4OVPA

Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1, target efi-510292, with bound alpha-d-manuronate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
323
structure length
308
Chain Sequence
HHHHHHMETVLRGASMFDEEHAFTKTLRKFEELVDEKYDGDVTFDLRLNGELGVESDYVTFLNQGVAIDYTILAPSNMAKFAPSIPLMDMPFLFRDLDHWNAVLSSDVLAPLEDELLEKADIKIVGYTGGGTRNLLSKQPVVTFDDLKGHKMRVMGAPIQAQIFQALTAAPSAIAYNEVYNAIQTGVIAGFENEAASIQNLKFYEVAPNLTLTRHSITVRPIVMSGKTFNSLPADLQAVVLEAGEEAGAYGRELESREDGVKLQEMVDAGQLTVSEFENRDKMLEMVKPVQDAYAAEIGASDLLEAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Solute-binding protein
molecule keywords C4-dicarboxylate transport system substrate-binding protein
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Sulfitobacter sp.
total genus 98
structure length 308
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ovpA00
4X8RA 5IZZA 4DI4B 4OVTA 4NGUA 4PF6A 4OVPA 5LTCA 4PBQA 4PFBA 4PCDA 5IM2A 2ZZWA 4YZZA 4N8GA 4O8MA 2HPGA 4MNPA 4DI3D 4MHFA 4MEVA 4PF8A 4MX6A 4PGNA 4OVRA 4MMPA 4XFEA 2CEXA 4XF5A 4LN5A 3GYYA 4PC9A 2PFZA 4PAKA 4MIJA 4PFIA 4O7MA 4OANA 4NHBA 4N17A 2XWIA 4N6DA 2XWOA 4NG7A 2WYKA 4PDDA 4YICA 4N6KA 4OA4A 5I5PA 4PAFA 2HZKA 4P1EA 2CEYA 4PGPA 4P1LA 4PFRA 2WYPA 3B50A 4NAPA 4PETA 5CM6A 3FXBA 2WX9A 4N4UA 4P9KA 2XA5A 5IGAA 4UABA 4PDHA 4MAGA 4N15A 4PAIA 2XWKA 4NF0A 2VPNA 2PFYA 4NX1A 4OVSA 4X04A 4NQ8A 3U65A 4OVQA 2XWVA 4N8YA 2ZZVA 2V4CA 2ZZXA 4O94A 2HZLA 5I7IA 4P47A 4P8BA 4N91A 4PBHA 4MNCA 4MNIA 4P3LA 4P56A 4MCOA 4XEQA 4PE3A 4NN3A 2VPOA 2XXKA
chains in the Genus database with same CATH superfamily
3HHGA 2OX3A 1AL3A 1MDQA 3H7MA 1FPJA 5K2YA 4U1OA 4KCDA 1FTKA 2I6EA 1PBQA 4FAJA 1OIBA 3A3UA 4U23A 5J1DA 1Y4TA 2Q2CA 4O8MA 1SI1A 2QS2A 1NKXA 2DOJA 4C1TA 4KYSA 4R9FA 2REJA 3MVYA 4FECA 2PT1A 3GYYA 2QMXA 3C33A 2XXRA 3MSTA 1MQIA 3QUFA 3RLFE 4O3BA 4EXLA 4MH5A 2RKMA 3QIMA 4X48A 4PQJA 4F18A 1URDA 3BKIB 1K9ZA 1LB8A 3LC8A 3EHTA 3LSXA 1DK4A 4HTGA 1M5BA 2DWHA 2VD3A 3H3GA 5HPQA 1MDP1 4QFNA 2OLBA 1IXIA 2WKYA 3JZJA 2O69A 1Z7ME 2I3VA 1N3XA 3VXBA 2PYYA 5DW8A 3S9LC 2I49A 2QRYA 1M5FA 5ITPA 2ZZXA 1TWYA 4IO3A 3H4ZA 3MVXA 3TFLA 4HCYA 1KWHA 3EQ1A 5DVJA 1IXHA 4NF8A 3PMVA 2Q9TA 1XHYA 4BDLA 1MXZA 4NF4B 3KJTA 2D3IA 1VSOA 1XI6A 1MXUA 4PP0A 1M5EA 1LAGE 4ELRA 1PB7A 2DWIA 5DEXA 3K02A 4DI3D 4OVRA 1JW5A 1Q9DA 5F1QA 1OMPA 5H8SA 4NWCA 4RPOA 4I3YA 5TU0A 4ELPA 3G3KA 4NHBA 2Y7PA 4RA1A 3IL1B 3UN6A 3MPLA 3V83A 4I1DA 3WAEA 1F9BA 4ZE8A 4R6YA 2PBWA 3TYHA 4OA4A 3V89B 1O63A 2LAOA 4PAFA 5ICQA 2V25A 1B4HA 3SEVA 3CSBA 4PFRA 5CM6A 2BJJX 3MVWA 1NNKA 2RF1A 3RPLB 3FXBA 2RCAA 1ZTYA 2O1MA 4HCWA 5IGAA 5KCJA 1SW1A 1SDXA 2QPQA 1SD3A 4G8MA 3GXAA 3OD7A 4G8HA 1A8FA 4R72A 5HBCA 3QAXA 5AE4A 1AOVA 3SETA 3KC0A 4ZEDA 4KR5A 4OVQA 1TXFA 3D1RA 2XXPA 1EYKA 4YKPA 4IR8A 4IO2A 4RK2A 3DP4A 4QF9A 1JQFA 3W9VA 2ANJA 1KA1A 4NWDA 2B4LA 2VPOA 5ET6A 3FATA 1MQGA 2CMOA 4IGTA 1FJ6A 3DLNA 5DT6A 3USDA 3O6GA 3AXFA 1UIUA 1JEUA 1YTVA 4LZ7A 5TPAB 2V3QA 2HPGA 4PF8A 2I0CA 2XHDA 3TELA 1WDNA 2DS9A 4H0WA 1NV6A 3SEXA 2Z8DA 2P2AA 2PT2A 4K3FA 1B3HA 3N94A 5K2XA 4U21A 1L5TA 4KI0E 2O7IA 2DSFA 4YKJA 2QS4A 4PFTA 2XXTA 1EU8A 2WYPA 2G29A 1ZLQA 1IMAA 4H45A 3FD3A 4N4UA 1IIWA 2X26A 5L9SA 1IITA 2XA5A 1BTJA 3SDFA 1NV3A 3RT6B 4XKNA 2YLNA 1B46A 2VGQA 1D4NA 5BWJA 1TFDA 3MVZA 4ZZAA 3KEIA 1JVYA 4LUBA 4U4SA 1ATGA 3DP8A 4TOZA 2A5TA 3OXNA 5I2NA 3VLWA 4LZ8A 1FW0A 1BIYA 2H4IA 5H8QA 2CZKA 1SI0A 1AWBA 3H06B 4PTKA 4DI4B 1O64A 3UA8A 1B2HA 3BBRA 2DDKA 4O3AA 1N7XA 2GH9A 4OFOA 4QSDA 3O6HA 4R9GA 4OWDA 3HSTA 4QFOA 3RTFB 1II5A 3PUWE 1DTZA 1Y20A 4AQ4A 3E79A 4O7MA 1Y9UA 1G0IA 2WBDA 3E13X 4GWXA 2FIEA 4THIA 4H6DA 4Q0CA 3WAFA 3CIJA 1A99A 1Q35A 3G3JA 1N0TA 2QJEA 1AMFA 4JXIA 1IZ1A 3FASA 3SERA 4G8NA 2GHBA 1ANFA 2VD2A 4E0WA 4KHZE 2R6GE 3BFUA 5I84A 3TTRA 4FE8A 1O7TA 1FPDA 4HS7A 4RXLA 3CI8A 4GRKA 2Z8EA 1A7LA 4PAIA 4KCCA 2F35A 4KYEA 4GL8A 4M4GA 1NUZA 4R2BA 4ND9A 3ILUB 3TCHA 3U65A 4N8YA 5CRYA 4FATA 5JTYA 3OOAA 1IEJA 4FBPA 5FBPA 1SW4A 1DPEA 4P47A 1B1XA 4NF5B 4N91A 3MBPA 4LQ2A 4AB6A 4I62A 3I3VA 1MG1A 2XXVA 3K1PA 3EHSA 2DE3A 3OSQA 4G68B 5T3JA 3QUJA 4GWZA 3M3FA 1AH5A 1GGGA 5LTCA 3M3KA 3K6VA 3KC1A 1IMDA 4XKPA 4N8GA 