A 4R74A 4BDMA 3MP8A 3C32A 3KN3A 1Z7NE 4WEDA 3IB1A 1B58A 1MQHA 1FTLA 1OVBA 3KBRA 4H1XA 3TCGA 1O64A 4LONB 1B3HA 2X7PA 2RCAA 4PP0A 4MLVA 2H4IA 3K6XA 3QIMA 1B51A 5EYFA 5HBCA 3TTRA 1MDQA 1MXZA 4K3FA 4Q30B 4DIGA 4X1BA 1GGGA 2HCAA 3K6UA 5AA2B 1BP5A 1Y3QA 2DE4A 3EN3A 4KR5A 1DPPA 3TCFA 4OYVA 3TFLA 4F2OA 4LA9A 4LZ7A 4ZZAA 5ITOA 2BJJX 1QUIA 1LAGE 1FQAA 1YTVA 2AL4A 1MM7A 3B6QA 3RUMA 2ZYOA 4Z7EA 1USYE 4PFYA 3TUSA 4BDRA 4R2BA 2OZZA 4GF8A 4RXLA 2REJA 4QFKA 3MWBA 3KZGA 4HS7A 1H3DA 1JEVA 1XC1A 2I48A 3G7WA 3V5AA 3FIRA 4NF4A 5L9MA 5ITPA 2RKMA 1Y1MA 2Y7KA 3IOUA 2OJTA 1Z7ME 4KD5A 1LBBA 1IIWA 1B7HA 1YAEA 1LLSA 4XKPA 3CVGA 5DEXB 4ZEFA 1B5IA 1B3EA 3MC2A 3PD9A 5ISUA 2QRYA 3FJMA 2Y7PA 5KCJA 4FATA 3PU5A 1AH5A 1Y20A 4H0WA 3CI8A 5I84A 3N26A 2GH9A 4E0XA 5CBRA 2DWJA 2FA7A 4OERA 5DVJA 4IY6A 3OELA 2NOOA 5JTYA 1A40A 5CBSA 1LB8A 2XD3A 4NTLA 1UTHB 1B6HA 2F5XA 4KHZE 3W9VA 4F1UA 1VR5A 3G3IA 2W7YA 4AQ4A 5F7VA 4R72A 3VVEA 2O7IA 5DEXA 2QMWA 3T96B 1OQGA 2ONKE 3PMWA 2FNCA 3G3HA 1JVXA 2I58A 2PVUA 2UYEA 2XXQA 4LQ5A 4O3AA 2Z22A 1DOTA 1N7WA 3K1NA 4LQ2A 1LGBC 4XTCQ 3SKPA 1Y9UA 3K0VA 1ZBMA 3CFLA 3SEWA 2ONRA 4IGRA 1P1NA 3MPKA 3IAZA 1B52A 1B32A 5DVIA 2Q8JA 1B4ZA 3Q27A 1NFTA 2XHDA 5KDTB 5H8HB 1AOVA 4ELOA 5H8FA 2F6GA 1I69A 1WVJA 2DSFA 4F1VA 3R7XA 4QF9A 2E0SA 2B3FA 1MRPA 2G93A 2YPNA 1ZTYA 3CR9A 1B7ZA 3FD3A 3MPLA 1JEUA 3R6UA 3QSLA 3RT8A 3LUYA 1MM6A 1P1UA 3UP9A 1POY1 2Z23A 5AA4A 3KJTA 4C1UA 4ISUA 2H99A 4POXA 3PUVE 5I58B 1PEBA 1LCTA 5DYHA 3MP6A 1B46A 3V83A 4ESXA 2OWTA 2DVCA 2DYXA 1URDA 1MXUA 1PB8A 4P0IA 5TPAA 3EHSA 1JVYA 4GLIA 3HSTA 2GRVA 4LUBA 2ZNSA 3H6VA 4UACA 4H67A 4KFQA 3T93B 2HAUA 2B3BA 3MUQA 4IO6A 4OEUA 1MY1A 4WEPA 1B5JA 4NF5A 3T9UA 1LFHA 4O3BA 3IOTA 1PB9A 4RJZA 3CIJA 3I5OA 3VV5A 3BKIB 3ZS6A 3MVXA 3IO6A 3LBSA 2Y7WA 4L17A 4MFIA 3O9PA 1QUJA 4BLAA 1IXIA 4C0RA 1NMUA 2HZKA 2Y7IA 3UORA 5CC2A 1FTMA 3IX1A 4GXAA 3W15C 1SYIA 2V25A 3Q26A 4GL0A 1S9TA 3H6UA 5CMKA 3ZSFA 4DXBA 1UTBB 2Q2AA 2DP8A 3ECRA 1Y1ZA 4IB2A 1H76A 1LAFE 3N6TA 2QSXA 3PPOA 1FQBA 3G3KA 3PUYE 4DLDA 4GL8A 4G4PA 4GFRA 2ESNA 2HZLA 2O69A 2DOJA 3SEVA 1MS7A 1MPBA 1MY4A 4QHQA 5CMMA 1TFDA 3U72A 4IO7A 5AA2D 1A8FA 4FAJA 2H9BA 1EZOA 2LAOA 3MQ9A 3IOWA 2Q9TA 4NWDA 5I59B 4JXIA 4U1ZA 2ONSA 2XXIA 3G3JA 1FQFA 4X9TA 1TWYA 2I49A 2DE2A 1M5BA 4LVQA 2F7AA 1IZ1A 4RA1A 5TP9B 3DP4A 2V93A 2QPQA 4RYAA 5JK4A 4MLQA 1R6ZA 1ATGA 2V3UA 4H65A 5I2KB 1TT1A 4EQ9A 3FVKA 1EH3A 2RF1A 2YLNA 1HSEA 1MQDA 4YU0A 2PX1A 3S2VA 3VLUA 4EDPA 3D4CA 3RT6B 5TP9A 2AL5A 1CE2A 1N0TA 1RYOA 1ZLQA 3EQ1A 4OQOA 3RGYA 4OXVA 4YKJA 2D3IA 4G8HA 4THIA 4GOTA 1T0KA 1XHYA 2DXYA 2VHAA 4ND9A 5CMCA 3PMXA 1HSLA 1MH3A 3TTNA 5I57B 3O2AA 3I6VA 2OBGA 2RINA 3OO8A 4KI0E 2GFEA 4R9GA 4YICA 4XKRA 2XXVA 1A54A 1AL3A 2F35A 4GD5A 1IITA 3FV2A 3UIFA 2DWIA 3FXRA 2ZNTA 1JQFA 3HPIA 4PE5B 3OOAA 1J1NA 4RNSA 1LB9A 4OEVA 1URGA 1B3FA 5A5XB 5FHOA 3TTLA 3OD7A 1B40A 3SEXA 3DP8A 2VGQA 2OCUA 3FJGA 3PUXE 3MBPA 4OVJA 4F1YA 2XXPA 1PBPA 4I9DA 1VFDA 1I6BA 3RTFB 4KYEA 1PC3A 3TODA 3K4UA 3O97A 4NMYA 3IORA 3M3KA 4ELRA 1VSOA 2ZNUA 3WAFA 3KGCA 1B5HA 2Z8EA 3H03A 3D4GA 5H8QB 1UIUA 4YB6A 4NWCA 4XKQA 4ZDMA 3TDJA 5I59A 4TLLB 3FGSA 4FE8A 3VDFA 3PGFA 3ILTB 5TPAB 4ZE9A 2QMXA 3ZKKA 1MQJA 3MAMA 3L6GA 1ZIUA 1RYXA 3PD8A 4JSDA 3PMVA 4OESA 3T66A 2PYYA 2P1SA 2CZLA 4QRZA 1Y3PA 1MXYA 1H43A 1UTBA 3TEPA 4TLMB 4N6PA 3SERA 4XIGQ 3TELA 1B9JA 2G29A 5H8SA 5HPQA 1XS5A 1Y4CA 4PFTA 1Y4TA 1NNPA 4YKPA 4OFLA 2THIA 4ONYA 2NVUB 1TXFA 4YAHX 3SEUA 3H06B 3HCQA 1BKAA 1JW4A 3BFUA 3JYRA 3O6IA 1B3GA 3SESA 3TAJA 4G8MA 4YMBA 2I4BA 4NF5B 1ANFA 2XX7A 3H3GA 3H4ZA 1OIBA 3K6WA 4ZEBA 4QFNA 3ZKLA 2HAVA 4IO3A 3LSWA 4P11A 3EF7A 5L8DA 5I56A 2H5YA 2YJPA 4QSDA 3GBAA 1FTOA 4I1DA 2HQ0A 3QUFA 2PT2A 2ZYKA 2Q2CA 3U93A 4G68C 4N13A 1P1QA 1LBCA 1N76A 3LSLA 3OEKA 4POWA 4F3PA 1MG1A 1TFAA 2O1MA 4M1VA 1GVCA 5AA3A 2UVJA 3HO7A 1RKMA 5DTBA 4U21A 1LFGA 3VFJA 4ELQA 3UN6A 2XXTA 1IXCA 2RC9A 3OEMA 4ECFA 3FASA 1ZU0A 3L6HA 2CMOA 3O28A 2DQVA 3AXFA 4EF1A 1AMFA 1VE4A 2XXWA 3F11A 1S7YA 1SW2A 1P1OA 1QW0A 4OMBA 4I8CA 4JWYA 1R9QA 3O6GA 2O1LA 4IGTA 3OXNA 3CRBA 4Q5TA 3VVFA 2DS9A 1IXHA 2V84A 3UA8A 4QFLA 3S9EA 4U1OA 2NUVA 4KPTA 3UGWA 2F34A 3MVYA 3O66A 3KOTA 4EQ7A 1MY0A 4FORA 4M4GA 4NF4B 4GIZA 1N84A 1FCKA 3ONMA 4HTGA 4U23A 4RPOA 3DELB 2DVZA 2PBWA 2P0SA 1N7XA 3KEIA 2M8CA 3OENA 1JETA 3USDA 2UYFA 5CRYA 3TMGA 4YMAA 3IOVA 1FTKA 1POTA 2QS3A 5AE4A 3H7MA 2KLFA 4OTEA 1B1HA 5I2KA 3TKDA 3H6TA 3CFXA 3IB2A 3S4UA 2O51A 3A09A 1A55A 1SDXA 2ANJA 4JB7A 1YCJA 4H8IA 5CI5A 5L9SA 4G68A 2R9JA 3E9XA 1GR2A 1UQWA 2QS4A 2RC8A 5KCJB 3RPWA 1OLCA 3HN0A 3IO4A 1US5A 4RK9A 1M5FA 3C4MA 1JW5A 5F1QA 3RNNA 4FECA 3OO9A 4GVOA 4OWDA 1SBPA 2E1SA 5I2NA 3E4RA 5H8NA 4DXUA 3K1MA 3IL1B 2I0BA 3W9WA 2VD2A 1IUDA 1A8EA 2V3QA 1N3XA 2OK2A 3EHUA 5CM6A 1D3KA 1D9VA 1MQGA 2B65A 2H25A 3TCHA 3MP1A 4R9FA 5EHMA 3T9HB 3VLWA 1KWHA 4FEDA 4YKKA 2NWJA 3Q28A 2QS2A 3RLFE 1MXXA 3FXQA 3T22A 2VP1A 2WKYA 4HW8A 5KZTA 3FVOA 1B7UA 3FATA 4F39A 4F18A 5DT6A 1SW1A 3ILUB 2I3VA 3FVNA 1O7TA 4IO4A 4NE4A 4GXSB 3DLNA 1PDAA 3S9NC 2D21A 5ICTA 1SI0A 2PT1A 2UXAA 4MF3A 2X26A 3IR1A 4H6DA 5K2YA 3TZAA 1JNFA 2XD2A 1SW4A 4IY5A 3A3UA 4MBPA 2F36A 3CFZA 3TQLA 1NNKA 4PQJA 4ELPA 3K02A 4TOZA 2QL3A 4F2QA 5BWJA 4H5FA 4Q8RA 1Y3NA 4ZEKA 2I4CA 3K1PA 4G68B 4JBZA 2XXHA 3RQTA 3MW0A 2Q89A 4R2FA 2GHBA 4U22A 3RN8A 2QJEA 2Z8FA 3MJNA 3OO6A 3C35A 1WDNA 1OVTA 4H5GA 4DCXA 3MVWA 3S9LC 5AA1A 3C9HA 3FJ7A 4GQOA 4UA8A 4RY1A 1QUKA 2I0CA 1NH7A 5B70A 5ICQA 1UIVA 5IAIA 4U4SA 3RTWB 2UVGA 4YB7A 3VLVA 3K2DA 1EZ9A 1ZMGA 2UVHA 1LAHE 3A3CA 3K6VA 2A5TA 1S50A 4NF8A 1QULA 2HFBA 1P99A 1QKBA 3G3GA 3OO7A 1B0HA 1BLFA 4U4XA 5M2VA 3CSGA 3SEYA 4P0GA 4LP2B 3CG3A 1MH4A 1QJMA 2X7QA 3C34A 4QSEA 3KG2A 2RC7A 4FIMA 3SDFA 1XVXA 