2VD2A

The crystal structure of hisg from b. subtilis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
AMGKLLTMAMPKGRIFEEAAGLLRQAGYRLPEEFEDSRKLIIDVPEENLRFILAKPMDVTTYVEHGVADVGIAGKDVMLEEERDVYEVLDLNISKCHLAVAGLPNTDWSGVAPRIATKYPNVASSYFREQGEQVEIIKLNGSIELAPLIGLADRIVDIVSTGQTLKENGLVETEHICDITSRFIVNPVSYRMKDDVIDEMASRLSLVVEGET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP PHOSPHORIBOSYLTRANSFERASE
publication title The Crystal Structure of Hisg from B. Subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 52
structure length 212
sequence length 212
ec nomenclature ec 2.4.2.17: ATP phosphoribosyltransferase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01634 HisG ATP phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vd2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vd2A02
4GIZA 2R9JA 2DE4A 4UA8A 3D4GA 1B1HA 1GGGA 3MVXA 3TCFA 2P1SA 2O7UA 3PPRA 1B3EA 3K6UA 4YMBA 3VXCA 1OLAA 4FEDA 5HM4B 3I5OA 3N5LA 3T9UA 3HCQA 2XXVA 4ESXA 4GVOA 3T66A 3RT8A 1TFDA 4R75A 2BJJX 5I2NA 5L9SA 2PYYA 4MLQA 3FVOA 3O97A 3OSQA 2I6EA 3TQWA 1A7LA 1WVJA 3N26A 5I56A 4F3BA 3VLUA 3C35A 5I57A 3R6UA 4LZ5A 3G3KA 1OQGA 1BLFA 4WEPA 1DTGA 3LR1A 2D21A 5CI5A 1IUDA 5AA4A 2OK2A 1SYIA 3EHSA 3GBBA 3FV2A 4N13A 3ZS6A 3QK6A 5CC2A 1Z7ME 4POXA 4NWDA 1B5IA 1L5TA 3MZBA 2HZKA 3UK4A 4EQBA 3OENA 1VE4A 3OOAA 5JTYB 2I48A 4DIGA 2V3QA 2AIXA 1TWYA 1P1NA 3K4UA 4NEDA 3C9HA 3SEUA 3KSXA 1JQFA 4QHQA 2P0SA 4PE5B 4ZZAA 3TTLA 3KEIA 2KLFA 2A5TB 4NMYA 5TP9B 2DE2A 3PPNA 3L6GA 1WDNA 5H8QA 4IO7A 1EZPA 1SVXB 2WKYA 3D4CA 1Q35A 3KJ7A 5K2YA 1TXFA 1H3DA 2THIA 3OO9A 3T96B 4QRZA 4P11A 1MH3A 1OQHA 4IO3A 3OEMA 3TCGA 2O6AA 3B6WA 2XHDA 4NF4B 4KFQA 5A5XB 4F1UA 5DT6A 3JZJA 1DOTA 3O6GA 1A54A 1FTMA 3ZSFA 2R6GE 4DXBA 2PMSA 1Z7NE 3EPEA 4QF9A 4F39A 4OEVA 2O1LA 3A09A 1IEJA 2HEUA 1A55A 4XKRA 3VVFA 5ELVA 2B65A 4GF8A 3CG3A 4OXVA 2HQ0A 4IO6A 3OO7A 4XXUA 1URDA 4DCYA 1SDXA 5DVJA 2OLBA 1NH7A 2GH9A 2B3BA 1N3WA 2DWHA 4MLVA 4QFOA 1B6HA 1RYOA 3IJXB 1AIVA 5JK4A 1BTJA 3CR9A 3IJOB 2XXUA 5CMCA 4KCDA 3ZKLA 1YAEA 1GR2A 4OMBA 3A3CA 3TEPA 2GHBA 1Y1MA 4I9DA 3S9NC 3M3LA 4KPTA 3SETA 3ILUB 4IO4A 4GQOA 2NOOA 4X1BA 3H03A 2F6GA 1PB8A 3B6QA 3AXFA 4QFPA 2PVUA 1VFEA 3HSTA 1FQBA 1VSOA 3PUZE 1O63A 4NF6A 3MBPA 3OD7A 1LBBA 4BLAA 3FXRA 1AOVA 1JEVA 1EZOA 2ZMBA 4N6PA 3U8QA 1S9TA 1II5A 2ONKE 2F78A 5DVIA 3EF7A 4EQ7A 3RPWA 5TP9A 1JW5A 2DQVA 3E3KA 1Y20A 1I69A 5ISUA 1LCTA 2DYXA 5H8HB 2VGQA 3ECRA 3USDA 4KHZE 3M3KA 2AL4A 3C36A 4X9TA 1MY0A 3MAMA 4LATA 1B0HA 4H5GA 3PUXE 2ANJA 3V5AA 4QSCA 2R71A 1AH5A 3DLNA 2IA4A 2XD2A 1ZTYA 4F1VA 2OCUA 3UN6A 4IGTA 1RKMA 3MJNA 2G93A 3VV5A 1B46A 2DS9A 4PQJA 4O3AA 2REJA 3MWBA 2DP8A 3IB0A 1LGBC 5DEXA 3MPLA 1T0KA 3TTRA 4TQUQ 1MXYA 3K00A 3R7XA 2I0CA 5I2NB 5IKBA 1SD3A 4NF5B 3SEYA 1BIYA 4O3BA 4BDOA 3RY3A 1H45A 2B3FA 2F7BA 1URSA 2HAVA 3QIMA 3FGSA 3M3FA 1NNKA 5I56B 3PPOA 4G4PA 4LP2B 1US4A 1J1NA 5I57B 1EZ9A 4F2QA 2GRVA 3UP9A 3BKIB 3HHGA 3ZKKA 1IIWA 3U72A 5AA4B 4F2OA 3K02A 3FD3A 1PB7A 4KYSA 2RINA 4ZZEA 3DELB 4LZ8A 4ZEBA 2F35A 3TCHA 4E0XA 1SBPA 4DXUA 3I6VA 3DP4A 1SW5A 3IOWA 4FE8A 2DWIA 2GHAA 5ICQA 5FTIA 3T22A 1H76A 1XVYA 1MH4A 1XHYA 1N7XA 4JB7A 2NXOA 5LOMA 5FTHA 4F3PA 4OFJA 1IXIA 3F11A 5DYHA 1I6BA 3CFLA 3B7DA 4NE4A 1FTKA 2QMWA 4R9GA 4G68C 4ISUA 2V25A 4XKPA 3OO6A 4KYDA 4IO2A 5H8QB 1MM7A 5ITPA 1O7TA 4HW8A 1B0LA 1R9QA 1SW2A 2QS4A 4DLDA 3EQ1A 1M5CA 5F7VA 4R74A 3DP6A 4PETA 1HSLA 4O3CA 4GL8A 2H25A 1EU8A 4ZE9A 4PFUA 2HZLA 4RK9A 5B70A 3LC8A 1LSTA 1MXZA 3RNNA 4EUOA 1Y3PA 4OERA 5BUUA 1D9VA 4LQ5A 3QUFA 4RY1A 1I6QA 2DWJA 3RTWB 4DXCA 1IXCA 5JEIA 1B3GA 3CVGA 3N6UA 3U92A 3K6WA 1MXXA 1N76A 4OQOA 4FJPA 3UA8A 2RCAA 1Q1KA 1A40A 3TDJA 4AQ4A 3PMXA 1FQFA 2Z8FA 4NF5A 1ZKBA 4HTGA 1LAGE 3FV1A 4YMAA 3U93A 4YKPA 3BFTA 3JV9A 1ZIUA 1M5FA 1JNFA 2ABHA 2REGA 4F3SA 1O64A 2HXWA 2H5YA 3E9XA 1NH8A 4X48A 2O68A 4HCYA 5AA2A 4I8CA 2Y7KA 3T9HB 5CMKA 3G7WA 1PB9A 1OMPA 4RPNA 2Q89A 2H9BA 3TKDA 4NF6B 4OENA 1MY1A 2XX9A 5J1DA 3WAFA 2CZLA 4Q5TA 3EHTA 2E1SA 1MDQA 3FJMA 4THIA 3SERA 2F97A 4I62A 4IY5A 2XXQA 2DE3A 4RPOA 4F22A 2XXIA 5DTBA 3FVNA 4OHNA 3FVKA 1I6AA 3H6VA 3FXQA 2YPNA 2XXWA 1Y1ZA 2AL5A 4JXIA 1MQDA 2O69A 2Z23A 1N84A 3TTKA 3C32A 4IGRA 3V89B 2XXTA 3KZGA 1JEUA 2OZZA 2OWSA 2H4IA 3Q28A 3ILTB 3ODBA 1S50A 1B58A 3OO8A 3QYTA 1DTZA 4GFRA 2FNCA 4DE8A 4FAJA 2FYIA 3CRBA 1VFDA 4U4SA 3KFMA 4Z0IA 4YKIA 3TQLA 3DM0A 2F5XA 5DEXB 3BFUA 4KQPA 3KN7A 3GLBA 1LCFA 2ONRA 3FASA 4JSDA 3O28A 4POWA 2VP1A 4F1YA 4EQ9A 1OVTA 3HO7A 1MM6A 1ZBMA 1FQAA 4XKNA 1NMUA 1B3LA 3B6TA 3KOSA 2QSXA 1MPCA 3T9XB 4JWYA 1M5BA 1B52A 2I0BA 3G3FA 1DMBA 5EHSA 1YTVA 2XD3A 2Y7PA 5EHMA 5CMMA 4BDRA 3MW0A 2XXXA 2F7CA 3PUWE 3IO6A 1MXWA 3TAJA 2QRYA 1HSEA 4Q8RA 2G29A 1ZLQA 1ATGA 4XTCQ 2X7PA 4GWOA 3G3GA 3IOTA 2DSFA 4MBPA 4R9FA 2YJPA 4AB5A 1N04A 3H4ZA 3MVYA 1PBQA 5AA3A 2UXAA 1RYXA 2ONSA 3H3GA 2F34A 1UTHA 1IZ1A 3T9VA 3KGCA 2PX1A 1MXUA 2RCBA 3E13X 1XVXA 4LQ2A 5K2XA 1ZJLA 2UYFA 2RC8A 5H8NB 1UQWA 5L8DA 4H67A 4XKQA 3MZ9A 3IK6B 2P2AA 1DPEA 3PPPA 1LAHE 1VR5A 2Q2AA 1ELJA 1P1OA 4LVQA 1UIVA 4UACA 3CFXA 4ELQA 4KI0E 4IY6A 5HBCA 3S2VA 4WKMA 2OBGA 4E0WA 3KJTA 1NNPA 1URGA 2HFBA 4NF8A 4IB2A 3Q27A 4G77A 3CIJA 3N94A 1SW4A 4R73A 4FORA 2ZXTA 4M1VA 2F7AA 2V3TA 3TODA 4PFYA 1FTLA 4GRKA 4G8NA 2F36A 1IITA 1MQJA 4PP0A 4DZ1A 4F18A 1B40A 4C0RA 4QSEA 5DVFA 1MXVA 1NFTA 2V3UA 1MS7A 4R6HA 5CMBA 1NL5A 1MQHA 1XC1A 3PUYE 4ZEKA 3MVZA 1JVYA 4OWDA 1LB8A 1A99A 4GOTA 4F29A 5CRYA 3U1OA 4EF1A 4YICA 4F31B 3RQTA 1GV8A 1UTBA 3RN8A 3O9PA 5KZTA 4YB5A 3FIRA 1F9BA 5TPAB 2Y7WA 3PU5A 4U2RA 5H8FA 3IORA 2ZNUA 2ZYOA 3KN3A 4OFOA 1GVCA 1M5EA 2ZYNA 5AA2B 4QSDA 3PMVA 2F6PA 4ZECA 4Q0CA 1B3HA 4KYEA 1P99A 2Q9TA 5FHMA 3G3HA 2RF1A 1R9LA 4XIGQ 1JVXA 1QJMA 2UVJA 2FA7A 3HPIA 3PUVE 1HSJA 1N0TA 2PT1A 4G68A 4G8MA 4HS7A 4ND9A 1A8FA 2Z22A 3QXMA 3TPAA 1B1XA 4OZ9A 4U1OA 5H8NA 4FECA 2V93A 2Y7RA 1LFGA 3MP6A 1JW1A 3IR1A 2CMOA 3PV0E 5HPQA 3O66A 3W15C 3H6TA 2H98A 1SI0A 2XXYA 1QULA 1FQDA 3HHFA 1B05A 3FXUA 1B5HA 2I4CA 1XOCA 3RLFE 4G2ZA 4QFNA 4RK2A 3RUMA 3PD9A 1USYH 3IB1A 3PD8A 2ZYMA 4GD5A 1PEBA 5AA1A 1NKXA 1SI1A 1B9JA 3VLVA 5I2KB 4TLLB 2Q88A 1M5DA 5L9MA 2I58A 4K3FA 4ZEDA 3S9EA 2QJEA 3QSLA 2Y84A 2DVZA 3IOUA 3A3UA 2XXRA 5KDTA 4U21A 1B2HA 3Q25A 4FIMA 3P7IA 4TLMB 2UVIA 3C31A 4JWOA 1SQYA 2HCAA 5KCJA 1Y4TA 4RJZA 3K2DA 3T93B 1B5JA 2W7YA 1B7UA 3N6TA 1UIUA 4HCWA 4C1TA 2XXPA 3EN3A 1TFAA 3VLWA 3G3IA 4H6DA 4NTLA 5I59A 1D9YA 1Y9UA 4QFKA 4DDDA 3MQ9A 5TPAA 3RT6B 4OYVA 4H5FA 4R2FA 1MDP1 4KD5A 3V8XB 3KOTA 4EXLA 1MY3A 3UORA 1IQ7A 3H6UA 3KSJA 1FW0A 1B32A 4IO5A 3O6HA 3VDFA 1FTJA 3R26A 2QPQA 3RTFB 1SYHA 5TU0A 4ECFA 3OXNA 2VD2A 2NVUB 3KG2A 2GFEA 5I58A 5L9OA 1FQEA 4ZDMA 1UTHB 1LB9A 4JSOA 3SEVA 1LBCA 2QS3A 1B4ZA 3K6XA 1ZU0A 4ZEIA 1B51A 1DPPA 2X26A 5BWJA 4BDLA 1Y3QA 4H65A 5B7DA 4WEDA 3LSFB 3KN8A 1D4NA 4U23A 2E0SA 4FATA 1Y4CA 1AMFA 3M8UA 1CB6A 2V84A 1ANFA 4LA9A 3OSRA 3K01A 4RNSA 2RC9A 2H99A 2M8CA 1BP5A 1MRPA 3LSWA 5H8SA 3SKPA 1POTA 4JWXA 3MVWA 1D3KA 3LSLA 4F19A 2Q8JA 3VVDA 4H8IA 4YB7A 3MZ1A 3C33A 2IEEA 5FHOA 1MG1A 4NF8B 2Y7IA 3O29A 4ZE8A 5F1QA 4RXLA 3EHUA 4LZ7A 1QUJA 2RKMA 4RA1A 5I2KA 3CFZA 3SESA 3PPQA 3UIFA 4OESA 1IXGA 3CI8A 3VVEA 3TZAA 4MFIA 4OVJA 4ELOA 2DOJA 3IOVA 3O2AA 4LUBA 3CG1A 4JBZA 3MP1A 1B7HA 3O6IA 1MQGA 3LUYA 4ZEFA 3FZVA 4TOZA 1P1WA 2ZNSA 4BDQA 1QW0A 4MF3A 1H44A 1MPBA 1UTBB 3PGFA 1S7YA 1A8EA 1P1QA 4EDPA 4KCCA 2Q2CA 3SEWA 1LFIA 4WXJA 1ZMGA 5H8FB 1LFHA 1H43A 1YPNA 4ELRA 1PDAA 5AA2D 5I84A 1JETA 2UYEA 4C1UA 2LAOA 4YKKA 4R6KA 3Q26A 1N3XA 2I49A 1FTOA 4ONYA 3HN0A 2DVCA 3SDFA 4EXKA 1JW4A 3IAZA 4BDNA 4G8HA 1CE2A 4GXAA 5CM6A 3UGWA 2F8DA 3DP8A 3IL1B 2O84X 1MPDA 3I3VA 4P0GA 4G68B 4GLIA 3H06B 3QAXA 3FJ7A 2HAUA 1AL3A 4GXSB 2DXRA 1Y3NA 4KR5A 1EH3A 3OELA 1R1NA 4JDFA 4LONB 5JTYA 2O7IA 3IX1A 4BDMA 3S9LC 3VE1B 1QUKA 5AE4A 3TYHA 2A5TA 2Z8DA 4YB6A 2NWJA 2A5SA 1TT1A 4YZZA 4U22A 1NNTA 4F3GA 3K1MA 2QS1A 2O1MA 3TTMA 4OEUA 3CSGA 2XXHA 3K1PA 3K1NA 2ESNA 4OFLA 4YKJA 2I3VA 2ALUA 3THIA 3K6VA 3U94A 3MP8A 1LLSA 4QFLA 2I3WA 1MY2A 4H0WA 1XT8A 4NF4A 3RGYA 4RYAA 4M4GA 4R2BA 4R72A 5A5XA 2VD3A 5KDTB 3GZGA 5M2VA 1B7ZA 3QUJA 2UVHA 2VOZA 5KCJB 2VHAA 1DSNA 3FVGA 5FHNA 1FQCA 1SW1A 1QVSA 1PC3A 3Q29A 1R6ZA 4PFWA 3FJGA 3TUSA 3CSBA 5I59B 2NUVA 2OWTA 2ZNTA 1BKAA 3W9WA 1WODA 2I4BA 4NWCA 4AB6A 4DCXA 3MUQA 4P0IA 3C34A 2PT2A 4MH5A 2QS2A 1QKAA 3FUZA 5ITOA 3TELA 3H6WA 5CBSA 3W9VA 3IB2A 2RC7A 3PMWA 4ELPA 1US5A 4H8JA 2AYSA 2DXYA 1OIBA 3WAEA 1YCJA 4EF2A 1MQIA 2DWAA 4YAHX 2QMXA 2YLNA 3MPKA 4H1XA 2O51A 5I58B 1USYE 2ZYKA 4R6YA 4FEBA 3V83A 3HV1A 1B4HA 3C4MA 1NNFA 3VXBA 3L6HA 3VFJA 3SEXA 1N7WA 2XX8A 2X7QA 2UVGA 3GXAA 1FCKA 4I1DA 1B3FA 3LBSA 4GL0A 4YU0A 4U1ZA 1MY4A 4X1DA 2D3IA 5ICTA 3FATA 2D5WA 4ZS9A 3OMBA 3KBRA 3TFLA 1POY1 1OVBA 3K0VA 5IAIA 4U4XA 3IO4A 3JYRA 2XX7A 4N07A 1QUIA 4OETA 3OEKA 3S4UA 4L17A 1P1UA 2OJTA 3E4RA 1XS5A 5CBRA 2QL3A 3S9MC 3MC2A 1LAFE 5H8HA 2Z8EA 3GBAA 1KWHA 3BBRA 4Q30B 1OLCA 3G3JA 2PBWA 5EYFA 3ONMA 1GTKA 4ESWA 3TTNA 3LSXA 1PBPA 4OTEA 3TMGA 4PFTA 4Z7EA 1LAXA 3H7MA 1IXHA 1QKBA