3PPRA 3FJ7A 5I56B 5I59A 1SBPA 4AS4A 3E4RA 3FBPA 4GVOA 4NF8B 4IGRA 2R71A 3K1NA 2V3UA 2OJTA 2DXYA 4KXPA 4PAKA 2V3TA 3ZS6A 1PBPA 4IY6A 1B3EA 4ZDMA 5H8HB 1A54A 1EH3A 3S9NC 5F7VA 2OZZA 3QK6A 3S9EA 4OESA 2HZKA 2DXRA 1LAHE 2RC9A 2UYEA 3IOVA 2ONKE 4POWA 5EQAA 1QVSA 3TPAA 1Q1KA 4BDQA 4LZ5A 3IJOB 2NUVA 1N3WA 1G0HA 4QBAA 1JW4A 1B6HA 1NNPA 1POTA 1MQHA 3C36A 2HQ0A 5TP9A 4N15A 1FPFA 1MM7A 5CMMA 1LAFE 3TCGA 3TEPA 4IB2A 1NH8A 2ONRA 3VV5A 1ZBMA 1MPDA 4OFJA 2F34A 1NL5A 2I4CA 4WEDA 3LR1A 3ZSFA 4YMBA 1PDAA 2ZYNA 2DVCA 4MCOA 4NN3A 4X1DA 1OVTA 4F2QA 4OENA 1MY4A 1B3GA 4RJZA 3MZ9A 4JVDA 4JVIA 1PC3A 1LSTA 1M5CA 1YCJA 2ZZWA 2R8TA 3Q27A 5H8FB 3B8BA 3VXCA 1H76A 4OTEA 3PGFA 4MX6A 3PUVE 3T93B 3T22A 5KDTB 2CEXA 4F19A 1TT1A 4LN5A 1LEVA 3U72A 2M8CA 4XKQA 3BFTA 3PPNA 3K00A 4JVCA 4N6KA 1HSEA 3RGYA 2A5SA 4U22A 2GHAA 1GTKA 2KQZA 3CFZA 3IJXB 4ONYA 2ZNSA 2HAUA 2XXIA 4I9DA 3IK6B 3EN3A 1MY2A 3B6TA 1FPIA 5CBSA 1MXVA 3KN7A 3TDJA 3OELA 3V8XB 2QS3A 2PX1A 4H5GA 2Q8MA 4HE0A 3RN8A 2XX8A 3MUQA 3EKIA 3HN0A 3VDFA 3FXUA 4ZE9A 1DPPA 3C32A 3MP8A 4GX3A 4PBHA 1FCKA 3UORA 1LB9A 2F36A 1UTHB 1SW5A 2E1SA 4GWWA 1P1UA 3I5OA 3R6UA 5BUUA 4FORA 3U93A 1LBYA 1SQYA 1H45A 1IXCA 2ZYOA 5I2NB 5EQ9A 4PGNA 3G3HA 1FTOA 3KGCA 4R6HA 3W9WA 2G93A 3K6WA 3MYUA 5IZ3A 1M5DA 4YB5A 4ZEKA 3UP9A 4GWSA 4DCYA 3KSJA 2Z22A 1US5A 4YICA 2X7QA 3Q25A 3KBZA 5I5PA 1ZIUA 3PUXE 1B7UA 5DTBA 3RTWB 1R1NA 3RPWA 4F31B 1JEVA 1P1OA 1RDXA 5CC2A 4MF3A 1RKMA 2HHMA 3N6TA 3SEWA 3MP6A 1QUIA 5M2VA 1LBVA 3MWBA 4WKMA 2ESNA 1B9JA 3R26A 1FBDA 4F3GA 3OO9A 1URGA 3F11A 3RYDA 4O7IA 2XWKA 4ZEFA 3TMGA 1YAEA 1D9VA 4FEBA 4YB6A 4I40A 3KN3A 3PTYA 1IQ7A 2DWJA 4U4XA 2AIXA 4F29A 4X1BA 5A5XA 3FVOA 4O94A 2XD2A 1N04A 2HZLA 3T9VA 5H8NA 1NNTA 2YPNA 2F78A 3ODBA 4QHQA 4IY5A 1POY1 1MPCA 1A40A 4MJOA 3E3KA 3IO6A 4H46A 1XC1A 1K9YA 3CR9A 4Z7EA 1NMUA 5L9MA 1B7HA 1CE2A 4MLVA 3FJMA 1I69A 3EF7A 3QMFA 4EQ9A 5JTYB 2ZYKA 1DMBA 3TUSA 5I57A 1YYZA 4GD5A 4YB7A 4ESWA 3B6WA 2R9JA 1FBEA 2Z23A 5I2KB 1NUXA 3MQ9A 1CB6A 4YU0A 2IEEA 4OANA 1IMEA 1JW1A 1NH7A 3CFXA 5FTHA 2HCAA 4UA8A 4MBPA 4OVJA 4OEUA 4GF8A 2H98A 5EYFA 2Z8FA 3OO6A 4KYDA 1UIVA 1NFTA 1VFEA 5CI5A 4OFLA 1QW0A 1S9TA 1FTAA 3S4UA 1B51A 3LV0A 4GQOA 4GXAA 4WEPA 3OENA 1RDZA 3TAJA 4IO5A 3KN8A 4H5FA 1B5IA 2H25A 1SYHA 1NI9A 4NX1A 1SVXB 1FTMA 5EHSA 4C0RA 2XWVA 4XKRA 2KLFA 4JBZA 4QFPA 4YMAA 3SEYA 5EYGA 1P1WA 4UACA 3IB2A 3IFCA 3ONMA 3HO7A 4QXDA 5DVIA 2Y5KA 3MZBA 4NEDA 3BIHA 1B1HA 1Y4CA 3H6TA 5ITOA 4P11A 4XFEA 1Y3PA 4XTCQ 1FPBA 1N84A 2ALUA 5B70A 4GX6A 2HFBA 3B6QA 4PC9A 1P99A 3Q29A 3OO7A 4GWYA 2PFZA 3TCFA 3U8QA 2XWIA 4N6DA 4OERA 2FNCA 4LONB 2P3VA 4JWYA 3CHGA 2WYKA 5IZ1A 1I6BA 1ZKBA 3LBSA 1UQWA 1YXIA 3EHUA 1JVXA 3CG3A 2QMWA 2V84A 2Q89A 4Q30B 1QUKA 3ROJA 1D3KA 4JSDA 2QSXA 3C35A 4NF4A 1OVBA 4Q5TA 2DE4A 1RYXA 3OSRA 4R73A 4WXJA 3L6GA 3IX1A 5AA2A 4G77A 4UABA 1EZ9A 4R74A 3THIA 1LGBC 3Q28A 3N6UA 2KR0A 4R75A 1NV0A 2GRVA 3A09A 1HSJA 2ABHA 2OWTA 5EHMA 3RY3A 1P1NA 1US4A 5I7IA 3M3LA 4P3LA 1DSNA 3IOTA 1LFHA 4F1UA 3PPOA 1NV4A 1YPNA 4OQOA 3KOTA 2QS1A 3RPLA 4EF1A 1UTBA 2Y84A 2VT5A 4PF6A 3C4MA 2H9BA 2O7UA 1OLCA 3O66A 4PBQA 4QSEA 5I3SA 2O1LA 3H03A 3IB0A 3T66A 4R2FA 4DDDA 3A3CA 4MMPA 1MQJA 1IXGA 1MPBA 1FQAA 3IR1A 3PPPA 3S9MC 3VVFA 4DZ1A 3DM0A 3U1OA 4JWOA 4TQUQ 2QFLA 4LVQA 3CSGA 4NG7A 3SKPA 4AB5A 4Z0IA 4N6PA 2F3DA 1MS7A 3MJNA 5AA2D 1EZPA 2I48A 3N26A 3FGSA 5AA4A 3SZPA 5IZ3B 2QVUA 1MH3A 3TKDA 2Q88A 4F22A 1NUWA 3TQLA 3JV9A 3LSLA 4EXKA 3K6UA 4GBVA 5IAIA 4F3PA 3PD8A 5DEXB 1OQHA 4DXBA 2F7AA 4JWXA 3ISPA 3PUZE 3U92A 4E0XA 1H44A 4N07A 5FHMA 1S50A 4HE2A 4H1XA 3G3FA 2Y7KA 1B5HA 1DCUA 3IORA 5A5LA 2F7CA 3RUMA 2HAVA 2I0BA 4O3CA 4MFIA 3K0VA 2D21A 4PFYA 5CBRA 5CMBA 1VE4A 4HW8A 3O97A 4NMYA 5ET7A 4OZ9A 1CNQA 2Y7RA 3QYTA 2OCUA 2Q8JA 4DLDA 3OEMA 2CZHA 1D9YA 4JDFA 1BLFA 1FBHA 3FVGA 5KCJB 4H8IA 3PMXA 5KZTA 2XXUA 4G68C 1VDWA 1EZOA 5ELVA 5HM4B 2ZMBA 4U2RA 1WODA 3FVNA 1INPA 1LBZA 4EQBA 3S2VA 3HCQA 2QVVA 3ZKKA 4N17A 4DXCA 1QUJA 1URSA 3KBRA 2XWOA 3K01A 3FV2A 3G3GA 2B3BA 3GLBA 1AIVA 3TZAA 1PEBA 3HV1A 3M8UA 4BDMA 1B40A 1GV8A 1ELJA 4EF2A 3T0JA 4GFRA 1B7ZA 3OEKA 4U1ZA 3TODA 1B5JA 1MM6A 1PB9A 4NE4A 1ZMGA 1FTLA 3FZVA 2O51A 