2VD2A

The crystal structure of hisg from b. subtilis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
AMGKLLTMAMPKGRIFEEAAGLLRQAGYRLPEEFEDSRKLIIDVPEENLRFILAKPMDVTTYVEHGVADVGIAGKDVMLEEERDVYEVLDLNISKCHLAVAGLPNTDWSGVAPRIATKYPNVASSYFREQGEQVEIIKLNGSIELAPLIGLADRIVDIVSTGQTLKENGLVETEHICDITSRFIVNPVSYRMKDDVIDEMASRLSLVVEGET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Hisg from B. Subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords ATP PHOSPHORIBOSYLTRANSFERASE
total genus 52
structure length 212
sequence length 212
ec nomenclature ec 2.4.2.17: ATP phosphoribosyltransferase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01634 HisG ATP phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vd2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vd2A02
2D21A 1BIYA 4NE4A 5DEXA 1SW4A 1JW1A 5TP9A 3RNNA 2B3BA 4LUBA 3C9HA 3C34A 3MQ9A 1PDAA 1PB8A 4XKQA 2ZNSA 5TPAA 5CRYA 3FVGA 4JXIA 1GV8A 4DE8A 3TTKA 5FTIA 4WXJA 5AA1A 2Q8JA 1QJMA 3MBPA 3PMWA 3QYTA 3H6VA 5DTBA 1UIVA 4U1ZA 3H7MA 4YMAA 2O1LA 4F2OA 2I3WA 3FXRA 1QUIA 3TUSA 3CFXA 3CSGA 3LSXA 4OZ9A 2I3VA 4IY6A 3Q27A 2HFBA 4FORA 4QFLA 3RTWB 2ZYOA 4OESA 4P0IA 4UACA 2F5XA 3IOTA 1ATGA 4O3CA 4U22A 5FHMA 1YPNA 1OLAA 3KJ7A 4GRKA 3DLNA 1I6AA 3FGSA 3M3FA 4QFNA 2RF1A 3USDA 3PUYE 3T22A 1Y4CA 4THIA 5H8SA 4F1VA 3MVWA 2ZYMA 3N26A 1B3HA 4KI0E 4PFUA 4ISUA 5CM6A 1H76A 1IZ1A 1HSJA 1S50A 3IAZA 3K6UA 1O64A 2A5SA 2Q2AA 4LVQA 1BP5A 1TT1A 4BDOA 4G68B 3KBRA 4U23A 1SYIA 2PX1A 1L5TA 1TXFA 1ZIUA 3UP9A 4DIGA 3O97A 2DVZA 3S9LC 4OEUA 4F18A 1A55A 4RXLA 1PEBA 4BDRA 1MDP1 5L9MA 1O63A 2UYEA 2XXIA 2I4BA 1B5IA 4H0WA 4H8IA 3Q25A 3VLVA 4I62A 1P1WA 1NH7A 3LBSA 3M3KA 3PV0E 4I8CA 4KCCA 3PPQA 3UGWA 5BUUA 3HHFA 1EH3A 4TLLB 1D4NA 4HCYA 2HAVA 1I69A 2QS2A 3OO6A 3OXNA 3VE1B 4EQ9A 2H99A 1EU8A 3TTNA 2UVJA 4YKKA 3U1OA 3D4GA 1MY4A 4NF5A 1BKAA 3IL1B 5H8FA 1I6QA 4POXA 2REGA 2R71A 5KCJB 2KLFA 4G8HA 3N94A 3U72A 3L6GA 1B7ZA 3VVEA 3SEYA 1DTZA 5H8HB 3TCFA 2VGQA 3HO7A 5HPQA 4XIGQ 1NKXA 1ZKBA 3FATA 5I2KA 3K2DA 3QUJA 1LAHE 1FTLA 1VR5A 4IO6A 1LAXA 3T93B 3VLWA 2QMWA 4DXCA 3U8QA 2V93A 3C4MA 2DWIA 1NMUA 2WKYA 2THIA 1NNKA 4R9FA 5IAIA 1ZTYA 3CFZA 3LSFB 1N3XA 4ELQA 5F7VA 3RY3A 2D3IA 4XKRA 1EZOA 1PB9A 3PD9A 1OQGA 4ZEBA 3K02A 1B3LA 4AQ4A 5AA2B 4TLMB 2V3TA 1J1NA 4HTGA 4YB5A 3DP4A 3H6TA 5ICTA 4ZZEA 2YPNA 1B51A 2OJTA 4YICA 4PQJA 4BDMA 3H06B 3ILTB 3BKIB 4QFOA 1NNFA 3KN3A 2F6PA 1MH4A 2V84A 3PPRA 4R6YA 1IQ7A 3SERA 2NXOA 2ZXTA 4ZEKA 2XXPA 2DYXA 4GF8A 1B2HA 2A5TB 1URGA 3Q28A 2ONKE 2VP1A 2ZNUA 1LLSA 4X48A 3TELA 3HN0A 1B0LA 4H1XA 3N6TA 2DOJA 3PUVE 4O3BA 4ONYA 2UVHA 2RINA 3W9WA 2H25A 4KYSA 3RQTA 3TDJA 3DELB 4FE8A 4R6HA 1IIWA 2CZLA 2Z23A 3TQWA 4PP0A 3AXFA 3K1NA 4LA9A 1A99A 2B3FA 3A3UA 3IJXB 1B05A 1FQFA 4I1DA 1N04A 1Z7ME 2OWTA 2F8DA 3DP6A 1QULA 4OVJA 1Q35A 4F19A 1Y4TA 3GLBA 2O51A 3UN6A 2I4CA 2O6AA 4ND9A 2ONRA 1ZBMA 2F6GA 3B7DA 3T9VA 2DWAA 3TFLA 4YU0A 1B4ZA 1B5JA 2Q2CA 3KOSA 3O2AA 2UVIA 4JSOA 4EUOA 1IXCA 3N5LA 2QMXA 3ZSFA 1US4A 2Q9TA 1GR2A 4F22A 4H5FA 4MF3A 3TZAA 1AOVA 1AMFA 1A8FA 3TTMA 2I48A 4OENA 2DWHA 3GBAA 3MC2A 4OHNA 1MDQA 1XS5A 5HBCA 4Q8RA 3V5AA 2XXWA 4F3GA 1UTBA 2Y7RA 3IO6A 4YZZA 4FAJA 5BWJA 1PB7A 1BLFA 1SYHA 5CMBA 2F35A 4DZ1A 2HQ0A 3FV1A 1LSTA 2XX7A 2NVUB 2Z8EA 4OQOA 1YTVA 4U4XA 1MY2A 1NNTA 3C33A 1POTA 3QUFA 2ABHA 5AE4A 4G68A 4HCWA 3CVGA 2NUVA 4LZ7A 2PT2A 