chains in the Genus database with same CATH superfamily
4GIZA 2CZKA 2R9JA 2DE4A 4UA8A 3D4GA 1B1HA 1GGGA 3MVXA 3TCFA 2P1SA 2O7UA 3PPRA 1B3EA 3K6UA 4YMBA 3VXCA 1DBZA 1OLAA 4FEDA 5HM4B 1EYIA 5EQAA 3I5OA 3ROJA 3N5LA 3T9UA 3HCQA 2XXVA 4ESXA 4GVOA 3T66A 3RT8A 4O7MA 1TFDA 2QFLA 2BJJX 4R75A 5ESYA 2QVVA 5I2NA 2FHYA 5L9SA 2PYYA 4MLQA 3FVOA 3O97A 1K9ZA 3OSQA 2I6EA 3TQWA 1A7LA 1WVJA 3N26A 5I56A 4F3BA 3VLUA 3C35A 2WYPA 5I57A 3R6UA 4LZ5A 3G3KA 1OQGA 1BLFA 4WEPA 1NI9A 1DTGA 3LR1A 1KZ8A 2D21A 5CI5A 1IUDA 5AA4A 2OK2A 1SYIA 3EHSA 3GBBA 3FV2A 4N13A 3ZS6A 3QK6A 5CC2A 1Z7ME 4POXA 4NWDA 1B5IA 4MAGA 4GWXA 1L5TA 3MZBA 2HZKA 3MSTA 3UK4A 4EQBA 3OENA 1VE4A 3OOAA 5JTYB 2I48A 4DIGA 2V3QA 2AIXA 3QMFA 1TWYA 1P1NA 3K4UA 4NEDA 3C9HA 3SEUA 1YXIA 3KSXA 1FJ6A 1JQFA 4QHQA 2P0SA 4PE5B 4ZZAA 2B4MA 4N91A 2KQZA 3TTLA 3KEIA 2KLFA 2A5TB 2F3DA 4NMYA 5TP9B 4PAKA 2DE2A 3PPNA 3L6GA 3LV0A 1WDNA 4JVDA 5H8QA 4IO7A 1EZPA 1SVXB 2WKYA 3D4CA 1Q35A 3KJ7A 5K2YA 1TXFA 4NN3A 1H3DA 2THIA 4AS5A 3OO9A 1LEVA 3T96B 4QRZA 4P11A 3D1RA 1MH3A 1OQHA 4NG7A 4IO3A 3OEMA 3TCGA 2O6AA 3B6WA 2XHDA 4NF4B 4FBPA 4KFQA 5A5XB 4F1UA 5DT6A 3JZJA 1DOTA 3O6GA 1A54A 2FBPA 1FTMA 3ZSFA 2R6GE 4DXBA 2PMSA 1Z7NE 3EPEA 4PF8A 4QF9A 4F39A 4OEVA 2O1LA 2PFZA 3A09A 1IEJA 2HEUA 1A55A 4XKRA 3LUZA 4P1EA 3VVFA 5ELVA 2B65A 4GF8A 4PFBA 4NX1A 4G61A 1IMEA 3CG3A 4OXVA 2HQ0A 4IO6A 4PF6A 3OO7A 4XXUA 1URDA 4DCYA 1SDXA 5DVJA 2OLBA 1NH7A 2GH9A 2B3BA 1N3WA 2DWHA 4MLVA 4QFOA 5J16A 1B6HA 1RYOA 3IJXB 1AIVA 5JK4A 1BTJA 3CR9A 3IJOB 2XXUA 5CMCA 1Q9DA 4N15A 2PCRA 4KCDA 3ZKLA 1YAEA 1GR2A 4OMBA 4H45A 3A3CA 3TEPA 2VT5A 2GHBA 4N81A 1Y1MA 4I9DA 3S9NC 3M3LA 4KPTA 3SETA 3ILUB 4HE0A 4IO4A 4GQOA 2NOOA 4X1BA 3H03A 2F6GA 1PB8A 3B6QA 3AXFA 1NUWA 4QFPA 2PVUA 1VFEA 3HSTA 1FQBA 1VSOA 3PUZE 1O63A 1BK4A 4NF6A 3MBPA 3OD7A 1LBBA 2FVZA 4BLAA 3FXRA 1AOVA 1JEVA 1EZOA 3U65A 2ZMBA 4N6PA 3U8QA 4GWZA 2FIXA 1S9TA 1II5A 2ONKE 4OANA 2F78A 5DVIA 3EF7A 4EQ7A 5IZ1A 3RPWA 2CEXA 5TP9A 1JW5A 2DQVA 3E3KA 1Y20A 1I69A 5ISUA 1LCTA 5ET6A 2DYXA 5H8HB 2VGQA 3ECRA 4HXVA 3USDA 4KHZE 3M3KA 2AL4A 3C36A 4X9TA 1FPDA 1MY0A 1IMFA 3MAMA 4LATA 1B0HA 4H5GA 3PUXE 2ANJA 3V5AA 4QSCA 2R71A 1AH5A 4NGUA 1JP4A 3DLNA 2IA4A 2XD2A 4OA4A 1ZTYA 4F1VA 2HHMA 2OCUA 3UN6A 4IGTA 1RKMA 3MJNA 5EQ7A 2G93A 4IR8A 3VV5A 4MX6A 3EKIA 1B46A 2DS9A 4PQJA 4O3AA 2REJA 3MWBA 2DP8A 3IB0A 1LGBC 5DEXA 3MPLA 1T0KA 3TTRA 4TQUQ 1MXYA 3K00A 3R7XA 4NF0A 2I0CA 5I2NB 5IKBA 2CZIA 1SD3A 4NF5B 3SEYA 1BIYA 4O3BA 4BDOA 3RY3A 1H45A 4JVCA 2B3FA 2F7BA 1URSA 2HAVA 3QIMA 3FGSA 3M3FA 1NNKA 5I56B 3PPOA 1CNQA 4G4PA 4MJOA 4LP2B 1US4A 1J1NA 5EYHA 1FPKA 5I57B 1EZ9A 2Q74A 4F2QA 2GRVA 3UP9A 3BKIB 3HHGA 3ZKKA 1IIWA 1FBHA 3U72A 5AA4B 1EYJA 4F2OA 3K02A 3FD3A 1PB7A 4KYSA 2RINA 4ZZEA 3DELB 4LZ8A 4ZEBA 2F35A 3TCHA 4E0XA 1SBPA 4DXUA 3I6VA 3DP4A 1SW5A 3IOWA 4FE8A 2DWIA 4QBAA 2GHAA 4GX6A 5ICQA 5FTIA 3T22A 1H76A 1XVYA 1MH4A 1XHYA 3GYYA 1N7XA 4JB7A 2NXOA 5LOMA 5FTHA 4F3PA 4OFJA 1IXIA 3F11A 5DYHA 1D9QA 1I6BA 3CFLA 3B7DA 4NE4A 4OVSA 1FTKA 2QMWA 4R9GA 4G68C 4ISUA 2V25A 4O94A 4XKPA 3OO6A 4KYDA 4IO2A 5H8QB 1MM7A 5ITPA 1O7TA 4HW8A 1B0LA 1R9QA 1FBDA 4NAPA 1SW2A 2QS4A 4DLDA 3EQ1A 1M5CA 4H46A 5F7VA 4R74A 3DP6A 3B8BA 4PETA 1HSLA 4O3CA 4GL8A 2H25A 1EU8A 4ZE9A 4PFUA 2HZLA 4RK9A 5B70A 3LC8A 1LSTA 1MXZA 2WYKA 3RNNA 4EUOA 1Y3PA 2WX9A 4OERA 5BUUA 1D9VA 4LQ5A 1FPJA 3QUFA 2Q8MA 4RY1A 1I6QA 5IZ3A 2DWJA 4I3EA 3RTWB 4DXCA 1IXCA 5JEIA 3IFAA 1B3GA 3CVGA 3N6UA 3U92A 3K6WA 1MXXA 2P3NA 1N76A 1FTAA 4OQOA 4FJPA 3UA8A 2RCAA 1Q1KA 1A40A 4N8GA 3TDJA 4AQ4A 3PMXA 1FQFA 2Z8FA 4NF5A 1ZKBA 4XEQA 4PAIA 4HTGA 1LAGE 2R8TA 3FV1A 4YMAA 3U93A 4YKPA 2OX3A 4P47A 5EQ8A 3BFTA 3JV9A 1ZIUA 1M5FA 1JNFA 2ABHA 2REGA 2CEYA 4F3SA 1O64A 2HXWA 2H5YA 3E9XA 1NH8A 4X48A 3RYDA 4OVQA 2O68A 4HCYA 1RDXA 5AA2A 4I8CA 2Y7KA 3T9HB 5CMKA 3G7WA 1PB9A 2XA5A 1OMPA 4RPNA 2Q89A 2H9BA 3TKDA 1G0IA 4NF6B 2XWOA 4OENA 1MY1A 4GWUA 2XX9A 4I3YA 5J1DA 3WAFA 2CZLA 4Q5TA 3EHTA 2E1SA 1MDQA 3FJMA 4THIA 3BIGA 1IMBA 2ZZXA 3SERA 2F97A 4I62A 4MNIA 4PFRA 4IY5A 4P3LA 2XXQA 2DE3A 4RPOA 4F22A 2XXIA 5DTBA 3FVNA 4OHNA 3FVKA 1I6AA 1FPGA 2PFYA 3H6VA 3FXQA 2YPNA 2XXWA 1Y1ZA 2AL5A 4JXIA 1MQDA 2O69A 2Z23A 4LN5A 4UABA 1N84A 3TTKA 4GBWA 3C32A 4IGRA 3V89B 2XXTA 3KZGA 1JEUA 2OZZA 2OWSA 2H4IA 3Q28A 3ILTB 3ODBA 1S50A 4XF5A 1DCUA 1B58A 3OO8A 3QYTA 1DTZA 4GFRA 2HPGA 2FNCA 4DE8A 1NV2A 4FAJA 2FYIA 3CRBA 1VDWA 1VFDA 4U4SA 3KFMA 4Z0IA 4YKIA 3TQLA 3DM0A 1EYKA 5I5PA 2F5XA 5DEXB 3BFUA 4KQPA 3KN7A 1NUYA 3GLBA 1LCFA 2ONRA 3FASA 4JSDA 3O28A 1RDZA 2VP1A 4POWA 4F1YA 4EQ9A 1OVTA 3HO7A 1MM6A 1AWBA 1FQAA 1ZBMA 4XKNA 1NMUA 1B3LA 3B6TA 3KOSA 2QSXA 1MPCA 3T9XB 4JWYA 3T0JA 1M5BA 1B52A 2I0BA 3G3FA 1DMBA 5EHSA 1YTVA 2XD3A 2Y7PA 5EHMA 4PAFA 5CMMA 1FPBA 4BDRA 3MW0A 2XXXA 2F7CA 3SZPA 3PUWE 3IO6A 1MXWA 3TAJA 2QRYA 1HSEA 1G0HA 2QVUA 4Q8RA 2DDKA 2G29A 1ZLQA 1ATGA 4XTCQ 4MNPA 2X7PA 4GWOA 3G3GA 3IOTA 4DI4B 2DSFA 4MBPA 4R9FA 2YJPA 4AB5A 1N04A 3H4ZA 3MVYA 1PBQA 5AA3A 2UXAA 1RYXA 1IMAA 2ONSA 4GX4A 3H3GA 2F34A 1UTHA 4PBHA 1IZ1A 3T9VA 3KGCA 2PX1A 2P3VA 1MXUA 2RCBA 4P8BA 3E13X 4GWWA 1XVXA 4LQ2A 5K2XA 1ZJLA 2UYFA 2RC8A 5H8NB 1UQWA 5L8DA 4H67A 3KC1A 4XKQA 3PTYA 3MZ9A 3IK6B 2P2AA 1DPEA 1NV6A 3PPPA 1LAHE 1VR5A 2Q2AA 1ELJA 1P1OA 4LVQA 1NUZA 1UIVA 4UACA 3CFXA 4ELQA 4KI0E 4IY6A 5HBCA 2XWVA 3RPLB 3S2VA 1RDYA 4WKMA 2OBGA 4E0WA 3KJTA 1NNPA 2QVRA 1URGA 2HFBA 4NF8A 4IB2A 3Q27A 4G77A 3CIJA 3N94A 1SW4A 4R73A 4FORA 1FRPA 5IZ3B 2ZXTA 4M1VA 2F7AA 2V3TA 3TODA 4PFYA 1FTLA 4GRKA 4G8NA 2F36A 1IITA 1MQJA 4I40A 4PP0A 4DZ1A 4F18A 1B40A 4C0RA 4QSEA 5DVFA 1MXVA 1NFTA 2V3UA 1MS7A 4R6HA 5CMBA 1NL5A 1MQHA 1XC1A 3PUYE 4MEVA 4ZEKA 3MVZA 1JVYA 4OWDA 1LB8A 1A99A 4GOTA 4F29A 5CRYA 4GBVA 3U1OA 4EF1A 4YICA 4F31B 3RQTA 1GV8A 1UTBA 1FBEA 3KC0A 3RN8A 5I7IA 3O9PA 5KZTA 4YB5A 3FIRA 1F9BA 5TPAB 2Y7WA 3PU5A 4U2RA 5H8FA 3IORA 2ZNUA 2ZYOA 3KN3A 4OFOA 1GVCA 1IMCA 1M5EA 3BIHA 2ZYNA 5AA2B 1XI6A 2ZZWA 4QSDA 3PMVA 2F6PA 4ZECA 4Q0CA 1B3HA 4KYEA 1P99A 2Q9TA 5FHMA 1FPLA 3G3HA 2RF1A 1R9LA 4XIGQ 1JVXA 1QJMA 2UVJA 2FA7A 3HPIA 3PUVE 1HSJA 1N0TA 2PT1A 4G68A 4G8MA 4HS7A 4ND9A 1A8FA 2Z22A 3A29A 3QXMA 3TPAA 1B1XA 4OZ9A 4U1OA 4PE3A 5H8NA 4FECA 3FBPA 2V93A 2Y7RA 1LFGA 4PGNA 3IFCA 3MP6A 1JW1A 3IR1A 2CMOA 3ISPA 2V4CA 3PV0E 5HPQA 3O66A 3W15C 3H6TA 2H98A 1SI0A 5DW8A 2XXYA 4PBQA 1QULA 3RPLA 1FQDA 3HHFA 1B05A 3FXUA 2FIEA 1B5HA 2I4CA 4QXDA 1XOCA 3RLFE 4G2ZA 4QFNA 5ET5A 4RK2A 3RUMA 3PD9A 1USYH 3IB1A 3PD8A 2ZYMA 5IM2A 4GD5A 1PEBA 5AA1A 1NKXA 1SI1A 1B9JA 3VLVA 5I2KB 4TLLB 2Q88A 1M5DA 5L9MA 2I58A 4K3FA 4ZEDA 3S9EA 2QJEA 3QSLA 2Y84A 2DVZA 3IOUA 3A3UA 2XXRA 4PDHA 5KDTA 1FPIA 1B2HA 4U21A 3Q25A 2OWZA 4FIMA 3P7IA 4TLMB 2UVIA 3C31A 4JWOA 1SQYA 2HCAA 2Y5LA 5KCJA 1Y4TA 4RJZA 3K2DA 3T93B 1B5JA 2W7YA 1LBZA 1B7UA 3N6TA 1UIUA 4HCWA 4C1TA 2XXPA 3EN3A 1TFAA 4H6DA 3G3IA 4NTLA 3VLWA 5I59A 1D9YA 1Y9UA 4QFKA 4DDDA 3MQ9A 1NV3A 5TPAA 3RT6B 3T1BA 4OYVA 4H5FA 4R2FA 5IGAA 1MDP1 4KD5A 3V8XB 3KOTA 5LDZA 4EXLA 1MY3A 3UORA 1IQ7A 3H6UA 3KSJA 1FW0A 1B32A 4IO5A 3O6HA 3VDFA 1FTJA 3R26A 2QPQA 3RTFB 1NV1A 1SYHA 5TU0A 2JJKA 2F3BA 4ECFA 4X8RA 3OXNA 1IMDA 2VD2A 2NVUB 3KG2A 2GFEA 5I58A 5L9OA 1FQEA 4P56A 1UTHB 4ZDMA 1LB9A 4JSOA 3SEVA 1LBCA 2QS3A 1B4ZA 3K6XA 1ZU0A 4ZEIA 1B51A 1DPPA 2L5VA 2X26A 5BWJA 4BDLA 1Y3QA 4H65A 4AS4A 5B7DA 2Y5KA 4WEDA 3LSFB 3KN8A 1D4NA 4U23A 4N17A 1NV4A 2E0SA 4FATA 1Y4CA 1AMFA 3M8UA 1CB6A 2V84A 1ANFA 4LA9A 3OSRA 3K01A 4GWYA 4RNSA 2RC9A 2H99A 1FBCA 2M8CA 4XFEA 2MKZA 1BP5A 1MRPA 2HXRA 3LSWA 5A5LA 5H8SA 3SKPA 1POTA 4JWXA 3NOHA 3MVWA 1D3KA 3LSLA 5EYGA 4F19A 2Q8JA 3VVDA 4H8IA 4NQ8A 3MZ1A 4YB7A 2BJIA 3C33A 2IEEA 5FHOA 1MG1A 4NF8B 2Y7IA 3O29A 4ZE8A 5F1QA 4RXLA 4PCDA 3EHUA 4LZ7A 1QUJA 3E78A 4O7IA 2RKMA 4RA1A 5I2KA 3CFZA 3SESA 3PPQA 1KA0A 3UIFA 4OESA 1IXGA 3CI8A 3VVEA 3TZAA 4MFIA 4OVJA 5FBPA 4ELOA 4MIJA 1DK4A 5ET8A 1YZ0A 2DOJA 3IOVA 3O2AA 4LUBA 1FPEA 3CG1A 4JBZA 3MP1A 1B7HA 3O6IA 1MQGA 3LUYA 4ZEFA 3FZVA 4TOZA 1P1WA 2ZNSA 5ET7A 4BDQA 5T3JA 1QW0A 4MF3A 1H44A 3E79A 1MPBA 1UTBB 4N4UA 3PGFA 1S7YA 1FSAA 1A8EA 1P1QA 4EDPA 4KCCA 2Q2CA 3SEWA 4MCOA 1LFIA 4WXJA 1ZMGA 5H8FB 1LFHA 1H43A 1YPNA 4GX3A 4ELRA 1PDAA 5AA2D 5I84A 1JETA 2UYEA 2GQ1A 4C1UA 2LAOA 4YKKA 4R6KA 4OVTA 3Q26A 1N3XA 4NHBA 2I49A 1FTOA 4ONYA 3HN0A 2DVCA 3SDFA 4EXKA 1JW4A 3IAZA 4BDNA 4G8HA 1CE2A 2VPOA 4GXAA 5CM6A 1YYZA 3UGWA 2F8DA 3DP8A 3IL1B 2O84X 1MPDA 3I3VA 4P0GA 4G68B 4GLIA 3MYUA 3H06B 3QAXA 3FJ7A 2HAUA 1AL3A 4N6DA 4GXSB 2DXRA 1Y3NA 4KR5A 1EH3A 3OELA 1R1NA 4JDFA 4LONB 5JTYA 2O7IA 4HE1A 3IX1A 4BDMA 3S9LC 3VE1B 2ZZVA 4O8MA 2KR0A 1FBFA 4PC9A 4JVIA 1QUKA 5AE4A 3TYHA 2A5TA 2Z8DA 4YB6A 2NWJA 2A5SA 1INPA 1TT1A 4YZZA 4U22A 1NNTA 4F3GA 3K1MA 2QS1A 2O1MA 3TTMA 4OEUA 2WEFA 4DI3D 1LBWA 3CSGA 2XXHA 1NV0A 3K1PA 3K1NA 2ESNA 4OFLA 4YKJA 2I3VA 1QGXA 2ALUA 2B4LA 3THIA 3K6VA 3U94A 3MP8A 1LLSA 4QFLA 1KA1A 2I3WA 1MY2A 4H0WA 1XT8A 4NF4A 3RGYA 4RYAA 4M4GA 4R2BA 4R72A 2CZHA 5A5XA 1FJ9A 2VD3A 4N6KA 5KDTB 4PGPA 1NV5A 3GZGA 5M2VA 1SPIA 4PDDA 1B7ZA 5LTCA 3QUJA 2UVHA 2VOZA 1FBGA 4P9KA 5KCJB 2WBDA 2VHAA 1DSNA 3FVGA 5FHNA 1FQCA 1SW1A 5F24A 1QVSA 3CHGA 4P1LA 1PC3A 3Q29A 4HE2A 1R6ZA 4PFWA 3FJGA 3TUSA 3CSBA 4PTKA 5I59B 2NUVA 2OWTA 2ZNTA 4KXPA 1BKAA 3W9WA 1WODA 1LBYA 2I4BA 4NWCA 4AB6A 4DCXA 3MUQA 4P0IA 3C34A 5I3SA 2PT2A 4MH5A 2QS2A 1QKAA 3FUZA 5ITOA 3TELA 3H6WA 5CBSA 3W9VA 3IB2A 2RC7A 3PMWA 4ELPA 1US5A 1K9YA 4H8JA 2XWIA 2AYSA 2DXYA 1OIBA 3WAEA 1FBPA 1YCJA 4EF2A 1MQIA 2DWAA 1LBXA 4YAHX 4PFIA 2QMXA 2YLNA 3MPKA 4H1XA 2O51A 5I58B 4MMPA 1USYE 2ZYKA 4R6YA 3KBZA 4FEBA 3V83A 3HV1A 3HFUA 1B4HA 3C4MA 1NNFA 3VXBA 3L6HA 3VFJA 3SEXA 4MHFA 1N7WA 2XX8A 2X7QA 4OVPA 2UVGA 3GXAA 1FCKA 5EQ9A 4I1DA 1NUXA 1B3FA 4N8YA 3LBSA 4GL0A 4YU0A 4MNCA 4U1ZA 1MY4A 4X1DA 2D3IA 3FXBA 5ICTA 4OVRA 3FATA 1FPFA 2D5WA 3OMBA 4ZS9A 1LBVA 4GWSA 3KBRA 3TFLA 1POY1 1OVBA 2VPNA 2XXKA 3K0VA 5IAIA 2XWKA 4U4XA 3IO4A 3JYRA 2XX7A 4N07A 1QUIA 2WBBA 4OETA 3OEKA 3S4UA 4L17A 1P1UA 2OJTA 3E4RA 1XS5A 5CBRA 2QL3A 3S9MC 3MC2A 1NV7A 1LAFE 5H8HA 2Z8EA 3GBAA 1KWHA 3BBRA 4Q30B 1OLCA 3G3JA 2PBWA 5EYFA 3ONMA 1GTKA 4ESWA 3B50A 3TTNA 4X04A 3LSXA 5IZZA 1PBPA 4OTEA 3TMGA 4PFTA 4Z7EA 1LAXA 3H7MA 1IXHA 1QKBA
chains in the Genus database with same CATH topology
4GIZA 2R9JA 2DE4A 4UA8A 3D4GA 1B1HA 1GGGA 3MVXA 3TCFA 2P1SA 2O7UA 3PPRA 1B3EA 3K6UA 4YMBA 3VXCA 1OLAA 4FEDA 5HM4B 3I5OA 3N5LA 3T9UA 3HCQA 2XXVA 4ESXA 4GVOA 3T66A 3RT8A 1TFDA 4R75A 2BJJX 5I2NA 5L9SA 2PYYA 4MLQA 3FVOA 3O97A 3OSQA 2I6EA 3TQWA 1A7LA 1WVJA 3N26A 5I56A 4F3BA 3VLUA 3C35A 5I57A 3R6UA 4LZ5A 3G3KA 1OQGA 1BLFA 4WEPA 1DTGA 3LR1A 2D21A 5CI5A 1IUDA 5AA4A 2OK2A 1SYIA 3EHSA 3GBBA 3FV2A 4N13A 3ZS6A 3QK6A 5CC2A 1Z7ME 4POXA 4NWDA 1B5IA 1L5TA 3MZBA 2HZKA 3UK4A 4EQBA 3OENA 1VE4A 3OOAA 5JTYB 2I48A 4DIGA 2V3QA 2AIXA 1TWYA 1P1NA 3K4UA 4NEDA 3C9HA 3SEUA 3KSXA 1JQFA 4QHQA 2P0SA 4PE5B 4ZZAA 3TTLA 3KEIA 2KLFA 2A5TB 4NMYA 5TP9B 2DE2A 3PPNA 3L6GA 1WDNA 5H8QA 4IO7A 1EZPA 1SVXB 2WKYA 3D4CA 1Q35A 3KJ7A 5K2YA 1TXFA 1H3DA 2THIA 3OO9A 3T96B 4QRZA 4P11A 1MH3A 1OQHA 4IO3A 3OEMA 3TCGA 2O6AA 3B6WA 2XHDA 4NF4B 4KFQA 5A5XB 4F1UA 5DT6A 3JZJA 1DOTA 3O6GA 1A54A 1FTMA 3ZSFA 2R6GE 4DXBA 2PMSA 1Z7NE 3EPEA 4QF9A 4F39A 4OEVA 2O1LA 3A09A 1IEJA 2HEUA 1A55A 4XKRA 3VVFA 5ELVA 2B65A 4GF8A 3CG3A 4OXVA 2HQ0A 4IO6A 3OO7A 4XXUA 1URDA 4DCYA 1SDXA 5DVJA 2OLBA 1NH7A 2GH9A 2B3BA 1N3WA 2DWHA 4MLVA 4QFOA 1B6HA 1RYOA 3IJXB 1AIVA 5JK4A 1BTJA 3CR9A 3IJOB 2XXUA 5CMCA 4KCDA 3ZKLA 1YAEA 1GR2A 4OMBA 3A3CA 3TEPA 2GHBA 1Y1MA 4I9DA 3S9NC 3M3LA 4KPTA 3SETA 3ILUB 4IO4A 4GQOA 2NOOA 4X1BA 3H03A 2F6GA 1PB8A 3B6QA 3AXFA 4QFPA 2PVUA 1VFEA 3HSTA 1FQBA 1VSOA 3PUZE 1O63A 4NF6A 3MBPA 3OD7A 1LBBA 4BLAA 3FXRA 1AOVA 1JEVA 1EZOA 2ZMBA 4N6PA 3U8QA 1S9TA 1II5A 2ONKE 2F78A 5DVIA 3EF7A 4EQ7A 3RPWA 5TP9A 1JW5A 2DQVA 3E3KA 1Y20A 1I69A 5ISUA 1LCTA 2DYXA 5H8HB 2VGQA 3ECRA 3USDA 4KHZE 3M3KA 2AL4A 3C36A 4X9TA 1MY0A 3MAMA 4LATA 1B0HA 4H5GA 3PUXE 2ANJA 3V5AA 4QSCA 2R71A 1AH5A 3DLNA 2IA4A 2XD2A 1ZTYA 4F1VA 2OCUA 3UN6A 4IGTA 1RKMA 3MJNA 2G93A 3VV5A 1B46A 2DS9A 4PQJA 4O3AA 2REJA 3MWBA 2DP8A 3IB0A 1LGBC 5DEXA 3MPLA 1T0KA 3TTRA 4TQUQ 1MXYA 3K00A 3R7XA 2I0CA 5I2NB 5IKBA 1SD3A 4NF5B 3SEYA 1BIYA 4O3BA 4BDOA 3RY3A 1H45A 2B3FA 2F7BA 1URSA 2HAVA 3QIMA 3FGSA 3M3FA 1NNKA 5I56B 3PPOA 4G4PA 4LP2B 1US4A 1J1NA 5I57B 1EZ9A 4F2QA 2GRVA 3UP9A 3BKIB 3HHGA 3ZKKA 1IIWA 3U72A 5AA4B 4F2OA 3K02A 3FD3A 1PB7A 4KYSA 2RINA 4ZZEA 3DELB 4LZ8A 4ZEBA 2F35A 3TCHA 4E0XA 1SBPA 4DXUA 3I6VA 3DP4A 1SW5A 3IOWA 4FE8A 2DWIA 2GHAA 5ICQA 5FTIA 3T22A 1H76A 1XVYA 1MH4A 1XHYA 1N7XA 4JB7A 2NXOA 5LOMA 5FTHA 4F3PA 4OFJA 1IXIA 3F11A 5DYHA 1I6BA 3CFLA 3B7DA 4NE4A 1FTKA 2QMWA 4R9GA 4G68C 4ISUA 2V25A 4XKPA 3OO6A 4KYDA 4IO2A 5H8QB 1MM7A 5ITPA 1O7TA 4HW8A 1B0LA 1R9QA 1SW2A 2QS4A 4DLDA 3EQ1A 1M5CA 5F7VA 4R74A 3DP6A 4PETA 1HSLA 4O3CA 4GL8A 2H25A 1EU8A 4ZE9A 4PFUA 2HZLA 4RK9A 5B70A 3LC8A 1LSTA 1MXZA 3RNNA 4EUOA 1Y3PA 4OERA 5BUUA 1D9VA 4LQ5A 3QUFA 4RY1A 1I6QA 2DWJA 3RTWB 4DXCA 1IXCA 5JEIA 1B3GA 3CVGA 3N6UA 3U92A 3K6WA 1MXXA 1N76A 4OQOA 4FJPA 3UA8A 2RCAA 1Q1KA 1A40A 3TDJA 4AQ4A 3PMXA 1FQFA 2Z8FA 4NF5A 1ZKBA 4HTGA 1LAGE 3FV1A 4YMAA 3U93A 4YKPA 3BFTA 3JV9A 1ZIUA 1M5FA 1JNFA 2ABHA 2REGA 4F3SA 1O64A 2HXWA 2H5YA 3E9XA 1NH8A 4X48A 2O68A 4HCYA 5AA2A 4I8CA 2Y7KA 3T9HB 5CMKA 3G7WA 1PB9A 1OMPA 4RPNA 2Q89A 2H9BA 3TKDA 4NF6B 4OENA 1MY1A 2XX9A 5J1DA 3WAFA 2CZLA 4Q5TA 3EHTA 2E1SA 1MDQA 3FJMA 4THIA 3SERA 2F97A 4I62A 4IY5A 2XXQA 2DE3A 4RPOA 4F22A 2XXIA 5DTBA 3FVNA 4OHNA 3FVKA 1I6AA 3H6VA 3FXQA 2YPNA 2XXWA 1Y1ZA 2AL5A 4JXIA 1MQDA 2O69A 2Z23A 1N84A 3TTKA 3C32A 4IGRA 3V89B 2XXTA 3KZGA 1JEUA 2OZZA 2OWSA 2H4IA 3Q28A 3ILTB 3ODBA 1S50A 1B58A 3OO8A 3QYTA 1DTZA 4GFRA 2FNCA 4DE8A 4FAJA 2FYIA 3CRBA 1VFDA 4U4SA 3KFMA 4Z0IA 4YKIA 3TQLA 3DM0A 2F5XA 5DEXB 3BFUA 4KQPA 3KN7A 3GLBA 1LCFA 2ONRA 3FASA 4JSDA 3O28A 4POWA 2VP1A 4F1YA 4EQ9A 1OVTA 3HO7A 1MM6A 1ZBMA 1FQAA 4XKNA 1NMUA 1B3LA 3B6TA 3KOSA 2QSXA 1MPCA 3T9XB 4JWYA 1M5BA 1B52A 2I0BA 3G3FA 1DMBA 5EHSA 1YTVA 2XD3A 2Y7PA 5EHMA 5CMMA 4BDRA 3MW0A 2XXXA 2F7CA 3PUWE 3IO6A 1MXWA 3TAJA 2QRYA 1HSEA 4Q8RA 2G29A 1ZLQA 1ATGA 4XTCQ 2X7PA 4GWOA 3G3GA 3IOTA 2DSFA 4MBPA 4R9FA 2YJPA 4AB5A 1N04A 3H4ZA 3MVYA 1PBQA 5AA3A 2UXAA 1RYXA 2ONSA 3H3GA 2F34A 1UTHA 1IZ1A 3T9VA 3KGCA 2PX1A 1MXUA 2RCBA 3E13X 1XVXA 4LQ2A 5K2XA 1ZJLA 2UYFA 2RC8A 5H8NB 1UQWA 5L8DA 4H67A 4XKQA 3MZ9A 3IK6B 2P2AA 1DPEA 3PPPA 1LAHE 1VR5A 2Q2AA 1ELJA 1P1OA 4LVQA 1UIVA 4UACA 3CFXA 4ELQA 4KI0E 4IY6A 5HBCA 3S2VA 4WKMA 2OBGA 4E0WA 3KJTA 1NNPA 1URGA 2HFBA 4NF8A 4IB2A 3Q27A 4G77A 3CIJA 3N94A 1SW4A 4R73A 4FORA 2ZXTA 4M1VA 2F7AA 2V3TA 3TODA 4PFYA 1FTLA 4GRKA 4G8NA 2F36A 1IITA 1MQJA 4PP0A 4DZ1A 4F18A 1B40A 4C0RA 4QSEA 5DVFA 1MXVA 1NFTA 2V3UA 1MS7A 4R6HA 5CMBA 1NL5A 1MQHA 1XC1A 3PUYE 4ZEKA 3MVZA 1JVYA 4OWDA 1LB8A 1A99A 4GOTA 4F29A 5CRYA 3U1OA 4EF1A 4YICA 4F31B 3RQTA 1GV8A 1UTBA 3RN8A 3O9PA 5KZTA 4YB5A 3FIRA 1F9BA 5TPAB 2Y7WA 3PU5A 4U2RA 5H8FA 3IORA 2ZNUA 2ZYOA 3KN3A 4OFOA 1GVCA 1M5EA 2ZYNA 5AA2B 4QSDA 3PMVA 2F6PA 4ZECA 4Q0CA 1B3HA 4KYEA 1P99A 2Q9TA 5FHMA 3G3HA 2RF1A 1R9LA 4XIGQ 1JVXA 1QJMA 2UVJA 2FA7A 3HPIA 3PUVE 1HSJA 1N0TA 2PT1A 4G68A 4G8MA 4HS7A 4ND9A 1A8FA 2Z22A 3QXMA 3TPAA 1B1XA 4OZ9A 4U1OA 5H8NA 4FECA 2V93A 2Y7RA 1LFGA 3MP6A 1JW1A 3IR1A 2CMOA 3PV0E 5HPQA 3O66A 3W15C 3H6TA 2H98A 1SI0A 2XXYA 1QULA 1FQDA 3HHFA 1B05A 3FXUA 1B5HA 2I4CA 1XOCA 3RLFE 4G2ZA 4QFNA 4RK2A 3RUMA 3PD9A 1USYH 3IB1A 3PD8A 2ZYMA 4GD5A 1PEBA 5AA1A 1NKXA 1SI1A 1B9JA 3VLVA 5I2KB 4TLLB 2Q88A 1M5DA 5L9MA 2I58A 4K3FA 4ZEDA 3S9EA 2QJEA 3QSLA 2Y84A 2DVZA 3IOUA 3A3UA 2XXRA 5KDTA 4U21A 1B2HA 3Q25A 4FIMA 3P7IA 4TLMB 2UVIA 3C31A 4JWOA 1SQYA 2HCAA 5KCJA 1Y4TA 4RJZA 3K2DA 3T93B 1B5JA 2W7YA 1B7UA 3N6TA 1UIUA 4HCWA 4C1TA 2XXPA 3EN3A 1TFAA 3VLWA 3G3IA 4H6DA 4NTLA 5I59A 1D9YA 1Y9UA 4QFKA 4DDDA 3MQ9A 5TPAA 3RT6B 4OYVA 4H5FA 4R2FA 1MDP1 4KD5A 3V8XB 3KOTA 4EXLA 1MY3A 3UORA 1IQ7A 3H6UA 3KSJA 1FW0A 1B32A 4IO5A 3O6HA 3VDFA 1FTJA 3R26A 2QPQA 3RTFB 1SYHA 5TU0A 4ECFA 3OXNA 2VD2A 2NVUB 3KG2A 2GFEA 5I58A 5L9OA 1FQEA 4ZDMA 1UTHB 1LB9A 4JSOA 3SEVA 1LBCA 2QS3A 1B4ZA 3K6XA 1ZU0A 4ZEIA 1B51A 1DPPA 2X26A 5BWJA 4BDLA 1Y3QA 4H65A 5B7DA 4WEDA 3LSFB 3KN8A 1D4NA 4U23A 2E0SA 4FATA 1Y4CA 1AMFA 3M8UA 