5I58A 2UXAA 2F5XA 3LSWA 2OK2A 3PD9A 1MXXA 2L5VA 3E9XA 4G4PA 3G7WA 3SEUA 1NV1A 4AS5A 2I3WA 5ICTA 2RINA 4RK9A 1NV7A 4HE1A 2UVJA 1BKAA 1FQEA 1EYIA 3FJGA 3QSLA 5CMKA 1I6AA 4F1VA 2FBPA 4I8CA 3U94A 2VHAA 3V5AA 4ZZEA 4Q8RA 1MXWA 1FPEA 1YZ0A 4G2ZA 4RYAA 3D4CA 4XEQA 4QSCA 4OHNA 4ELOA 2FA7A 3T9HB 3UIFA 2F97A 5F24A 1FSAA 2DQVA 4OVTA 4QRZA 3VVEA 1OLAA 3T1BA 2WBBA 4R6KA 1LAXA 5EQ8A 1ZJLA 2REGA 3KSXA 4EDPA 3IAZA 3O28A 1LLSA 4XF5A 1FQCA 4FJPA 4GX4A 2RC7A 4TLMB 2AYSA 1VFDA 4NTLA 1QGXA 3TTKA 4NF5A 3IB1A 2FIXA 2A5TB 2XXWA 4NF6A 4RNSA 1B4ZA 3C31A 2ZNTA 1XVYA 1B32A 4YKKA 4G68A 5DVFA 1WVJA 5H8QB 1USYH 2XD3A 1N76A 1H43A 4N13A 3PMWA 1B0HA 5I56A 4PDHA 4MAGA 2V93A 3I6VA 3SESA 3MZ1A 1SW2A 4HXVA 2Q2AA 1LBBA 1Y1ZA 2ZNUA 4OVSA 3IOUA 3ILTB 3HPIA 4OETA 3MAMA 4DE8A 5H8HA 1FPLA 4OMBA 2X7PA 5AA2B 1FQFA 4ZEIA 3IO4A 3OMBA 4BDNA 4X9TA 1H3DA 1R9LA 4ESXA 5J16A 3LUZA 2GFEA 4IO6A 3K1MA 3C9HA 1J1NA 1IMCA 1USYE 1LCFA 3IOWA 1PB8A 3Q26A 3GZGA 3FXRA 5L8DA 1ZU0A 2DWAA 2O84X 1R6ZA 1FQBA 2W7YA 3FUZA 4ZS9A 3L6HA 1FBFA 4H67A 1UTBB 1SPIA 4PFIA 4RPNA 3GBAA 1LBCA 1JNFA 1GVCA 1BK4A 4PDDA 5CMCA 3TTLA 5LDZA 4PE5B 1MXYA 4IO4A 2XXHA 1B52A 2NOOA 2QL3A 3FIRA 4IO7A 1LBWA 3CFLA 1MQDA 2CEYA 2AL5A 4KPTA 3B50A 1MH4A 4NAPA 3N5LA 5EQ7A 5ISUA 1B05A 2DVZA 3H6UA 4F3SA 2WX9A 5H8FA 2OWZA 1XS5A 1DBZA 2F7BA 2P3NA 4GBWA 5KDTA 4DXUA 3HFUA 3BIGA 3O2AA 1LFGA 5ET8A 1TFAA 4L17A 5I59B 5AA4B 4LATA 4NF0A 4DCXA 1IUDA 4NQ8A 4EQ7A 2P1SA 1N7WA 1KZ8A 3MP1A 2Q74A 2OWSA 3C34A 2O68A 4P0IA 5ET5A 1NNFA 3FVKA 4F3BA 5IZZA 4M1VA 2NVUB 3KJ7A 4F2OA 5ESYA 4GLIA 2UVHA 5IM2A 1P1QA 2ZYMA 4QFKA 2FVZA 2VOZA 3UK4A 2OBGA 4XXUA 2I4BA 3PU5A 5TP9B 3PPQA 4GOTA 2PVUA 2XXQA 4PFUA 4F1YA 4ZECA 4MIJA 3FXQA 2E0SA 4FEDA 3JYRA 2ONSA 1OQGA 2F3BA 3GBBA 3O6IA 3TTNA 2UYFA 1B0LA 1GR2A 1UTHA 1QULA 3DP6A 4POXA 4PETA 4DIGA 2F6GA 3HHFA 2B65A 1LFIA 1FBGA 3EPEA 5FHOA 3O29A 5FHNA 2XX7A 3DELB 1FQDA 4N81A 2FYIA 4KD5A 3LSFB 2DYXA 1JP4A 2PFYA 4RY1A 4GWUA 3K4UA 3VLUA 4ISUA 1Y1MA 2D5WA 5JK4A 1VR5A 5IKBA 1A8EA 3MPKA 5I58B 1FPKA 2ZXTA 1XT8A 1LBXA 2O6AA 3P7IA 1QKAA 1RYOA 3H6WA 3T96B 4MNIA 2XX9A 2H99A 1EYJA 3VVDA 2B3FA 3FV1A 2PCRA 1FJ9A 3H6VA 5DYHA 2RC8A 4XIGQ 4OVPA 4BLAA 1QJMA 3W15C 2Y7WA 2Y5LA 4GXSB 2NXOA 1LCTA 4YZZA 1Z7NE 4OXVA 2F8DA 4H8JA 2IA4A 4MNPA 5JEIA 4MEVA 5AA3A 1HSLA 1FBPA 1XVXA 2CZIA 3K6XA 3QXMA 1FTJA 1IMBA 2HEUA 2HXRA 4JB7A 5L9OA 1A55A 4EUOA 2UVGA 3R7XA 1NV2A 1FBCA 4I3EA 3MC2A 4PGPA 3TQWA 3VLVA 4KQPA 4YAHX 4GWOA 3G3IA 3ECRA 4C1UA 2PMSA 2H5YA 1FRPA 4MLQA 2WEFA 1SYIA 4NF6B 4ZEBA 1BP5A 1FPGA 3KG2A 1Y3QA 5I2KA 1XOCA 3NOHA 3K2DA 3PV0E 4X04A 2AL4A 3VFJA 3T9UA 2THIA 2ZZVA 2V4CA 4OYVA 3E78A 5TPAA 1B58A 4BDOA 1RDYA 2GQ1A 3OO8A 3D4GA 4P0GA 4P56A 2B4MA 2HXWA 4GL0A 4LA9A 2XXKA 3RT8A 1DTGA 1MRPA 4FIMA 4BDRA 4X8RA 1KA0A 4NGUA 4KFQA 1B3FA 1D9QA 4PFWA 2DP8A 4PFBA 4PCDA 2XXYA 4ECFA 1B3LA 4MHFA 2BJIA 3T9XB 1Y3NA 3B7DA 4JSOA 3CVGA 1IMFA 3VE1B 2RCBA 3ZKLA 2JJKA 1NV5A 1NUYA 1R9QA 2FHYA 5A5XB 1MY1A 4YKIA 1JETA 3A29A 1DOTA 5EYHA 4TLLB 3PUYE 5H8NB 3TTMA 1QKBA 4P1EA 3RNNA 3RQTA 4P1LA 2XXXA 4G61A 2DE2A 5B7DA 2QVRA 4GIZA 1MY3A 1I6QA 5AA1A 3IFAA 2CZLA 2I58A 4P9KA 3MW0A 3CG1A 2UVIA 4LP2B 2F6PA 1T0KA 3LUYA 2MKZA 5FTIA 5I57B 2P0SA 2VPNA 3KZGA 5LOMA 1MY0A 3UGWA 2Y7IA 2NWJA 3KOSA 4F39A 4QFLA 3KFMA 1S7YA 2VP1A 4LQ5A 4ELQA 3CRBA 4H65A 3O9PA 4OEVA 4P8BA 4MNCA 2YJPA 4PE3A
chains in the Genus database with same CATH topology
2OX3A 2Y5KA 2DE3A 5T3JA 1FPJA 4GWZA 5J16A 3LUZA 3BIHA 5J1DA 5LTCA 3KC1A 1IMDA 4N8GA 1IMCA 4O8MA 4XFEA 4AS4A 3FBPA 1FPBA 4GX6A 3GYYA 3MSTA 4PC9A 4GWYA 2PFZA 4KXPA 4PAKA 1FBFA 4PFIA 1SPIA 2XWIA 4N6DA 2P3VA 1BK4A 3CHGA 2WYKA 4PDDA 5IZ1A 5LDZA 4F18A 1YXIA 1K9ZA 1LBWA 2HZKA 2CEYA 3ROJA 1DK4A 3B50A 5EQAA 4NAPA 5EQ7A 2DVZA 2DE4A 2WX9A 2OWZA 1G0HA 4QBAA 1DBZA 4UABA 2P3NA 4GBWA 3HFUA 4N15A 1FPFA 3BIGA 5ET8A 4NF0A 2KR0A 5DW8A 1NV0A 4NQ8A 1KZ8A 2Q74A 2ZZXA 5I7IA 4P3LA 4HCYA 4F1UA 4MCOA 5ET5A 1NV4A 4NN3A 2Q9TA 5IZZA 4M1VA 3RPLA 2VT5A 4PF6A 5ESYA 4JVDA 4JVIA 1XI6A 4PBQA 5IM2A 2ZZWA 5I3SA 2R8TA 2FVZA 3B8BA 4DI3D 4MX6A 4OVRA 4MMPA 2CEXA 1Q9DA 4F19A 4LN5A 1LEVA 4I3YA 4MIJA 4NHBA 2QFLA 4NG7A 2F3BA 4JVCA 2F3DA 4N6KA 