4OVPA

Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1, target efi-510292, with bound alpha-d-manuronate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
323
structure length
308
Chain Sequence
b'HHHHHHMETVLRGASMFDEEHAFTKTLRKFEELVDEKYDGDVTFDLRLNGELGVESDYVTFLNQGVAIDYTILAPSNMAKFAPSIPLMDMPFLFRDLDHWNAVLSSDVLAPLEDELLEKADIKIVGYTGGGTRNLLSKQPVVTFDDLKGHKMRVMGAPIQAQIFQALTAAPSAIAYNEVYNAIQTGVIAGFENEAASIQNLKFYEVAPNLTLTRHSITVRPIVMSGKTFNSLPADLQAVVLEAGEEAGAYGRELESREDGVKLQEMVDAGQLTVSEFENRDKMLEMVKPVQDAYAAEIGASDLLEAVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C4-dicarboxylate transport system substrate-binding protein
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Sulfitobacter sp.
molecule tags Solute-binding protein
total genus 98
structure length 308
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ovpA00
4NGUA 4P1LA 4N91A 4PFBA 4MCOA 4PCDA 4MHFA 5I5PA 4P47A 4PFIA 5IGAA 4OVPA 2VPNA 4MIJA 4NQ8A 4OANA 4MX6A 4UABA 4P8BA 2WX9A 4MEVA 4PGPA 4PDHA 2V4CA 4OVQA 4NN3A 4PAFA 4PDDA 4O94A 4XF5A 4PF6A 4P9KA 4NX1A 4PFRA 5I7IA 3FXBA 2HPGA 5IM2A 4DI4B 4XFEA 4X04A 5IZZA 2XA5A 4O7MA 2VPOA 4N15A 4NF0A 4PF8A 2CEYA 4PAIA 2XWKA 2XXKA 4N8YA 2ZZWA 2PFZA 4P3LA 4DI3D 4N8GA 4PBHA 4N4UA 4P1EA 4NAPA 4N6DA 2HZKA 4P56A 4O8MA 2XWIA 2XWOA 4OA4A 2XWVA 3U65A 4PBQA 4OVSA 5CM6A 4OVTA 2ZZXA 4NHBA 3B50A 4XEQA 4PAKA 4YICA 4LN5A 4MMPA 4N6KA 4MAGA 4NG7A 4YZZA 4MNCA 4N17A 2CEXA 4X8RA 2WYPA 2HZLA 4PE3A 3GYYA 4PC9A 4PETA 4OVRA 2ZZVA 5LTCA 2WYKA 2PFYA 4PGNA 4MNPA 4MNIA
chains in the Genus database with same CATH superfamily
1L5TA 1B4ZA 4F22A 4PP0A 5H8FA 4RYAA 4N91A 2CZHA 4MCOA 4DLDA 3HSTA 4MHFA 4WEPA 1LBWA 2VOZA 1JW1A 1MH4A 2ZYKA 4JDFA 2CZKA 4JBZA 1B32A 2WEFA 2Q2AA 4P8BA 5TP9B 5J1DA 4GVOA 1ZMGA 1K9YA 1IXIA 4Z7EA 3MQ9A 4JVIA 5DVJA 3RN8A 3PMXA 4I40A 5KDTA 4HS7A 1FPKA 3O6HA 1QGXA 1IUDA 2HCAA 3PPOA 4H8IA 4GBWA 3EHUA 2KLFA 3ZS6A 4N15A 4U2RA 3O97A 2I4CA 2F7BA 4F18A 5CI5A 5HM4B 4EQ7A 1XVXA 4F2QA 1FQBA 2NVUB 3T93B 1USYE 1XI6A 4P3LA 3IL1B 1MY1A 3PPPA 3DM0A 1CNQA 4FEDA 1D4NA 4FECA 3RPWA 3AXFA 3FV1A 2I0BA 2ZYMA 4ZDMA 1QKBA 1LAFE 1GR2A 4NF8A 2F34A 4G8MA 3RGYA 4YKKA 2ONRA 5I57B 1HSLA 2D5WA 5JEIA 2Z23A 4F3BA 1ZJLA 3VVDA 3I5OA 5I3SA 5K2XA 1OLAA 3VLUA 1TFAA 2H99A 4P11A 2O68A 2F7AA 3KSXA 1JVYA 5HBCA 3LBSA 2HXRA 5FHNA 3M3FA 3T1BA 3DP6A 3SDFA 4ZECA 2F3DA 3M3KA 2DE3A 4OYVA 1SW2A 3PGFA 2Q9TA 5DYHA 3HHFA 4GQOA 1FBEA 5I56A 4R9GA 1P1OA 4H46A 1N7WA 1MQDA 1EH3A 1NUXA 2AYSA 2F36A 4HXVA 4YMAA 2GH9A 3SKPA 4UABA 3R7XA 2WX9A 4OVQA 3Q28A 4GD5A 3H03A 4R74A 4PF6A 2PX1A 1VSOA 4EF1A 2OLBA 4EDPA 3GXAA 4M4GA 4ZE8A 2RC8A 1DPEA 4GIZA 4ECFA 4NF5B 2XXQA 3OEMA 3DP8A 4ESWA 1US5A 1XC1A 3K02A 1Z7ME 4R75A 1MDP1 5FBPA 5CMCA 3QMFA 3EQ1A 4MF3A 3D4GA 3TYHA 5H8HB 2XWOA 4OA4A 2ZMBA 4EQBA 3LC8A 5B7DA 5CM6A 3GBBA 3G7WA 3E4RA 4X1BA 4MFIA 1QJMA 4U1OA 4THIA 2DP8A 2AIXA 3CFZA 3KN7A 3K1NA 4DZ1A 3N26A 5CRYA 3W9WA 1NUYA 2X26A 1B5JA 3DP4A 1FRPA 1M5EA 1SPIA 3PPQA 4LZ8A 2QVRA 3VDFA 4Q30B 4FORA 1O7TA 4O7IA 1P1WA 2REGA 3FJMA 1MPBA 4MX6A 4NF4B 5EQ9A 3G3HA 5H8NB 3TELA 3UORA 3B7DA 4PFTA 3U8QA 1URSA 4YMBA 2F35A 1JP4A 4JB7A 1ZTYA 1LSTA 5K2YA 1B52A 4GX6A 4BDQA 5H8QA 1SW5A 4PFUA 4Z0IA 2VPOA 3V8XB 4GWWA 4ZS9A 4WXJA 2QSXA 3SEVA 1OIBA 4PAIA 4N8YA 1LB9A 1O64A 2V93A 3IOVA 3HCQA 4QSCA 4KYSA 3O66A 5TP9A 5I84A 1NNTA 1RDYA 4OHNA 3U93A 3ZKKA 1LCFA 3QIMA 4OVTA 1NNFA 1FPEA 2QMXA 4G61A 1BKAA 3W15C 1QUJA 3D1RA 1NUWA 1M5CA 2XHDA 1FTJA 1SQYA 4H8JA 4YZZA 1IZ1A 4PQJA 3SETA 3ROJA 4PETA 3CRBA 5ET5A 1QULA 1FTMA 2NWJA 2FYIA 4NGUA 4QFOA 1P99A 2HEUA 1FPFA 3RY3A 2H4IA 2F78A 3G3IA 3RT8A 1TXFA 4AB6A 4ESXA 2KQZA 4IO6A 1XT8A 1R9LA 4G8HA 5FTIA 3BIHA 3W9VA 5KCJB 1EZ9A 4MLVA 1SI1A 1DBZA 1FBCA 4ELPA 4FE8A 2O1MA 1FTOA 3BBRA 1IMAA 5EHMA 4XXUA 4F19A 2QMWA 1LAHE 3B8BA 1YYZA 3TTLA 4XFEA 1NUZA 1DTZA 2R9JA 3I3VA 2M8CA 1TT1A 2XX7A 4ELOA 4PF8A 3L6HA 2B4MA 3PTYA 4IO3A 1MM7A 4Q0CA 3RPLB 4OEVA 1NH8A 2PMSA 1ELJA 4GRKA 2L5VA 1UTHB 4NWDA 2XWIA 1OMPA 1RKMA 3QUFA 4AQ4A 1S50A 4GXSB 3U65A 4JVCA 3KFMA 5ICQA 3IB1A 4MMPA 2QVVA 4OVJA 4NF5A 1FPBA 5ITOA 3TUSA 3LSWA 1AH5A 4G2ZA 1YCJA 3A09A 3FATA 1P1NA 3IK6B 1N3WA 3IB2A 