1GVCA

18kda n-ii domain fragment of duck ovotransferrin + nta
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
SYYAVAVVKKGTDFMIKDLRGKTSCHTGLGRSAGWNIPIGTLIHRGDIEWEGIESGSVEQAVAKFFSASCVPGATTEQKLCRQCKGDAKTKCLRNAPYSGYSGAFQCLKDGKGDVAFVKHTTVQENAPEEKDEYELLCLDGTRQPVDSYKTCNWARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron transport
molecule keywords OVOTRANSFERRIN
publication title The Mechanism of Iron Uptake by Transferrins: The X-Ray Structures of the 18 kDa Nii Domain Fragment of Duck Ovotransferrin and its Nitrilotriacetate Complex
pubmed doi rcsb
total genus 43
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2002-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1gvcA00
1MPDA 5ISUA 1MQDA 3PUVE 4YKIA 4ZS9A 4F31B 4IGRA 3FV1A 1JVXA 2UYEA 3MP6A 3H3GA 4DCYA 2O1LA 4PETA 3JYRA 4JB7A 1USYE 4YB6A 1FQBA 1PDAA 2I0CA 1MDP1 3I6VA 3FATA 3S2VA 5TP9B 1NNKA 2FYIA 1RYXA 3LSXA 2PYYA 3W9WA 1N3XA 3O97A 4TLLB 4RPNA 3IJOB 3FVNA 1I6AA 2XXIA 3FVGA 1Y4CA 4BDQA 4N6PA 3H6UA 2VHAA 2H25A 2W7YA 4FATA 4OERA 1NNPA 3KZGA 1R6ZA 3U94A 3IB2A 2OK2A 3MC2A 3CIJA 3S9MC 1B5JA 3RLFE 4TQUQ 1I6BA 1MH3A 2Y84A 2P2AA 4R72A 3EQ1A 3BFTA 1URGA 5AA4A 3KSXA 4OFLA 3V89B 3OEKA 1L5TA 5ICQA 5EYFA 4IO4A 2H4IA 4C1TA 3UP9A 1DMBA 1N3WA 5HPQA 4IGTA 4ESWA 3TQWA 5H8HA 4H65A 4F1UA 2Z8FA 5L9OA 1MM7A 4U1ZA 4JWXA 1JEVA 2I48A 4QRZA 2QMXA 3EHUA 1A7LA 3TTKA 2QS4A 2B3FA 2VP1A 2DQVA 2HEUA 1B9JA 4O3CA 2O69A 3OO6A 3KN3A 2O84X 2F36A 2RKMA 4NEDA 4QFNA 1P1QA 3LR1A 4GQOA 1FTKA 4OHNA 3KOTA 3K1PA 2G93A 2ONSA 3TODA 4G68A 5I84A 4KCCA 3K1NA 4ELPA 2DWJA 4JDFA 2RC8A 3G3FA 1D9YA 1B3FA 1VE4A 3F11A 2UYFA 3VLVA 3MWBA 1QUJA 3PPPA 3C36A 4F3SA 4ZEBA 3SEYA 4U4XA 1A8EA 4G2ZA 4EQ7A 1OLAA 1A55A 1LGBC 3T93B 3VDFA 2H98A 4ZECA 4GL8A 1WODA 2UVHA 4RY1A 2G29A 1TT1A 1EZ9A 4FECA 1ZJLA 5FTIA 1CB6A 2P1SA 1IXIA 3C34A 3IOTA 4YMBA 2XD3A 4QSEA 3U1OA 2QPQA 3OO7A 3TTRA 3I3VA 3TCGA 3TYHA 2XXUA 3CRBA 5H8NB 1NMUA 3R6UA 2I4BA 1B7UA 3VVFA 4ESXA 4MLQA 1CE2A 3C32A 1MXVA 4F2OA 1TWYA 4BDOA 3O6HA 1KWHA 5IAIA 4U4SA 2F8DA 4JSOA 1MPCA 4M4GA 2QSXA 2NUVA 5DT6A 2QRYA 1SBPA 3EPEA 3TDJA 3CFLA 4POWA 3G3GA 2BJJX 3MAMA 2GH9A 1MXZA 4R74A 2HFBA 5I2NB 2DE4A 3EHTA 4FEBA 4H8IA 5KDTA 1MDQA 3A3UA 4NWCA 1OQHA 4WEPA 3ODBA 1SDXA 1B1HA 2QMWA 4NF8B 4NTLA 3OO8A 2R71A 1R9QA 4PQJA 1MQHA 2FA7A 4JXIA 1ZTYA 2HAUA 1JW1A 1II5A 2QJEA 3H6TA 4RJZA 1I69A 1AIVA 2NOOA 3O6IA 4XXUA 1D4NA 4RPOA 5BUUA 4ZEIA 1B4ZA 2OJTA 1FW0A 1O63A 4DXBA 3CFXA 4IO5A 2DS9A 2XHDA 2ZXTA 4LUBA 4FJPA 3E3KA 3N5LA 2B65A 3KFMA 3E9XA 3DM0A 4EXKA 4NF5B 2KLFA 3KN7A 3FXUA 5I59A 4DXUA 1MRPA 5J1DA 2NXOA 4NWDA 2HXWA 1RKMA 2HCAA 4YB5A 3UGWA 5L8DA 1Y3QA 4ZEFA 5CM6A 3U8QA 1PB7A 4QSCA 1UQWA 3MVZA 1P1OA 4DLDA 4XKRA 2FNCA 4OETA 1LB9A 3T9XB 4ZE9A 4KYSA 4TOZA 3IOWA 4F1YA 3QK6A 1SVXB 1B6HA 1XHYA 1FTOA 4KQPA 2H5YA 1B3HA 3PMXA 4KYDA 3TTNA 4XKNA 4LQ2A 4F3PA 4R73A 5I56A 3C35A 3DELB 4O3BA 1B3GA 4R75A 5EHSA 5DEXA 3V83A 2XX7A 4YAHX 5CMBA 1UTBA 3UIFA 2V93A 3TKDA 3FASA 4GVOA 4R9GA 2XX9A 3I5OA 5I2KA 1B4HA 5KCJB 3UN6A 3N94A 1B52A 2F7AA 1P1UA 2ESNA 4U2RA 3ILTB 3ZKKA 3HHGA 3KOSA 2F6GA 1LSTA 5CC2A 3Q27A 1N84A 1YCJA 4OEVA 3TCHA 4K3FA 4F22A 1PBQA 3FJ7A 3D4CA 4KFQA 3TEPA 1LCFA 5JK4A 1Y1MA 2NWJA 1B05A 1TFDA 2ZNSA 4U23A 3RQTA 4OZ9A 5M2VA 2GHBA 2OCUA 3CFZA 1PB8A 2NVUB 4OFJA 4X1DA 4YB7A 3G3KA 2O7IA 5LOMA 4EUOA 1IXCA 3O6GA 1BLFA 3MZ9A 1FQCA 2XXWA 1LFIA 4Z7EA 3B6WA 3K6XA 3MJNA 1F9BA 1B51A 3C31A 4F39A 4I9DA 5H8QA 5CRYA 5AA4B 3T96B 5I58A 1N7WA 2Y7WA 5AA2D 3PUYE 1IEJA 4IO3A 1MXYA 1ZLQA 2AYSA 2ONRA 2VGQA 2DWHA 1B3EA 2D21A 5TPAA 4WXJA 3ZSFA 5H8HB 1BTJA 3O28A 4UACA 1IXHA 2I3WA 1ATGA 3IX1A 3VXBA 2O1MA 3HSTA 1QW0A 2LAOA 3SEWA 2D5WA 4R6HA 4YKJA 2REJA 5IKBA 3G3IA 1M5FA 4MF3A 4EDPA 3P7IA 2F34A 1IIWA 4IO6A 3T9HB 1UTHA 1LB8A 2YLNA 2Y7PA 4NF4A 3H7MA 3SEVA 1NNTA 3KG2A 1JW4A 3OENA 1UIUA 4G68B 1PEBA 3UA8A 2ZMBA 4LZ7A 3GBAA 1H3DA 4RK2A 2H99A 1RYOA 4ISUA 4HW8A 3MP8A 1SYIA 3ECRA 1DTZA 1N76A 2REGA 2IA4A 4H5GA 2AL4A 1TFAA 2IEEA 5FHNA 1N04A 1VFEA 2QS2A 4E0XA 4HS7A 3C33A 3IOVA 1WDNA 4JSDA 2UXAA 3RT6B 4QSDA 4DZ1A 4RYAA 4NF6A 1S9TA 3SERA 2E1SA 4GL0A 1HSJA 4KHZE 2I58A 5B70A 1Y9UA 2B3BA 2RCBA 4PFTA 1VR5A 1B5IA 4PP0A 1QKBA 1S50A 3KSJA 2F7CA 1B3LA 2ALUA 3H6VA 2A5TA 1MY2A 3T66A 4BDRA 4R2BA 4QFLA 3TZAA 3GXAA 1GTKA 2PT2A 3O9PA 4H67A 1FQDA 4QF9A 3K6VA 2DVZA 3IO6A 3DP6A 2Z8DA 3FD3A 2Y7RA 3K2DA 4F19A 5K2XA 3H4ZA 1JW5A 1HSLA 4ND9A 1US4A 2O68A 2QL3A 1VSOA 4P11A 5ICTA 5BWJA 1YTVA 5CMMA 4H1XA 5DVJA 3EHSA 3VFJA 5AA3A 4F18A 2GRVA 3MPLA 5F1QA 2RF1A 1JVYA 3R7XA 1SW1A 5AA1A 1ANFA 4WKMA 1Z7ME 2Q8JA 4PE5B 4F3BA 4BLAA 3CSBA 5HM4B 5KDTB 4R6YA 1B2HA 1B5HA 2THIA 2Y7IA 1LLSA 4OMBA 3G7WA 2I0BA 3CSGA 4Q8RA 5ITOA 1SQYA 1MXUA 1URDA 2I4CA 3DP4A 1FTMA 5K2YA 3SEXA 4O3AA 4PFWA 1USYH 2X26A 1SI1A 5L9SA 3KEIA 1XVXA 3VE1B 1O7TA 2HAVA 1FQFA 3L6HA 1VFDA 5CBRA 4OQOA 3PV0E 2Q2CA 2D3IA 5F7VA 1B58A 2RINA 2F35A 1EU8A 4DXCA 5JTYA 2F97A 1ZIUA 3MW0A 3Q25A 3PGFA 3H6WA 5I59B 2XD2A 4RXLA 1H44A 1MQGA 2Z8EA 1NKXA 3TCFA 3MZBA 1NH7A 1ZMGA 1LAFE 4OXVA 4LONB 2VD2A 4FEDA 5A5XA 1US5A 1J1NA 4LA9A 3H03A 2RC7A 3PUXE 4ZEKA 1SD3A 3FXRA 3M8UA 4QHQA 4ONYA 3K1MA 1LBCA 4IO2A 3GZGA 5KZTA 2XXXA 3Q26A 4I62A 2RC9A 1XVYA 1Q35A 5ELVA 4AB6A 1M5DA 4R6KA 2OZZA 3T22A 3IK6B 3UORA 3BKIB 3VXCA 2DVCA 1I6QA 5I56B 4FORA 2OWSA 1H76A 1A8FA 4BDMA 5DEXB 1UTBB 1H43A 1SYHA 3OSQA 3OELA 1DPEA 5DVIA 1O64A 3V5AA 2YPNA 4AB5A 3MQ9A 4AQ4A 5I2KB 4TLMB 1POTA 4R2FA 2XXVA 3FVKA 3TMGA 1SW2A 3MVWA 3IB1A 3PPRA 4HCWA 3LBSA 2DP8A 3OSRA 3IOUA 5FHOA 4C1UA 4F2QA 5I57A 2E0SA 2ZYNA 2Q89A 4OTEA 4LZ5A 4XTCQ 3CG1A 3N26A 3M3FA 4MH5A 1XT8A 1XS5A 4Z0IA 5JEIA 3G3HA 4G8NA 1LAXA 1R1NA 3B7DA 2ABHA 2OWTA 3Q28A 2YJPA 2HZKA 3V8XB 1POY1 1ZKBA 1D9VA 1GVCA 4KI0E 1URSA 1B0LA 1MM6A 4G8MA 1FTJA 3RGYA 1Q1KA 1B0HA 5DTBA 1OIBA 5DYHA 4H5FA 3K6WA 2P0SA 3HCQA 3D4GA 3RPWA 5H8QB 3KJ7A 4H0WA 1N7XA 5AA2B 1IQ7A 4P0GA 3M3KA 3R26A 5I58B 4EQBA 3PMVA 2ZYMA 1TXFA 1QJMA 1AH5A 3RUMA 3EF7A 4QFPA 5TPAB 4XKQA 3TUSA 2XXRA 4EF1A 1A54A 1B1XA 4F3GA 3K0VA 4BDNA 4N13A 5CMKA 4X9TA 2Z23A 1P1NA 3MVYA 3S9EA 3CI8A 4OENA 3QAXA 3K01A 4EQ9A 4NE4A 1A40A 4HTGA 3RTFB 1JEUA 1UTHB 2DYXA 1LAHE 5H8FA 4ZZEA 4NF4B 2UVIA 3B6TA 3U72A 3K4UA 5CI5A 4GF8A 3VVEA 3DLNA 4H8JA 4THIA 3K00A 2PMSA 4XIGQ 4JWOA 5AA2A 2CMOA 4LQ5A 1M5CA 3GLBA 1MG1A 1JETA 3IR1A 3IAZA 3DP8A 3SDFA 3RT8A 1N0TA 1BP5A 3C9HA 3UK4A 4NF6B 3WAEA 2DOJA 4X48A 1PBPA 2XXPA 2M8CA 4FIMA 3LC8A 3FXQA 2DE3A 4HCYA 4G68C 4I8CA 4GIZA 3N6UA 1MY3A 3PD9A 4KR5A 1MXXA 2V84A 1P1WA 2ANJA 3PMWA 4YU0A 3VV5A 1LAGE 4G8HA 2Q88A 2A5TB 3IB0A 4DE8A 2Y7KA 4KPTA 3PPQA 4U21A 1S7YA 1SW4A 1P99A 3FJMA 1ZBMA 3U92A 2DE2A 3MVXA 3C4MA 3HO7A 1MPBA 3MZ1A 1ELJA 4PFYA 4YKPA 2CZLA 1A99A 3S9LC 1MY1A 4GOTA 3O2AA 3E13X 3ZS6A 1MH4A 3USDA 1EZOA 4BDLA 3ILUB 3FJGA 2WKYA 4GD5A 2R6GE 5TP9A 3AXFA 3MUQA 3TFLA 2ZYKA 1MS7A 4LZ8A 1B7HA 3IORA 1QUKA 5L9MA 4ELRA 4QFKA 5FTHA 1OMPA 3TTMA 1M5BA 3QYTA 1YAEA 3QSLA 4GFRA 2AIXA 5EHMA 3SETA 3MBPA 2X7PA 1QULA 2QS3A 3H06B 4QFOA 1QUIA 3KN8A 2DXRA 2DXYA 1H45A 3W9VA 3VVDA 4P0IA 4ZDMA 3E4RA 1Y1ZA 4GXSB 4GLIA 1FQAA 4E0WA 4MLVA 1LBBA 3RN8A 2GHAA 2XXQA 3A09A 2O7UA 1OVTA 3HV1A 3OXNA 4GXAA 1GV8A 4RK9A 1GR2A 5B7DA 2H9BA 4FE8A 5JTYB 2UVJA 3FV2A 4U22A 4ZEDA 5H8SA 4OFOA 1MY0A 2ZYOA 4UA8A 1HSEA 2I6EA 5CBSA 1DSNA 3VLWA 4FAJA 2Q2AA 5CMCA 4N07A 1LFGA 3Q29A 2F5XA 1OQGA 3PU5A 1B32A 2GFEA 4XKPA 5FHMA 3ONMA 1GGGA 5A5XB 3N6TA 1IITA 2XXTA 3CG3A 2R9JA 3PD8A 3SKPA 3RNNA 2PBWA 1LFHA 2DWAA 3O66A 3L6GA 4M1VA 2PX1A 3IL1B 1Y3NA 2I49A 3K6UA 1XC1A 3S9NC 3MPKA 5AE4A 4MBPA 2Q9TA 4MFIA 1QKAA 3OEMA 3TQLA 1B40A 2Z22A 2OBGA 2V25A 1DOTA 1WVJA 1MQJA 1NH8A 3FUZA 3KBRA 3W15C 3LUYA 4F29A 1LCTA 4IY5A 3B6QA 3SESA 3OMBA 1R9LA 2XXYA 3S4UA 2V3TA 4RA1A 4PFUA 3OD7A 4OYVA 3IO4A 3IJXB 4L17A 4YMAA 3QUJA 2ZNUA 3FZVA 3GBBA 3PPNA 3BFUA 3MP1A 4JWYA 3LSLA 4POXA 5I57B 3LSFB 2PVUA 2DSFA 1IZ1A 5H8NA 2AL5A 3HPIA 3TAJA 2VOZA 1NNFA 1FQEA 4Q0CA 1B46A 3KJTA 3ZKLA 4ECFA 4LVQA 1AL3A 4KCDA 3RTWB 1NFTA 3A3CA 1EH3A 4NMYA 1BIYA 4Q30B 1NL5A 4WEDA 4F1VA 4OESA 4GWOA 4IB2A 1T0KA 4IY6A 1ZU0A 2F78A 3WAFA 5DVFA 4ZE8A 1FCKA 5TU0A 3LSWA 3QIMA 3QXMA 4C0RA 3TELA 1BKAA 3FIRA 5I2NA 2VD3A 4OEUA 3JZJA 1MXWA 3EN3A 3BBRA 4YICA 4NF8A 4G77A 1JNFA 2A5SA 2O6AA 1FTLA 1MQIA 3FGSA 1OVBA 1D3KA 3T9VA 2ZNTA 4RNSA 1B7ZA 5ITPA 1EZPA 1IXGA 2XXHA 4YZZA 2DWIA 3OO9A 3CVGA 1AOVA 4DIGA 4EXLA 1DPPA 4KYEA 3SEUA 2F6PA 4LP2B 1OLCA 3G3JA 2HQ0A 4Q5TA 3M3LA 4ELQA 4NF5A 5HBCA 3O29A 3TTLA 1QVSA 1DTGA 5H8FB 4U1OA 1UIVA 4OWDA 1PC3A 2X7QA 1AMFA 1MY4A 3KGCA 1PB9A 2I3VA 4DCXA 4H6DA 3QUFA 3TPAA 1JQFA 3CR9A 1SW5A 1Y20A 2F7BA 4LATA 3T9UA 3THIA 1Y4TA 3RY3A 2V3UA 3VLUA 2HZLA 3PUWE 3U93A 4G4PA 2QS1A 2V3QA 3FVOA 1SI0A 1Y3PA 1YPNA 3PPOA 3K02A 1M5EA 4JBZA 2UVGA 1IUDA 4EF2A 4DDDA 2XX8A 2O51A 4OVJA 1Z7NE 3HN0A 2ONKE 4GRKA 4X1BA 2OLBA 4KD5A 4IO7A 4YKKA 2RCAA 3HHFA 4ELOA 4I1DA 1XOCA 3JV9A 4ZZAA 2PT1A 4R9FA 5KCJA 3OOAA 3PUZE