4OA4A 4PAFA 3SZPA 4PFRA 2QVUA 5IZ3B 4PETA 5CM6A 2KQZA 3RPLB 3FXBA 1NUWA 4HCWA 5IGAA 1FBGA 2QPQA 4GBVA 4N81A 1FPIA 3ISPA 2PFYA 1JP4A 4GWUA 2Q8MA 4HE0A 3KC0A 3EKIA 4OVQA 3D1RA 4HE2A 5JK4A 1EYKA 1DCUA 5A5LA 4IR8A 1FPKA 1LBXA 4GX3A 3W9VA 4PBHA 4MNIA 1KA1A 2B4LA 2VPOA 5ET6A 1EYJA 2PCRA 1FJ9A 1FJ6A 5ET7A 1CNQA 4OVPA 4GWWA 2Y5LA 2CZHA 4YZZA 1FBHA 2V3QA 1LBYA 2HPGA 4MNPA 4MEVA 4PF8A 5EQ9A 4PGNA 1FBPA 2CZIA 1NV6A 1VDWA 3W9WA 3MYUA 5IZ3A 1IMBA 2HXRA 1INPA 1LBZA 4GWSA 2QVVA 4N17A 2XWOA 1NV2A 1FBCA 4YICA 4I3EA 3KBZA 5I5PA 4PGPA 3T0JA 2WYPA 1RDXA 1IMAA 4H45A 2HHMA 4N4UA 1FRPA 2XA5A 1LBVA 2F5XA 2WEFA 1FBDA 1NV3A 2L5VA 1FPGA 1NV1A 3RYDA 4O7IA 4AS5A 2XWKA 3NOHA 1NV7A 4X04A 4HE1A 4I40A 3PTYA 1EYIA 2ZZVA 4F1VA 2V4CA 2FBPA 3E78A 4O94A 2HZLA 1RDYA 2GQ1A 1FPEA 1YZ0A 4P56A 2B4MA 4XEQA 2XXKA 2CZKA 4X8RA 1AWBA 4MJOA 4PTKA 1KA0A 4H46A 5F24A 1FSAA 1K9YA 4OVTA 4DI4B 4NGUA 1D9QA 3T1BA 4PFBA 4PCDA 2WBBA 3QMFA 5EQ8A 2DDKA 4MHFA 2BJIA 1YYZA 4XF5A 1IMFA 1FBEA 4GX4A 1NUXA 2JJKA 3E79A 4O7MA 4OANA 1G0IA 2WBDA 4GWXA 1IMEA 1NV5A 1QGXA 2FIEA 1NUYA 2FIXA 2FHYA 3A29A 5EYHA 4P1EA 4P1LA 4G61A 2DE2A 2QVRA 3IFAA 1FTAA 4P9KA 3LV0A 4PDHA 4MAGA 1FPDA 1RDZA 2MKZA 4HXVA 4PAIA 2VPNA 1NUZA 4NX1A 1NI9A 4OVSA 3U65A 2XWVA 4N8YA 1FPLA 5FBPA 4FBPA 5EYGA 4P47A 4P8BA 4N91A 4MNCA 4X9TA 4PE3A 3IFCA 4QXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8R A;  5IZZ A;  4DI4 B;  4OVT A;  4NGU A;  4PF6 A;  4OVP A;  5LTC A;  4PBQ A;  4PFB A;  4PCD A;  5IM2 A;  2ZZW A;  4YZZ A;  4N8G A;  4O8M A;  2HPG A;  4MNP A;  4DI3 D;  4MHF A;  4MEV A;  4PF8 A;  4MX6 A;  4PGN A;  4OVR A;  4MMP A;  4XFE A;  2CEX A;  4XF5 A;  4LN5 A;  3GYY A;  4PC9 A;  2PFZ A;  4PAK A;  4MIJ A;  4PFI A;  4O7M A;  4OAN A;  4NHB A;  4N17 A;  2XWI A;  4N6D A;  2XWO A;  4NG7 A;  2WYK A;  4PDD A;  4YIC A;  4N6K A;  4OA4 A;  5I5P A;  4PAF A;  2HZK A;  4P1E A;  2CEY A;  4PGP A;  4P1L A;  4PFR A;  2WYP A;  3B50 A;  4NAP A;  4PET A;  5CM6 A;  3FXB A;  2WX9 A;  4N4U A;  4P9K A;  2XA5 A;  5IGA A;  4UAB A;  4PDH A;  4MAG A;  4N15 A;  4PAI A;  2XWK A;  4NF0 A;  2VPN A;  2PFY A;  4NX1 A;  4OVS A;  4X04 A;  4NQ8 A;  3U65 A;  4OVQ A;  2XWV A;  4N8Y A;  2ZZV A;  2V4C A;  2ZZX A;  4O94 A;  2HZL A;  5I7I A;  4P47 A;  4P8B A;  4N91 A;  4PBH A;  4MNC A;  4MNI A;  4P3L A;  4P56 A;  4MCO A;  4XEQ A;  4PE3 A;  4NN3 A;  2VPO A;  2XXK A; 
#chains in the Genus database with same CATH topology
 3HHG A;  2OX3 A;  1AL3 A;  1MDQ A;  3H7M A;  1FPJ A;  5K2Y A;  4U1O A;  4KCD A;  1FTK A;  2I6E A;  1PBQ A;  4FAJ A;  1OIB A;  3A3U A;  4U23 A;  5J1D A;  1Y4T A;  2Q2C A;  4O8M A;  1SI1 A;  2QS2 A;  1NKX A;  2DOJ A;  4C1T A;  4KYS A;  4R9F A;  2REJ A;  3MVY A;  4FEC A;  2PT1 A;  3GYY A;  2QMX A;  3C33 A;  2XXR A;  3MST A;  1MQI A;  3QUF A;  3RLF E;  4O3B A;  4EXL A;  4MH5 A;  2RKM A;  3QIM A;  4X48 A;  4PQJ A;  4F18 A;  1URD A;  3BKI B;  1K9Z A;  1LB8 A;  3LC8 A;  3EHT A;  3LSX A;  1DK4 A;  4HTG A;  1M5B A;  2DWH A;  2VD3 A;  3H3G A;  5HPQ A;  1MDP 1;  4QFN A;  2OLB A;  1IXI A;  2WKY A;  3JZJ A;  2O69 A;  1Z7M E;  2I3V A;  1N3X A;  3VXB A;  2PYY A;  5DW8 A;  3S9L C;  2I49 A;  2QRY A;  1M5F A;  5ITP A;  2ZZX A;  1TWY A;  4IO3 A;  3H4Z A;  3MVX A;  3TFL A;  4HCY A;  1KWH A;  3EQ1 A;  5DVJ A;  1IXH A;  4NF8 A;  3PMV A;  2Q9T A;  1XHY A;  4BDL A;  1MXZ A;  4NF4 B;  3KJT A;  2D3I A;  1VSO A;  1XI6 A;  1MXU A;  4PP0 A;  1M5E A;  1LAG E;  4ELR A;  1PB7 A;  2DWI A;  5DEX A;  3K02 A;  4DI3 D;  4OVR A;  1JW5 A;  1Q9D A;  5F1Q A;  1OMP A;  5H8S A;  4NWC A;  4RPO A;  4I3Y A;  5TU0 A;  4ELP A;  3G3K A;  4NHB A;  2Y7P A;  4RA1 A;  3IL1 B;  3UN6 A;  3MPL A;  3V83 A;  4I1D A;  3WAE A;  1F9B A;  4ZE8 A;  4R6Y A;  2PBW A;  3TYH A;  4OA4 A;  3V89 B;  1O63 A;  2LAO A;  4PAF A;  5ICQ A;  2V25 A;  1B4H A;  3SEV A;  3CSB A;  4PFR A;  5CM6 A;  2BJJ X;  3MVW A;  1NNK A;  2RF1 A;  3RPL B;  3FXB A;  2RCA A;  1ZTY A;  2O1M A;  4HCW A;  5IGA A;  5KCJ A;  1SW1 A;  1SDX A;  2QPQ A;  1SD3 A;  4G8M A;  3GXA A;  3OD7 A;  4G8H A;  1A8F A;  4R72 A;  5HBC A;  3QAX A;  5AE4 A;  1AOV A;  3SET A;  3KC0 A;  4ZED A;  4KR5 A;  4OVQ A;  1TXF A;  3D1R A;  2XXP A;  1EYK A;  4YKP A;  4IR8 A;  4IO2 A;  4RK2 A;  3DP4 A;  4QF9 A;  1JQF A;  3W9V A;  2ANJ A;  1KA1 A;  4NWD A;  2B4L A;  2VPO A;  5ET6 A;  3FAT A;  1MQG A;  2CMO A;  4IGT A;  1FJ6 A;  3DLN A;  5DT6 A;  3USD A;  3O6G A;  3AXF A;  1UIU A;  1JEU A;  1YTV A;  4LZ7 A;  5TPA B;  2V3Q A;  2HPG A;  4PF8 A;  2I0C A;  2XHD A;  3TEL A;  1WDN A;  2DS9 A;  4H0W A;  1NV6 A;  3SEX A;  2Z8D A;  2P2A A;  2PT2 A;  4K3F A;  1B3H A;  3N94 A;  5K2X A;  4U21 A;  1L5T A;  4KI0 E;  2O7I A;  2DSF A;  4YKJ A;  2QS4 A;  4PFT A;  2XXT A;  1EU8 A;  2WYP A;  2G29 A;  1ZLQ A;  1IMA A;  4H45 A;  3FD3 A;  4N4U A;  1IIW A;  2X26 A;  5L9S A;  1IIT A;  2XA5 A;  1BTJ A;  3SDF A;  1NV3 A;  3RT6 B;  4XKN A;  2YLN A;  1B46 A;  2VGQ A;  1D4N A;  5BWJ A;  1TFD A;  3MVZ A;  4ZZA A;  3KEI A;  1JVY A;  4LUB A;  4U4S A;  1ATG A;  3DP8 A;  4TOZ A;  2A5T A;  3OXN A;  5I2N A;  3VLW A;  4LZ8 A;  1FW0 A;  1BIY A;  2H4I A;  5H8Q A;  2CZK A;  1SI0 A;  1AWB A;  3H06 B;  4PTK A;  4DI4 B;  1O64 A;  3UA8 A;  1B2H A;  3BBR A;  2DDK A;  4O3A A;  1N7X A;  2GH9 A;  4OFO A;  4QSD A;  3O6H A;  4R9G A;  4OWD A;  3HST A;  4QFO A;  3RTF B;  1II5 A;  3PUW E;  1DTZ A;  1Y20 A;  4AQ4 A;  3E79 A;  4O7M A;  1Y9U A;  1G0I A;  2WBD A;  3E13 X;  4GWX A;  2FIE A;  4THI A;  4H6D A;  4Q0C A;  3WAF A;  3CIJ A;  1A99 A;  1Q35 A;  3G3J A;  1N0T A;  2QJE A;  1AMF A;  4JXI A;  1IZ1 A;  3FAS A;  3SER A;  4G8N A;  2GHB A;  1ANF A;  2VD2 A;  4E0W A;  4KHZ E;  2R6G E;  3BFU A;  5I84 A;  3TTR A;  4FE8 A;  1O7T A;  1FPD A;  4HS7 A;  4RXL A;  3CI8 A;  4GRK A;  2Z8E A;  1A7L A;  4PAI A;  4KCC A;  2F35 A;  4KYE A;  4GL8 A;  4M4G A;  1NUZ A;  4R2B A;  4ND9 A;  3ILU B;  3TCH A;  3U65 A;  4N8Y A;  5CRY A;  4FAT A;  5JTY A;  3OOA A;  1IEJ A;  4FBP A;  5FBP A;  1SW4 A;  1DPE A;  4P47 A;  1B1X A;  4NF5 B;  4N91 A;  3MBP A;  4LQ2 A;  4AB6 A;  4I62 A;  3I3V A;  1MG1 A;  2XXV A;  3K1P A;  3EHS A;  2DE3 A;  3OSQ A;  4G68 B;  5T3J A;  3QUJ A;  4GWZ A;  3M3F A;  1AH5 A;  1GGG A;  5LTC A;  3M3K A;  3K6V A;  3KC1 A;  1IMD A;  4XKP A;  4N8G A;  3PPR A;  3FJ7 A;  5I56 B;  5I59 A;  1SBP A;  4AS4 A;  3E4R A;  3FBP A;  4GVO A;  4NF8 B;  4IGR A;  2R71 A;  3K1N A;  2V3U A;  2OJT A;  2DXY A;  4KXP A;  4PAK A;  2V3T A;  3ZS6 A;  1PBP A;  4IY6 A;  1B3E A;  4ZDM A;  5H8H B;  1A54 A;  1EH3 A;  3S9N C;  5F7V A;  2OZZ A;  3QK6 A;  3S9E A;  4OES A;  2HZK A;  2DXR A;  1LAH E;  2RC9 A;  2UYE A;  3IOV A;  2ONK E;  4POW A;  5EQA A;  1QVS A;  3TPA A;  1Q1K A;  4BDQ A;  4LZ5 A;  3IJO B;  2NUV A;  1N3W A;  1G0H A;  4QBA A;  1JW4 A;  1B6H A;  1NNP A;  1POT A;  1MQH A;  3C36 A;  2HQ0 A;  5TP9 A;  4N15 A;  1FPF A;  1MM7 A;  5CMM A;  1LAF E;  3TCG A;  3TEP A;  4IB2 A;  1NH8 A;  2ONR A;  3VV5 A;  1ZBM A;  1MPD A;  4OFJ A;  2F34 A;  1NL5 A;  2I4C A;  4WED A;  3LR1 A;  3ZSF A;  4YMB A;  1PDA A;  2ZYN A;  2DVC A;  4MCO A;  4NN3 A;  4X1D A;  1OVT A;  4F2Q A;  4OEN A;  1MY4 A;  1B3G A;  4RJZ A;  3MZ9 A;  4JVD A;  4JVI A;  1PC3 A;  1LST A;  1M5C A;  1YCJ A;  2ZZW A;  2R8T A;  3Q27 A;  5H8F B;  3B8B A;  3VXC A;  1H76 A;  4OTE A;  3PGF A;  4MX6 A;  3PUV E;  3T93 B;  3T22 A;  5KDT B;  2CEX A;  4F19 A;  1TT1 A;  4LN5 A;  1LEV A;  3U72 A;  2M8C A;  4XKQ A;  3BFT A;  3PPN A;  3K00 A;  4JVC A;  4N6K A;  1HSE A;  3RGY A;  2A5S A;  4U22 A;  2GHA A;  1GTK A;  2KQZ A;  3CFZ A;  3IJX B;  4ONY A;  2ZNS A;  2HAU A;  2XXI A;  4I9D A;  3IK6 B;  3EN3 A;  1MY2 A;  3B6T A;  1FPI A;  5CBS A;  1MXV A;  3KN7 A;  3TDJ A;  3OEL A;  3V8X B;  2QS3 A;  2PX1 A;  4H5G A;  2Q8M A;  4HE0 A;  3RN8 A;  2XX8 A;  3MUQ A;  3EKI A;  3HN0 A;  3VDF A;  3FXU A;  4ZE9 A;  1DPP A;  3C32 A;  3MP8 A;  4GX3 A;  4PBH A;  1FCK A;  3UOR A;  1LB9 A;  2F36 A;  1UTH B;  1SW5 A;  2E1S A;  4GWW A;  1P1U A;  3I5O A;  3R6U A;  5BUU A;  4FOR A;  3U93 A;  1LBY A;  1SQY A;  1H45 A;  1IXC A;  2ZYO A;  5I2N B;  5EQ9 A;  4PGN A;  3G3H A;  1FTO A;  3KGC A;  4R6H A;  3W9W A;  2G93 A;  3K6W A;  3MYU A;  5IZ3 A;  1M5D A;  4YB5 A;  4ZEK A;  3UP9 A;  4GWS A;  4DCY A;  3KSJ A;  2Z22 A;  1US5 A;  4YIC A;  2X7Q A;  3Q25 A;  3KBZ A;  