3BIGA 4OETA 2G93A 1POTA 3MAMA 1Z7NE 4MNIA 3FZVA 2I58A 1Y1MA 5H8HA 1DK4A 3WAEA 2VPNA 4TLLB 1G0IA 3ODBA 4KYEA 4F3GA 1CE2A 4QFPA 3RNNA 4PGPA 4KI0E 4LONB 3B6QA 3QSLA 2CZIA 4P9KA 1FPDA 3S4UA 1XOCA 5H8SA 2DDKA 3E9XA 4WKMA 3QAXA 4JWOA 4C1TA 3FD3A 1UTBB 2H9BA 4G68C 3O9PA 3LSFB 4ISUA 2ZZWA 4GWUA 1IMBA 1DCUA 3KGCA 2XXIA 3MVZA 1II5A 2Y84A 5L9OA 4NF4A 2GHBA 5H8NA 1FPGA 2OWZA 4U4SA 4E0XA 2O1LA 1RYOA 1KZ8A 3BKIB 1D9YA 3DELB 3RUMA 1VDWA 3S9MC 5EYHA 2XWVA 2XX8A 5IZ3B 2XXRA 5CC2A 4ELRA 3HO7A 1AWBA 1JEVA 1JQFA 5DEXB 4DIGA 3C35A 3T9VA 4FIMA 1FPJA 5TPAB 1AMFA 5AA2B 4HTGA 4RNSA 2ONSA 3OSQA 3SEYA 3FVOA 5A5XA 4I62A 1NH7A 2ZZVA 1GV8A 1NI9A 4HCYA 2OWTA 5EQ7A 4ZE9A 1PC3A 2QS3A 4O3CA 3PMWA 1LBXA 1XVYA 4O3BA 2R6GE 2FHYA 4GWYA 4YKIA 1QW0A 1SBPA 3VV5A 1MDQA 3Q27A 4IGRA 4NN3A 1B4HA 1AOVA 5AA2D 4GWSA 5ESYA 3IOWA 4UACA 4QFKA 1H44A 2DWJA 3H6WA 3I6VA 4KXPA 1GTKA 4JSOA 2UVIA 1DTGA 2RC7A 5AA4B 2FVZA 2V3QA 3FJ7A 5M2VA 4PFYA 4DI3D 4I9DA 4TOZA 3O6GA 5LDZA 2A5SA 2ANJA 4F31B 1NV3A 4P1EA 2DQVA 5DT6A 2ZNTA 3H6UA 2ZXTA 4DDDA 1NV4A 2DSFA 4NWCA 1AL3A 1SDXA 4QSDA 3O28A 3U94A 3BFTA 3M8UA 4L17A 3A29A 3PV0E 3Q25A 4AB5A 5BUUA 3JYRA 2V3TA 3FBPA 4NG7A 3T9XB 1S7YA 1NV2A 4MJOA 1IIWA 1KWHA 1SW4A 2DE2A 2XXWA 4NE4A 1KA1A 4QF9A 3RPLA 1YTVA 3OO8A 3TPAA 2VD2A 3CFLA 4MNPA 4BLAA 3TTRA 5I58B 1UTHA 4HE1A 2H5YA 1D9QA 4UA8A 4GBVA 4OWDA 4C0RA 2Y5KA 2OJTA 1NFTA 2OK2A 3KJTA 1R6ZA 2FBPA 2I48A 3EF7A 2ZYOA 5A5LA 3QUJA 2R8TA 4XKQA 3FUZA 4IO5A 3E79A 3MP6A 4I8CA 4KHZE 4F3PA 3FXRA 2FIXA 2P0SA 2RF1A 4QFNA 4ZEBA 3OOAA 3IFCA 4N13A 4QFLA 4POXA 2WKYA 5HPQA 2B65A 1LB8A 1WVJA 2Z8DA 4POWA 3CSGA 4HE0A 4XKPA 1ZKBA 2DWAA 1SD3A 4NAPA 1YZ0A 2GFEA 2O7UA 4GWXA 1B1XA 3UK4A 5FHMA 2XXXA 4XIGQ 2A5TB 4AS4A 4PAKA 4F1YA 1LBZA 5FTHA 1NV6A 5CMMA 1URDA 1UIVA 2WYKA 3PD8A 1EYKA 3OO7A 5FHOA 3FVKA 2I3WA 4MLQA 1WODA 1MQHA 1ZLQA 2ESNA 3ECRA 4DXUA 4RK9A 5IGAA 5B70A 2DWHA 3RT6B 1Y3PA 4GWOA 1EZPA 3MPKA 1WDNA 3SEUA 2NOOA 2RCBA 1SW1A 5ITPA 4EF2A 5EHSA 3TQLA 2OX3A 5AA2A 4LZ5A 3N6UA 2PT1A 5L9SA 4IY6A 4PE5B 1N3XA 3CFXA 1PDAA 1FBPA 1VFDA 5ET7A 1NNPA 4FATA 1Y20A 4BDRA 3OO6A 1MXWA 1UQWA 2Z22A 1FTLA 2VT5A 4I3EA 4H0WA 4KFQA 3IOTA 5I2KB 3GBAA 2DOJA 1IMDA 2I4BA 1B0LA 3KC0A 4FBPA 1FTKA 4N6DA 3FGSA 2O7IA 3MP1A 1IXGA 3MZ1A 5CMBA 4IO2A 4GFRA 4NTLA 2F8DA 4EXKA 2KR0A 3LV0A 2YPNA 5EQ8A 4ONYA 3FXQA 4RPOA 2GQ1A 1KA0A 2GRVA 2IA4A 5JTYB 1LBVA 4DE8A 2F97A 3FV2A 3V5AA 4P0IA 4MNCA 1MQIA 1MH3A 4X1DA 2WYPA 3VVEA 3OENA 5LTCA 4PGNA 2QS1A 4R2FA 1PB7A 4JSDA 1B51A 1MPDA 3KOTA 3SEWA 3MPLA 2Y7RA 1G0HA 1LGBC 2RKMA 4ZEFA 4GX3A 4DCXA 4PDHA 5I2NB 4PFWA 5JK4A 1IEJA 3PUZE 1GVCA 1Q9DA 1YXIA 3MJNA 5TU0A 4EXLA 3EHTA 2O51A 2Q88A 4LATA 2FA7A 3MZ9A 3UIFA 2XA5A 2B4LA 2B3BA 2Q8JA 1FQEA 5I58A 3HV1A 5I57A 4LA9A 1AIVA 1B0HA 1H76A 4YU0A 1H43A 1LLSA 4YB6A 4PBHA 3K00A 3N94A 1B58A 1BK4A 4KPTA 3N5LA 1B7UA 4XKRA 2XD3A 4IY5A 4R2BA 1EU8A 3K6XA 4H5GA 1BTJA 3PD9A 2F3BA 4NHBA 1NL5A 2VD3A 3C4MA 2H98A 3TKDA 1MXUA 3S9EA 1A54A 1ZIUA 1P1UA 4G77A 1FBGA 2DYXA 3FVNA 4MH5A 2MKZA 4JWXA 4DXBA 1FPLA 4R6YA 4MBPA 4IO7A 2CEXA 2VGQA 5L8DA 1BIYA 2DWIA 3G3KA 3KJ7A 4TQUQ 5IZ1A 1USYH 3OMBA 1IXCA 4R9FA 1MXYA 1FBHA 3SERA 5DW8A 3VVFA 3TFLA 2PBWA 1H3DA 4XTCQ 5I5PA 1I6QA 4U22A 3KN8A 1MY2A 2A5TA 4M1VA 3M3LA 3KN3A 3BFUA 5F1QA 1FBFA 2PT2A 2V4CA 5L9MA 3TCHA 4XF5A 2V84A 1A7LA 4NX1A 3E3KA 2DVCA 3K01A 3FXBA 4DI4B 2I3VA 5I56B 3THIA 3LSLA 5IZZA 4O7MA 1VFEA 2E1SA 3UP9A 3IB0A 3TAJA 5EYFA 5I59B 4NF0A 5J16A 4C1UA 3FJGA 2Q74A 3FIRA 3FVGA 2PFZA 3T0JA 1OLCA 4QHQA 1B3GA 4KQPA 3DLNA 1M5BA 1I6AA 2F5XA 3QYTA 1QKAA 2Z8EA 3LSXA 3O2AA 3MVWA 4X48A 4QBAA 3MWBA 4Q8RA 1PBQA 4YKJA 2DXYA 2QPQA 2UVJA 3OSRA 4KCCA 3KG2A 4G68B 3MW0A 3ONMA 4GL0A 3MYUA 5I2KA 2Z8FA 2CZLA 3MP8A 4HCWA 2XX9A 1Y3NA 2OZZA 3K6UA 4NF6B 4R6HA 2DVZA 3TDJA 4PFIA 2THIA 2Y7PA 1B9JA 1SYHA 3E13X 3G3JA 3U72A 4H67A 1DMBA 3P7IA 4OENA 4ZEKA 4GXAA 1B6HA 2VHAA 1B7ZA 3H6VA 3EPEA 1RDZA 3N6TA 4H1XA 1B2HA 5AE4A 4F2OA 4BDOA 3OELA 3ISPA 1IMCA 3JV9A 4X04A 3KZGA 3UGWA 3T22A 2E0SA 3SEXA 4IB2A 3WAFA 4ZZAA 3HFUA 3C36A 3TTMA 1SI0A 3F11A 1JVXA 3K0VA 3VXBA 2XXKA 4OFJA 3CR9A 2QS4A 4IGTA 1OQGA 3H6TA 3T66A 3C33A 3TQWA 3KSJA 1B3LA 4OEUA 2UVGA 