1CB6A 2V84A 1ANFA 4LA9A 3OSRA 3K01A 4RNSA 2RC9A 2H99A 2M8CA 1BP5A 1MRPA 3LSWA 5H8SA 3SKPA 1POTA 4JWXA 3MVWA 1D3KA 3LSLA 4F19A 2Q8JA 3VVDA 4H8IA 4YB7A 3MZ1A 3C33A 2IEEA 5FHOA 1MG1A 4NF8B 2Y7IA 3O29A 4ZE8A 5F1QA 4RXLA 3EHUA 4LZ7A 1QUJA 2RKMA 4RA1A 5I2KA 3CFZA 3SESA 3PPQA 3UIFA 4OESA 1IXGA 3CI8A 3VVEA 3TZAA 4MFIA 4OVJA 4ELOA 2DOJA 3IOVA 3O2AA 4LUBA 3CG1A 4JBZA 3MP1A 1B7HA 3O6IA 1MQGA 3LUYA 4ZEFA 3FZVA 4TOZA 1P1WA 2ZNSA 4BDQA 1QW0A 4MF3A 1H44A 1MPBA 1UTBB 3PGFA 1S7YA 1A8EA 1P1QA 4EDPA 4KCCA 2Q2CA 3SEWA 1LFIA 4WXJA 1ZMGA 5H8FB 1LFHA 1H43A 1YPNA 4ELRA 1PDAA 5AA2D 5I84A 1JETA 2UYEA 4C1UA 2LAOA 4YKKA 4R6KA 3Q26A 1N3XA 2I49A 1FTOA 4ONYA 3HN0A 2DVCA 3SDFA 4EXKA 1JW4A 3IAZA 4BDNA 4G8HA 1CE2A 4GXAA 5CM6A 3UGWA 2F8DA 3DP8A 3IL1B 2O84X 1MPDA 3I3VA 4P0GA 4G68B 4GLIA 3H06B 3QAXA 3FJ7A 2HAUA 1AL3A 4GXSB 2DXRA 1Y3NA 4KR5A 1EH3A 3OELA 1R1NA 4JDFA 4LONB 5JTYA 2O7IA 3IX1A 4BDMA 3S9LC 3VE1B 1QUKA 5AE4A 3TYHA 2A5TA 2Z8DA 4YB6A 2NWJA 2A5SA 1TT1A 4YZZA 4U22A 1NNTA 4F3GA 3K1MA 2QS1A 2O1MA 3TTMA 4OEUA 3CSGA 2XXHA 3K1PA 3K1NA 2ESNA 4OFLA 4YKJA 2I3VA 2ALUA 3THIA 3K6VA 3U94A 3MP8A 1LLSA 4QFLA 2I3WA 1MY2A 4H0WA 1XT8A 4NF4A 3RGYA 4RYAA 4M4GA 4R2BA 4R72A 5A5XA 2VD3A 5KDTB 3GZGA 5M2VA 1B7ZA 3QUJA 2UVHA 2VOZA 5KCJB 2VHAA 1DSNA 3FVGA 5FHNA 1FQCA 1SW1A 1QVSA 1PC3A 3Q29A 1R6ZA 4PFWA 3FJGA 3TUSA 3CSBA 5I59B 2NUVA 2OWTA 2ZNTA 1BKAA 3W9WA 1WODA 2I4BA 4NWCA 4AB6A 4DCXA 3MUQA 4P0IA 3C34A 2PT2A 4MH5A 2QS2A 1QKAA 3FUZA 5ITOA 3TELA 3H6WA 5CBSA 3W9VA 3IB2A 2RC7A 3PMWA 4ELPA 1US5A 4H8JA 2AYSA 2DXYA 1OIBA 3WAEA 1YCJA 4EF2A 1MQIA 2DWAA 4YAHX 2QMXA 2YLNA 3MPKA 4H1XA 2O51A 5I58B 1USYE 2ZYKA 4R6YA 4FEBA 3V83A 3HV1A 1B4HA 3C4MA 1NNFA 3VXBA 3L6HA 3VFJA 3SEXA 1N7WA 2XX8A 2X7QA 2UVGA 3GXAA 1FCKA 4I1DA 1B3FA 3LBSA 4GL0A 4YU0A 4U1ZA 1MY4A 4X1DA 2D3IA 5ICTA 3FATA 2D5WA 4ZS9A 3OMBA 3KBRA 3TFLA 1POY1 1OVBA 3K0VA 5IAIA 4U4XA 3IO4A 3JYRA 2XX7A 4N07A 1QUIA 4OETA 3OEKA 3S4UA 4L17A 1P1UA 2OJTA 3E4RA 1XS5A 5CBRA 2QL3A 3S9MC 3MC2A 1LAFE 5H8HA 2Z8EA 3GBAA 1KWHA 3BBRA 4Q30B 1OLCA 3G3JA 2PBWA 5EYFA 3ONMA 1GTKA 4ESWA 3TTNA 3LSXA 1PBPA 4OTEA 3TMGA 4PFTA 4Z7EA 1LAXA 3H7MA 1IXHA 1QKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GIZ A;  2R9J A;  2DE4 A;  4UA8 A;  3D4G A;  1B1H A;  1GGG A;  3MVX A;  3TCF A;  2P1S A;  2O7U A;  3PPR A;  1B3E A;  3K6U A;  4YMB A;  3VXC A;  1OLA A;  4FED A;  5HM4 B;  3I5O A;  3N5L A;  3T9U A;  3HCQ A;  2XXV A;  4ESX A;  4GVO A;  3T66 A;  3RT8 A;  1TFD A;  4R75 A;  2BJJ X;  5I2N A;  5L9S A;  2PYY A;  4MLQ A;  3FVO A;  3O97 A;  3OSQ A;  2I6E A;  3TQW A;  1A7L A;  1WVJ A;  3N26 A;  5I56 A;  4F3B A;  3VLU A;  3C35 A;  5I57 A;  3R6U A;  4LZ5 A;  3G3K A;  1OQG A;  1BLF A;  4WEP A;  1DTG A;  3LR1 A;  2D21 A;  5CI5 A;  1IUD A;  5AA4 A;  2OK2 A;  1SYI A;  3EHS A;  3GBB A;  3FV2 A;  4N13 A;  3ZS6 A;  3QK6 A;  5CC2 A;  1Z7M E;  4POX A;  4NWD A;  1B5I A;  1L5T A;  3MZB A;  2HZK A;  3UK4 A;  4EQB A;  3OEN A;  1VE4 A;  3OOA A;  5JTY B;  2I48 A;  4DIG A;  2V3Q A;  2AIX A;  1TWY A;  1P1N A;  3K4U A;  4NED A;  3C9H A;  3SEU A;  3KSX A;  1JQF A;  4QHQ A;  2P0S A;  4PE5 B;  4ZZA A;  3TTL A;  3KEI A;  2KLF A;  2A5T B;  4NMY A;  5TP9 B;  2DE2 A;  3PPN A;  3L6G A;  1WDN A;  5H8Q A;  4IO7 A;  1EZP A;  1SVX B;  2WKY A;  3D4C A;  1Q35 A;  3KJ7 A;  5K2Y A;  1TXF A;  1H3D A;  2THI A;  3OO9 A;  3T96 B;  4QRZ A;  4P11 A;  1MH3 A;  1OQH A;  4IO3 A;  3OEM A;  3TCG A;  2O6A A;  3B6W A;  2XHD A;  4NF4 B;  4KFQ A;  5A5X B;  4F1U A;  5DT6 A;  3JZJ A;  1DOT A;  3O6G A;  1A54 A;  1FTM A;  3ZSF A;  2R6G E;  4DXB A;  2PMS A;  1Z7N E;  3EPE A;  4QF9 A;  4F39 A;  4OEV A;  2O1L A;  3A09 A;  1IEJ A;  2HEU A;  1A55 A;  4XKR A;  3VVF A;  5ELV A;  2B65 A;  4GF8 A;  3CG3 A;  4OXV A;  2HQ0 A;  4IO6 A;  3OO7 A;  4XXU A;  1URD A;  4DCY A;  1SDX A;  5DVJ A;  2OLB A;  1NH7 A;  2GH9 A;  2B3B A;  1N3W A;  2DWH A;  4MLV A;  4QFO A;  1B6H A;  1RYO A;  3IJX B;  1AIV A;  5JK4 A;  1BTJ A;  3CR9 A;  3IJO B;  2XXU A;  5CMC A;  4KCD A;  3ZKL A;  1YAE A;  1GR2 A;  4OMB A;  3A3C A;  3TEP A;  2GHB A;  1Y1M A;  4I9D A;  3S9N C;  3M3L A;  4KPT A;  3SET A;  3ILU B;  4IO4 A;  4GQO A;  2NOO A;  4X1B A;  3H03 A;  2F6G A;  1PB8 A;  3B6Q A;  3AXF A;  4QFP A;  2PVU A;  1VFE A;  3HST A;  1FQB A;  1VSO A;  3PUZ E;  1O63 A;  4NF6 A;  3MBP A;  3OD7 A;  1LBB A;  4BLA A;  3FXR A;  1AOV A;  1JEV A;  1EZO A;  2ZMB A;  4N6P A;  3U8Q A;  1S9T A;  1II5 A;  2ONK E;  2F78 A;  5DVI A;  3EF7 A;  4EQ7 A;  3RPW A;  5TP9 A;  1JW5 A;  2DQV A;  3E3K A;  1Y20 A;  1I69 A;  5ISU A;  1LCT A;  2DYX A;  5H8H B;  2VGQ A;  3ECR A;  3USD A;  4KHZ E;  3M3K A;  2AL4 A;  3C36 A;  4X9T A;  1MY0 A;  3MAM A;  4LAT A;  1B0H A;  4H5G A;  3PUX E;  2ANJ A;  3V5A A;  4QSC A;  2R71 A;  1AH5 A;  3DLN A;  2IA4 A;  2XD2 A;  1ZTY A;  4F1V A;  2OCU A;  3UN6 A;  4IGT A;  1RKM A;  3MJN A;  2G93 A;  3VV5 A;  1B46 A;  2DS9 A;  4PQJ A;  4O3A A;  2REJ A;  3MWB A;  2DP8 A;  3IB0 A;  1LGB C;  5DEX A;  3MPL A;  1T0K A;  3TTR A;  4TQU Q;  1MXY A;  3K00 A;  3R7X A;  2I0C A;  5I2N B;  5IKB A;  1SD3 A;  4NF5 B;  3SEY A;  1BIY A;  4O3B A;  4BDO A;  3RY3 A;  1H45 A;  2B3F A;  2F7B A;  1URS A;  2HAV A;  3QIM A;  3FGS A;  3M3F A;  1NNK A;  5I56 B;  3PPO A;  4G4P A;  4LP2 B;  1US4 A;  1J1N A;  5I57 B;  1EZ9 A;  4F2Q A;  2GRV A;  3UP9 A;  3BKI B;  3HHG A;  3ZKK A;  1IIW A;  3U72 A;  5AA4 B;  4F2O A;  3K02 A;  3FD3 A;  1PB7 A;  4KYS A;  2RIN A;  4ZZE A;  3DEL B;  4LZ8 A;  4ZEB A;  2F35 A;  3TCH A;  4E0X A;  1SBP A;  4DXU A;  3I6V A;  3DP4 A;  1SW5 A;  3IOW A;  4FE8 A;  2DWI A;  2GHA A;  5ICQ A;  5FTI A;  3T22 A;  1H76 A;  1XVY A;  1MH4 A;  1XHY A;  1N7X A;  4JB7 A;  2NXO A;  5LOM A;  5FTH A;  4F3P A;  4OFJ A;  1IXI A;  3F11 A;  5DYH A;  1I6B A;  3CFL A;  3B7D A;  4NE4 A;  1FTK A;  2QMW A;  4R9G A;  4G68 C;  4ISU A;  2V25 A;  4XKP A;  3OO6 A;  4KYD A;  4IO2 A;  5H8Q B;  1MM7 A;  5ITP A;  1O7T A;  4HW8 A;  1B0L A;  1R9Q A;  1SW2 A;  2QS4 A;  4DLD A;  3EQ1 A;  1M5C A;  5F7V A;  4R74 A;  3DP6 A;  4PET A;  1HSL A;  4O3C A;  4GL8 A;  2H25 A;  1EU8 A;  4ZE9 A;  4PFU A;  2HZL A;  4RK9 A;  5B70 A;  3LC8 A;  1LST A;  1MXZ A;  3RNN A;  4EUO A;  1Y3P A;  4OER A;  5BUU A;  1D9V A;  4LQ5 A;  3QUF A;  4RY1 A;  1I6Q A;  2DWJ A;  3RTW B;  4DXC A;  1IXC A;  5JEI A;  1B3G A;  3CVG A;  3N6U A;  3U92 A;  3K6W A;  1MXX A;  1N76 A;  4OQO A;  4FJP A;  3UA8 A;  2RCA A;  1Q1K A;  1A40 A;  3TDJ A;  4AQ4 A;  3PMX A;  1FQF A;  2Z8F A;  4NF5 A;  1ZKB A;  4HTG A;  1LAG E;  3FV1 A;  4YMA A;  3U93 A;  4YKP A;  3BFT A;  3JV9 A;  1ZIU A;  1M5F A;  1JNF A;  2ABH A;  2REG A;  4F3S A;  1O64 A;  2HXW A;  2H5Y A;  3E9X A;  1NH8 A;  4X48 A;  2O68 A;  4HCY A;  5AA2 A;  4I8C A;  2Y7K A;  3T9H B;  5CMK A;  3G7W A;  1PB9 A;  1OMP A;  4RPN A;  2Q89 A;  2H9B A;  3TKD A;  4NF6 B;  4OEN A;  1MY1 A;  2XX9 A;  5J1D A;  3WAF A;  2CZL A;  4Q5T A;  3EHT A;  2E1S A;  1MDQ A;  3FJM A;  4THI A;  3SER A;  2F97 A;  4I62 A;  4IY5 A;  2XXQ A;  2DE3 A;  4RPO A;  4F22 A;  2XXI A;  5DTB A;  3FVN A;  4OHN A;  3FVK A;  1I6A A;  3H6V A;  3FXQ A;  2YPN A;  2XXW A;  1Y1Z A;  2AL5 A;  4JXI A;  1MQD A;  2O69 A;  2Z23 A;  1N84 A;  3TTK A;  3C32 A;  4IGR A;  3V89 B;  2XXT A;  3KZG A;  1JEU A;  2OZZ A;  2OWS A;  2H4I A;  3Q28 A;  3ILT B;  3ODB A;  1S50 A;  1B58 A;  3OO8 A;  3QYT A;  1DTZ A;  4GFR A;  2FNC A;  4DE8 A;  4FAJ A;  2FYI A;  3CRB A;  1VFD A;  4U4S A;  3KFM A;  4Z0I A;  4YKI A;  3TQL A;  3DM0 A;  2F5X A;  5DEX B;  3BFU A;  4KQP A;  3KN7 A;  3GLB A;  1LCF A;  2ONR A;  3FAS A;  4JSD A;  3O28 A;  4POW A;  2VP1 A;  4F1Y A;  4EQ9 A;  1OVT A;  3HO7 A;  1MM6 A;  1ZBM A;  1FQA A;  4XKN A;  1NMU A;  1B3L A;  3B6T A;  3KOS A;  2QSX A;  1MPC A;  3T9X B;  4JWY A;  1M5B A;  1B52 A;  2I0B A;  3G3F A;  1DMB A;  5EHS A;  1YTV A;  2XD3 A;  2Y7P A;  5EHM A;  5CMM A;  4BDR A;  3MW0 A;  2XXX A;  2F7C A;  3PUW E;  3IO6 A;  1MXW A;  3TAJ A;  2QRY A;  1HSE A;  4Q8R A;  2G29 A;  1ZLQ A;  1ATG A;  4XTC Q;  2X7P A;  4GWO A;  3G3G A;  3IOT A;  2DSF A;  4MBP A;  4R9F A;  2YJP A;  4AB5 A;  1N04 A;  3H4Z A;  3MVY A;  1PBQ A;  5AA3 A;  2UXA A;  1RYX A;  2ONS A;  3H3G A;  2F34 A;  1UTH A;  1IZ1 A;  3T9V A;  3KGC A;  2PX1 A;  1MXU A;  2RCB A;  3E13 X;  1XVX A;  4LQ2 A;  5K2X A;  1ZJL A;  2UYF A;  2RC8 A;  5H8N B;  1UQW A;  5L8D A;  4H67 A;  