5I5P A;  1ZIU A;  3PUX E;  1B7U A;  5DTB A;  3RTW B;  1R1N A;  3RPW A;  4F31 B;  1JEV A;  1P1O A;  1RDX A;  5CC2 A;  4MF3 A;  1RKM A;  2HHM A;  3N6T A;  3SEW A;  3MP6 A;  1QUI A;  5M2V A;  1LBV A;  3MWB A;  4WKM A;  2ESN A;  1B9J A;  3R26 A;  1FBD A;  4F3G A;  3OO9 A;  1URG A;  3F11 A;  3RYD A;  4O7I A;  2XWK A;  4ZEF A;  3TMG A;  1YAE A;  1D9V A;  4FEB A;  4YB6 A;  4I40 A;  3KN3 A;  3PTY A;  1IQ7 A;  2DWJ A;  4U4X A;  2AIX A;  4F29 A;  4X1B A;  5A5X A;  3FVO A;  4O94 A;  2XD2 A;  1N04 A;  2HZL A;  3T9V A;  5H8N A;  1NNT A;  2YPN A;  2F78 A;  3ODB A;  4QHQ A;  4IY5 A;  1POY 1;  1MPC A;  1A40 A;  4MJO A;  3E3K A;  3IO6 A;  4H46 A;  1XC1 A;  1K9Y A;  3CR9 A;  4Z7E A;  1NMU A;  5L9M A;  1B7H A;  1CE2 A;  4MLV A;  3FJM A;  1I69 A;  3EF7 A;  3QMF A;  4EQ9 A;  5JTY B;  2ZYK A;  1DMB A;  3TUS A;  5I57 A;  1YYZ A;  4GD5 A;  4YB7 A;  4ESW A;  3B6W A;  2R9J A;  1FBE A;  2Z23 A;  5I2K B;  1NUX A;  3MQ9 A;  1CB6 A;  4YU0 A;  2IEE A;  4OAN A;  1IME A;  1JW1 A;  1NH7 A;  3CFX A;  5FTH A;  2HCA A;  4UA8 A;  4MBP A;  4OVJ A;  4OEU A;  4GF8 A;  2H98 A;  5EYF A;  2Z8F A;  3OO6 A;  4KYD A;  1UIV A;  1NFT A;  1VFE A;  5CI5 A;  4OFL A;  1QW0 A;  1S9T A;  1FTA A;  3S4U A;  1B51 A;  3LV0 A;  4GQO A;  4GXA A;  4WEP A;  3OEN A;  1RDZ A;  3TAJ A;  4IO5 A;  3KN8 A;  4H5F A;  1B5I A;  2H25 A;  1SYH A;  1NI9 A;  4NX1 A;  1SVX B;  1FTM A;  5EHS A;  4C0R A;  2XWV A;  4XKR A;  2KLF A;  4JBZ A;  4QFP A;  4YMA A;  3SEY A;  5EYG A;  1P1W A;  4UAC A;  3IB2 A;  3IFC A;  3ONM A;  3HO7 A;  4QXD A;  5DVI A;  2Y5K A;  3MZB A;  4NED A;  3BIH A;  1B1H A;  1Y4C A;  3H6T A;  5ITO A;  4P11 A;  4XFE A;  1Y3P A;  4XTC Q;  1FPB A;  1N84 A;  2ALU A;  5B70 A;  4GX6 A;  2HFB A;  3B6Q A;  4PC9 A;  1P99 A;  3Q29 A;  3OO7 A;  4GWY A;  2PFZ A;  3TCF A;  3U8Q A;  2XWI A;  4N6D A;  4OER A;  2FNC A;  4LON B;  2P3V A;  4JWY A;  3CHG A;  2WYK A;  5IZ1 A;  1I6B A;  1ZKB A;  3LBS A;  1UQW A;  1YXI A;  3EHU A;  1JVX A;  3CG3 A;  2QMW A;  2V84 A;  2Q89 A;  4Q30 B;  1QUK A;  3ROJ A;  1D3K A;  4JSD A;  2QSX A;  3C35 A;  4NF4 A;  1OVB A;  4Q5T A;  2DE4 A;  1RYX A;  3OSR A;  4R73 A;  4WXJ A;  3L6G A;  3IX1 A;  5AA2 A;  4G77 A;  4UAB A;  1EZ9 A;  4R74 A;  3THI A;  1LGB C;  3Q28 A;  3N6U A;  2KR0 A;  4R75 A;  1NV0 A;  2GRV A;  3A09 A;  1HSJ A;  2ABH A;  2OWT A;  5EHM A;  3RY3 A;  1P1N A;  1US4 A;  5I7I A;  3M3L A;  4P3L A;  1DSN A;  3IOT A;  1LFH A;  4F1U A;  3PPO A;  1NV4 A;  1YPN A;  4OQO A;  3KOT A;  2QS1 A;  3RPL A;  4EF1 A;  1UTB A;  2Y84 A;  2VT5 A;  4PF6 A;  3C4M A;  2H9B A;  2O7U A;  1OLC A;  3O66 A;  4PBQ A;  4QSE A;  5I3S A;  2O1L A;  3H03 A;  3IB0 A;  3T66 A;  4R2F A;  4DDD A;  3A3C A;  4MMP A;  1MQJ A;  1IXG A;  1MPB A;  1FQA A;  3IR1 A;  3PPP A;  3S9M C;  3VVF A;  4DZ1 A;  3DM0 A;  3U1O A;  4JWO A;  4TQU Q;  2QFL A;  4LVQ A;  3CSG A;  4NG7 A;  3SKP A;  4AB5 A;  4Z0I A;  4N6P A;  2F3D A;  1MS7 A;  3MJN A;  5AA2 D;  1EZP A;  2I48 A;  3N26 A;  3FGS A;  5AA4 A;  3SZP A;  5IZ3 B;  2QVU A;  1MH3 A;  3TKD A;  2Q88 A;  4F22 A;  1NUW A;  3TQL A;  3JV9 A;  3LSL A;  4EXK A;  3K6U A;  4GBV A;  5IAI A;  4F3P A;  3PD8 A;  5DEX B;  1OQH A;  4DXB A;  2F7A A;  4JWX A;  3ISP A;  3PUZ E;  3U92 A;  4E0X A;  1H44 A;  4N07 A;  5FHM A;  1S50 A;  4HE2 A;  4H1X A;  3G3F A;  2Y7K A;  1B5H A;  1DCU A;  3IOR A;  5A5L A;  2F7C A;  3RUM A;  2HAV A;  2I0B A;  4O3C A;  4MFI A;  3K0V A;  2D21 A;  4PFY A;  5CBR A;  5CMB A;  1VE4 A;  4HW8 A;  3O97 A;  4NMY A;  5ET7 A;  4OZ9 A;  1CNQ A;  2Y7R A;  3QYT A;  2OCU A;  2Q8J A;  4DLD A;  3OEM A;  2CZH A;  1D9Y A;  4JDF A;  1BLF A;  1FBH A;  3FVG A;  5KCJ B;  4H8I A;  3PMX A;  5KZT A;  2XXU A;  4G68 C;  1VDW A;  1EZO A;  5ELV A;  5HM4 B;  2ZMB A;  4U2R A;  1WOD A;  3FVN A;  1INP A;  1LBZ A;  4EQB A;  3S2V A;  3HCQ A;  2QVV A;  3ZKK A;  4N17 A;  4DXC A;  1QUJ A;  1URS A;  3KBR A;  2XWO A;  3K01 A;  3FV2 A;  3G3G A;  2B3B A;  3GLB A;  1AIV A;  3TZA A;  1PEB A;  3HV1 A;  3M8U A;  4BDM A;  1B40 A;  1GV8 A;  1ELJ A;  4EF2 A;  3T0J A;  4GFR A;  1B7Z A;  3OEK A;  4U1Z A;  3TOD A;  1B5J A;  1MM6 A;  1PB9 A;  4NE4 