1MS7A 1N0TA 2ZYNA 5I2NA 3RQTA 5LOMA 1EYIA 3PPRA 5AA3A 4P56A 3U92A 1NV5A 4QXDA 3LUYA 1IMFA 1M5DA 2ZZXA 3R6UA 4XEQA 3OD7A 2RC9A 5KCJA 4LVQA 5BWJA 2UXAA 1EZOA 5CBRA 1SYIA 4X8RA 5F24A 1VE4A 4LZ7A 4PE3A 1NNKA 4PC9A 3T9HB 1NV0A 4FEBA 2VP1A 5CMKA 1HSEA 3CI8A 3SZPA 1I69A 3JZJA 1MY0A 3G3FA 4PCDA 5EYGA 3QXMA 4N6PA 4F1VA 4F3SA 1PBPA 2XXPA 4JVDA 4MIJA 1ZBMA 4NMYA 1B46A 4IO4A 1Y9UA 4RK2A 3TMGA 1GGGA 2DS9A 1RYXA 3CG1A 3FASA 2YLNA 1FW0A 4PAFA 1LEVA 3K6VA 4BDNA 4F39A 2PYYA 4Q5TA 4ZZEA 3TZAA 4OMBA 4RXLA 2PVUA 2I0CA 1FPIA 2CMOA 2B3FA 2QVUA 4LP2B 2BJJX 2XWKA 4KR5A 3KBRA 3PMVA 2P3VA 1B5HA 1LAGE 2QRYA 3IO6A 2V25A 2X7PA 4N4UA 4R72A 3KC1A 1B5IA 2NUVA 3S9LC 3QK6A 3A3UA 1US4A 2UVHA 2XD2A 4OERA 2XXYA 4WEDA 1D3KA 5DVIA 4EQ9A 1P1QA 2GHAA 2O69A 3V83A 2W7YA 5I59A 5T3JA 1NV1A 2AL5A 2JJKA 3RLFE 3RTFB 1YAEA 3TCGA 4F29A 1LFGA 5EQAA 2G29A 3TTNA 5ICTA 2FIEA 4FAJA 1LCTA 1QUIA 1MM6A 1ATGA 4XKNA 4IR8A 1FSAA 4ZEDA 3O6IA 2XXUA 1B7HA 2YJPA 4TLMB 3U1OA 1UTBA 4H65A 3K1MA 4OTEA 3PUVE 1D9VA 3SESA 1I6BA 2H25A 2BJIA 5IAIA 1H45A 3IFAA 3EN3A 4JXIA 3V89B 1JNFA 1B3HA 1DSNA 4O94A 4OESA 4OFLA 1PB8A 2ABHA 2X7QA 3B6TA 4BDMA 4E0WA 4G68A 2RCAA 2XXHA 5IM2A 1IMEA 5IZ3A 3K2DA 2Q89A 4YB7A 3PUYE 2F6PA 5DEXA 4NF6A 3OO9A 4BDLA 1TWYA 1QUKA 3S9NC 5TPAA 4GX4A 1FQAA 4LQ2A 3UN6A 2XXTA 1TFDA 4RY1A 3HN0A 2O84X 4P0GA 1MRPA 3R26A 4AS5A 1MG1A 3IO4A 3IJXB 4O3AA 3IOUA 3D4CA 3PU5A 3H4ZA 2ZNUA 1URGA 1ANFA 1BLFA 3KOSA 1MQGA 4MAGA 1A40A 2HQ0A 2AL4A 3G3GA 4U23A 1FQFA 1SVXB 3C34A 4JWYA 2QL3A 1LAXA 3L6GA 1YPNA 1Q35A 3VXCA 1FJ6A 3GYYA 2WBBA 3MVYA 3C31A 1POY1 1IXHA 2PCRA 4I3YA 4P1LA 3IJOB 5AA1A 3OXNA 1FBDA 3K4UA 2HXWA 3B6WA 2Y7WA 5AA4A 3VFJA 3MVXA 4OVPA 2HAVA 4G8NA 2I49A 2ONKE 2OWSA 4MEVA 1FTAA 4H6DA 5DVFA 3FXUA 1Y4TA 4K3FA 5A5XB 3PPNA 5I7IA 3HPIA 4OFOA 1B1HA 3EHSA 1O63A 4H45A 2I6EA 4OQOA 2CEYA 1RDXA 3PUXE 3ZSFA 3TODA 1LBBA 3LUZA 1MY3A 1PEBA 4ND9A 1NV7A 3IAZA 4G4PA 5H8FB 2HZKA 3KEIA 3MBPA 2Y5LA 1CB6A 1A99A 3CIJA 3EKIA 2UYFA 1XS5A 2FNCA 2UYEA 2HFBA 4RJZA 3B50A 3E78A 1K9ZA 1LBCA 4GLIA 5CBSA 4KD5A 3H3GA 5F7VA 1FJ9A 1JETA 1UIUA 1PB9A 3CVGA 3C9HA 4I1DA 4N07A 4N17A 5KDTB 1N04A 1FQCA 3CG3A 2HZLA 1Q1KA 5ET6A 2PFYA 2D21A 4GF8A 3GZGA 4U1ZA 3OEKA 3PUWE 2D3IA 2IEEA 3TCFA 2REJA 4PFBA 3IORA 4HE2A 1MY4A 4GL8A 4OXVA 4LUBA 4NEDA 1NMUA 4NQ8A 4F1UA 5DTBA 1FQDA 4RA1A 2Q2CA 3ZKLA 3MUQA 1NKXA 1XHYA 4U4XA 3T9UA 1EYJA 4NF8B 4R6KA 3UA8A 4U21A 5ISUA 2F7CA 2HHMA 3CHGA 3H7MA 1Y4CA 2LAOA 4RPNA 2ZNSA 1S9TA 1R9QA 2QS2A 4N8GA 1DPPA 2O6AA 2P2AA 1HSJA 3MC2A 3TTKA 4X9TA 3T96B 3VLWA 3VE1B 3ILUB 1Y3QA 2Y7IA 4O8MA 3K1PA 3GLBA 3IR1A 1R1NA 2V3UA 3ILTB 4OVSA 1JEUA 3A3CA 4FJPA 4YICA 1MXZA 3MZBA 2P1SA 2P3NA 3Q26A 4HW8A 1JW5A 1N7XA 4PTKA 4LQ5A 3VLVA 1MXXA 2ALUA 3LR1A 4DCYA 1B3FA 1Y1ZA 1IITA 2DE4A 2OBGA 4ZEIA 2NXOA 4YAHX 1ZU0A 4N81A 4KYDA 1OVTA 3USDA 1JW4A 1INPA 4GWZA 4P47A 3C32A 2F6GA 4QRZA 4OANA 1DOTA 3MSTA 1B05A 1N76A 4H5FA 4PDDA 2Y7KA 1LFHA 2WBDA 4PFRA 1A8FA 2QJEA 2HPGA 3KBZA 4QSEA 2RINA 1F9BA 5IKBA 1MPCA 3TEPA 3H06B 4YKPA 3NOHA 4R73A 2R71A 3K6WA 5JTYA 4DXCA 2DXRA 1A8EA 5KZTA 5ET8A 3Q29A 3RYDA 2XXVA 2OCUA 1LFIA 3CSBA 1T0KA 1B3EA 1J1NA 1M5FA 2QFLA 1LBYA 4OZ9A 1BP5A 4YB5A 1VR5A 1MQJA 4PBQA 2HAUA 4KCDA 4ELQA 4EUOA 1IQ7A 4LN5A 3HHGA 4N6KA 5ELVA 1OVBA 3IX1A 1FCKA 1MXVA 3S2VA 1OQHA 1A55A 3RTWB 1N84A 1QVSA 4OVRA 3O29A 2Q8MA 5H8QB 1B40A 4GOTA
chains in the Genus database with same CATH topology
1FSAA 4N91A 2CZHA 4MCOA 1DK4A 4MHFA 1LBWA 2VPNA 1G0IA 2CZKA 1G0HA 2WEFA 2BJIA 4P8BA 3IFAA 4GX3A 5J1DA 4PGPA 4PDHA 1K9YA 5JK4A 4O94A 4JVIA 2CZIA 4P9KA 1FPDA 4I40A 1FPKA 2DDKA 1QGXA 1Q9DA 1YXIA 5IM2A 1IMEA 5IZ3A 4GBWA 2XA5A 2B4LA 4N15A 4F18A 2ZZWA 4GWUA 1IMBA 1DCUA 4GX4A 1XI6A 4P3LA 4PBHA 1CNQA 1FPGA 2OWZA 1BK4A 1KZ8A 4AS5A 1VDWA 5EYHA 2XWVA 5IZ3B 1AWBA 2F3BA 4NHBA 5I3SA 1FBGA 4MAGA 2MKZA 1FPJA 1FPLA 2HXRA 2CEXA 3T1BA 2F3DA 5IZ1A 2DE3A 1FJ6A 3GYYA 2WBBA 2ZZVA 1NI9A 4HCYA 2Q9TA 5EQ7A 1FBEA 1FBHA 2PCRA 4I3YA 4P1LA 4H46A 1LBXA 5DW8A 1FBDA 1NUXA 2FHYA 5I5PA 4OVPA 4HXVA 4GWYA 4M1VA 4UABA 2WX9A 1FBFA 4MEVA 1FTAA 2V4CA 4OVQA 4NN3A 4GWSA 5ESYA 4XF5A 4PF6A 4NX1A 5I7IA 3FXBA 4DI4B 4KXPA 5IZZA 4O7MA 4H45A 2FVZA 