4YKIA

Mnemiopsis leidyi ml032222a iglur lbd glycine complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
247
Chain Sequence
LIGRHLRLGSVEEQPFMFFATEGCEGNDCWSGMVNDMVVKLSEDLGFTYEYIQPDDRKFGALNKTTNEWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGEGTTLNQVLELLDQDKYKWGVIGSRHPETLLKTHRDSRYSRLVDEGVELKDLNHAIETLRGGLFVFIDEGPVLAHNLISDCDVFSVGEEFQSFEYAFGLPKDSPYKSLIDSHLLKFREEGFIDILWEKWSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords ML032222a iGluR
publication title Glycine activated ion channel subunits encoded by ctenophore glutamate receptor genes.
pubmed doi rcsb
source organism Mnemiopsis leidyi
total genus 79
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ykiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ykiA02
1BIYA 4LA9A 3IO4A 2UVGA 4JWYA 1FTOA 2Q89A 1B0LA 1ZJLA 1N76A 2Q9TA 1BTJA 2REJA 4OTEA 4F31B 2F97A 4OZ9A 2HAUA 4ISUA 2QSXA 2Q2AA 4C0RA 4WEDA 2I6EA 1LGBC 2ZXTA 3SKPA 4MH5A 3VVEA 3O97A 2F7CA 4ELPA 2D21A 4JSOA 2I0BA 3PD9A 3T9XB 2Z8EA 3K00A 5TU0A 3SEWA 4X1BA 5CMKA 4ZDMA 1UQWA 3G3IA 2QS1A 5H8FB 1DOTA 2QRYA 2I0CA 1JEUA 3U92A 5I56B 3M3LA 1B4ZA 1MG1A 4YKPA 1MXUA 3ILTB 4I9DA 1P1NA 2HCAA 3ILUB 1IZ1A 3SDFA 2DVZA 3KN8A 2DWHA 3K1PA 1FTKA 3HHGA 4QFLA 1PEBA 4LVQA 1UTHB 1WVJA 5IKBA 4PQJA 1D9YA 1LFGA 2NVUB 3U1OA 2AYSA 2X26A 2O7IA 5ICTA 3O66A 3N6UA 2GH9A 5H8QB 4HCYA 1A40A 1QULA 4YKKA 2QMXA 2XXPA 3L6GA 4MF3A 2Y84A 5KZTA 2RINA 5I2KA 3RGYA 1VR5A 2V3UA 3LBSA 3PPQA 3RY3A 4Q30B 1YCJA 4MFIA 2HAVA 4QSEA 3PV0E 1DPEA 1MY1A 4ZEFA 3ECRA 1QUIA 1B5JA 2UVJA 3TDJA 3S2VA 4RY1A 4IO7A 4XXUA 4GF8A 4U23A 4IO3A 2H9BA 3MZBA 3KEIA 3K6XA 2Z22A 3MW0A 3CFZA 5I58A 4DLDA 2O1LA 2DWJA 1DSNA 3K0VA 1NKXA 3M8UA 4BDOA 5DEXA 3Q26A 2O68A 4XKNA 5I2NB 3PMVA 5B7DA 4U1OA 5TPAB 1N04A 2V3TA 4NF5A 4EF2A 5CC2A 2ZYKA 5A5XA 4OENA 4O3CA 3KOSA 1GVCA 3W9VA 4ZS9A 4R72A 3HV1A 3N5LA 1B40A 1FW0A 4NTLA 2HXWA 2FYIA 2O84X 4ESXA 1MDP1 4RPNA 2F7BA 1SW1A 4RXLA 2XXUA 3VVDA 1IUDA 1N3XA 3L6HA 1QVSA 3V8XB 3PUWE 3H03A 3KOTA 2DWAA 4IO5A 1UTBB 4H0WA 4NF8A 3N94A 2YJPA 4GL0A 5KCJB 4ZEIA 3SEUA 4AB5A 1SD3A 2I49A 3LUYA 4H65A 2E1SA 4ZEDA 4QRZA 1LAHE 1JW5A 4Q5TA 4LQ5A 3OO7A 5I56A 4ZZEA 5IAIA 3QYTA 3KBRA 2DS9A 3Q29A 4DZ1A 1MY0A 1QJMA 4R75A 1YTVA 1UTHA 2Q2CA 2I4BA 3VLVA 3ZKLA 4MBPA 4E0WA 3G3FA 4YU0A 1PB9A 3O6HA 3UORA 1LAGE 3KSXA 4BDNA 3P7IA 4IY6A 3KJ7A 4H6DA 1QW0A 4N07A 2ZNUA 3T9VA 4LZ5A 3OSRA 2FA7A 1FTMA 1MH3A 1JETA 3K4UA 3UK4A 1LFHA 2X7QA 3MPKA 5KDTB 2Y7WA 1N7XA 3T22A 1USYE 4PFTA 2DE4A 2H4IA 1HSLA 1SW5A 3C9HA 3F11A 4U4XA 1URDA 4PP0A 4F39A 4GD5A 3O6IA 1VFEA 4OETA 4OHNA 3C31A 2QJEA 4JWXA 3M3FA 5J1DA 5CMBA 1DTGA 3R6UA 5L8DA 3TMGA 5I2NA 4RYAA 4R2FA 5EHSA 4PFUA 1RYOA 5TPAA 4GXSB 3OO6A 2Y7IA 3SERA 1Y1MA 1SI0A 4JXIA 5AA2D 3FUZA 4JB7A 2QMWA 1UIVA 4WKMA 1F9BA 1MQHA 4X1DA 1M5CA 3N6TA 4G68B 4G77A 1B7UA 4F29A 1TT1A 1I6BA 2I3VA 3IOTA 4EDPA 3VLUA 1Q35A 1MM6A 3TYHA 4QHQA 3T96B 4F3GA 3K1MA 3OSQA 4KYDA 5TP9B 2XXRA 1XHYA 3RPWA 3VVFA 2UVIA 4DDDA 1QUJA 3WAEA 1O7TA 3K1NA 4LONB 1LAXA 3BKIB 1UTBA 1XC1A 1Q1KA 3C35A 4AB6A 1S50A 2XXYA 2PX1A 5KCJA 5HM4B 4GOTA 4DXUA 1M5EA 3PPNA 3B6QA 4FE8A 3ZSFA 1OLAA 3UGWA 3PUVE 2O1MA 3IJXB 3IOUA 2RC7A 4P0GA 3SESA 4IO2A 3KJTA 3JYRA 3CSGA 4ND9A 1H45A 4RK9A 2GHBA 3TODA 5I57A 2F6PA 2XXHA 3RT8A 2UYEA 3KN7A 4F1UA 5AA2B 2GHAA 4KHZE 3IB0A 3T9HB 1Z7NE 3ZS6A 2VD3A 4MLQA 2A5TA 2UYFA 3GBAA 1BLFA 4QFPA 1OVBA 3RQTA 1VSOA 3HN0A 4H1XA 4EQBA 1QUKA 5KDTA 1J1NA 2G29A 1ZLQA 2OBGA 1JQFA 4H67A 4OFLA 3RN8A 1B1XA 1NNKA 2RCAA 4F3SA 3DP6A 2R71A 2PT2A 2AIXA 3OEKA 1D3KA 2OWSA 3MVWA 5F1QA 3QUJA 5CRYA 3PPOA 1SW4A 2THIA 1A7LA 3JZJA 4UACA 3OEMA 5AA4A 3UN6A 3IL1B 1LBCA 1S9TA 4GRKA 3G3GA 2VHAA 3GZGA 4KFQA 1N84A 3V5AA 3W9WA 3CVGA 3CFLA 3PUYE 1US5A 2R6GE 1OLCA 4ONYA 1EU8A 3CI8A 2H25A 3K2DA 3G3HA 2XHDA 2RC8A 4HTGA 1IXCA 2X7PA 5DVJA 2XXWA 4C1UA 4G68A 2B3FA 1P1UA 5CM6A 3TFLA 1SVXB 5B70A 2V3QA 2CZLA 3C33A 5JTYB 3C32A 3R26A 3O9PA 3K02A 1VFDA 2ESNA 2UVHA 4XKPA 1O63A 2RKMA 1N0TA 2O51A 1Y4CA 2DYXA 4QFNA 3QUFA 2OZZA 4HW8A 3PUXE 4H5FA 4IO4A 2DSFA 3EHUA 3FVGA 4JWOA 2P0SA 4Z7EA 3MP1A 1FTJA 3I3VA 1L5TA 3U8QA 3G7WA 4RA1A 3HPIA 1H3DA 3IX1A 3TEPA 2OK2A 3TTKA 2D5WA 5L9OA 2YPNA 2O69A 3KG2A 2F78A 3BBRA 3CIJA 1MPCA 1MXVA 4F3BA 4TQUQ 4QSCA 3TTLA 4YZZA 1SDXA 3TCHA 3B7DA 3ODBA 3K6UA 2F8DA 4M1VA 4GXAA 1ZU0A 3QIMA 4BDQA 4ELQA 4JDFA 1LSTA 4P11A 3IB2A 5K2XA 5CI5A 5AA2A 1FQEA 1NNTA 3Q25A 2ZNTA 1POY1 4OXVA 1PC3A 3KSJA 1NFTA 1JEVA 1EH3A 4OQOA 4TOZA 1B9JA 3PMXA 1SYHA 4X9TA 3D4CA 2YLNA 1MPBA 1GGGA 3W15C 1BKAA 3LR1A 4YB7A 2XX7A 2V93A 4FAJA 4OWDA 4R73A 3QSLA 1OMPA 4OERA 3IK6B 4R6KA 4OMBA 1JVYA 4THIA 1XOCA 3FJGA 4L17A 1FQDA 2PBWA 1A54A 2ONRA 1O64A 2PT1A 3SEYA 3MVXA 5H8FA 3S4UA 1MY4A 3FV1A 2I3WA 1M5DA 3E13X 4KPTA 2RC9A 4ZEBA 4HCWA 4F3PA 2ZMBA 4H8IA 4POXA 3SEXA 3MQ9A 5EYFA 4GL8A 3HSTA 2ABHA 4FEBA 3V83A 4KQPA 3CRBA 5JTYA 3H06B 4DE8A 4G8NA 1CE2A 1M5BA 3RTWB 4YB6A 1OIBA 5CMCA 2UXAA 5AE4A 1A99A 1B46A 3A3CA 3H4ZA 2OWTA 4X48A 2RCBA 1P1QA 5H8QA 4LZ7A 1PBPA 1I6AA 4FJPA 4NWCA 4F2OA 3CG3A 4C1TA 3MZ1A 2F36A 3OENA 1NL5A 1TWYA 1QKAA 1NH7A 2QS2A 4G4PA 4U2RA 1B5IA 3VXCA 3KN3A 3TTMA 3CSBA 1B7ZA 2O7UA 5H8NB 3C4MA 1A8FA 4PE5B 4LP2B 3H6WA 5ITOA 2DVCA 4KCCA 1B5HA 3FJ7A 5DTBA 4RK2A 4IB2A 1JVXA 4BDMA 3ONMA 4OYVA 4KR5A 4POWA 1S7YA 1IIWA 1EZOA 1SYIA 4I62A 4EXKA 5DVFA 2OLBA 3HCQA 4XKQA 3VFJA 4KCDA 3IJOB 1NMUA 2Z23A 3IB1A 5FHNA 1B58A 4MLVA 3PD8A 2IA4A 3D4GA 1WODA 2XXVA 1Z7ME 4LZ8A 3HO7A 4BLAA 2VP1A 1B3EA 1TFAA 3QK6A 2XXXA 3FASA 5M2VA 1A55A 5F7VA 1LB8A 4Z0IA 2A5SA 2NXOA 3LSLA 3FZVA 1B52A 2XD3A 3O29A 2E0SA 2BJJX 2QPQA 4F1VA 3TQWA 3A3UA 1P1OA 5ISUA 4AQ4A 1Y3NA 5AA3A 1I69A 5AA1A 3RTFB 3E9XA 4NMYA 3LSFB 4G8MA 1B05A 2VD2A 1PB7A 3FXQA 2NUVA 2H5YA 3O2AA 2CMOA 1DPPA 5EHMA 4ZE9A 1Y3PA 5H8HB 2LAOA 2KLFA 4U4SA 5DYHA 4GWOA 4OFJA 3MJNA 3T9UA 4JBZA 2Y7RA 4QFOA 1H43A 1PDAA 2DWIA 1EZPA 3KZGA 3DM0A 5HPQA 2H98A 4FORA 2PYYA 1UIUA 3I6VA 5DVIA 3IORA 1SBPA 2Z8FA 1ZKBA 1LLSA 4NWDA 3T66A 4ECFA 3TKDA 4ELRA 2Y7PA 2ZYMA 2F5XA 5L9MA 3MVYA 4G8HA 2HZLA 3MC2A 3MBPA 3ZKKA 1ELJA 1ATGA 3PPRA 3VE1B 3G3JA 1OVTA 4PETA 3RUMA 5DEXB 3QXMA 1R1NA 3N26A 3THIA 3RLFE 4NF5B 3IO6A 1MRPA 4PFWA 3FV2A 1MQIA 3SETA 3U72A 2DOJA 1NNFA 4Q0CA 2B3BA 1B0HA 3FD3A 4YMAA 4R74A 4R6YA 3FVKA 1JW1A 3I5OA 2FNCA 5BUUA 3EQ1A 1N7WA 4O3AA 3S9NC 1MXWA 4ZEKA 3BFUA 1B3HA 3DP8A 4KYEA 3K6VA 2ONSA 4WXJA 4EF1A 1B2HA 3H6UA 1B7HA 4NF6B 2HEUA 3CR9A 1RKMA 3FJMA 3JV9A 4NF8B 1KWHA 5I84A 3O6GA 4G2ZA 4R9FA 1D4NA 4RPOA 1IXGA 1AL3A 1I6QA 1EZ9A 3PMWA 4DXBA 2HQ0A 3MP6A 3IR1A 5TP9A 1SQYA 4TLMB 3RT6B 1LAFE 4GQOA 4E0XA 4BDRA 3S9MC 1ZTYA 4NF4B 4QSDA 4GFRA 3WAFA 3IOWA 2XX8A 2PVUA 5DT6A 1B6HA 3TCGA 1LB9A 1FQCA 3FATA 3VV5A 3MP8A 1GTKA 3TZAA 2F7AA 4FIMA 1FQBA 2R9JA 1GR2A 5L9SA 1XT8A 5HBCA 3AXFA 2XD2A 3VLWA 3TTRA 5H8HA 1B4HA 3TQLA 3TPAA 3K6WA 1HSEA 3TCFA 1B3GA 1POTA 2V84A 2XXTA 3M3KA 3TTNA 5JEIA 3MZ9A 1IXIA 1FQAA 4IGTA 1VE4A 3S9LC 1URSA 3R7XA 1OQHA 2ANJA 4N6PA 3LSWA 4GVOA 4I1DA 3LC8A 2Z8DA 3Q28A 1MY2A 3H6VA 1NH8A 4NE4A 4LQ2A 3OMBA 2F6GA 4OFOA 3TAJA 1PB8A 4Q8RA 4FEDA 3TELA 1SW2A 4YMBA 4LUBA 1N3WA 4ZZAA 1WDNA 4BDLA 4DCYA 4EQ7A 1B1HA 4F19A 3IOVA 1ZIUA 2W7YA 2GRVA 2I48A 1LBBA 2REGA 1II5A 2I4CA 2DXRA 2XXQA 1PBQA 2QL3A 4LATA 2ONKE 1B3FA 3MPLA 4DIGA 1MY3A 1Y4TA 1ZMGA 1SI1A 4YAHX 1IXHA 4EXLA 1GV8A 3OOAA 5FTIA 3QAXA 2ZYOA 3UIFA 3IAZA 3FVNA 4UA8A 1AMFA 2AL5A 2G93A 4XTCQ 1IQ7A 3H3GA 3VDFA 3KFMA 4M4GA 1Y3QA 1XS5A 2DQVA 2Q88A 2DXYA 3E3KA 1P1WA 2DP8A 4YB5A 4P0IA 3CFXA 4KI0E 2P1SA 2F35A 1R9QA 4QF9A 2F34A 1Y1ZA 1JNFA 5CMMA 4NF6A 3O28A 1URGA 3EF7A 3GXAA 4YKIA 4RNSA 1BP5A 3FIRA 3BFTA 1AH5A 4ZECA 4R2BA 2HFBA 4ESWA 1IEJA 2VGQA 4IGRA 3PUZE 2PMSA 2QS4A 4NF4A 3OD7A 3T93B 5I57B 4DCXA 1FTLA 4F18A 4XIGQ 4GIZA 4ELOA 3MWBA 1LCTA 3EPEA 1XVYA 5I59B 2DE3A 3DELB 2I58A 3GLBA 4NEDA 2RF1A 2ZYNA 4R6HA 3K01A 2A5TB 3PPPA 4G68C 5ITPA 3H7MA 1MDQA 4H5GA 1MXZA 2D3IA 3EHTA 3OELA 1FCKA 1XVXA 1MQJA 4EUOA 4JSDA 1ZBMA 3S9EA 1YPNA 1USYH 5BWJA 1DTZA 1MQGA 3MAMA 4U21A 3HHFA 5K2YA 2V25A 3TUSA 2H99A 4F1YA 3FXRA 4QFKA 1FQFA 1MQDA 3U93A 5LOMA 1D9VA 1P99A 2Q8JA 3MVZA 5AA4B 2HZKA 1MXXA 3DLNA 4OEUA 4ZE8A 4PFYA 2XX9A 3C34A 3CG1A 2NOOA 1B51A 1YAEA 3U94A 1CB6A 2P2AA 1H76A 1JW4A 1MS7A 3PU5A 5ELVA 5CBSA 5FHMA 1NNPA 4OESA 4K3FA 3Q27A 3EN3A 3FGSA 1DMBA 2XXIA 1TXFA 1R6ZA 1T0KA 3MUQA 3VXBA 3FVOA 4O3BA 3UA8A 1MPDA 1AOVA 3B6WA 1R9LA 4N13A 3B6TA 5ICQA 4F2QA 4U1ZA 4XKRA 1B3LA 4I8CA 5H8SA 5FTHA 2O6AA 3DP4A 3GBBA 3USDA 2QS3A 4TLLB 1MH4A 5I2KB 4EQ9A 1RYXA 3EHSA 4IO6A 4OVJA 3OO8A 4WEPA 5JK4A 1A8EA 4FATA 4YICA 2Y7KA 1US4A 3KGCA 2WKYA 2VOZA 3FXUA 1Y20A 3OO9A 1MM7A 2ALUA 4YKJA 4GLIA 1OQGA 2NWJA 1MXYA 4OEVA 3OXNA 3LSXA 2OJTA 1LFIA 5FHOA 4F22A 2DE2A 2B65A 4FECA 3V89B 2AL4A 3H6TA 5I58B 4IY5A 1H44A 4DXCA 3C36A 4U22A 3UP9A 2GFEA 2IEEA 1ANFA 2ZNSA 5I59A 1IITA 2M8CA 4HS7A 1AIVA 4KD5A 3A09A 4R9GA 1B32A 2OCUA 1QKBA 4H8JA 5H8NA 3RNNA 3PGFA 5A5XB 1HSJA 4RJZA 3SEVA 5CBRA 1Y9UA 1M5FA 1TFDA 3E4RA 3G3KA 1LCFA 4KYSA