A;  1ZMG A;  1FTL A;  3FZV A;  2O51 A;  5I58 A;  2UXA A;  2F5X A;  3LSW A;  2OK2 A;  3PD9 A;  1MXX A;  2L5V A;  3E9X A;  4G4P A;  3G7W A;  3SEU A;  1NV1 A;  4AS5 A;  2I3W A;  5ICT A;  2RIN A;  4RK9 A;  1NV7 A;  4HE1 A;  2UVJ A;  1BKA A;  1FQE A;  1EYI A;  3FJG A;  3QSL A;  5CMK A;  1I6A A;  4F1V A;  2FBP A;  4I8C A;  3U94 A;  2VHA A;  3V5A A;  4ZZE A;  4Q8R A;  1MXW A;  1FPE A;  1YZ0 A;  4G2Z A;  4RYA A;  3D4C A;  4XEQ A;  4QSC A;  4OHN A;  4ELO A;  2FA7 A;  3T9H B;  3UIF A;  2F97 A;  5F24 A;  1FSA A;  2DQV A;  4OVT A;  4QRZ A;  3VVE A;  1OLA A;  3T1B A;  2WBB A;  4R6K A;  1LAX A;  5EQ8 A;  1ZJL A;  2REG A;  3KSX A;  4EDP A;  3IAZ A;  3O28 A;  1LLS A;  4XF5 A;  1FQC A;  4FJP A;  4GX4 A;  2RC7 A;  4TLM B;  2AYS A;  1VFD A;  4NTL A;  1QGX A;  3TTK A;  4NF5 A;  3IB1 A;  2FIX A;  2A5T B;  2XXW A;  4NF6 A;  4RNS A;  1B4Z A;  3C31 A;  2ZNT A;  1XVY A;  1B32 A;  4YKK A;  4G68 A;  5DVF A;  1WVJ A;  5H8Q B;  1USY H;  2XD3 A;  1N76 A;  1H43 A;  4N13 A;  3PMW A;  1B0H A;  5I56 A;  4PDH A;  4MAG A;  2V93 A;  3I6V A;  3SES A;  3MZ1 A;  1SW2 A;  4HXV A;  2Q2A A;  1LBB A;  1Y1Z A;  2ZNU A;  4OVS A;  3IOU A;  3ILT B;  3HPI A;  4OET A;  3MAM A;  4DE8 A;  5H8H A;  1FPL A;  4OMB A;  2X7P A;  5AA2 B;  1FQF A;  4ZEI A;  3IO4 A;  3OMB A;  4BDN A;  4X9T A;  1H3D A;  1R9L A;  4ESX A;  5J16 A;  3LUZ A;  2GFE A;  4IO6 A;  3K1M A;  3C9H A;  1J1N A;  1IMC A;  1USY E;  1LCF A;  3IOW A;  1PB8 A;  3Q26 A;  3GZG A;  3FXR A;  5L8D A;  1ZU0 A;  2DWA A;  2O84 X;  1R6Z A;  1FQB A;  2W7Y A;  3FUZ A;  4ZS9 A;  3L6H A;  1FBF A;  4H67 A;  1UTB B;  1SPI A;  4PFI A;  4RPN A;  3GBA A;  1LBC A;  1JNF A;  1GVC A;  1BK4 A;  4PDD A;  5CMC A;  3TTL A;  5LDZ A;  4PE5 B;  1MXY A;  4IO4 A;  2XXH A;  1B52 A;  2NOO A;  2QL3 A;  3FIR A;  4IO7 A;  1LBW A;  3CFL A;  1MQD A;  2CEY A;  2AL5 A;  4KPT A;  3B50 A;  1MH4 A;  4NAP A;  3N5L A;  5EQ7 A;  5ISU A;  1B05 A;  2DVZ A;  3H6U A;  4F3S A;  2WX9 A;  5H8F A;  2OWZ A;  1XS5 A;  1DBZ A;  2F7B A;  2P3N A;  4GBW A;  5KDT A;  4DXU A;  3HFU A;  3BIG A;  3O2A A;  1LFG A;  5ET8 A;  1TFA A;  4L17 A;  5I59 B;  5AA4 B;  4LAT A;  4NF0 A;  4DCX A;  1IUD A;  4NQ8 A;  4EQ7 A;  2P1S A;  1N7W A;  1KZ8 A;  3MP1 A;  2Q74 A;  2OWS A;  3C34 A;  2O68 A;  4P0I A;  5ET5 A;  1NNF A;  3FVK A;  4F3B A;  5IZZ A;  4M1V A;  2NVU B;  3KJ7 A;  4F2O A;  5ESY A;  4GLI A;  2UVH A;  5IM2 A;  1P1Q A;  2ZYM A;  4QFK A;  2FVZ A;  2VOZ A;  3UK4 A;  2OBG A;  4XXU A;  2I4B A;  3PU5 A;  5TP9 B;  3PPQ A;  4GOT A;  2PVU A;  2XXQ A;  4PFU A;  4F1Y A;  4ZEC A;  4MIJ A;  3FXQ A;  2E0S A;  4FED A;  3JYR A;  2ONS A;  1OQG A;  2F3B A;  3GBB A;  3O6I A;  3TTN A;  2UYF A;  1B0L A;  1GR2 A;  1UTH A;  1QUL A;  3DP6 A;  4POX A;  4PET A;  4DIG A;  2F6G A;  3HHF A;  2B65 A;  1LFI A;  1FBG A;  3EPE A;  5FHO A;  3O29 A;  5FHN A;  2XX7 A;  3DEL B;  1FQD A;  4N81 A;  2FYI A;  4KD5 A;  3LSF B;  2DYX A;  1JP4 A;  2PFY A;  4RY1 A;  4GWU A;  3K4U A;  3VLU A;  4ISU A;  1Y1M A;  2D5W A;  5JK4 A;  1VR5 A;  5IKB A;  1A8E A;  3MPK A;  5I58 B;  1FPK A;  2ZXT A;  1XT8 A;  1LBX A;  2O6A A;  3P7I A;  1QKA A;  1RYO A;  3H6W A;  3T96 B;  4MNI A;  2XX9 A;  2H99 A;  1EYJ A;  3VVD A;  2B3F A;  3FV1 A;  2PCR A;  1FJ9 A;  3H6V A;  5DYH A;  2RC8 A;  4XIG Q;  4OVP A;  4BLA A;  1QJM A;  3W15 C;  2Y7W A;  2Y5L A;  4GXS B;  2NXO A;  1LCT A;  4YZZ A;  1Z7N E;  4OXV A;  2F8D A;  4H8J A;  2IA4 A;  4MNP A;  5JEI A;  4MEV A;  5AA3 A;  1HSL A;  1FBP A;  1XVX A;  2CZI A;  3K6X A;  3QXM A;  1FTJ A;  1IMB A;  2HEU A;  2HXR A;  4JB7 A;  5L9O A;  1A55 A;  4EUO A;  2UVG A;  3R7X A;  1NV2 A;  1FBC A;  4I3E A;  3MC2 A;  4PGP A;  3TQW A;  3VLV A;  4KQP A;  4YAH X;  4GWO A;  3G3I A;  3ECR A;  4C1U A;  2PMS A;  2H5Y A;  1FRP A;  4MLQ A;  2WEF A;  1SYI A;  4NF6 B;  4ZEB A;  1BP5 A;  1FPG A;  3KG2 A;  1Y3Q A;  5I2K A;  1XOC A;  3NOH A;  3K2D A;  3PV0 E;  4X04 A;  2AL4 A;  3VFJ A;  3T9U A;  2THI A;  2ZZV A;  2V4C A;  4OYV A;  3E78 A;  5TPA A;  1B58 A;  4BDO A;  1RDY A;  2GQ1 A;  3OO8 A;  3D4G A;  4P0G A;  4P56 A;  2B4M A;  2HXW A;  4GL0 A;  4LA9 A;  2XXK A;  3RT8 A;  