4XKQ A;  3MZ9 A;  3IK6 B;  2P2A A;  1DPE A;  3PPP A;  1LAH E;  1VR5 A;  2Q2A A;  1ELJ A;  1P1O A;  4LVQ A;  1UIV A;  4UAC A;  3CFX A;  4ELQ A;  4KI0 E;  4IY6 A;  5HBC A;  3S2V A;  4WKM A;  2OBG A;  4E0W A;  3KJT A;  1NNP A;  1URG A;  2HFB A;  4NF8 A;  4IB2 A;  3Q27 A;  4G77 A;  3CIJ A;  3N94 A;  1SW4 A;  4R73 A;  4FOR A;  2ZXT A;  4M1V A;  2F7A A;  2V3T A;  3TOD A;  4PFY A;  1FTL A;  4GRK A;  4G8N A;  2F36 A;  1IIT A;  1MQJ A;  4PP0 A;  4DZ1 A;  4F18 A;  1B40 A;  4C0R A;  4QSE A;  5DVF A;  1MXV A;  1NFT A;  2V3U A;  1MS7 A;  4R6H A;  5CMB A;  1NL5 A;  1MQH A;  1XC1 A;  3PUY E;  4ZEK A;  3MVZ A;  1JVY A;  4OWD A;  1LB8 A;  1A99 A;  4GOT A;  4F29 A;  5CRY A;  3U1O A;  4EF1 A;  4YIC A;  4F31 B;  3RQT A;  1GV8 A;  1UTB A;  3RN8 A;  3O9P A;  5KZT A;  4YB5 A;  3FIR A;  1F9B A;  5TPA B;  2Y7W A;  3PU5 A;  4U2R A;  5H8F A;  3IOR A;  2ZNU A;  2ZYO A;  3KN3 A;  4OFO A;  1GVC A;  1M5E A;  2ZYN A;  5AA2 B;  4QSD A;  3PMV A;  2F6P A;  4ZEC A;  4Q0C A;  1B3H A;  4KYE A;  1P99 A;  2Q9T A;  5FHM A;  3G3H A;  2RF1 A;  1R9L A;  4XIG Q;  1JVX A;  1QJM A;  2UVJ A;  2FA7 A;  3HPI A;  3PUV E;  1HSJ A;  1N0T A;  2PT1 A;  4G68 A;  4G8M A;  4HS7 A;  4ND9 A;  1A8F A;  2Z22 A;  3QXM A;  3TPA A;  1B1X A;  4OZ9 A;  4U1O A;  5H8N A;  4FEC A;  2V93 A;  2Y7R A;  1LFG A;  3MP6 A;  1JW1 A;  3IR1 A;  2CMO A;  3PV0 E;  5HPQ A;  3O66 A;  3W15 C;  3H6T A;  2H98 A;  1SI0 A;  2XXY A;  1QUL A;  1FQD A;  3HHF A;  1B05 A;  3FXU A;  1B5H A;  2I4C A;  1XOC A;  3RLF E;  4G2Z A;  4QFN A;  4RK2 A;  3RUM A;  3PD9 A;  1USY H;  3IB1 A;  3PD8 A;  2ZYM A;  4GD5 A;  1PEB A;  5AA1 A;  1NKX A;  1SI1 A;  1B9J A;  3VLV A;  5I2K B;  4TLL B;  2Q88 A;  1M5D A;  5L9M A;  2I58 A;  4K3F A;  4ZED A;  3S9E A;  2QJE A;  3QSL A;  2Y84 A;  2DVZ A;  3IOU A;  3A3U A;  2XXR A;  5KDT A;  4U21 A;  1B2H A;  3Q25 A;  4FIM A;  3P7I A;  4TLM B;  2UVI A;  3C31 A;  4JWO A;  1SQY A;  2HCA A;  5KCJ A;  1Y4T A;  4RJZ A;  3K2D A;  3T93 B;  1B5J A;  2W7Y A;  1B7U A;  3N6T A;  1UIU A;  4HCW A;  4C1T A;  2XXP A;  3EN3 A;  1TFA A;  3VLW A;  3G3I A;  4H6D A;  4NTL A;  5I59 A;  1D9Y A;  1Y9U A;  4QFK A;  4DDD A;  3MQ9 A;  5TPA A;  3RT6 B;  4OYV A;  4H5F A;  4R2F A;  1MDP 1;  4KD5 A;  3V8X B;  3KOT A;  4EXL A;  1MY3 A;  3UOR A;  1IQ7 A;  3H6U A;  3KSJ A;  1FW0 A;  1B32 A;  4IO5 A;  3O6H A;  3VDF A;  1FTJ A;  3R26 A;  2QPQ A;  3RTF B;  1SYH A;  5TU0 A;  4ECF A;  3OXN A;  2VD2 A;  2NVU B;  3KG2 A;  2GFE A;  5I58 A;  5L9O A;  1FQE A;  4ZDM A;  1UTH B;  1LB9 A;  4JSO A;  3SEV A;  1LBC A;  2QS3 A;  1B4Z A;  3K6X A;  1ZU0 A;  4ZEI A;  1B51 A;  1DPP A;  2X26 A;  5BWJ A;  4BDL A;  1Y3Q A;  4H65 A;  5B7D A;  4WED A;  3LSF B;  3KN8 A;  1D4N A;  4U23 A;  2E0S A;  4FAT A;  1Y4C A;  1AMF A;  3M8U A;  1CB6 A;  2V84 A;  1ANF A;  4LA9 A;  3OSR A;  3K01 A;  4RNS A;  2RC9 A;  2H99 A;  2M8C A;  1BP5 A;  1MRP A;  3LSW A;  5H8S A;  3SKP A;  1POT A;  4JWX A;  3MVW A;  1D3K A;  3LSL A;  4F19 A;  2Q8J A;  3VVD A;  4H8I A;  4YB7 A;  3MZ1 A;  3C33 A;  2IEE A;  5FHO A;  1MG1 A;  4NF8 B;  2Y7I A;  3O29 A;  4ZE8 A;  5F1Q A;  4RXL A;  3EHU A;  4LZ7 A;  1QUJ A;  2RKM A;  4RA1 A;  5I2K A;  3CFZ A;  3SES A;  3PPQ A;  3UIF A;  4OES A;  1IXG A;  3CI8 A;  3VVE A;  3TZA A;  4MFI A;  4OVJ A;  4ELO A;  2DOJ A;  3IOV A;  3O2A A;  4LUB A;  3CG1 A;  4JBZ A;  3MP1 A;  1B7H A;  3O6I A;  1MQG A;  3LUY A;  4ZEF A;  3FZV A;  4TOZ A;  1P1W A;  2ZNS A;  4BDQ A;  1QW0 A;  4MF3 A;  1H44 A;  1MPB A;  1UTB B;  3PGF A;  1S7Y A;  1A8E A;  1P1Q A;  4EDP A;  4KCC A;  2Q2C A;  3SEW A;  1LFI A;  4WXJ A;  1ZMG A;  5H8F B;  1LFH A;  1H43 A;  1YPN A;  4ELR A;  1PDA A;  5AA2 D;  5I84 A;  1JET A;  2UYE A;  4C1U A;  2LAO A;  4YKK A;  4R6K A;  3Q26 A;  1N3X A;  2I49 A;  1FTO A;  4ONY A;  3HN0 A;  2DVC A;  3SDF A;  4EXK A;  1JW4 A;  3IAZ A;  4BDN A;  4G8H A;  1CE2 A;  4GXA A;  5CM6 A;  3UGW A;  2F8D A;  3DP8 A;  3IL1 B;  2O84 X;  1MPD A;  3I3V A;  4P0G A;  4G68 B;  4GLI A;  3H06 B;  3QAX A;  3FJ7 A;  2HAU A;  1AL3 A;  4GXS B;  2DXR A;  1Y3N A;  4KR5 A;  1EH3 A;  3OEL A;  1R1N A;  4JDF A;  4LON B;  5JTY A;  2O7I A;  3IX1 A;  4BDM A;  3S9L C;  3VE1 B;  1QUK A;  5AE4 A;  3TYH A;  2A5T A;  2Z8D A;  4YB6 A;  2NWJ A;  2A5S A;  1TT1 A;  4YZZ A;  4U22 A;  1NNT A;  4F3G A;  3K1M A;  2QS1 A;  2O1M A;  3TTM A;  4OEU A;  3CSG A;  2XXH A;  3K1P A;  3K1N A;  2ESN A;  4OFL A;  4YKJ A;  2I3V A;  2ALU A;  3THI A;  3K6V A;  3U94 A;  3MP8 A;  1LLS A;  4QFL A;  2I3W A;  1MY2 A;  4H0W A;  1XT8 A;  4NF4 A;  3RGY A;  4RYA A;  4M4G A;  4R2B A;  4R72 A;  5A5X A;  2VD3 A;  5KDT B;  3GZG A;  5M2V A;  1B7Z A;  3QUJ A;  2UVH A;  2VOZ A;  5KCJ B;  2VHA A;  1DSN A;  3FVG A;  5FHN A;  1FQC A;  1SW1 A;  1QVS A;  1PC3 A;  3Q29 A;  1R6Z A;  4PFW A;  3FJG A;  3TUS A;  3CSB A;  5I59 B;  2NUV A;  2OWT A;  2ZNT A;  1BKA A;  3W9W A;  1WOD A;  2I4B A;  4NWC A;  4AB6 A;  4DCX A;  3MUQ A;  4P0I A;  3C34 A;  2PT2 A;  4MH5 A;  2QS2 A;  1QKA A;  3FUZ A;  5ITO A;  3TEL A;  3H6W A;  5CBS A;  3W9V A;  3IB2 A;  2RC7 A;  3PMW A;  4ELP A;  1US5 A;  4H8J A;  2AYS A;  2DXY A;  1OIB A;  3WAE A;  1YCJ A;  4EF2 A;  1MQI A;  2DWA A;  4YAH X;  2QMX A;  2YLN A;  3MPK A;  4H1X A;  2O51 A;  5I58 B;  1USY E;  2ZYK A;  4R6Y A;  4FEB A;  3V83 A;  3HV1 A;  1B4H A;  3C4M A;  1NNF A;  3VXB A;  3L6H A;  3VFJ A;  3SEX A;  1N7W A;  2XX8 A;  2X7Q A;  2UVG A;  3GXA A;  1FCK A;  4I1D A;  1B3F A;  3LBS A;  4GL0 A;  4YU0 A;  4U1Z A;  1MY4 A;  4X1D A;  2D3I A;  5ICT A;  3FAT A;  2D5W A;  4ZS9 A;  3OMB A;  3KBR A;  3TFL A;  1POY 1;  1OVB A;  3K0V A;  5IAI A;  4U4X A;  3IO4 A;  3JYR A;  2XX7 A;  4N07 A;  1QUI A;  4OET A;  3OEK A;  3S4U A;  4L17 A;  1P1U A;  2OJT A;  3E4R A;  1XS5 A;  5CBR A;  2QL3 A;  3S9M C;  3MC2 A;  1LAF E;  5H8H A;  2Z8E A;  3GBA A;  1KWH A;  3BBR A;  4Q30 B;  1OLC A;  3G3J A;  2PBW A;  5EYF A;  3ONM A;  1GTK A;  4ESW A;  3TTN A;  3LSX A;  1PBP A;  4OTE A;  3TMG A;  4PFT A;  4Z7E A;  1LAX A;  3H7M A;  1IXH A;  1QKB A; 
#chains in the Genus database with same CATH topology
 4GIZ A;  2CZK A;  2R9J A;  2DE4 A;  4UA8 A;  3D4G A;  1B1H A;  1GGG A;  3MVX A;  3TCF A;  2P1S A;  2O7U A;  3PPR A;  1B3E A;  3K6U A;  4YMB A;  3VXC A;  1DBZ A;  1OLA A;  4FED A;  5HM4 B;  1EYI A;  5EQA A;  3I5O A;  3ROJ A;  3N5L A;  3T9U A;  3HCQ A;  2XXV A;  4ESX A;  4GVO A;  3T66 A;  3RT8 A;  4O7M A;  1TFD A;  2QFL A;  2BJJ X;  4R75 A;  5ESY A;  2QVV A;  5I2N A;  2FHY A;  5L9S A;  2PYY A;  4MLQ A;  3FVO A;  3O97 A;  1K9Z A;  3OSQ A;  2I6E A;  3TQW A;  1A7L A;  1WVJ A;  3N26 A;  5I56 A;  4F3B A;  3VLU A;  3C35 A;  2WYP A;  5I57 A;  3R6U A;  4LZ5 A;  3G3K A;  1OQG A;  1BLF A;  4WEP A;  1NI9 A;  1DTG A;  3LR1 A;  1KZ8 A;  2D21 A;  5CI5 A;  1IUD A;  5AA4 A;  2OK2 A;  1SYI A;  3EHS A;  3GBB A;  3FV2 A;  4N13 A;  3ZS6 A;  3QK6 A;  5CC2 A;  1Z7M E;  4POX A;  4NWD A;  1B5I A;  4MAG A;  4GWX A;  1L5T A;  3MZB A;  2HZK A;  3MST A;  3UK4 A;  4EQB A;  3OEN A;  1VE4 A;  3OOA A;  5JTY B;  2I48 A;  4DIG A;  2V3Q A;  2AIX A;  3QMF A;  1TWY A;  1P1N A;  3K4U A;  4NED A;  3C9H A;  3SEU A;  1YXI A;  3KSX A;  1FJ6 A;  1JQF A;  4QHQ A;  2P0S A;  4PE5 B;  4ZZA A;  2B4M A;  4N91 A;  2KQZ A;  3TTL A;  3KEI A;  2KLF A;  2A5T B;  2F3D A;  4NMY A;  5TP9 B;  4PAK A;  2DE2 A;  3PPN A;  3L6G A;  3LV0 A;  1WDN A;  4JVD A;  5H8Q A;  4IO7 A;  1EZP A;  1SVX B;  2WKY A;  3D4C A;  1Q35 A;  3KJ7 A;  5K2Y A;  1TXF A;  4NN3 A;  1H3D A;  2THI A;  4AS5 A;  3OO9 A;  1LEV A;  3T96 B;  4QRZ A;  4P11 A;  3D1R A;  1MH3 A;  1OQH A;  4NG7 A;  4IO3 A;  3OEM A;  3TCG A;  2O6A A;  3B6W A;  2XHD A;  4NF4 B;  4FBP A;  4KFQ A;  5A5X B;  4F1U A;  5DT6 A;  3JZJ A;  1DOT A;  3O6G A;  1A54 A;  2FBP A;  1FTM A;  3ZSF A;  2R6G E;  4DXB A;  2PMS A;  1Z7N E;  3EPE A;  4PF8 A;  4QF9 A;  4F39 A;  4OEV A;  2O1L A;  2PFZ A;  3A09 A;  1IEJ A;  2HEU A;  1A55 A;  4XKR A;  3LUZ A;  4P1E A;  3VVF A;  5ELV A;  2B65 A;  4GF8 A;  4PFB A;  4NX1 A;  4G61 A;  1IME A;  3CG3 A;  4OXV A;  2HQ0 A;  4IO6 A;  4PF6 A;  3OO7 A;  4XXU A;  1URD A;  4DCY A;  1SDX A;  5DVJ A;  2OLB A;  1NH7 A;  2GH9 A;  2B3B A;  1N3W A;  2DWH A;  4MLV A;  4QFO A;  5J16 A;  1B6H A;  1RYO A;  3IJX B;  1AIV A;  5JK4 A;  1BTJ A;  3CR9 A;  3IJO B;  2XXU A;  5CMC A;  1Q9D A;  4N15 A;  2PCR A;  4KCD A;  3ZKL A;  1YAE A;  