2V3QA 4NF0A 5J16A 2CEYA 1RDXA 2Q74A 2PFZA 3T0JA 4DI3D 3LUZA 5LDZA 5FBPA 1NV7A 1NV3A 4P1EA 3QMFA 2F5XA 2HZKA 1NV4A 2Y5LA 2XWOA 4OA4A 3EKIA 5CM6A 4QBAA 3B50A 3E78A 1K9ZA 3A29A 1FJ9A 2QPQA 3FBPA 4NG7A 4N17A 1NV2A 4MJOA 3W9WA 2DE2A 1NUYA 2HZLA 1KA1A 3RPLA 1FRPA 3MYUA 5ET6A 2PFYA 1SPIA 4MNPA 4HCWA 4HE1A 2QVRA 4PFBA 4HE2A 1D9QA 2DVZA 4GBVA 4O7IA 4PFIA 2Y5KA 4NQ8A 4MX6A 4F1UA 5EQ9A 2FBPA 5A5LA 2R8TA 1RDZA 3E79A 1JP4A 1EYJA 4GX6A 3ISPA 1IMCA 2FIXA 4X04A 2HHMA 3CHGA 2VPOA 3HFUA 4GWWA 3IFCA 4PAIA 2XXKA 4N8YA 4N8GA 4HE0A 4X9TA 1RDYA 1EYIA 4NAPA 1YZ0A 4P56A 4O8MA 4GWXA 1NV5A 4QXDA 4OVSA 1IMFA 4OVTA 2ZZXA 4AS4A 4XEQA 4PAKA 4YICA 1FPEA 4G61A 1LBZA 3D1RA 1NUWA 2P3NA 4YZZA 4PTKA 1NV6A 4X8RA 5F24A 3ROJA 4PE3A 4PC9A 4PETA 5ET5A 1NV0A 2WYKA 2DE4A 1EYKA 4NGUA 1FPFA 4N81A 3SZPA 4PCDA 5EYGA 4F1VA 4P47A 1INPA 4GWZA 5IGAA 4JVDA 4MIJA 2KQZA 4OANA 3MSTA 3BIHA 3W9VA 1DBZA 1FBCA 4PAFA 4PDDA 2OX3A 1IMAA 1LEVA 2WBDA 4PFRA 4F19A 2HPGA 3KBZA 1FBPA 3B8BA 5ET7A 1YYZA 4XFEA 1NUZA 1FPIA 2QVUA 4PF8A 2B4MA 2XWKA 3NOHA 3PTYA 2P3VA 2VT5A 4I3EA 3RPLB 5ET8A 1IMDA 3KC0A 3RYDA 4N4UA 3KC1A 2L5VA 4FBPA 4N6DA 2QFLA 2XWIA 1LBYA 3U65A 4PBQA 4JVCA 2KR0A 3LV0A 4LN5A 5EQ8A 4MMPA 2QVVA 4N6KA 2GQ1A 1KA0A 1FPBA 1LBVA 5T3JA 1NV1A 2JJKA 4MNCA 5EQAA 2WYPA 2FIEA 3BIGA 4OVRA 5LTCA 2Q8MA 4IR8A 4PGNA 4MNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGU A;  4P1L A;  4N91 A;  4PFB A;  4MCO A;  4PCD A;  4MHF A;  5I5P A;  4P47 A;  4PFI A;  5IGA A;  4OVP A;  2VPN A;  4MIJ A;  4NQ8 A;  4OAN A;  4MX6 A;  4UAB A;  4P8B A;  2WX9 A;  4MEV A;  4PGP A;  4PDH A;  2V4C A;  4OVQ A;  4NN3 A;  4PAF A;  4PDD A;  4O94 A;  4XF5 A;  4PF6 A;  4P9K A;  4NX1 A;  4PFR A;  5I7I A;  3FXB A;  2HPG A;  5IM2 A;  4DI4 B;  4XFE A;  4X04 A;  5IZZ A;  2XA5 A;  4O7M A;  2VPO A;  4N15 A;  4NF0 A;  4PF8 A;  2CEY A;  4PAI A;  2XWK A;  2XXK A;  4N8Y A;  2ZZW A;  2PFZ A;  4P3L A;  4DI3 D;  4N8G A;  4PBH A;  4N4U A;  4P1E A;  4NAP A;  4N6D A;  2HZK A;  4P56 A;  4O8M A;  2XWI A;  2XWO A;  4OA4 A;  2XWV A;  3U65 A;  4PBQ A;  4OVS A;  5CM6 A;  4OVT A;  2ZZX A;  4NHB A;  3B50 A;  4XEQ A;  4PAK A;  4YIC A;  4LN5 A;  4MMP A;  4N6K A;  4MAG A;  4NG7 A;  4YZZ A;  4MNC A;  4N17 A;  2CEX A;  4X8R A;  2WYP A;  2HZL A;  4PE3 A;  3GYY A;  4PC9 A;  4PET A;  4OVR A;  2ZZV A;  5LTC A;  2WYK A;  2PFY A;  4PGN A;  4MNP A;  4MNI A; 
#chains in the Genus database with same CATH topology
 1L5T A;  1B4Z A;  4F22 A;  4PP0 A;  5H8F A;  4RYA A;  4N91 A;  2CZH A;  4MCO A;  4DLD A;  3HST A;  4MHF A;  4WEP A;  1LBW A;  2VOZ A;  1JW1 A;  1MH4 A;  2ZYK A;  4JDF A;  2CZK A;  4JBZ A;  1B32 A;  2WEF A;  2Q2A A;  4P8B A;  5TP9 B;  5J1D A;  4GVO A;  1ZMG A;  1K9Y A;  1IXI A;  4Z7E A;  3MQ9 A;  4JVI A;  5DVJ A;  3RN8 A;  3PMX A;  4I40 A;  5KDT A;  4HS7 A;  1FPK A;  3O6H A;  1QGX A;  1IUD A;  2HCA A;  3PPO A;  4H8I A;  4GBW A;  3EHU A;  2KLF A;  3ZS6 A;  4N15 A;  4U2R A;  3O97 A;  2I4C A;  2F7B A;  4F18 A;  5CI5 A;  5HM4 B;  4EQ7 A;  1XVX A;  4F2Q A;  1FQB A;  2NVU B;  3T93 B;  1USY E;  1XI6 A;  4P3L A;  3IL1 B;  1MY1 A;  3PPP A;  3DM0 A;  1CNQ A;  4FED A;  1D4N A;  4FEC A;  3RPW A;  3AXF A;  3FV1 A;  2I0B A;  2ZYM A;  4ZDM A;  1QKB A;  1LAF E;  1GR2 A;  4NF8 A;  2F34 A;  4G8M A;  3RGY A;  4YKK A;  2ONR A;  5I57 B;  1HSL A;  2D5W A;  5JEI A;  2Z23 A;  4F3B A;  1ZJL A;  3VVD A;  3I5O A;  5I3S A;  5K2X A;  1OLA A;  3VLU A;  1TFA A;  2H99 A;  4P11 A;  2O68 A;  2F7A A;  3KSX A;  1JVY A;  5HBC A;  3LBS A;  2HXR A;  5FHN A;  3M3F A;  3T1B A;  3DP6 A;  3SDF A;  4ZEC A;  2F3D A;  3M3K A;  2DE3 A;  4OYV A;  1SW2 A;  3PGF A;  2Q9T A;  5DYH A;  3HHF A;  4GQO A;  1FBE A;  5I56 A;  4R9G A;  1P1O A;  4H46 A;  1N7W A;  1MQD A;  1EH3 A;  1NUX A;  2AYS A;  2F36 A;  4HXV A;  4YMA A;  2GH9 A;  3SKP A;  4UAB A;  3R7X A;  2WX9 A;  4OVQ A;  3Q28 A;  4GD5 A;  3H03 A;  4R74 A;  4PF6 A;  2PX1 A;  1VSO A;  4EF1 A;  2OLB A;  4EDP A;  3GXA A;  4M4G A;  4ZE8 A;  2RC8 A;  1DPE A;  4GIZ A;  4ECF A;  4NF5 B;  2XXQ A;  3OEM A;  3DP8 A;  4ESW A;  1US5 A;  1XC1 A;  3K02 A;  1Z7M E;  4R75 A;  1MDP 1;  5FBP A;  5CMC A;  3QMF