3IB0A 1DSNA 4EF2A 4ZEDA 1A7LA 4F3BA 2XXXA 5HM4B 4ZS9A 3FXUA 4KYDA 3VXCA 4WKMA 1B05A 1D9YA 2HXWA 4N07A 3SETA 5I57A 2Y7RA 3V89B 4OETA 1M5DA 1OQHA 2ZYMA 3JZJA 4Q0CA 4QSCA 4NF6A 3M3LA 2REGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O7U A;  5FTH A;  5B7D A;  3P7I A;  1LAX A;  4YKI A;  1MQI A;  4HCY A;  3QAX A;  3WAE A;  4NED A;  4WXJ A;  2F78 A;  1HSJ A;  4XXU A;  4JWO A;  4F22 A;  1P1W A;  2F7B A;  3O6H A;  2IEE A;  4RPN A;  1LST A;  2VD3 A;  1CB6 A;  4TQU Q;  5I56 B;  1USY H;  2ABH A;  1I6A A;  3I3V A;  4QFP A;  2ZXT A;  4ZE8 A;  3GXA A;  1FW0 A;  3DP6 A;  3N5L A;  1B2H A;  1IEJ A;  3FZV A;  3PPQ A;  5TU0 A;  2GHA A;  3VE1 B;  3VXB A;  3UK4 A;  1F9B A;  3TYH A;  4DZ1 A;  3TTM A;  4EXK A;  1O63 A;  3LSX A;  3PPN A;  2Y84 A;  3BFT A;  4IO2 A;  4AB6 A;  4F3S A;  4JDF A;  4ZEC A;  2XXU A;  1XVY A;  3U92 A;  3V8X B;  1GTK A;  2IA4 A;  4IO5 A;  1VFE A;  4PFW A;  1ELJ A;  1NKX A;  3N6U A;  1SI1 A;  3LR1 A;  1DTZ A;  1IXG A;  2OLB A;  4Z0I A;  1NH8 A;  2UVI A;  4GRK A;  3RY3 A;  3Q29 A;  3TPA A;  2AIX A;  3KJ7 A;  5EHS A;  2FYI A;  1ZKB A;  5FTI A;  1H44 A;  1IQ7 A;  4FEB A;  2Z8D A;  1NL5 A;  4R6H A;  1SW5 A;  4KYS A;  5BUU A;  1Q35 A;  2XXY A;  3GBB A;  4G77 A;  3TTK A;  5AA4 B;  3KN8 A;  1MY3 A;  3FUZ A;  4ZEI A;  2R6G E;  3KOS A;  4YZZ A;  5H8Q A;  3T9X B;  1MPC A;  1FQD A;  5CMB A;  4KCC A;  4EQB A;  1DTG A;  5L9O A;  3MVZ A;  1URS A;  1JW1 A;  1US4 A;  1MPD A;  1XOC A;  2V3T A;  3G3F A;  2O6A A;  3TQW A;  5LOM A;  2A5S A;  2P2A A;  4F3G A;  4ESW A;  5A5X A;  4R6K A;  4BDO A;  1A99 A;  2OWS A;  3B6W A;  2HEU A;  2PMS A;  1PBQ A;  4YB5 A;  1GV8 A;  1B1X A;  3KN7 A;  3T9V A;  5JEI A;  2R71 A;  3MZ1 A;  4MH5 A;  1BIY A;  3QUJ A;  3CG1 A;  3Q25 A;  1B3L A;  1NNT A;  5I58 A;  3U1O A;  4OZ9 A;  5FHN A;  2XX9 A;  3QK6 A;  4NF6 B;  3KFM A;  4PFU A;  2ZYN A;  5AA2 A;  1I6Q A;  4BDN A;  4OHN A;  2DE3 A;  2H98 A;  4U2R A;  1SVX B;  3B7D A;  4EXL A;  4F31 B;  4OEN A;  3QXM A;  4HCW A;  1EU8 A;  3K01 A;  5H8F B;  4AB5 A;  5J1D A;  2O68 A;  3HHF A;  2I6E A;  1MXV A;  3N94 A;  4G8N A;  4LZ8 A;  2AYS A;  5H8H A;  4OFO A;  2XXR A;  4BDL A;  5FHM A;  1M5C A;  2F8D A;  3S9M C;  4JWX A;  1MXW A;  3MZ9 A;  3ODB A;  2NXO A;  3JV9 A;  4JSO A;  4X48 A;  3HHG A;  2RCB A;  3OSR A;  4LAT A;  1LCF A;  1OMP A;  2D5W A;  1H45 A;  3FV1 A;  1FQE A;  1D4N A;  2VOZ A;  3H6W A;  3PUZ E;  4R73 A;  5K2X A;  3IJO B;  4EUO A;  5IKB A;  3GZG A;  4RK2 A;  2O84 X;  5DVF A;  1R1N A;  3DM0 A;  3O29 A;  2DWH A;  3IJX B;  3FVG A;  3LSF B;  4OFJ A;  1DPE A;  4DDD A;  3BBR A;  4X1D A;  4QFO A;  2DXR A;  4DE8 A;  3PV0 E;  1UTH A;  1DMB A;  2QS1 A;  5JTY B;  4H8J A;  2F6P A;  3MZB A;  3OSQ A;  1FQC A;  1BTJ A;  3M8U A;  1PB7 A;  2DWA A;  4O3C A;  3HV1 A;  3U94 A;  3EHT A;  4F19 A;  1ZJL A;  1SQY A;  5KDT A;  1EZP A;  4C1T A;  1QVS A;  4E0W A;  1AIV A;  4F29 A;  1OLA A;  4KQP A;  3KSX A;  4R75 A;  3U8Q A;  1B4H A;  1N3W A;  1YPN A;  3IK6 B;  3M3F A;  3OMB A;  1NNF A;  4BDQ A;  1WOD A;  3CSB A;  3PPR A;  1LFI A;  2A5T B;  3C36 A;  1R9L A;  4G2Z A;  4NF8 B;  2F97 A;  2Q88 A;  4GWO A;  1MY2 A;  3KSJ A;  1XT8 A;  4KCD A;  4DCY A;  3EPE A;  4R6Y A;  1SYH A;  3E3K A;  3PPP A;  1B0L A;  1SD3 A;  4FJP A;  1MDP 1;  3B6T A;  3R26 A;  3VVD A;  2ZMB A;  1L5T A;  2ALU A;  3LC8 A;  1Q1K A;  1FTJ A;  2XX8 A;  4ZZE A;  3K00 A;  4PET A;  3C31 A;  3PUW E;  4LZ5 A;  1QKA A;  3QYT A;  1II5 A;  2I3W A;  3GLB A;  5ELV A;  5H8N B;  5I2N B;  1N04 A;  1M5E A;  4I62 A;  4XKN A;  3E13 X;  3THI A;  4DXC A;  2F7C A;  3C33 A;  4R74 A;  4BDM A;  3MP8 A;  3C32 A;  3KN3 A;  1Z7N E;  4WED A;  3IB1 A;  1B58 A;  1MQH A;  1FTL A;  1OVB A;  3KBR A;  4H1X A;  3TCG A;  1O64 A;  4LON B;  1B3H A;  2X7P A;  2RCA A;  4PP0 A;  4MLV A;  2H4I A;  3K6X A;  3QIM A;  1B51 A;  5EYF A;  5HBC A;  3TTR A;  1MDQ A;  1MXZ A;  4K3F A;  4Q30 B;  4DIG A;  4X1B A;  1GGG A;  2HCA A;  3K6U A;  5AA2 B;  1BP5 A;  1Y3Q A;  2DE4 A;  3EN3 A;  4KR5 A;  1DPP A;  3TCF A;  4OYV A;  3TFL A;  4F2O A;  4LA9 A;  4LZ7 A;  4ZZA A;  5ITO A;  2BJJ X;  1QUI A;  1LAG E;  1FQA A;  1YTV A;  2AL4 A;  1MM7 A;  3B6Q A;  3RUM A;  2ZYO A;  4Z7E A;  1USY E;  4PFY A;  3TUS A;  4BDR A;  4R2B A;  2OZZ A;  4GF8 A;  4RXL A;  2REJ A;  4QFK A;  3MWB A;  3KZG A;  4HS7 A;  1H3D A;  1JEV A;  1XC1 A;  2I48 A;  3G7W A;  3V5A A;  3FIR A;  4NF4 A;  5L9M A;  5ITP A;  2RKM A;  1Y1M A;  2Y7K A;  3IOU A;  2OJT A;  1Z7M E;  4KD5 A;  1LBB A;  1IIW A;  1B7H A;  1YAE A;  1LLS A;  4XKP A;  3CVG A;  5DEX B;  4ZEF A;  1B5I A;  1B3E A;  3MC2 A;  3PD9 A;  5ISU A;  2QRY A;  3FJM A;  2Y7P A;  5KCJ A;  4FAT A;  3PU5 A;  1AH5 A;  1Y20 A;  4H0W A;  3CI8 A;  5I84 A;  3N26 A;  2GH9 A;  4E0X A;  5CBR A;  2DWJ A;  2FA7 A;  4OER A;  5DVJ A;  4IY6 A;  3OEL A;  2NOO A;  5JTY A;  1A40 A;  5CBS A;  1LB8 A;  2XD3 A;  4NTL A;  1UTH B;  1B6H A;  2F5X A;  4KHZ E;  3W9V A;  4F1U A;  1VR5 A;  3G3I A;  2W7Y A;  4AQ4 A;  5F7V A;  4R72 A;  3VVE A;  2O7I A;  5DEX A;  2QMW A;  3T96 B;  1OQG A;  2ONK E;  3PMW A;  2FNC A;  3G3H A;  1JVX A;  2I58 A;  2PVU A;  2UYE A;  2XXQ A;  4LQ5 A;  4O3A A;  2Z22 A;  1DOT A;  1N7W A;  3K1N A;  4LQ2 A;  1LGB C;  4XTC Q;  3SKP A;  1Y9U A;  3K0V A;  1ZBM A;  3CFL A;  3SEW A;  2ONR A;  4IGR A;  1P1N A;  3MPK A;  3IAZ A;  1B52 A;  1B32 A;  5DVI A;  2Q8J A;  1B4Z A;  3Q27 A;  1NFT A;  2XHD A;  5KDT B;  5H8H B;  1AOV A;  4ELO A;  5H8F A;  2F6G A;  1I69 A;  1WVJ A;  2DSF A;  4F1V A;  3R7X A;  4QF9 A;  2E0S A;  2B3F A;  1MRP A;  2G93 A;  2YPN A;  1ZTY A;  3CR9 A;  1B7Z A;  3FD3 A;  3MPL A;  1JEU A;  3R6U A;  3QSL A;  3RT8 A;  3LUY A;  1MM6 A;  1P1U A;  