chains in the Genus database with same CATH superfamily
1MPDA 2XWKA 5ISUA 2HXRA 1MQDA 3PUVE 4YKIA 4ZS9A 1LBYA 4F31B 5A5LA 1JP4A 4IGRA 3FV1A 1JVXA 2UYEA 3MP6A 4PAKA 3E79A 3H3GA 4DCYA 2O1LA 4PETA 3JYRA 4JB7A 4MMPA 1USYE 4YB6A 4N17A 1FQBA 4GWSA 1PDAA 1FBEA 2I0CA 1NI9A 1MDP1 3I6VA 2XA5A 3FATA 3LUZA 3S2VA 5TP9B 1NNKA 2FYIA 1RYXA 3LSXA 2PYYA 3W9WA 1N3XA 3O97A 4TLLB 4RPNA 3IJOB 3FVNA 4XFEA 1I6AA 2XXIA 3FVGA 1Y4CA 4BDQA 4N6PA 3H6UA 4NHBA 2VHAA 2H25A 5ET7A 2W7YA 4FATA 4OERA 1NNPA 3KZGA 3MYUA 1R6ZA 3U94A 3IB2A 2OK2A 4NG7A 3MC2A 3CIJA 3S9MC 1B5JA 3RLFE 4TQUQ 4X04A 1I6BA 2XWIA 1MH3A 2Y84A 4P47A 2BJIA 2P2AA 4R72A 3EQ1A 3BFTA 1URGA 5AA4A 1INPA 3KSXA 4OFLA 3V89B 3OEKA 1L5TA 5ICQA 5EYFA 1FSAA 4IO4A 1FPDA 2H4IA 4C1TA 3UP9A 1DMBA 1N3WA 5HPQA 4IGTA 4ESWA 3TQWA 4PTKA 5H8HA 4H65A 1FBPA 4F1UA 2Z8FA 4MEVA 5L9OA 1MM7A 4U1ZA 4JWXA 1JEVA 2I48A 4QRZA 2QMXA 3EHUA 1A7LA 3TTKA 2QS4A 2B3FA 2VP1A 2DQVA 2HEUA 1B9JA 4O3CA 2O69A 3OO6A 2L5VA 1YXIA 3KN3A 2O84X 2F36A 2RKMA 4NEDA 4QFNA 1P1QA 3LR1A 4GQOA 4QBAA 1FTKA 4OHNA 4PCDA 3KOTA 3K1PA 2G93A 2ONSA 3TODA 4G68A 5I84A 4KCCA 3K1NA 1LBZA 4ELPA 2DWJA 4JDFA 2RC8A 3G3FA 1D9YA 1B3FA 2FHYA 1VE4A 3F11A 4LN5A 2UYFA 3HFUA 3VLVA 3MWBA 1QUJA 3PPPA 3C36A 4F3SA 4ZEBA 5FBPA 3SEYA 4PDHA 4U4XA 1A8EA 4G2ZA 4EQ7A 1NUWA 1OLAA 1A55A 1LGBC 5IM2A 3T93B 3VDFA 2H98A 4ZECA 4GL8A 1WODA 1XI6A 2UVHA 4RY1A 2G29A 1TT1A 1EZ9A 4FECA 1ZJLA 5FTIA 1CB6A 2P1SA 1IXIA 3C34A 3IOTA 4YMBA 2XD3A 4QSEA 3U1OA 2QPQA 3OO7A 3TTRA 3I3VA 3RPLA 5EQ7A 3TCGA 3TYHA 4P1EA 5EYHA 2XXUA 3CRBA 3KBZA 5H8NB 1NMUA 3R6UA 2I4BA 1B7UA 3VVFA 4ESXA 4MLQA 1CE2A 3C32A 1MXVA 4F2OA 1TWYA 4BDOA 3O6HA 1KWHA 5IAIA 4U4SA 2F8DA 4JSOA 1MPCA 4M4GA 2QSXA 4JVIA 3T0JA 2NUVA 5DT6A 2QRYA 1SBPA 3EPEA 1AWBA 3TDJA 3CFLA 4POWA 3G3GA 2BJJX 3MAMA 2GH9A 4GX3A 1MXZA 4R74A 2HFBA 5I2NB 2DE4A 3EKIA 3EHTA 4FEBA 4H8IA 5KDTA 4XEQA 4GX4A 1MDQA 3A3UA 1CNQA 4PF8A 4NWCA 1OQHA 4WEPA 3ODBA 1SDXA 1IMAA 1B1HA 2QMWA 4NF8B 4HE1A 2CEXA 4NTLA 3OO8A 2R71A 1R9QA 4PQJA 1MQHA 2FA7A 4JXIA 1ZTYA 1NUZA 2HAUA 1JW1A 2VPOA 1II5A 2QJEA 3H6TA 5IZ3A 4RJZA 1I69A 3ROJA 1AIVA 2NOOA 3O6IA 4JVDA 4XXUA 1D4NA 4RPOA 5BUUA 3LV0A 4ZEIA 1B4ZA 2OJTA 2WBDA 1FW0A 1O63A 4DXBA 3CFXA 4IO5A 2F3DA 2DS9A 2XHDA 2ZXTA 4LUBA 4FJPA 3E3KA 4MNIA 3N5LA 4H45A 2XWVA 2B65A 3KFMA 4NQ8A 3E9XA 3DM0A 4EXKA 2Y5KA 4NF5B 2KLFA 3KN7A 3FXUA 5I59A 4DXUA 1MRPA 5J1DA 2NXOA 2Q74A 4NWDA 2HXWA 1RKMA 4MIJA 2HCAA 4YB5A 3UGWA 5L8DA 2WBBA 1Y3QA 2CZIA 4ZEFA 5CM6A 3U8QA 1PB7A 4QSCA 1UQWA 3MVZA 1P1OA 4DLDA 4XKRA 2FNCA 4N6DA 4OETA 1LB9A 3T9XB 4ZE9A 4KYSA 4TOZA 3IOWA 4F1YA 3QK6A 1SVXB 1B6HA 1XHYA 1FJ9A 1FTOA 4KQPA 1DCUA 2H5YA 1B3HA 3PMXA 4KYDA 3TTNA 4XKNA 3ISPA 4LQ2A 4F3PA 4R73A 4P56A 5I56A 3C35A 3DELB 4O3BA 1B3GA 4R75A 5EHSA 5DEXA 3V83A 2XX7A 4YAHX 5CMBA 1UTBA 3UIFA 2V93A 3TKDA 3FASA 4GVOA 4R9GA 3IFAA 2XX9A 3I5OA 5I2KA 1B4HA 5KCJB 3UN6A 3N94A 1B52A 1RDZA 2F7AA 1P1UA 2ESNA 4U2RA 3ILTB 4N81A 3HHGA 3ZKKA 3KOSA 2F6GA 1LSTA 5CC2A 3Q27A 1N84A 1YCJA 4OEVA 3TCHA 4K3FA 4F22A 1PBQA 3FJ7A 3D4CA 4AS5A 4P1LA 4KFQA 3TEPA 1LCFA 5JK4A 1Y1MA 2NWJA 4PAFA 1B05A 1TFDA 2ZNSA 4U23A 3RQTA 4OZ9A 5M2VA 1NV5A 2GHBA 2OCUA 3CFZA 4MAGA 1PB8A 2V4CA 2MKZA 1LBWA 5I3SA 2NVUB 4NN3A 4OFJA 4OVPA 4X1DA 4DI3D 4YB7A 1K9ZA 3G3KA 2O7IA 5LOMA 4EUOA 1IXCA 3O6GA 1EYJA 1BLFA 3MZ9A 1FQCA 2XXWA 1FPKA 1LFIA 1FPJA 4Z7EA 3B6WA 2HPGA 3K6XA 3MJNA 1F9BA 1B51A 3C31A 4F39A 4I9DA 4X8RA 2GQ1A 5H8QA 1FPFA 3PTYA 5CRYA 5AA4B 3T96B 4P9KA 5I58A 1N7WA 1KA0A 2Y7WA 5AA2D 3PUYE 1IEJA 4IO3A 1MXYA 1ZLQA 2AYSA 2ONRA 2VGQA 2DWHA 1B3EA 2D21A 5TPAA 4WXJA 3ZSFA 5H8HB 1BTJA 1DK4A 3O28A 4UACA 1IXHA 2I3WA 1ATGA 3IX1A 3VXBA 2O1MA 3HSTA 1QW0A 2LAOA 3SEWA 2D5WA 4R6HA 3GYYA 4YKJA 2REJA 4GBVA 5IKBA 3G3IA 1M5FA 4MF3A 4EDPA 3P7IA 2F34A 2DDKA 1IIWA 4N4UA 4IO6A 3T9HB 4HE0A 1UTHA 1LB8A 2YLNA 2Y7PA 4NF4A 3H7MA 3SEVA 1NNTA 5EQAA 3KG2A 1JW4A 3OENA 1UIUA 4G68B 1PEBA 4MX6A 3UA8A 2ZMBA 4LZ7A 3KC1A 3GBAA 1H3DA 4RK2A 2H99A 1RYOA 4ISUA 4HW8A 3MP8A 1SYIA 3ECRA 1DTZA 1N76A 2REGA 2IA4A 4H5GA 2AL4A 1TFAA 4O7IA 2IEEA 5FHNA 1N04A 1VFEA 3B8BA 2QS2A 2QVUA 4E0XA 4HS7A 3C33A 3IOVA 1WDNA 4JSDA 2UXAA 3RT6B 3BIGA 4QSDA 4DZ1A 4RYAA 4NF6A 1S9TA 3SERA 2E1SA 4GL0A 1HSJA 4KHZE 2I58A 5B70A 1Y9UA 4AS4A 2B3BA 2RCBA 4PFTA 2KQZA 1VR5A 1B5IA 4PP0A 1QKBA 1S50A 1NV7A 3KSJA 2F7CA 4MNCA 1B3LA 2ALUA 4GX6A 3RPLB 3H6VA 2A5TA 1MY2A 3T66A 4BDRA 4R2BA 4QFLA 4I3EA 3TZAA 3GXAA 1GTKA 2PT2A 3O9PA 4H67A 4G61A 1FQDA 4QF9A 1KA1A 3K6VA 2DVZA 3IO6A 3DP6A 2Z8DA 1NV4A 3FD3A 4PFRA 2Y7RA 3K2DA 4F19A 5K2XA 3H4ZA 1JW5A 4O7MA 1HSLA 4ND9A 1US4A 2O68A 2QL3A 1VSOA 4P11A 5ICTA 4HXVA 5BWJA 2PFZA 1YTVA 5CMMA 4H1XA 5DVJA 3EHSA 3VFJA 5AA3A 4F18A 2PFYA 1LBXA 2GRVA 3MPLA 5F1QA 2RF1A 1JVYA 5AA1A 1SW1A 3R7XA 1ANFA 1FPBA 2OWZA 4WKMA 5ET6A 1Z7ME 2Q8JA 4PE5B 4F3BA 4BLAA 4NX1A 3CSBA 5HM4B 5KDTB 4R6YA 1B2HA 1B5HA 5T3JA 1DBZA 2THIA 2Y7IA 1LLSA 1EYKA 4OMBA 3G7WA 2I0BA 3CSGA 4Q8RA 5ITOA 1SQYA 1MXUA 1URDA 2I4CA 3DP4A 1FTMA 5K2YA 2FIEA 2QVVA 3SEXA 5LDZA 5IZ3B 4O3AA 4PFWA 1USYH 2X26A 1SI1A 5L9SA 3KEIA 4N91A 1XVXA 2R8TA 1SPIA 3VE1B 2CZHA 1NV0A 1O7TA 2HAVA 1FQFA 3L6HA 1VFDA 1LEVA 4OQOA 5CBRA 3PV0E 2Q2CA 2D3IA 5F7VA 2QVRA 1FBDA 1B58A 2Y5LA 2RINA 2F35A 1EU8A 4DXCA 5JTYA 1IMBA 2F97A 1ZIUA 4NAPA 5EQ8A 2QFLA 3MW0A 3Q25A 3PGFA 3H6WA 5I59B 2XD2A 4RXLA 1H44A 1MQGA 2Z8EA 1NKXA 2XXKA 3TCFA 3MZBA 1NH7A 2ZZXA 1ZMGA 1LAFE 4OXVA 4LONB 2VD2A 4FEDA 5A5XA 1US5A 1J1NA 4LA9A 1YZ0A 3H03A 2RC7A 4GWZA 3PUXE 4ZEKA 1SD3A 3FXRA 3M8UA 4QHQA 4ONYA 3K1MA 1LBCA 2KR0A 4IO2A 3GZGA 5KZTA 4PE3A 2XXXA 3Q26A 4PGNA 4I62A 2RC9A 1XVYA 1Q35A 5ELVA 4AB6A 1M5DA 4R6KA 2OZZA 3T22A 3IK6B 3UORA 3BKIB 3VXCA 4GWUA 2DVCA 1I6QA 5I56B 4FORA 2OWSA 1H76A 1A8FA 4BDMA 5DEXB 4DI4B 1UTBB 1H43A 1SYHA 3OSQA 3OELA 1DPEA 5DVIA 1O64A 3V5AA 2YPNA 5EQ9A 4AB5A 3FBPA 3MQ9A 4AQ4A 5I2KB 4TLMB 1POTA 4R2FA 2XXVA 3FVKA 2F3BA 3TMGA 1SW2A 3MVWA 3IB1A 3PPRA 1IMCA 4HCWA 3LBSA 4UABA 3MSTA 2DP8A 3OSRA 3IOUA 5FHOA 4C1UA 4OVQA 4F2QA 5I57A 2E0SA 2ZYNA 1FPGA 2Q89A 4OTEA 4LZ5A 4XTCQ 3CG1A 3N26A 3M3FA 4MH5A 4GWYA 1FBHA 1XT8A 5I7IA 2JJKA 1NV1A 2FIXA 1XS5A 3QMFA 4Z0IA 5JEIA 3G3HA 4G8NA 1LAXA 1R1NA 3B7DA 1FBGA 2ABHA 5I5PA 2OWTA 3Q28A 2YJPA 2HZKA 3V8XB 1POY1 1IMFA 5ET8A 4MHFA 1ZKBA 1D9VA 1GVCA 4KI0E 1URSA 1B0LA 1MM6A 3D1RA 2P3VA 4G8MA 1FTJA 3RGYA 1Q1KA 1B0HA 5DTBA 1OIBA 5DYHA 1G0IA 4H5FA 3K6WA 2P0SA 3HCQA 3D4GA 3RPWA 5H8QB 3KJ7A 4MNPA 4H0WA 1FTAA 1N7XA 5LTCA 5AA2B 1IQ7A 4P0GA 3M3KA 3R26A 5I58B 4I40A 4GBWA 2FBPA 4EQBA 3PMVA 2CZKA 2ZYMA 1TXFA 1QJMA 1IMEA 1AH5A 3RUMA 3EF7A 4QFPA 1NV6A 5TPAB 4XKQA 3TUSA 1IMDA 2XXRA 4EF1A 1A54A 1VDWA 1B1XA 4F3GA 4PBQA 3K0VA 4BDNA 4N13A 5CMKA 4X9TA 2Z23A 1P1NA 3MVYA 3S9EA 3CI8A 4OENA 5J16A 3QAXA 3K01A 4EQ9A 4NE4A 1A40A 1NUYA 4HTGA 3RTFB 2OX3A 1JEUA 1UTHB 2CEYA 2DYXA 1LAHE 5H8FA 4P3LA 4ZZEA 4NF4B 2UVIA 3B6TA 3U72A 3K4UA 4PAIA 5CI5A 4GF8A 3VVEA 3DLNA 4H8JA 4THIA 3K00A 2PMSA 4XIGQ 4JVCA 4JWOA 5AA2A 4PBHA 4H46A 2CMOA 4LQ5A 4O8MA 1M5CA 3GLBA 1MG1A 1JETA 3RYDA 3IR1A 3IAZA 3DP8A 3SDFA 5DW8A 3RT8A 1N0TA 1BP5A 3C9HA 3UK4A 4NF6B 3WAEA 2DOJA 4X48A 1PBPA 2XXPA 3IFCA 5IZZA 2M8CA 1RDYA 4FIMA 3LC8A 3FXQA 2DE3A 4HCYA 4G68C 4I8CA 4GIZA 3N6UA 5ET5A 1MY3A 3PD9A 4MJOA 4KR5A 1MXXA 2V84A 1P1WA 2ANJA 3PMWA 4YU0A 3VV5A 1LAGE 4G8HA 2Q88A 2A5TB 3IB0A 4DE8A 2Y7KA 4KPTA 3PPQA 4U21A 1S7YA 1SW4A 1P99A 3FJMA 1ZBMA 3U92A 2ZZVA 2DE2A 3MVXA 3C4MA 3HO7A 1MPBA 3MZ1A 1ELJA 4PFYA 4YKPA 4PFIA 2CZLA 1A99A 2VT5A 3S9LC 1MY1A 4GOTA 3O2AA 2WYPA 3E13X 3ZS6A 1MH4A 3USDA 1EZOA 3U65A 4BDLA 3ILUB 3FJGA 2WKYA 4GD5A 2R6GE 5TP9A 4IR8A 2ZZWA 3AXFA 3MUQA 3E78A 3TFLA 3B50A 2ZYKA 1MS7A 4LZ8A 1B7HA 3IORA 1QUKA 5L9MA 4ELRA 3T1BA 4QFKA 5FTHA 1OMPA 3TTMA 3FXBA 1M5BA 3QYTA 4OA4A 1YAEA 3QSLA 3BIHA 4GFRA 2AIXA 5EHMA 3SETA 3MBPA 2WYKA 2FVZA 2X7PA 1QULA 2QS3A 4KXPA 4HE2A 3H06B 4QFOA 1QUIA 3SZPA 3KN8A 2DXRA 2DXYA 1H45A 3W9VA 3CHGA 