3FIRA 4F3SA 3S9EA 5ELVA 2OWSA 3C36A 1MY3A 1SDXA 3CR9A 4LZ8A 1POY1 3EHSA 5AA3A 1WVJA 1QVSA 1ZMGA 4QSDA 2F36A 3CSBA 1QKBA 2ZYNA 4JWXA 2DVCA 3PUWE 3U92A 3ZS6A 5CMCA 1IXHA 2XHDA 4C0RA 2QS4A 3T96B 5HM4B 1JEVA 2DQVA 4Q30B 1MY1A 3FD3A 1D3KA 3T9UA 3LSLA 5I57A 4G4PA 1B46A 4GQOA 3RTFB 2XXHA 3QXMA 2F78A 1GGGA 2H4IA 3BBRA 3KG2A 4OEVA 1VFEA 1XVYA 3OOAA 4JDFA 2ZNTA 3MZ1A 1SBPA 1RKMA 4XXUA 3Q29A 3UORA 4ESWA 5CMKA 1IUDA 2OLBA 1A54A 4BDLA 1DPEA 3OO9A 3RN8A 3U94A 2DXYA 4KQPA 3G7WA 4WEPA 5B70A 4F1YA 3A09A 3S9NC 3RLFE 4KYDA 1FQCA 1MQHA 3TYHA 3H03A 1N76A 2GRVA 3FJGA 4C1TA 1AH5A 1AL3A 3A3CA 3FVKA 3HCQA 5CMMA 4ZDMA 4ELOA 1TFAA 1R1NA 1USYE 2H9BA 3V83A 3IOWA 4EXKA 1MQDA 3FJMA 3S4UA 1OLCA 5DT6A 4RYAA 5I56A 3O66A 1LBBA 2B65A 5I84A 1BTJA 2ESNA 2OK2A 4LONB 3JV9A 3O29A 2I49A 3O9PA 4RK2A 4GWOA 1FCKA 4IB2A 1MQGA 1NFTA 3R26A 4EF1A 1I6BA 2ZMBA 2P1SA 3E13X 2W7YA 1B4HA 3IJOB 3N6UA 4HW8A 3ONMA 1SI0A 2O1MA 2QL3A 4KCDA 4BDQA 4EXLA 3Q26A 3OELA 3IORA 5K2YA 1B1HA 1R9QA 2H5YA 5L8DA 1S7YA 3C32A 1M5CA 2Y7KA 3EQ1A 3MAMA 3MPLA 1QKAA 4KR5A 1Y20A 3WAFA 3TAJA 1PC3A 3U93A 3G3IA 2GH9A 3MP8A 2G29A 1NH8A 3W9VA 1SVXB 5JTYB 4NTLA 4RA1A 1GTKA 1P99A 1B7HA 2XXTA 2QS3A 4N07A 3RGYA 3KN7A 1LFGA 3MJNA 2UYFA 2RCAA 1B3FA 5AA2A 4WKMA 1JETA 1US5A 4KPTA 3PUZE 1A7LA 2XXUA 4LQ5A 3DP8A 4YMBA 2O7UA 1RYXA 2QS1A 4N13A 1SQYA 1HSLA 2R9JA 4IO7A 4H5GA 4OTEA 3VXBA 3QIMA 4ZZAA 5LOMA 3KGCA 4IO3A 5CBRA 1ANFA 3LR1A 5FHOA 1A40A 4GXSB 1EZ9A 1PBPA 1OIBA 3KEIA 1B3GA 1XVXA 4NMYA 3PUXE 1B7UA 2O7IA 2PMSA 4I9DA 2UVGA 4JWYA 4LQ2A 3ECRA 3G3JA 3MZBA 3O6HA 2VHAA 4QFKA 1UTBB 3B6WA 2Z8FA 3H3GA 2BJJX 3G3HA 3TCHA 3EHTA 3DM0A 3PPOA 4LZ5A 4R73A 2PVUA 2VD3A 1MG1A 2DWJA 3BFTA 3P7IA 1SI1A 4R74A 3FXQA 2XX8A 3MVZA 4ZEFA 1GVCA 1MPCA 2ALUA 4IO5A 2FNCA 4JB7A 4FATA 1LAGE 2GHAA 3OO8A 2OBGA 2Q88A 3GZGA 2DE2A 3K1MA 2O69A 2ZYKA 5I2NB 4FEBA 4NWDA 1MRPA 3EHUA 3OD7A 5I58A 4EF2A 1XHYA 3S9MC 2RC8A 1UTHB 3MWBA 3SEWA 3TPAA 5JTYA 2O84X 4EQ7A 1T0KA 3VXCA 4QRZA 3G3GA 4GL8A 4MLVA 2OZZA 1OVTA 1JVYA 1B0HA 3K1PA 3VV5A 2FA7A 4F2QA 2D5WA 3RUMA 4XTCQ 3F11A 1SW1A 2AIXA 3FZVA 1SW5A 3CFLA 1LFIA 1OVBA 1S9TA 2Y7PA 3SDFA 1IXGA 3SEUA 5I59A 1LCTA 3KJTA 4LP2B 3RPWA 4OWDA 1AIVA 2A5TA 2H98A 2I0CA 1UIUA 1URSA 4GOTA 4PFTA 4U21A 2ONSA 3SESA 4IGTA 3FXUA 2Q89A 4ZEDA 1MPBA 2XXXA 3KSJA 4FJPA 4M1VA 4DDDA 3OMBA 2X7QA 4OFJA 3O6GA 2R6GE 3IOUA 4OXVA 4AB5A 5H8QA 3ZKKA 4DCXA 5KZTA 4G68C 2F7BA 2QRYA 3OEMA 3PD8A 5EHMA 4F39A 1FQBA 5AA2D 1IITA 5I59B 3TTRA 3T9HB 5ITOA 2NOOA 3B6QA 3BFUA 4RY1A 1Q1KA 1TFDA 2F7CA 3OENA 4NF6A 3IX1A 5DVFA 5FTHA 3T66A 4M4GA 3KOTA 4F3BA 1MH3A 5M2VA 3QAXA 2F97A 4FIMA 2XXVA 2I0BA 1UQWA 4OYVA 4TOZA 2F34A 4G77A 2V3UA 3HPIA 4POWA 3V89B 2LAOA 4PFWA 1JQFA 4RPNA 1B32A 3MVYA 1XOCA 1XT8A 1UTHA 2QSXA 3K4UA 3OEKA 3THIA 1XC1A 5L9SA 4H67A 3K6WA 4OMBA 1D9YA 1P1QA 3VVDA 1QUKA 1H44A 3VDFA 1N0TA 4X1BA 4ESXA 2HXWA 3KSXA 3H4ZA 3JYRA 3KZGA 3MP6A 1JW4A 1M5FA 5H8FB 3K6XA 1EZPA 4U2RA 2Y84A 1MXYA 1LB9A 1DOTA 4KYEA 1DSNA 3OO7A 3PMXA 1A8EA 1YCJA 4WEDA 4NF4B 4YKJA 1H45A 1Y3QA 5CI5A 5CBSA 4QFPA 1DPPA 5F1QA 1R6ZA 3TTLA 4DXUA 1PBQA 4JBZA 1B1XA 4K3FA 1ZU0A 3FASA 2RC7A 2DE3A 4F1UA 4F3PA 3TQLA 3W15C 4O3AA 3GXAA 3C35A 4ZECA 5A5XA 4X1DA 2QPQA 1R9LA 2XX9A 3G3KA 1LFHA 4X9TA 1M5DA 1B40A 1SD3A 3K01A 2E1SA 4DXBA 1NL5A 1WDNA 5I57B 3UIFA 3TKDA 3CI8A 3E9XA 3MVXA 4IGRA 2V3QA 3LC8A 3CIJA 3PGFA 4ZEIA 3T9XB 1Y9UA 