A;  3EQ1 A;  4MF3 A;  3D4G A;  3TYH A;  5H8H B;  2XWO A;  4OA4 A;  2ZMB A;  4EQB A;  3LC8 A;  5B7D A;  5CM6 A;  3GBB A;  3G7W A;  3E4R A;  4X1B A;  4MFI A;  1QJM A;  4U1O A;  4THI A;  2DP8 A;  2AIX A;  3CFZ A;  3KN7 A;  3K1N A;  4DZ1 A;  3N26 A;  5CRY A;  3W9W A;  1NUY A;  2X26 A;  1B5J A;  3DP4 A;  1FRP A;  1M5E A;  1SPI A;  3PPQ A;  4LZ8 A;  2QVR A;  3VDF A;  4Q30 B;  4FOR A;  1O7T A;  4O7I A;  1P1W A;  2REG A;  3FJM A;  1MPB A;  4MX6 A;  4NF4 B;  5EQ9 A;  3G3H A;  5H8N B;  3TEL A;  3UOR A;  3B7D A;  4PFT A;  3U8Q A;  1URS A;  4YMB A;  2F35 A;  1JP4 A;  4JB7 A;  1ZTY A;  1LST A;  5K2Y A;  1B52 A;  4GX6 A;  4BDQ A;  5H8Q A;  1SW5 A;  4PFU A;  4Z0I A;  2VPO A;  3V8X B;  4GWW A;  4ZS9 A;  4WXJ A;  2QSX A;  3SEV A;  1OIB A;  4PAI A;  4N8Y A;  1LB9 A;  1O64 A;  2V93 A;  3IOV A;  3HCQ A;  4QSC A;  4KYS A;  3O66 A;  5TP9 A;  5I84 A;  1NNT A;  1RDY A;  4OHN A;  3U93 A;  3ZKK A;  1LCF A;  3QIM A;  4OVT A;  1NNF A;  1FPE A;  2QMX A;  4G61 A;  1BKA A;  3W15 C;  1QUJ A;  3D1R A;  1NUW A;  1M5C A;  2XHD A;  1FTJ A;  1SQY A;  4H8J A;  4YZZ A;  1IZ1 A;  4PQJ A;  3SET A;  3ROJ A;  4PET A;  3CRB A;  5ET5 A;  1QUL A;  1FTM A;  2NWJ A;  2FYI A;  4NGU A;  4QFO A;  1P99 A;  2HEU A;  1FPF A;  3RY3 A;  2H4I A;  2F78 A;  3G3I A;  3RT8 A;  1TXF A;  4AB6 A;  4ESX A;  2KQZ A;  4IO6 A;  1XT8 A;  1R9L A;  4G8H A;  5FTI A;  3BIH A;  3W9V A;  5KCJ B;  1EZ9 A;  4MLV A;  1SI1 A;  1DBZ A;  1FBC A;  4ELP A;  4FE8 A;  2O1M A;  1FTO A;  3BBR A;  1IMA A;  5EHM A;  4XXU A;  4F19 A;  2QMW A;  1LAH E;  3B8B A;  1YYZ A;  3TTL A;  4XFE A;  1NUZ A;  1DTZ A;  2R9J A;  3I3V A;  2M8C A;  1TT1 A;  2XX7 A;  4ELO A;  4PF8 A;  3L6H A;  2B4M A;  3PTY A;  4IO3 A;  1MM7 A;  4Q0C A;  3RPL B;  4OEV A;  1NH8 A;  2PMS A;  1ELJ A;  4GRK A;  2L5V A;  1UTH B;  4NWD A;  2XWI A;  1OMP A;  1RKM A;  3QUF A;  4AQ4 A;  1S50 A;  4GXS B;  3U65 A;  4JVC A;  3KFM A;  5ICQ A;  3IB1 A;  4MMP A;  2QVV A;  4OVJ A;  4NF5 A;  1FPB A;  5ITO A;  3TUS A;  3LSW A;  1AH5 A;  4G2Z A;  1YCJ A;  3A09 A;  3FAT A;  1P1N A;  3IK6 B;  1N3W A;  3IB2 A;  3BIG A;  4OET A;  2G93 A;  1POT A;  3MAM A;  1Z7N E;  4MNI A;  3FZV A;  2I58 A;  1Y1M A;  5H8H A;  1DK4 A;  3WAE A;  2VPN A;  4TLL B;  1G0I A;  3ODB A;  4KYE A;  4F3G A;  1CE2 A;  4QFP A;  3RNN A;  4PGP A;  4KI0 E;  4LON B;  3B6Q A;  3QSL A;  2CZI A;  4P9K A;  1FPD A;  3S4U A;  1XOC A;  5H8S A;  2DDK A;  3E9X A;  4WKM A;  3QAX A;  4JWO A;  4C1T A;  3FD3 A;  1UTB B;  2H9B A;  4G68 C;  3O9P A;  3LSF B;  4ISU A;  2ZZW A;  4GWU A;  1IMB A;  1DCU A;  3KGC A;  2XXI A;  3MVZ A;  1II5 A;  2Y84 A;  5L9O A;  4NF4 A;  2GHB A;  5H8N A;  1FPG A;  2OWZ A;  4U4S A;  4E0X A;  2O1L A;  1RYO A;  1KZ8 A;  3BKI B;  1D9Y A;  3DEL B;  3RUM A;  1VDW A;  3S9M C;  5EYH A;  2XWV A;  2XX8 A;  5IZ3 B;  2XXR A;  5CC2 A;  4ELR A;  3HO7 A;  1AWB A;  1JEV A;  1JQF A;  5DEX B;  4DIG A;  3C35 A;  3T9V A;  4FIM A;  1FPJ A;  5TPA B;  1AMF A;  5AA2 B;  4HTG A;  4RNS A;  2ONS A;  3OSQ A;  3SEY A;  3FVO A;  5A5X A;  4I62 A;  1NH7 A;  2ZZV A;  1GV8 A;  1NI9 A;  4HCY A;  2OWT A;  5EQ7 A;  4ZE9 A;  1PC3 A;  2QS3 A;  4O3C A;  3PMW A;  1LBX A;  1XVY A;  4O3B A;  2R6G E;  2FHY A;  4GWY A;  4YKI A;  1QW0 A;  1SBP A;  3VV5 A;  1MDQ A;  3Q27 A;  4IGR A;  4NN3 A;  1B4H A;  1AOV A;  5AA2 D;  4GWS A;  5ESY A;  3IOW A;  4UAC A;  4QFK A;  1H44 A;  2DWJ A;  3H6W A;  3I6V A;  4KXP A;  1GTK A;  4JSO A;  2UVI A;  1DTG A;  2RC7 A;  5AA4 B;  2FVZ A;  2V3Q A;  3FJ7 A;  5M2V A;  4PFY A;  4DI3 D;  4I9D A;  4TOZ A;  3O6G A;  5LDZ A;  2A5S A;  2ANJ A;  4F31 B;  1NV3 A;  4P1E A;  2DQV A;  5DT6 A;  2ZNT A;  3H6U A;  2ZXT A;  4DDD A;  1NV4 A;  2DSF A;  4NWC A;  1AL3 A;  1SDX A;  4QSD A;  3O28 A;  3U94 A;  3BFT A;  3M8U A;  4L17 A;  3A29 A;  3PV0 E;  3Q25 A;  4AB5 A;  5BUU A;  3JYR A;  2V3T A;  3FBP A;  4NG7 A;  3T9X B;  1S7Y A;  1NV2 A;  4MJO A;  1IIW A;  1KWH A;  1SW4 A;  2DE2 A;  2XXW A;  4NE4 A;  1KA1 A;  4QF9 A;  3RPL A;  1YTV A;  3OO8 A;  3TPA A;  2VD2 A;  3CFL A;  4MNP A;  4BLA A;  3TTR A;  5I58 B;  1UTH A;  4HE1 A;  2H5Y A;  1D9Q A;  4UA8 A;  4GBV A;  