3VVDA 4GWXA 4P0IA 4ZDMA 3E4RA 1Y1ZA 4GXSB 4GLIA 1FQAA 4E0WA 4MLVA 1LBBA 4XF5A 3RN8A 2GHAA 2XXQA 3A09A 2O7UA 1OVTA 3HV1A 3OXNA 4GXAA 1GV8A 4RK9A 1GR2A 5B7DA 2H9BA 4FE8A 5JTYB 2UVJA 3FV2A 4U22A 4ZEDA 5H8SA 4OFOA 1MY0A 2ZYOA 4UA8A 1HSEA 2I6EA 4OVSA 2VPNA 5CBSA 1DSNA 3VLWA 4FAJA 2Q2AA 5CMCA 4N07A 4OVRA 1LFGA 5ESYA 3Q29A 2F5XA 1OQGA 3PU5A 1B32A 2GFEA 4XKPA 5FHMA 3ONMA 1GGGA 1LBVA 5A5XB 3N6TA 1IITA 2XXTA 3CG3A 2R9JA 3PD8A 1NV3A 3SKPA 3RNNA 2PBWA 1LFHA 2DWAA 1BK4A 3O66A 3L6GA 4M1VA 2PX1A 3IL1B 1Y3NA 1EYIA 2I49A 3K6UA 4N15A 1XC1A 3S9NC 3MPKA 5AE4A 4MBPA 2Q9TA 4QXDA 4MFIA 1QKAA 4N8GA 3OEMA 3TQLA 1B40A 2Z22A 2OBGA 2V25A 4PC9A 1DOTA 1WVJA 4I3YA 1MQJA 1NH8A 4N8YA 3FUZA 3KBRA 3W15C 3LUYA 4F29A 1LCTA 4IY5A 3B6QA 3SESA 3OMBA 1R9LA 2WX9A 2XXYA 3S4UA 2WEFA 2V3TA 4RA1A 4PFUA 3OD7A 5IZ1A 4OYVA 3IO4A 3IJXB 4L17A 1FRPA 4YMAA 3QUJA 2ZNUA 3FZVA 3GBBA 3PPNA 3BFUA 3MP1A 1FPEA 4JWYA 4PFBA 3NOHA 3LSLA 4POXA 1FBFA 5I57B 3LSFB 2PVUA 2DSFA 4FBPA 1IZ1A 5H8NA 2AL5A 3HPIA 3TAJA 2VOZA 1NNFA 1FQEA 4Q0CA 1B46A 3KJTA 3ZKLA 4ECFA 4LVQA 1AL3A 4KCDA 3RTWB 1NFTA 3A3CA 1EH3A 4NMYA 1BIYA 4Q30B 1NL5A 4WEDA 2Q8MA 4F1VA 4OESA 4GWOA 4NF0A 1FJ6A 4IB2A 1T0KA 4IY6A 1ZU0A 4GWWA 2F78A 4O94A 3WAFA 5DVFA 4ZE8A 1FCKA 5TU0A 3LSWA 3QIMA 4OVTA 3QXMA 4C0RA 3TELA 2P3NA 1BKAA 4PDDA 3FIRA 5I2NA 4NGUA 2VD3A 4OEUA 1NV2A 3JZJA 1MXWA 3EN3A 3BBRA 1FPLA 4YICA 2B4LA 4PF6A 4NF8A 4G77A 1JNFA 1NUXA 1FBCA 2A5SA 2PCRA 2O6AA 1FTLA 1K9YA 1QGXA 1MQIA 2B4MA 3FGSA 1OVBA 1D3KA 3T9VA 2ZNTA 1RDXA 4RNSA 1B7ZA 5ITPA 1EZPA 1IXGA 1D9QA 2XXHA 4YZZA 2DWIA 3OO9A 4MCOA 3CVGA 1AOVA 4DIGA 4EXLA 1DPPA 4KYEA 3SEUA 2F6PA 4LP2B 1OLCA 3G3JA 2HQ0A 4Q5TA 3M3LA 4ELQA 4PGPA 4NF5A 5HBCA 3O29A 3TTLA 1QVSA 1DTGA 5H8FB 4U1OA 1UIVA 4OWDA 1PC3A 2X7QA 1AMFA 1MY4A 2XWOA 3KGCA 1PB9A 2I3VA 4DCXA 3KC0A 1FPIA 4H6DA 3QUFA 3TPAA 5F24A 5EYGA 1JQFA 1KZ8A 3CR9A 1SW5A 1Y20A 1YYZA 2F7BA 4LATA 3T9UA 3THIA 1Y4TA 3RY3A 2V3UA 3VLUA 5IGAA 2HZLA 3PUWE 3U93A 4G4PA 2QS1A 4P8BA 2V3QA 3FVOA 1SI0A 1Y3PA 1YPNA 3PPOA 1G0HA 3K02A 4OANA 1M5EA 4JBZA 2UVGA 4N6KA 1IUDA 4DDDA 2XX8A 4EF2A 2O51A 4OVJA 1Z7NE 3HN0A 2ONKE 3A29A 4GRKA 4X1BA 2OLBA 4KD5A 4IO7A 4YKKA 2RCAA 3HHFA 4ELOA 4I1DA 2HHMA 1Q9DA 1XOCA 3JV9A 4ZZAA 2PT1A 4R9FA 5KCJA 3OOAA 3PUZE
chains in the Genus database with same CATH topology
1MPDA 5ISUA 1MQDA 3PUVE 4YKIA 4ZS9A 4F31B 4IGRA 3FV1A 1JVXA 2UYEA 3MP6A 3H3GA 4DCYA 2O1LA 4PETA 3JYRA 4JB7A 1USYE 4YB6A 1FQBA 1PDAA 2I0CA 1MDP1 3I6VA 3FATA 3S2VA 5TP9B 1NNKA 2FYIA 1RYXA 3LSXA 2PYYA 3W9WA 1N3XA 3O97A 4TLLB 4RPNA 3IJOB 3FVNA 1I6AA 2XXIA 3FVGA 1Y4CA 4BDQA 4N6PA 3H6UA 2VHAA 2H25A 2W7YA 4FATA 4OERA 1NNPA 3KZGA 1R6ZA 3U94A 3IB2A 2OK2A 3MC2A 3CIJA 3S9MC 1B5JA 3RLFE 4TQUQ 1I6BA 1MH3A 2Y84A 2P2AA 4R72A 3EQ1A 3BFTA 1URGA 5AA4A 3KSXA 4OFLA 3V89B 3OEKA 1L5TA 5ICQA 5EYFA 4IO4A 2H4IA 4C1TA 3UP9A 1DMBA 1N3WA 5HPQA 4IGTA 4ESWA 3TQWA 5H8HA 4H65A 4F1UA 2Z8FA 5L9OA 1MM7A 4U1ZA 4JWXA 1JEVA 2I48A 4QRZA 2QMXA 3EHUA 1A7LA 3TTKA 2QS4A 2B3FA 2VP1A 2DQVA 2HEUA 1B9JA 4O3CA 2O69A 3OO6A 3KN3A 2O84X 2F36A 2RKMA 4NEDA 4QFNA 1P1QA 3LR1A 4GQOA 1FTKA 4OHNA 3KOTA 3K1PA 2G93A 2ONSA 3TODA 4G68A 5I84A 4KCCA 3K1NA 4ELPA 2DWJA 4JDFA 2RC8A 3G3FA 1D9YA 1B3FA 1VE4A 3F11A 2UYFA 3VLVA 3MWBA 1QUJA 3PPPA 3C36A 4F3SA 4ZEBA 3SEYA 4U4XA 1A8EA 4G2ZA 4EQ7A 1OLAA 1A55A 1LGBC 3T93B 3VDFA 2H98A 4ZECA 4GL8A 1WODA 2UVHA 4RY1A 2G29A 1TT1A 1EZ9A 4FECA 1ZJLA 5FTIA 1CB6A 2P1SA 1IXIA 3C34A 3IOTA 4YMBA 2XD3A 4QSEA 3U1OA 2QPQA 3OO7A 3TTRA 3I3VA 3TCGA 3TYHA 2XXUA 3CRBA 5H8NB 1NMUA 3R6UA 2I4BA 1B7UA 3VVFA 4ESXA 4MLQA 1CE2A 3C32A 1MXVA 4F2OA 1TWYA 4BDOA 3O6HA 1KWHA 5IAIA 4U4SA 2F8DA 4JSOA 1MPCA 4M4GA 2QSXA 2NUVA 5DT6A 2QRYA 1SBPA 3EPEA 3TDJA 3CFLA 4POWA 3G3GA 2BJJX 3MAMA 2GH9A 1MXZA 4R74A 2HFBA 5I2NB 2DE4A 3EHTA 4FEBA 4H8IA 5KDTA 1MDQA 3A3UA 4NWCA 1OQHA 4WEPA 3ODBA 1SDXA 1B1HA 2QMWA 4NF8B 4NTLA 3OO8A 2R71A 1R9QA 4PQJA 1MQHA 2FA7A 4JXIA 1ZTYA 2HAUA 1JW1A 1II5A 2QJEA 3H6TA 4RJZA 1I69A 1AIVA 2NOOA 3O6IA 4XXUA 1D4NA 4RPOA 5BUUA 4ZEIA 1B4ZA 2OJTA 1FW0A 1O63A 4DXBA 3CFXA 4IO5A 2DS9A 2XHDA 2ZXTA 4LUBA 4FJPA 3E3KA 3N5LA 2B65A 3KFMA 3E9XA 3DM0A 4EXKA 4NF5B 2KLFA 3KN7A 3FXUA 5I59A 4DXUA 1MRPA 5J1DA 2NXOA 4NWDA 2HXWA 1RKMA 2HCAA 4YB5A 3UGWA 5L8DA 1Y3QA 4ZEFA 5CM6A 3U8QA 1PB7A 4QSCA 1UQWA 3MVZA 1P1OA 4DLDA 4XKRA 2FNCA 4OETA 1LB9A 3T9XB 4ZE9A 4KYSA 4TOZA 3IOWA 4F1YA 3QK6A 1SVXB 1B6HA 1XHYA 1FTOA 4KQPA 2H5YA 1B3HA 3PMXA 4KYDA 3TTNA 4XKNA 4LQ2A 4F3PA 4R73A 5I56A 3C35A 3DELB 4O3BA 1B3GA 4R75A 5EHSA 5DEXA 3V83A 2XX7A 4YAHX 5CMBA 1UTBA 3UIFA 2V93A 3TKDA 3FASA 4GVOA 4R9GA 2XX9A 3I5OA 5I2KA 1B4HA 5KCJB 3UN6A 3N94A 1B52A 2F7AA 1P1UA 2ESNA 4U2RA 3ILTB 3ZKKA 3HHGA 3KOSA 2F6GA 1LSTA 5CC2A 3Q27A 1N84A 1YCJA 4OEVA 3TCHA 4K3FA 4F22A 1PBQA 3FJ7A 3D4CA 4KFQA 3TEPA 1LCFA 5JK4A 1Y1MA 2NWJA 1B05A 1TFDA 2ZNSA 4U23A 3RQTA 4OZ9A 5M2VA 2GHBA 2OCUA 3CFZA 1PB8A 2NVUB 4OFJA 4X1DA 4YB7A 3G3KA 2O7IA 5LOMA 4EUOA 1IXCA 3O6GA 1BLFA 3MZ9A 1FQCA 2XXWA 1LFIA 4Z7EA 3B6WA 3K6XA 3MJNA 1F9BA 1B51A 3C31A 4F39A 4I9DA 5H8QA 5CRYA 5AA4B 3T96B 5I58A 1N7WA 2Y7WA 5AA2D 3PUYE 1IEJA 4IO3A 1MXYA 1ZLQA 2AYSA 2ONRA 2VGQA 2DWHA 1B3EA 2D21A 5TPAA 4WXJA 3ZSFA 5H8HB 1BTJA 3O28A 4UACA 1IXHA 2I3WA 1ATGA 3IX1A 3VXBA 2O1MA 3HSTA 1QW0A 2LAOA 3SEWA 2D5WA 4R6HA 4YKJA 2REJA 5IKBA 3G3IA 1M5FA 4MF3A 4EDPA 3P7IA 2F34A 1IIWA 4IO6A 3T9HB 1UTHA 1LB8A 2YLNA 2Y7PA 4NF4A 3H7MA 3SEVA 1NNTA 3KG2A 1JW4A 3OENA 1UIUA 4G68B 1PEBA 3UA8A 2ZMBA 4LZ7A 3GBAA 1H3DA 4RK2A 2H99A 1RYOA 4ISUA 4HW8A 3MP8A 1SYIA 3ECRA 1DTZA 1N76A 2REGA 2IA4A 4H5GA 2AL4A 1TFAA 2IEEA 5FHNA 1N04A 1VFEA 2QS2A 4E0XA 4HS7A 3C33A 3IOVA 1WDNA 4JSDA 2UXAA 3RT6B 4QSDA 4DZ1A 4RYAA 4NF6A 1S9TA 3SERA 2E1SA 4GL0A 1HSJA 4KHZE 2I58A 5B70A 1Y9UA 2B3BA 2RCBA 4PFTA 1VR5A 1B5IA 4PP0A 1QKBA 1S50A 3KSJA 2F7CA 1B3LA 2ALUA 3H6VA 2A5TA 1MY2A 3T66A 4BDRA 4R2BA 4QFLA 3TZAA 3GXAA 1GTKA 2PT2A 3O9PA 4H67A 1FQDA 4QF9A 3K6VA 2DVZA 3IO6A 3DP6A 2Z8DA 3FD3A 2Y7RA 3K2DA 4F19A 5K2XA 3H4ZA 1JW5A 1HSLA 4ND9A 1US4A 2O68A 2QL3A 1VSOA 4P11A 5ICTA 5BWJA 1YTVA 5CMMA 4H1XA 5DVJA 3EHSA 3VFJA 5AA3A 4F18A 2GRVA 3MPLA 5F1QA 2RF1A 1JVYA 3R7XA 1SW1A 5AA1A 1ANFA 4WKMA 1Z7ME 2Q8JA 4PE5B 4F3BA 4BLAA 3CSBA 5HM4B 5KDTB 4R6YA 1B2HA 1B5HA 2THIA 2Y7IA 1LLSA 4OMBA 3G7WA 2I0BA 3CSGA 4Q8RA 5ITOA 1SQYA 1MXUA 1URDA 2I4CA 3DP4A 1FTMA 5K2YA 3SEXA 4O3AA 4PFWA 1USYH 2X26A 1SI1A 5L9SA 3KEIA 1XVXA 3VE1B 1O7TA 2HAVA 1FQFA 3L6HA 1VFDA 5CBRA 4OQOA 3PV0E 2Q2CA 2D3IA 5F7VA 1B58A 2RINA 2F35A 1EU8A 4DXCA 5JTYA 2F97A 1ZIUA 3MW0A 3Q25A 3PGFA 3H6WA 5I59B 2XD2A 4RXLA 1H44A 1MQGA 2Z8EA 1NKXA 3TCFA 3MZBA 1NH7A 1ZMGA 1LAFE 4OXVA 4LONB 2VD2A 4FEDA 5A5XA 1US5A 1J1NA 4LA9A 3H03A 2RC7A 3PUXE 4ZEKA 1SD3A 3FXRA 3M8UA 4QHQA 4ONYA 3K1MA 1LBCA 4IO2A 3GZGA 5KZTA 2XXXA 3Q26A 4I62A 2RC9A 1XVYA 1Q35A 5ELVA 4AB6A 1M5DA 4R6KA 2OZZA 3T22A 3IK6B 3UORA 3BKIB 3VXCA 2DVCA 1I6QA 5I56B 4FORA 2OWSA 1H76A 1A8FA 4BDMA 5DEXB 1UTBB 1H43A 1SYHA 3OSQA 3OELA 1DPEA 5DVIA 1O64A 3V5AA 2YPNA 4AB5A 3MQ9A 4AQ4A 5I2KB 4TLMB 1POTA 4R2FA 2XXVA 3FVKA 3TMGA 1SW2A 3MVWA 3IB1A 3PPRA 4HCWA 3LBSA 2DP8A 3OSRA 3IOUA 5FHOA 4C1UA 4F2QA 5I57A 2E0SA 2ZYNA 2Q89A 4OTEA 4LZ5A 4XTCQ 3CG1A 3N26A 3M3FA 4MH5A 1XT8A 1XS5A 4Z0IA 5JEIA 3G3HA 4G8NA 1LAXA 1R1NA 3B7DA 2ABHA 2OWTA 3Q28A 2YJPA 2HZKA 3V8XB 1POY1 1ZKBA 1D9VA 1GVCA 4KI0E 1URSA 1B0LA 1MM6A 4G8MA 1FTJA 3RGYA 1Q1KA 1B0HA 5DTBA 1OIBA 5DYHA 4H5FA 3K6WA 2P0SA 3HCQA 3D4GA 3RPWA 5H8QB 3KJ7A 4H0WA 1N7XA 5AA2B 1IQ7A 4P0GA 3M3KA 3R26A 5I58B 4EQBA 3PMVA 2ZYMA 1TXFA 1QJMA 1AH5A 3RUMA 3EF7A 4QFPA 5TPAB 4XKQA 3TUSA 2XXRA 4EF1A 1A54A 1B1XA 4F3GA 3K0VA 4BDNA 4N13A 5CMKA 4X9TA 2Z23A 1P1NA 3MVYA 3S9EA 3CI8A 4OENA 3QAXA 3K01A 4EQ9A 4NE4A 1A40A 4HTGA 3RTFB 1JEUA 1UTHB 2DYXA 1LAHE 5H8FA 4ZZEA 4NF4B 2UVIA 3B6TA 3U72A 3K4UA 5CI5A 4GF8A 3VVEA 3DLNA 4H8JA 4THIA 3K00A 2PMSA 4XIGQ 4JWOA 5AA2A 2CMOA 4LQ5A 1M5CA 3GLBA 1MG1A 1JETA 3IR1A 3IAZA 3DP8A 3SDFA 3RT8A 1N0TA 1BP5A 3C9HA 3UK4A 4NF6B 3WAEA 2DOJA 4X48A 1PBPA 2XXPA 2M8CA 4FIMA 3LC8A 3FXQA 2DE3A 4HCYA 4G68C 4I8CA 4GIZA 3N6UA 1MY3A 3PD9A 4KR5A 1MXXA 2V84A 1P1WA 2ANJA 3PMWA 4YU0A 3VV5A 1LAGE 4G8HA 2Q88A 2A5TB 3IB0A 4DE8A 2Y7KA 4KPTA 3PPQA 4U21A 1S7YA 1SW4A 1P99A 3FJMA 1ZBMA 3U92A 2DE2A 3MVXA 3C4MA 3HO7A 1MPBA 3MZ1A 1ELJA 4PFYA 4YKPA 2CZLA 1A99A 3S9LC 1MY1A 4GOTA 3O2AA 3E13X 3ZS6A 1MH4A 3USDA 1EZOA 4BDLA 3ILUB 3FJGA 2WKYA 4GD5A 2R6GE 