chains in the Genus database with same CATH superfamily
1BIYA 4LA9A 3IO4A 2UVGA 4JWYA 1FTOA 4KXPA 2Q89A 1B0LA 1ZJLA 1N76A 2Q9TA 1BTJA 5IM2A 2REJA 4OTEA 4F31B 2F97A 4X8RA 4OZ9A 2HAUA 4ISUA 2QSXA 2Q2AA 3ROJA 4C0RA 4WEDA 2I6EA 1LGBC 2ZXTA 3SKPA 4MH5A 2ZZVA 3VVEA 3O97A 5ESYA 2F7CA 4ELPA 4MEVA 2D21A 4JSOA 2I0BA 3PD9A 3T9XB 1NV7A 2Z8EA 3K00A 5TU0A 4MAGA 3SEWA 4X1BA 5CMKA 4ZDMA 4QXDA 4P1EA 1UQWA 3G3IA 2QS1A 5H8FB 1DOTA 2QRYA 2I0CA 1JEUA 3U92A 5I56B 3M3LA 1B4ZA 1MG1A 4YKPA 1MXUA 3ILTB 4I9DA 1RDYA 1P1NA 2HCAA 3ILUB 1IZ1A 4JVIA 3SDFA 2DVZA 3KN8A 2DWHA 3K1PA 1FTKA 3HHGA 4QFLA 1CNQA 1PEBA 4LVQA 1UTHB 1FBEA 1WVJA 5IKBA 2CZKA 4PQJA 1D9YA 1LFGA 2NVUB 3U1OA 1FBHA 2AYSA 2X26A 2O7IA 5ICTA 3O66A 3N6UA 2GH9A 5H8QB 4HCYA 1A40A 1QULA 4YKKA 2QMXA 2XXPA 3L6GA 4MF3A 2Y84A 5KZTA 2RINA 5I2KA 3RGYA 1VR5A 2V3UA 3LBSA 3PPQA 3RY3A 4Q30B 1YCJA 4MFIA 2HAVA 2KR0A 4JVCA 4PE3A 4QSEA 3PV0E 3MSTA 2P3VA 1DPEA 1MY1A 4ZEFA 3ECRA 1QUIA 2XXKA 1B5JA 2UVJA 3TDJA 3S2VA 4RY1A 4IO7A 4XXUA 4GF8A 4U23A 4IO3A 2H9BA 3MZBA 3KEIA 3K6XA 1JP4A 2Z22A 3MW0A 3CFZA 5I58A 4DLDA 2O1LA 2DWJA 1DSNA 3K0VA 1NKXA 3M8UA 4BDOA 5DEXA 1EYJA 3Q26A 4GBWA 1LBZA 2O68A 4XKNA 5I2NB 3PMVA 5B7DA 2VT5A 4U1OA 5TPAB 1N04A 2V3TA 4NF5A 4EF2A 5CC2A 2ZYKA 1INPA 5A5XA 5EYGA 1NV4A 4OENA 4O3CA 2PCRA 3KOSA 1GVCA 3W9VA 4ZS9A 4R72A 3HV1A 3KC0A 3N5LA 3U65A 1B40A 1FW0A 4NTLA 2HXWA 2FYIA 2O84X 4ESXA 1MDP1 4NQ8A 4RPNA 2F7BA 1FJ9A 1SW1A 4RXLA 2XXUA 3VVDA 1IUDA 1DCUA 1N3XA 3L6HA 1QVSA 3V8XB 3PUWE 3H03A 3KOTA 2DWAA 4IO5A 5F24A 5A5LA 1UTBB 4H0WA 4NF8A 3N94A 2YJPA 4GL0A 1FTAA 5KCJB 4ZEIA 1NUZA 3SEUA 4AB5A 1SD3A 2I49A 3LUYA 4H65A 2E1SA 4ZEDA 4QRZA 1LAHE 1JW5A 4Q5TA 4LQ5A 3OO7A 5I56A 4ZZEA 5IAIA 3PTYA 4MNIA 3QYTA 3KBRA 2DS9A 3Q29A 4DZ1A 1MY0A 1QJMA 4R75A 1YTVA 1NUWA 1UTHA 2Q2CA 2I4BA 3VLVA 4N81A 3ZKLA 4PGNA 4I40A 4MBPA 4E0WA 3G3FA 4YU0A 5I3SA 1PB9A 3O6HA 3UORA 1LAGE 3KSXA 4BDNA 3P7IA 4IY6A 3KJ7A 4PFIA 4H6DA 1QW0A 4N07A 4O94A 2XA5A 2ZNUA 3T9VA 4LZ5A 3OSRA 2FA7A 1FTMA 1MH3A 1JETA 3K4UA 5EQAA 5LTCA 4NHBA 3UK4A 1LFHA 2X7QA 3MPKA 5KDTB 2Y7WA 1N7XA 3T22A 1USYE 4PFTA 2DE4A 2H4IA 2B4LA 1HSLA 1SW5A 3C9HA 3F11A 3E79A 4U4XA 1URDA 4PP0A 4F39A 4GD5A 1YXIA 3O6IA 4H46A 1VFEA 4OETA 4OHNA 3FBPA 3C31A 1NV3A 2QJEA 4JWXA 3M3FA 5J1DA 5CMBA 1FPKA 1DTGA 3R6UA 5L8DA 3TMGA 5I2NA 4RYAA 4R2FA 5EHSA 4PFUA 1RYOA 5TPAA 4GXSB 3OO6A 2Y7IA 3SERA 1Y1MA 1SI0A 4JXIA 5AA2D 3FUZA 4JB7A 2QMWA 1UIVA 4WKMA 1F9BA 1MQHA 4OVTA 4X1DA 1M5CA 2CEYA 3N6TA 4G68B 4G77A 1B7UA 4F29A 1TT1A 1I6BA 4HXVA 2I3VA 1IMFA 3IOTA 4EDPA 3VLUA 4HE2A 1Q35A 1MM6A 3TYHA 4QHQA 5IZ3B 3LV0A 3T96B 4F3GA 3K1MA 3OSQA 4GWWA 4GWUA 4KYDA 5TP9B 4NG7A 2XXRA 1NV5A 1XHYA 3RPWA 3VVFA 2UVIA 4DDDA 1QUJA 3WAEA 1O7TA 3K1NA 4LONB 4N6KA 1LAXA 3BKIB 1UTBA 1IMDA 1XC1A 2FVZA 1Q1KA 3C35A 4AB6A 1S50A 2XXYA 2PX1A 5KCJA 5HM4B 4GOTA 4PFRA 4DXUA 1M5EA 3PPNA 1FBCA 3B6QA 4FE8A 3ZSFA 1OLAA 3UGWA 1IMCA 3PUVE 2O1MA 3IJXB 5IZ1A 4N15A 3IOUA 2RC7A 4P0GA 3SESA 4IO2A 3KJTA 2L5VA 3JYRA 3CSGA 4ND9A 1H45A 4RK9A 2GHBA 3TODA 5I57A 5EQ9A 2F6PA 4P1LA 2XXHA 3RT8A 2WYKA 2UYEA 3KN7A 4MNPA 4F1UA 4FBPA 5AA2B 2GHAA 4KHZE 3IB0A 4PGPA 3T9HB 1DBZA 1Z7NE 1NUYA 3ZS6A 2VD3A 1FPJA 4MLQA 2A5TA 2UYFA 3GBAA 1BLFA 4QFPA 1OVBA 3RQTA 1FBFA 1VSOA 3HN0A 4H1XA 4EQBA 1QUKA 5KDTA 1J1NA 2G29A 1ZLQA 2OBGA 1JQFA 4H67A 4OFLA 5I5PA 3RN8A 3MYUA 1B1XA 1NNKA 2RCAA 4F3SA 3DP6A 2R71A 2PT2A 2AIXA 3OEKA 1D3KA 2OWSA 3MVWA 5F1QA 3QUJA 5CRYA 3PPOA 1SW4A 2THIA 1A7LA 3JZJA 4UACA 2Q74A 3OEMA 5AA4A 2V4CA 4PAKA 3UN6A 3IL1B 3IFCA 1LBCA 1S9TA 4MX6A 4GRKA 4HE0A 2ZZXA 3G3GA 2VHAA 3GZGA 4KFQA 1N84A 3V5AA 3W9WA 3CVGA 3CFLA 3PUYE 1US5A 2R6GE 1OLCA 4ONYA 1EU8A 3CI8A 2H25A 3K2DA 3G3HA 2XHDA 2RC8A 4HTGA 1IXCA 2X7PA 5DVJA 2XXWA 4C1UA 4G68A 2B3FA 1P1UA 5CM6A 3TFLA 4QBAA 1SVXB 5B70A 2V3QA 2CZLA 3C33A 1KA1A 3E78A 5JTYB 3C32A 3A29A 2GQ1A 5IZ3A 1SPIA 3R26A 1LBYA 3O9PA 3K02A 1VFDA 2ESNA 2UVHA 4N8GA 4XKPA 1O63A 2RKMA 5EQ8A 3T0JA 1N0TA 2O51A 1Y4CA 2DYXA 4QFNA 3QUFA 2OZZA 4HW8A 3PUXE 4H5FA 4IO4A 3SZPA 2DSFA 3EHUA 3FVGA 4JWOA 2P0SA 4Z7EA 3MP1A 1FTJA 3I3VA 1L5TA 3U8QA 3G7WA 4RA1A 5EQ7A 3HPIA 2XWOA 1H3DA 4XEQA 3IX1A 3TEPA 1NV1A 2OK2A 4GWZA 3TTKA 2D5WA 5L9OA 2YPNA 2O69A 4GWSA 3KG2A 2F78A 3BBRA 3CIJA 4PC9A 4PDDA 1MPCA 1MXVA 4F3BA 4TQUQ 4QSCA 1IMAA 3TTLA 4YZZA 1SDXA 3TCHA 1XI6A 3B7DA 3ODBA 3K6UA 2F8DA 1YYZA 5IGAA 4M1VA 4GXAA 4I3YA 1ZU0A 3QIMA 4BDQA 4ELQA 4JDFA 1LSTA 4P11A 3IB2A 5K2XA 5CI5A 5AA2A 1FQEA 1NNTA 3Q25A 2ZNTA 1POY1 4OXVA 1PC3A 3KSJA 1NFTA 2XWKA 2ZZWA 1JEVA 4DI4B 1FJ6A 1EH3A 4OQOA 4TOZA 1B9JA 3PMXA 4P8BA 1SYHA 3NOHA 4MJOA 4X9TA 3D4CA 2YLNA 1MPBA 1GGGA 3W15C 1BKAA 3GYYA 3LR1A 4YB7A 2XX7A 2V93A 4FAJA 4OWDA 4R73A 3QSLA 1OMPA 4OERA 3IK6B 4R6KA 4OMBA 1JVYA 4THIA 1XOCA 3FJGA 3KC1A 4L17A 1FQDA 2PBWA 1A54A 2ONRA 1O64A 4PF6A 2PT1A 3SEYA 3MVXA 5H8FA 3S4UA 1MY4A 3FV1A 2I3WA 2VPOA 1M5DA 4OA4A 3E13X 2FHYA 4KPTA 2RC9A 4ZEBA 4HCWA 4F3PA 2ZMBA 4H8IA 4POXA 3SEXA 3MQ9A 2HHMA 2B4MA 4GL8A 5EYFA 2OWZA 3HSTA 2WYPA 2ABHA 4FEBA 3CHGA 3V83A 4PBHA 4KQPA 3CRBA 5JTYA 3H06B 4DE8A 2WBDA 4G8NA 1CE2A 1M5BA 3RTWB 4YB6A 1OIBA 5CMCA 2UXAA 5AE4A 1A99A 1B46A 5IZZA 2XWVA 3A3CA 3H4ZA 4GX4A 2OWTA 3T1BA 4X48A 2RCBA 1P1QA 5H8QA 4LZ7A 1PBPA 1I6AA 4FJPA 4NWCA 4F2OA 3CG3A 2QVUA 2F3DA 4GX3A 3KBZA 4C1TA 3MZ1A 2F36A 4X04A 3OENA 1NL5A 1TWYA 1QKAA 1NH7A 2QS2A 4G4PA 4U2RA 2DDKA 1B5IA 4UABA 3VXCA 3KN3A 3TTMA 3CSBA 1B7ZA 1NV6A 2WEFA 2O7UA 5H8NB 3C4MA 1A8FA 4PE5B 4LP2B 3H6WA 5ITOA 2DVCA 4KCCA 1B5HA 3FJ7A 4IR8A 5DTBA 4RK2A 4PAFA 4IB2A 2F3BA 1JVXA 2QVRA 2WX9A 4BDMA 5J16A 3ONMA 5ET5A 4OYVA 4KR5A 4OANA 4POWA 1S7YA 2XWIA 3B50A 1IIWA 3QMFA 1EZOA 1SYIA 4I62A 4EXKA 5DVFA 2OLBA 3HCQA 2WBBA 4XKQA 3VFJA 4KCDA 4O7MA 3IJOB 1NMUA 2Z23A 3IB1A 1EYKA 2FIEA 5FHNA 1B58A 4MLVA 3PD8A 2IA4A 3D4GA 1WODA 2XXVA 1Z7ME 4LZ8A 3HO7A 4BLAA 2VP1A 1B3EA 1TFAA 3QK6A 2XXXA 3FASA 5M2VA 1A55A 5F7VA 1LB8A 4Z0IA 2A5SA 2NXOA 3LSLA 3FZVA 1B52A 4N8YA 2XD3A 3O29A 2E0SA 2BJJX 2QPQA 4F1VA 2Y5LA 3TQWA 3A3UA 1P1OA 5ISUA 4AQ4A 1Y3NA 5AA3A 3D1RA 1I69A 5AA1A 3RTFB 3E9XA 2MKZA 4NMYA 1IMBA 3LSFB 2QVVA 4G8MA 1B05A 2VD2A 4MMPA 1PB7A 3FXQA 2NUVA 2H5YA 3O2AA 2CMOA 4I3EA 1DPPA 5EHMA 1RDZA 4DI3D 4ZE9A 2Y5KA 1Y3PA 4NAPA 5H8HB 2PFYA 2LAOA 2KLFA 4U4SA 5DYHA 4GWOA 4OFJA 3MJNA 3T9UA 1FBPA 4JBZA 4N6DA 5EYHA 2Y7RA 4QFOA 1H43A 1PDAA 2DWIA 1EZPA 3KZGA 1K9ZA 2CZIA 3RPLB 3DM0A 5HPQA 2H98A 4FORA 1LBVA 2PYYA 1UIUA 3I6VA 5DVIA 3IORA 1NV2A 1SBPA 2Z8FA 1ZKBA 1LLSA 1K9YA 2BJIA 4NWDA 1D9QA 3T66A 4ECFA 3BIGA 3TKDA 4ELRA 2Y7PA 2ZYMA 2R8TA 1AWBA 2F5XA 5L9MA 4O8MA 3MVYA 4G8HA 2HZLA 2CZHA 3MC2A 3MBPA 3ZKKA 1Q9DA 1ELJA 1ATGA 3PPRA 3VE1B 3G3JA 1OVTA 4PETA 3RUMA 5DEXB 3QXMA 2PFZA 1R1NA 3N26A 3THIA 4MHFA 3RLFE 4NF5B 3IO6A 1G0IA 1MRPA 4PFWA 3FV2A 4N4UA 1MQIA 4PFBA 3SETA 3U72A 2DOJA 1NNFA 4Q0CA 1FPBA 1LBXA 2B3BA 1B0HA 3FD3A 4YMAA 4R74A 4R6YA 3FVKA 1JW1A 3I5OA 2FNCA 5BUUA 3EQ1A 4AS5A 1N7WA 4O3AA 3S9NC 1MXWA 4ZEKA 2FIXA 3BFUA 1B3HA 3DP8A 4KYEA 1FSAA 3K6VA 2ONSA 4PBQA 4WXJA 4EF1A 1B2HA 3H6UA 1B7HA 2JJKA 4NF6B 2HEUA 3CR9A 1RKMA 3FJMA 3JV9A 4NF8B 2CEXA 1KWHA 4P3LA 1LBWA 5I84A 3O6GA 4G2ZA 4R9FA 1D4NA 1YZ0A 4RPOA 1IXGA 1AL3A 1I6QA 1EZ9A 3PMWA 4NX1A 4DXBA 1EYIA 2HQ0A 3MP6A 3IR1A 5TP9A 1SQYA 4PAIA 4TLMB 5DW8A 3RT6B 1LAFE 4GQOA 1RDXA 4E0XA 4BDRA 3S9MC 1ZTYA 4NF4B 4QSDA 4GFRA 5LDZA 3WAFA 3IOWA 2XX8A 2PVUA 5DT6A 1B6HA 3TCGA 1LB9A 1FQCA 3FATA 3VV5A 3MP8A 1GTKA 3TZAA 2F7AA 4FIMA 1FQBA 2R9JA 1GR2A 5L9SA 1XT8A 5HBCA 3AXFA 2XD2A 1NI9A 3VLWA 3TTRA 5H8HA 1B4HA 4LN5A 3TQLA 3TPAA 3K6WA 1HSEA 3TCFA 1B3GA 1POTA 2V84A 2XXTA 3M3KA 3TTNA 5JEIA 3MZ9A 1IXIA 1FQAA 4IGTA 1VE4A 4GWYA 4OVRA 3S9LC 1URSA 3RPLA 3R7XA 4P47A 4H45A 1OQHA 1FPFA 2ANJA 4N6PA 4P9KA 2P3NA 3LSWA 4GVOA 1FBDA 4N91A 4I1DA 3LC8A 2Z8DA 3Q28A 1MY2A 3H6VA 1NH8A 4NE4A 1BK4A 4LQ2A 3OMBA 4GX6A 1NV0A 2F6GA 4OFOA 3TAJA 1PB8A 4Q8RA 