1GR2 A;  4OMB A;  4H45 A;  3A3C A;  3TEP A;  2VT5 A;  2GHB A;  4N81 A;  1Y1M A;  4I9D A;  3S9N C;  3M3L A;  4KPT A;  3SET A;  3ILU B;  4HE0 A;  4IO4 A;  4GQO A;  2NOO A;  4X1B A;  3H03 A;  2F6G A;  1PB8 A;  3B6Q A;  3AXF A;  1NUW A;  4QFP A;  2PVU A;  1VFE A;  3HST A;  1FQB A;  1VSO A;  3PUZ E;  1O63 A;  1BK4 A;  4NF6 A;  3MBP A;  3OD7 A;  1LBB A;  2FVZ A;  4BLA A;  3FXR A;  1AOV A;  1JEV A;  1EZO A;  3U65 A;  2ZMB A;  4N6P A;  3U8Q A;  4GWZ A;  2FIX A;  1S9T A;  1II5 A;  2ONK E;  4OAN A;  2F78 A;  5DVI A;  3EF7 A;  4EQ7 A;  5IZ1 A;  3RPW A;  2CEX A;  5TP9 A;  1JW5 A;  2DQV A;  3E3K A;  1Y20 A;  1I69 A;  5ISU A;  1LCT A;  5ET6 A;  2DYX A;  5H8H B;  2VGQ A;  3ECR A;  4HXV A;  3USD A;  4KHZ E;  3M3K A;  2AL4 A;  3C36 A;  4X9T A;  1FPD A;  1MY0 A;  1IMF A;  3MAM A;  4LAT A;  1B0H A;  4H5G A;  3PUX E;  2ANJ A;  3V5A A;  4QSC A;  2R71 A;  1AH5 A;  4NGU A;  1JP4 A;  3DLN A;  2IA4 A;  2XD2 A;  4OA4 A;  1ZTY A;  4F1V A;  2HHM A;  2OCU A;  3UN6 A;  4IGT A;  1RKM A;  3MJN A;  5EQ7 A;  2G93 A;  4IR8 A;  3VV5 A;  4MX6 A;  3EKI A;  1B46 A;  2DS9 A;  4PQJ A;  4O3A A;  2REJ A;  3MWB A;  2DP8 A;  3IB0 A;  1LGB C;  5DEX A;  3MPL A;  1T0K A;  3TTR A;  4TQU Q;  1MXY A;  3K00 A;  3R7X A;  4NF0 A;  2I0C A;  5I2N B;  5IKB A;  2CZI A;  1SD3 A;  4NF5 B;  3SEY A;  1BIY A;  4O3B A;  4BDO A;  3RY3 A;  1H45 A;  4JVC A;  2B3F A;  2F7B A;  1URS A;  2HAV A;  3QIM A;  3FGS A;  3M3F A;  1NNK A;  5I56 B;  3PPO A;  1CNQ A;  4G4P A;  4MJO A;  4LP2 B;  1US4 A;  1J1N A;  5EYH A;  1FPK A;  5I57 B;  1EZ9 A;  2Q74 A;  4F2Q A;  2GRV A;  3UP9 A;  3BKI B;  3HHG A;  3ZKK A;  1IIW A;  1FBH A;  3U72 A;  5AA4 B;  1EYJ A;  4F2O A;  3K02 A;  3FD3 A;  1PB7 A;  4KYS A;  2RIN A;  4ZZE A;  3DEL B;  4LZ8 A;  4ZEB A;  2F35 A;  3TCH A;  4E0X A;  1SBP A;  4DXU A;  3I6V A;  3DP4 A;  1SW5 A;  3IOW A;  4FE8 A;  2DWI A;  4QBA A;  2GHA A;  4GX6 A;  5ICQ A;  5FTI A;  3T22 A;  1H76 A;  1XVY A;  1MH4 A;  1XHY A;  3GYY A;  1N7X A;  4JB7 A;  2NXO A;  5LOM A;  5FTH A;  4F3P A;  4OFJ A;  1IXI A;  3F11 A;  5DYH A;  1D9Q A;  1I6B A;  3CFL A;  3B7D A;  4NE4 A;  4OVS A;  1FTK A;  2QMW A;  4R9G A;  4G68 C;  4ISU A;  2V25 A;  4O94 A;  4XKP A;  3OO6 A;  4KYD A;  4IO2 A;  5H8Q B;  1MM7 A;  5ITP A;  1O7T A;  4HW8 A;  1B0L A;  1R9Q A;  1FBD A;  4NAP A;  1SW2 A;  2QS4 A;  4DLD A;  3EQ1 A;  1M5C A;  4H46 A;  5F7V A;  4R74 A;  3DP6 A;  3B8B A;  4PET A;  1HSL A;  4O3C A;  4GL8 A;  2H25 A;  1EU8 A;  4ZE9 A;  4PFU A;  2HZL A;  4RK9 A;  5B70 A;  3LC8 A;  1LST A;  1MXZ A;  2WYK A;  3RNN A;  4EUO A;  1Y3P A;  2WX9 A;  4OER A;  5BUU A;  1D9V A;  4LQ5 A;  1FPJ A;  3QUF A;  2Q8M A;  4RY1 A;  1I6Q A;  5IZ3 A;  2DWJ A;  4I3E A;  3RTW B;  4DXC A;  1IXC A;  5JEI A;  3IFA A;  1B3G A;  3CVG A;  3N6U A;  3U92 A;  3K6W A;  1MXX A;  2P3N A;  1N76 A;  1FTA A;  4OQO A;  4FJP A;  3UA8 A;  2RCA A;  1Q1K A;  1A40 A;  4N8G A;  3TDJ A;  4AQ4 A;  3PMX A;  1FQF A;  2Z8F A;  4NF5 A;  1ZKB A;  4XEQ A;  4PAI A;  4HTG A;  1LAG E;  2R8T A;  3FV1 A;  4YMA A;  3U93 A;  4YKP A;  2OX3 A;  4P47 A;  5EQ8 A;  3BFT A;  3JV9 A;  1ZIU A;  1M5F A;  1JNF A;  2ABH A;  2REG A;  2CEY A;  4F3S A;  1O64 A;  2HXW A;  2H5Y A;  3E9X A;  1NH8 A;  4X48 A;  3RYD A;  4OVQ A;  2O68 A;  4HCY A;  1RDX A;  5AA2 A;  4I8C A;  2Y7K A;  3T9H B;  5CMK A;  3G7W A;  1PB9 A;  2XA5 A;  1OMP A;  4RPN A;  2Q89 A;  2H9B A;  3TKD A;  1G0I A;  4NF6 B;  2XWO A;  4OEN A;  1MY1 A;  4GWU A;  2XX9 A;  4I3Y A;  5J1D A;  3WAF A;  2CZL A;  4Q5T A;  3EHT A;  2E1S A;  1MDQ A;  3FJM A;  4THI A;  3BIG A;  1IMB A;  2ZZX A;  3SER A;  2F97 A;  4I62 A;  4MNI A;  4PFR A;  4IY5 A;  4P3L A;  2XXQ A;  2DE3 A;  4RPO A;  4F22 A;  2XXI A;  5DTB A;  3FVN A;  4OHN A;  3FVK A;  1I6A A;  1FPG A;  2PFY A;  3H6V A;  3FXQ A;  2YPN A;  2XXW A;  1Y1Z A;  2AL5 A;  4JXI A;  1MQD A;  2O69 A;  2Z23 A;  4LN5 A;  4UAB A;  1N84 A;  3TTK A;  4GBW A;  3C32 A;  4IGR A;  3V89 B;  2XXT A;  3KZG A;  1JEU A;  2OZZ A;  2OWS A;  2H4I A;  3Q28 A;  3ILT B;  3ODB A;  1S50 A;  4XF5 A;  1DCU A;  1B58 A;  3OO8 A;  3QYT A;  1DTZ A;  4GFR A;  2HPG A;  2FNC A;  4DE8 A;  1NV2 A;  4FAJ A;  2FYI A;  3CRB A;  1VDW A;  1VFD A;  4U4S A;  3KFM A;  4Z0I A;  4YKI A;  3TQL A;  3DM0 A;  1EYK A;  5I5P A;  2F5X A;  5DEX B;  3BFU A;  4KQP A;  3KN7 A;  1NUY A;  3GLB A;  1LCF A;  2ONR A;  3FAS A;  4JSD A;  3O28 A;  1RDZ A;  2VP1 A;  4POW A;  4F1Y A;  4EQ9 A;  1OVT A;  3HO7 A;  1MM6 A;  1AWB A;  1FQA A;  1ZBM A;  4XKN A;  1NMU A;  1B3L A;  3B6T A;  3KOS A;  2QSX A;  1MPC A;  3T9X B;  4JWY A;  3T0J A;  1M5B A;  1B52 A;  2I0B A;  3G3F A;  1DMB A;  5EHS A;  1YTV A;  2XD3 A;  2Y7P A;  5EHM A;  4PAF A;  5CMM A;  1FPB A;  4BDR A;  3MW0 A;  2XXX A;  2F7C A;  3SZP A;  3PUW E;  3IO6 A;  1MXW A;  3TAJ A;  2QRY A;  1HSE A;  1G0H A;  2QVU A;  4Q8R A;  2DDK A;  2G29 A;  1ZLQ A;  1ATG A;  4XTC Q;  4MNP A;  2X7P A;  4GWO A;  3G3G A;  3IOT A;  4DI4 B;  2DSF A;  4MBP A;  4R9F A;  2YJP A;  4AB5 A;  1N04 A;  3H4Z A;  3MVY A;  1PBQ A;  5AA3 A;  2UXA A;  1RYX A;  1IMA A;  2ONS A;  4GX4 A;  3H3G A;  2F34 A;  1UTH A;  4PBH A;  1IZ1 A;  3T9V A;  3KGC A;  2PX1 A;  2P3V A;  1MXU A;  2RCB A;  4P8B A;  3E13 X;  4GWW A;  1XVX A;  4LQ2 A;  5K2X A;  1ZJL A;  2UYF A;  2RC8 A;  5H8N B;  1UQW A;  5L8D A;  4H67 A;  3KC1 A;  4XKQ A;  3PTY A;  3MZ9 A;  3IK6 B;  2P2A A;  1DPE A;  1NV6 A;  3PPP A;  1LAH E;  1VR5 A;  2Q2A A;  1ELJ A;  1P1O A;  4LVQ A;  1NUZ A;  1UIV A;  4UAC A;  3CFX A;  4ELQ A;  4KI0 E;  4IY6 A;  5HBC A;  2XWV A;  3RPL B;  3S2V A;  1RDY A;  4WKM A;  2OBG A;  4E0W A;  3KJT A;  1NNP A;  2QVR A;  1URG A;  2HFB A;  4NF8 A;  4IB2 A;  3Q27 A;  4G77 A;  3CIJ A;  3N94 A;  1SW4 A;  4R73 A;  4FOR A;  1FRP A;  5IZ3 B;  2ZXT A;  4M1V A;  2F7A A;  2V3T A;  3TOD A;  4PFY A;  1FTL A;  4GRK A;  4G8N A;  2F36 A;  1IIT A;  1MQJ A;  4I40 A;  4PP0 A;  4DZ1 A;  4F18 A;  1B40 A;  4C0R A;  4QSE A;  5DVF A;  1MXV A;  1NFT A;  2V3U A;  1MS7 A;  4R6H A;  5CMB A;  1NL5 A;  1MQH A;  1XC1 A;  3PUY E;  4MEV A;  4ZEK A;  3MVZ A;  1JVY A;  4OWD A;  1LB8 A;  1A99 A;  4GOT A;  4F29 A;  5CRY A;  4GBV A;  3U1O A;  4EF1 A;  4YIC A;  4F31 B;  3RQT A;  1GV8 A;  1UTB A;  1FBE A;  3KC0 A;  3RN8 A;  5I7I A;  3O9P A;  5KZT A;  4YB5 A;  3FIR A;  1F9B A;  5TPA B;  2Y7W A;  3PU5 A;  4U2R A;  5H8F A;  3IOR A;  2ZNU A;  2ZYO A;  3KN3 A;  4OFO A;  1GVC A;  1IMC A;  1M5E A;  3BIH A;  2ZYN A;  5AA2 B;  1XI6 A;  2ZZW A;  4QSD A;  3PMV A;  2F6P A;  4ZEC A;  4Q0C A;  1B3H A;  4KYE A;  1P99 A;  2Q9T A;  5FHM A;  1FPL A;  3G3H A;  2RF1 A;  1R9L A;  4XIG Q;  1JVX A;  1QJM A;  2UVJ A;  2FA7 A;  3HPI A;  3PUV E;  1HSJ A;  1N0T A;  2PT1 A;  4G68 A;  4G8M A;  4HS7 A;  4ND9 A;  1A8F A;  2Z22 A;  3A29 A;  3QXM A;  3TPA A;  1B1X A;  4OZ9 A;  4U1O A;  4PE3 A;  5H8N A;  4FEC A;  3FBP A;  2V93 A;  2Y7R A;  1LFG A;  4PGN A;  3IFC A;  3MP6 A;  1JW1 A;  3IR1 A;  2CMO A;  3ISP A;  2V4C A;  3PV0 E;  5HPQ A;  3O66 A;  3W15 C;  3H6T A;  2H98 A;  1SI0 A;  5DW8 A;  2XXY A;  4PBQ A;  1QUL A;  3RPL A;  1FQD A;  3HHF A;  1B05 A;  3FXU A;  2FIE A;  1B5H A;  2I4C A;  4QXD A;  1XOC A;  3RLF E;  4G2Z A;  4QFN A;  5ET5 A;  4RK2 A;  3RUM A;  3PD9 A;  1USY H;  3IB1 A;  3PD8 A;  2ZYM A;  5IM2 A;  4GD5 A;  1PEB A;  5AA1 A;  1NKX A;  1SI1 A;  1B9J A;  3VLV A;  5I2K B;  4TLL B;  2Q88 A;  1M5D A;  5L9M A;  2I58 A;  4K3F A;  4ZED A;  3S9E A;  2QJE A;  3QSL A;  2Y84 A;  2DVZ A;  3IOU A;  3A3U A;  2XXR A;  4PDH A;  5KDT A;  1FPI A;  1B2H A;  4U21 A;  3Q25 A;  2OWZ A;  4FIM A;  3P7I A;  4TLM B;  2UVI A;  3C31 A;  4JWO A;  1SQY A;  2HCA A;  2Y5L A;  5KCJ A;  1Y4T A;  4RJZ A;  3K2D A;  3T93 B;  1B5J A;  2W7Y A;  1LBZ A;  1B7U A;  3N6T A;  1UIU A;  4HCW A;  4C1T A;  2XXP A;  3EN3 A;  1TFA A;  4H6D A;  3G3I A;  4NTL A;  3VLW A;  5I59 A;  1D9Y A;  1Y9U A;  4QFK A;  4DDD A;  3MQ9 A;  1NV3 A;  5TPA A;  3RT6 B;  3T1B A;  4OYV A;  4H5F A;  4R2F A;  5IGA A;  1MDP 1;  4KD5 A;  3V8X B;  3KOT A;  5LDZ A;  4EXL A;  1MY3 A;  3UOR A;  1IQ7 A;  3H6U A;  3KSJ A;  1FW0 A;  1B32 A;  4IO5 A;  3O6H A;  3VDF A;  1FTJ A;  3R26 A;  2QPQ A;  3RTF B;  1NV1 A;  1SYH A;  5TU0 A;  2JJK A;  2F3B A;  4ECF A;  4X8R A;  3OXN A;  1IMD A;  2VD2 A;  2NVU B;  3KG2 A;  2GFE A;  5I58 A;  5L9O A;  1FQE A;  4P56 A;  1UTH B;  4ZDM A;  1LB9 A;  4JSO A;  