5TP9A 3AXFA 3MUQA 3TFLA 2ZYKA 1MS7A 4LZ8A 1B7HA 3IORA 1QUKA 5L9MA 4ELRA 4QFKA 5FTHA 1OMPA 3TTMA 1M5BA 3QYTA 1YAEA 3QSLA 4GFRA 2AIXA 5EHMA 3SETA 3MBPA 2X7PA 1QULA 2QS3A 3H06B 4QFOA 1QUIA 3KN8A 2DXRA 2DXYA 1H45A 3W9VA 3VVDA 4P0IA 4ZDMA 3E4RA 1Y1ZA 4GXSB 4GLIA 1FQAA 4E0WA 4MLVA 1LBBA 3RN8A 2GHAA 2XXQA 3A09A 2O7UA 1OVTA 3HV1A 3OXNA 4GXAA 1GV8A 4RK9A 1GR2A 5B7DA 2H9BA 4FE8A 5JTYB 2UVJA 3FV2A 4U22A 4ZEDA 5H8SA 4OFOA 1MY0A 2ZYOA 4UA8A 1HSEA 2I6EA 5CBSA 1DSNA 3VLWA 4FAJA 2Q2AA 5CMCA 4N07A 1LFGA 3Q29A 2F5XA 1OQGA 3PU5A 1B32A 2GFEA 4XKPA 5FHMA 3ONMA 1GGGA 5A5XB 3N6TA 1IITA 2XXTA 3CG3A 2R9JA 3PD8A 3SKPA 3RNNA 2PBWA 1LFHA 2DWAA 3O66A 3L6GA 4M1VA 2PX1A 3IL1B 1Y3NA 2I49A 3K6UA 1XC1A 3S9NC 3MPKA 5AE4A 4MBPA 2Q9TA 4MFIA 1QKAA 3OEMA 3TQLA 1B40A 2Z22A 2OBGA 2V25A 1DOTA 1WVJA 1MQJA 1NH8A 3FUZA 3KBRA 3W15C 3LUYA 4F29A 1LCTA 4IY5A 3B6QA 3SESA 3OMBA 1R9LA 2XXYA 3S4UA 2V3TA 4RA1A 4PFUA 3OD7A 4OYVA 3IO4A 3IJXB 4L17A 4YMAA 3QUJA 2ZNUA 3FZVA 3GBBA 3PPNA 3BFUA 3MP1A 4JWYA 3LSLA 4POXA 5I57B 3LSFB 2PVUA 2DSFA 1IZ1A 5H8NA 2AL5A 3HPIA 3TAJA 2VOZA 1NNFA 1FQEA 4Q0CA 1B46A 3KJTA 3ZKLA 4ECFA 4LVQA 1AL3A 4KCDA 3RTWB 1NFTA 3A3CA 1EH3A 4NMYA 1BIYA 4Q30B 1NL5A 4WEDA 4F1VA 4OESA 4GWOA 4IB2A 1T0KA 4IY6A 1ZU0A 2F78A 3WAFA 5DVFA 4ZE8A 1FCKA 5TU0A 3LSWA 3QIMA 3QXMA 4C0RA 3TELA 1BKAA 3FIRA 5I2NA 2VD3A 4OEUA 3JZJA 1MXWA 3EN3A 3BBRA 4YICA 4NF8A 4G77A 1JNFA 2A5SA 2O6AA 1FTLA 1MQIA 3FGSA 1OVBA 1D3KA 3T9VA 2ZNTA 4RNSA 1B7ZA 5ITPA 1EZPA 1IXGA 2XXHA 4YZZA 2DWIA 3OO9A 3CVGA 1AOVA 4DIGA 4EXLA 1DPPA 4KYEA 3SEUA 2F6PA 4LP2B 1OLCA 3G3JA 2HQ0A 4Q5TA 3M3LA 4ELQA 4NF5A 5HBCA 3O29A 3TTLA 1QVSA 1DTGA 5H8FB 4U1OA 1UIVA 4OWDA 1PC3A 2X7QA 1AMFA 1MY4A 3KGCA 1PB9A 2I3VA 4DCXA 4H6DA 3QUFA 3TPAA 1JQFA 3CR9A 1SW5A 1Y20A 2F7BA 4LATA 3T9UA 3THIA 1Y4TA 3RY3A 2V3UA 3VLUA 2HZLA 3PUWE 3U93A 4G4PA 2QS1A 2V3QA 3FVOA 1SI0A 1Y3PA 1YPNA 3PPOA 3K02A 1M5EA 4JBZA 2UVGA 1IUDA 4EF2A 4DDDA 2XX8A 2O51A 4OVJA 1Z7NE 3HN0A 2ONKE 4GRKA 4X1BA 2OLBA 4KD5A 4IO7A 4YKKA 2RCAA 3HHFA 4ELOA 4I1DA 1XOCA 3JV9A 4ZZAA 2PT1A 4R9FA 5KCJA 3OOAA 3PUZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPD A;  5ISU A;  1MQD A;  3PUV E;  4YKI A;  4ZS9 A;  4F31 B;  4IGR A;  3FV1 A;  1JVX A;  2UYE A;  3MP6 A;  3H3G A;  4DCY A;  2O1L A;  4PET A;  3JYR A;  4JB7 A;  1USY E;  4YB6 A;  1FQB A;  1PDA A;  2I0C A;  1MDP 1;  3I6V A;  3FAT A;  3S2V A;  5TP9 B;  1NNK A;  2FYI A;  1RYX A;  3LSX A;  2PYY A;  3W9W A;  1N3X A;  3O97 A;  4TLL B;  4RPN A;  3IJO B;  3FVN A;  1I6A A;  2XXI A;  3FVG A;  1Y4C A;  4BDQ A;  4N6P A;  3H6U A;  2VHA A;  2H25 A;  2W7Y A;  4FAT A;  4OER A;  1NNP A;  3KZG A;  1R6Z A;  3U94 A;  3IB2 A;  2OK2 A;  3MC2 A;  3CIJ A;  3S9M C;  1B5J A;  3RLF E;  4TQU Q;  1I6B A;  1MH3 A;  2Y84 A;  2P2A A;  4R72 A;  3EQ1 A;  3BFT A;  1URG A;  5AA4 A;  3KSX A;  4OFL A;  3V89 B;  3OEK A;  1L5T A;  5ICQ A;  5EYF A;  4IO4 A;  2H4I A;  4C1T A;  3UP9 A;  1DMB A;  1N3W A;  5HPQ A;  4IGT A;  4ESW A;  3TQW A;  5H8H A;  4H65 A;  4F1U A;  2Z8F A;  5L9O A;  1MM7 A;  4U1Z A;  4JWX A;  1JEV A;  2I48 A;  4QRZ A;  2QMX A;  3EHU A;  1A7L A;  3TTK A;  2QS4 A;  2B3F A;  2VP1 A;  2DQV A;  2HEU A;  1B9J A;  4O3C A;  2O69 A;  3OO6 A;  3KN3 A;  2O84 X;  2F36 A;  2RKM A;  4NED A;  4QFN A;  1P1Q A;  3LR1 A;  4GQO A;  1FTK A;  4OHN A;  3KOT A;  3K1P A;  2G93 A;  2ONS A;  3TOD A;  4G68 A;  5I84 A;  4KCC A;  3K1N A;  4ELP A;  2DWJ A;  4JDF A;  2RC8 A;  3G3F A;  1D9Y A;  1B3F A;  1VE4 A;  3F11 A;  2UYF A;  3VLV A;  3MWB A;  1QUJ A;  3PPP A;  3C36 A;  4F3S A;  4ZEB A;  3SEY A;  4U4X A;  1A8E A;  4G2Z A;  4EQ7 A;  1OLA A;  1A55 A;  1LGB C;  3T93 B;  3VDF A;  2H98 A;  4ZEC A;  4GL8 A;  1WOD A;  2UVH A;  4RY1 A;  2G29 A;  1TT1 A;  1EZ9 A;  4FEC A;  1ZJL A;  5FTI A;  1CB6 A;  2P1S A;  1IXI A;  3C34 A;  3IOT A;  4YMB A;  2XD3 A;  4QSE A;  3U1O A;  2QPQ A;  3OO7 A;  3TTR A;  3I3V A;  3TCG A;  3TYH A;  2XXU A;  3CRB A;  5H8N B;  1NMU A;  3R6U A;  2I4B A;  1B7U A;  3VVF A;  4ESX A;  4MLQ A;  1CE2 A;  3C32 A;  1MXV A;  4F2O A;  1TWY A;  4BDO A;  3O6H A;  1KWH A;  5IAI A;  4U4S A;  2F8D A;  4JSO A;  1MPC A;  4M4G A;  2QSX A;  2NUV A;  5DT6 A;  2QRY A;  1SBP A;  3EPE A;  3TDJ A;  3CFL A;  4POW A;  3G3G A;  2BJJ X;  3MAM A;  2GH9 A;  1MXZ A;  4R74 A;  2HFB A;  5I2N B;  2DE4 A;  3EHT A;  4FEB A;  4H8I A;  5KDT A;  1MDQ A;  3A3U A;  4NWC A;  1OQH A;  4WEP A;  3ODB A;  1SDX A;  1B1H A;  2QMW A;  4NF8 B;  4NTL A;  3OO8 A;  2R71 A;  1R9Q A;  4PQJ A;  1MQH A;  2FA7 A;  4JXI A;  1ZTY A;  2HAU A;  1JW1 A;  1II5 A;  2QJE A;  3H6T A;  4RJZ A;  1I69 A;  1AIV A;  2NOO A;  3O6I A;  4XXU A;  1D4N A;  4RPO A;  5BUU A;  4ZEI A;  1B4Z A;  2OJT A;  1FW0 A;  1O63 A;  4DXB A;  3CFX A;  4IO5 A;  2DS9 A;  2XHD A;  2ZXT A;  4LUB A;  4FJP A;  3E3K A;  3N5L A;  2B65 A;  3KFM A;  3E9X A;  3DM0 A;  4EXK A;  4NF5 B;  2KLF A;  3KN7 A;  3FXU A;  5I59 A;  4DXU A;  1MRP A;  5J1D A;  2NXO A;  4NWD A;  2HXW A;  1RKM A;  2HCA A;  4YB5 A;  3UGW A;  5L8D A;  1Y3Q A;  4ZEF A;  5CM6 A;  3U8Q A;  1PB7 A;  4QSC A;  1UQW A;  3MVZ A;  1P1O A;  4DLD A;  4XKR A;  2FNC A;  4OET A;  1LB9 A;  3T9X B;  4ZE9 A;  4KYS A;  4TOZ A;  3IOW A;  4F1Y A;  3QK6 A;  1SVX B;  1B6H A;  1XHY A;  1FTO A;  4KQP A;  2H5Y A;  1B3H A;  3PMX A;  4KYD A;  3TTN A;  4XKN A;  4LQ2 A;  4F3P A;  4R73 A;  5I56 A;  3C35 A;  3DEL B;  4O3B A;  1B3G A;  4R75 A;  5EHS A;  5DEX A;  3V83 A;  2XX7 A;  4YAH X;  5CMB A;  1UTB A;  3UIF A;  2V93 A;  3TKD A;  3FAS A;  4GVO A;  4R9G A;  2XX9 A;  3I5O A;  5I2K A;  1B4H A;  5KCJ B;  3UN6 A;  3N94 A;  1B52 A;  2F7A A;  1P1U A;  2ESN A;  4U2R A;  3ILT B;  3ZKK A;  3HHG A;  3KOS A;  2F6G A;  1LST A;  5CC2 A;  3Q27 A;  1N84 A;  1YCJ A;  4OEV A;  3TCH A;  4K3F A;  4F22 A;  1PBQ A;  3FJ7 A;  3D4C A;  4KFQ A;  3TEP A;  1LCF A;  5JK4 A;  1Y1M A;  2NWJ A;  1B05 A;  1TFD A;  2ZNS A;  4U23 A;  3RQT A;  4OZ9 A;  5M2V A;  2GHB A;  2OCU A;  3CFZ A;  1PB8 A;  2NVU B;  4OFJ A;  4X1D A;  4YB7 A;  3G3K A;  2O7I A;  5LOM A;  4EUO A;  1IXC A;  3O6G A;  1BLF A;  3MZ9 A;  1FQC A;  2XXW A;  1LFI A;  4Z7E A;  3B6W A;  3K6X A;  3MJN A;  1F9B A;  1B51 A;  3C31 A;  4F39 A;  4I9D A;  5H8Q A;  5CRY A;  5AA4 B;  3T96 B;  5I58 A;  1N7W A;  2Y7W A;  5AA2 D;  3PUY E;  1IEJ A;  4IO3 A;  1MXY A;  1ZLQ A;  2AYS A;  2ONR A;  2VGQ A;  2DWH A;  1B3E A;  2D21 A;  5TPA A;  4WXJ A;  3ZSF A;  5H8H B;  1BTJ A;  3O28 A;  4UAC A;  1IXH A;  2I3W A;  1ATG A;  3IX1 A;  3VXB A;  2O1M A;  3HST A;  1QW0 A;  2LAO A;  3SEW A;  2D5W A;  4R6H A;  4YKJ A;  2REJ A;  5IKB A;  3G3I A;  1M5F A;  4MF3 A;  4EDP A;  3P7I A;  2F34 A;  1IIW A;  4IO6 A;  3T9H B;  1UTH A;  1LB8 A;  2YLN A;  2Y7P A;  4NF4 A;  3H7M A;  3SEV A;  1NNT A;  3KG2 A;  1JW4 A;  3OEN A;  1UIU A;  4G68 B;  1PEB A;  3UA8 A;  2ZMB A;  4LZ7 A;  3GBA A;  1H3D A;  4RK2 A;  2H99 A;  1RYO A;  4ISU A;  4HW8 A;  3MP8 A;  1SYI A;  3ECR A;  1DTZ A;  1N76 A;  2REG A;  2IA4 A;  4H5G A;  2AL4 A;  1TFA A;  2IEE A;  5FHN A;  1N04 A;  1VFE A;  2QS2 A;  4E0X A;  4HS7 A;  3C33 A;  3IOV A;  1WDN A;  4JSD A;  2UXA A;  3RT6 B;  4QSD A;  4DZ1 A;  4RYA A;  4NF6 A;  1S9T A;  3SER A;  2E1S A;  4GL0 A;  1HSJ A;  4KHZ E;  2I58 A;  5B70 A;  1Y9U A;  2B3B A;  2RCB A;  4PFT A;  1VR5 A;  1B5I A;  4PP0 A;  1QKB A;  1S50 A;  3KSJ A;  2F7C A;  1B3L A;  2ALU A;  3H6V A;  2A5T A;  1MY2 A;  3T66 A;  4BDR A;  4R2B A;  4QFL A;  3TZA A;  3GXA A;  1GTK A;  2PT2 A;  3O9P A;  4H67 A;  1FQD A;  4QF9 A;  3K6V A;  2DVZ A;  3IO6 A;  3DP6 A;  2Z8D A;  3FD3 A;  2Y7R A;  3K2D A;  4F19 A;  5K2X A;  3H4Z A;  1JW5 A;  1HSL A;  4ND9 A;  1US4 A;  2O68 A;  2QL3 A;  1VSO A;  4P11 A;  5ICT A;  5BWJ A;  1YTV A;  5CMM A;  4H1X A;  5DVJ A;  3EHS A;  3VFJ A;  5AA3 A;  4F18 A;  2GRV A;  3MPL A;  5F1Q A;  2RF1 A;  1JVY A;  3R7X A;  1SW1 A;  5AA1 A;  1ANF A;  4WKM A;  1Z7M E;  2Q8J A;  4PE5 B;  4F3B A;  4BLA A;  3CSB A;  5HM4 B;  5KDT B;  4R6Y A;  1B2H A;  1B5H A;  2THI A;  2Y7I A;  1LLS A;  4OMB A;  3G7W A;  2I0B A;  3CSG A;  4Q8R A;  5ITO A;  1SQY A;  1MXU A;  1URD A;  2I4C A;  3DP4 A;  1FTM A;  5K2Y A;  3SEX A;  4O3A A;  4PFW A;  1USY H;  2X26 A;  1SI1 A;  5L9S A;  3KEI A;  1XVX A;  3VE1 B;  1O7T A;  2HAV A;  1FQF A;  3L6H A;  1VFD A;  5CBR A;  4OQO A;  3PV0 E;  2Q2C A;  2D3I A;  5F7V A;  1B58 A;  2RIN A;  