3UP9 A;  1POY 1;  2Z23 A;  5AA4 A;  3KJT A;  4C1U A;  4ISU A;  2H99 A;  4POX A;  3PUV E;  5I58 B;  1PEB A;  1LCT A;  5DYH A;  3MP6 A;  1B46 A;  3V83 A;  4ESX A;  2OWT A;  2DVC A;  2DYX A;  1URD A;  1MXU A;  1PB8 A;  4P0I A;  5TPA A;  3EHS A;  1JVY A;  4GLI A;  3HST A;  2GRV A;  4LUB A;  2ZNS A;  3H6V A;  4UAC A;  4H67 A;  4KFQ A;  3T93 B;  2HAU A;  2B3B A;  3MUQ A;  4IO6 A;  4OEU A;  1MY1 A;  4WEP A;  1B5J A;  4NF5 A;  3T9U A;  1LFH A;  4O3B A;  3IOT A;  1PB9 A;  4RJZ A;  3CIJ A;  3I5O A;  3VV5 A;  3BKI B;  3ZS6 A;  3MVX A;  3IO6 A;  3LBS A;  2Y7W A;  4L17 A;  4MFI A;  3O9P A;  1QUJ A;  4BLA A;  1IXI A;  4C0R A;  1NMU A;  2HZK A;  2Y7I A;  3UOR A;  5CC2 A;  1FTM A;  3IX1 A;  4GXA A;  3W15 C;  1SYI A;  2V25 A;  3Q26 A;  4GL0 A;  1S9T A;  3H6U A;  5CMK A;  3ZSF A;  4DXB A;  1UTB B;  2Q2A A;  2DP8 A;  3ECR A;  1Y1Z A;  4IB2 A;  1H76 A;  1LAF E;  3N6T A;  2QSX A;  3PPO A;  1FQB A;  3G3K A;  3PUY E;  4DLD A;  4GL8 A;  4G4P A;  4GFR A;  2ESN A;  2HZL A;  2O69 A;  2DOJ A;  3SEV A;  1MS7 A;  1MPB A;  1MY4 A;  4QHQ A;  5CMM A;  1TFD A;  3U72 A;  4IO7 A;  5AA2 D;  1A8F A;  4FAJ A;  2H9B A;  1EZO A;  2LAO A;  3MQ9 A;  3IOW A;  2Q9T A;  4NWD A;  5I59 B;  4JXI A;  4U1Z A;  2ONS A;  2XXI A;  3G3J A;  1FQF A;  4X9T A;  1TWY A;  2I49 A;  2DE2 A;  1M5B A;  4LVQ A;  2F7A A;  1IZ1 A;  4RA1 A;  5TP9 B;  3DP4 A;  2V93 A;  2QPQ A;  4RYA A;  5JK4 A;  4MLQ A;  1R6Z A;  1ATG A;  2V3U A;  4H65 A;  5I2K B;  1TT1 A;  4EQ9 A;  3FVK A;  1EH3 A;  2RF1 A;  2YLN A;  1HSE A;  1MQD A;  4YU0 A;  2PX1 A;  3S2V A;  3VLU A;  4EDP A;  3D4C A;  3RT6 B;  5TP9 A;  2AL5 A;  1CE2 A;  1N0T A;  1RYO A;  1ZLQ A;  3EQ1 A;  4OQO A;  3RGY A;  4OXV A;  4YKJ A;  2D3I A;  4G8H A;  4THI A;  4GOT A;  1T0K A;  1XHY A;  2DXY A;  2VHA A;  4ND9 A;  5CMC A;  3PMX A;  1HSL A;  1MH3 A;  3TTN A;  5I57 B;  3O2A A;  3I6V A;  2OBG A;  2RIN A;  3OO8 A;  4KI0 E;  2GFE A;  4R9G A;  4YIC A;  4XKR A;  2XXV A;  1A54 A;  1AL3 A;  2F35 A;  4GD5 A;  1IIT A;  3FV2 A;  3UIF A;  2DWI A;  3FXR A;  2ZNT A;  1JQF A;  3HPI A;  4PE5 B;  3OOA A;  1J1N A;  4RNS A;  1LB9 A;  4OEV A;  1URG A;  1B3F A;  5A5X B;  5FHO A;  3TTL A;  3OD7 A;  1B40 A;  3SEX A;  3DP8 A;  2VGQ A;  2OCU A;  3FJG A;  3PUX E;  3MBP A;  4OVJ A;  4F1Y A;  2XXP A;  1PBP A;  4I9D A;  1VFD A;  1I6B A;  3RTF B;  4KYE A;  1PC3 A;  3TOD A;  3K4U A;  3O97 A;  4NMY A;  3IOR A;  3M3K A;  4ELR A;  1VSO A;  2ZNU A;  3WAF A;  3KGC A;  1B5H A;  2Z8E A;  3H03 A;  3D4G A;  5H8Q B;  1UIU A;  4YB6 A;  4NWC A;  4XKQ A;  4ZDM A;  3TDJ A;  5I59 A;  4TLL B;  3FGS A;  4FE8 A;  3VDF A;  3PGF A;  3ILT B;  5TPA B;  4ZE9 A;  2QMX A;  3ZKK A;  1MQJ A;  3MAM A;  3L6G A;  1ZIU A;  1RYX A;  3PD8 A;  4JSD A;  3PMV A;  4OES A;  3T66 A;  2PYY A;  2P1S A;  2CZL A;  4QRZ A;  1Y3P A;  1MXY A;  1H43 A;  1UTB A;  3TEP A;  4TLM B;  4N6P A;  3SER A;  4XIG Q;  3TEL A;  1B9J A;  2G29 A;  5H8S A;  5HPQ A;  1XS5 A;  1Y4C A;  4PFT A;  1Y4T A;  1NNP A;  4YKP A;  4OFL A;  2THI A;  4ONY A;  2NVU B;  1TXF A;  4YAH X;  3SEU A;  3H06 B;  3HCQ A;  1BKA A;  1JW4 A;  3BFU A;  3JYR A;  3O6I A;  1B3G A;  3SES A;  3TAJ A;  4G8M A;  4YMB A;  2I4B A;  4NF5 B;  1ANF A;  2XX7 A;  3H3G A;  3H4Z A;  1OIB A;  3K6W A;  4ZEB A;  4QFN A;  3ZKL A;  2HAV A;  4IO3 A;  3LSW A;  4P11 A;  3EF7 A;  5L8D A;  5I56 A;  2H5Y A;  2YJP A;  4QSD A;  3GBA A;  1FTO A;  4I1D A;  2HQ0 A;  3QUF A;  2PT2 A;  2ZYK A;  2Q2C A;  3U93 A;  4G68 C;  4N13 A;  1P1Q A;  1LBC A;  1N76 A;  3LSL A;  3OEK A;  4POW A;  4F3P A;  1MG1 A;  1TFA A;  2O1M A;  4M1V A;  1GVC A;  5AA3 A;  2UVJ A;  3HO7 A;  1RKM A;  5DTB A;  4U21 A;  1LFG A;  3VFJ A;  4ELQ A;  3UN6 A;  2XXT A;  1IXC A;  2RC9 A;  3OEM A;  4ECF A;  3FAS A;  1ZU0 A;  3L6H A;  2CMO A;  3O28 A;  2DQV A;  3AXF A;  4EF1 A;  1AMF A;  1VE4 A;  2XXW A;  3F11 A;  1S7Y A;  1SW2 A;  1P1O A;  1QW0 A;  4OMB A;  4I8C A;  4JWY A;  1R9Q A;  3O6G A;  2O1L A;  4IGT A;  3OXN A;  3CRB A;  4Q5T A;  3VVF A;  2DS9 A;  1IXH A;  2V84 A;  3UA8 A;  4QFL A;  3S9E A;  4U1O A;  2NUV A;  4KPT A;  3UGW A;  2F34 A;  3MVY A;  3O66 A;  3KOT A;  4EQ7 A;  1MY0 A;  4FOR A;  4M4G A;  4NF4 B;  4GIZ A;  1N84 A;  1FCK A;  3ONM A;  4HTG A;  4U23 A;  4RPO A;  3DEL B;  2DVZ A;  2PBW A;  2P0S A;  1N7X A;  3KEI A;  2M8C A;  3OEN A;  1JET A;  3USD A;  2UYF A;  5CRY A;  3TMG A;  4YMA A;  3IOV A;  1FTK A;  1POT A;  2QS3 A;  5AE4 A;  3H7M A;  2KLF A;  4OTE A;  1B1H A;  5I2K A;  3TKD A;  3H6T A;  3CFX A;  3IB2 A;  3S4U A;  2O51 A;  3A09 A;  1A55 A;  1SDX A;  2ANJ A;  4JB7 A;  1YCJ A;  4H8I A;  5CI5 A;  5L9S A;  4G68 A;  2R9J A;  3E9X A;  1GR2 A;  1UQW A;  2QS4 A;  2RC8 A;  5KCJ B;  3RPW A;  1OLC A;  3HN0 A;  3IO4 A;  1US5 A;  4RK9 A;  1M5F A;  3C4M A;  1JW5 A;  5F1Q A;  3RNN A;  4FEC A;  3OO9 A;  4GVO A;  4OWD A;  1SBP A;  2E1S A;  5I2N A;  3E4R A;  5H8N A;  4DXU A;  3K1M A;  3IL1 B;  2I0B A;  3W9W A;  2VD2 A;  1IUD A;  1A8E A;  2V3Q A;  1N3X A;  2OK2 A;  3EHU A;  5CM6 A;  1D3K A;  1D9V A;  1MQG A;  2B65 A;  2H25 A;  3TCH A;  3MP1 A;  4R9F A;  5EHM A;  3T9H B;  3VLW A;  1KWH A;  4FED A;  4YKK A;  2NWJ A;  3Q28 A;  2QS2 A;  3RLF E;  1MXX A;  3FXQ A;  3T22 A;  2VP1 A;  2WKY A;  4HW8 A;  5KZT A;  3FVO A;  1B7U A;  3FAT A;  4F39 A;  4F18 A;  5DT6 A;  1SW1 A;  3ILU B;  2I3V A;  3FVN A;  1O7T A;  4IO4 A;  4NE4 A;  4GXS B;  3DLN A;  1PDA A;  3S9N C;  2D21 A;  5ICT A;  1SI0 A;  2PT1 A;  2UXA A;  4MF3 A;  2X26 A;  3IR1 A;  4H6D A;  5K2Y A;  3TZA A;  1JNF A;  2XD2 A;  1SW4 A;  4IY5 A;  3A3U A;  4MBP A;  2F36 A;  3CFZ A;  3TQL A;  1NNK A;  4PQJ A;  4ELP A;  3K02 A;  4TOZ A;  2QL3 A;  4F2Q A;  5BWJ A;  4H5F A;  