4OWD A;  4C0R A;  2Y5K A;  2OJT A;  1NFT A;  2OK2 A;  3KJT A;  1R6Z A;  2FBP A;  2I48 A;  3EF7 A;  2ZYO A;  5A5L A;  3QUJ A;  2R8T A;  4XKQ A;  3FUZ A;  4IO5 A;  3E79 A;  3MP6 A;  4I8C A;  4KHZ E;  4F3P A;  3FXR A;  2FIX A;  2P0S A;  2RF1 A;  4QFN A;  4ZEB A;  3OOA A;  3IFC A;  4N13 A;  4QFL A;  4POX A;  2WKY A;  5HPQ A;  2B65 A;  1LB8 A;  1WVJ A;  2Z8D A;  4POW A;  3CSG A;  4HE0 A;  4XKP A;  1ZKB A;  2DWA A;  1SD3 A;  4NAP A;  1YZ0 A;  2GFE A;  2O7U A;  4GWX A;  1B1X A;  3UK4 A;  5FHM A;  2XXX A;  4XIG Q;  2A5T B;  4AS4 A;  4PAK A;  4F1Y A;  1LBZ A;  5FTH A;  1NV6 A;  5CMM A;  1URD A;  1UIV A;  2WYK A;  3PD8 A;  1EYK A;  3OO7 A;  5FHO A;  3FVK A;  2I3W A;  4MLQ A;  1WOD A;  1MQH A;  1ZLQ A;  2ESN A;  3ECR A;  4DXU A;  4RK9 A;  5IGA A;  5B70 A;  2DWH A;  3RT6 B;  1Y3P A;  4GWO A;  1EZP A;  3MPK A;  1WDN A;  3SEU A;  2NOO A;  2RCB A;  1SW1 A;  5ITP A;  4EF2 A;  5EHS A;  3TQL A;  2OX3 A;  5AA2 A;  4LZ5 A;  3N6U A;  2PT1 A;  5L9S A;  4IY6 A;  4PE5 B;  1N3X A;  3CFX A;  1PDA A;  1FBP A;  1VFD A;  5ET7 A;  1NNP A;  4FAT A;  1Y20 A;  4BDR A;  3OO6 A;  1MXW A;  1UQW A;  2Z22 A;  1FTL A;  2VT5 A;  4I3E A;  4H0W A;  4KFQ A;  3IOT A;  5I2K B;  3GBA A;  2DOJ A;  1IMD A;  2I4B A;  1B0L A;  3KC0 A;  4FBP A;  1FTK A;  4N6D A;  3FGS A;  2O7I A;  3MP1 A;  1IXG A;  3MZ1 A;  5CMB A;  4IO2 A;  4GFR A;  4NTL A;  2F8D A;  4EXK A;  2KR0 A;  3LV0 A;  2YPN A;  5EQ8 A;  4ONY A;  3FXQ A;  4RPO A;  2GQ1 A;  1KA0 A;  2GRV A;  2IA4 A;  5JTY B;  1LBV A;  4DE8 A;  2F97 A;  3FV2 A;  3V5A A;  4P0I A;  4MNC A;  1MQI A;  1MH3 A;  4X1D A;  2WYP A;  3VVE A;  3OEN A;  5LTC A;  4PGN A;  2QS1 A;  4R2F A;  1PB7 A;  4JSD A;  1B51 A;  1MPD A;  3KOT A;  3SEW A;  3MPL A;  2Y7R A;  1G0H A;  1LGB C;  2RKM A;  4ZEF A;  4GX3 A;  4DCX A;  4PDH A;  5I2N B;  4PFW A;  5JK4 A;  1IEJ A;  3PUZ E;  1GVC A;  1Q9D A;  1YXI A;  3MJN A;  5TU0 A;  4EXL A;  3EHT A;  2O51 A;  2Q88 A;  4LAT A;  2FA7 A;  3MZ9 A;  3UIF A;  2XA5 A;  2B4L A;  2B3B A;  2Q8J A;  1FQE A;  5I58 A;  3HV1 A;  5I57 A;  4LA9 A;  1AIV A;  1B0H A;  1H76 A;  4YU0 A;  1H43 A;  1LLS A;  4YB6 A;  4PBH A;  3K00 A;  3N94 A;  1B58 A;  1BK4 A;  4KPT A;  3N5L A;  1B7U A;  4XKR A;  2XD3 A;  4IY5 A;  4R2B A;  1EU8 A;  3K6X A;  4H5G A;  1BTJ A;  3PD9 A;  2F3B A;  4NHB A;  1NL5 A;  2VD3 A;  3C4M A;  2H98 A;  3TKD A;  1MXU A;  3S9E A;  1A54 A;  1ZIU A;  1P1U A;  4G77 A;  1FBG A;  2DYX A;  3FVN A;  4MH5 A;  2MKZ A;  4JWX A;  4DXB A;  1FPL A;  4R6Y A;  4MBP A;  4IO7 A;  2CEX A;  2VGQ A;  5L8D A;  1BIY A;  2DWI A;  3G3K A;  3KJ7 A;  4TQU Q;  5IZ1 A;  1USY H;  3OMB A;  1IXC A;  4R9F A;  1MXY A;  1FBH A;  3SER A;  5DW8 A;  3VVF A;  3TFL A;  2PBW A;  1H3D A;  4XTC Q;  5I5P A;  1I6Q A;  4U22 A;  3KN8 A;  1MY2 A;  2A5T A;  4M1V A;  3M3L A;  3KN3 A;  3BFU A;  5F1Q A;  1FBF A;  2PT2 A;  2V4C A;  5L9M A;  3TCH A;  4XF5 A;  2V84 A;  1A7L A;  4NX1 A;  3E3K A;  2DVC A;  3K01 A;  3FXB A;  4DI4 B;  2I3V A;  5I56 B;  3THI A;  3LSL A;  5IZZ A;  4O7M A;  1VFE A;  2E1S A;  3UP9 A;  3IB0 A;  3TAJ A;  5EYF A;  5I59 B;  4NF0 A;  5J16 A;  4C1U A;  3FJG A;  2Q74 A;  3FIR A;  3FVG A;  2PFZ A;  3T0J A;  1OLC A;  4QHQ A;  1B3G A;  4KQP A;  3DLN A;  1M5B A;  1I6A A;  2F5X A;  3QYT A;  1QKA A;  2Z8E A;  3LSX A;  3O2A A;  3MVW A;  4X48 A;  4QBA A;  3MWB A;  4Q8R A;  1PBQ A;  4YKJ A;  2DXY A;  2QPQ A;  2UVJ A;  3OSR A;  4KCC A;  3KG2 A;  4G68 B;  3MW0 A;  3ONM A;  4GL0 A;  3MYU A;  5I2K A;  2Z8F A;  2CZL A;  3MP8 A;  4HCW A;  2XX9 A;  1Y3N A;  2OZZ A;  3K6U A;  4NF6 B;  4R6H A;  2DVZ A;  3TDJ A;  4PFI A;  2THI A;  2Y7P A;  1B9J A;  1SYH A;  3E13 X;  3G3J A;  3U72 A;  4H67 A;  1DMB A;  3P7I A;  4OEN A;  4ZEK A;  4GXA A;  1B6H A;  2VHA A;  1B7Z A;  3H6V A;  3EPE A;  1RDZ A;  3N6T A;  4H1X A;  1B2H A;  5AE4 A;  4F2O A;  4BDO A;  3OEL A;  3ISP A;  1IMC A;  3JV9 A;  4X04 A;  3KZG A;  3UGW A;  3T22 A;  2E0S A;  3SEX A;  4IB2 A;  3WAF A;  4ZZA A;  3HFU A;  3C36 A;  3TTM A;  1SI0 A;  3F11 A;  1JVX A;  3K0V A;  3VXB A;  2XXK A;  4OFJ A;  3CR9 A;  2QS4 A;  4IGT A;  1OQG A;  3H6T A;  3T66 A;  3C33 A;  3TQW