2F35 A;  1EU8 A;  4DXC A;  5JTY A;  2F97 A;  1ZIU A;  3MW0 A;  3Q25 A;  3PGF A;  3H6W A;  5I59 B;  2XD2 A;  4RXL A;  1H44 A;  1MQG A;  2Z8E A;  1NKX A;  3TCF A;  3MZB A;  1NH7 A;  1ZMG A;  1LAF E;  4OXV A;  4LON B;  2VD2 A;  4FED A;  5A5X A;  1US5 A;  1J1N A;  4LA9 A;  3H03 A;  2RC7 A;  3PUX E;  4ZEK A;  1SD3 A;  3FXR A;  3M8U A;  4QHQ A;  4ONY A;  3K1M A;  1LBC A;  4IO2 A;  3GZG A;  5KZT A;  2XXX A;  3Q26 A;  4I62 A;  2RC9 A;  1XVY A;  1Q35 A;  5ELV A;  4AB6 A;  1M5D A;  4R6K A;  2OZZ A;  3T22 A;  3IK6 B;  3UOR A;  3BKI B;  3VXC A;  2DVC A;  1I6Q A;  5I56 B;  4FOR A;  2OWS A;  1H76 A;  1A8F A;  4BDM A;  5DEX B;  1UTB B;  1H43 A;  1SYH A;  3OSQ A;  3OEL A;  1DPE A;  5DVI A;  1O64 A;  3V5A A;  2YPN A;  4AB5 A;  3MQ9 A;  4AQ4 A;  5I2K B;  4TLM B;  1POT A;  4R2F A;  2XXV A;  3FVK A;  3TMG A;  1SW2 A;  3MVW A;  3IB1 A;  3PPR A;  4HCW A;  3LBS A;  2DP8 A;  3OSR A;  3IOU A;  5FHO A;  4C1U A;  4F2Q A;  5I57 A;  2E0S A;  2ZYN A;  2Q89 A;  4OTE A;  4LZ5 A;  4XTC Q;  3CG1 A;  3N26 A;  3M3F A;  4MH5 A;  1XT8 A;  1XS5 A;  4Z0I A;  5JEI A;  3G3H A;  4G8N A;  1LAX A;  1R1N A;  3B7D A;  2ABH A;  2OWT A;  3Q28 A;  2YJP A;  2HZK A;  3V8X B;  1POY 1;  1ZKB A;  1D9V A;  1GVC A;  4KI0 E;  1URS A;  1B0L A;  1MM6 A;  4G8M A;  1FTJ A;  3RGY A;  1Q1K A;  1B0H A;  5DTB A;  1OIB A;  5DYH A;  4H5F A;  3K6W A;  2P0S A;  3HCQ A;  3D4G A;  3RPW A;  5H8Q B;  3KJ7 A;  4H0W A;  1N7X A;  5AA2 B;  1IQ7 A;  4P0G A;  3M3K A;  3R26 A;  5I58 B;  4EQB A;  3PMV A;  2ZYM A;  1TXF A;  1QJM A;  1AH5 A;  3RUM A;  3EF7 A;  4QFP A;  5TPA B;  4XKQ A;  3TUS A;  2XXR A;  4EF1 A;  1A54 A;  1B1X A;  4F3G A;  3K0V A;  4BDN A;  4N13 A;  5CMK A;  4X9T A;  2Z23 A;  1P1N A;  3MVY A;  3S9E A;  3CI8 A;  4OEN A;  3QAX A;  3K01 A;  4EQ9 A;  4NE4 A;  1A40 A;  4HTG A;  3RTF B;  1JEU A;  1UTH B;  2DYX A;  1LAH E;  5H8F A;  4ZZE A;  4NF4 B;  2UVI A;  3B6T A;  3U72 A;  3K4U A;  5CI5 A;  4GF8 A;  3VVE A;  3DLN A;  4H8J A;  4THI A;  3K00 A;  2PMS A;  4XIG Q;  4JWO A;  5AA2 A;  2CMO A;  4LQ5 A;  1M5C A;  3GLB A;  1MG1 A;  1JET A;  3IR1 A;  3IAZ A;  3DP8 A;  3SDF A;  3RT8 A;  1N0T A;  1BP5 A;  3C9H A;  3UK4 A;  4NF6 B;  3WAE A;  2DOJ A;  4X48 A;  1PBP A;  2XXP A;  2M8C A;  4FIM A;  3LC8 A;  3FXQ A;  2DE3 A;  4HCY A;  4G68 C;  4I8C A;  4GIZ A;  3N6U A;  1MY3 A;  3PD9 A;  4KR5 A;  1MXX A;  2V84 A;  1P1W A;  2ANJ A;  3PMW A;  4YU0 A;  3VV5 A;  1LAG E;  4G8H A;  2Q88 A;  2A5T B;  3IB0 A;  4DE8 A;  2Y7K A;  4KPT A;  3PPQ A;  4U21 A;  1S7Y A;  1SW4 A;  1P99 A;  3FJM A;  1ZBM A;  3U92 A;  2DE2 A;  3MVX A;  3C4M A;  3HO7 A;  1MPB A;  3MZ1 A;  1ELJ A;  4PFY A;  4YKP A;  2CZL A;  1A99 A;  3S9L C;  1MY1 A;  4GOT A;  3O2A A;  3E13 X;  3ZS6 A;  1MH4 A;  3USD A;  1EZO A;  4BDL A;  3ILU B;  3FJG A;  2WKY A;  4GD5 A;  2R6G E;  5TP9 A;  3AXF A;  3MUQ A;  3TFL A;  2ZYK A;  1MS7 A;  4LZ8 A;  1B7H A;  3IOR A;  1QUK A;  5L9M A;  4ELR A;  4QFK A;  5FTH A;  1OMP A;  3TTM A;  1M5B A;  3QYT A;  1YAE A;  3QSL A;  4GFR A;  2AIX A;  5EHM A;  3SET A;  3MBP A;  2X7P A;  1QUL A;  2QS3 A;  3H06 B;  4QFO A;  1QUI A;  3KN8 A;  2DXR A;  2DXY A;  1H45 A;  3W9V A;  3VVD A;  4P0I A;  4ZDM A;  3E4R A;  1Y1Z A;  4GXS B;  4GLI A;  1FQA A;  4E0W A;  4MLV A;  1LBB A;  3RN8 A;  2GHA A;  2XXQ A;  3A09 A;  2O7U A;  1OVT A;  3HV1 A;  3OXN A;  4GXA A;  1GV8 A;  4RK9 A;  1GR2 A;  5B7D A;  2H9B A;  4FE8 A;  5JTY B;  2UVJ A;  3FV2 A;  4U22 A;  4ZED A;  5H8S A;  4OFO A;  1MY0 A;  2ZYO A;  4UA8 A;  1HSE A;  2I6E A;  5CBS A;  1DSN A;  3VLW A;  4FAJ A;  2Q2A A;  5CMC A;  4N07 A;  1LFG A;  3Q29 A;  2F5X A;  1OQG A;  3PU5 A;  1B32 A;  2GFE A;  4XKP A;  5FHM A;  3ONM A;  1GGG A;  5A5X B;  3N6T A;  1IIT A;  2XXT A;  3CG3 A;  2R9J A;  3PD8 A;  3SKP A;  3RNN A;  2PBW A;  1LFH A;  2DWA A;  3O66 A;  3L6G A;  4M1V A;  2PX1 A;  3IL1 B;  1Y3N A;  2I49 A;  3K6U A;  1XC1 A;  3S9N C;  3MPK A;  5AE4 A;  4MBP A;  2Q9T A;  4MFI A;  1QKA A;  3OEM A;  3TQL A;  1B40 A;  2Z22 A;  2OBG A;  2V25 A;  1DOT A;  1WVJ A;  1MQJ A;  1NH8 A;  3FUZ A;  3KBR A;  3W15 C;  3LUY A;  4F29 A;  1LCT A;  4IY5 A;  3B6Q A;  3SES A;  3OMB A;  1R9L A;  2XXY A;  3S4U A;  2V3T A;  4RA1 A;  4PFU A;  3OD7 A;  4OYV A;  3IO4 A;  3IJX B;  4L17 A;  4YMA A;  3QUJ A;  2ZNU A;  3FZV A;  3GBB A;  3PPN A;  3BFU A;  3MP1 A;  4JWY A;  3LSL A;  4POX A;  5I57 B;  3LSF B;  2PVU A;  2DSF A;  1IZ1 A;  5H8N A;  2AL5 A;  3HPI A;  3TAJ A;  2VOZ A;  1NNF A;  1FQE A;  4Q0C A;  1B46 A;  3KJT A;  3ZKL A;  4ECF A;  4LVQ A;  1AL3 A;  4KCD A;  3RTW B;  1NFT A;  3A3C A;  1EH3 A;  4NMY A;  1BIY A;  4Q30 B;  1NL5 A;  4WED A;  4F1V A;  4OES A;  4GWO A;  4IB2 A;  1T0K A;  4IY6 A;  1ZU0 A;  2F78 A;  3WAF A;  5DVF A;  4ZE8 A;  1FCK A;  5TU0 A;  3LSW A;  3QIM A;  3QXM A;  4C0R A;  3TEL A;  1BKA A;  3FIR A;  5I2N A;  2VD3 A;  4OEU A;  3JZJ A;  1MXW A;  3EN3 A;  3BBR A;  4YIC A;  4NF8 A;  4G77 A;  1JNF A;  2A5S A;  2O6A A;  1FTL A;  1MQI A;  3FGS A;  1OVB A;  1D3K A;  3T9V A;  2ZNT A;  4RNS A;  1B7Z A;  5ITP A;  1EZP A;  1IXG A;  2XXH A;  4YZZ A;  2DWI A;  3OO9 A;  3CVG A;  1AOV A;  4DIG A;  4EXL A;  1DPP A;  4KYE A;  3SEU A;  2F6P A;  4LP2 B;  1OLC A;  3G3J A;  2HQ0 A;  4Q5T A;  3M3L A;  4ELQ A;  4NF5 A;  5HBC A;  3O29 A;  3TTL A;  1QVS A;  1DTG A;  5H8F B;  4U1O A;  1UIV A;  4OWD A;  1PC3 A;  2X7Q A;  1AMF A;  1MY4 A;  3KGC A;  1PB9 A;  2I3V A;  4DCX A;  4H6D A;  3QUF A;  3TPA A;  1JQF A;  3CR9 A;  1SW5 A;  1Y20 A;  2F7B A;  4LAT A;  3T9U A;  3THI A;  1Y4T A;  3RY3 A;  2V3U A;  3VLU A;  2HZL A;  3PUW E;  3U93 A;  4G4P A;  2QS1 A;  2V3Q A;  3FVO A;  1SI0 A;  1Y3P A;  1YPN A;  3PPO A;  3K02 A;  1M5E A;  4JBZ A;  2UVG A;  1IUD A;  4EF2 A;  4DDD A;  2XX8 A;  2O51 A;  4OVJ A;  1Z7N E;  3HN0 A;  2ONK E;  4GRK A;  4X1B A;  2OLB A;  4KD5 A;  4IO7 A;  4YKK A;  2RCA A;  3HHF A;  4ELO A;  4I1D A;  1XOC A;  3JV9 A;  4ZZA A;  2PT1 A;  4R9F A;  5KCJ A;  3OOA A;  3PUZ E; 
#chains in the Genus database with same CATH topology
 1MPD A;  2XWK A;  5ISU A;  2HXR A;  1MQD A;  3PUV E;  4YKI A;  4ZS9 A;  1LBY A;  4F31 B;  5A5L A;  1JP4 A;  4IGR A;  3FV1 A;  1JVX A;  2UYE A;  3MP6 A;  4PAK A;  3E79 A;  3H3G A;  4DCY A;  2O1L A;  4PET A;  3JYR A;  4JB7 A;  4MMP A;  1USY E;  4YB6 A;  4N17 A;  1FQB A;  4GWS A;  1PDA A;  1FBE A;  2I0C A;  1NI9 A;  1MDP 1;  3I6V A;  2XA5 A;  3FAT A;  3LUZ A;  3S2V A;  5TP9 B;  1NNK A;  2FYI A;  1RYX A;  3LSX A;  2PYY A;  3W9W A;  1N3X A;  3O97 A;  4TLL B;  4RPN A;  3IJO B;  3FVN A;  4XFE A;  1I6A A;  2XXI A;  3FVG A;  1Y4C A;  4BDQ A;  4N6P A;  3H6U A;  4NHB A;  2VHA A;  2H25 A;  5ET7 A;  2W7Y A;  4FAT A;  4OER A;  1NNP A;  3KZG A;  3MYU A;  1R6Z A;  3U94 A;  3IB2 A;  2OK2 A;  4NG7 A;  3MC2 A;  3CIJ A;  3S9M C;  1B5J A;  3RLF E;  4TQU Q;  4X04 A;  1I6B A;  2XWI A;  1MH3 A;  2Y84 A;  4P47 A;  2BJI A;  2P2A A;  4R72 A;  3EQ1 A;  3BFT A;  1URG A;  5AA4 A;  1INP A;  3KSX A;  4OFL A;  3V89 B;  3OEK A;  1L5T A;  5ICQ A;  5EYF A;  1FSA A;  4IO4 A;  1FPD A;  2H4I A;  4C1T A;  3UP9 A;  1DMB A;  1N3W A;  5HPQ A;  4IGT A;  4ESW A;  3TQW A;  4PTK A;  5H8H A;  4H65 A;  1FBP A;  4F1U A;  2Z8F A;  4MEV A;  5L9O A;  1MM7 A;  4U1Z A;  4JWX A;  1JEV A;  2I48 A;  4QRZ A;  2QMX A;  3EHU A;  1A7L A;  3TTK A;  2QS4 A;  2B3F A;  2VP1 A;  2DQV A;  2HEU A;  1B9J A;  4O3C A;  2O69 A;  3OO6 A;  2L5V A;  1YXI A;  3KN3 A;  2O84 X;  2F36 A;  2RKM A;  4NED A;  4QFN A;  1P1Q A;  3LR1 A;  4GQO A;  4QBA A;  1FTK A;  4OHN A;  4PCD A;  3KOT A;  3K1P A;  2G93 A;  2ONS A;  3TOD A;  4G68 A;  5I84 A;  4KCC A;  3K1N A;  1LBZ A;  4ELP A;  2DWJ A;  4JDF A;  2RC8 A;  3G3F A;  1D9Y A;  1B3F A;  2FHY A;  1VE4 A;  3F11 A;  4LN5 A;  2UYF A;  3HFU A;  3VLV A;  3MWB A;  1QUJ A;  3PPP A;  3C36 A;  4F3S A;  4ZEB A;  5FBP A;  3SEY A;  4PDH A;  4U4X A;  1A8E A;  4G2Z A;  4EQ7 A;  1NUW A;  1OLA A;  1A55 A;  1LGB C;  5IM2 A;  3T93 B;  3VDF A;  2H98 A;  4ZEC A;  4GL8 A;  1WOD A;  1XI6 A;  2UVH A;  4RY1 A;  2G29 A;  1TT1 A;  1EZ9 A;  4FEC A;  1ZJL A;  5FTI A;  1CB6 A;  2P1S A;  1IXI A;  3C34 A;  3IOT A;  4YMB A;  2XD3 A;  4QSE A;  3U1O A;  2QPQ A;  3OO7 A;  3TTR A;  3I3V A;  3RPL A;  5EQ7 A;  3TCG A;  3TYH A;  4P1E A;  5EYH A;  2XXU A;  3CRB A;  3KBZ A;  5H8N B;  1NMU A;  3R6U A;  2I4B A;  1B7U A;  3VVF A;  