4Q8R A;  1Y3N A;  4ZEK A;  2I4C A;  3K1P A;  4G68 B;  4JBZ A;  2XXH A;  3RQT A;  3MW0 A;  2Q89 A;  4R2F A;  2GHB A;  4U22 A;  3RN8 A;  2QJE A;  2Z8F A;  3MJN A;  3OO6 A;  3C35 A;  1WDN A;  1OVT A;  4H5G A;  4DCX A;  3MVW A;  3S9L C;  5AA1 A;  3C9H A;  3FJ7 A;  4GQO A;  4UA8 A;  4RY1 A;  1QUK A;  2I0C A;  1NH7 A;  5B70 A;  5ICQ A;  1UIV A;  5IAI A;  4U4S A;  3RTW B;  2UVG A;  4YB7 A;  3VLV A;  3K2D A;  1EZ9 A;  1ZMG A;  2UVH A;  1LAH E;  3A3C A;  3K6V A;  2A5T A;  1S50 A;  4NF8 A;  1QUL A;  2HFB A;  1P99 A;  1QKB A;  3G3G A;  3OO7 A;  1B0H A;  1BLF A;  4U4X A;  5M2V A;  3CSG A;  3SEY A;  4P0G A;  4LP2 B;  3CG3 A;  1MH4 A;  1QJM A;  2X7Q A;  3C34 A;  4QSE A;  3KG2 A;  2RC7 A;  4FIM A;  3SDF A;  1XVX A;  3IB0 A;  1DSN A;  4EF2 A;  4ZED A;  1A7L A;  4F3B A;  2XXX A;  5HM4 B;  4ZS9 A;  3FXU A;  4KYD A;  3VXC A;  4WKM A;  1B05 A;  1D9Y A;  2HXW A;  4N07 A;  3SET A;  5I57 A;  2Y7R A;  3V89 B;  4OET A;  1M5D A;  1OQH A;  2ZYM A;  3JZJ A;  4Q0C A;  4QSC A;  4NF6 A;  3M3L A;  2REG A; 
#chains in the Genus database with same CATH topology
 2O7U A;  4YKI A;  3MYU A;  2CEY A;  2F78 A;  1P1W A;  1LBX A;  2IEE A;  1XI6 A;  4ZE8 A;  3GXA A;  1FW0 A;  3FZV A;  4G61 A;  3TYH A;  4EXK A;  4IO2 A;  2Y84 A;  4X8R A;  4AB6 A;  4F3S A;  2XXU A;  1GTK A;  4PFW A;  1ELJ A;  1NKX A;  3LR1 A;  1NH8 A;  3RY3 A;  3Q29 A;  3TPA A;  5EHS A;  1NUY A;  1ZKB A;  1IQ7 A;  4FEB A;  1SW5 A;  4G77 A;  2Q74 A;  1MY3 A;  1MPC A;  1FQD A;  5CMB A;  1XOC A;  1QGX A;  2P2A A;  4F3G A;  2HEU A;  4N15 A;  4MX6 A;  2XX9 A;  2KQZ A;  4OHN A;  4F31 B;  4AB5 A;  3FBP A;  5H8H A;  1MXV A;  5FHM A;  1M5C A;  1FBC A;  3ODB A;  2NXO A;  4HE0 A;  3HHG A;  4LAT A;  3PUZ E;  1OMP A;  5K2X A;  1FQE A;  2O84 X;  3LUZ A;  2DWH A;  4PAK A;  4DDD A;  4X1D A;  3SZP A;  5JTY B;  3MZB A;  3NOH A;  4O3C A;  1G0H A;  4F19 A;  2Y5K A;  1YZ0 A;  4F29 A;  1FPF A;  1B4H A;  3IK6 B;  3OMB A;  1WOD A;  2A5T B;  2Q88 A;  4GWO A;  4XEQ A;  1SYH A;  2FBP A;  4FJP A;  1B0L A;  5ET7 A;  1L5T A;  3LC8 A;  1Q1K A;  1FTJ A;  3K00 A;  4LZ5 A;  3QYT A;  3GLB A;  4P1E A;  1FBF A;  1M5E A;  2B4L A;  4R74 A;  3C32 A;  1O64 A;  4MLV A;  3K6X A;  5HBC A;  3TTR A;  1Y3Q A;  3TCF A;  4F2O A;  4LA9 A;  1YTV A;  3MWB A;  3KZG A;  3V5A A;  3FIR A;  4PTK A;  2OJT A;  4P56 A;  1B7H A;  1YAE A;  4XKP A;  1IMB A;  3CVG A;  5DEX B;  1B5I A;  3MC2 A;  3PD9 A;  2QRY A;  4IR8 A;  3FJM A;  2Y7P A;  4FAT A;  1FPE A;  4N81 A;  4OER A;  5JTY A;  1A40 A;  2XD3 A;  4KHZ E;  4AQ4 A;  3VVE A;  1NV7 A;  5DEX A;  4JVD A;  2ONK E;  3PMW A;  2FNC A;  2I58 A;  2UYE A;  3K0V A;  3SEW A;  1B52 A;  5ET8 A;  1B4Z A;  1NFT A;  2XHD A;  2DSF A;  3R7X A;  4QF9 A;  4X04 A;  2YPN A;  1JEU A;  4DI3 D;  4OVQ A;  3QSL A;  1MM6 A;  5I58 B;  3KC1 A;  1FJ6 A;  1LCT A;  1B46 A;  2OWT A;  2DVC A;  1URD A;  1JVY A;  4GLI A;  4PAI A;  4MNI A;  5I3S A;  4UAC A;  1LFH A;  2VPO A;  3ZS6 A;  3IO6 A;  3LBS A;  4PGP A;  1IXI A;  2Y7I A;  3UOR A;  1LBW A;  3IX1 A;  4GL0 A;  2Q2A A;  3T1B A;  4IB2 A;  4N6K A;  3N6T A;  4DLD A;  4G4P A;  3SEV A;  4O8M A;  1FPL A;  1MS7 A;  1MPB A;  4QHQ A;  4QBA A;  1FQF A;  1M5B A;  1DK4 A;  1IZ1 A;  1NV0 A;  3DP4 A;  1R6Z A;  1MQD A;  1NUZ A;  4THI A;  1T0K A;  1XHY A;  2DXY A;  4I3E A;  3TTN A;  5I57 B;  4KI0 E;  3FV2 A;  2ZNT A;  3TTL A;  1LBY A;  3SEX A;  3DP8 A;  3FJG A;  3RTF B;  4KYE A;  5H8Q B;  1B5H A;  3H03 A;  4XKQ A;  4ZDM A;  4NQ8 A;  4MNP A;  1MQJ A;  2MKZ A;  3L6G A;  1RYX A;  2VPN A;  5EYH A;  2CZL A;  1Y3P A;  1MXY A;  1DCU A;  4H45 A;  3TEP A;  1B9J A;  1XS5 A;  4PFT A;  4OFL A;  3SEU A;  1BKA A;  1FPB A;  3T0J A;  2I4B A;  3H4Z A;  3K6W A;  2XWI A;  4QFN A;  3ZKL A;  4P11 A;  4IO3 A;  4QSD A;  1IMF A;  2PT2 A;  2ZYK A;  1P1Q A;  1LBC A;  4F3P A;  1GVC A;  2UVJ A;  1RKM A;  4PBQ A;  4ECF A;  3OEM A;  2RC9 A;  4GWW A;  5IGA A;  2CMO A;  4EF1 A;  1S7Y A;  2FVZ A;  4JWY A;  1R9Q A;  3VVF A;  3OXN A;  3CRB A;  4KPT A;  2F34 A;  2CZH A;  4FOR A;  4M4G A;  4GIZ A;  3ONM A;  4U23 A;  3DEL B;  4YMA A;  1FTK A;  3H7M A;  2KLF A;  4OTE A;  3CFX A;  2O51 A;  1YCJ A;  5CI5 A;  2WEF A;  2RC8 A;  3IO4 A;  5LDZ A;  4GX6 A;  4FEC A;  4OWD A;  3W9W A;  3TCH A;  2B65 A;  2H25 A;  2R8T A;  3MP1 A;  2HHM A;  3T9H B;  3VLW A;  4PBH A;  4NHB A;  1MXX A;  4XF5 A;  2WKY A;  3FVO A;  3LV0 A;  4MF3 A;  1JP4 A;  4ZEC A;  4GX4 A;  5KDT B;  3CFZ A;  2I4C A;  4JBZ A;  2XXH A;  3RN8 A;  2XWV A;  3CHG A;  1OVT A;  5AA1 A;  4GQO A;  5ICQ A;  5B70 A;  2PFZ A;  5IAI A;  3RTW B;  1ZMG A;  2A5T A;  1P99 A;  1QKB A;  3OO7 A;  4U4X A;  1B0H A;  3SEY A;  3CG3 A;  3C34 A;  4FIM A;  1XVX A;  1A7L A;  5HM4 B;  3FXU A;  4KYD A;  3VXC A;  1B05 A;  1D9Y A;  2HXW A;  4N07 A;  4OET A;  3TOD A;  1MQI A;  4HCY A;  4NED A;  4WXJ A;  4XXU A;  4F22 A;  2F7B A;  4PE3 A;  2VD3 A;  2ABH A;  1I6A A;  3I3V A;  2Q8M A;  2GHA A;  1O63 A;  3LSX A;  4JDF A;  1DTZ A;  4NG7 A;  2OLB A;  2UVI A;  1RDX A;  2L5V A;  5FTI A;  1NL5 A;  4R6H A;  4KYS A;  5BUU A;  5AA4 B;  2XWO A;  4GBW A;  4ZEI A;  4YZZ A;  3T9X B;  3RPL A;  1JW1 A;  2V3T A;  3KC0 A;  5A5X A;  4YB5 A;  1PBQ A;  5JEI A;  3KN7 A;  5AA2 A;  4MJO A;  2QVV A;  4P9K A;  4EXL A;  5J1D A;  2O68 A;  3N94 A;  4G8N A;  2AYS A;  4OFO A;  2XXR A;  2F8D A;  3JV9 A;  4JSO A;  4X48 A;  2RCB A;  4EUO A;  4GRK A;  4R73 A;  4ZZA A;  5I2K A;  3H6W A;  3IJO B;  3FVG A;  3LSF B;  4OFJ A;  1DPE A;  4NN3 A;  1UTH A;  2QS1 A;  4PDD A;  2WYP A;  4H8J A;  1BTJ A;  1PB7 A;  2DWA A;  3U94 A;  4E0W A;  4R75 A;  1N3W A;  2HPG A;  4BDQ A;  1NNF A;  3CSB A;  3PPR A;  1LFI A;  4G2Z A;  3C36 A;  4DCY A;  1MY2 