3R6UA 5H8NB 4AB6A 2ANJA 1FTJA 3MP1A 1H3DA 3O28A 1MM6A 2HZKA 5DEXB 1JVXA 1P1NA 4JSDA 2G93A 3OSRA 4ZE9A 1YAEA 4GL0A 5I56B 4FEDA 4KFQA 4NF8A 4OFOA 4QHQA 5TPAB 3I3VA 1B3EA 3K0VA 3VVFA 4F31B 4G8MA 5TU0A 1FTMA 1USYH 2E0SA 1Z7NE 4JWOA 1B9JA 3E3KA 1NNPA 1HSEA 2NWJA 5TP9B 4GVOA 5AA4A 1Y3PA 1N7XA 3FJ7A 4H65A 4HS7A 4NF4A 4RPOA 3MUQA 2V25A 5JEIA 3I5OA 4XKPA 2XXRA 4R9GA 2DP8A 2DXRA 3MZ9A 2Z22A 1MPDA 2GFEA 3TEPA 4BDNA 1LCFA 2DE4A 2IA4A 2RC9A 4KHZE 4BLAA 1Y3NA 2CMOA 3PMVA 2Z8DA 4E0WA 5JK4A 1VSOA 2Y7WA 4GD5A 5EHSA 1LGBC 1RYOA 2QJEA 5H8HA 3PPNA 5K2XA 4DLDA 3KFMA 5I2NA 3UK4A 3IB2A 1Y1MA 4Q0CA 3C31A 4NF5B 1B58A 2DS9A 4G2ZA 5EYFA 2X26A 3PPPA 1MXUA 4R72A 4OERA 5L9OA 1N84A 5B7DA 3VLUA 4ECFA 5DVJA 5AA4B 3FV2A 4RJZA 4Z0IA 2VD2A 4RNSA 4DCYA 1IEJA 4R6KA 4H6DA 5KDTA 3VFJA 3H6WA 1MXVA 3MPKA 4G8NA 4ELRA 3D4CA 1SW2A 5ICQA 1OMPA 1JEUA 1O7TA 2AL5A 2O68A 3O6IA 4NEDA 5H8QB 3HSTA 1FW0A 3B6TA 3L6HA 1DTGA 4R2FA 1MXZA 1OQHA 3E4RA 1FQAA 4ELPA 1B6HA 5KCJA 4PE5B 4YAHX 4H8JA 1QW0A 2XXYA 1KWHA 3H6UA 3ILUB 4E0XA 1LAFE 3LSWA 4YKIA 3QK6A 3RT8A 5ISUA 4NF8B 1IXIA 3S2VA 4EDPA 2HZLA 3LUYA 3WAEA 2X7PA 1FTOA 1FTKA 1MQIA 1MXWA 1MY0A 3SETA 2PT1A 5CC2A 4YB6A 4ZS9A 3SEXA 3IK6B 1MS7A 3V8XB 2Y7IA 2YLNA 5J1DA 1MQJA 3IB1A 4P0GA 2XD3A 2PBWA 2FYIA 4QSCA 3QSLA 1B52A 1JNFA 3CRBA 4MLQA 4QSEA 3PU5A 3HHGA 4YKPA 5H8NA 3ZKLA 5I58B 2YJPA 4N6PA 5IKBA 2RKMA 1URDA 2OCUA 1VE4A 4QF9A 3ODBA 1P1OA 4TQUQ 3UA8A 2RCBA 2DSFA 4RK9A 5A5XB 1D9VA 1N3WA 3IR1A 4MFIA 3G3FA 3HV1A 1H43A 2AL4A 3M8UA 5DYHA 2F7AA 3K6VA 2AYSA 3I6VA 2GHBA 1N7WA 3CG1A 5FHNA 2P0SA 1QUJA 3OSQA 2I58A 3IB0A 4IY5A 4U4SA 4NWCA 1WODA 2HAUA 3RT6B 4EQBA 4GFRA 3SKPA 1B5HA 2UXAA 4KD5A 4Q5TA 1CE2A 3KN8A 3TCGA 3TODA 4OETA 5KDTB 4R2BA 1ZLQA 3GBBA 3FVOA 2PYYA 1II5A 4IO2A 2P2AA 1MM7A 4LATA 4OFLA 4UA8A 1F9BA 1M5EA 4MBPA 4PETA 4U1OA 4R75A 4XKNA 4C1UA 4MH5A 1JW5A 3R7XA 2XXQA 4L17A 3CG3A 3IO4A 3JZJA 1ELJA 1LB8A 3SEVA 3MW0A 3IOVA 4NF6B 1VFDA 2IEEA 3K00A 4PFYA 3EPEA 3FUZA 3EF7A 2REJA 1CB6A 4IO4A 3TMGA 4F29A 5I2KB 2VOZA 3M3LA 4P11A 1P1UA 4YB7A 1M5BA 1FQDA 1MXXA 1ZJLA 2XD2A 3FVNA 4FECA 5DVIA 1LBCA 2HEUA 2M8CA 4ZE8A 5ITPA 3EN3A 1TWYA 1FQEA 4GIZA 2HCAA 4Z7EA 4GXAA 2I6EA 1DMBA 4GLIA 1Y1ZA
chains in the Genus database with same CATH superfamily
1IMDA 1JW1A 3RNNA 1PB8A 5TPAA 3TTKA 2Q8JA 3PMWA 2FHYA 3TUSA 4PAKA 3CFXA 3CSGA 3LSXA 2I3VA 3Q27A 2HFBA 4UACA 3IOTA 5FHMA 1YPNA 4GX6A 2RF1A 3USDA 3N26A 4KI0E 1B3HA 1HSJA 3IAZA 4LVQA 2A5SA 3LV0A 4BDOA 3KBRA 1SYIA 3UP9A 4F18A 1A55A 1PEBA 5L9MA 2QVUA 2WYPA 4I62A 1P1WA 4KCCA 1LBVA 5ET7A 4TLLB 4HCYA 5EQ8A 1EU8A 4NF5A 2CEYA 2REGA 1FPFA 3SEYA 5H8HB 3HO7A 4XIGQ 1ZKBA 3FATA 3K2DA 3QUJA 3VLWA 5KZTA 2DWIA 4R9FA 5IAIA 3RPLA 5F7VA 3RY3A 2D3IA 4XKRA 3DP4A 4ZZEA 4P1LA 4PQJA 5EYHA 5EQ9A 4BDMA 3KN3A 2F6PA 4R6YA 2V84A 3PPRA 1NV6A 2NXOA 2DYXA 1URGA 2ONKE 1NV2A 4H1XA 4HXVA 3KC1A 3RQTA 3TDJA 3DELB 4FE8A 4R6HA 1A99A 3IJXB 1N04A 2OWTA 3DP6A 1Q35A 3GLBA 2O51A 5IZZA 4ND9A 1ZBMA 2CZIA 3TFLA 2Q2CA 3KOSA 3O2AA 1IXCA 1XI6A 2QMXA 1AMFA 2VPOA 3QMFA 3KBZA 3V5AA 5BWJA 1BLFA 4P3LA 5CMBA 2HQ0A 2ZZVA 2XX7A 2NVUB 3C33A 4G68A 5ELVA 3C36A 4LZ8A 1POY1 1QVSA 2OX3A 3ZS6A 3PUWE 2XHDA 2QS4A 3T96B 5HM4B 3FD3A 3QXMA 2F78A 1XVYA 3OOAA 4JDFA 3MZ1A 5CMKA 3OO9A 3U94A 2DXYA 3A09A 4KYDA 1FPKA 3TYHA 1N76A 4ZDMA 1USYE 1MQDA 5I7IA 5DT6A 4RYAA 1LBBA 2BJIA 1NUXA 3O29A 2I49A 3IJOB 3N6UA 