4ESX A;  4MLQ A;  1CE2 A;  3C32 A;  1MXV A;  4F2O A;  1TWY A;  4BDO A;  3O6H A;  1KWH A;  5IAI A;  4U4S A;  2F8D A;  4JSO A;  1MPC A;  4M4G A;  2QSX A;  4JVI A;  3T0J A;  2NUV A;  5DT6 A;  2QRY A;  1SBP A;  3EPE A;  1AWB A;  3TDJ A;  3CFL A;  4POW A;  3G3G A;  2BJJ X;  3MAM A;  2GH9 A;  4GX3 A;  1MXZ A;  4R74 A;  2HFB A;  5I2N B;  2DE4 A;  3EKI A;  3EHT A;  4FEB A;  4H8I A;  5KDT A;  4XEQ A;  4GX4 A;  1MDQ A;  3A3U A;  1CNQ A;  4PF8 A;  4NWC A;  1OQH A;  4WEP A;  3ODB A;  1SDX A;  1IMA A;  1B1H A;  2QMW A;  4NF8 B;  4HE1 A;  2CEX A;  4NTL A;  3OO8 A;  2R71 A;  1R9Q A;  4PQJ A;  1MQH A;  2FA7 A;  4JXI A;  1ZTY A;  1NUZ A;  2HAU A;  1JW1 A;  2VPO A;  1II5 A;  2QJE A;  3H6T A;  5IZ3 A;  4RJZ A;  1I69 A;  3ROJ A;  1AIV A;  2NOO A;  3O6I A;  4JVD A;  4XXU A;  1D4N A;  4RPO A;  5BUU A;  3LV0 A;  4ZEI A;  1B4Z A;  2OJT A;  2WBD A;  1FW0 A;  1O63 A;  4DXB A;  3CFX A;  4IO5 A;  2F3D A;  2DS9 A;  2XHD A;  2ZXT A;  4LUB A;  4FJP A;  3E3K A;  4MNI A;  3N5L A;  4H45 A;  2XWV A;  2B65 A;  3KFM A;  4NQ8 A;  3E9X A;  3DM0 A;  4EXK A;  2Y5K A;  4NF5 B;  2KLF A;  3KN7 A;  3FXU A;  5I59 A;  4DXU A;  1MRP A;  5J1D A;  2NXO A;  2Q74 A;  4NWD A;  2HXW A;  1RKM A;  4MIJ A;  2HCA A;  4YB5 A;  3UGW A;  5L8D A;  2WBB A;  1Y3Q A;  2CZI A;  4ZEF A;  5CM6 A;  3U8Q A;  1PB7 A;  4QSC A;  1UQW A;  3MVZ A;  1P1O A;  4DLD A;  4XKR A;  2FNC A;  4N6D A;  4OET A;  1LB9 A;  3T9X B;  4ZE9 A;  4KYS A;  4TOZ A;  3IOW A;  4F1Y A;  3QK6 A;  1SVX B;  1B6H A;  1XHY A;  1FJ9 A;  1FTO A;  4KQP A;  1DCU A;  2H5Y A;  1B3H A;  3PMX A;  4KYD A;  3TTN A;  4XKN A;  3ISP A;  4LQ2 A;  4F3P A;  4R73 A;  4P56 A;  5I56 A;  3C35 A;  3DEL B;  4O3B A;  1B3G A;  4R75 A;  5EHS A;  5DEX A;  3V83 A;  2XX7 A;  4YAH X;  5CMB A;  1UTB A;  3UIF A;  2V93 A;  3TKD A;  3FAS A;  4GVO A;  4R9G A;  3IFA A;  2XX9 A;  3I5O A;  5I2K A;  1B4H A;  5KCJ B;  3UN6 A;  3N94 A;  1B52 A;  1RDZ A;  2F7A A;  1P1U A;  2ESN A;  4U2R A;  3ILT B;  4N81 A;  3HHG A;  3ZKK A;  3KOS A;  2F6G A;  1LST A;  5CC2 A;  3Q27 A;  1N84 A;  1YCJ A;  4OEV A;  3TCH A;  4K3F A;  4F22 A;  1PBQ A;  3FJ7 A;  3D4C A;  4AS5 A;  4P1L A;  4KFQ A;  3TEP A;  1LCF A;  5JK4 A;  1Y1M A;  2NWJ A;  4PAF A;  1B05 A;  1TFD A;  2ZNS A;  4U23 A;  3RQT A;  4OZ9 A;  5M2V A;  1NV5 A;  2GHB A;  2OCU A;  3CFZ A;  4MAG A;  1PB8 A;  2V4C A;  2MKZ A;  1LBW A;  5I3S A;  2NVU B;  4NN3 A;  4OFJ A;  4OVP A;  4X1D A;  4DI3 D;  4YB7 A;  1K9Z A;  3G3K A;  2O7I A;  5LOM A;  4EUO A;  1IXC A;  3O6G A;  1EYJ A;  1BLF A;  3MZ9 A;  1FQC A;  2XXW A;  1FPK A;  1LFI A;  1FPJ A;  4Z7E A;  3B6W A;  2HPG A;  3K6X A;  3MJN A;  1F9B A;  1B51 A;  3C31 A;  4F39 A;  4I9D A;  4X8R A;  2GQ1 A;  5H8Q A;  1FPF A;  3PTY A;  5CRY A;  5AA4 B;  3T96 B;  4P9K A;  5I58 A;  1N7W A;  1KA0 A;  2Y7W A;  5AA2 D;  3PUY E;  1IEJ A;  4IO3 A;  1MXY A;  1ZLQ A;  2AYS A;  2ONR A;  2VGQ A;  2DWH A;  1B3E A;  2D21 A;  5TPA A;  4WXJ A;  3ZSF A;  5H8H B;  1BTJ A;  1DK4 A;  3O28 A;  4UAC A;  1IXH A;  2I3W A;  1ATG A;  3IX1 A;  3VXB A;  2O1M A;  3HST A;  1QW0 A;  2LAO A;  3SEW A;  2D5W A;  4R6H A;  3GYY A;  4YKJ A;  2REJ A;  4GBV A;  5IKB A;  3G3I A;  1M5F A;  4MF3 A;  4EDP A;  3P7I A;  2F34 A;  2DDK A;  1IIW A;  4N4U A;  4IO6 A;  3T9H B;  4HE0 A;  1UTH A;  1LB8 A;  2YLN A;  2Y7P A;  4NF4 A;  3H7M A;  3SEV A;  1NNT A;  5EQA A;  3KG2 A;  1JW4 A;  3OEN A;  1UIU A;  4G68 B;  1PEB A;  4MX6 A;  3UA8 A;  2ZMB A;  4LZ7 A;  3KC1 A;  3GBA A;  1H3D A;  4RK2 A;  2H99 A;  1RYO A;  4ISU A;  4HW8 A;  3MP8 A;  1SYI A;  3ECR A;  1DTZ A;  1N76 A;  2REG A;  2IA4 A;  4H5G A;  2AL4 A;  1TFA A;  4O7I A;  2IEE A;  5FHN A;  1N04 A;  1VFE A;  3B8B A;  2QS2 A;  2QVU A;  4E0X A;  4HS7 A;  3C33 A;  3IOV A;  1WDN A;  4JSD A;  2UXA A;  3RT6 B;  3BIG A;  4QSD A;  4DZ1 A;  4RYA A;  4NF6 A;  1S9T A;  3SER A;  2E1S A;  4GL0 A;  1HSJ A;  4KHZ E;  2I58 A;  5B70 A;  1Y9U A;  4AS4 A;  2B3B A;  2RCB A;  4PFT A;  2KQZ A;  1VR5 A;  1B5I A;  4PP0 A;  1QKB A;  1S50 A;  1NV7 A;  3KSJ A;  2F7C A;  4MNC A;  1B3L A;  2ALU A;  4GX6 A;  3RPL B;  3H6V A;  2A5T A;  1MY2 A;  3T66 A;  4BDR A;  4R2B A;  4QFL A;  4I3E A;  3TZA A;  3GXA A;  1GTK A;  2PT2 A;  3O9P A;  4H67 A;  4G61 A;  1FQD A;  4QF9 A;  1KA1 A;  3K6V A;  2DVZ A;  3IO6 A;  3DP6 A;  2Z8D A;  1NV4 A;  3FD3 A;  4PFR A;  2Y7R A;  3K2D A;  4F19 A;  5K2X A;  3H4Z A;  1JW5 A;  4O7M A;  1HSL A;  4ND9 A;  1US4 A;  2O68 A;  2QL3 A;  1VSO A;  4P11 A;  5ICT A;  4HXV A;  5BWJ A;  2PFZ A;  1YTV A;  5CMM A;  4H1X A;  5DVJ A;  3EHS A;  3VFJ A;  5AA3 A;  4F18 A;  2PFY A;  1LBX A;  2GRV A;  3MPL A;  5F1Q A;  2RF1 A;  1JVY A;  5AA1 A;  1SW1 A;  3R7X A;  1ANF A;  1FPB A;  2OWZ A;  4WKM A;  5ET6 A;  1Z7M E;  2Q8J A;  4PE5 B;  4F3B A;  4BLA A;  4NX1 A;  3CSB A;  5HM4 B;  5KDT B;  4R6Y A;  1B2H A;  1B5H A;  5T3J A;  1DBZ A;  2THI A;  2Y7I A;  1LLS A;  1EYK A;  4OMB A;  3G7W A;  2I0B A;  3CSG A;  4Q8R A;  5ITO A;  1SQY A;  1MXU A;  1URD A;  2I4C A;  3DP4 A;  1FTM A;  5K2Y A;  2FIE A;  2QVV A;  3SEX A;  5LDZ A;  5IZ3 B;  4O3A A;  4PFW A;  1USY H;  2X26 A;  1SI1 A;  5L9S A;  3KEI A;  4N91 A;  1XVX A;  2R8T A;  1SPI A;  3VE1 B;  2CZH A;  1NV0 A;  1O7T A;  2HAV A;  1FQF A;  3L6H A;  1VFD A;  1LEV A;  4OQO A;  5CBR A;  3PV0 E;  2Q2C A;  2D3I A;  5F7V A;  2QVR A;  1FBD A;  1B58 A;  2Y5L A;  2RIN A;  2F35 A;  1EU8 A;  4DXC A;  5JTY A;  1IMB A;  2F97 A;  1ZIU A;  4NAP A;  5EQ8 A;  2QFL A;  3MW0 A;  3Q25 A;  3PGF A;  3H6W A;  5I59 B;  2XD2 A;  4RXL A;  1H44 A;  1MQG A;  2Z8E A;  1NKX A;  2XXK A;  3TCF A;  3MZB A;  1NH7 A;  2ZZX A;  1ZMG A;  1LAF E;  4OXV A;  4LON B;  2VD2 A;  4FED A;  5A5X A;  1US5 A;  1J1N A;  4LA9 A;  1YZ0 A;  3H03 A;  2RC7 A;  4GWZ A;  3PUX E;  4ZEK A;  1SD3 A;  3FXR A;  3M8U A;  4QHQ A;  4ONY A;  3K1M A;  1LBC A;  2KR0 A;  4IO2 A;  3GZG A;  5KZT A;  4PE3 A;  2XXX A;  3Q26 A;  4PGN A;  4I62 A;  2RC9 A;  1XVY A;  1Q35 A;  5ELV A;  4AB6 A;  1M5D A;  4R6K A;  2OZZ A;  3T22 A;  3IK6 B;  3UOR A;  3BKI B;  3VXC A;  4GWU A;  2DVC A;  1I6Q A;  5I56 B;  4FOR A;  2OWS A;  1H76 A;  1A8F A;  4BDM A;  5DEX B;  4DI4 B;  1UTB B;  1H43 A;  1SYH A;  3OSQ A;  3OEL A;  1DPE A;  5DVI A;  1O64 A;  3V5A A;  2YPN A;  5EQ9 A;  4AB5 A;  3FBP A;  3MQ9 A;  4AQ4 A;  5I2K B;  4TLM B;  1POT A;  4R2F A;  2XXV A;  3FVK A;  2F3B A;  3TMG A;  1SW2 A;  3MVW A;  3IB1 A;  3PPR A;  1IMC A;  4HCW A;  3LBS A;  4UAB A;  3MST A;  2DP8 A;  3OSR A;  3IOU A;  5FHO A;  4C1U A;  4OVQ A;  4F2Q A;  5I57 A;  2E0S A;  2ZYN A;  1FPG A;  2Q89 A;  4OTE A;  4LZ5 A;  4XTC Q;  3CG1 A;  3N26 A;  3M3F A;  4MH5 A;  4GWY A;  1FBH A;  1XT8 A;  5I7I A;  2JJK A;  1NV1 A;  2FIX A;  1XS5 A;  3QMF A;  4Z0I A;  5JEI A;  3G3H A;  4G8N A;  1LAX A;  1R1N A;  3B7D A;  1FBG A;  2ABH A;  5I5P A;  2OWT A;  3Q28 A;  2YJP A;  2HZK A;  3V8X B;  1POY 1;  1IMF A;  5ET8 A;  4MHF A;  1ZKB A;  1D9V A;  1GVC A;  4KI0 E;  1URS A;  1B0L A;  1MM6 A;  3D1R A;  2P3V A;  4G8M A;  1FTJ A;  3RGY A;  1Q1K A;  1B0H A;  5DTB A;  1OIB A;  5DYH A;  1G0I A;  4H5F A;  3K6W A;  2P0S A;  3HCQ A;  3D4G A;  3RPW A;  5H8Q B;  3KJ7 A;  4MNP A;  4H0W A;  1FTA A;  1N7X A;  5LTC A;  5AA2 B;  1IQ7 A;  4P0G A;  3M3K A;  3R26 A;  5I58 B;  4I40 A;  4GBW A;  2FBP A;  4EQB A;  3PMV A;  2CZK A;  2ZYM A;  1TXF A;  1QJM A;  1IME A;  1AH5 A;  3RUM A;  3EF7 A;  4QFP A;  1NV6 A;  5TPA B;  4XKQ A;  3TUS A;  1IMD A;  2XXR A;  4EF1 A;  1A54 A;  1VDW A;  1B1X A;  4F3G A;  4PBQ A;  3K0V A;  4BDN A;  4N13 A;  5CMK A;  4X9T A;  2Z23 A;  1P1N A;  3MVY A;  3S9E A;  3CI8 A;  4OEN A;  5J16 A;  3QAX A;  3K01 A;  4EQ9 A;  4NE4 A;  1A40 A;  1NUY A;  4HTG A;  3RTF B;  2OX3 A;  1JEU A;  1UTH B;  2CEY A;  2DYX A;  1LAH E;  5H8F A;  4P3L A;  4ZZE A;  4NF4 B;  2UVI A;  3B6T A;  3U72 A;  3K4U A;  4PAI A;  5CI5 A;  4GF8 A;  3VVE A;  3DLN A;  4H8J A;  4THI A;  3K00 A;  2PMS A;  4XIG Q;  4JVC A;  4JWO A;  5AA2 A;  4PBH A;  4H46 A;  2CMO A;  4LQ5 A;  4O8M A;  1M5C A;  3GLB A;  1MG1 A;  1JET A;  3RYD A;  3IR1 A;  3IAZ A;  3DP8 A;  3SDF A;  5DW8 A;  3RT8 A;  1N0T A;  1BP5 A;  3C9H A;  3UK4 A;  4NF6 B;  3WAE A;  2DOJ A;  4X48 A;  1PBP A;  2XXP A;  3IFC A;  5IZZ A;  2M8C A;  1RDY A;  4FIM A;  3LC8 A;  3FXQ A;  2DE3 A;  4HCY A;  4G68 C;  4I8C A;  4GIZ A;  3N6U A;  5ET5 A;  1MY3 A;  3PD9 