A;  1SD3 A;  4PC9 A;  3B6T A;  3R26 A;  4N8Y A;  2ZMB A;  5ET6 A;  3PUW E;  1QKA A;  3THI A;  4WED A;  3IB1 A;  1OVB A;  3KBR A;  4P1L A;  4LON B;  4PDH A;  5EYF A;  4Q30 B;  4DIG A;  1EYK A;  1DPP A;  3TFL A;  5LTC A;  4LZ7 A;  5ITO A;  2BJJ X;  1MM7 A;  5F24 A;  3TUS A;  2ZYO A;  1USY E;  1Q9D A;  2FIE A;  4O7I A;  1JEV A;  4PFI A;  3G7W A;  2Y7K A;  3IOU A;  5DW8 A;  1LLS A;  4ZEF A;  1B3E A;  5ISU A;  1FBP A;  2QVU A;  2PFY A;  3PU5 A;  5KCJ A;  3CI8 A;  4E0X A;  2DWJ A;  2XWK A;  4IY6 A;  3OEL A;  2NOO A;  1UTH B;  1B6H A;  2F5X A;  2QMW A;  2PVU A;  2XXQ A;  3PTY A;  2Z22 A;  4LQ2 A;  1ZBM A;  2ONR A;  4IGR A;  4OVP A;  1B32 A;  5DVI A;  2F3B A;  2F6G A;  1I69 A;  2E0S A;  1MRP A;  4GWX A;  1B7Z A;  3RT8 A;  3UP9 A;  2Z23 A;  2GQ1 A;  3FXB A;  4N6D A;  4ESX A;  1MXU A;  1PB8 A;  3EHS A;  3HST A;  2GRV A;  4LUB A;  1NV3 A;  1MY1 A;  1B5J A;  1PB9 A;  4RJZ A;  3CIJ A;  3I5O A;  3VV5 A;  3MVX A;  4MFI A;  3O9P A;  4BLA A;  2HZK A;  1FTM A;  4GXA A;  3W15 C;  2V25 A;  2V4C A;  2ZZV A;  4HE1 A;  1Y1Z A;  1LAF E;  3PPO A;  2ESN A;  1IME A;  5AA2 D;  4GWS A;  1TFD A;  2H9B A;  2LAO A;  5EQ8 A;  3IOW A;  4NWD A;  4JXI A;  4U1Z A;  2ONS A;  2XXI A;  3KBZ A;  4MMP A;  4OVT A;  2DE2 A;  4RYA A;  5I2K B;  1HSE A;  4YU0 A;  3S2V A;  3VLU A;  3RT6 B;  2FIX A;  1RYO A;  4OQO A;  4OXV A;  4GOT A;  4ND9 A;  3PMX A;  3I6V A;  4R9G A;  3OO8 A;  4YIC A;  2GFE A;  4O94 A;  4XKR A;  3UIF A;  4MEV A;  5T3J A;  4PE5 B;  1K9Z A;  5A5X B;  4N4U A;  1B40 A;  3MBP A;  4F1Y A;  1PBP A;  4I9D A;  1I6B A;  1VSO A;  3D4G A;  4NWC A;  3VDF A;  3PGF A;  4ZE9 A;  2CZK A;  3PD8 A;  4OES A;  3T66 A;  1UTB A;  3TEL A;  5HPQ A;  5H8S A;  1SPI A;  1Y4C A;  2XXK A;  2THI A;  3HCQ A;  3SES A;  1B3G A;  4NF5 B;  1ANF A;  3LSW A;  2H5Y A;  3GBA A;  1FBD A;  2HQ0 A;  3QUF A;  2Q2C A;  3U93 A;  4G68 C;  5IZZ A;  3LSL A;  4POW A;  1MG1 A;  3HFU A;  1LFG A;  2XXT A;  1IXC A;  1ZU0 A;  3AXF A;  4OMB A;  1VE4 A;  3F11 A;  4I8C A;  5EQA A;  3S9E A;  3UA8 A;  2NUV A;  3O66 A;  3KOT A;  4NF4 B;  4HTG A;  4RPO A;  3KEI A;  3OEN A;  2M8C A;  2UYF A;  5CRY A;  2QS3 A;  3TKD A;  3IB2 A;  4JB7 A;  2ANJ A;  2WYK A;  4H8I A;  2CZI A;  1GR2 A;  5KCJ B;  3RPW A;  4RK9 A;  1M5F A;  1JW5 A;  4DI4 B;  4GVO A;  5H8N A;  2Y5L A;  1NV4 A;  4DXU A;  3IL1 B;  2OK2 A;  5CM6 A;  1MQG A;  4P8B A;  2NWJ A;  3FXQ A;  3FAT A;  5DT6 A;  3ILU B;  3S9N C;  1O7T A;  1FSA A;  2X26 A;  4H6D A;  4PFR A;  2XD2 A;  4OA4 A;  3TQL A;  2F36 A;  4PQJ A;  4TOZ A;  3RQT A;  2GHB A;  2Z8F A;  3MJN A;  3MVW A;  3S9L C;  3C9H A;  3FJ7 A;  1QUK A;  2UVG A;  3BIH A;  2UVH A;  3A3C A;  4HE2 A;  3G3G A;  5M2V A;  1BLF A;  3CSG A;  4LP2 B;  1MH4 A;  1NV1 A;  3SDF A;  3E78 A;  4EF2 A;  4F3B A;  1EYJ A;  3SET A;  4QSC A;  4Q0C A;  2ZYM A;  3JZJ A;  1IMA A;  2REG A;  5FTH A;  1LAX A;  3QAX A;  3WAE A;  1HSJ A;  1IMD A;  1LST A;  4TQU Q;  5I56 B;  2ZZX A;  5IZ3 A;  3IFC A;  3N5L A;  1B2H A;  1IEJ A;  5TU0 A;  3VE1 B;  4DZ1 A;  3TTM A;  3PPN A;  1XVY A;  3V8X B;  2IA4 A;  1LBZ A;  4IO5 A;  1VFE A;  3N6U A;  4NAP A;  1IXG A;  4Z0I A;  2AIX A;  1NUX A;  2Z8D A;  4NGU A;  1YYZ A;  3TTK A;  2XXY A;  3RYD A;  2R6G E;  5H8Q A;  4EQB A;  5L9O A;  1DTG A;  3MVZ A;  1URS A;  5EQ9 A;  1MPD A;  3G3F A;  3TQW A;  5LOM A;  2A5S A;  4ESW A;  4R6K A;  1A99 A;  2OWS A;  3B6W A;  2XA5 A;  3T9V A;  1B1X A;  4MH5 A;  1BIY A;  5I58 A;  3CG1 A;  1B3L A;  4OZ9 A;  5FHN A;  4NF6 B;  1I6Q A;  4BDN A;  3QXM A;  4HCW A;  3K01 A;  3HHF A;  2I6E A;  4LZ8 A;  3S9M C;  1MXW A;  3MZ9 A;  3OSR A;  1H45 A;  1D4N A;  2VOZ A;  5IKB A;  3GZG A;  5DVF A;  1R1N A;  1FTA A;  4QFO A;  2DXR A;  3PV0 E;  2DDK A;  2F6P A;  3OSQ A;  1FQC A;  3EHT A;  1EZP A;  1AIV A;  3KSX A;  3M3F A;  1BK4 A;  1FBG A;  1R9L A;  3EPE A;  3E3K A;  5I5P A;  2ALU A;  2JJK A;  2XX8 A;  5H8N B;  1II5 A;  4I62 A;  4DXC A;  3E13 X;  3MP8 A;  1B58 A;  1MQH A;  1FTL A;  4H1X A;  4PCD A;  2CEX A;  1B51 A;  1MDQ A;  4K3F A;  4X1B A;  1GGG A;  3K6U A;  4P3L A;  1BP5 A;  2DE4 A;  3EN3 A;  4OYV A;  1G0I A;  1QUI A;  3B6Q A;  1FQA A;  3RUM A;  4Z7E A;  4R2B A;  2OZZ A;  4GF8 A;  4RXL A;  1H3D A;  1XC1 A;  4NF4 A;  5L9M A;  2RKM A;  1Y1M A;  4KD5 A;  1AH5 A;  1Y20 A;  4H0W A;  2GH9 A;  2FA7 A;  5EQ7 A;  5IM2 A;  1LB8 A;  4NTL A;  3W9V A;  4F1U A;  3G3I A;  2W7Y A;  4R72 A;  3T96 B;  1OQG A;  3G3H A;  4AS5 A;  1DBZ A;  2BJI A;  4O3A A;  1DOT A;  3K1N A;  4XTC Q;  3SKP A;  3CFL A;  3MPK A;  4GX3 A;  3B50 A;  2Q8J A;  3ISP A;  4FBP A;  1NI9 A;  5H8H B;  4ELO A;  1WVJ A;  4F1V A;  2G93 A;  3FD3 A;  1ZTY A;  3CR9 A;  3MPL A;  3LUY A;  1P1U A;  1POY 1;  4POX A;  3PUV E;  2DYX A;  5TPA A;  2ZNS A;  3H6V A;  4H67 A;  2HAU A;  3MUQ A;  4IO6 A;  4WEP A;  4O3B A;  3IOT A;  2Y7W A;  1FBE A;  1NMU A;  1K9Y A;  1S9T A;  5CMK A;  4DXB A;  3ECR A;  1FQB A;  4GL8 A;  2HZL A;  2DOJ A;  5CMM A;  3U72 A;  1EZO A;  1A8F A;  3MQ9 A;  2Q9T A;  5ESY A;  5I59 B;  1TWY A;  4LVQ A;  5TP9 B;  2V93 A;  2QPQ A;  1ATG A;  2V3U A;  2OWZ A;  4H65 A;  1TT1 A;  2RF1 A;  2PX1 A;  4HXV A;  3D4C A;  2AL5 A;  1CE2 A;  1ZLQ A;  4YKJ A;  2D3I A;  1LBV A;  2VHA A;  4XFE A;  3O2A A;  2OBG A;  2RIN A;  2XXV A;  1A54 A;  1AL3 A;  4GD5 A;  1IIT A;  2WBB A;  3FXR A;  1JQF A;  3HPI A;  3OOA A;  1J1N A;  4RNS A;  1LB9 A;  4OEV A;  1URG A;  2OCU A;  4OVJ A;  3IOR A;  3M3K A;  4ELR A;  3WAF A;  2Z8E A;  1EYI A;  5I59 A;  3TDJ A;  4TLL B;  3FGS A;  3MST A;  1ZIU A;  4JSD A;  3PMV A;  2PYY A;  2P1S A;  5ET5 A;  4TLM B;  3SER A;  1Y4T A;  1NNP A;  3H06 B;  1JW4 A;  3O6I A;  4G8M A;  3H3G A;  2XX7 A;  1OIB A;  3D1R