A;  3KSJ A;  1B3L A;  4OEU A;  2UVG A;  1MS7 A;  1N0T A;  2ZYN A;  5I2N A;  3RQT A;  5LOM A;  1EYI A;  3PPR A;  5AA3 A;  4P56 A;  3U92 A;  1NV5 A;  4QXD A;  3LUY A;  1IMF A;  1M5D A;  2ZZX A;  3R6U A;  4XEQ A;  3OD7 A;  2RC9 A;  5KCJ A;  4LVQ A;  5BWJ A;  2UXA A;  1EZO A;  5CBR A;  1SYI A;  4X8R A;  5F24 A;  1VE4 A;  4LZ7 A;  4PE3 A;  1NNK A;  4PC9 A;  3T9H B;  1NV0 A;  4FEB A;  2VP1 A;  5CMK A;  1HSE A;  3CI8 A;  3SZP A;  1I69 A;  3JZJ A;  1MY0 A;  3G3F A;  4PCD A;  5EYG A;  3QXM A;  4N6P A;  4F1V A;  4F3S A;  1PBP A;  2XXP A;  4JVD A;  4MIJ A;  1ZBM A;  4NMY A;  1B46 A;  4IO4 A;  1Y9U A;  4RK2 A;  3TMG A;  1GGG A;  2DS9 A;  1RYX A;  3CG1 A;  3FAS A;  2YLN A;  1FW0 A;  4PAF A;  1LEV A;  3K6V A;  4BDN A;  4F39 A;  2PYY A;  4Q5T A;  4ZZE A;  3TZA A;  4OMB A;  4RXL A;  2PVU A;  2I0C A;  1FPI A;  2CMO A;  2B3F A;  2QVU A;  4LP2 B;  2BJJ X;  2XWK A;  4KR5 A;  3KBR A;  3PMV A;  2P3V A;  1B5H A;  1LAG E;  2QRY A;  3IO6 A;  2V25 A;  2X7P A;  4N4U A;  4R72 A;  3KC1 A;  1B5I A;  2NUV A;  3S9L C;  3QK6 A;  3A3U A;  1US4 A;  2UVH A;  2XD2 A;  4OER A;  2XXY A;  4WED A;  1D3K A;  5DVI A;  4EQ9 A;  1P1Q A;  2GHA A;  2O69 A;  3V83 A;  2W7Y A;  5I59 A;  5T3J A;  1NV1 A;  2AL5 A;  2JJK A;  3RLF E;  3RTF B;  1YAE A;  3TCG A;  4F29 A;  1LFG A;  5EQA A;  2G29 A;  3TTN A;  5ICT A;  2FIE A;  4FAJ A;  1LCT A;  1QUI A;  1MM6 A;  1ATG A;  4XKN A;  4IR8 A;  1FSA A;  4ZED A;  3O6I A;  2XXU A;  1B7H A;  2YJP A;  4TLM B;  3U1O A;  1UTB A;  4H65 A;  3K1M A;  4OTE A;  3PUV E;  1D9V A;  3SES A;  1I6B A;  2H25 A;  2BJI A;  5IAI A;  1H45 A;  3IFA A;  3EN3 A;  4JXI A;  3V89 B;  1JNF A;  1B3H A;  1DSN A;  4O94 A;  4OES A;  4OFL A;  1PB8 A;  2ABH A;  2X7Q A;  3B6T A;  4BDM A;  4E0W A;  4G68 A;  2RCA A;  2XXH A;  5IM2 A;  1IME A;  5IZ3 A;  3K2D A;  2Q89 A;  4YB7 A;  3PUY E;  2F6P A;  5DEX A;  4NF6 A;  3OO9 A;  4BDL A;  1TWY A;  1QUK A;  3S9N C;  5TPA A;  4GX4 A;  1FQA A;  4LQ2 A;  3UN6 A;  2XXT A;  1TFD A;  4RY1 A;  3HN0 A;  2O84 X;  4P0G A;  1MRP A;  3R26 A;  4AS5 A;  1MG1 A;  3IO4 A;  3IJX B;  4O3A A;  3IOU A;  3D4C A;  3PU5 A;  3H4Z A;  2ZNU A;  1URG A;  1ANF A;  1BLF A;  3KOS A;  1MQG A;  4MAG A;  1A40 A;  2HQ0 A;  2AL4 A;  3G3G A;  4U23 A;  1FQF A;  1SVX B;  3C34 A;  4JWY A;  2QL3 A;  1LAX A;  3L6G A;  1YPN A;  1Q35 A;  3VXC A;  1FJ6 A;  3GYY A;  2WBB A;  3MVY A;  3C31 A;  1POY 1;  1IXH A;  2PCR A;  4I3Y A;  4P1L A;  3IJO B;  5AA1 A;  3OXN A;  1FBD A;  3K4U A;  2HXW A;  3B6W A;  2Y7W A;  5AA4 A;  3VFJ A;  3MVX A;  4OVP A;  2HAV A;  4G8N A;  2I49 A;  2ONK E;  2OWS A;  4MEV A;  1FTA A;  4H6D A;  5DVF A;  3FXU A;  1Y4T A;  4K3F A;  5A5X B;  3PPN A;  5I7I A;  3HPI A;  4OFO A;  1B1H A;  3EHS A;  1O63 A;  4H45 A;  2I6E A;  4OQO A;  2CEY A;  1RDX A;  3PUX E;  3ZSF A;  3TOD A;  1LBB A;  3LUZ A;  1MY3 A;  1PEB A;  4ND9 A;  1NV7 A;  3IAZ A;  4G4P A;  5H8F B;  2HZK A;  3KEI A;  3MBP A;  2Y5L A;  1CB6 A;  1A99 A;  3CIJ A;  3EKI A;  2UYF A;  1XS5 A;  2FNC A;  2UYE A;  2HFB A;  4RJZ A;  3B50 A;  3E78 A;  1K9Z A;  1LBC A;  4GLI A;  5CBS A;  4KD5 A;  3H3G A;  5F7V A;  1FJ9 A;  1JET A;  1UIU A;  1PB9 A;  3CVG A;  3C9H A;  4I1D A;  4N07 A;  4N17 A;  5KDT B;  1N04 A;  1FQC A;  3CG3 A;  2HZL A;  1Q1K A;  5ET6 A;  2PFY A;  2D21 A;  4GF8 A;  3GZG A;  4U1Z A;  3OEK A;  3PUW E;  2D3I A;  2IEE A;  3TCF A;  2REJ A;  4PFB A;  3IOR A;  4HE2 A;  1MY4 A;  4GL8 A;  4OXV A;  4LUB A;  4NED A;  1NMU A;  4NQ8 A;  4F1U A;  5DTB A;  1FQD A;  4RA1 A;  2Q2C A;  3ZKL A;  3MUQ A;  1NKX A;  1XHY A;  4U4X A;  3T9U A;  1EYJ A;  4NF8 B;  4R6K A;  3UA8 A;  4U21 A;  5ISU A;  2F7C A;  2HHM A;  3CHG A;  3H7M A;  1Y4C A;  2LAO A;  4RPN A;  2ZNS A;  1S9T A;  1R9Q A;  2QS2 A;  4N8G A;  1DPP A;  2O6A A;  2P2A A;  1HSJ A;  3MC2 A;  3TTK A;  4X9T A;  3T96 B;  3VLW A;  3VE1 B;  3ILU B;  1Y3Q A;  2Y7I A;  4O8M A;  3K1P A;  3GLB A;  3IR1 A;  1R1N A;  2V3U A;  3ILT B;  4OVS A;  1JEU A;  3A3C A;  4FJP A;  4YIC A;  1MXZ A;  3MZB A;  2P1S A;  2P3N A;  3Q26 A;  4HW8 A;  1JW5 A;  1N7X A;  4PTK A;  4LQ5 A;  3VLV A;  1MXX A;  2ALU A;  3LR1 A;  4DCY A;  