A;  4MJO A;  4KR5 A;  1MXX A;  2V84 A;  1P1W A;  2ANJ A;  3PMW A;  4YU0 A;  3VV5 A;  1LAG E;  4G8H A;  2Q88 A;  2A5T B;  3IB0 A;  4DE8 A;  2Y7K A;  4KPT A;  3PPQ A;  4U21 A;  1S7Y A;  1SW4 A;  1P99 A;  3FJM A;  1ZBM A;  3U92 A;  2ZZV A;  2DE2 A;  3MVX A;  3C4M A;  3HO7 A;  1MPB A;  3MZ1 A;  1ELJ A;  4PFY A;  4YKP A;  4PFI A;  2CZL A;  1A99 A;  2VT5 A;  3S9L C;  1MY1 A;  4GOT A;  3O2A A;  2WYP A;  3E13 X;  3ZS6 A;  1MH4 A;  3USD A;  1EZO A;  3U65 A;  4BDL A;  3ILU B;  3FJG A;  2WKY A;  4GD5 A;  2R6G E;  5TP9 A;  4IR8 A;  2ZZW A;  3AXF A;  3MUQ A;  3E78 A;  3TFL A;  3B50 A;  2ZYK A;  1MS7 A;  4LZ8 A;  1B7H A;  3IOR A;  1QUK A;  5L9M A;  4ELR A;  3T1B A;  4QFK A;  5FTH A;  1OMP A;  3TTM A;  3FXB A;  1M5B A;  3QYT A;  4OA4 A;  1YAE A;  3QSL A;  3BIH A;  4GFR A;  2AIX A;  5EHM A;  3SET A;  3MBP A;  2WYK A;  2FVZ A;  2X7P A;  1QUL A;  2QS3 A;  4KXP A;  4HE2 A;  3H06 B;  4QFO A;  1QUI A;  3SZP A;  3KN8 A;  2DXR A;  2DXY A;  1H45 A;  3W9V A;  3CHG A;  3VVD A;  4GWX A;  4P0I A;  4ZDM A;  3E4R A;  1Y1Z A;  4GXS B;  4GLI A;  1FQA A;  4E0W A;  4MLV A;  1LBB A;  4XF5 A;  3RN8 A;  2GHA A;  2XXQ A;  3A09 A;  2O7U A;  1OVT A;  3HV1 A;  3OXN A;  4GXA A;  1GV8 A;  4RK9 A;  1GR2 A;  5B7D A;  2H9B A;  4FE8 A;  5JTY B;  2UVJ A;  3FV2 A;  4U22 A;  4ZED A;  5H8S A;  4OFO A;  1MY0 A;  2ZYO A;  4UA8 A;  1HSE A;  2I6E A;  4OVS A;  2VPN A;  5CBS A;  1DSN A;  3VLW A;  4FAJ A;  2Q2A A;  5CMC A;  4N07 A;  4OVR A;  1LFG A;  5ESY A;  3Q29 A;  2F5X A;  1OQG A;  3PU5 A;  1B32 A;  2GFE A;  4XKP A;  5FHM A;  3ONM A;  1GGG A;  1LBV A;  5A5X B;  3N6T A;  1IIT A;  2XXT A;  3CG3 A;  2R9J A;  3PD8 A;  1NV3 A;  3SKP A;  3RNN A;  2PBW A;  1LFH A;  2DWA A;  1BK4 A;  3O66 A;  3L6G A;  4M1V A;  2PX1 A;  3IL1 B;  1Y3N A;  1EYI A;  2I49 A;  3K6U A;  4N15 A;  1XC1 A;  3S9N C;  3MPK A;  5AE4 A;  4MBP A;  2Q9T A;  4QXD A;  4MFI A;  1QKA A;  4N8G A;  3OEM A;  3TQL A;  1B40 A;  2Z22 A;  2OBG A;  2V25 A;  4PC9 A;  1DOT A;  1WVJ A;  4I3Y A;  1MQJ A;  1NH8 A;  4N8Y A;  3FUZ A;  3KBR A;  3W15 C;  3LUY A;  4F29 A;  1LCT A;  4IY5 A;  3B6Q A;  3SES A;  3OMB A;  1R9L A;  2WX9 A;  2XXY A;  3S4U A;  2WEF A;  2V3T A;  4RA1 A;  4PFU A;  3OD7 A;  5IZ1 A;  4OYV A;  3IO4 A;  3IJX B;  4L17 A;  1FRP A;  4YMA A;  3QUJ A;  2ZNU A;  3FZV A;  3GBB A;  3PPN A;  3BFU A;  3MP1 A;  1FPE A;  4JWY A;  4PFB A;  3NOH A;  3LSL A;  4POX A;  1FBF A;  5I57 B;  3LSF B;  2PVU A;  2DSF A;  4FBP A;  1IZ1 A;  5H8N A;  2AL5 A;  3HPI A;  3TAJ A;  2VOZ A;  1NNF A;  1FQE A;  4Q0C A;  1B46 A;  3KJT A;  3ZKL A;  4ECF A;  4LVQ A;  1AL3 A;  4KCD A;  3RTW B;  1NFT A;  3A3C A;  1EH3 A;  4NMY A;  1BIY A;  4Q30 B;  1NL5 A;  4WED A;  2Q8M A;  4F1V A;  4OES A;  4GWO A;  4NF0 A;  1FJ6 A;  4IB2 A;  1T0K A;  4IY6 A;  1ZU0 A;  4GWW A;  2F78 A;  4O94 A;  3WAF A;  5DVF A;  4ZE8 A;  1FCK A;  5TU0 A;  3LSW A;  3QIM A;  4OVT A;  3QXM A;  4C0R A;  3TEL A;  2P3N A;  1BKA A;  4PDD A;  3FIR A;  5I2N A;  4NGU A;  2VD3 A;  4OEU A;  1NV2 A;  3JZJ A;  1MXW A;  3EN3 A;  3BBR A;  1FPL A;  4YIC A;  2B4L A;  4PF6 A;  4NF8 A;  4G77 A;  1JNF A;  1NUX A;  1FBC A;  2A5S A;  2PCR A;  2O6A A;  1FTL A;  1K9Y A;  1QGX A;  1MQI A;  2B4M A;  3FGS A;  1OVB A;  1D3K A;  3T9V A;  2ZNT A;  1RDX A;  4RNS A;  1B7Z A;  5ITP A;  1EZP A;  1IXG A;  1D9Q A;  2XXH A;  4YZZ A;  2DWI A;  3OO9 A;  4MCO A;  3CVG A;  1AOV A;  4DIG A;  4EXL A;  1DPP A;  4KYE A;  3SEU A;  2F6P A;  4LP2 B;  1OLC A;  3G3J A;  2HQ0 A;  4Q5T A;  3M3L A;  4ELQ A;  4PGP A;  4NF5 A;  5HBC A;  3O29 A;  3TTL A;  1QVS A;  1DTG A;  5H8F B;  4U1O A;  1UIV A;  4OWD A;  1PC3 A;  2X7Q A;  1AMF A;  1MY4 A;  2XWO A;  3KGC A;  1PB9 A;  2I3V A;  4DCX A;  3KC0 A;  1FPI A;  4H6D A;  3QUF A;  3TPA A;  5F24 A;  5EYG A;  1JQF A;  1KZ8 A;  3CR9 A;  1SW5 A;  1Y20 A;  1YYZ A;  2F7B A;  4LAT A;  3T9U A;  3THI A;  1Y4T A;  3RY3 A;  2V3U A;  3VLU A;  5IGA A;  2HZL A;  3PUW E;  3U93 A;  4G4P A;  2QS1 A;  4P8B A;  2V3Q A;  3FVO A;  1SI0 A;  1Y3P A;  1YPN A;  3PPO A;  1G0H A;  3K02 A;  4OAN A;  1M5E A;  4JBZ A;  2UVG A;  4N6K A;  1IUD A;  4DDD A;  2XX8 A;  4EF2 A;  2O51 A;  4OVJ A;  1Z7N E;  3HN0 A;  2ONK E;  3A29 A;  4GRK A;  4X1B A;  2OLB A;  4KD5 A;  4IO7 A;  4YKK A;  2RCA A;  3HHF A;  4ELO A;  4I1D A;  2HHM A;  1Q9D A;  1XOC A;  3JV9 A;  4ZZA A;  2PT1 A;  4R9F A;  5KCJ A;  3OOA A;  3PUZ E; 
#chains in the Genus database with same CATH homology
 1MPD A;  5ISU A;  1MQD A;  3PUV E;  4YKI A;  4ZS9 A;  4F31 B;  4IGR A;  3FV1 A;  1JVX A;  2UYE A;  3MP6 A;  3H3G A;  4DCY A;  2O1L A;  4PET A;  3JYR A;  4JB7 A;  1USY E;  4YB6 A;  1FQB A;  1PDA A;  2I0C A;  1MDP 1;  3I6V A;  3FAT A;  3S2V A;  5TP9 B;  1NNK A;  2FYI A;  1RYX A;  3LSX A;  2PYY A;  3W9W A;  1N3X A;  3O97 A;  4TLL B;  4RPN A;  3IJO B;  3FVN A;  1I6A A;  2XXI A;  3FVG A;  1Y4C A;  4BDQ A;  4N6P A;  3H6U A;  2VHA A;  2H25 A;  2W7Y A;  4FAT A;  4OER A;  1NNP A;  3KZG A;  1R6Z A;  3U94 A;  3IB2 A;  2OK2 A;  3MC2 A;  3CIJ A;  3S9M C;  1B5J A;  3RLF E;  4TQU Q;  1I6B A;  1MH3 A;  2Y84 A;  2P2A A;  4R72 A;  3EQ1 A;  3BFT A;  1URG A;  5AA4 A;  3KSX A;  4OFL A;  3V89 B;  3OEK A;  1L5T A;  5ICQ A;  5EYF A;  4IO4 A;  2H4I A;  4C1T A;  3UP9 A;  1DMB A;  1N3W A;  5HPQ A;  4IGT A;  4ESW A;  3TQW A;  5H8H A;  4H65 A;  4F1U A;  2Z8F A;  5L9O A;  1MM7 A;  4U1Z A;  4JWX A;  1JEV A;  2I48 A;  4QRZ A;  2QMX A;  3EHU A;  1A7L A;  3TTK A;  2QS4 A;  2B3F A;  2VP1 A;  2DQV A;  2HEU A;  1B9J A;  4O3C A;  2O69 A;  3OO6 A;  3KN3 A;  2O84 X;  2F36 A;  2RKM A;  4NED A;  4QFN A;  1P1Q A;  3LR1 A;  4GQO A;  1FTK A;  4OHN A;  3KOT A;  3K1P A;  2G93 A;  2ONS A;  3TOD A;  4G68 A;  5I84 A;  4KCC A;  3K1N A;  4ELP A;  2DWJ A;  4JDF A;  2RC8 A;  3G3F A;  1D9Y A;  1B3F A;  1VE4 A;  3F11 A;  2UYF A;  3VLV A;  3MWB A;  1QUJ A;  3PPP A;  3C36 A;  4F3S A;  4ZEB A;  3SEY A;  4U4X A;  1A8E A;  4G2Z A;  4EQ7 A;  1OLA A;  1A55 A;  1LGB C;  3T93 B;  3VDF A;  2H98 A;  4ZEC A;  4GL8 A;  1WOD A;  2UVH A;  4RY1 A;  2G29 A;  1TT1 A;  1EZ9 A;  4FEC A;  1ZJL A;  5FTI A;  1CB6 A;  2P1S A;  1IXI A;  3C34 A;  3IOT A;  4YMB A;  2XD3 A;  4QSE A;  3U1O A;  2QPQ A;  3OO7 A;  3TTR A;  3I3V A;  3TCG A;  3TYH A;  2XXU A;  3CRB A;  5H8N B;  1NMU A;  3R6U A;  2I4B A;  1B7U A;  3VVF A;  4ESX A;  4MLQ A;  1CE2 A;  3C32 A;  1MXV A;  4F2O A;  1TWY A;  4BDO A;  3O6H A;  1KWH A;  5IAI A;  4U4S A;  2F8D A;  4JSO A;  1MPC A;  4M4G A;  2QSX A;  2NUV A;  5DT6 A;  2QRY A;  1SBP A;  3EPE A;  3TDJ A;  3CFL A;  4POW A;  3G3G A;  2BJJ X;  3MAM A;  2GH9 A;  1MXZ A;  4R74 A;  2HFB A;  5I2N B;  2DE4 A;  3EHT A;  4FEB A;  4H8I A;  5KDT A;  1MDQ A;  3A3U A;  4NWC A;  1OQH A;  4WEP A;  3ODB A;  1SDX A;  1B1H A;  2QMW A;  4NF8 B;  4NTL A;  3OO8 A;  2R71 A;  1R9Q A;  4PQJ A;  1MQH A;  2FA7 A;  4JXI A;  1ZTY A;  2HAU A;  1JW1 A;  1II5 A;  2QJE A;  3H6T A;  4RJZ A;  1I69 A;  1AIV A;  2NOO A;  3O6I A;  4XXU A;  1D4N A;  4RPO A;  5BUU A;  4ZEI A;  1B4Z A;  2OJT A;  1FW0 A;  1O63 A;  4DXB A;  3CFX A;  4IO5 A;  2DS9 A;  2XHD A;  2ZXT A;  4LUB A;  4FJP A;  3E3K A;  3N5L A;  2B65 A;  3KFM A;  3E9X A;  3DM0 A;  4EXK A;  4NF5 B;  2KLF A;  3KN7 A;  3FXU A;  5I59 A;  4DXU A;  1MRP A;  5J1D A;  2NXO A;  4NWD A;  2HXW A;  1RKM A;  2HCA A;  4YB5 A;  3UGW A;  5L8D A;  1Y3Q A;  4ZEF A;  5CM6 A;  3U8Q A;  1PB7 A;  4QSC A;  1UQW A;  3MVZ A;  1P1O A;  4DLD A;  4XKR A;  2FNC A;  4OET A;  1LB9 A;  3T9X B;  4ZE9 A;  4KYS A;  4TOZ A;  3IOW A;  4F1Y A;  3QK6 A;  1SVX B;  1B6H A;  1XHY A;  1FTO A;  4KQP A;  2H5Y A;  1B3H A;  3PMX A;  4KYD A;  3TTN A;  4XKN A;  4LQ2 A;  4F3P A;  4R73 A;  5I56 A;  3C35 A;  3DEL B;  4O3B A;  1B3G A;  4R75 A;  5EHS A;  5DEX A;  3V83 A;  2XX7 A;  4YAH X;  5CMB A;  1UTB A;  3UIF A;  2V93 A;  3TKD A;  3FAS A;  4GVO A;  4R9G A;  2XX9 A;  3I5O A;  5I2K A;  1B4H A;  5KCJ B;  3UN6 A;  3N94 A;  1B52 A;  2F7A A;  1P1U A;  2ESN A;  4U2R A;  3ILT B;  3ZKK A;  3HHG A;  3KOS A;  2F6G A;  1LST A;  5CC2 A;  3Q27 A;  1N84 A;  1YCJ A;  4OEV A;  3TCH A;  4K3F A;  4F22 A;  1PBQ A;  3FJ7 A;  3D4C A;  4KFQ A;  3TEP A;  1LCF A;  5JK4 A;  1Y1M A;  2NWJ A;  1B05 A;  1TFD A;  2ZNS A;  4U23 A;  3RQT A;  4OZ9 A;  5M2V A;  2GHB A;  2OCU A;  3CFZ A;  1PB8 A;  2NVU B;  4OFJ A;  4X1D A;  4YB7 A;  3G3K A;  2O7I A;  