4FEDA 3TELA 4P56A 1SW2A 4YMBA 1KZ8A 4LUBA 1N3WA 4ZZAA 3IFAA 1WDNA 4BDLA 1NUXA 4DCYA 4EQ7A 1B1HA 4F19A 3IOVA 1ZIUA 2W7YA 2GRVA 2I48A 1LBBA 1QGXA 2REGA 1II5A 4N17A 4PTKA 2I4CA 2DXRA 2XXQA 1PBQA 2QL3A 4LATA 2ONKE 1B3FA 3MPLA 4DIGA 1MY3A 4XF5A 1Y4TA 1ZMGA 1SI1A 4YAHX 1IXHA 4EXLA 1GV8A 3OOAA 5FTIA 3QAXA 2ZYOA 3UIFA 3IAZA 3FVNA 4UA8A 1AMFA 2AL5A 2G93A 4XTCQ 1IQ7A 3H3GA 3VDFA 3KFMA 4M4GA 1Y3QA 1XS5A 2DQVA 2Q88A 2DXYA 3E3KA 1P1WA 2DP8A 4YB5A 4P0IA 1FPLA 3CFXA 4KI0E 2P1SA 2F35A 1R9QA 4QF9A 2F34A 1Y1ZA 1JNFA 5CMMA 4NF6A 1FPGA 3O28A 1URGA 4OVQA 3EF7A 3GXAA 3FXBA 4YKIA 4RNSA 1BP5A 1FBGA 3FIRA 3BFTA 1AH5A 4NGUA 4ZECA 1KA0A 4R2BA 2HFBA 4ESWA 1IEJA 2VGQA 4IGRA 1G0HA 2HXRA 3PUZE 5T3JA 2PMSA 2QS4A 4NF4A 3OD7A 3T93B 5I57B 4DCXA 1FTLA 1FPDA 2HPGA 4F18A 4XIGQ 4GIZA 4ELOA 3MWBA 1LCTA 3EPEA 1XVYA 4O7IA 5I59B 2DE3A 3DELB 2I58A 3GLBA 3B8BA 4NEDA 2RF1A 2ZYNA 4R6HA 3K01A 2A5TB 3PPPA 4G68C 5ITPA 3H7MA 1MDQA 4H5GA 1MXZA 4AS4A 2FBPA 2D3IA 5ET7A 3EHTA 3OELA 1FCKA 1XVXA 1MQJA 3HFUA 4EUOA 4JSDA 1ZBMA 3S9EA 1YPNA 1USYH 5BWJA 1DTZA 1MQGA 3MAMA 4U21A 3HHFA 5K2YA 2V25A 3TUSA 2H99A 4F1YA 3FXRA 4QFKA 1FQFA 1MQDA 3U93A 5ET8A 5LOMA 4NF0A 1D9VA 1P99A 2Q8JA 3MVZA 5AA4B 2HZKA 1MXXA 3DLNA 1LEVA 4OEUA 3RYDA 4ZE8A 4OVPA 2XX9A 4PFYA 3C34A 3CG1A 2NOOA 1B51A 1YAEA 3U94A 4NN3A 1VDWA 1CB6A 2P2AA 1H76A 1JW4A 4MIJA 1MS7A 1FPIA 3PU5A 5ELVA 5CBSA 5FHMA 2KQZA 1NNPA 4OESA 4K3FA 3EKIA 3Q27A 4MNCA 5FBPA 3EN3A 3FGSA 1DMBA 2XXIA 1TXFA 1R6ZA 1T0KA 3BIHA 3MUQA 3VXBA 3FVOA 4O3BA 3UA8A 1MPDA 1AOVA 3B6WA 1R9LA 4N13A 2Q8MA 4GWXA 3B6TA 5ICQA 4F2QA 4U1ZA 4XKRA 1B3LA 4I8CA 5H8SA 2VPNA 5FTHA 2O6AA 3DP4A 4XFEA 3GBBA 3USDA 2QS3A 4TLLB 1MH4A 5I2KB 4EQ9A 1RYXA 3EHSA 4IO6A 4PDHA 4OVJA 4WEPA 3OO8A 4G61A 5JK4A 1A8EA 4FATA 4YICA 2Y7KA 1US4A 1IMEA 3KGCA 2WKYA 4PF8A 2VOZA 3FXUA 1Y20A 4MCOA 3LUZA 3OO9A 1MM7A 2ALUA 4YKJA 4GLIA 1OQGA 2NWJA 1MXYA 4OEVA 3OXNA 3LSXA 2OJTA 1LFIA 4HE1A 5FHOA 4F22A 2DE2A 2B65A 1DK4A 2OX3A 4FECA 3V89B 2AL4A 3H6TA 5I58B 4IY5A 1H44A 4DXCA 3C36A 1FRPA 1FPEA 2QFLA 4U22A 3UP9A 2GFEA 4PCDA 2IEEA 1ANFA 2ZNSA 5I59A 1IITA 5I7IA 2M8CA 4HS7A 1AIVA 4KD5A 3A09A 4R9GA 1B32A 2OCUA 1QKBA 4H8JA 5H8NA 3RNNA 3PGFA 4JVDA 5A5XB 1HSJA 4RJZA 3SEVA 3ISPA 4GBVA 5CBRA 1Y9UA 1M5FA 1TFDA 3E4RA 3G3KA 4OVSA 1LCFA 5ET6A 4KYSA
chains in the Genus database with same CATH topology
1BIYA 4LA9A 3IO4A 2UVGA 4JWYA 1FTOA 2Q89A 1B0LA 1ZJLA 1N76A 2Q9TA 1BTJA 2REJA 4OTEA 4F31B 2F97A 4OZ9A 2HAUA 4ISUA 2QSXA 2Q2AA 4C0RA 4WEDA 2I6EA 1LGBC 2ZXTA 3SKPA 4MH5A 3VVEA 3O97A 2F7CA 4ELPA 2D21A 4JSOA 2I0BA 3PD9A 3T9XB 2Z8EA 3K00A 5TU0A 3SEWA 4X1BA 5CMKA 4ZDMA 1UQWA 3G3IA 2QS1A 5H8FB 1DOTA 2QRYA 2I0CA 1JEUA 3U92A 5I56B 3M3LA 1B4ZA 1MG1A 4YKPA 1MXUA 3ILTB 4I9DA 1P1NA 2HCAA 3ILUB 1IZ1A 3SDFA 2DVZA 3KN8A 2DWHA 3K1PA 1FTKA 3HHGA 4QFLA 1PEBA 4LVQA 1UTHB 1WVJA 5IKBA 4PQJA 1D9YA 1LFGA 2NVUB 3U1OA 2AYSA 2X26A 2O7IA 5ICTA 3O66A 3N6UA 2GH9A 5H8QB 4HCYA 1A40A 1QULA 4YKKA 2QMXA 2XXPA 3L6GA 4MF3A 2Y84A 5KZTA 2RINA 5I2KA 3RGYA 1VR5A 2V3UA 3LBSA 3PPQA 3RY3A 4Q30B 1YCJA 4MFIA 2HAVA 4QSEA 3PV0E 1DPEA 1MY1A 4ZEFA 3ECRA 1QUIA 1B5JA 2UVJA 3TDJA 3S2VA 4RY1A 4IO7A 4XXUA 4GF8A 4U23A 4IO3A 2H9BA 3MZBA 3KEIA 3K6XA 2Z22A 3MW0A 3CFZA 5I58A 4DLDA 2O1LA 2DWJA 1DSNA 3K0VA 1NKXA 3M8UA 4BDOA 5DEXA 3Q26A 2O68A 4XKNA 5I2NB 3PMVA 5B7DA 4U1OA 5TPAB 1N04A 2V3TA 4NF5A 4EF2A 5CC2A 2ZYKA 5A5XA 4OENA 4O3CA 3KOSA 1GVCA 3W9VA 4ZS9A 4R72A 3HV1A 3N5LA 1B40A 1FW0A 4NTLA 2HXWA 2FYIA 2O84X 4ESXA 1MDP1 4RPNA 2F7BA 1SW1A 4RXLA 2XXUA 3VVDA 1IUDA 1N3XA 3L6HA 1QVSA 3V8XB 3PUWE 3H03A 3KOTA 2DWAA 4IO5A 1UTBB 4H0WA 4NF8A 3N94A 2YJPA 4GL0A 5KCJB 4ZEIA 3SEUA 4AB5A 1SD3A 2I49A 3LUYA 4H65A 2E1SA 4ZEDA 4QRZA 1LAHE 1JW5A 4Q5TA 4LQ5A 3OO7A 5I56A 4ZZEA 5IAIA 3QYTA 3KBRA 2DS9A 3Q29A 4DZ1A 1MY0A 1QJMA 4R75A 1YTVA 1UTHA 2Q2CA 2I4BA 3VLVA 3ZKLA 4MBPA 4E0WA 3G3FA 4YU0A 1PB9A 3O6HA 3UORA 1LAGE 3KSXA 4BDNA 3P7IA 4IY6A 3KJ7A 4H6DA 1QW0A 4N07A 2ZNUA 3T9VA 4LZ5A 3OSRA 2FA7A 1FTMA 1MH3A 1JETA 3K4UA 3UK4A 1LFHA 2X7QA 3MPKA 5KDTB 2Y7WA 1N7XA 3T22A 1USYE 4PFTA 2DE4A 2H4IA 1HSLA 1SW5A 3C9HA 3F11A 4U4XA 1URDA 4PP0A 4F39A 4GD5A 3O6IA 1VFEA 4OETA 4OHNA 3C31A 2QJEA 4JWXA 3M3FA 5J1DA 5CMBA 1DTGA 3R6UA 5L8DA 3TMGA 5I2NA 4RYAA 4R2FA 5EHSA 4PFUA 1RYOA 5TPAA 4GXSB 3OO6A 2Y7IA 3SERA 1Y1MA 1SI0A 4JXIA 5AA2D 3FUZA 4JB7A 2QMWA 1UIVA 4WKMA 1F9BA 1MQHA 4X1DA 1M5CA 3N6TA 4G68B 4G77A 1B7UA 4F29A 1TT1A 1I6BA 2I3VA 3IOTA 4EDPA 3VLUA 1Q35A 1MM6A 3TYHA 4QHQA 3T96B 4F3GA 3K1MA 3OSQA 4KYDA 5TP9B 2XXRA 1XHYA 3RPWA 3VVFA 2UVIA 4DDDA 1QUJA 3WAEA 1O7TA 3K1NA 4LONB 1LAXA 3BKIB 1UTBA 1XC1A 1Q1KA 3C35A 4AB6A 1S50A 2XXYA 2PX1A 5KCJA 5HM4B 4GOTA 4DXUA 1M5EA 3PPNA 3B6QA 4FE8A 3ZSFA 1OLAA 3UGWA 3PUVE 2O1MA 3IJXB 3IOUA 2RC7A 4P0GA 3SESA 4IO2A 3KJTA 3JYRA 3CSGA 4ND9A 1H45A 4RK9A 2GHBA 3TODA 5I57A 2F6PA 2XXHA 3RT8A 2UYEA 3KN7A 4F1UA 5AA2B 2GHAA 4KHZE 3IB0A 3T9HB 1Z7NE 3ZS6A 2VD3A 4MLQA 2A5TA 2UYFA 3GBAA 1BLFA 4QFPA 1OVBA 3RQTA 1VSOA 3HN0A 4H1XA 4EQBA 1QUKA 5KDTA 1J1NA 2G29A 1ZLQA 2OBGA 1JQFA 4H67A 4OFLA 3RN8A 1B1XA 1NNKA 2RCAA 4F3SA 3DP6A 2R71A 2PT2A 2AIXA 3OEKA 1D3KA 2OWSA 3MVWA 5F1QA 3QUJA 5CRYA 3PPOA 1SW4A 2THIA 1A7LA 3JZJA 4UACA 3OEMA 5AA4A 3UN6A 3IL1B 1LBCA 1S9TA 4GRKA 3G3GA 2VHAA 3GZGA 4KFQA 1N84A 3V5AA 3W9WA 3CVGA 3CFLA 3PUYE 1US5A 2R6GE 1OLCA 4ONYA 1EU8A 3CI8A 2H25A 3K2DA 3G3HA 2XHDA 2RC8A 4HTGA 1IXCA 2X7PA 5DVJA 2XXWA 4C1UA 4G68A 2B3FA 1P1UA 5CM6A 3TFLA 1SVXB 5B70A 2V3QA 2CZLA 3C33A 5JTYB 3C32A 3R26A 3O9PA 3K02A 1VFDA 2ESNA 2UVHA 4XKPA 1O63A 2RKMA 1N0TA 2O51A 1Y4CA 2DYXA 4QFNA 3QUFA 2OZZA 4HW8A 3PUXE 4H5FA 4IO4A 2DSFA 3EHUA 3FVGA 4JWOA 2P0SA 4Z7EA 3MP1A 1FTJA 3I3VA 1L5TA 3U8QA 3G7WA 4RA1A 3HPIA 1H3DA 3IX1A 3TEPA 2OK2A 3TTKA 2D5WA 5L9OA 2YPNA 2O69A 3KG2A 2F78A 3BBRA 3CIJA 1MPCA 1MXVA 4F3BA 4TQUQ 4QSCA 3TTLA 4YZZA 1SDXA 3TCHA 3B7DA 3ODBA 3K6UA 2F8DA 4M1VA 4GXAA 1ZU0A 3QIMA 4BDQA 4ELQA 4JDFA 1LSTA 4P11A 3IB2A 5K2XA 5CI5A 5AA2A 1FQEA 1NNTA 3Q25A 2ZNTA 1POY1 4OXVA 1PC3A 3KSJA 1NFTA 1JEVA 1EH3A 4OQOA 4TOZA 1B9JA 3PMXA 1SYHA 4X9TA 3D4CA 2YLNA 1MPBA 1GGGA 3W15C 1BKAA 3LR1A 4YB7A 2XX7A 2V93A 4FAJA 4OWDA 4R73A 3QSLA 1OMPA 4OERA 3IK6B 4R6KA 4OMBA 1JVYA 4THIA 1XOCA 3FJGA 4L17A 1FQDA 2PBWA 1A54A 2ONRA 1O64A 2PT1A 3SEYA 3MVXA 5H8FA 3S4UA 1MY4A 3FV1A 2I3WA 1M5DA 3E13X 4KPTA 2RC9A 4ZEBA 4HCWA 4F3PA 2ZMBA 4H8IA 4POXA 3SEXA 3MQ9A 5EYFA 4GL8A 3HSTA 2ABHA 4FEBA 3V83A 4KQPA 3CRBA 5JTYA 3H06B 4DE8A 4G8NA 1CE2A 1M5BA 3RTWB 4YB6A 1OIBA 5CMCA 2UXAA 5AE4A 1A99A 1B46A 3A3CA 3H4ZA 2OWTA 4X48A 2RCBA 1P1QA 5H8QA 4LZ7A 1PBPA 1I6AA 4FJPA 4NWCA 4F2OA 3CG3A 4C1TA 3MZ1A 2F36A 3OENA 1NL5A 1TWYA 1QKAA 1NH7A 2QS2A 4G4PA 4U2RA 1B5IA 3VXCA 3KN3A 3TTMA 3CSBA 1B7ZA 2O7UA 5H8NB 3C4MA 1A8FA 4PE5B 4LP2B 3H6WA 5ITOA 2DVCA 4KCCA 1B5HA 3FJ7A 5DTBA 4RK2A 4IB2A 1JVXA 4BDMA 3ONMA 4OYVA 4KR5A 4POWA 1S7YA 1IIWA 1EZOA 1SYIA 4I62A 4EXKA 5DVFA 2OLBA 3HCQA 4XKQA 3VFJA 4KCDA 3IJOB 1NMUA 2Z23A 3IB1A 5FHNA 1B58A 4MLVA 3PD8A 2IA4A 3D4GA 1WODA 2XXVA 1Z7ME 4LZ8A 3HO7A 4BLAA 2VP1A 1B3EA 1TFAA 3QK6A 2XXXA 3FASA 5M2VA 1A55A 5F7VA 1LB8A 4Z0IA 2A5SA 2NXOA 3LSLA 3FZVA 1B52A 2XD3A 3O29A 2E0SA 2BJJX 2QPQA 4F1VA 3TQWA 3A3UA 1P1OA 5ISUA 4AQ4A 1Y3NA 5AA3A 1I69A 5AA1A 3RTFB 3E9XA 4NMYA 3LSFB 4G8MA 1B05A 2VD2A 1PB7A 3FXQA 2NUVA 2H5YA 3O2AA 2CMOA 1DPPA 5EHMA 4ZE9A 1Y3PA 5H8HB 2LAOA 2KLFA 4U4SA 5DYHA 4GWOA 4OFJA 3MJNA 3T9UA 4JBZA 2Y7RA 4QFOA 1H43A 1PDAA 2DWIA 1EZPA 3KZGA 3DM0A 5HPQA 2H98A 4FORA 2PYYA 1UIUA 3I6VA 5DVIA 3IORA 1SBPA 2Z8FA 1ZKBA 1LLSA 4NWDA 3T66A 4ECFA 3TKDA 4ELRA 2Y7PA 2ZYMA 2F5XA 5L9MA 3MVYA 4G8HA 2HZLA 3MC2A 3MBPA 3ZKKA 1ELJA 1ATGA 3PPRA 3VE1B 3G3JA 1OVTA 4PETA 3RUMA 5DEXB 3QXMA 1R1NA 3N26A 3THIA 3RLFE 4NF5B 3IO6A 1MRPA 4PFWA 3FV2A 1MQIA 3SETA 3U72A 2DOJA 1NNFA 4Q0CA 2B3BA 1B0HA 3FD3A 4YMAA 4R74A 4R6YA 3FVKA 1JW1A 3I5OA 2FNCA 5BUUA 3EQ1A 1N7WA 4O3AA 3S9NC 1MXWA 4ZEKA 3BFUA 1B3HA 3DP8A 4KYEA 3K6VA 2ONSA 4WXJA 4EF1A 1B2HA 3H6UA 1B7HA 4NF6B 2HEUA 3CR9A 1RKMA 3FJMA 3JV9A 4NF8B 1KWHA 5I84A 3O6GA 4G2ZA 4R9FA 1D4NA 4RPOA 1IXGA 1AL3A 1I6QA 1EZ9A 3PMWA 4DXBA 2HQ0A 3MP6A 3IR1A 5TP9A 1SQYA 4TLMB 3RT6B 1LAFE 4GQOA 4E0XA 4BDRA 3S9MC 1ZTYA 4NF4B 4QSDA 4GFRA 3WAFA 3IOWA 2XX8A 2PVUA 5DT6A 1B6HA 3TCGA 1LB9A 1FQCA 3FATA 3VV5A 3MP8A 1GTKA 3TZAA 2F7AA 4FIMA 1FQBA 2R9JA 1GR2A 5L9SA 1XT8A 5HBCA 3AXFA 2XD2A 3VLWA 3TTRA 5H8HA 1B4HA 3TQLA 3TPAA 3K6WA 1HSEA 3TCFA 