1SI0A 2O1MA 5K2YA 2H5YA 3EQ1A 1M5CA 2GH9A 5JTYB 4NTLA 4RA1A 4N07A 1B7HA 2XXTA 3RGYA 1LFGA 1A7LA 1NUZA 1SPIA 1SQYA 1HSLA 4OTEA 2VPNA 2FBPA 4ZZAA 4IO3A 4MNIA 1PBPA 1OIBA 2PMSA 1LBXA 3ECRA 2VHAA 1UTBB 2BJJX 3G3HA 4GBVA 3DM0A 4R74A 2XX8A 1GVCA 4IO5A 2ALUA 2FNCA 2Q88A 4FEBA 3OD7A 5I58A 1IMEA 4EQ7A 1B0HA 2PFYA 4F2QA 3MSTA 1EYKA 1SW1A 1FPIA 1LFIA 1OVBA 5I59A 1LCTA 1LBWA 3KJTA 1AIVA 4PFTA 4U21A 1YZ0A 2ONSA 4IGTA 2Q89A 4FJPA 3KSJA 4M1VA 4MJOA 3ISPA 4G68C 4PF6A 3PD8A 5AA2D 1IITA 5I59B 3TTRA 1Q1KA 3T66A 4M4GA 4F3BA 4OYVA 2F34A 4QXDA 4POWA 1FJ9A 2XXKA 5L9SA 3VVDA 1P1QA 5H8FB 3K6XA 1EZPA 1DOTA 4WEDA 4NGUA 5CBSA 1DPPA 3TTLA 5IM2A 1ZU0A 4N6DA 4F1UA 3C35A 4ZECA 1M5DA 1B40A 3K01A 1EYIA 5I57B 3CI8A 1LBYA 4NG7A 1FTJA 3MP1A 1H3DA 3O28A 1P1NA 4JSDA 2G93A 2Q8MA 4ZE9A 1YAEA 4GL0A 4FEDA 3ROJA 3I3VA 4PAFA 3T1BA 4OVRA 4JWOA 4H65A 4NF4A 3MUQA 2V25A 3MZ9A 4P8BA 1MPDA 2GFEA 1LCFA 2B4MA 2RC9A 4BLAA 2Z8DA 5JK4A 5K2XA 5I2NA 3UK4A 1YXIA 2DS9A 4G2ZA 2X26A 4OERA 3VLUA 4MNCA 5A5LA 2CZHA 4H6DA 3H6WA 1MXVA 4G8NA 4AS5A 4ELRA 5ICQA 1OMPA 3B6TA 1LEVA 4ELPA 1B6HA 5KCJA 4PE5B 4YAHX 1KWHA 4E0XA 3RT8A 5ISUA 1MXWA 1MY0A 4ZS9A 3V8XB 1MS7A 5J1DA 3IB1A 4P0GA 2XD3A 4UABA 2PBWA 3QSLA 1B52A 5LDZA 3ZKLA 3HHGA 2YJPA 4N6PA 1URDA 3ODBA 3HV1A 1H43A 3K6VA 2GHBA 3CG1A 4IY5A 3RT6B 4EQBA 3SKPA 4Q5TA 3TODA 4OETA 5KDTB 3BIHA 1FBHA 3FVOA 2PYYA 4LATA 4OFLA 4R75A 4XF5A 2XXQA 4L17A 1ELJA 1LB8A 2IEEA 3EPEA 4NQ8A 3LUZA 4FECA 1M5BA 1FQDA 2XD2A 1JP4A 2XA5A 5ITPA 2I6EA 4GLIA 1BIYA 5DEXA 4DI4B 1SW4A 5IZ1A 3C34A 1PDAA 4XKQA 4DE8A 4WXJA 5AA1A 3QYTA 2P3NA 4F2OA 2I3WA 1QUIA 3RTWB 4OESA 4P0IA 2F5XA 1QGXA 1I6AA 4QFNA 2PFZA 1Y4CA 5CM6A 1H76A 1EYJA 1O64A 4G68B 3S9LC 4DIGA 2DVZA 4OEUA 4RXLA 1O63A 2UYEA 1B5IA 3Q25A 3VLVA 1FBEA 3M3KA 4I8CA 4EQ9A 2QS2A 3U1OA 3A29A 1MY4A 3IL1B 1IMCA 2KLFA 4G8HA 3U72A 3L6GA 1B7ZA 3VVEA 1DTZA 2VGQA 5HPQA 3T93B 4DXCA 1FTLA 4MX6A 4PAIA 1NNKA 3CFZA 3LSFB 1EZOA 3PD9A 1CNQA 4N91A 3H6TA 2YPNA 3BKIB 1K9YA 4PBQA 2VP1A 3TELA 3IFAA 1B0LA 4ONYA 2H25A 4KYSA 1IIWA 3A3UA 2L5VA 4I1DA 1Z7ME 4F19A 3B7DA 4YU0A 4JSOA 2Q9TA 1GR2A 1A8FA 2DWHA 3GBAA 5HBCA 4G61A 2XXWA 4F3GA 4O94A 1AWBA 1UTBA 2Y7RA 3FXBA 4OVTA 1PB7A 4H45A 1SYHA 2F35A 4PFIA 2Z8EA 1YTVA 4HE1A 3QUFA 2ABHA 4LZ7A 2PT2A 3NOHA 1WVJA 2KR0A 2F36A 2V4CA 3CSBA 2ZYNA 2DVCA 4C0RA 5CMCA 2DQVA 1MY1A 1B46A 3RTFB 1GGGA 3KG2A 1VFEA 3Q29A 4GX4A 1A54A 4BDLA 4KQPA 3G7WA 4F1YA 3S9NC 3H03A 1AH5A 1AL3A 3FVKA 5CMMA 2F3DA 4ELOA 3V83A 1OLCA 3O66A 2ESNA 3E79A 4LONB 3JV9A 3O9PA 4IB2A 1MQGA 3R26A 2ZMBA 3E13X 2W7YA 4KCDA 4EXLA 3IORA 1S7YA 4KR5A 3WAFA 3MPLA 1Y20A 2G29A 1NH8A 3W9VA 5CBRA 1GTKA 2QS3A 3KN7A 3CHGA 1BK4A 1D9QA 4KPTA 3PUZE 2XXUA 4LQ5A 1RYXA 4N13A 1NV0A 2CZKA 3QIMA 1ANFA 5FHOA 4GXSB 4JWYA 3G3JA 3MZBA 4I3EA 3B6WA 2Z8FA 3TCHA 4LZ5A 3PPOA 2PVUA 3P7IA 1MG1A 2DWJA 1Y1ZA 1SI1A 4I3YA 4FATA 1LAGE 2OBGA 3GZGA 1KA0A 1NV5A 2DE2A 2O69A 1FPDA 4EF2A 3S9MC 2RC8A 1UTHB 1DBZA 3MWBA 3G3GA 2OZZA 1JVYA 3K1PA 2FA7A 4N17A 2AIXA 5LTCA 4LP2B 4OWDA 1URSA 4ZEDA 5EQ7A 1FRPA 2X7QA 1RDZA 3ZKKA 2F7BA 4BDQA 3UA8A 5AE4A 3IX1A 3KOTA 1MH3A 5M2VA 3QAXA 2F97A 2V3UA 3E78A 3V89B 2LAOA 4PFWA 1JQFA 1KA1A 4O7MA 1QUKA 1H44A 1N0TA 4PFBA 4ESXA 2HXWA 3KSXA 3H4ZA 3JYRA 1JW4A 4U2RA 2Y84A 1DSNA 1A8EA 1YCJA 4YKJA 1H45A 1FJ6A 4P56A 4QBAA 3FASA 2RC7A 4O7IA 3TQLA 4O3AA 2QPQA 4HE0A 2JJKA 3UIFA 3TKDA 4IGRA 3PGFA 