A;  5IZ3 B;  2HAV A;  4MAG A;  5I56 A;  2YJP A;  4N17 A;  3ROJ A;  1N76 A;  1TFA A;  2O1M A;  4M1V A;  5AA3 A;  5DTB A;  3HO7 A;  4U21 A;  3VFJ A;  4ELQ A;  3UN6 A;  3FAS A;  3O28 A;  2DQV A;  1AMF A;  1SW2 A;  3O6G A;  4Q5T A;  2DS9 A;  1IXH A;  4QFL A;  4U1O A;  3UGW A;  4EQ7 A;  1MY0 A;  1N84 A;  2DVZ A;  1N7X A;  3GYY A;  3TMG A;  3IOV A;  1POT A;  1B1H A;  3S4U A;  3A09 A;  1A55 A;  5L9S A;  4G68 A;  1OLC A;  1FPG A;  1US5 A;  5F1Q A;  3RNN A;  3E79 A;  4O7M A;  1KA0 A;  1SBP A;  2E1S A;  5I2N A;  2FHY A;  1D9V A;  5EHM A;  1KWH A;  4YKK A;  3Q28 A;  3RLF E;  5KZT A;  2VP1 A;  4F18 A;  1B7U A;  4NE4 A;  1SW1 A;  2I3V A;  3FVN A;  5J16 A;  4GXS B;  3DLN A;  2VT5 A;  5ICT A;  1SI0 A;  3IR1 A;  4MBP A;  1NNK A;  5BWJ A;  3K02 A;  4F2Q A;  2QL3 A;  1CNQ A;  4H5F A;  4ZEK A;  3A29 A;  4R2F A;  1NV6 A;  3OO6 A;  4H5G A;  4DCX A;  4NX1 A;  4UA8 A;  2I0C A;  1NV5 A;  1UIV A;  3VLV A;  3K2D A;  5CMC A;  1LAH E;  3K6V A;  1S50 A;  1QUL A;  2HFB A;  2X7Q A;  4QSE A;  3KG2 A;  2RC7 A;  4JVC A;  3IB0 A;  4WKM A;  1FPD A;  2Y7R A;  1RDZ A;  5AA2 B;  1M5D A;  1OQH A;  4GBV A;  4YAH X;  3M3L A;  5B7D A;  3P7I A;  4JWO A;  3O6H A;  4UAB A;  4RPN A;  1IMC A;  1CB6 A;  1USY H;  4QFP A;  2ZXT A;  3DP6 A;  2ZZW A;  3PPQ A;  3VXB A;  3UK4 A;  1F9B A;  5AA4 A;  3BFT A;  3U92 A;  2P3V A;  1SI1 A;  5EYG A;  2WX9 A;  3KJ7 A;  2FYI A;  1H44 A;  1Q35 A;  3GBB A;  3KN8 A;  3FUZ A;  3KOS A;  4JVI A;  4KCC A;  4PF6 A;  1US4 A;  2O6A A;  1FJ9 A;  4I3Y A;  4BDO A;  2PMS A;  1GV8 A;  2R71 A;  3MZ1 A;  3QUJ A;  3Q25 A;  1NNT A;  3U1O A;  3QK6 A;  3KFM A;  4PFU A;  2ZYN A;  1AWB A;  4QXD A;  4U2R A;  2DE3 A;  2H98 A;  1SVX B;  3B7D A;  4OEN A;  1EU8 A;  5H8F B;  4BDL A;  4JWX A;  2WBD A;  1NV2 A;  1LCF A;  2D5W A;  3FV1 A;  4OVS A;  4RK2 A;  3DM0 A;  3O29 A;  3IJX B;  3BBR A;  1KZ8 A;  1DMB A;  3M8U A;  4I40 A;  3HV1 A;  1ZJL A;  1SQY A;  5KDT A;  4C1T A;  1QVS A;  4OVR A;  3B8B A;  1OLA A;  4KQP A;  3U8Q A;  1YPN A;  3U65 A;  4NF8 B;  2F97 A;  4KCD A;  3KSJ A;  1XT8 A;  4R6Y A;  3PPP A;  4P47 A;  1MDP 1;  3VVD A;  4ZZE A;  4PET A;  3C31 A;  5ELV A;  5I2N B;  2I3W A;  1N04 A;  4XKN A;  2F7C A;  3C33 A;  4BDM A;  3KN3 A;  1Z7N E;  3TCG A;  1B3H A;  2X7P A;  2RCA A;  4PP0 A;  2H4I A;  3QIM A;  1MXZ A;  1KA1 A;  2HCA A;  4KR5 A;  1FRP A;  1LAG E;  2AL4 A;  4PFY A;  4BDR A;  2REJ A;  4QFK A;  4HS7 A;  2I48 A;  5ITP A;  1Z7M E;  1LBB A;  1IIW A;  5I84 A;  3N26 A;  5CBR A;  5DVJ A;  5CBS A;  1VR5 A;  5F7V A;  2O7I A;  1JVX A;  4LQ5 A;  1N7W A;  1LGB C;  1Y9U A;  1P1N A;  3IAZ A;  4KXP A;  3Q27 A;  4AS4 A;  4GWZ A;  1AOV A;  5H8F A;  1D9Q A;  2B3F A;  3BIG A;  3R6U A;  2B4M A;  4NF0 A;  3KJT A;  4C1U A;  4ISU A;  2H99 A;  1PEB A;  5DYH A;  5I7I A;  3MP6 A;  3V83 A;  4P0I A;  3T93 B;  4KFQ A;  2B3B A;  4OEU A;  4NF5 A;  3T9U A;  3BKI B;  3RPL B;  4L17 A;  1QUJ A;  4C0R A;  5CC2 A;  1SYI A;  3Q26 A;  3H6U A;  3ZSF A;  1UTB B;  2DP8 A;  1H76 A;  1FPJ A;  2QSX A;  3G3K A;  3PUY E;  4GFR A;  2O69 A;  1MY4 A;  4IO7 A;  4FAJ A;  3G3J A;  4X9T A;  2I49 A;  4LN5 A;  2F7A A;  4RA1 A;  5JK4 A;  4MLQ A;  4EQ9 A;  3FVK A;  1EH3 A;  4EDP A;  2YLN A;  5TP9 A;  1N0T A;  3EQ1 A;  1RDY A;  3RGY A;  1FBH A;  4G8H A;  4PFB A;  1HSL A;  1MH3 A;  2F35 A;  2DWI A;  3QMF A;  1B3F A;  5FHO A;  3OD7 A;  2VGQ A;  3PUX E;  2XXP A;  1VFD A;  1PC3 A;  3K4U A;  3O97 A;  4NMY A;  2ZNU A;  3KGC A;  1UIU A;  4YB6 A;  4MIJ A;  4FE8 A;  3ILT B;  5TPA B;  2QMX A;  3ZKK A;  3MAM A;  4QRZ A;  1LEV A;  4MNC A;  1H43 A;  4N6P A;  4XIG Q;  2G29 A;  2NVU B;  4YKP A;  4ONY A;  1TXF A;  4GWY A;  3BFU A;  3JYR A;  3TAJ A;  2OX3 A;  4YMB A;  4ZEB A;  5L8D A;  3EF7 A;  4OAN A;  1FTO A;  2P3N A;  4I1D A;  4N13 A;  3OEK A;  4PF8 A;  3L6H A;  5A5L A;  2XXW A;  3IFA A;  4DE8 A;  1P1O A;  1QW0 A;  2HXR A;  2O1L A;  4IGT A;  2V84 A;  3MVY A;  1YXI A;  5FBP A;  1FCK A;  2KR0 A;  2PBW A;  2P0S A;  3USD A;  1JET A;  4MCO A;  5AE4 A;  3H6T A;  1SDX A;  2R9J A;  5IZ1 A;  3E9X A;  1UQW A;  2QS4 A;  3HN0 A;  3C4M A;  3OO9 A;  3E4R A;  3K1M A;  2I0B A;  2VD2 A;  1IUD A;  1A8E A;  2V3Q A;  1N3X A;  3EHU A;  4PGN A;  4H46 A;  1D3K A;  4R9F A;  4FED A;  1INP A;  4HW8 A;  2QS2 A;  3T22 A;  4F39 A;  1VDW A;  4IO4 A;  1PDA A;  2D21 A;  2PT1 A;  2UXA A;  5K2Y A;  3TZA A;  1JNF A;  4IY5 A;  1SW4 A;  3A3U A;  4ELP A;  4Q8R A;  1Y3N A;  1FPI A;  3K1P A;  4G68 B;  3EKI A;  3MW0 A;  2QFL A;  2Q89 A;  4U22 A;  2QJE A;  3C35 A;  1WDN A;  2F3D A;  2PCR A;  4RY1 A;  1NH7 A;  1NUW A;  4U4S A;  4YB7 A;  2QVR A;  4GWU A;  1FPK A;  1EZ9 A;  4NF8 A;  4P0G A;  1QJM A;  1DSN A;  4ZED A;  2XXX A;  4ZS9 A;  4N91 A;  5I57 A;  4N8G A;  4PAF A;  4MHF A;  3V89 B;  4NF6 A; 
#chains in the Genus database with same CATH homology