1B3GA 1POTA 2V84A 2XXTA 3M3KA 3TTNA 5JEIA 3MZ9A 1IXIA 1FQAA 4IGTA 1VE4A 3S9LC 1URSA 3R7XA 1OQHA 2ANJA 4N6PA 3LSWA 4GVOA 4I1DA 3LC8A 2Z8DA 3Q28A 1MY2A 3H6VA 1NH8A 4NE4A 4LQ2A 3OMBA 2F6GA 4OFOA 3TAJA 1PB8A 4Q8RA 4FEDA 3TELA 1SW2A 4YMBA 4LUBA 1N3WA 4ZZAA 1WDNA 4BDLA 4DCYA 4EQ7A 1B1HA 4F19A 3IOVA 1ZIUA 2W7YA 2GRVA 2I48A 1LBBA 2REGA 1II5A 2I4CA 2DXRA 2XXQA 1PBQA 2QL3A 4LATA 2ONKE 1B3FA 3MPLA 4DIGA 1MY3A 1Y4TA 1ZMGA 1SI1A 4YAHX 1IXHA 4EXLA 1GV8A 3OOAA 5FTIA 3QAXA 2ZYOA 3UIFA 3IAZA 3FVNA 4UA8A 1AMFA 2AL5A 2G93A 4XTCQ 1IQ7A 3H3GA 3VDFA 3KFMA 4M4GA 1Y3QA 1XS5A 2DQVA 2Q88A 2DXYA 3E3KA 1P1WA 2DP8A 4YB5A 4P0IA 3CFXA 4KI0E 2P1SA 2F35A 1R9QA 4QF9A 2F34A 1Y1ZA 1JNFA 5CMMA 4NF6A 3O28A 1URGA 3EF7A 3GXAA 4YKIA 4RNSA 1BP5A 3FIRA 3BFTA 1AH5A 4ZECA 4R2BA 2HFBA 4ESWA 1IEJA 2VGQA 4IGRA 3PUZE 2PMSA 2QS4A 4NF4A 3OD7A 3T93B 5I57B 4DCXA 1FTLA 4F18A 4XIGQ 4GIZA 4ELOA 3MWBA 1LCTA 3EPEA 1XVYA 5I59B 2DE3A 3DELB 2I58A 3GLBA 4NEDA 2RF1A 2ZYNA 4R6HA 3K01A 2A5TB 3PPPA 4G68C 5ITPA 3H7MA 1MDQA 4H5GA 1MXZA 2D3IA 3EHTA 3OELA 1FCKA 1XVXA 1MQJA 4EUOA 4JSDA 1ZBMA 3S9EA 1YPNA 1USYH 5BWJA 1DTZA 1MQGA 3MAMA 4U21A 3HHFA 5K2YA 2V25A 3TUSA 2H99A 4F1YA 3FXRA 4QFKA 1FQFA 1MQDA 3U93A 5LOMA 1D9VA 1P99A 2Q8JA 3MVZA 5AA4B 2HZKA 1MXXA 3DLNA 4OEUA 4ZE8A 4PFYA 2XX9A 3C34A 3CG1A 2NOOA 1B51A 1YAEA 3U94A 1CB6A 2P2AA 1H76A 1JW4A 1MS7A 3PU5A 5ELVA 5CBSA 5FHMA 1NNPA 4OESA 4K3FA 3Q27A 3EN3A 3FGSA 1DMBA 2XXIA 1TXFA 1R6ZA 1T0KA 3MUQA 3VXBA 3FVOA 4O3BA 3UA8A 1MPDA 1AOVA 3B6WA 1R9LA 4N13A 3B6TA 5ICQA 4F2QA 4U1ZA 4XKRA 1B3LA 4I8CA 5H8SA 5FTHA 2O6AA 3DP4A 3GBBA 3USDA 2QS3A 4TLLB 1MH4A 5I2KB 4EQ9A 1RYXA 3EHSA 4IO6A 4OVJA 3OO8A 4WEPA 5JK4A 1A8EA 4FATA 4YICA 2Y7KA 1US4A 3KGCA 2WKYA 2VOZA 3FXUA 1Y20A 3OO9A 1MM7A 2ALUA 4YKJA 4GLIA 1OQGA 2NWJA 1MXYA 4OEVA 3OXNA 3LSXA 2OJTA 1LFIA 5FHOA 4F22A 2DE2A 2B65A 4FECA 3V89B 2AL4A 3H6TA 5I58B 4IY5A 1H44A 4DXCA 3C36A 4U22A 3UP9A 2GFEA 2IEEA 1ANFA 2ZNSA 5I59A 1IITA 2M8CA 4HS7A 1AIVA 4KD5A 3A09A 4R9GA 1B32A 2OCUA 1QKBA 4H8JA 5H8NA 3RNNA 3PGFA 5A5XB 1HSJA 4RJZA 3SEVA 5CBRA 1Y9UA 1M5FA 1TFDA 3E4RA 3G3KA 1LCFA 4KYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIY A;  4LA9 A;  3IO4 A;  2UVG A;  4JWY A;  1FTO A;  2Q89 A;  1B0L A;  1ZJL A;  1N76 A;  2Q9T A;  1BTJ A;  2REJ A;  4OTE A;  4F31 B;  2F97 A;  4OZ9 A;  2HAU A;  4ISU A;  2QSX A;  2Q2A A;  4C0R A;  4WED A;  2I6E A;  1LGB C;  2ZXT A;  3SKP A;  4MH5 A;  3VVE A;  3O97 A;  2F7C A;  4ELP A;  2D21 A;  4JSO A;  2I0B A;  3PD9 A;  3T9X B;  2Z8E A;  3K00 A;  5TU0 A;  3SEW A;  4X1B A;  5CMK A;  4ZDM A;  1UQW A;  3G3I A;  2QS1 A;  5H8F B;  1DOT A;  2QRY A;  2I0C A;  1JEU A;  3U92 A;  5I56 B;  3M3L A;  1B4Z A;  1MG1 A;  4YKP A;  1MXU A;  3ILT B;  4I9D A;  1P1N A;  2HCA A;  3ILU B;  1IZ1 A;  3SDF A;  2DVZ A;  3KN8 A;  2DWH A;  3K1P A;  1FTK A;  3HHG A;  4QFL A;  1PEB A;  4LVQ A;  1UTH B;  1WVJ A;  5IKB A;  4PQJ A;  1D9Y A;  1LFG A;  2NVU B;  3U1O A;  2AYS A;  2X26 A;  2O7I A;  5ICT A;  3O66 A;  3N6U A;  2GH9 A;  5H8Q B;  4HCY A;  1A40 A;  1QUL A;  4YKK A;  2QMX A;  2XXP A;  3L6G A;  4MF3 A;  2Y84 A;  5KZT A;  2RIN A;  5I2K A;  3RGY A;  1VR5 A;  2V3U A;  3LBS A;  3PPQ A;  3RY3 A;  4Q30 B;  1YCJ A;  4MFI A;  2HAV A;  4QSE A;  3PV0 E;  1DPE A;  1MY1 A;  4ZEF A;  3ECR A;  1QUI A;  1B5J A;  2UVJ A;  3TDJ A;  3S2V A;  4RY1 A;  4IO7 A;  4XXU A;  4GF8 A;  4U23 A;  4IO3 A;  2H9B A;  3MZB A;  3KEI A;  3K6X A;  2Z22 A;  3MW0 A;  3CFZ A;  5I58 A;  4DLD A;  2O1L A;  2DWJ A;  1DSN A;  3K0V A;  1NKX A;  3M8U A;  4BDO A;  5DEX A;  3Q26 A;  2O68 A;  4XKN A;  5I2N B;  3PMV A;  5B7D A;  4U1O A;  5TPA B;  1N04 A;  2V3T A;  4NF5 A;  4EF2 A;  5CC2 A;  2ZYK A;  5A5X A;  4OEN A;  4O3C A;  3KOS A;  1GVC A;  3W9V A;  4ZS9 A;  4R72 A;  3HV1 A;  3N5L A;  1B40 A;  1FW0 A;  4NTL A;  2HXW A;  2FYI A;  2O84 X;  4ESX A;  1MDP 1;  4RPN A;  2F7B A;  1SW1 A;  4RXL A;  2XXU A;  3VVD A;  1IUD A;  1N3X A;  3L6H A;  1QVS A;  3V8X B;  3PUW E;  3H03 A;  3KOT A;  2DWA A;  4IO5 A;  1UTB B;  4H0W A;  4NF8 A;  3N94 A;  2YJP A;  4GL0 A;  5KCJ B;  4ZEI A;  3SEU A;  4AB5 A;  1SD3 A;  2I49 A;  3LUY A;  4H65 A;  2E1S A;  4ZED A;  4QRZ A;  1LAH E;  1JW5 A;  4Q5T A;  4LQ5 A;  3OO7 A;  5I56 A;  4ZZE A;  5IAI A;  3QYT A;  3KBR A;  2DS9 A;  3Q29 A;  4DZ1 A;  1MY0 A;  1QJM A;  4R75 A;  1YTV A;  1UTH A;  2Q2C A;  2I4B A;  3VLV A;  3ZKL A;  4MBP A;  4E0W A;  3G3F A;  4YU0 A;  1PB9 A;  3O6H A;  3UOR A;  1LAG E;  3KSX A;  4BDN A;  3P7I A;  4IY6 A;  3KJ7 A;  4H6D A;  1QW0 A;  4N07 A;  2ZNU A;  3T9V A;  4LZ5 A;  3OSR A;  2FA7 A;  1FTM A;  1MH3 A;  1JET A;  3K4U A;  3UK4 A;  1LFH A;  2X7Q A;  3MPK A;  5KDT B;  2Y7W A;  1N7X A;  3T22 A;  1USY E;  4PFT A;  2DE4 A;  2H4I A;  1HSL A;  1SW5 A;  3C9H A;  3F11 A;  4U4X A;  1URD A;  4PP0 A;  4F39 A;  4GD5 A;  3O6I A;  1VFE A;  4OET A;  4OHN A;  3C31 A;  2QJE A;  4JWX A;  3M3F A;  5J1D A;  5CMB A;  1DTG A;  3R6U A;  5L8D A;  3TMG A;  5I2N A;  4RYA A;  4R2F A;  5EHS A;  4PFU A;  1RYO A;  5TPA A;  4GXS B;  3OO6 A;  2Y7I A;  3SER A;  1Y1M A;  1SI0 A;  4JXI A;  5AA2 D;  3FUZ A;  4JB7 A;  2QMW A;  1UIV A;  4WKM A;  1F9B A;  1MQH A;  4X1D A;  1M5C A;  3N6T A;  4G68 B;  4G77 A;  1B7U A;  4F29 A;  1TT1 A;  1I6B A;  2I3V A;  3IOT A;  4EDP A;  3VLU A;  1Q35 A;  1MM6 A;  3TYH A;  4QHQ A;  3T96 B;  4F3G A;  3K1M A;  3OSQ A;  4KYD A;  5TP9 B;  2XXR A;  1XHY A;  3RPW A;  3VVF A;  2UVI A;  4DDD A;  1QUJ A;  3WAE A;  1O7T A;  3K1N A;  4LON B;  1LAX A;  3BKI B;  1UTB A;  1XC1 A;  1Q1K A;  3C35 A;  4AB6 A;  1S50 A;  2XXY A;  2PX1 A;  5KCJ A;  5HM4 B;  4GOT A;  4DXU A;  1M5E A;  3PPN A;  3B6Q A;  4FE8 A;  3ZSF A;  1OLA A;  3UGW A;  3PUV E;  2O1M A;  3IJX B;  3IOU A;  2RC7 A;  4P0G A;  3SES A;  4IO2 A;  3KJT A;  3JYR A;  3CSG A;  4ND9 A;  1H45 A;  4RK9 A;  2GHB A;  3TOD A;  5I57 A;  2F6P A;  2XXH A;  3RT8 A;  2UYE A;  3KN7 A;  4F1U A;  5AA2 B;  2GHA A;  4KHZ E;  3IB0 A;  3T9H B;  1Z7N E;  3ZS6 A;  2VD3 A;  4MLQ A;  2A5T A;  2UYF A;  3GBA A;  1BLF A;  4QFP A;  1OVB A;  3RQT A;  1VSO A;  3HN0 A;  4H1X A;  4EQB A;  1QUK A;  5KDT A;  1J1N A;  2G29 A;  1ZLQ A;  2OBG A;  1JQF A;  4H67 A;  4OFL A;  3RN8 A;  1B1X A;  1NNK A;  2RCA A;  4F3S A;  3DP6 A;  2R71 A;  2PT2 A;  2AIX A;  3OEK A;  1D3K A;  2OWS A;  3MVW A;  5F1Q A;  3QUJ A;  5CRY A;  3PPO A;  1SW4 A;  2THI A;  1A7L A;  3JZJ A;  4UAC A;  3OEM A;  5AA4 A;  3UN6 A;  3IL1 B;  1LBC A;  1S9T A;  4GRK A;  3G3G A;  2VHA A;  3GZG A;  4KFQ A;  1N84 A;  3V5A A;  3W9W A;  3CVG A;  3CFL A;  3PUY E;  1US5 A;  2R6G E;  1OLC A;  4ONY A;  1EU8 A;  3CI8 A;  2H25 A;  3K2D A;  3G3H A;  2XHD A;  2RC8 A;  4HTG A;  1IXC A;  2X7P A;  5DVJ A;  2XXW A;  4C1U A;  4G68 A;  2B3F A;  1P1U A;  5CM6 A;  3TFL A;  1SVX B;  5B70 A;  2V3Q A;  2CZL A;  3C33 A;  5JTY B;  3C32 A;  3R26 A;  3O9P A;  3K02 A;  1VFD A;  2ESN A;  2UVH A;  4XKP A;  1O63 A;  2RKM A;  1N0T A;  2O51 A;  1Y4C A;  2DYX A;  4QFN A;  3QUF A;  2OZZ A;  4HW8 A;  3PUX E;  4H5F A;  4IO4 A;  2DSF A;  3EHU A;  3FVG A;  4JWO A;  2P0S A;  4Z7E A;  3MP1 A;  1FTJ A;  3I3V A;  1L5T A;  3U8Q A;  3G7W A;  4RA1 A;  3HPI A;  1H3D A;  3IX1 A;  3TEP A;  2OK2 A;  3TTK A;  2D5W A;  5L9O A;  2YPN A;  2O69 A;  3KG2 A;  2F78 A;  3BBR A;  3CIJ A;  1MPC A;  1MXV A;  4F3B A;  4TQU Q;  4QSC A;  3TTL A;  4YZZ A;  1SDX A;  3TCH A;  3B7D A;  3ODB A;  3K6U A;  2F8D A;  4M1V A;  4GXA A;  1ZU0 A;  3QIM A;  4BDQ A;  4ELQ A;  4JDF A;  1LST A;  4P11 A;  3IB2 A;  5K2X A;  5CI5 A;  5AA2 A;  1FQE A;  1NNT A;  3Q25 A;  2ZNT A;  1POY 1;  4OXV A;  1PC3 A;  3KSJ A;  1NFT A;  1JEV A;  1EH3 A;  4OQO A;  4TOZ A;  1B9J A;  3PMX A;  1SYH A;  4X9T A;  3D4C A;  2YLN A;  1MPB A;  1GGG A;  3W15 C;  1BKA A;  3LR1 A;  4YB7 A;  2XX7 A;  2V93 A;  4FAJ A;  4OWD A;  4R73 A;  3QSL A;  1OMP A;  4OER A;  3IK6 B;  4R6K A;  4OMB A;  1JVY A;  4THI A;  1XOC A;  3FJG A;  4L17 A;  1FQD A;  2PBW A;  1A54 A;  2ONR A;  1O64 A;  2PT1 A;  3SEY A;  3MVX A;  5H8F A;  3S4U A;  1MY4 A;  3FV1 A;  2I3W A;  1M5D A;  3E13 X;  4KPT A;  2RC9 A;  4ZEB A;  4HCW A;  4F3P A;  2ZMB A;  4H8I A;  4POX A;  3SEX A;  3MQ9 A;  5EYF A;  4GL8 A;  3HST A;  2ABH A;  4FEB A;  3V83 A;  4KQP A;  3CRB A;  5JTY A;  3H06 B;  4DE8 A;  4G8N A;  1CE2 A;  1M5B A;  3RTW B;  4YB6 A;  1OIB A;  5CMC A;  2UXA A;  5AE4 A;  1A99 