3SEV A;  1LBC A;  2QS3 A;  1B4Z A;  3K6X A;  1ZU0 A;  4ZEI A;  1B51 A;  1DPP A;  2L5V A;  2X26 A;  5BWJ A;  4BDL A;  1Y3Q A;  4H65 A;  4AS4 A;  5B7D A;  2Y5K A;  4WED A;  3LSF B;  3KN8 A;  1D4N A;  4U23 A;  4N17 A;  1NV4 A;  2E0S A;  4FAT A;  1Y4C A;  1AMF A;  3M8U A;  1CB6 A;  2V84 A;  1ANF A;  4LA9 A;  3OSR A;  3K01 A;  4GWY A;  4RNS A;  2RC9 A;  2H99 A;  1FBC A;  2M8C A;  4XFE A;  2MKZ A;  1BP5 A;  1MRP A;  2HXR A;  3LSW A;  5A5L A;  5H8S A;  3SKP A;  1POT A;  4JWX A;  3NOH A;  3MVW A;  1D3K A;  3LSL A;  5EYG A;  4F19 A;  2Q8J A;  3VVD A;  4H8I A;  4NQ8 A;  3MZ1 A;  4YB7 A;  2BJI A;  3C33 A;  2IEE A;  5FHO A;  1MG1 A;  4NF8 B;  2Y7I A;  3O29 A;  4ZE8 A;  5F1Q A;  4RXL A;  4PCD A;  3EHU A;  4LZ7 A;  1QUJ A;  3E78 A;  4O7I A;  2RKM A;  4RA1 A;  5I2K A;  3CFZ A;  3SES A;  3PPQ A;  1KA0 A;  3UIF A;  4OES A;  1IXG A;  3CI8 A;  3VVE A;  3TZA A;  4MFI A;  4OVJ A;  5FBP A;  4ELO A;  4MIJ A;  1DK4 A;  5ET8 A;  1YZ0 A;  2DOJ A;  3IOV A;  3O2A A;  4LUB A;  1FPE A;  3CG1 A;  4JBZ A;  3MP1 A;  1B7H A;  3O6I A;  1MQG A;  3LUY A;  4ZEF A;  3FZV A;  4TOZ A;  1P1W A;  2ZNS A;  5ET7 A;  4BDQ A;  5T3J A;  1QW0 A;  4MF3 A;  1H44 A;  3E79 A;  1MPB A;  1UTB B;  4N4U A;  3PGF A;  1S7Y A;  1FSA A;  1A8E A;  1P1Q A;  4EDP A;  4KCC A;  2Q2C A;  3SEW A;  4MCO A;  1LFI A;  4WXJ A;  1ZMG A;  5H8F B;  1LFH A;  1H43 A;  1YPN A;  4GX3 A;  4ELR A;  1PDA A;  5AA2 D;  5I84 A;  1JET A;  2UYE A;  2GQ1 A;  4C1U A;  2LAO A;  4YKK A;  4R6K A;  4OVT A;  3Q26 A;  1N3X A;  4NHB A;  2I49 A;  1FTO A;  4ONY A;  3HN0 A;  2DVC A;  3SDF A;  4EXK A;  1JW4 A;  3IAZ A;  4BDN A;  4G8H A;  1CE2 A;  2VPO A;  4GXA A;  5CM6 A;  1YYZ A;  3UGW A;  2F8D A;  3DP8 A;  3IL1 B;  2O84 X;  1MPD A;  3I3V A;  4P0G A;  4G68 B;  4GLI A;  3MYU A;  3H06 B;  3QAX A;  3FJ7 A;  2HAU A;  1AL3 A;  4N6D A;  4GXS B;  2DXR A;  1Y3N A;  4KR5 A;  1EH3 A;  3OEL A;  1R1N A;  4JDF A;  4LON B;  5JTY A;  2O7I A;  4HE1 A;  3IX1 A;  4BDM A;  3S9L C;  3VE1 B;  2ZZV A;  4O8M A;  2KR0 A;  1FBF A;  4PC9 A;  4JVI A;  1QUK A;  5AE4 A;  3TYH A;  2A5T A;  2Z8D A;  4YB6 A;  2NWJ A;  2A5S A;  1INP A;  1TT1 A;  4YZZ A;  4U22 A;  1NNT A;  4F3G A;  3K1M A;  2QS1 A;  2O1M A;  3TTM A;  4OEU A;  2WEF A;  4DI3 D;  1LBW A;  3CSG A;  2XXH A;  1NV0 A;  3K1P A;  3K1N A;  2ESN A;  4OFL A;  4YKJ A;  2I3V A;  1QGX A;  2ALU A;  2B4L A;  3THI A;  3K6V A;  3U94 A;  3MP8 A;  1LLS A;  4QFL A;  1KA1 A;  2I3W A;  1MY2 A;  4H0W A;  1XT8 A;  4NF4 A;  3RGY A;  4RYA A;  4M4G A;  4R2B A;  4R72 A;  2CZH A;  5A5X A;  1FJ9 A;  2VD3 A;  4N6K A;  5KDT B;  4PGP A;  1NV5 A;  3GZG A;  5M2V A;  1SPI A;  4PDD A;  1B7Z A;  5LTC A;  3QUJ A;  2UVH A;  2VOZ A;  1FBG A;  4P9K A;  5KCJ B;  2WBD A;  2VHA A;  1DSN A;  3FVG A;  5FHN A;  1FQC A;  1SW1 A;  5F24 A;  1QVS A;  3CHG A;  4P1L A;  1PC3 A;  3Q29 A;  4HE2 A;  1R6Z A;  4PFW A;  3FJG A;  3TUS A;  3CSB A;  4PTK A;  5I59 B;  2NUV A;  2OWT A;  2ZNT A;  4KXP A;  1BKA A;  3W9W A;  1WOD A;  1LBY A;  2I4B A;  4NWC A;  4AB6 A;  4DCX A;  3MUQ A;  4P0I A;  3C34 A;  5I3S A;  2PT2 A;  4MH5 A;  2QS2 A;  1QKA A;  3FUZ A;  5ITO A;  3TEL A;  3H6W A;  5CBS A;  3W9V A;  3IB2 A;  2RC7 A;  3PMW A;  4ELP A;  1US5 A;  1K9Y A;  4H8J A;  2XWI A;  2AYS A;  2DXY A;  1OIB A;  3WAE A;  1FBP A;  1YCJ A;  4EF2 A;  1MQI A;  2DWA A;  1LBX A;  4YAH X;  4PFI A;  2QMX A;  2YLN A;  3MPK A;  4H1X A;  2O51 A;  5I58 B;  4MMP A;  1USY E;  2ZYK A;  4R6Y A;  3KBZ A;  4FEB A;  3V83 A;  3HV1 A;  3HFU A;  1B4H A;  3C4M A;  1NNF A;  3VXB A;  3L6H A;  3VFJ A;  3SEX A;  4MHF A;  1N7W A;  2XX8 A;  2X7Q A;  4OVP A;  2UVG A;  3GXA A;  1FCK A;  5EQ9 A;  4I1D A;  1NUX A;  1B3F A;  4N8Y A;  3LBS A;  4GL0 A;  4YU0 A;  4MNC A;  4U1Z A;  1MY4 A;  4X1D A;  2D3I A;  3FXB A;  5ICT A;  4OVR A;  3FAT A;  1FPF A;  2D5W A;  3OMB A;  4ZS9 A;  1LBV A;  4GWS A;  3KBR A;  3TFL A;  1POY 1;  1OVB A;  2VPN A;  2XXK A;  3K0V A;  5IAI A;  2XWK A;  4U4X A;  3IO4 A;  3JYR A;  2XX7 A;  4N07 A;  1QUI A;  2WBB A;  4OET A;  3OEK A;  3S4U A;  4L17 A;  1P1U A;  2OJT A;  3E4R A;  1XS5 A;  5CBR A;  2QL3 A;  3S9M C;  3MC2 A;  1NV7 A;  1LAF E;  5H8H A;  2Z8E A;  3GBA A;  1KWH A;  3BBR A;  4Q30 B;  1OLC A;  3G3J A;  2PBW A;  5EYF A;  3ONM A;  1GTK A;  4ESW A;  3B50 A;  3TTN A;  4X04 A;  3LSX A;  5IZZ A;  1PBP A;  4OTE A;  3TMG A;  4PFT A;  4Z7E A;  1LAX A;  3H7M A;  1IXH A;  1QKB A; 
#chains in the Genus database with same CATH homology
 4GIZ A;  2R9J A;  2DE4 A;  4UA8 A;  3D4G A;  1B1H A;  1GGG A;  3MVX A;  3TCF A;  2P1S A;  2O7U A;  3PPR A;  1B3E A;  3K6U A;  4YMB A;  3VXC A;  1OLA A;  4FED A;  5HM4 B;  3I5O A;  3N5L A;  3T9U A;  3HCQ A;  2XXV A;  4ESX A;  4GVO A;  3T66 A;  3RT8 A;  1TFD A;  4R75 A;  2BJJ X;  5I2N A;  5L9S A;  2PYY A;  4MLQ A;  3FVO A;  3O97 A;  3OSQ A;  2I6E A;  3TQW A;  1A7L A;  1WVJ A;  3N26 A;  5I56 A;  4F3B A;  3VLU A;  3C35 A;  5I57 A;  3R6U A;  4LZ5 A;  3G3K A;  1OQG A;  1BLF A;  4WEP A;  1DTG A;  3LR1 A;  2D21 A;  5CI5 A;  1IUD A;  5AA4 A;  2OK2 A;  1SYI A;  3EHS A;  3GBB A;  3FV2 A;  4N13 A;  3ZS6 A;  3QK6 A;  5CC2 A;  1Z7M E;  4POX A;  4NWD A;  1B5I A;  1L5T A;  3MZB A;  2HZK A;  3UK4 A;  4EQB A;  3OEN A;  1VE4 A;  3OOA A;  5JTY B;  2I48 A;  4DIG A;  2V3Q A;  2AIX A;  1TWY A;  1P1N A;  3K4U A;  4NED A;  3C9H A;  3SEU A;  3KSX A;  1JQF A;  4QHQ A;  2P0S A;  4PE5 B;  4ZZA A;  3TTL A;  3KEI A;  2KLF A;  2A5T B;  4NMY A;  5TP9 B;  2DE2 A;  3PPN A;  3L6G A;  1WDN A;  5H8Q A;  4IO7 A;  1EZP A;  1SVX B;  2WKY A;  3D4C A;  1Q35 A;  3KJ7 A;  5K2Y A;  1TXF A;  1H3D A;  2THI A;  3OO9 A;  3T96 B;  4QRZ A;  4P11 A;  1MH3 A;  1OQH A;  4IO3 A;  3OEM A;  3TCG A;  2O6A A;  3B6W A;  2XHD A;  4NF4 B;  4KFQ A;  5A5X B;  4F1U A;  5DT6 A;  3JZJ A;  1DOT A;  3O6G A;  1A54 A;  1FTM A;  3ZSF A;  2R6G E;  4DXB A;  2PMS A;  1Z7N E;  3EPE A;  4QF9 A;  4F39 A;  4OEV A;  2O1L A;  3A09 A;  1IEJ A;  2HEU A;  1A55 A;  4XKR A;  3VVF A;  5ELV A;  2B65 A;  4GF8 A;  3CG3 A;  4OXV A;  2HQ0 A;  4IO6 A;  3OO7 A;  4XXU A;  1URD A;  4DCY A;  1SDX A;  5DVJ A;  2OLB A;  1NH7 A;  2GH9 A;  2B3B A;  1N3W A;  2DWH A;  4MLV A;  4QFO A;  1B6H A;  1RYO A;  3IJX B;  1AIV A;  5JK4 A;  1BTJ A;  3CR9 A;  3IJO B;  2XXU A;  5CMC A;  4KCD A;  3ZKL A;  1YAE A;  1GR2 A;  4OMB A;  3A3C A;  3TEP A;  2GHB A;  1Y1M A;  4I9D A;  3S9N C;  3M3L A;  4KPT A;  3SET A;  3ILU B;  4IO4 A;  4GQO A;  2NOO A;  4X1B A;  3H03 A;  2F6G A;  1PB8 A;  3B6Q A;  3AXF A;  4QFP A;  2PVU A;  1VFE A;  3HST A;  1FQB A;  1VSO A;  3PUZ E;  1O63 A;  4NF6 A;  3MBP A;  3OD7 A;  1LBB A;  4BLA A;  3FXR A;  1AOV A;  1JEV A;  1EZO A;  2ZMB A;  4N6P A;  3U8Q A;  1S9T A;  1II5 A;  2ONK E;  2F78 A;  5DVI A;  3EF7 A;  4EQ7 A;  3RPW A;  5TP9 A;  1JW5 A;  2DQV A;  3E3K A;  1Y20 A;  1I69 A;  5ISU A;  1LCT A;  2DYX A;  5H8H B;  2VGQ A;  3ECR A;  3USD A;  4KHZ E;  3M3K A;  2AL4 A;  3C36 A;  4X9T A;  1MY0 A;  3MAM A;  4LAT A;  1B0H A;  4H5G A;  3PUX E;  2ANJ A;  3V5A A;  4QSC A;  2R71 A;  1AH5 A;  3DLN A;  2IA4 A;  2XD2 A;  1ZTY A;  4F1V A;  2OCU A;  3UN6 A;  4IGT A;  1RKM A;  3MJN A;  2G93 A;  3VV5 A;  1B46 A;  2DS9 A;  4PQJ A;  4O3A A;  2REJ A;  3MWB A;  2DP8 A;  3IB0 A;  1LGB C;  5DEX A;  3MPL A;  1T0K A;  3TTR A;  4TQU Q;  1MXY A;  3K00 A;  3R7X A;  2I0C A;  5I2N B;  5IKB A;  1SD3 A;  4NF5 B;  3SEY A;  1BIY A;  4O3B A;  4BDO A;  3RY3 A;  1H45 A;  2B3F A;  2F7B A;  1URS A;  2HAV A;  3QIM A;  3FGS A;  3M3F A;  1NNK A;  5I56 B;  3PPO A;  4G4P A;  4LP2 B;  1US4 A;  1J1N A;  5I57 B;  1EZ9 A;  4F2Q A;  2GRV A;  3UP9 A;  3BKI B;  3HHG A;  3ZKK A;  1IIW A;  3U72 A;  5AA4 B;  4F2O A;  3K02 A;  3FD3 A;  1PB7 A;  4KYS A;  2RIN A;  4ZZE A;  3DEL B;  4LZ8 A;  4ZEB A;  2F35 A;  3TCH A;  4E0X A;  1SBP A;  4DXU A;  3I6V A;  3DP4 A;  1SW5 A;  3IOW A;  4FE8 A;  2DWI A;  2GHA A;  5ICQ A;  5FTI A;  3T22 A;  1H76 A;  1XVY A;  1MH4 A;  1XHY A;  1N7X A;  4JB7 A;  2NXO A;  5LOM A;  5FTH A;  4F3P A;  4OFJ A;  1IXI A;  3F11 A;  5DYH A;  1I6B A;  3CFL A;  3B7D A;  4NE4 A;  1FTK A;  2QMW A;  4R9G A;  4G68 C;  4ISU A;  2V25 A;  4XKP A;  3OO6 A;  4KYD A;  4IO2 A;  5H8Q B;  1MM7 A;  5ITP A;  1O7T A;  4HW8 A;  1B0L A;  1R9Q A;  1SW2 A;  2QS4 A;  4DLD A;  3EQ1 A;  1M5C A;  5F7V A;  4R74 A;  3DP6 A;  4PET A;  1HSL A;  4O3C A;  4GL8 A;  2H25 