 2O7U A;  5FTH A;  5B7D A;  3P7I A;  1LAX A;  4YKI A;  1MQI A;  4HCY A;  3QAX A;  3WAE A;  4NED A;  4WXJ A;  2F78 A;  1HSJ A;  4XXU A;  4JWO A;  4F22 A;  1P1W A;  2F7B A;  3O6H A;  2IEE A;  4RPN A;  1LST A;  2VD3 A;  1CB6 A;  4TQU Q;  5I56 B;  1USY H;  2ABH A;  1I6A A;  3I3V A;  4QFP A;  2ZXT A;  4ZE8 A;  3GXA A;  1FW0 A;  3DP6 A;  3N5L A;  1B2H A;  1IEJ A;  3FZV A;  3PPQ A;  5TU0 A;  2GHA A;  3VE1 B;  3VXB A;  3UK4 A;  1F9B A;  3TYH A;  4DZ1 A;  3TTM A;  4EXK A;  1O63 A;  3LSX A;  3PPN A;  2Y84 A;  3BFT A;  4IO2 A;  4AB6 A;  4F3S A;  4JDF A;  4ZEC A;  2XXU A;  1XVY A;  3U92 A;  3V8X B;  1GTK A;  2IA4 A;  4IO5 A;  1VFE A;  4PFW A;  1ELJ A;  1NKX A;  3N6U A;  1SI1 A;  3LR1 A;  1DTZ A;  1IXG A;  2OLB A;  4Z0I A;  1NH8 A;  2UVI A;  4GRK A;  3RY3 A;  3Q29 A;  3TPA A;  2AIX A;  3KJ7 A;  5EHS A;  2FYI A;  1ZKB A;  5FTI A;  1H44 A;  1IQ7 A;  4FEB A;  2Z8D A;  1NL5 A;  4R6H A;  1SW5 A;  4KYS A;  5BUU A;  1Q35 A;  2XXY A;  3GBB A;  4G77 A;  3TTK A;  5AA4 B;  3KN8 A;  1MY3 A;  3FUZ A;  4ZEI A;  2R6G E;  3KOS A;  4YZZ A;  5H8Q A;  3T9X B;  1MPC A;  1FQD A;  5CMB A;  4KCC A;  4EQB A;  1DTG A;  5L9O A;  3MVZ A;  1URS A;  1JW1 A;  1US4 A;  1MPD A;  1XOC A;  2V3T A;  3G3F A;  2O6A A;  3TQW A;  5LOM A;  2A5S A;  2P2A A;  4F3G A;  4ESW A;  5A5X A;  4R6K A;  4BDO A;  1A99 A;  2OWS A;  3B6W A;  2HEU A;  2PMS A;  1PBQ A;  4YB5 A;  1GV8 A;  1B1X A;  3KN7 A;  3T9V A;  5JEI A;  2R71 A;  3MZ1 A;  4MH5 A;  1BIY A;  3QUJ A;  3CG1 A;  3Q25 A;  1B3L A;  1NNT A;  5I58 A;  3U1O A;  4OZ9 A;  5FHN A;  2XX9 A;  3QK6 A;  4NF6 B;  3KFM A;  4PFU A;  2ZYN A;  5AA2 A;  1I6Q A;  4BDN A;  4OHN A;  2DE3 A;  2H98 A;  4U2R A;  1SVX B;  3B7D A;  4EXL A;  4F31 B;  4OEN A;  3QXM A;  4HCW A;  1EU8 A;  3K01 A;  5H8F B;  4AB5 A;  5J1D A;  2O68 A;  3HHF A;  2I6E A;  1MXV A;  3N94 A;  4G8N A;  4LZ8 A;  2AYS A;  5H8H A;  4OFO A;  2XXR A;  4BDL A;  5FHM A;  1M5C A;  2F8D A;  3S9M C;  4JWX A;  1MXW A;  3MZ9 A;  3ODB A;  2NXO A;  3JV9 A;  4JSO A;  4X48 A;  3HHG A;  2RCB A;  3OSR A;  4LAT A;  1LCF A;  1OMP A;  2D5W A;  1H45 A;  3FV1 A;  1FQE A;  1D4N A;  2VOZ A;  3H6W A;  3PUZ E;  4R73 A;  5K2X A;  3IJO B;  4EUO A;  5IKB A;  3GZG A;  4RK2 A;  2O84 X;  5DVF A;  1R1N A;  3DM0 A;  3O29 A;  2DWH A;  3IJX B;  3FVG A;  3LSF B;  4OFJ A;  1DPE A;  4DDD A;  3BBR A;  4X1D A;  4QFO A;  2DXR A;  4DE8 A;  3PV0 E;  1UTH A;  1DMB A;  2QS1 A;  5JTY B;  4H8J A;  2F6P A;  3MZB A;  3OSQ A;  1FQC A;  1BTJ A;  3M8U A;  1PB7 A;  2DWA A;  4O3C A;  3HV1 A;  3U94 A;  3EHT A;  4F19 A;  1ZJL A;  1SQY A;  5KDT A;  1EZP A;  4C1T A;  1QVS A;  4E0W A;  1AIV A;  4F29 A;  1OLA A;  4KQP A;  3KSX A;  4R75 A;  3U8Q A;  1B4H A;  1N3W A;  1YPN A;  3IK6 B;  3M3F A;  3OMB A;  1NNF A;  4BDQ A;  1WOD A;  3CSB A;  3PPR A;  1LFI A;  2A5T B;  3C36 A;  1R9L A;  4G2Z A;  4NF8 B;  2F97 A;  2Q88 A;  4GWO A;  1MY2 A;  3KSJ A;  1XT8 A;  4KCD A;  4DCY A;  3EPE A;  4R6Y A;  1SYH A;  3E3K A;  3PPP A;  1B0L A;  1SD3 A;  4FJP A;  1MDP 1;  3B6T A;  3R26 A;  3VVD A;  2ZMB A;  1L5T A;  2ALU A;  3LC8 A;  1Q1K A;  1FTJ A;  2XX8 A;  4ZZE A;  3K00 A;  4PET A;  3C31 A;  3PUW E;  4LZ5 A;  1QKA A;  3QYT A;  1II5 A;  2I3W A;  3GLB A;  5ELV A;  5H8N B;  5I2N B;  1N04 A;  1M5E A;  4I62 A;  4XKN A;  3E13 X;  3THI A;  4DXC A;  2F7C A;  3C33 A;  4R74 A;  4BDM A;  3MP8 A;  3C32 A;  3KN3 A;  1Z7N E;  4WED A;  3IB1 A;  1B58 A;  1MQH A;  1FTL A;  1OVB A;  3KBR A;  4H1X A;  3TCG A;  1O64 A;  4LON B;  1B3H A;  2X7P A;  2RCA A;  4PP0 A;  4MLV A;  2H4I A;  3K6X A;  3QIM A;  1B51 A;  5EYF A;  5HBC A;  3TTR A;  1MDQ A;  1MXZ A;  4K3F A;  4Q30 B;  4DIG A;  4X1B A;  1GGG A;  2HCA A;  3K6U A;  5AA2 B;  1BP5 A;  1Y3Q A;  2DE4 A;  3EN3 A;  4KR5 A;  1DPP A;  3TCF A;  4OYV A;  3TFL A;  4F2O A;  4LA9 A;  4LZ7 A;  4ZZA A;  5ITO A;  2BJJ X;  1QUI A;  1LAG E;  1FQA A;  1YTV A;  2AL4 A;  1MM7 A;  3B6Q A;  3RUM A;  2ZYO A;  4Z7E A;  1USY E;  4PFY A;  3TUS A;  4BDR A;  4R2B A;  2OZZ A;  4GF8 A;  4RXL A;  2REJ A;  4QFK A;  3MWB A;  3KZG A;  4HS7 A;  1H3D A;  1JEV A;  1XC1 A;  2I48 A;  3G7W A;  3V5A A;  3FIR A;  4NF4 A;  5L9M A;  5ITP A;  2RKM A;  1Y1M A;  2Y7K A;  3IOU A;  2OJT A;  1Z7M E;  4KD5 A;  1LBB A;  1IIW A;  1B7H A;  1YAE A;  1LLS A;  4XKP A;  3CVG A;  5DEX B;  4ZEF A;  1B5I A;  1B3E A;  3MC2 A;  3PD9 A;  5ISU A;  2QRY A;  3FJM A;  2Y7P A;  5KCJ A;  4FAT A;  3PU5 A;  1AH5 A;  1Y20 A;  4H0W A;  3CI8 A;  5I84 A;  3N26 A;  2GH9 A;  4E0X A;  5CBR A;  2DWJ A;  2FA7 A;  4OER A;  5DVJ A;  4IY6 A;  3OEL A;  2NOO A;  5JTY A;  1A40 A;  5CBS A;  1LB8 A;  2XD3 A;  4NTL A;  1UTH B;  1B6H A;  2F5X A;  4KHZ E;  3W9V A;  4F1U A;  1VR5 A;  3G3I A;  2W7Y A;  4AQ4 A;  5F7V A;  4R72 A;  3VVE A;  2O7I A;  5DEX A;  2QMW A;  3T96 B;  1OQG A;  2ONK E;  3PMW A;  2FNC A;  3G3H A;  1JVX A;  2I58 A;  2PVU A;  2UYE A;  2XXQ A;  4LQ5 A;  4O3A A;  2Z22 A;  1DOT A;  1N7W A;  3K1N A;  4LQ2 A;  1LGB C;  4XTC Q;  3SKP A;  1Y9U A;  3K0V A;  1ZBM A;  3CFL A;  3SEW A;  2ONR A;  4IGR A;  1P1N A;  3MPK A;  3IAZ A;  1B52 A;  1B32 A;  5DVI A;  2Q8J A;  1B4Z A;  3Q27 A;  1NFT A;  2XHD A;  5KDT B;  5H8H B;  1AOV A;  4ELO A;  5H8F A;  2F6G A;  1I69 A;  1WVJ A;  2DSF A;  4F1V A;  3R7X A;  4QF9 A;  2E0S A;  2B3F A;  1MRP A;  2G93 A;  2YPN A;  1ZTY A;  3CR9 A;  1B7Z A;  3FD3 A;  3MPL A;  1JEU A;  3R6U A;  3QSL A;  3RT8 A;  3LUY A;  1MM6 A;  1P1U A;  3UP9 A;  1POY 1;  2Z23 A;  5AA4 A;  3KJT A;  4C1U A;  4ISU A;  2H99 A;  4POX A;  3PUV E;  5I58 B;  1PEB A;  1LCT A;  5DYH A;  3MP6 A;  1B46 A;  3V83 A;  4ESX A;  2OWT A;  2DVC A;  2DYX A;  1URD A;  1MXU A;  1PB8 A;  4P0I A;  5TPA A;  3EHS A;  1JVY A;  4GLI A;  3HST A;  2GRV A;  4LUB A;  2ZNS A;  3H6V A;  4UAC A;  4H67 A;  4KFQ A;  3T93 B;  2HAU A;  2B3B A;  3MUQ A;  4IO6 A;  4OEU A;  1MY1 A;  4WEP A;  1B5J A;  4NF5 A;  3T9U A;  1LFH A;  4O3B A;  3IOT A;  1PB9 A;  4RJZ A;  3CIJ A;  3I5O A;  3VV5 A;  3BKI B;  3ZS6 A;  3MVX A;  3IO6 A;  3LBS A;  2Y7W A;  4L17 A;  4MFI A;  3O9P A;  1QUJ A;  4BLA A;  1IXI A;  4C0R A;  1NMU A;  2HZK A;  2Y7I A;  3UOR A;  5CC2 A;  1FTM A;  3IX1 A;  4GXA A;  3W15 C;  1SYI A;  2V25 A;  3Q26 A;  4GL0 A;  1S9T A;  3H6U A;  5CMK A;  3ZSF A;  4DXB A;  1UTB B;  2Q2A A;  2DP8 A;  3ECR A;  1Y1Z A;  4IB2 A;  1H76 A;  1LAF E;  3N6T A;  2QSX A;  3PPO A;  1FQB A;  3G3K A;  3PUY E;  4DLD A;  4GL8 A;  4G4P A;  4GFR A;  2ESN A;  2HZL A;  2O69 A;  2DOJ A;  3SEV A;  1MS7 A;  1MPB A;  1MY4 A;  4QHQ A;  5CMM A;  1TFD