A;  1B46 A;  3A3C A;  3H4Z A;  2OWT A;  4X48 A;  2RCB A;  1P1Q A;  5H8Q A;  4LZ7 A;  1PBP A;  1I6A A;  4FJP A;  4NWC A;  4F2O A;  3CG3 A;  4C1T A;  3MZ1 A;  2F36 A;  3OEN A;  1NL5 A;  1TWY A;  1QKA A;  1NH7 A;  2QS2 A;  4G4P A;  4U2R A;  1B5I A;  3VXC A;  3KN3 A;  3TTM A;  3CSB A;  1B7Z A;  2O7U A;  5H8N B;  3C4M A;  1A8F A;  4PE5 B;  4LP2 B;  3H6W A;  5ITO A;  2DVC A;  4KCC A;  1B5H A;  3FJ7 A;  5DTB A;  4RK2 A;  4IB2 A;  1JVX A;  4BDM A;  3ONM A;  4OYV A;  4KR5 A;  4POW A;  1S7Y A;  1IIW A;  1EZO A;  1SYI A;  4I62 A;  4EXK A;  5DVF A;  2OLB A;  3HCQ A;  4XKQ A;  3VFJ A;  4KCD A;  3IJO B;  1NMU A;  2Z23 A;  3IB1 A;  5FHN A;  1B58 A;  4MLV A;  3PD8 A;  2IA4 A;  3D4G A;  1WOD A;  2XXV A;  1Z7M E;  4LZ8 A;  3HO7 A;  4BLA A;  2VP1 A;  1B3E A;  1TFA A;  3QK6 A;  2XXX A;  3FAS A;  5M2V A;  1A55 A;  5F7V A;  1LB8 A;  4Z0I A;  2A5S A;  2NXO A;  3LSL A;  3FZV A;  1B52 A;  2XD3 A;  3O29 A;  2E0S A;  2BJJ X;  2QPQ A;  4F1V A;  3TQW A;  3A3U A;  1P1O A;  5ISU A;  4AQ4 A;  1Y3N A;  5AA3 A;  1I69 A;  5AA1 A;  3RTF B;  3E9X A;  4NMY A;  3LSF B;  4G8M A;  1B05 A;  2VD2 A;  1PB7 A;  3FXQ A;  2NUV A;  2H5Y A;  3O2A A;  2CMO A;  1DPP A;  5EHM A;  4ZE9 A;  1Y3P A;  5H8H B;  2LAO A;  2KLF A;  4U4S A;  5DYH A;  4GWO A;  4OFJ A;  3MJN A;  3T9U A;  4JBZ A;  2Y7R A;  4QFO A;  1H43 A;  1PDA A;  2DWI A;  1EZP A;  3KZG A;  3DM0 A;  5HPQ A;  2H98 A;  4FOR A;  2PYY A;  1UIU A;  3I6V A;  5DVI A;  3IOR A;  1SBP A;  2Z8F A;  1ZKB A;  1LLS A;  4NWD A;  3T66 A;  4ECF A;  3TKD A;  4ELR A;  2Y7P A;  2ZYM A;  2F5X A;  5L9M A;  3MVY A;  4G8H A;  2HZL A;  3MC2 A;  3MBP A;  3ZKK A;  1ELJ A;  1ATG A;  3PPR A;  3VE1 B;  3G3J A;  1OVT A;  4PET A;  3RUM A;  5DEX B;  3QXM A;  1R1N A;  3N26 A;  3THI A;  3RLF E;  4NF5 B;  3IO6 A;  1MRP A;  4PFW A;  3FV2 A;  1MQI A;  3SET A;  3U72 A;  2DOJ A;  1NNF A;  4Q0C A;  2B3B A;  1B0H A;  3FD3 A;  4YMA A;  4R74 A;  4R6Y A;  3FVK A;  1JW1 A;  3I5O A;  2FNC A;  5BUU A;  3EQ1 A;  1N7W A;  4O3A A;  3S9N C;  1MXW A;  4ZEK A;  3BFU A;  1B3H A;  3DP8 A;  4KYE A;  3K6V A;  2ONS A;  4WXJ A;  4EF1 A;  1B2H A;  3H6U A;  1B7H A;  4NF6 B;  2HEU A;  3CR9 A;  1RKM A;  3FJM A;  3JV9 A;  4NF8 B;  1KWH A;  5I84 A;  3O6G A;  4G2Z A;  4R9F A;  1D4N A;  4RPO A;  1IXG A;  1AL3 A;  1I6Q A;  1EZ9 A;  3PMW A;  4DXB A;  2HQ0 A;  3MP6 A;  3IR1 A;  5TP9 A;  1SQY A;  4TLM B;  3RT6 B;  1LAF E;  4GQO A;  4E0X A;  4BDR A;  3S9M C;  1ZTY A;  4NF4 B;  4QSD A;  4GFR A;  3WAF A;  3IOW A;  2XX8 A;  2PVU A;  5DT6 A;  1B6H A;  3TCG A;  1LB9 A;  1FQC A;  3FAT A;  3VV5 A;  3MP8 A;  1GTK A;  3TZA A;  2F7A A;  4FIM A;  1FQB A;  2R9J A;  1GR2 A;  5L9S A;  1XT8 A;  5HBC A;  3AXF A;  2XD2 A;  3VLW A;  3TTR A;  5H8H A;  1B4H A;  3TQL A;  3TPA A;  3K6W A;  1HSE A;  3TCF A;  1B3G A;  1POT A;  2V84 A;  2XXT A;  3M3K A;  3TTN A;  5JEI A;  3MZ9 A;  1IXI A;  1FQA A;  4IGT A;  1VE4 A;  3S9L C;  1URS A;  3R7X A;  1OQH A;  2ANJ A;  4N6P A;  3LSW A;  4GVO A;  4I1D A;  3LC8 A;  2Z8D A;  3Q28 A;  1MY2 A;  3H6V A;  1NH8 A;  4NE4 A;  4LQ2 A;  3OMB A;  2F6G A;  4OFO A;  3TAJ A;  1PB8 A;  4Q8R A;  4FED A;  3TEL A;  1SW2 A;  4YMB A;  4LUB A;  1N3W A;  4ZZA A;  1WDN A;  4BDL A;  4DCY A;  4EQ7 A;  1B1H A;  4F19 A;  3IOV A;  1ZIU A;  2W7Y A;  2GRV A;  2I48 A;  1LBB A;  2REG A;  1II5 A;  2I4C A;  2DXR A;  2XXQ A;  1PBQ A;  2QL3 A;  4LAT A;  2ONK E;  1B3F A;  3MPL A;  4DIG A;  1MY3 A;  1Y4T A;  1ZMG A;  1SI1 A;  4YAH X;  1IXH A;  4EXL A;  1GV8 A;  3OOA A;  5FTI A;  3QAX A;  2ZYO A;  3UIF A;  3IAZ A;  3FVN A;  4UA8 A;  1AMF A;  2AL5 A;  2G93 A;  4XTC Q;  1IQ7 A;  3H3G A;  3VDF A;  3KFM A;  4M4G A;  1Y3Q A;  1XS5 A;  2DQV A;  2Q88 A;  2DXY A;  3E3K A;  1P1W A;  2DP8 A;  4YB5 A;  4P0I A;  3CFX A;  4KI0 E;  2P1S A;  2F35 A;  1R9Q A;  4QF9 A;  2F34 A;  1Y1Z A;  1JNF A;  5CMM A;  4NF6 A;  3O28 A;  1URG A;  3EF7 A;  3GXA A;  4YKI A;  4RNS A;  1BP5 A;  3FIR A;  3BFT A;  1AH5 A;  4ZEC A;  4R2B A;  2HFB A;  4ESW A;  1IEJ A;  2VGQ A;  4IGR A;  3PUZ E;  2PMS A;  2QS4 A;  4NF4 A;  3OD7 A;  3T93 B;  5I57 B;  4DCX A;  1FTL A;  4F18 A;  4XIG Q;  4GIZ A;  4ELO A;  3MWB A;  1LCT A;  3EPE A;  1XVY A;  5I59 B;  2DE3 A;  3DEL B;  2I58 A;  3GLB A;  4NED A;  2RF1 A;  2ZYN A;  4R6H A;  3K01 A;  2A5T B;  3PPP A;  4G68 C;  5ITP A;  3H7M A;  1MDQ A;  4H5G A;  1MXZ A;  2D3I A;  3EHT A;  3OEL A;  1FCK A;  1XVX A;  1MQJ A;  4EUO A;  4JSD A;  1ZBM A;  3S9E A;  1YPN A;  1USY H;  5BWJ A;  1DTZ A;  1MQG A;  3MAM A;  4U21 A;  3HHF A;  5K2Y A;  2V25 A;  3TUS A;  2H99 A;  4F1Y A;  3FXR A;  4QFK A;  1FQF A;  1MQD A;  3U93 A;  5LOM A;  1D9V A;  1P99 A;  2Q8J A;  3MVZ A;  5AA4 B;  2HZK A;  1MXX A;  3DLN A;  4OEU A;  4ZE8 A;  4PFY A;  2XX9 A;  3C34 A;  3CG1 A;  2NOO A;  1B51 A;  1YAE A;  3U94 A;  1CB6 A;  2P2A A;  1H76 A;  1JW4 A;  1MS7 A;  3PU5 A;  5ELV A;  5CBS A;  5FHM A;  1NNP A;  4OES A;  4K3F A;  3Q27 A;  3EN3 A;  3FGS A;  1DMB A;  2XXI A;  1TXF A;  1R6Z A;  1T0K A;  3MUQ A;  3VXB A;  3FVO A;  4O3B A;  3UA8 A;  1MPD A;  1AOV A;  3B6W A;  1R9L A;  4N13 A;  3B6T A;  5ICQ A;  4F2Q A;  4U1Z A;  4XKR A;  1B3L A;  4I8C A;  5H8S A;  5FTH A;  2O6A A;  3DP4 A;  3GBB A;  3USD A;  2QS3 A;  4TLL B;  1MH4 A;  5I2K B;  4EQ9 A;  1RYX A;  3EHS A;  4IO6 A;  4OVJ A;  3OO8 A;  4WEP A;  5JK4 A;  1A8E A;  4FAT A;  4YIC A;  2Y7K A;  1US4 A;  3KGC A;  2WKY A;  2VOZ A;  3FXU A;  1Y20 A;  3OO9 A;  1MM7 A;  2ALU A;  4YKJ A;  4GLI A;  1OQG A;  2NWJ A;  1MXY A;  4OEV A;  3OXN A;  3LSX A;  2OJT A;  1LFI A;  5FHO A;  4F22 A;  2DE2 A;  2B65 A;  4FEC A;  3V89 B;  2AL4 A;  3H6T A;  5I58 B;  4IY5 A;  1H44 A;  4DXC A;  3C36 A;  4U22 A;  3UP9 A;  2GFE A;  2IEE A;  1ANF A;  2ZNS A;  5I59 A;  1IIT A;  2M8C A;  4HS7 A;  1AIV A;  4KD5 A;  3A09 A;  4R9G A;  1B32 A;  2OCU A;  1QKB A;  4H8J A;  5H8N A;  3RNN A;  3PGF A;  5A5X B;  1HSJ A;  4RJZ A;  3SEV A;  5CBR A;  1Y9U A;  1M5F A;  1TFD A;  3E4R A;  3G3K A;  1LCF A;  4KYS A; 
#chains in the Genus database with same CATH topology
 1BIY A;  4LA9 A;  3IO4 A;  2UVG A;  4JWY A;  1FTO A;  4KXP A;  2Q89 A;  1B0L A;  1ZJL A;  1N76 A;  2Q9T A;  1BTJ A;  5IM2 A;  2REJ A;  4OTE A;  4F31 B;  2F97 A;  4X8R A;  4OZ9 A;  2HAU A;  4ISU A;  2QSX A;  2Q2A A;  3ROJ A;  4C0R A;  4WED A;  2I6E A;  1LGB C;  2ZXT A;  3SKP A;  4MH5 A;  2ZZV A;  3VVE A;  3O97 A;  5ESY A;  2F7C A;  4ELP A;  4MEV A;  2D21 A;  4JSO A;  2I0B A;  3PD9 A;  3T9X B;  1NV7 A;  2Z8E A;  3K00 A;  5TU0 A;  4MAG A;  3SEW A;  4X1B A;  5CMK A;  4ZDM A;  4QXD A;  4P1E A;  1UQW A;  3G3I A;  2QS1 A;  5H8F B;  1DOT A;  2QRY A;  2I0C A;  1JEU A;  3U92 A;  5I56 B;  3M3L A;  1B4Z A;  1MG1 A;  4YKP A;  1MXU A;  3ILT B;  4I9D A;  1RDY A;  1P1N A;  2HCA A;  3ILU B;  1IZ1 A;  4JVI A;  3SDF A;  2DVZ A;  3KN8 A;  2DWH A;  3K1P A;  1FTK A;  3HHG A;  4QFL A;  1CNQ A;  1PEB A;  4LVQ A;  1UTH B;  1FBE A;  1WVJ A;  5IKB A;  2CZK A;  4PQJ A;  1D9Y A;  1LFG A;  2NVU B;  3U1O A;  1FBH A;  2AYS A;  2X26 A;  2O7I A;  5ICT A;  3O66 A;  3N6U A;  2GH9 A;  5H8Q B;  4HCY A;  1A40 A;  1QUL A;  4YKK A;  2QMX A;  2XXP A;  3L6G A;  4MF3 A;  2Y84 A;  5KZT A;  2RIN A;  5I2K A;  3RGY A;  1VR5 A;  2V3U A;  3LBS A;  3PPQ A;  3RY3 A;  4Q30 B;  1YCJ A;  4MFI A;  2HAV A;  2KR0 A;  4JVC A;  4PE3 A;  4QSE A;  3PV0 E;  3MST A;  2P3V A;  1DPE A;  1MY1 A;  4ZEF A;  3ECR A;  1QUI A;  2XXK A;  1B5J A;  2UVJ A;  3TDJ A;  3S2V A;  4RY1 A;  4IO7 A;  4XXU A;  4GF8 A;  4U23 A;  4IO3 A;  2H9B A;  3MZB A;  3KEI A;  3K6X A;  1JP4 A;  2Z22 A;  3MW0 A;  3CFZ A;  5I58 A;  4DLD A;  2O1L A;  2DWJ A;  1DSN A;  3K0V A;  1NKX A;  3M8U A;  4BDO A;  5DEX A;  1EYJ A;  3Q26 A;  4GBW A;  1LBZ A;  2O68 A;  4XKN A;  5I2N B;  3PMV A;  5B7D A;  2VT5 A;  4U1O A;  5TPA B;  1N04 A;  2V3T A;  4NF5 A;  4EF2 A;  5CC2 A;  2ZYK A;  1INP A;  5A5X A;  5EYG A;  1NV4 A;  4OEN A;  4O3C A;  2PCR A;  3KOS A;  1GVC A;  3W9V A;  4ZS9 A;  4R72 A;  3HV1 A;  3KC0 A;  3N5L A;  3U65 A;  1B40 A;  1FW0 A;  4NTL A;  2HXW A;  2FYI A;  2O84 X;  4ESX A;  1MDP 1;  4NQ8 A;  4RPN A;  2F7B A;  1FJ9 A;  1SW1 A;  4RXL A;  2XXU A;  3VVD A;  1IUD A;  1DCU A;  1N3X A;  3L6H A;  1QVS A;  3V8X B;  3PUW E;  3H03 A;  3KOT A;  2DWA A;  4IO5 A;  5F24 A;  5A5L A;  1UTB B;  4H0W A;  4NF8 A;  3N94 A;  2YJP A;  4GL0 A;  1FTA A;  5KCJ B;  4ZEI A;  1NUZ A;  3SEU A;  4AB5 A;  1SD3 A;  2I49 A;  3LUY A;  4H65 A;  2E1S A;  4ZED A;  4QRZ A;  1LAH E;  1JW5 A;  4Q5T A;  4LQ5 A;  3OO7 A;  5I56 A;  4ZZE A;  5IAI A;  3PTY A;  4MNI A;  3QYT A;  3KBR A;  2DS9 A;  3Q29 A;  4DZ1 A;  1MY0 A;  1QJM A;  4R75 A;  1YTV A;  1NUW A;  1UTH A;  2Q2C A;  2I4B A;  3VLV A;  4N81 A;  3ZKL A;  4PGN A;  4I40 A;  4MBP A;  4E0W A;  3G3F A;  4YU0 A;  5I3S A;  1PB9 A;  3O6H A;  3UOR A;  1LAG E;  3KSX A;  4BDN A;  3P7I A;  4IY6 A;  3KJ7 A;  4PFI A;  4H6D A;  1QW0 A;  4N07 A;  4O94 A;  2XA5 A;  2ZNU A;  3T9V A;  4LZ5 A;  3OSR A;  2FA7 A;  1FTM A;  1MH3 A;  1JET A;  3K4U A;  5EQA A;  5LTC A;  4NHB A;  3UK4 A;  1LFH A;  2X7Q A;  3MPK A;  5KDT B;  2Y7W A;  1N7X A;  3T22 A;  1USY E;  4PFT A;  2DE4 A;  2H4I A;  2B4L A;  1HSL A;  1SW5 A;  3C9H A;  3F11 A;  3E79 A;  4U4X A;  1URD A;  4PP0 A;  4F39 A;  4GD5 A;  1YXI A;  3O6I A;  4H46 A;  1VFE A;  4OET A;  4OHN A;  3FBP A;  3C31 A;  1NV3 A;  2QJE A;  4JWX A;  3M3F A;  5J1D A;  5CMB A;  1FPK A;  1DTG A;  3R6U A;  5L8D A;  3TMG A;  5I2N A;  4RYA A;  4R2F A;  5EHS A;  4PFU A;  1RYO A;  5TPA A;  4GXS B;  3OO6 A;  2Y7I A;  3SER A;  1Y1M A;  1SI0 A;  4JXI A;  5AA2 D;  3FUZ A;  4JB7 A;  2QMW A;  1UIV A;  4WKM A;  1F9B A;  1MQH A;  4OVT A;  4X1D A;  1M5C A;  2CEY A;  3N6T A;  4G68 B;  4G77 A;  1B7U A;  4F29 A;  1TT1 A;  1I6B A;  4HXV A;  2I3V A;  1IMF A;  3IOT A;  4EDP A;  3VLU A;  4HE2 A;  1Q35 A;  1MM6 A;  3TYH A;  4QHQ A;  5IZ3 B;  3LV0 A;  3T96 B;  4F3G A;  3K1M A;  3OSQ A;  4GWW A;  4GWU A;  4KYD A;  5TP9 B;  4NG7 A;  2XXR A;  1NV5 A;  1XHY A;  3RPW A;  3VVF A;  2UVI A;  4DDD A;  1QUJ A;  3WAE A;  1O7T A;  3K1N A;  4LON B;  4N6K A;  1LAX A;  3BKI B;  1UTB A;  1IMD A;  1XC1 A;  2FVZ A;  1Q1K A;  3C35 A;  4AB6 A;  1S50 A;  2XXY A;  2PX1 A;  5KCJ A;  5HM4 B;  4GOT A;  4PFR A;  4DXU A;  1M5E A;  3PPN A;  1FBC A;  3B6Q A;  4FE8 A;  3ZSF A;  1OLA A;  3UGW A;  1IMC A;  3PUV E;  2O1M A;  3IJX B;  5IZ1 A;  4N15 A;  3IOU A;  2RC7 A;  4P0G A;  3SES A;  4IO2 A;  3KJT A;  2L5V A;  3JYR A;  3CSG A;  4ND9 A;  1H45 A;  4RK9 A;  2GHB A;  3TOD A;  5I57 A;  5EQ9 A;  2F6P A;  4P1L A;  2XXH A;  3RT8 A;  2WYK A;  2UYE A;  3KN7 A;  4MNP A;  4F1U A;  4FBP A;  5AA2 B;  2GHA A;  4KHZ E;  3IB0 A;  4PGP A;  3T9H B;  1DBZ A;  1Z7N E;  1NUY A;  3ZS6 A;  2VD3 A;  1FPJ A;  4MLQ A;  2A5T A;  2UYF A;  3GBA A;  1BLF A;  4QFP A;  1OVB A;  3RQT A;  1FBF A;  1VSO A;  3HN0 A;  4H1X A;  4EQB A;  1QUK A;  5KDT A;  1J1N A;  2G29 A;  1ZLQ A;  2OBG A;  1JQF A;  4H67 A;  4OFL A;  5I5P A;  3RN8 A;  3MYU A;  1B1X A;  1NNK A;  2RCA A;  4F3S A;  3DP6 A;  2R71 A;  2PT2 A;  2AIX A;  3OEK A;  1D3K A;  2OWS A;  3MVW A;  5F1Q A;  3QUJ A;  5CRY A;  3PPO A;  1SW4 A;  2THI A;  1A7L A;  3JZJ A;  4UAC A;  2Q74 A;  3OEM A;  5AA4 A;  2V4C A;  4PAK A;  3UN6 A;  3IL1 B;  3IFC A;  1LBC A;  1S9T A;  4MX6 A;  4GRK A;  4HE0 A;  2ZZX A;  3G3G A;  2VHA A;  3GZG A;  4KFQ A;  1N84 A;  3V5A A;  3W9W A;  3CVG A;  3CFL A;  3PUY E;  1US5 A;  2R6G E;  1OLC A;  4ONY A;  1EU8 A;  3CI8 A;  2H25 A;  3K2D A;  3G3H A;  2XHD A;  2RC8 A;  4HTG A;  1IXC A;  2X7P A;  5DVJ A;  2XXW A;  4C1U A;  4G68 A;  2B3F A;  1P1U A;  5CM6 A;  3TFL A;  4QBA A;  1SVX B;  5B70 A;  2V3Q A;  2CZL A;  3C33 A;  1KA1 A;  3E78 A;  5JTY B;  3C32 A;  3A29 A;  2GQ1 A;  5IZ3 A;  1SPI A;  3R26 A;  1LBY A;  3O9P A;  3K02 A;  1VFD A;  2ESN A;  2UVH A;  4N8G A;  4XKP A;  1O63 A;  2RKM A;  5EQ8 A;  3T0J A;  1N0T A;  2O51 A;  1Y4C A;  2DYX A;  4QFN A;  3QUF A;  2OZZ A;  4HW8 A;  3PUX E;  4H5F A;  4IO4 A;  3SZP A;  2DSF A;  3EHU A;  3FVG A;  4JWO A;  2P0S A;  4Z7E A;  3MP1 A;  1FTJ A;  3I3V A;  1L5T A;  3U8Q A;  3G7W A;  4RA1 A;  5EQ7 A;  3HPI A;  2XWO A;  1H3D A;  4XEQ A;  3IX1 A;  3TEP A;  1NV1 A;  2OK2 A;  4GWZ A;  3TTK A;  2D5W A;  5L9O A;  2YPN A;  2O69 A;  4GWS A;  3KG2 A;  2F78 A;  3BBR A;  3CIJ A;  4PC9 A;  4PDD A;  1MPC A;  1MXV A;  4F3B A;  4TQU Q;  4QSC A;  1IMA A;  3TTL A;  4YZZ A;  1SDX A;  3TCH A;  1XI6 A;  3B7D A;  3ODB A;  3K6U A;  2F8D A;  1YYZ A;  5IGA A;  4M1V A;  4GXA A;  4I3Y A;  1ZU0 A;  3QIM A;  4BDQ A;  4ELQ A;  4JDF A;  1LST A;  4P11 A;  3IB2 A;  5K2X A;  5CI5 A;  5AA2 A;  1FQE A;  1NNT A;  3Q25 A;  2ZNT A;  1POY 1;  4OXV A;  1PC3 A;  3KSJ A;  1NFT A;  2XWK A;  2ZZW A;  1JEV A;  4DI4 B;  1FJ6 A;  1EH3 A;  4OQO A;  4TOZ A;  1B9J A;  3PMX A;  4P8B A;  1SYH A;  3NOH A;  4MJO A;  4X9T A;  3D4C A;  2YLN A;  1MPB A;  1GGG A;  3W15 C;  1BKA A;  3GYY A;  3LR1 A;  4YB7 A;  2XX7 A;  2V93 A;  4FAJ A;  4OWD A;  4R73 A;  3QSL A;  1OMP A;  4OER A;  3IK6 B;  4R6K A;  4OMB A;  1JVY A;  4THI A;  1XOC A;  3FJG A;  3KC1 A;  4L17 A;  1FQD A;  2PBW A;  1A54 A;  2ONR A;  1O64 A;  4PF6 A;  2PT1 A;  3SEY A;  3MVX A;  5H8F A;  3S4U A;  1MY4 A;  3FV1 A;  2I3W A;  2VPO A;  1M5D A;  4OA4 A;  3E13 X;  2FHY A;  4KPT A;  2RC9 A;  4ZEB A;  4HCW A;  4F3P A;  2ZMB A;  4H8I A;  4POX A;  3SEX A;  3MQ9 A;  2HHM A;  2B4M A;  4GL8 A;  5EYF A;  2OWZ A;  3HST A;  2WYP A;  2ABH A;  4FEB A;  3CHG A;  3V83 A;  4PBH A;  4KQP A;  3CRB A;  5JTY A;  3H06 B;  4DE8 A;  2WBD A;  4G8N A;  1CE2 A;  1M5B A;  3RTW B;  4YB6 A;  1OIB A;  5CMC A;  2UXA A;  5AE4 A;  1A99 A;  1B46 A;  5IZZ A;  2XWV A;  3A3C A;  3H4Z A;  4GX4 A;  2OWT A;  3T1B A;  4X48 A;  2RCB A;  1P1Q A;  5H8Q A;  4LZ7 A;  1PBP A;  1I6A A;  4FJP A;  4NWC A;  4F2O A;  3CG3 A;  2QVU A;  2F3D A;  4GX3 A;  3KBZ A;  4C1T A;  3MZ1 A;  2F36 A;  4X04 A;  3OEN A;  1NL5 A;  1TWY A;  1QKA A;  1NH7 A;  2QS2 A;  4G4P A;  4U2R A;  2DDK A;  1B5I A;  4UAB A;  3VXC A;  3KN3 A;  3TTM A;  3CSB A;  1B7Z A;  1NV6 A;  2WEF A;  2O7U A;  5H8N B;  3C4M A;  1A8F A;  4PE5 B;  4LP2 B;  3H6W A;  5ITO A;  2DVC A;  4KCC A;  1B5H A;  3FJ7 A;  4IR8 A;  5DTB A;  4RK2 A;  4PAF A;  4IB2 A;  2F3B A;  1JVX A;  2QVR A;  2WX9 A;  4BDM A;  5J16 A;  3ONM A;  5ET5 A;  4OYV A;  4KR5 A;  4OAN A;  4POW A;  1S7Y A;  2XWI A;  3B50 A;  1IIW A;  3QMF A;  1EZO A;  1SYI A;  4I62 A;  4EXK A;  5DVF A;  2OLB A;  3HCQ A;  2WBB A;  4XKQ A;  3VFJ A;  4KCD A;  4O7M A;  3IJO B;  1NMU A;  2Z23 A;  3IB1 A;  1EYK A;  2FIE A;  5FHN A;  1B58 A;  4MLV A;  3PD8 A;  2IA4 A;  3D4G A;  1WOD A;  2XXV A;  1Z7M E;  4LZ8 A;  3HO7 A;  4BLA A;  2VP1 A;  1B3E A;  1TFA A;  3QK6 A;  2XXX A;  3FAS A;  5M2V A;  1A55 A;  5F7V A;  1LB8 A;  4Z0I A;  2A5S A;  2NXO A;  3LSL A;  3FZV A;  1B52 A;  4N8Y A;  2XD3 A;  3O29 A;  2E0S A;  2BJJ X;  2QPQ A;  4F1V A;  2Y5L A;  3TQW A;  3A3U A;  1P1O A;  5ISU A;  4AQ4 A;  1Y3N A;  5AA3 A;  3D1R A;  1I69 A;  5AA1 A;  3RTF B;  3E9X A;  2MKZ A;  4NMY A;  1IMB A;  3LSF B;  2QVV A;  4G8M A;  1B05 A;  2VD2 A;  4MMP A;  1PB7 A;  3FXQ A;  2NUV A;  2H5Y A;  3O2A A;  2CMO A;  4I3E A;  1DPP A;  5EHM A;  1RDZ A;  4DI3 D;  4ZE9 A;  2Y5K A;  1Y3P A;  4NAP A;  5H8H B;  2PFY A;  2LAO A;  2KLF A;  4U4S A;  5DYH A;  4GWO A;  4OFJ A;  3MJN A;  3T9U A;  1FBP A;  4JBZ A;  4N6D A;  5EYH A;  2Y7R A;  4QFO A;  1H43 A;  1PDA A;  2DWI A;  1EZP A;  3KZG A;  1K9Z A;  2CZI A;  3RPL B;  3DM0 A;  5HPQ A;  2H98 A;  4FOR A;  1LBV A;  2PYY A;  1UIU A;  3I6V A;  5DVI A;  3IOR A;  1NV2 A;  1SBP A;  2Z8F A;  1ZKB A;  1LLS A;  1K9Y A;  2BJI A;  4NWD A;  1D9Q A;  3T66 A;  4ECF A;  3BIG A;  3TKD A;  4ELR A;  2Y7P A;  2ZYM A;  2R8T A;  1AWB A;  2F5X A;  5L9M A;  4O8M A;  3MVY A;  4G8H A;  2HZL A;  2CZH A;  3MC2 A;  3MBP A;  3ZKK A;  1Q9D A;  1ELJ A;  1ATG A;  3PPR A;  3VE1 B;  3G3J A;  1OVT A;  4PET A;  3RUM A;  5DEX B;  3QXM A;  2PFZ A;  1R1N A;  3N26 A;  3THI A;  4MHF A;  3RLF E;  4NF5 B;  3IO6 A;  1G0I A;  1MRP A;  4PFW A;  3FV2 A;  4N4U A;  1MQI A;  4PFB A;  3SET A;  3U72 A;  2DOJ A;  1NNF A;  4Q0C A;  1FPB A;  1LBX A;  2B3B A;  1B0H A;  3FD3 A;  4YMA A;  4R74 A;  4R6Y A;  3FVK A;  1JW1 A;  3I5O A;  2FNC A;  5BUU A;  3EQ1 A;  4AS5 A;  1N7W A;  4O3A A;  3S9N C;  1MXW A;  4ZEK A;  2FIX A;  3BFU A;  1B3H A;  3DP8 A;  4KYE A;  1FSA A;  3K6V A;  2ONS A;  4PBQ A;  4WXJ A;  4EF1 A;  1B2H A;  3H6U A;  1B7H A;  2JJK A;  4NF6 B;  2HEU A;  3CR9 A;  1RKM A;  3FJM A;  3JV9 A;  4NF8 B;  2CEX A;  1KWH A;  4P3L A;  1LBW A;  5I84 A;  3O6G A;  4G2Z A;  4R9F A;  1D4N A;  1YZ0 A;  4RPO A;  1IXG A;  1AL3 A;  1I6Q A;  1EZ9 A;  3PMW A;  4NX1 A;  4DXB A;  1EYI A;  2HQ0 A;  3MP6 