1FBPA 4OANA 2HHMA 1MM6A 2HZKA 5DEXB 5ET6A 1NV3A 5TPAB 1B3EA 1USYH 1Z7NE 5IGAA 1B9JA 5AA4A 1Y3PA 1N7XA 2Q74A 4N15A 2XWIA 5EYGA 2DXRA 5I3SA 2Z22A 1YYZA 2IA4A 2ZZWA 4I40A 4X8RA 3SZPA 1VSOA 4GD5A 3PPNA 3IB2A 1Y1MA 3C31A 4NF5B 1FTAA 4N6KA 4OVPA 5B7DA 4ECFA 3FV2A 4RJZA 4Z0IA 4RNSA 5KDTA 3MPKA 3D4CA 2O68A 4OVSA 2AL5A 4NEDA 3E4RA 1FQAA 4H8JA 2FVZA 3H6UA 1LAFE 3QK6A 3S2VA 3WAEA 1FTOA 1MQIA 3SETA 4MCOA 2B4LA 2FYIA 4QSCA 5H8NA 4QSEA 3PU5A 4YKPA 2RKMA 1VE4A 3FBPA 2DSFA 4PCDA 1D9VA 4OA4A 5DYHA 5FHNA 1QUJA 2I58A 4NWCA 4JVDA 3KN8A 4NF0A 1G0IA 4UA8A 4U1OA 4XKNA 4C1UA 1JW5A 3IO4A 3SEVA 3IOVA 1VFDA 3K00A 4PFYA 3FUZA 2REJA 5I2KB 3M3LA 1G0HA 1ZJLA 3FVNA 2XWKA 4GIZA 2HCAA 5ESYA 4LUBA 3C9HA 3MQ9A 2ZNSA 1GV8A 5FTIA 5AA3A 1QJMA 3MBPA 1Q9DA 4YMAA 4IY6A 4FORA 4QFLA 3VDFA 4O3CA 1ATGA 3FGSA 3PUYE 3T22A 4THIA 5H8SA 2DDKA 4F1VA 3MVWA 2ZYMA 4PFUA 4ISUA 1IZ1A 3K6UA 2Q2AA 4O8MA 1TT1A 4OVQA 1L5TA 2PX1A 5ET8A 3O97A 4BDRA 1MDP1 4H8IA 2I4BA 4MIJA 2HPGA 4PGNA 3PPQA 1EH3A 1D4NA 2Y5KA 3VE1B 3OXNA 2H99A 4YKKA 1BKAA 1I6QA 4POXA 4GX3A 1VR5A 3U8QA 2WKYA 1ZTYA 3RPLB 1PB9A 2WEFA 4ZEBA 1B3LA 4TLMB 4YB5A 5ICTA 2OJTA 3H06B 1FPGA 3ILTB 4QFOA 5DW8A 1NNFA 1MH4A 1IQ7A 4P47A 3SERA 2ZXTA 4GWWA 2VT5A 2XXPA 4GF8A 1B2HA 1KZ8A 3Q28A 2ZNUA 3HN0A 4O3BA 2DOJA 2Z23A 3TQWA 4PDDA 3AXFA 4LA9A 2B3FA 3B8BA 1FQFA 1QULA 3UN6A 2O6AA 4EUOA 2UVIA 3RYDA 3ZSFA 1US4A 4F22A 4H5FA 3TTMA 3MC2A 4OHNA 1XS5A 4PE3A 4Q8RA 1FBFA 4KXPA 4DZ1A 1MY2A 1NNTA 1POTA 4HCWA 3CVGA 4F3SA 2OWSA 3CR9A 1MY3A 1SDXA 3EHSA 2WBDA 1IXHA 1JEVA 3LSLA 5I57A 4G4PA 2GQ1A 4GQOA 2H4IA 3BBRA 2WYKA 2ZNTA 1SBPA 1RKMA 4XXUA 3UORA 4ESWA 1DPEA 3RN8A 5B70A 4WEPA 3RLFE 1FQCA 1MQHA 4C1TA 3A3CA 3HCQA 1TFAA 1R1NA 3IOWA 3S4UA 5I56A 2B65A 5I84A 1BTJA 1FPLA 2OK2A 4GWOA 1FCKA 1I6BA 2P1SA 4HW8A 2QL3A 5FBPA 4N8YA 1R9QA 3C32A 3MAMA 1QKAA 1FPBA 3TAJA 1PC3A 3MP8A 1SVXB 3MJNA 5AA2A 4WKMA 1US5A 4PTKA 4YMBA 4IO7A 4H5GA 3VXBA 5LOMA 3KGCA 4NN3A 3KEIA 4NMYA 1B3GA 1XVXA 2KQZA 3PUXE 4I9DA 4QFKA 4GWUA 3H3GA 3BFTA 3FXQA 4ZEFA 1MPCA 4JB7A 2GHAA 3K1MA 2ZYKA 4IR8A 5I2NB 4NWDA 1MRPA 4N4UA 3EHUA 1NI9A 3SEWA 5JTYA 2O84X 1T0KA 3VXCA 4GL8A 4MLVA 1OVTA 3VV5A 4PGPA 2D5WA 4XTCQ 3F11A 3CFLA 3SDFA 3SEUA 2A5TA 1UIUA 3FXUA 1MPBA 3OMBA 3O6GA 4OXVA 4DCXA 4AB5A 5H8QA 2QRYA 4F39A 1FQBA 4RY1A 3W15C 2F7CA 1TFDA 1RDYA 3OENA 5FTHA 2XXVA 2MKZA 1UQWA 4G77A 4RPNA 3MVYA 1XT8A 4OMBA 1D9YA 4GBWA 4X1BA 4MNPA 1M5FA 4KYEA 3OO7A 4NF4B 4X04A 4QFPA 5F1QA 4DXUA 1PBQA 1VDWA 1B1XA 4K3FA 2DE3A 4X1DA 1R9LA 2XX9A 1NUYA 4DXBA 3E9XA 2V3QA 3CIJA 3T0JA 3T9XB 5H8NB 3R6UA 5F24A 2ANJA 2WBBA 5EQAA 4NHBA 2FIEA 4KFQA 2XWVA 4PFRA 5TU0A 3E3KA 1HSEA 5TP9B 4GVOA 4RPOA 1NV1A 2XXRA 4R9GA 2DP8A 3TEPA 2DE4A 4E0WA 1DCUA 2XWOA 5EYFA 1B58A 3HFUA 1MXUA 4R72A 5L9OA 1N84A 1FBCA 2VD2A 1FSAA 4DCYA 1IEJA 3VFJA 1SW2A 1JEUA 3O6IA 2QFLA 1FW0A 3L6HA 1MXZA 3LSWA 4EDPA 2F3BA 2X7PA 5CC2A 1FTKA 4N81A 2YLNA 1MQJA 3PTYA 1JNFA 3CRBA 5IKBA 4QF9A 1P1OA 2RCBA 5A5XB 4GWYA 4MFIA 3M8UA 2AL4A 2F7AA 2AYSA 3I6VA 1N7WA 3IB0A 1B5HA 1CE2A 4R2BA 1ZLQA 1II5A 4IO2A 2P2AA 1MM7A 4PETA 3JZJA 3MW0A 4NF6B 3EF7A 1CB6A 4F29A 5DVIA 4EF1A 3MYUA 1LBCA 2M8CA 3IFCA 1TWYA 4Z7EA 1DMBA 2D21A 4GWXA 4NE4A 5TP9A 2B3BA 5CRYA 3FVGA 4JXIA 1FBGA 5DTBA 3H6VA 1UIVA 4U1ZA 3H7MA 2O1LA 3FXRA 4OZ9A 2ZYOA 4U22A 1OLAA 3KJ7A 4GRKA 3DLNA 3M3FA 2R8TA 1S50A 1BP5A 4U23A 1TXFA 1ZIUA 2XXIA 4H0WA 1NH7A 3LBSA 3PV0E 3UGWA 2OWZA 5BUUA 3HHFA 2HAVA 1I69A 3OO6A 3TTNA 2UVJA 3D4GA 5KCJB 5H8FA 2R71A 3N94A 3TCFA 2ZZXA 1NKXA 5I2KA 4IO6A 1LAHE 1LAXA 2QMWA 2V93A 3C4MA 1FPEA 1NMUA 2THIA 2CEXA 4ELQA 1N3XA 4MMPA 1OQGA 3K02A 4AQ4A 5AA2B 2V3TA 1J1NA 4HTGA 1B51A 4YICA 5IZ3A 2WX9A 4ZEKA 2A5TB 2P3VA 1LLSA 4X48A 5T3JA 3N6TA 3PUVE 2UVHA 2RINA 3W9WA 4XEQA 2CZLA 3BIGA 4PP0A 3K1NA 1INPA 1B05A 4OVJA 2F8DA 1Y4TA 2I4CA 2ONRA 2F6GA 4MHFA 3T9VA 2DWAA 1B4ZA 1B5JA 4MF3A 3TZAA 1AOVA 4PF8A 2I48A 4OENA 1MDQA 4FBPA 3IO6A 4YZZA 4FAJA 3FV1A 1LSTA 3B50A 4OQOA 4U4XA 2NUVA 4GWSA 3FIRA 3S9EA 1ZMGA 4QSDA 1QKBA 1RDXA 4JWXA 3U92A 4Q30B 3T9UA 1D3KA 2XXHA 4OEVA 1NV4A 1IUDA 2OLBA 5ET5A 2GRVA 3FJGA 1K9ZA 2H9BA 4EXKA 1IMAA 3FJMA 4XFEA 4RK2A 1NFTA 4H46A 4PDHA 1B4HA 3ONMA 3Q26A 3OELA 1B1HA 5L8DA 2Y7KA 3U93A 3G3IA 2Y5LA 1P99A 4P1EA 2UYFA 2RCAA 1B3FA 1JETA 3DP8A 2O7UA 2QS1A 4JVIA 2R9JA 3KC0A 3LR1A 1A40A 1EZ9A 1B7UA 2O7IA 2UVGA 4LQ2A 1LBZA 3O6HA 3EHTA 4R73A 4PC9A 2VD3A 3MVZA 3EKIA 3OO8A 1IMFA 1XHYA 3GYYA 3TPAA 4QRZA 4HE2A 4NX1A 3RUMA 3FZVA 1SW5A 1S9TA 2Y7PA 1IXGA 4NAPA 4JVCA 3RPWA 2I0CA 2H98A 3SESA 2QVVA 4GOTA 1NV7A 2XXXA 4DDDA 4OFJA 2R6GE 3IOUA 5IZ3B 3OEMA 5EHMA 3T9HB 5ITOA 2NOOA 3B6QA 3BFUA 5DVFA 4NF6A 1DK4A 4FIMA 2I0BA 4TOZA 5I5PA 3HPIA 3D1RA 1B32A 1XOCA 1UTHA 2QSXA 3K4UA 3OEKA 3THIA 1XC1A 4H67A 3K6WA 1FBDA 3MP6A 3KZGA 1MXYA 1LB9A 3PMXA 3U65A 1Y3QA 5CI5A 1R6ZA 4JBZA 4F3PA 3GXAA 5A5XA 3G3KA 1LFHA 4X9TA 1SD3A 2E1SA 4DI3D 4N8GA 1NL5A 1WDNA 3MVXA 4ZEIA 3LC8A 1NUWA 1Y9UA 4AB6A 1JVXA 3OSRA 5I56B 2HXRA 4NF8A 4OFOA 4QHQA 3K0VA 3VVFA 4F31B 4G8MA 1FTMA 2E0SA 1NNPA 1FPJA 2NWJA 3FJ7A 4HS7A 5JEIA 3I5OA 4XKPA 1IMBA 4BDNA 4KHZE 1Y3NA 2CMOA 3PMVA 2Y7WA 5EHSA 5H8HA 1LGBC 1RYOA 2QJEA 4DLDA 3KFMA 4Q0CA 3PPPA 5DVJA 5AA4B 4R6KA 4P9KA 1O7TA 5H8QB 3HSTA 4R2FA 1DTGA 1OQHA 4MEVA 1QW0A 2XXYA 3ILUB 4YKIA 4NF8B 1IXIA 2HZLA 3LUYA 2PT1A 4YB6A 3SEXA 3IK6B 2Y7IA 4MAGA 4AS4A 4MLQA 5I58B 4PBHA 2OCUA 4TQUQ 4RK9A 3IR1A 1N3WA 3G3FA 2P0SA 3OSQA 4U4SA 1WODA 2HAUA 4GFRA 2UXAA 4KD5A 2PCRA 2FIXA 3TCGA 2QVRA 3GBBA 1F9BA 1M5EA 4MBPA 4MH5A 3R7XA 3CG3A 4GWZA 4IO4A 4LN5A 3TMGA 2VOZA 4P11A 1P1UA 4YB7A 1MXXA 4ZE8A 5J16A 2HEUA 3EN3A 1FQEA 4GXAA 3N5LA
chains in the Genus database with same CATH topology
2D21A 1BIYA 4NE4A 5DEXA 1SW4A 1JW1A 5TP9A 3RNNA 2B3BA 4LUBA 3C9HA 3C34A 3MQ9A 1PDAA 1PB8A 4XKQA 2ZNSA 5TPAA 5CRYA 3FVGA 4JXIA 1GV8A 4DE8A 3TTKA 5FTIA 4WXJA 5AA1A 2Q8JA 1QJMA 3MBPA 3PMWA 3QYTA 3H6VA 5DTBA 1UIVA 4U1ZA 3H7MA 4YMAA 2O1LA 4F2OA 2I3WA 3FXRA 1QUIA 3TUSA 3CFXA 3CSGA 3LSXA 4OZ9A 2I3VA 4IY6A 3Q27A 2HFBA 4FORA 4QFLA 3RTWB 2ZYOA 4OESA 4P0IA 4UACA 2F5XA 3IOTA 1ATGA 4O3CA 4U22A 5FHMA 1YPNA 1OLAA 3KJ7A 4GRKA 3DLNA 1I6AA 3FGSA 3M3FA 4QFNA 2RF1A 3USDA 3PUYE 3T22A 1Y4CA 4THIA 5H8SA 4F1VA 3MVWA 2ZYMA 3N26A 1B3HA 4KI0E 4PFUA 4ISUA 5CM6A 1H76A 1IZ1A 1HSJA 1S50A 3IAZA 3K6UA 1O64A 2A5SA 2Q2AA 4LVQA 1BP5A 1TT1A 4BDOA 4G68B 3KBRA 4U23A 1SYIA 2PX1A 1L5TA 1TXFA 1ZIUA 3UP9A 4DIGA 3O97A 2DVZA 3S9LC 4OEUA 4F18A 1A55A 4RXLA 1PEBA 4BDRA 1MDP1 5L9MA 1O63A 2UYEA 2XXIA 2I4BA 1B5IA 4H0WA 4H8IA 3Q25A 3VLVA 4I62A 1P1WA 1NH7A 3LBSA 3M3KA 3PV0E 4I8CA 4KCCA 3PPQA 3UGWA 5BUUA 3HHFA 1EH3A 4TLLB 1D4NA 4HCYA 2HAVA 1I69A 2QS2A 3OO6A 3OXNA 3VE1B 4EQ9A 2H99A 1EU8A 3TTNA 2UVJA 4YKKA 3U1OA 3D4GA 1MY4A 4NF5A 1BKAA 3IL1B 5H8FA 1I6QA 4POXA 2REGA 2R71A 5KCJB 2KLFA 