A;  3U72 A;  4IO7 A;  5AA2 D;  1A8F A;  4FAJ A;  2H9B A;  1EZO A;  2LAO A;  3MQ9 A;  3IOW A;  2Q9T A;  4NWD A;  5I59 B;  4JXI A;  4U1Z A;  2ONS A;  2XXI A;  3G3J A;  1FQF A;  4X9T A;  1TWY A;  2I49 A;  2DE2 A;  1M5B A;  4LVQ A;  2F7A A;  1IZ1 A;  4RA1 A;  5TP9 B;  3DP4 A;  2V93 A;  2QPQ A;  4RYA A;  5JK4 A;  4MLQ A;  1R6Z A;  1ATG A;  2V3U A;  4H65 A;  5I2K B;  1TT1 A;  4EQ9 A;  3FVK A;  1EH3 A;  2RF1 A;  2YLN A;  1HSE A;  1MQD A;  4YU0 A;  2PX1 A;  3S2V A;  3VLU A;  4EDP A;  3D4C A;  3RT6 B;  5TP9 A;  2AL5 A;  1CE2 A;  1N0T A;  1RYO A;  1ZLQ A;  3EQ1 A;  4OQO A;  3RGY A;  4OXV A;  4YKJ A;  2D3I A;  4G8H A;  4THI A;  4GOT A;  1T0K A;  1XHY A;  2DXY A;  2VHA A;  4ND9 A;  5CMC A;  3PMX A;  1HSL A;  1MH3 A;  3TTN A;  5I57 B;  3O2A A;  3I6V A;  2OBG A;  2RIN A;  3OO8 A;  4KI0 E;  2GFE A;  4R9G A;  4YIC A;  4XKR A;  2XXV A;  1A54 A;  1AL3 A;  2F35 A;  4GD5 A;  1IIT A;  3FV2 A;  3UIF A;  2DWI A;  3FXR A;  2ZNT A;  1JQF A;  3HPI A;  4PE5 B;  3OOA A;  1J1N A;  4RNS A;  1LB9 A;  4OEV A;  1URG A;  1B3F A;  5A5X B;  5FHO A;  3TTL A;  3OD7 A;  1B40 A;  3SEX A;  3DP8 A;  2VGQ A;  2OCU A;  3FJG A;  3PUX E;  3MBP A;  4OVJ A;  4F1Y A;  2XXP A;  1PBP A;  4I9D A;  1VFD A;  1I6B A;  3RTF B;  4KYE A;  1PC3 A;  3TOD A;  3K4U A;  3O97 A;  4NMY A;  3IOR A;  3M3K A;  4ELR A;  1VSO A;  2ZNU A;  3WAF A;  3KGC A;  1B5H A;  2Z8E A;  3H03 A;  3D4G A;  5H8Q B;  1UIU A;  4YB6 A;  4NWC A;  4XKQ A;  4ZDM A;  3TDJ A;  5I59 A;  4TLL B;  3FGS A;  4FE8 A;  3VDF A;  3PGF A;  3ILT B;  5TPA B;  4ZE9 A;  2QMX A;  3ZKK A;  1MQJ A;  3MAM A;  3L6G A;  1ZIU A;  1RYX A;  3PD8 A;  4JSD A;  3PMV A;  4OES A;  3T66 A;  2PYY A;  2P1S A;  2CZL A;  4QRZ A;  1Y3P A;  1MXY A;  1H43 A;  1UTB A;  3TEP A;  4TLM B;  4N6P A;  3SER A;  4XIG Q;  3TEL A;  1B9J A;  2G29 A;  5H8S A;  5HPQ A;  1XS5 A;  1Y4C A;  4PFT A;  1Y4T A;  1NNP A;  4YKP A;  4OFL A;  2THI A;  4ONY A;  2NVU B;  1TXF A;  4YAH X;  3SEU A;  3H06 B;  3HCQ A;  1BKA A;  1JW4 A;  3BFU A;  3JYR A;  3O6I A;  1B3G A;  3SES A;  3TAJ A;  4G8M A;  4YMB A;  2I4B A;  4NF5 B;  1ANF A;  2XX7 A;  3H3G A;  3H4Z A;  1OIB A;  3K6W A;  4ZEB A;  4QFN A;  3ZKL A;  2HAV A;  4IO3 A;  3LSW A;  4P11 A;  3EF7 A;  5L8D A;  5I56 A;  2H5Y A;  2YJP A;  4QSD A;  3GBA A;  1FTO A;  4I1D A;  2HQ0 A;  3QUF A;  2PT2 A;  2ZYK A;  2Q2C A;  3U93 A;  4G68 C;  4N13 A;  1P1Q A;  1LBC A;  1N76 A;  3LSL A;  3OEK A;  4POW A;  4F3P A;  1MG1 A;  1TFA A;  2O1M A;  4M1V A;  1GVC A;  5AA3 A;  2UVJ A;  3HO7 A;  1RKM A;  5DTB A;  4U21 A;  1LFG A;  3VFJ A;  4ELQ A;  3UN6 A;  2XXT A;  1IXC A;  2RC9 A;  3OEM A;  4ECF A;  3FAS A;  1ZU0 A;  3L6H A;  2CMO A;  3O28 A;  2DQV A;  3AXF A;  4EF1 A;  1AMF A;  1VE4 A;  2XXW A;  3F11 A;  1S7Y A;  1SW2 A;  1P1O A;  1QW0 A;  4OMB A;  4I8C A;  4JWY A;  1R9Q A;  3O6G A;  2O1L A;  4IGT A;  3OXN A;  3CRB A;  4Q5T A;  3VVF A;  2DS9 A;  1IXH A;  2V84 A;  3UA8 A;  4QFL A;  3S9E A;  4U1O A;  2NUV A;  4KPT A;  3UGW A;  2F34 A;  3MVY A;  3O66 A;  3KOT A;  4EQ7 A;  1MY0 A;  4FOR A;  4M4G A;  4NF4 B;  4GIZ A;  1N84 A;  1FCK A;  3ONM A;  4HTG A;  4U23 A;  4RPO A;  3DEL B;  2DVZ A;  2PBW A;  2P0S A;  1N7X A;  3KEI A;  2M8C A;  3OEN A;  1JET A;  3USD A;  2UYF A;  5CRY A;  3TMG A;  4YMA A;  3IOV A;  1FTK A;  1POT A;  2QS3 A;  5AE4 A;  3H7M A;  2KLF A;  4OTE A;  1B1H A;  5I2K A;  3TKD A;  3H6T A;  3CFX A;  3IB2 A;  3S4U A;  2O51 A;  3A09 A;  1A55 A;  1SDX A;  2ANJ A;  4JB7 A;  1YCJ A;  4H8I A;  5CI5 A;  5L9S A;  4G68 A;  2R9J A;  3E9X A;  1GR2 A;  1UQW A;  2QS4 A;  2RC8 A;  5KCJ B;  3RPW A;  1OLC A;  3HN0 A;  3IO4 A;  1US5 A;  4RK9 A;  1M5F A;  3C4M A;  1JW5 A;  5F1Q A;  3RNN A;  4FEC A;  3OO9 A;  4GVO A;  4OWD A;  1SBP A;  2E1S A;  5I2N A;  3E4R A;  5H8N A;  4DXU A;  3K1M A;  3IL1 B;  2I0B A;  3W9W A;  2VD2 A;  1IUD A;  1A8E A;  2V3Q A;  1N3X A;  2OK2 A;  3EHU A;  5CM6 A;  1D3K A;  1D9V A;  1MQG A;  2B65 A;  2H25 A;  3TCH A;  3MP1 A;  4R9F A;  5EHM A;  3T9H B;  3VLW A;  1KWH A;  4FED A;  4YKK A;  2NWJ A;  3Q28 A;  2QS2 A;  3RLF E;  1MXX A;  3FXQ A;  3T22 A;  2VP1 A;  2WKY A;  4HW8 A;  5KZT A;  3FVO A;  1B7U A;  3FAT A;  4F39 A;  4F18 A;  5DT6 A;  1SW1 A;  3ILU B;  2I3V A;  3FVN A;  1O7T A;  4IO4 A;  4NE4 A;  4GXS B;  3DLN A;  1PDA A;  3S9N C;  2D21 A;  5ICT A;  1SI0 A;  2PT1 A;  2UXA A;  4MF3 A;  2X26 A;  3IR1 A;  4H6D A;  5K2Y A;  3TZA A;  1JNF A;  2XD2 A;  1SW4 A;  4IY5 A;  3A3U A;  4MBP A;  2F36 A;  3CFZ A;  3TQL A;  1NNK A;  4PQJ A;  4ELP A;  3K02 A;  4TOZ A;  2QL3 A;  4F2Q A;  5BWJ A;  4H5F A;  4Q8R A;  1Y3N A;  4ZEK A;  2I4C A;  3K1P A;  4G68 B;  4JBZ A;  2XXH A;  3RQT A;  3MW0 A;  2Q89 A;  4R2F A;  2GHB A;  4U22 A;  3RN8 A;  2QJE A;  2Z8F A;  3MJN A;  3OO6 A;  3C35 A;  1WDN A;  1OVT A;  4H5G A;  4DCX A;  3MVW A;  3S9L C;  5AA1 A;  3C9H A;  3FJ7 A;  4GQO A;  4UA8 A;  4RY1 A;  1QUK A;  2I0C A;  1NH7 A;  5B70 A;  5ICQ A;  1UIV A;  5IAI A;  4U4S A;  3RTW B;  2UVG A;  4YB7 A;  3VLV A;  3K2D A;  1EZ9 A;  1ZMG A;  2UVH A;  1LAH E;  3A3C A;  3K6V A;  2A5T A;  1S50 A;  4NF8 A;  1QUL A;  2HFB A;  1P99 A;  1QKB A;  3G3G A;  3OO7 A;  1B0H A;  1BLF A;  4U4X A;  5M2V A;  3CSG A;  3SEY A;  4P0G A;  4LP2 B;  3CG3 A;  1MH4 A;  1QJM A;  2X7Q A;  3C34 A;  4QSE A;  3KG2 A;  2RC7 A;  4FIM A;  3SDF A;  1XVX A;  3IB0 A;  1DSN A;  4EF2 A;  4ZED A;  1A7L A;  4F3B A;  2XXX A;  5HM4 B;  4ZS9 A;  3FXU A;  4KYD A;  3VXC A;  4WKM A;  1B05 A;  1D9Y A;  2HXW A;  4N07 A;  3SET A;  5I57 A;  2Y7R A;  3V89 B;  4OET A;  1M5D A;  1OQH A;  2ZYM A;  3JZJ A;  4Q0C A;  4QSC A;  4NF6 A;  3M3L A;  2REG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...