A;  3IR1 A;  5TP9 A;  1SQY A;  4PAI A;  4TLM B;  5DW8 A;  3RT6 B;  1LAF E;  4GQO A;  1RDX A;  4E0X A;  4BDR A;  3S9M C;  1ZTY A;  4NF4 B;  4QSD A;  4GFR A;  5LDZ A;  3WAF A;  3IOW A;  2XX8 A;  2PVU A;  5DT6 A;  1B6H A;  3TCG A;  1LB9 A;  1FQC A;  3FAT A;  3VV5 A;  3MP8 A;  1GTK A;  3TZA A;  2F7A A;  4FIM A;  1FQB A;  2R9J A;  1GR2 A;  5L9S A;  1XT8 A;  5HBC A;  3AXF A;  2XD2 A;  1NI9 A;  3VLW A;  3TTR A;  5H8H A;  1B4H A;  4LN5 A;  3TQL A;  3TPA A;  3K6W A;  1HSE A;  3TCF A;  1B3G A;  1POT A;  2V84 A;  2XXT A;  3M3K A;  3TTN A;  5JEI A;  3MZ9 A;  1IXI A;  1FQA A;  4IGT A;  1VE4 A;  4GWY A;  4OVR A;  3S9L C;  1URS A;  3RPL A;  3R7X A;  4P47 A;  4H45 A;  1OQH A;  1FPF A;  2ANJ A;  4N6P A;  4P9K A;  2P3N A;  3LSW A;  4GVO A;  1FBD A;  4N91 A;  4I1D A;  3LC8 A;  2Z8D A;  3Q28 A;  1MY2 A;  3H6V A;  1NH8 A;  4NE4 A;  1BK4 A;  4LQ2 A;  3OMB A;  4GX6 A;  1NV0 A;  2F6G A;  4OFO A;  3TAJ A;  1PB8 A;  4Q8R A;  4FED A;  3TEL A;  4P56 A;  1SW2 A;  4YMB A;  1KZ8 A;  4LUB A;  1N3W A;  4ZZA A;  3IFA A;  1WDN A;  4BDL A;  1NUX A;  4DCY A;  4EQ7 A;  1B1H A;  4F19 A;  3IOV A;  1ZIU A;  2W7Y A;  2GRV A;  2I48 A;  1LBB A;  1QGX A;  2REG A;  1II5 A;  4N17 A;  4PTK A;  2I4C A;  2DXR A;  2XXQ A;  1PBQ A;  2QL3 A;  4LAT A;  2ONK E;  1B3F A;  3MPL A;  4DIG A;  1MY3 A;  4XF5 A;  1Y4T A;  1ZMG A;  1SI1 A;  4YAH X;  1IXH A;  4EXL A;  1GV8 A;  3OOA A;  5FTI A;  3QAX A;  2ZYO A;  3UIF A;  3IAZ A;  3FVN A;  4UA8 A;  1AMF A;  2AL5 A;  2G93 A;  4XTC Q;  1IQ7 A;  3H3G A;  3VDF A;  3KFM A;  4M4G A;  1Y3Q A;  1XS5 A;  2DQV A;  2Q88 A;  2DXY A;  3E3K A;  1P1W A;  2DP8 A;  4YB5 A;  4P0I A;  1FPL A;  3CFX A;  4KI0 E;  2P1S A;  2F35 A;  1R9Q A;  4QF9 A;  2F34 A;  1Y1Z A;  1JNF A;  5CMM A;  4NF6 A;  1FPG A;  3O28 A;  1URG A;  4OVQ A;  3EF7 A;  3GXA A;  3FXB A;  4YKI A;  4RNS A;  1BP5 A;  1FBG A;  3FIR A;  3BFT A;  1AH5 A;  4NGU A;  4ZEC A;  1KA0 A;  4R2B A;  2HFB A;  4ESW A;  1IEJ A;  2VGQ A;  4IGR A;  1G0H A;  2HXR A;  3PUZ E;  5T3J A;  2PMS A;  2QS4 A;  4NF4 A;  3OD7 A;  3T93 B;  5I57 B;  4DCX A;  1FTL A;  1FPD A;  2HPG A;  4F18 A;  4XIG Q;  4GIZ A;  4ELO A;  3MWB A;  1LCT A;  3EPE A;  1XVY A;  4O7I A;  5I59 B;  2DE3 A;  3DEL B;  2I58 A;  3GLB A;  3B8B A;  4NED A;  2RF1 A;  2ZYN A;  4R6H A;  3K01 A;  2A5T B;  3PPP A;  4G68 C;  5ITP A;  3H7M A;  1MDQ A;  4H5G A;  1MXZ A;  4AS4 A;  2FBP A;  2D3I A;  5ET7 A;  3EHT A;  3OEL A;  1FCK A;  1XVX A;  1MQJ A;  3HFU A;  4EUO A;  4JSD A;  1ZBM A;  3S9E A;  1YPN A;  1USY H;  5BWJ A;  1DTZ A;  1MQG A;  3MAM A;  4U21 A;  3HHF A;  5K2Y A;  2V25 A;  3TUS A;  2H99 A;  4F1Y A;  3FXR A;  4QFK A;  1FQF A;  1MQD A;  3U93 A;  5ET8 A;  5LOM A;  4NF0 A;  1D9V A;  1P99 A;  2Q8J A;  3MVZ A;  5AA4 B;  2HZK A;  1MXX A;  3DLN A;  1LEV A;  4OEU A;  3RYD A;  4ZE8 A;  4OVP A;  2XX9 A;  4PFY A;  3C34 A;  3CG1 A;  2NOO A;  1B51 A;  1YAE A;  3U94 A;  4NN3 A;  1VDW A;  1CB6 A;  2P2A A;  1H76 A;  1JW4 A;  4MIJ A;  1MS7 A;  1FPI A;  3PU5 A;  5ELV A;  5CBS A;  5FHM A;  2KQZ A;  1NNP A;  4OES A;  4K3F A;  3EKI A;  3Q27 A;  4MNC A;  5FBP A;  3EN3 A;  3FGS A;  1DMB A;  2XXI A;  1TXF A;  1R6Z A;  1T0K A;  3BIH A;  3MUQ A;  3VXB A;  3FVO A;  4O3B A;  3UA8 A;  1MPD A;  1AOV A;  3B6W A;  1R9L A;  4N13 A;  2Q8M A;  4GWX A;  3B6T A;  5ICQ A;  4F2Q A;  4U1Z A;  4XKR A;  1B3L A;  4I8C A;  5H8S A;  2VPN A;  5FTH A;  2O6A A;  3DP4 A;  4XFE A;  3GBB A;  3USD A;  2QS3 A;  4TLL B;  1MH4 A;  5I2K B;  4EQ9 A;  1RYX A;  3EHS A;  4IO6 A;  4PDH A;  4OVJ A;  4WEP A;  3OO8 A;  4G61 A;  5JK4 A;  1A8E A;  4FAT A;  4YIC A;  2Y7K A;  1US4 A;  1IME A;  3KGC A;  2WKY A;  4PF8 A;  2VOZ A;  3FXU A;  1Y20 A;  4MCO A;  3LUZ A;  3OO9 A;  1MM7 A;  2ALU A;  4YKJ A;  4GLI A;  1OQG A;  2NWJ A;  1MXY A;  4OEV A;  3OXN A;  3LSX A;  2OJT A;  1LFI A;  4HE1 A;  5FHO A;  4F22 A;  2DE2 A;  2B65 A;  1DK4 A;  2OX3 A;  4FEC A;  3V89 B;  2AL4 A;  3H6T A;  5I58 B;  4IY5 A;  1H44 A;  4DXC A;  3C36 A;  1FRP A;  1FPE A;  2QFL A;  4U22 A;  3UP9 A;  2GFE A;  4PCD A;  2IEE A;  1ANF A;  2ZNS A;  5I59 A;  1IIT A;  5I7I A;  2M8C A;  4HS7 A;  1AIV A;  4KD5 A;  3A09 A;  4R9G A;  1B32 A;  2OCU A;  1QKB A;  4H8J A;  5H8N A;  3RNN A;  3PGF A;  4JVD A;  5A5X B;  1HSJ A;  4RJZ A;  3SEV A;  3ISP A;  4GBV A;  5CBR A;  1Y9U A;  1M5F A;  1TFD A;  3E4R A;  3G3K A;  4OVS A;  1LCF A;  5ET6 A;  4KYS A; 
#chains in the Genus database with same CATH homology
 1BIY A;  4LA9 A;  3IO4 A;  2UVG A;  4JWY A;  1FTO A;  2Q89 A;  1B0L A;  1ZJL A;  1N76 A;  2Q9T A;  1BTJ A;  2REJ A;  4OTE A;  4F31 B;  2F97 A;  4OZ9 A;  2HAU A;  4ISU A;  2QSX A;  2Q2A A;  4C0R A;  4WED A;  2I6E A;  1LGB C;  2ZXT A;  3SKP A;  4MH5 A;  3VVE A;  3O97 A;  2F7C A;  4ELP A;  2D21 A;  4JSO A;  2I0B A;  3PD9 A;  3T9X B;  2Z8E A;  3K00 A;  5TU0 A;  3SEW A;  4X1B A;  5CMK A;  4ZDM A;  1UQW A;  3G3I A;  2QS1 A;  5H8F B;  1DOT A;  2QRY A;  2I0C A;  1JEU A;  3U92 A;  5I56 B;  3M3L A;  1B4Z A;  1MG1 A;  4YKP A;  1MXU A;  3ILT B;  4I9D A;  1P1N A;  2HCA A;  3ILU B;  1IZ1 A;  3SDF A;  2DVZ A;  3KN8 A;  2DWH A;  3K1P A;  1FTK A;  3HHG A;  4QFL A;  1PEB A;  4LVQ A;  1UTH B;  1WVJ A;  5IKB A;  4PQJ A;  1D9Y A;  1LFG A;  2NVU B;  3U1O A;  2AYS A;  2X26 A;  2O7I A;  5ICT A;  3O66 A;  3N6U A;  2GH9 A;  5H8Q B;  4HCY A;  1A40 A;  1QUL A;  4YKK A;  2QMX A;  2XXP A;  3L6G A;  4MF3 A;  2Y84 A;  5KZT A;  2RIN A;  5I2K A;  3RGY A;  1VR5 A;  2V3U A;  3LBS A;  3PPQ A;  3RY3 A;  4Q30 B;  1YCJ A;  4MFI A;  2HAV A;  4QSE A;  3PV0 E;  1DPE A;  1MY1 A;  4ZEF A;  3ECR A;  1QUI A;  1B5J A;  2UVJ A;  3TDJ A;  3S2V A;  4RY1 A;  4IO7 A;  4XXU A;  4GF8 A;  4U23 A;  4IO3 A;  2H9B A;  3MZB A;  3KEI A;  3K6X A;  2Z22 A;  3MW0 A;  3CFZ A;  5I58 A;  4DLD A;  2O1L A;  2DWJ A;  1DSN A;  3K0V A;  1NKX A;  3M8U A;  4BDO A;  5DEX A;  3Q26 A;  2O68 A;  4XKN A;  5I2N B;  3PMV A;  5B7D A;  4U1O A;  5TPA B;  1N04 A;  2V3T A;  4NF5 A;  4EF2 A;  5CC2 A;  2ZYK A;  5A5X A;  4OEN A;  4O3C A;  3KOS A;  1GVC A;  3W9V A;  4ZS9 A;  4R72 A;  3HV1 A;  3N5L A;  1B40 A;  1FW0 A;  4NTL A;  2HXW A;  2FYI A;  2O84 X;  4ESX A;  1MDP 1;  4RPN A;  2F7B A;  1SW1 A;  4RXL A;  2XXU A;  3VVD A;  1IUD A;  1N3X A;  3L6H A;  1QVS A;  3V8X B;  3PUW E;  3H03 A;  3KOT A;  2DWA A;  4IO5 A;  1UTB B;  4H0W A;  4NF8 A;  3N94 A;  2YJP A;  4GL0 A;  5KCJ B;  4ZEI A;  3SEU A;  4AB5 A;  1SD3 A;  2I49 A;  3LUY A;  4H65 A;  2E1S A;  4ZED A;  4QRZ A;  1LAH E;  1JW5 A;  4Q5T A;  4LQ5 A;  3OO7 A;  5I56 A;  4ZZE A;  5IAI A;  3QYT A;  3KBR A;  2DS9 A;  3Q29 A;  4DZ1 A;  1MY0 A;  1QJM A;  4R75 A;  1YTV A;  1UTH A;  2Q2C A;  2I4B A;  3VLV A;  3ZKL A;  4MBP A;  4E0W A;  3G3F A;  4YU0 A;  1PB9 A;  3O6H A;  3UOR A;  1LAG E;  3KSX A;  4BDN A;  3P7I A;  4IY6 A;  3KJ7 A;  4H6D A;  1QW0 A;  4N07 A;  2ZNU A;  3T9V A;  4LZ5 A;  3OSR A;  2FA7 A;  1FTM A;  1MH3 A;  1JET A;  3K4U A;  3UK4 A;  1LFH A;  2X7Q A;  3MPK A;  5KDT B;  2Y7W A;  1N7X A;  3T22 A;  1USY E;  4PFT A;  2DE4 A;  2H4I A;  1HSL A;  1SW5 A;  3C9H A;  3F11 A;  4U4X A;  1URD A;  4PP0 A;  4F39 A;  4GD5 A;  3O6I A;  1VFE A;  4OET A;  4OHN A;  3C31 A;  2QJE A;  4JWX A;  3M3F A;  5J1D A;  5CMB A;  1DTG A;  3R6U A;  5L8D A;  3TMG A;  5I2N A;  4RYA A;  4R2F A;  5EHS A;  4PFU A;  1RYO A;  5TPA A;  4GXS B;  3OO6 A;  2Y7I A;  3SER A;  1Y1M A;  1SI0 A;  4JXI A;  5AA2 D;  3FUZ A;  4JB7 A;  2QMW A;  1UIV A;  4WKM A;  1F9B A;  1MQH A;  4X1D A;  1M5C A;  3N6T A;  4G68 B;  4G77 A;  1B7U A;  4F29 A;  1TT1 A;  1I6B A;  2I3V A;  3IOT A;  4EDP A;  3VLU A;  1Q35 A;  1MM6 A;  3TYH A;  4QHQ A;  3T96 B;  4F3G A;  3K1M A;  3OSQ A;  4KYD A;  5TP9 B;  2XXR A;  1XHY A;  3RPW A;  3VVF A;  2UVI A;  4DDD A;  1QUJ A;  3WAE A;  1O7T A;  3K1N A;  4LON B;  1LAX A;  3BKI B;  1UTB A;  1XC1 A;  1Q1K A;  3C35 A;  4AB6 A;  1S50 A;  2XXY A;  2PX1 A;  5KCJ A;  5HM4 B;  4GOT A;  4DXU A;  1M5E A;  3PPN A;  3B6Q A;  4FE8 A;  3ZSF A;  1OLA A;  3UGW A;  3PUV E;  2O1M A;  3IJX B;  3IOU A;  2RC7 A;  4P0G A;  3SES A;  4IO2 A;  3KJT A;  3JYR A;  3CSG A;  4ND9 A;  1H45 A;  4RK9 A;  2GHB A;  3TOD A;  5I57 A;  2F6P A;  2XXH A;  3RT8 A;  2UYE A;  3KN7 A;  4F1U A;  5AA2 B;  2GHA A;  4KHZ E;  3IB0 A;  3T9H B;  1Z7N E;  3ZS6 A;  2VD3 A;  4MLQ A;  2A5T A;  2UYF A;  3GBA A;  1BLF A;  4QFP A;  1OVB