4G8HA 3N94A 3U72A 3L6GA 1B7ZA 3VVEA 3SEYA 1DTZA 5H8HB 3TCFA 2VGQA 3HO7A 5HPQA 4XIGQ 1NKXA 1ZKBA 3FATA 5I2KA 3K2DA 3QUJA 1LAHE 1FTLA 1VR5A 4IO6A 1LAXA 3T93B 3VLWA 2QMWA 4DXCA 3U8QA 2V93A 3C4MA 2DWIA 1NMUA 2WKYA 2THIA 1NNKA 4R9FA 5IAIA 1ZTYA 3CFZA 3LSFB 1N3XA 4ELQA 5F7VA 3RY3A 2D3IA 4XKRA 1EZOA 1PB9A 3PD9A 1OQGA 4ZEBA 3K02A 1B3LA 4AQ4A 5AA2B 4TLMB 2V3TA 1J1NA 4HTGA 4YB5A 3DP4A 3H6TA 5ICTA 4ZZEA 2YPNA 1B51A 2OJTA 4YICA 4PQJA 4BDMA 3H06B 3ILTB 3BKIB 4QFOA 1NNFA 3KN3A 2F6PA 1MH4A 2V84A 3PPRA 4R6YA 1IQ7A 3SERA 2NXOA 2ZXTA 4ZEKA 2XXPA 2DYXA 4GF8A 1B2HA 2A5TB 1URGA 3Q28A 2ONKE 2VP1A 2ZNUA 1LLSA 4X48A 3TELA 3HN0A 1B0LA 4H1XA 3N6TA 2DOJA 3PUVE 4O3BA 4ONYA 2UVHA 2RINA 3W9WA 2H25A 4KYSA 3RQTA 3TDJA 3DELB 4FE8A 4R6HA 1IIWA 2CZLA 2Z23A 3TQWA 4PP0A 3AXFA 3K1NA 4LA9A 1A99A 2B3FA 3A3UA 3IJXB 1B05A 1FQFA 4I1DA 1N04A 1Z7ME 2OWTA 2F8DA 3DP6A 1QULA 4OVJA 1Q35A 4F19A 1Y4TA 3GLBA 2O51A 3UN6A 2I4CA 2O6AA 4ND9A 2ONRA 1ZBMA 2F6GA 3B7DA 3T9VA 2DWAA 3TFLA 4YU0A 1B4ZA 1B5JA 2Q2CA 3KOSA 3O2AA 2UVIA 4JSOA 4EUOA 1IXCA 3N5LA 2QMXA 3ZSFA 1US4A 2Q9TA 1GR2A 4F22A 4H5FA 4MF3A 3TZAA 1AOVA 1AMFA 1A8FA 3TTMA 2I48A 4OENA 2DWHA 3GBAA 3MC2A 4OHNA 1MDQA 1XS5A 5HBCA 4Q8RA 3V5AA 2XXWA 4F3GA 1UTBA 2Y7RA 3IO6A 4YZZA 4FAJA 5BWJA 1PB7A 1BLFA 1SYHA 5CMBA 2F35A 4DZ1A 2HQ0A 3FV1A 1LSTA 2XX7A 2NVUB 2Z8EA 4OQOA 1YTVA 4U4XA 1MY2A 1NNTA 3C33A 1POTA 3QUFA 2ABHA 5AE4A 4G68A 4HCWA 3CVGA 2NUVA 4LZ7A 2PT2A 3FIRA 4F3SA 3S9EA 5ELVA 2OWSA 3C36A 1MY3A 1SDXA 3CR9A 4LZ8A 1POY1 3EHSA 5AA3A 1WVJA 1QVSA 1ZMGA 4QSDA 2F36A 3CSBA 1QKBA 2ZYNA 4JWXA 2DVCA 3PUWE 3U92A 3ZS6A 5CMCA 1IXHA 2XHDA 4C0RA 2QS4A 3T96B 5HM4B 1JEVA 2DQVA 4Q30B 1MY1A 3FD3A 1D3KA 3T9UA 3LSLA 5I57A 4G4PA 1B46A 4GQOA 3RTFB 2XXHA 3QXMA 2F78A 1GGGA 2H4IA 3BBRA 3KG2A 4OEVA 1VFEA 1XVYA 3OOAA 4JDFA 2ZNTA 3MZ1A 1SBPA 1RKMA 4XXUA 3Q29A 3UORA 4ESWA 5CMKA 1IUDA 2OLBA 1A54A 4BDLA 1DPEA 3OO9A 3RN8A 3U94A 2DXYA 4KQPA 3G7WA 4WEPA 5B70A 4F1YA 3A09A 3S9NC 3RLFE 4KYDA 1FQCA 1MQHA 3TYHA 3H03A 1N76A 2GRVA 3FJGA 4C1TA 1AH5A 1AL3A 3A3CA 3FVKA 3HCQA 5CMMA 4ZDMA 4ELOA 1TFAA 1R1NA 1USYE 2H9BA 3V83A 3IOWA 4EXKA 1MQDA 3FJMA 3S4UA 1OLCA 5DT6A 4RYAA 5I56A 3O66A 1LBBA 2B65A 5I84A 1BTJA 2ESNA 2OK2A 4LONB 3JV9A 3O29A 2I49A 3O9PA 4RK2A 4GWOA 1FCKA 4IB2A 1MQGA 1NFTA 3R26A 4EF1A 1I6BA 2ZMBA 2P1SA 3E13X 2W7YA 1B4HA 3IJOB 3N6UA 4HW8A 3ONMA 1SI0A 2O1MA 2QL3A 4KCDA 4BDQA 4EXLA 3Q26A 3OELA 3IORA 5K2YA 1B1HA 1R9QA 2H5YA 5L8DA 1S7YA 3C32A 1M5CA 2Y7KA 3EQ1A 3MAMA 3MPLA 1QKAA 4KR5A 1Y20A 3WAFA 3TAJA 1PC3A 3U93A 3G3IA 2GH9A 3MP8A 2G29A 1NH8A 3W9VA 1SVXB 5JTYB 4NTLA 4RA1A 1GTKA 1P99A 1B7HA 2XXTA 2QS3A 4N07A 3RGYA 3KN7A 1LFGA 3MJNA 2UYFA 2RCAA 1B3FA 5AA2A 4WKMA 1JETA 1US5A 4KPTA 3PUZE 1A7LA 2XXUA 4LQ5A 3DP8A 4YMBA 2O7UA 1RYXA 2QS1A 4N13A 1SQYA 1HSLA 2R9JA 4IO7A 4H5GA 4OTEA 3VXBA 3QIMA 4ZZAA 5LOMA 3KGCA 4IO3A 5CBRA 1ANFA 3LR1A 5FHOA 1A40A 4GXSB 1EZ9A 1PBPA 1OIBA 3KEIA 1B3GA 1XVXA 4NMYA 3PUXE 1B7UA 2O7IA 2PMSA 4I9DA 2UVGA 4JWYA 4LQ2A 3ECRA 3G3JA 3MZBA 3O6HA 2VHAA 4QFKA 1UTBB 3B6WA 2Z8FA 3H3GA 2BJJX 3G3HA 3TCHA 3EHTA 3DM0A 3PPOA 4LZ5A 4R73A 2PVUA 2VD3A 1MG1A 2DWJA 3BFTA 3P7IA 1SI1A 4R74A 3FXQA 2XX8A 3MVZA 4ZEFA 1GVCA 1MPCA 2ALUA 4IO5A 2FNCA 4JB7A 4FATA 1LAGE 2GHAA 3OO8A 2OBGA 2Q88A 3GZGA 2DE2A 3K1MA 2O69A 2ZYKA 5I2NB 4FEBA 4NWDA 1MRPA 3EHUA 3OD7A 5I58A 4EF2A 1XHYA 3S9MC 2RC8A 1UTHB 3MWBA 