5LOM A;  4EUO A;  1IXC A;  3O6G A;  1BLF A;  3MZ9 A;  1FQC A;  2XXW A;  1LFI A;  4Z7E A;  3B6W A;  3K6X A;  3MJN A;  1F9B A;  1B51 A;  3C31 A;  4F39 A;  4I9D A;  5H8Q A;  5CRY A;  5AA4 B;  3T96 B;  5I58 A;  1N7W A;  2Y7W A;  5AA2 D;  3PUY E;  1IEJ A;  4IO3 A;  1MXY A;  1ZLQ A;  2AYS A;  2ONR A;  2VGQ A;  2DWH A;  1B3E A;  2D21 A;  5TPA A;  4WXJ A;  3ZSF A;  5H8H B;  1BTJ A;  3O28 A;  4UAC A;  1IXH A;  2I3W A;  1ATG A;  3IX1 A;  3VXB A;  2O1M A;  3HST A;  1QW0 A;  2LAO A;  3SEW A;  2D5W A;  4R6H A;  4YKJ A;  2REJ A;  5IKB A;  3G3I A;  1M5F A;  4MF3 A;  4EDP A;  3P7I A;  2F34 A;  1IIW A;  4IO6 A;  3T9H B;  1UTH A;  1LB8 A;  2YLN A;  2Y7P A;  4NF4 A;  3H7M A;  3SEV A;  1NNT A;  3KG2 A;  1JW4 A;  3OEN A;  1UIU A;  4G68 B;  1PEB A;  3UA8 A;  2ZMB A;  4LZ7 A;  3GBA A;  1H3D A;  4RK2 A;  2H99 A;  1RYO A;  4ISU A;  4HW8 A;  3MP8 A;  1SYI A;  3ECR A;  1DTZ A;  1N76 A;  2REG A;  2IA4 A;  4H5G A;  2AL4 A;  1TFA A;  2IEE A;  5FHN A;  1N04 A;  1VFE A;  2QS2 A;  4E0X A;  4HS7 A;  3C33 A;  3IOV A;  1WDN A;  4JSD A;  2UXA A;  3RT6 B;  4QSD A;  4DZ1 A;  4RYA A;  4NF6 A;  1S9T A;  3SER A;  2E1S A;  4GL0 A;  1HSJ A;  4KHZ E;  2I58 A;  5B70 A;  1Y9U A;  2B3B A;  2RCB A;  4PFT A;  1VR5 A;  1B5I A;  4PP0 A;  1QKB A;  1S50 A;  3KSJ A;  2F7C A;  1B3L A;  2ALU A;  3H6V A;  2A5T A;  1MY2 A;  3T66 A;  4BDR A;  4R2B A;  4QFL A;  3TZA A;  3GXA A;  1GTK A;  2PT2 A;  3O9P A;  4H67 A;  1FQD A;  4QF9 A;  3K6V A;  2DVZ A;  3IO6 A;  3DP6 A;  2Z8D A;  3FD3 A;  2Y7R A;  3K2D A;  4F19 A;  5K2X A;  3H4Z A;  1JW5 A;  1HSL A;  4ND9 A;  1US4 A;  2O68 A;  2QL3 A;  1VSO A;  4P11 A;  5ICT A;  5BWJ A;  1YTV A;  5CMM A;  4H1X A;  5DVJ A;  3EHS A;  3VFJ A;  5AA3 A;  4F18 A;  2GRV A;  3MPL A;  5F1Q A;  2RF1 A;  1JVY A;  3R7X A;  1SW1 A;  5AA1 A;  1ANF A;  4WKM A;  1Z7M E;  2Q8J A;  4PE5 B;  4F3B A;  4BLA A;  3CSB A;  5HM4 B;  5KDT B;  4R6Y A;  1B2H A;  1B5H A;  2THI A;  2Y7I A;  1LLS A;  4OMB A;  3G7W A;  2I0B A;  3CSG A;  4Q8R A;  5ITO A;  1SQY A;  1MXU A;  1URD A;  2I4C A;  3DP4 A;  1FTM A;  5K2Y A;  3SEX A;  4O3A A;  4PFW A;  1USY H;  2X26 A;  1SI1 A;  5L9S A;  3KEI A;  1XVX A;  3VE1 B;  1O7T A;  2HAV A;  1FQF A;  3L6H A;  1VFD A;  5CBR A;  4OQO A;  3PV0 E;  2Q2C A;  2D3I A;  5F7V A;  1B58 A;  2RIN A;  2F35 A;  1EU8 A;  4DXC A;  5JTY A;  2F97 A;  1ZIU A;  3MW0 A;  3Q25 A;  3PGF A;  3H6W A;  5I59 B;  2XD2 A;  4RXL A;  1H44 A;  1MQG A;  2Z8E A;  1NKX A;  3TCF A;  3MZB A;  1NH7 A;  1ZMG A;  1LAF E;  4OXV A;  4LON B;  2VD2 A;  4FED A;  5A5X A;  1US5 A;  1J1N A;  4LA9 A;  3H03 A;  2RC7 A;  3PUX E;  4ZEK A;  1SD3 A;  3FXR A;  3M8U A;  4QHQ A;  4ONY A;  3K1M A;  1LBC A;  4IO2 A;  3GZG A;  5KZT A;  2XXX A;  3Q26 A;  4I62 A;  2RC9 A;  1XVY A;  1Q35 A;  5ELV A;  4AB6 A;  1M5D A;  4R6K A;  2OZZ A;  3T22 A;  3IK6 B;  3UOR A;  3BKI B;  3VXC A;  2DVC A;  1I6Q A;  5I56 B;  4FOR A;  2OWS A;  1H76 A;  1A8F A;  4BDM A;  5DEX B;  1UTB B;  1H43 A;  1SYH A;  3OSQ A;  3OEL A;  1DPE A;  5DVI A;  1O64 A;  3V5A A;  2YPN A;  4AB5 A;  3MQ9 A;  4AQ4 A;  5I2K B;  4TLM B;  1POT A;  4R2F A;  2XXV A;  3FVK A;  3TMG A;  1SW2 A;  3MVW A;  3IB1 A;  3PPR A;  4HCW A;  3LBS A;  2DP8 A;  3OSR A;  3IOU A;  5FHO A;  4C1U A;  4F2Q A;  5I57 A;  2E0S A;  2ZYN A;  2Q89 A;  4OTE A;  4LZ5 A;  4XTC Q;  3CG1 A;  3N26 A;  3M3F A;  4MH5 A;  1XT8 A;  1XS5 A;  4Z0I A;  5JEI A;  3G3H A;  4G8N A;  1LAX A;  1R1N A;  3B7D A;  2ABH A;  2OWT A;  3Q28 A;  2YJP A;  2HZK A;  3V8X B;  1POY 1;  1ZKB A;  1D9V A;  1GVC A;  4KI0 E;  1URS A;  1B0L A;  1MM6 A;  4G8M A;  1FTJ A;  3RGY A;  1Q1K A;  1B0H A;  5DTB A;  1OIB A;  5DYH A;  4H5F A;  3K6W A;  2P0S A;  3HCQ A;  3D4G A;  3RPW A;  5H8Q B;  3KJ7 A;  4H0W A;  1N7X A;  5AA2 B;  1IQ7 A;  4P0G A;  3M3K A;  3R26 A;  5I58 B;  4EQB A;  3PMV A;  2ZYM A;  1TXF A;  1QJM A;  1AH5 A;  3RUM A;  3EF7 A;  4QFP A;  5TPA B;  4XKQ A;  3TUS A;  2XXR A;  4EF1 A;  1A54 A;  1B1X A;  4F3G A;  3K0V A;  4BDN A;  4N13 A;  5CMK A;  4X9T A;  2Z23 A;  1P1N A;  3MVY A;  3S9E A;  3CI8 A;  4OEN A;  3QAX A;  3K01 A;  4EQ9 A;  4NE4 A;  1A40 A;  4HTG A;  3RTF B;  1JEU A;  1UTH B;  2DYX A;  1LAH E;  5H8F A;  4ZZE A;  4NF4 B;  2UVI A;  3B6T A;  3U72 A;  3K4U A;  5CI5 A;  4GF8 A;  3VVE A;  3DLN A;  4H8J A;  4THI A;  3K00 A;  2PMS A;  4XIG Q;  4JWO A;  5AA2 A;  2CMO A;  4LQ5 A;  1M5C A;  3GLB A;  1MG1 A;  1JET A;  3IR1 A;  3IAZ A;  3DP8 A;  3SDF A;  3RT8 A;  1N0T A;  1BP5 A;  3C9H A;  3UK4 A;  4NF6 B;  3WAE A;  2DOJ A;  4X48 A;  1PBP A;  2XXP A;  2M8C A;  4FIM A;  3LC8 A;  3FXQ A;  2DE3 A;  4HCY A;  4G68 C;  4I8C A;  4GIZ A;  3N6U A;  1MY3 A;  3PD9 A;  4KR5 A;  1MXX A;  2V84 A;  1P1W A;  2ANJ A;  3PMW A;  4YU0 A;  3VV5 A;  1LAG E;  4G8H A;  2Q88 A;  2A5T B;  3IB0 A;  4DE8 A;  2Y7K A;  4KPT A;  3PPQ A;  4U21 A;  1S7Y A;  1SW4 A;  1P99 A;  3FJM A;  1ZBM A;  3U92 A;  2DE2 A;  3MVX A;  3C4M A;  3HO7 A;  1MPB A;  3MZ1 A;  1ELJ A;  4PFY A;  4YKP A;  2CZL A;  1A99 A;  3S9L C;  1MY1 A;  4GOT A;  3O2A A;  3E13 X;  3ZS6 A;  1MH4 A;  3USD A;  1EZO A;  4BDL A;  3ILU B;  3FJG A;  2WKY A;  4GD5 A;  2R6G E;  5TP9 A;  3AXF A;  3MUQ A;  3TFL A;  2ZYK A;  1MS7 A;  4LZ8 A;  1B7H A;  3IOR A;  1QUK A;  5L9M A;  4ELR A;  4QFK A;  5FTH A;  1OMP A;  3TTM A;  1M5B A;  3QYT A;  1YAE A;  3QSL A;  4GFR A;  2AIX A;  5EHM A;  3SET A;  3MBP A;  2X7P A;  1QUL A;  2QS3 A;  3H06 B;  4QFO A;  1QUI A;  3KN8 A;  2DXR A;  2DXY A;  1H45 A;  3W9V A;  3VVD A;  4P0I A;  4ZDM A;  3E4R A;  1Y1Z A;  4GXS B;  4GLI A;  1FQA A;  4E0W A;  4MLV A;  1LBB A;  3RN8 A;  2GHA A;  2XXQ A;  3A09 A;  2O7U A;  1OVT A;  3HV1 A;  3OXN A;  4GXA A;  1GV8 A;  4RK9 A;  1GR2 A;  5B7D A;  2H9B A;  4FE8 A;  5JTY B;  2UVJ A;  3FV2 A;  4U22 A;  4ZED A;  5H8S A;  4OFO A;  1MY0 A;  2ZYO A;  4UA8 A;  1HSE A;  2I6E A;  5CBS A;  1DSN A;  3VLW A;  4FAJ A;  2Q2A A;  5CMC A;  4N07 A;  1LFG A;  3Q29 A;  2F5X A;  1OQG A;  3PU5 A;  1B32 A;  2GFE A;  4XKP A;  5FHM A;  3ONM A;  1GGG A;  5A5X B;  3N6T A;  1IIT A;  2XXT A;  3CG3 A;  2R9J A;  3PD8 A;  3SKP A;  3RNN A;  2PBW A;  1LFH A;  2DWA A;  3O66 A;  3L6G A;  4M1V A;  2PX1 A;  3IL1 B;  1Y3N A;  2I49 A;  3K6U A;  1XC1 A;  3S9N C;  3MPK A;  5AE4 A;  4MBP A;  2Q9T A;  4MFI A;  1QKA A;  3OEM A;  3TQL A;  1B40 A;  2Z22 A;  2OBG A;  2V25 A;  1DOT A;  1WVJ A;  1MQJ A;  1NH8 A;  3FUZ A;  3KBR A;  3W15 C;  3LUY A;  4F29 A;  1LCT A;  4IY5 A;  3B6Q A;  3SES A;  3OMB A;  1R9L A;  2XXY A;  3S4U A;  2V3T A;  4RA1 A;  4PFU A;  3OD7 A;  4OYV A;  3IO4 A;  3IJX B;  4L17 A;  4YMA A;  3QUJ A;  2ZNU A;  3FZV A;  3GBB A;  3PPN A;  3BFU A;  3MP1 A;  4JWY A;  3LSL A;  4POX A;  5I57 B;  3LSF B;  2PVU A;  2DSF A;  1IZ1 A;  5H8N A;  2AL5 A;  3HPI A;  3TAJ A;  2VOZ A;  1NNF A;  1FQE A;  4Q0C A;  1B46 A;  3KJT A;  3ZKL A;  4ECF A;  4LVQ A;  1AL3 A;  4KCD A;  3RTW B;  1NFT A;  3A3C A;  1EH3 A;  4NMY A;  1BIY A;  4Q30 B;  1NL5 A;  4WED A;  4F1V A;  4OES A;  4GWO A;  4IB2 A;  1T0K A;  4IY6 A;  1ZU0 A;  2F78 A;  3WAF A;  5DVF A;  4ZE8 A;  1FCK A;  5TU0 A;  3LSW A;  3QIM A;  3QXM A;  4C0R A;  3TEL A;  1BKA A;  3FIR A;  5I2N A;  2VD3 A;  4OEU A;  3JZJ A;  1MXW A;  3EN3 A;  3BBR A;  4YIC A;  4NF8 A;  4G77 A;  1JNF A;  2A5S A;  2O6A A;  1FTL A;  1MQI A;  3FGS A;  1OVB A;  1D3K A;  3T9V A;  2ZNT A;  4RNS A;  1B7Z A;  5ITP A;  1EZP A;  1IXG A;  2XXH A;  4YZZ A;  2DWI A;  3OO9 A;  3CVG A;  1AOV A;  4DIG A;  4EXL A;  1DPP A;  4KYE A;  3SEU A;  2F6P A;  4LP2 B;  1OLC A;  3G3J A;  2HQ0 A;  4Q5T A;  3M3L A;  4ELQ A;  4NF5 A;  5HBC A;  3O29 A;  3TTL A;  1QVS A;  1DTG A;  5H8F B;  4U1O A;  1UIV A;  4OWD A;  1PC3 A;  2X7Q A;  1AMF A;  1MY4 A;  3KGC A;  1PB9 A;  2I3V A;  4DCX A;  4H6D A;  3QUF A;  3TPA A;  1JQF A;  3CR9 A;  1SW5 A;  1Y20 A;  2F7B A;  4LAT A;  3T9U A;  3THI A;  1Y4T A;  3RY3 A;  2V3U A;  3VLU A;  2HZL A;  3PUW E;  3U93 A;  4G4P A;  2QS1 A;  2V3Q A;  3FVO A;  1SI0 A;  1Y3P A;  1YPN A;  3PPO A;  3K02 A;  1M5E A;  4JBZ A;  2UVG A;  1IUD A;  4EF2 A;  4DDD A;  2XX8 A;  2O51 A;  4OVJ A;  1Z7N E;  3HN0 A;  2ONK E;  4GRK A;  4X1B A;  2OLB A;  4KD5 A;  4IO7 A;  4YKK A;  2RCA A;  3HHF A;  4ELO A;  4I1D A;  1XOC A;  3JV9 A;  4ZZA A;  2PT1 A;  4R9F A;  5KCJ A;  3OOA A;  3PUZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...