A;  3RQT A;  1VSO A;  3HN0 A;  4H1X A;  4EQB A;  1QUK A;  5KDT A;  1J1N A;  2G29 A;  1ZLQ A;  2OBG A;  1JQF A;  4H67 A;  4OFL A;  3RN8 A;  1B1X A;  1NNK A;  2RCA A;  4F3S A;  3DP6 A;  2R71 A;  2PT2 A;  2AIX A;  3OEK A;  1D3K A;  2OWS A;  3MVW A;  5F1Q A;  3QUJ A;  5CRY A;  3PPO A;  1SW4 A;  2THI A;  1A7L A;  3JZJ A;  4UAC A;  3OEM A;  5AA4 A;  3UN6 A;  3IL1 B;  1LBC A;  1S9T A;  4GRK A;  3G3G A;  2VHA A;  3GZG A;  4KFQ A;  1N84 A;  3V5A A;  3W9W A;  3CVG A;  3CFL A;  3PUY E;  1US5 A;  2R6G E;  1OLC A;  4ONY A;  1EU8 A;  3CI8 A;  2H25 A;  3K2D A;  3G3H A;  2XHD A;  2RC8 A;  4HTG A;  1IXC A;  2X7P A;  5DVJ A;  2XXW A;  4C1U A;  4G68 A;  2B3F A;  1P1U A;  5CM6 A;  3TFL A;  1SVX B;  5B70 A;  2V3Q A;  2CZL A;  3C33 A;  5JTY B;  3C32 A;  3R26 A;  3O9P A;  3K02 A;  1VFD A;  2ESN A;  2UVH A;  4XKP A;  1O63 A;  2RKM A;  1N0T A;  2O51 A;  1Y4C A;  2DYX A;  4QFN A;  3QUF A;  2OZZ A;  4HW8 A;  3PUX E;  4H5F A;  4IO4 A;  2DSF A;  3EHU A;  3FVG A;  4JWO A;  2P0S A;  4Z7E A;  3MP1 A;  1FTJ A;  3I3V A;  1L5T A;  3U8Q A;  3G7W A;  4RA1 A;  3HPI A;  1H3D A;  3IX1 A;  3TEP A;  2OK2 A;  3TTK A;  2D5W A;  5L9O A;  2YPN A;  2O69 A;  3KG2 A;  2F78 A;  3BBR A;  3CIJ A;  1MPC A;  1MXV A;  4F3B A;  4TQU Q;  4QSC A;  3TTL A;  4YZZ A;  1SDX A;  3TCH A;  3B7D A;  3ODB A;  3K6U A;  2F8D A;  4M1V A;  4GXA A;  1ZU0 A;  3QIM A;  4BDQ A;  4ELQ A;  4JDF A;  1LST A;  4P11 A;  3IB2 A;  5K2X A;  5CI5 A;  5AA2 A;  1FQE A;  1NNT A;  3Q25 A;  2ZNT A;  1POY 1;  4OXV A;  1PC3 A;  3KSJ A;  1NFT A;  1JEV A;  1EH3 A;  4OQO A;  4TOZ A;  1B9J A;  3PMX A;  1SYH A;  4X9T A;  3D4C A;  2YLN A;  1MPB A;  1GGG A;  3W15 C;  1BKA A;  3LR1 A;  4YB7 A;  2XX7 A;  2V93 A;  4FAJ A;  4OWD A;  4R73 A;  3QSL A;  1OMP A;  4OER A;  3IK6 B;  4R6K A;  4OMB A;  1JVY A;  4THI A;  1XOC A;  3FJG A;  4L17 A;  1FQD A;  2PBW A;  1A54 A;  2ONR A;  1O64 A;  2PT1 A;  3SEY A;  3MVX A;  5H8F A;  3S4U A;  1MY4 A;  3FV1 A;  2I3W A;  1M5D A;  3E13 X;  4KPT A;  2RC9 A;  4ZEB A;  4HCW A;  4F3P A;  2ZMB A;  4H8I A;  4POX A;  3SEX A;  3MQ9 A;  5EYF A;  4GL8 A;  3HST A;  2ABH A;  4FEB A;  3V83 A;  4KQP A;  3CRB A;  5JTY A;  3H06 B;  4DE8 A;  4G8N A;  1CE2 A;  1M5B A;  3RTW B;  4YB6 A;  1OIB A;  5CMC A;  2UXA A;  5AE4 A;  1A99 A;  1B46 A;  3A3C A;  3H4Z A;  2OWT A;  4X48 A;  2RCB A;  1P1Q A;  5H8Q A;  4LZ7 A;  1PBP A;  1I6A A;  4FJP A;  4NWC A;  4F2O A;  3CG3 A;  4C1T A;  3MZ1 A;  2F36 A;  3OEN A;  1NL5 A;  1TWY A;  1QKA A;  1NH7 A;  2QS2 A;  4G4P A;  4U2R A;  1B5I A;  3VXC A;  3KN3 A;  3TTM A;  3CSB A;  1B7Z A;  2O7U A;  5H8N B;  3C4M A;  1A8F A;  4PE5 B;  4LP2 B;  3H6W A;  5ITO A;  2DVC A;  4KCC A;  1B5H A;  3FJ7 A;  5DTB A;  4RK2 A;  4IB2 A;  1JVX A;  4BDM A;  3ONM A;  4OYV A;  4KR5 A;  4POW A;  1S7Y A;  1IIW A;  1EZO A;  1SYI A;  4I62 A;  4EXK A;  5DVF A;  2OLB A;  3HCQ A;  4XKQ A;  3VFJ A;  4KCD A;  3IJO B;  1NMU A;  2Z23 A;  3IB1 A;  5FHN A;  1B58 A;  4MLV A;  3PD8 A;  2IA4 A;  3D4G A;  1WOD A;  2XXV A;  1Z7M E;  4LZ8 A;  3HO7 A;  4BLA A;  2VP1 A;  1B3E A;  1TFA A;  3QK6 A;  2XXX A;  3FAS A;  5M2V A;  1A55 A;  5F7V A;  1LB8 A;  4Z0I A;  2A5S A;  2NXO A;  3LSL A;  3FZV A;  1B52 A;  2XD3 A;  3O29 A;  2E0S A;  2BJJ X;  2QPQ A;  4F1V A;  3TQW A;  3A3U A;  1P1O A;  5ISU A;  4AQ4 A;  1Y3N A;  5AA3 A;  1I69 A;  5AA1 A;  3RTF B;  3E9X A;  4NMY A;  3LSF B;  4G8M A;  1B05 A;  2VD2 A;  1PB7 A;  3FXQ A;  2NUV A;  2H5Y A;  3O2A A;  2CMO A;  1DPP A;  5EHM A;  4ZE9 A;  1Y3P A;  5H8H B;  2LAO A;  2KLF A;  4U4S A;  5DYH A;  4GWO A;  4OFJ A;  3MJN A;  3T9U A;  4JBZ A;  2Y7R A;  4QFO A;  1H43 A;  1PDA A;  2DWI A;  1EZP A;  3KZG A;  3DM0 A;  5HPQ A;  2H98 A;  4FOR A;  2PYY A;  1UIU A;  3I6V A;  5DVI A;  3IOR A;  1SBP A;  2Z8F A;  1ZKB A;  1LLS A;  4NWD A;  3T66 A;  4ECF A;  3TKD A;  4ELR A;  2Y7P A;  2ZYM A;  2F5X A;  5L9M A;  3MVY A;  4G8H A;  2HZL A;  3MC2 A;  3MBP A;  3ZKK A;  1ELJ A;  1ATG A;  3PPR A;  3VE1 B;  3G3J A;  1OVT A;  4PET A;  3RUM A;  5DEX B;  3QXM A;  1R1N A;  3N26 A;  3THI A;  3RLF E;  4NF5 B;  3IO6 A;  1MRP A;  4PFW A;  3FV2 A;  1MQI A;  3SET A;  3U72 A;  2DOJ A;  1NNF A;  4Q0C A;  2B3B A;  1B0H A;  3FD3 A;  4YMA A;  4R74 A;  4R6Y A;  3FVK A;  1JW1 A;  3I5O A;  2FNC A;  5BUU A;  3EQ1 A;  1N7W A;  4O3A A;  3S9N C;  1MXW A;  4ZEK A;  3BFU A;  1B3H A;  3DP8 A;  4KYE A;  3K6V A;  2ONS A;  4WXJ A;  4EF1 A;  1B2H A;  3H6U A;  1B7H A;  4NF6 B;  2HEU A;  3CR9 A;  1RKM A;  3FJM A;  3JV9 A;  4NF8 B;  1KWH A;  5I84 A;  3O6G A;  4G2Z A;  4R9F A;  1D4N A;  4RPO A;  1IXG A;  1AL3 A;  1I6Q A;  1EZ9 A;  3PMW A;  4DXB A;  2HQ0 A;  3MP6 A;  3IR1 A;  5TP9 A;  1SQY A;  4TLM B;  3RT6 B;  1LAF E;  4GQO A;  4E0X A;  4BDR A;  3S9M C;  1ZTY A;  4NF4 B;  4QSD A;  4GFR A;  3WAF A;  3IOW A;  2XX8 A;  2PVU A;  5DT6 A;  1B6H A;  3TCG A;  1LB9 A;  1FQC A;  3FAT A;  3VV5 A;  3MP8 A;  1GTK A;  3TZA A;  2F7A A;  4FIM A;  1FQB A;  2R9J A;  1GR2 A;  5L9S A;  1XT8 A;  5HBC A;  3AXF A;  2XD2 A;  3VLW A;  3TTR A;  5H8H A;  1B4H A;  3TQL A;  3TPA A;  3K6W A;  1HSE A;  3TCF A;  1B3G A;  1POT A;  2V84 A;  2XXT A;  3M3K A;  3TTN A;  5JEI A;  3MZ9 A;  1IXI A;  1FQA A;  4IGT A;  1VE4 A;  3S9L C;  1URS A;  3R7X A;  1OQH A;  2ANJ A;  4N6P A;  3LSW A;  4GVO A;  4I1D A;  3LC8 A;  2Z8D A;  3Q28 A;  1MY2 A;  3H6V A;  1NH8 A;  4NE4 A;  4LQ2 A;  3OMB A;  2F6G A;  4OFO A;  3TAJ A;  1PB8 A;  4Q8R A;  4FED A;  3TEL A;  1SW2 A;  4YMB A;  4LUB A;  1N3W A;  4ZZA A;  1WDN A;  4BDL A;  4DCY A;  4EQ7 A;  1B1H A;  4F19 A;  3IOV A;  1ZIU A;  2W7Y A;  2GRV A;  2I48 A;  1LBB A;  2REG A;  1II5 A;  2I4C A;  2DXR A;  2XXQ A;  1PBQ A;  2QL3 A;  4LAT A;  2ONK E;  1B3F A;  3MPL A;  4DIG A;  1MY3 A;  1Y4T A;  1ZMG A;  1SI1 A;  4YAH X;  1IXH A;  4EXL A;  1GV8 A;  3OOA A;  5FTI A;  3QAX A;  2ZYO A;  3UIF A;  3IAZ A;  3FVN A;  4UA8 A;  1AMF A;  2AL5 A;  2G93 A;  4XTC Q;  1IQ7 A;  3H3G A;  3VDF A;  3KFM A;  4M4G A;  1Y3Q A;  1XS5 A;  2DQV A;  2Q88 A;  2DXY A;  3E3K A;  1P1W A;  2DP8 A;  4YB5 A;  4P0I A;  3CFX A;  4KI0 E;  2P1S A;  2F35 A;  1R9Q A;  4QF9 A;  2F34 A;  1Y1Z A;  1JNF A;  5CMM A;  4NF6 A;  3O28 A;  1URG A;  3EF7 A;  3GXA A;  4YKI A;  4RNS A;  1BP5 A;  3FIR A;  3BFT A;  1AH5 A;  4ZEC A;  4R2B A;  2HFB A;  4ESW A;  1IEJ A;  2VGQ A;  4IGR A;  3PUZ E;  2PMS A;  2QS4 A;  4NF4 A;  3OD7 A;  3T93 B;  5I57 B;  4DCX A;  1FTL A;  4F18 A;  4XIG Q;  4GIZ A;  4ELO A;  3MWB A;  1LCT A;  3EPE A;  1XVY A;  5I59 B;  2DE3 A;  3DEL B;  2I58 A;  3GLB A;  4NED A;  2RF1 A;  2ZYN A;  4R6H A;  3K01 A;  2A5T B;  3PPP A;  4G68 C;  5ITP A;  3H7M A;  1MDQ A;  4H5G A;  1MXZ A;  2D3I A;  3EHT A;  3OEL A;  1FCK A;  1XVX A;  1MQJ A;  4EUO A;  4JSD A;  1ZBM A;  3S9E A;  1YPN A;  1USY H;  5BWJ A;  1DTZ A;  1MQG A;  3MAM A;  4U21 A;  3HHF A;  5K2Y A;  2V25 A;  3TUS A;  2H99 A;  4F1Y A;  3FXR A;  4QFK A;  1FQF A;  1MQD A;  3U93 A;  5LOM A;  1D9V A;  1P99 A;  2Q8J A;  3MVZ A;  5AA4 B;  2HZK A;  1MXX A;  3DLN A;  4OEU A;  4ZE8 A;  4PFY A;  2XX9 A;  3C34 A;  3CG1 A;  2NOO A;  1B51 A;  1YAE A;  3U94 A;  1CB6 A;  2P2A A;  1H76 A;  1JW4 A;  1MS7 A;  3PU5 A;  5ELV A;  5CBS A;  5FHM A;  1NNP A;  4OES A;  4K3F A;  3Q27 A;  3EN3 A;  3FGS A;  1DMB A;  2XXI A;  1TXF A;  1R6Z A;  1T0K A;  3MUQ A;  3VXB A;  3FVO A;  4O3B A;  3UA8 A;  1MPD A;  1AOV A;  3B6W A;  1R9L A;  4N13 A;  3B6T A;  5ICQ A;  4F2Q A;  4U1Z A;  4XKR A;  1B3L A;  4I8C A;  5H8S A;  5FTH A;  2O6A A;  3DP4 A;  3GBB A;  3USD A;  2QS3 A;  4TLL B;  1MH4 A;  5I2K B;  4EQ9 A;  1RYX A;  3EHS A;  4IO6 A;  4OVJ A;  3OO8 A;  4WEP A;  5JK4 A;  1A8E A;  4FAT A;  4YIC A;  2Y7K A;  1US4 A;  3KGC A;  2WKY A;  2VOZ A;  3FXU A;  1Y20 A;  3OO9 A;  1MM7 A;  2ALU A;  4YKJ A;  4GLI A;  1OQG A;  2NWJ A;  1MXY A;  4OEV A;  3OXN A;  3LSX A;  2OJT A;  1LFI A;  5FHO A;  4F22 A;  2DE2 A;  2B65 A;  4FEC A;  3V89 B;  2AL4 A;  3H6T A;  5I58 B;  4IY5 A;  1H44 A;  4DXC A;  3C36 A;  4U22 A;  3UP9 A;  2GFE A;  2IEE A;  1ANF A;  2ZNS A;  5I59 A;  1IIT A;  2M8C A;  4HS7 A;  1AIV A;  4KD5 A;  3A09 A;  4R9G A;  1B32 A;  2OCU A;  1QKB A;  4H8J A;  5H8N A;  3RNN A;  3PGF A;  5A5X B;  1HSJ A;  4RJZ A;  3SEV A;  5CBR A;  1Y9U A;  1M5F A;  1TFD A;  3E4R A;  3G3K A;  1LCF A;  4KYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...