A;  1EU8 A;  4ZE9 A;  4PFU A;  2HZL A;  4RK9 A;  5B70 A;  3LC8 A;  1LST A;  1MXZ A;  3RNN A;  4EUO A;  1Y3P A;  4OER A;  5BUU A;  1D9V A;  4LQ5 A;  3QUF A;  4RY1 A;  1I6Q A;  2DWJ A;  3RTW B;  4DXC A;  1IXC A;  5JEI A;  1B3G A;  3CVG A;  3N6U A;  3U92 A;  3K6W A;  1MXX A;  1N76 A;  4OQO A;  4FJP A;  3UA8 A;  2RCA A;  1Q1K A;  1A40 A;  3TDJ A;  4AQ4 A;  3PMX A;  1FQF A;  2Z8F A;  4NF5 A;  1ZKB A;  4HTG A;  1LAG E;  3FV1 A;  4YMA A;  3U93 A;  4YKP A;  3BFT A;  3JV9 A;  1ZIU A;  1M5F A;  1JNF A;  2ABH A;  2REG A;  4F3S A;  1O64 A;  2HXW A;  2H5Y A;  3E9X A;  1NH8 A;  4X48 A;  2O68 A;  4HCY A;  5AA2 A;  4I8C A;  2Y7K A;  3T9H B;  5CMK A;  3G7W A;  1PB9 A;  1OMP A;  4RPN A;  2Q89 A;  2H9B A;  3TKD A;  4NF6 B;  4OEN A;  1MY1 A;  2XX9 A;  5J1D A;  3WAF A;  2CZL A;  4Q5T A;  3EHT A;  2E1S A;  1MDQ A;  3FJM A;  4THI A;  3SER A;  2F97 A;  4I62 A;  4IY5 A;  2XXQ A;  2DE3 A;  4RPO A;  4F22 A;  2XXI A;  5DTB A;  3FVN A;  4OHN A;  3FVK A;  1I6A A;  3H6V A;  3FXQ A;  2YPN A;  2XXW A;  1Y1Z A;  2AL5 A;  4JXI A;  1MQD A;  2O69 A;  2Z23 A;  1N84 A;  3TTK A;  3C32 A;  4IGR A;  3V89 B;  2XXT A;  3KZG A;  1JEU A;  2OZZ A;  2OWS A;  2H4I A;  3Q28 A;  3ILT B;  3ODB A;  1S50 A;  1B58 A;  3OO8 A;  3QYT A;  1DTZ A;  4GFR A;  2FNC A;  4DE8 A;  4FAJ A;  2FYI A;  3CRB A;  1VFD A;  4U4S A;  3KFM A;  4Z0I A;  4YKI A;  3TQL A;  3DM0 A;  2F5X A;  5DEX B;  3BFU A;  4KQP A;  3KN7 A;  3GLB A;  1LCF A;  2ONR A;  3FAS A;  4JSD A;  3O28 A;  4POW A;  2VP1 A;  4F1Y A;  4EQ9 A;  1OVT A;  3HO7 A;  1MM6 A;  1ZBM A;  1FQA A;  4XKN A;  1NMU A;  1B3L A;  3B6T A;  3KOS A;  2QSX A;  1MPC A;  3T9X B;  4JWY A;  1M5B A;  1B52 A;  2I0B A;  3G3F A;  1DMB A;  5EHS A;  1YTV A;  2XD3 A;  2Y7P A;  5EHM A;  5CMM A;  4BDR A;  3MW0 A;  2XXX A;  2F7C A;  3PUW E;  3IO6 A;  1MXW A;  3TAJ A;  2QRY A;  1HSE A;  4Q8R A;  2G29 A;  1ZLQ A;  1ATG A;  4XTC Q;  2X7P A;  4GWO A;  3G3G A;  3IOT A;  2DSF A;  4MBP A;  4R9F A;  2YJP A;  4AB5 A;  1N04 A;  3H4Z A;  3MVY A;  1PBQ A;  5AA3 A;  2UXA A;  1RYX A;  2ONS A;  3H3G A;  2F34 A;  1UTH A;  1IZ1 A;  3T9V A;  3KGC A;  2PX1 A;  1MXU A;  2RCB A;  3E13 X;  1XVX A;  4LQ2 A;  5K2X A;  1ZJL A;  2UYF A;  2RC8 A;  5H8N B;  1UQW A;  5L8D A;  4H67 A;  4XKQ A;  3MZ9 A;  3IK6 B;  2P2A A;  1DPE A;  3PPP A;  1LAH E;  1VR5 A;  2Q2A A;  1ELJ A;  1P1O A;  4LVQ A;  1UIV A;  4UAC A;  3CFX A;  4ELQ A;  4KI0 E;  4IY6 A;  5HBC A;  3S2V A;  4WKM A;  2OBG A;  4E0W A;  3KJT A;  1NNP A;  1URG A;  2HFB A;  4NF8 A;  4IB2 A;  3Q27 A;  4G77 A;  3CIJ A;  3N94 A;  1SW4 A;  4R73 A;  4FOR A;  2ZXT A;  4M1V A;  2F7A A;  2V3T A;  3TOD A;  4PFY A;  1FTL A;  4GRK A;  4G8N A;  2F36 A;  1IIT A;  1MQJ A;  4PP0 A;  4DZ1 A;  4F18 A;  1B40 A;  4C0R A;  4QSE A;  5DVF A;  1MXV A;  1NFT A;  2V3U A;  1MS7 A;  4R6H A;  5CMB A;  1NL5 A;  1MQH A;  1XC1 A;  3PUY E;  4ZEK A;  3MVZ A;  1JVY A;  4OWD A;  1LB8 A;  1A99 A;  4GOT A;  4F29 A;  5CRY A;  3U1O A;  4EF1 A;  4YIC A;  4F31 B;  3RQT A;  1GV8 A;  1UTB A;  3RN8 A;  3O9P A;  5KZT A;  4YB5 A;  3FIR A;  1F9B A;  5TPA B;  2Y7W A;  3PU5 A;  4U2R A;  5H8F A;  3IOR A;  2ZNU A;  2ZYO A;  3KN3 A;  4OFO A;  1GVC A;  1M5E A;  2ZYN A;  5AA2 B;  4QSD A;  3PMV A;  2F6P A;  4ZEC A;  4Q0C A;  1B3H A;  4KYE A;  1P99 A;  2Q9T A;  5FHM A;  3G3H A;  2RF1 A;  1R9L A;  4XIG Q;  1JVX A;  1QJM A;  2UVJ A;  2FA7 A;  3HPI A;  3PUV E;  1HSJ A;  1N0T A;  2PT1 A;  4G68 A;  4G8M A;  4HS7 A;  4ND9 A;  1A8F A;  2Z22 A;  3QXM A;  3TPA A;  1B1X A;  4OZ9 A;  4U1O A;  5H8N A;  4FEC A;  2V93 A;  2Y7R A;  1LFG A;  3MP6 A;  1JW1 A;  3IR1 A;  2CMO A;  3PV0 E;  5HPQ A;  3O66 A;  3W15 C;  3H6T A;  2H98 A;  1SI0 A;  2XXY A;  1QUL A;  1FQD A;  3HHF A;  1B05 A;  3FXU A;  1B5H A;  2I4C A;  1XOC A;  3RLF E;  4G2Z A;  4QFN A;  4RK2 A;  3RUM A;  3PD9 A;  1USY H;  3IB1 A;  3PD8 A;  2ZYM A;  4GD5 A;  1PEB A;  5AA1 A;  1NKX A;  1SI1 A;  1B9J A;  3VLV A;  5I2K B;  4TLL B;  2Q88 A;  1M5D A;  5L9M A;  2I58 A;  4K3F A;  4ZED A;  3S9E A;  2QJE A;  3QSL A;  2Y84 A;  2DVZ A;  3IOU A;  3A3U A;  2XXR A;  5KDT A;  4U21 A;  1B2H A;  3Q25 A;  4FIM A;  3P7I A;  4TLM B;  2UVI A;  3C31 A;  4JWO A;  1SQY A;  2HCA A;  5KCJ A;  1Y4T A;  4RJZ A;  3K2D A;  3T93 B;  1B5J A;  2W7Y A;  1B7U A;  3N6T A;  1UIU A;  4HCW A;  4C1T A;  2XXP A;  3EN3 A;  1TFA A;  3VLW A;  3G3I A;  4H6D A;  4NTL A;  5I59 A;  1D9Y A;  1Y9U A;  4QFK A;  4DDD A;  3MQ9 A;  5TPA A;  3RT6 B;  4OYV A;  4H5F A;  4R2F A;  1MDP 1;  4KD5 A;  3V8X B;  3KOT A;  4EXL A;  1MY3 A;  3UOR A;  1IQ7 A;  3H6U A;  3KSJ A;  1FW0 A;  1B32 A;  4IO5 A;  3O6H A;  3VDF A;  1FTJ A;  3R26 A;  2QPQ A;  3RTF B;  1SYH A;  5TU0 A;  4ECF A;  3OXN A;  2VD2 A;  2NVU B;  3KG2 A;  2GFE A;  5I58 A;  5L9O A;  1FQE A;  4ZDM A;  1UTH B;  1LB9 A;  4JSO A;  3SEV A;  1LBC A;  2QS3 A;  1B4Z A;  3K6X A;  1ZU0 A;  4ZEI A;  1B51 A;  1DPP A;  2X26 A;  5BWJ A;  4BDL A;  1Y3Q A;  4H65 A;  5B7D A;  4WED A;  3LSF B;  3KN8 A;  1D4N A;  4U23 A;  2E0S A;  4FAT A;  1Y4C A;  1AMF A;  3M8U A;  1CB6 A;  2V84 A;  1ANF A;  4LA9 A;  3OSR A;  3K01 A;  4RNS A;  2RC9 A;  2H99 A;  2M8C A;  1BP5 A;  1MRP A;  3LSW A;  5H8S A;  3SKP A;  1POT A;  4JWX A;  3MVW A;  1D3K A;  3LSL A;  4F19 A;  2Q8J A;  3VVD A;  4H8I A;  4YB7 A;  3MZ1 A;  3C33 A;  2IEE A;  5FHO A;  1MG1 A;  4NF8 B;  2Y7I A;  3O29 A;  4ZE8 A;  5F1Q A;  4RXL A;  3EHU A;  4LZ7 A;  1QUJ A;  2RKM A;  4RA1 A;  5I2K A;  3CFZ A;  3SES A;  3PPQ A;  3UIF A;  4OES A;  1IXG A;  3CI8 A;  3VVE A;  3TZA A;  4MFI A;  4OVJ A;  4ELO A;  2DOJ A;  3IOV A;  3O2A A;  4LUB A;  3CG1 A;  4JBZ A;  3MP1 A;  1B7H A;  3O6I A;  1MQG A;  3LUY A;  4ZEF A;  3FZV A;  4TOZ A;  1P1W A;  2ZNS A;  4BDQ A;  1QW0 A;  4MF3 A;  1H44 A;  1MPB A;  1UTB B;  3PGF A;  1S7Y A;  1A8E A;  1P1Q A;  4EDP A;  4KCC A;  2Q2C A;  3SEW A;  1LFI A;  4WXJ A;  1ZMG A;  5H8F B;  1LFH A;  1H43 A;  1YPN A;  4ELR A;  1PDA A;  5AA2 D;  5I84 A;  1JET A;  2UYE A;  4C1U A;  2LAO A;  4YKK A;  4R6K A;  3Q26 A;  1N3X A;  2I49 A;  1FTO A;  4ONY A;  3HN0 A;  2DVC A;  3SDF A;  4EXK A;  1JW4 A;  3IAZ A;  4BDN A;  4G8H A;  1CE2 A;  4GXA A;  5CM6 A;  3UGW A;  2F8D A;  3DP8 A;  3IL1 B;  2O84 X;  1MPD A;  3I3V A;  4P0G A;  4G68 B;  4GLI A;  3H06 B;  3QAX A;  3FJ7 A;  2HAU A;  1AL3 A;  4GXS B;  2DXR A;  1Y3N A;  4KR5 A;  1EH3 A;  3OEL A;  1R1N A;  4JDF A;  4LON B;  5JTY A;  2O7I A;  3IX1 A;  4BDM A;  3S9L C;  3VE1 B;  1QUK A;  5AE4 A;  3TYH A;  2A5T A;  2Z8D A;  4YB6 A;  2NWJ A;  2A5S A;  1TT1 A;  4YZZ A;  4U22 A;  1NNT A;  4F3G A;  3K1M A;  2QS1 A;  2O1M A;  3TTM A;  4OEU A;  3CSG A;  2XXH A;  3K1P A;  3K1N A;  2ESN A;  4OFL A;  4YKJ A;  2I3V A;  2ALU A;  3THI A;  3K6V A;  3U94 A;  3MP8 A;  1LLS A;  4QFL A;  2I3W A;  1MY2 A;  4H0W A;  1XT8 A;  4NF4 A;  3RGY A;  4RYA A;  4M4G A;  4R2B A;  4R72 A;  5A5X A;  2VD3 A;  5KDT B;  3GZG A;  5M2V A;  1B7Z A;  3QUJ A;  2UVH A;  2VOZ A;  5KCJ B;  2VHA A;  1DSN A;  3FVG A;  5FHN A;  1FQC A;  1SW1 A;  1QVS A;  1PC3 A;  3Q29 A;  1R6Z A;  4PFW A;  3FJG A;  3TUS A;  3CSB A;  5I59 B;  2NUV A;  2OWT A;  2ZNT A;  1BKA A;  3W9W A;  1WOD A;  2I4B A;  4NWC A;  4AB6 A;  4DCX A;  3MUQ A;  4P0I A;  3C34 A;  2PT2 A;  4MH5 A;  2QS2 A;  1QKA A;  3FUZ A;  5ITO A;  3TEL A;  3H6W A;  5CBS A;  3W9V A;  3IB2 A;  2RC7 A;  3PMW A;  4ELP A;  1US5 A;  4H8J A;  2AYS A;  2DXY A;  1OIB A;  3WAE A;  1YCJ A;  4EF2 A;  1MQI A;  2DWA A;  4YAH X;  2QMX A;  2YLN A;  3MPK A;  4H1X A;  2O51 A;  5I58 B;  1USY E;  2ZYK A;  4R6Y A;  4FEB A;  3V83 A;  3HV1 A;  1B4H A;  3C4M A;  1NNF A;  3VXB A;  3L6H A;  3VFJ A;  3SEX A;  1N7W A;  2XX8 A;  2X7Q A;  2UVG A;  3GXA A;  1FCK A;  4I1D A;  1B3F A;  3LBS A;  4GL0 A;  4YU0 A;  4U1Z A;  1MY4 A;  4X1D A;  2D3I A;  5ICT A;  3FAT A;  2D5W A;  4ZS9 A;  3OMB A;  3KBR A;  3TFL A;  1POY 1;  1OVB A;  3K0V A;  5IAI A;  4U4X A;  3IO4 A;  3JYR A;  2XX7 A;  4N07 A;  1QUI A;  4OET A;  3OEK A;  3S4U A;  4L17 A;  1P1U A;  2OJT A;  3E4R A;  1XS5 A;  5CBR A;  2QL3 A;  3S9M C;  3MC2 A;  1LAF E;  5H8H A;  2Z8E A;  3GBA A;  1KWH A;  3BBR A;  4Q30 B;  1OLC A;  3G3J A;  2PBW A;  5EYF A;  3ONM A;  1GTK A;  4ESW A;  3TTN A;  3LSX A;  1PBP A;  4OTE A;  3TMG A;  4PFT A;  4Z7E A;  1LAX A;  3H7M A;  1IXH A;  1QKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...