1B3F A;  1Y1Z A;  1IIT A;  2DE4 A;  2OBG A;  4ZEI A;  2NXO A;  4YAH X;  1ZU0 A;  4N81 A;  4KYD A;  1OVT A;  3USD A;  1JW4 A;  1INP A;  4GWZ A;  4P47 A;  3C32 A;  2F6G A;  4QRZ A;  4OAN A;  1DOT A;  3MST A;  1B05 A;  1N76 A;  4H5F A;  4PDD A;  2Y7K A;  1LFH A;  2WBD A;  4PFR A;  1A8F A;  2QJE A;  2HPG A;  3KBZ A;  4QSE A;  2RIN A;  1F9B A;  5IKB A;  1MPC A;  3TEP A;  3H06 B;  4YKP A;  3NOH A;  4R73 A;  2R71 A;  3K6W A;  5JTY A;  4DXC A;  2DXR A;  1A8E A;  5KZT A;  5ET8 A;  3Q29 A;  3RYD A;  2XXV A;  2OCU A;  1LFI A;  3CSB A;  1T0K A;  1B3E A;  1J1N A;  1M5F A;  2QFL A;  1LBY A;  4OZ9 A;  1BP5 A;  4YB5 A;  1VR5 A;  1MQJ A;  4PBQ A;  2HAU A;  4KCD A;  4ELQ A;  4EUO A;  1IQ7 A;  4LN5 A;  3HHG A;  4N6K A;  5ELV A;  1OVB A;  3IX1 A;  1FCK A;  1MXV A;  3S2V A;  1OQH A;  1A55 A;  3RTW B;  1N84 A;  1QVS A;  4OVR A;  3O29 A;  2Q8M A;  5H8Q B;  1B40 A;  4GOT A; 
#chains in the Genus database with same CATH homology
 1FSA A;  4N91 A;  2CZH A;  4MCO A;  1DK4 A;  4MHF A;  1LBW A;  2VPN A;  1G0I A;  2CZK A;  1G0H A;  2WEF A;  2BJI A;  4P8B A;  3IFA A;  4GX3 A;  5J1D A;  4PGP A;  4PDH A;  1K9Y A;  5JK4 A;  4O94 A;  4JVI A;  2CZI A;  4P9K A;  1FPD A;  4I40 A;  1FPK A;  2DDK A;  1QGX A;  1Q9D A;  1YXI A;  5IM2 A;  1IME A;  5IZ3 A;  4GBW A;  2XA5 A;  2B4L A;  4N15 A;  4F18 A;  2ZZW A;  4GWU A;  1IMB A;  1DCU A;  4GX4 A;  1XI6 A;  4P3L A;  4PBH A;  1CNQ A;  1FPG A;  2OWZ A;  1BK4 A;  1KZ8 A;  4AS5 A;  1VDW A;  5EYH A;  2XWV A;  5IZ3 B;  1AWB A;  2F3B A;  4NHB A;  5I3S A;  1FBG A;  4MAG A;  2MKZ A;  1FPJ A;  1FPL A;  2HXR A;  2CEX A;  3T1B A;  2F3D A;  5IZ1 A;  2DE3 A;  1FJ6 A;  3GYY A;  2WBB A;  2ZZV A;  1NI9 A;  4HCY A;  2Q9T A;  5EQ7 A;  1FBE A;  1FBH A;  2PCR A;  4I3Y A;  4P1L A;  4H46 A;  1LBX A;  5DW8 A;  1FBD A;  1NUX A;  2FHY A;  5I5P A;  4OVP A;  4HXV A;  4GWY A;  4M1V A;  4UAB A;  2WX9 A;  1FBF A;  4MEV A;  1FTA A;  2V4C A;  4OVQ A;  4NN3 A;  4GWS A;  5ESY A;  4XF5 A;  4PF6 A;  4NX1 A;  5I7I A;  3FXB A;  4DI4 B;  4KXP A;  5IZZ A;  4O7M A;  4H45 A;  2FVZ A;  2V3Q A;  4NF0 A;  5J16 A;  2CEY A;  1RDX A;  2Q74 A;  2PFZ A;  3T0J A;  4DI3 D;  3LUZ A;  5LDZ A;  5FBP A;  1NV7 A;  1NV3 A;  4P1E A;  3QMF A;  2F5X A;  2HZK A;  1NV4 A;  2Y5L A;  2XWO A;  4OA4 A;  3EKI A;  5CM6 A;  4QBA A;  3B50 A;  3E78 A;  1K9Z A;  3A29 A;  1FJ9 A;  2QPQ A;  3FBP A;  4NG7 A;  4N17 A;  1NV2 A;  4MJO A;  3W9W A;  2DE2 A;  1NUY A;  2HZL A;  1KA1 A;  3RPL A;  1FRP A;  3MYU A;  5ET6 A;  2PFY A;  1SPI A;  4MNP A;  4HCW A;  4HE1 A;  2QVR A;  4PFB A;  4HE2 A;  1D9Q A;  2DVZ A;  4GBV A;  4O7I A;  4PFI A;  2Y5K A;  4NQ8 A;  4MX6 A;  4F1U A;  5EQ9 A;  2FBP A;  5A5L A;  2R8T A;  1RDZ A;  3E79 A;  1JP4 A;  1EYJ A;  4GX6 A;  3ISP A;  1IMC A;  2FIX A;  4X04 A;  2HHM A;  3CHG A;  2VPO A;  3HFU A;  4GWW A;  3IFC A;  4PAI A;  2XXK A;  4N8Y A;  4N8G A;  4HE0 A;  4X9T A;  1RDY A;  1EYI A;  4NAP A;  1YZ0 A;  4P56 A;  4O8M A;  4GWX A;  1NV5 A;  4QXD A;  4OVS A;  1IMF A;  4OVT A;  2ZZX A;  4AS4 A;  4XEQ A;  4PAK A;  4YIC A;  1FPE A;  4G61 A;  1LBZ A;  3D1R A;  1NUW A;  2P3N A;  4YZZ A;  4PTK A;  1NV6 A;  4X8R A;  5F24 A;  3ROJ A;  4PE3 A;  4PC9 A;  4PET A;  5ET5 A;  1NV0 A;  2WYK A;  2DE4 A;  1EYK A;  4NGU A;  1FPF A;  4N81 A;  3SZP A;  4PCD A;  5EYG A;  4F1V A;  4P47 A;  1INP A;  4GWZ A;  5IGA A;  4JVD A;  4MIJ A;  2KQZ A;  4OAN A;  3MST A;  3BIH A;  3W9V A;  1DBZ A;  1FBC A;  4PAF A;  4PDD A;  2OX3 A;  1IMA A;  1LEV A;  2WBD A;  4PFR A;  4F19 A;  2HPG A;  3KBZ A;  1FBP A;  3B8B A;  5ET7 A;  1YYZ A;  4XFE A;  1NUZ A;  1FPI A;  2QVU A;  4PF8 A;  2B4M A;  2XWK A;  3NOH A;  3PTY A;  2P3V A;  2VT5 A;  4I3E A;  3RPL B;  5ET8 A;  1IMD A;  3KC0 A;  3RYD A;  4N4U A;  3KC1 A;  2L5V A;  4FBP A;  4N6D A;  2QFL A;  2XWI A;  1LBY A;  3U65 A;  4PBQ A;  4JVC A;  2KR0 A;  3LV0 A;  4LN5 A;  5EQ8 A;  4MMP A;  2QVV A;  4N6K A;  2GQ1 A;  1KA0 A;  1FPB A;  1LBV A;  5T3J A;  1NV1 A;  2JJK A;  4MNC A;  5EQA A;  2WYP A;  2FIE A;  3BIG A;  4OVR A;  5LTC A;  2Q8M A;  4IR8 A;  4PGN A;  4MNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...