1DTG A;  1MRP A;  4FIM A;  4BDR A;  4X8R A;  1KA0 A;  4NGU A;  4KFQ A;  1B3F A;  1D9Q A;  4PFW A;  2DP8 A;  4PFB A;  4PCD A;  2XXY A;  4ECF A;  1B3L A;  4MHF A;  2BJI A;  3T9X B;  1Y3N A;  3B7D A;  4JSO A;  3CVG A;  1IMF A;  3VE1 B;  2RCB A;  3ZKL A;  2JJK A;  1NV5 A;  1NUY A;  1R9Q A;  2FHY A;  5A5X B;  1MY1 A;  4YKI A;  1JET A;  3A29 A;  1DOT A;  5EYH A;  4TLL B;  3PUY E;  5H8N B;  3TTM A;  1QKB A;  4P1E A;  3RNN A;  3RQT A;  4P1L A;  2XXX A;  4G61 A;  2DE2 A;  5B7D A;  2QVR A;  4GIZ A;  1MY3 A;  1I6Q A;  5AA1 A;  3IFA A;  2CZL A;  2I58 A;  4P9K A;  3MW0 A;  3CG1 A;  2UVI A;  4LP2 B;  2F6P A;  1T0K A;  3LUY A;  2MKZ A;  5FTI A;  5I57 B;  2P0S A;  2VPN A;  3KZG A;  5LOM A;  1MY0 A;  3UGW A;  2Y7I A;  2NWJ A;  3KOS A;  4F39 A;  4QFL A;  3KFM A;  1S7Y A;  2VP1 A;  4LQ5 A;  4ELQ A;  3CRB A;  4H65 A;  3O9P A;  4OEV A;  4P8B A;  4MNC A;  2YJP A;  4PE3 A; 
#chains in the Genus database with same CATH homology
 2OX3 A;  2Y5K A;  2DE3 A;  5T3J A;  1FPJ A;  4GWZ A;  5J16 A;  3LUZ A;  3BIH A;  5J1D A;  5LTC A;  3KC1 A;  1IMD A;  4N8G A;  1IMC A;  4O8M A;  4XFE A;  4AS4 A;  3FBP A;  1FPB A;  4GX6 A;  3GYY A;  3MST A;  4PC9 A;  4GWY A;  2PFZ A;  4KXP A;  4PAK A;  1FBF A;  4PFI A;  1SPI A;  2XWI A;  4N6D A;  2P3V A;  1BK4 A;  3CHG A;  2WYK A;  4PDD A;  5IZ1 A;  5LDZ A;  4F18 A;  1YXI A;  1K9Z A;  1LBW A;  2HZK A;  2CEY A;  3ROJ A;  1DK4 A;  3B50 A;  5EQA A;  4NAP A;  5EQ7 A;  2DVZ A;  2DE4 A;  2WX9 A;  2OWZ A;  1G0H A;  4QBA A;  1DBZ A;  4UAB A;  2P3N A;  4GBW A;  3HFU A;  4N15 A;  1FPF A;  3BIG A;  5ET8 A;  4NF0 A;  2KR0 A;  5DW8 A;  1NV0 A;  4NQ8 A;  1KZ8 A;  2Q74 A;  2ZZX A;  5I7I A;  4P3L A;  4HCY A;  4F1U A;  4MCO A;  5ET5 A;  1NV4 A;  4NN3 A;  2Q9T A;  5IZZ A;  4M1V A;  3RPL A;  2VT5 A;  4PF6 A;  5ESY A;  4JVD A;  4JVI A;  1XI6 A;  4PBQ A;  5IM2 A;  2ZZW A;  5I3S A;  2R8T A;  2FVZ A;  3B8B A;  4DI3 D;  4MX6 A;  4OVR A;  4MMP A;  2CEX A;  1Q9D A;  4F19 A;  4LN5 A;  1LEV A;  4I3Y A;  4MIJ A;  4NHB A;  2QFL A;  4NG7 A;  2F3B A;  4JVC A;  2F3D A;  4N6K A;  4OA4 A;  4PAF A;  3SZP A;  4PFR A;  2QVU A;  5IZ3 B;  4PET A;  5CM6 A;  2KQZ A;  3RPL B;  3FXB A;  1NUW A;  4HCW A;  5IGA A;  1FBG A;  2QPQ A;  4GBV A;  4N81 A;  1FPI A;  3ISP A;  2PFY A;  1JP4 A;  4GWU A;  2Q8M A;  4HE0 A;  3KC0 A;  3EKI A;  4OVQ A;  3D1R A;  4HE2 A;  5JK4 A;  1EYK A;  1DCU A;  5A5L A;  4IR8 A;  1FPK A;  1LBX A;  4GX3 A;  3W9V A;  4PBH A;  4MNI A;  1KA1 A;  2B4L A;  2VPO A;  5ET6 A;  1EYJ A;  2PCR A;  1FJ9 A;  1FJ6 A;  5ET7 A;  1CNQ A;  4OVP A;  4GWW A;  2Y5L A;  2CZH A;  4YZZ A;  1FBH A;  2V3Q A;  1LBY A;  2HPG A;  4MNP A;  4MEV A;  4PF8 A;  5EQ9 A;  4PGN A;  1FBP A;  2CZI A;  1NV6 A;  1VDW A;  3W9W A;  3MYU A;  5IZ3 A;  1IMB A;  2HXR A;  1INP A;  1LBZ A;  4GWS A;  2QVV A;  4N17 A;  2XWO A;  1NV2 A;  1FBC A;  4YIC A;  4I3E A;  3KBZ A;  5I5P A;  4PGP A;  3T0J A;  2WYP A;  1RDX A;  1IMA A;  4H45 A;  2HHM A;  4N4U A;  1FRP A;  2XA5 A;  1LBV A;  2F5X A;  2WEF A;  1FBD A;  1NV3 A;  2L5V A;  1FPG A;  1NV1 A;  3RYD A;  4O7I A;  4AS5 A;  2XWK A;  3NOH A;  1NV7 A;  4X04 A;  4HE1 A;  4I40 A;  3PTY A;  1EYI A;  2ZZV A;  4F1V A;  2V4C A;  2FBP A;  3E78 A;  4O94 A;  2HZL A;  1RDY A;  2GQ1 A;  1FPE A;  1YZ0 A;  4P56 A;  2B4M A;  4XEQ A;  2XXK A;  2CZK A;  4X8R A;  1AWB A;  4MJO A;  4PTK A;  1KA0 A;  4H46 A;  5F24 A;  1FSA A;  1K9Y A;  4OVT A;  4DI4 B;  4NGU A;  1D9Q A;  3T1B A;  4PFB A;  4PCD A;  2WBB A;  3QMF A;  5EQ8 A;  2DDK A;  4MHF A;  2BJI A;  1YYZ A;  4XF5 A;  1IMF A;  1FBE A;  4GX4 A;  1NUX A;  2JJK A;  3E79 A;  4O7M A;  4OAN A;  1G0I A;  2WBD A;  4GWX A;  1IME A;  1NV5 A;  1QGX A;  2FIE A;  1NUY A;  2FIX A;  2FHY A;  3A29 A;  5EYH A;  4P1E A;  4P1L A;  4G61 A;  2DE2 A;  2QVR A;  3IFA A;  1FTA A;  4P9K A;  3LV0 A;  4PDH A;  4MAG A;  1FPD A;  1RDZ A;  2MKZ A;  4HXV A;  4PAI A;  2VPN A;  1NUZ A;  4NX1 A;  1NI9 A;  4OVS A;  3U65 A;  2XWV A;  4N8Y A;  1FPL A;  5FBP A;  4FBP A;  5EYG A;  4P47 A;  4P8B A;  4N91 A;  4MNC A;  4X9T A;  4PE3 A;  3IFC A;  4QXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...