3SEWA 3TPAA 5JTYA 2O84X 4EQ7A 1T0KA 3VXCA 4QRZA 3G3GA 4GL8A 4MLVA 2OZZA 1OVTA 1JVYA 1B0HA 3K1PA 3VV5A 2FA7A 4F2QA 2D5WA 3RUMA 4XTCQ 3F11A 1SW1A 2AIXA 3FZVA 1SW5A 3CFLA 1LFIA 1OVBA 1S9TA 2Y7PA 3SDFA 1IXGA 3SEUA 5I59A 1LCTA 3KJTA 4LP2B 3RPWA 4OWDA 1AIVA 2A5TA 2H98A 2I0CA 1UIUA 1URSA 4GOTA 4PFTA 4U21A 2ONSA 3SESA 4IGTA 3FXUA 2Q89A 4ZEDA 1MPBA 2XXXA 3KSJA 4FJPA 4M1VA 4DDDA 3OMBA 2X7QA 4OFJA 3O6GA 2R6GE 3IOUA 4OXVA 4AB5A 5H8QA 3ZKKA 4DCXA 5KZTA 4G68C 2F7BA 2QRYA 3OEMA 3PD8A 5EHMA 4F39A 1FQBA 5AA2D 1IITA 5I59B 3TTRA 3T9HB 5ITOA 2NOOA 3B6QA 3BFUA 4RY1A 1Q1KA 1TFDA 2F7CA 3OENA 4NF6A 3IX1A 5DVFA 5FTHA 3T66A 4M4GA 3KOTA 4F3BA 1MH3A 5M2VA 3QAXA 2F97A 4FIMA 2XXVA 2I0BA 1UQWA 4OYVA 4TOZA 2F34A 4G77A 2V3UA 3HPIA 4POWA 3V89B 2LAOA 4PFWA 1JQFA 4RPNA 1B32A 3MVYA 1XOCA 1XT8A 1UTHA 2QSXA 3K4UA 3OEKA 3THIA 1XC1A 5L9SA 4H67A 3K6WA 4OMBA 1D9YA 1P1QA 3VVDA 1QUKA 1H44A 3VDFA 1N0TA 4X1BA 4ESXA 2HXWA 3KSXA 3H4ZA 3JYRA 3KZGA 3MP6A 1JW4A 1M5FA 5H8FB 3K6XA 1EZPA 4U2RA 2Y84A 1MXYA 1LB9A 1DOTA 4KYEA 1DSNA 3OO7A 3PMXA 1A8EA 1YCJA 4WEDA 4NF4B 4YKJA 1H45A 1Y3QA 5CI5A 5CBSA 4QFPA 1DPPA 5F1QA 1R6ZA 3TTLA 4DXUA 1PBQA 4JBZA 1B1XA 4K3FA 1ZU0A 3FASA 2RC7A 2DE3A 4F1UA 4F3PA 3TQLA 3W15C 4O3AA 3GXAA 3C35A 4ZECA 5A5XA 4X1DA 2QPQA 1R9LA 2XX9A 3G3KA 1LFHA 4X9TA 1M5DA 1B40A 1SD3A 3K01A 2E1SA 4DXBA 1NL5A 1WDNA 5I57B 3UIFA 3TKDA 3CI8A 3E9XA 3MVXA 4IGRA 2V3QA 3LC8A 3CIJA 3PGFA 4ZEIA 3T9XB 1Y9UA 3R6UA 5H8NB 4AB6A 2ANJA 1FTJA 3MP1A 1H3DA 3O28A 1MM6A 2HZKA 5DEXB 1JVXA 1P1NA 4JSDA 2G93A 3OSRA 4ZE9A 1YAEA 4GL0A 5I56B 4FEDA 4KFQA 4NF8A 4OFOA 4QHQA 5TPAB 3I3VA 1B3EA 3K0VA 3VVFA 4F31B 4G8MA 5TU0A 1FTMA 1USYH 2E0SA 1Z7NE 4JWOA 1B9JA 3E3KA 1NNPA 1HSEA 2NWJA 5TP9B 4GVOA 5AA4A 1Y3PA 1N7XA 3FJ7A 4H65A 4HS7A 4NF4A 4RPOA 3MUQA 2V25A 5JEIA 3I5OA 4XKPA 2XXRA 4R9GA 2DP8A 2DXRA 3MZ9A 2Z22A 1MPDA 2GFEA 3TEPA 4BDNA 1LCFA 2DE4A 2IA4A 2RC9A 4KHZE 4BLAA 1Y3NA 2CMOA 3PMVA 2Z8DA 4E0WA 5JK4A 1VSOA 2Y7WA 4GD5A 5EHSA 1LGBC 1RYOA 2QJEA 5H8HA 3PPNA 5K2XA 4DLDA 3KFMA 5I2NA 3UK4A 3IB2A 1Y1MA 4Q0CA 3C31A 4NF5B 1B58A 2DS9A 4G2ZA 5EYFA 2X26A 3PPPA 1MXUA 4R72A 4OERA 5L9OA 1N84A 5B7DA 3VLUA 4ECFA 5DVJA 5AA4B 3FV2A 4RJZA 4Z0IA 2VD2A 4RNSA 4DCYA 1IEJA 4R6KA 4H6DA 5KDTA 3VFJA 3H6WA 1MXVA 3MPKA 4G8NA 4ELRA 3D4CA 1SW2A 5ICQA 1OMPA 1JEUA 1O7TA 2AL5A 2O68A 3O6IA 4NEDA 5H8QB 3HSTA 1FW0A 3B6TA 3L6HA 1DTGA 4R2FA 1MXZA 1OQHA 3E4RA 1FQAA 4ELPA 1B6HA 5KCJA 4PE5B 4YAHX 4H8JA 1QW0A 2XXYA 1KWHA 3H6UA 3ILUB 4E0XA 1LAFE 3LSWA 4YKIA 3QK6A 3RT8A 5ISUA 4NF8B 1IXIA 3S2VA 4EDPA 2HZLA 3LUYA 3WAEA 2X7PA 1FTOA 1FTKA 1MQIA 1MXWA 1MY0A 3SETA 2PT1A 5CC2A 4YB6A 4ZS9A 3SEXA 3IK6B 1MS7A 3V8XB 2Y7IA 2YLNA 5J1DA 1MQJA 3IB1A 4P0GA 2XD3A 2PBWA 2FYIA 4QSCA 3QSLA 1B52A 1JNFA 3CRBA 4MLQA 4QSEA 3PU5A 3HHGA 4YKPA 5H8NA 3ZKLA 5I58B 2YJPA 4N6PA 5IKBA 2RKMA 1URDA 2OCUA 1VE4A 4QF9A 3ODBA 1P1OA 4TQUQ 3UA8A 2RCBA 2DSFA 4RK9A 5A5XB 1D9VA 1N3WA 3IR1A 4MFIA 3G3FA 3HV1A 1H43A 2AL4A 3M8UA 5DYHA 2F7AA 3K6VA 2AYSA 3I6VA 2GHBA 1N7WA 3CG1A 5FHNA 2P0SA 1QUJA 3OSQA 2I58A 3IB0A 4IY5A 4U4SA 4NWCA 1WODA 2HAUA 3RT6B 4EQBA 4GFRA 3SKPA 1B5HA 2UXAA 4KD5A 4Q5TA 1CE2A 3KN8A 3TCGA 3TODA 4OETA 5KDTB 4R2BA 1ZLQA 3GBBA 3FVOA 2PYYA 1II5A 4IO2A 2P2AA 1MM7A 4LATA 4OFLA 4UA8A 1F9BA 1M5EA 4MBPA 4PETA 4U1OA 4R75A 4XKNA 4C1UA 4MH5A 1JW5A 3R7XA 2XXQA 4L17A 3CG3A 3IO4A 3JZJA 1ELJA 1LB8A 3SEVA 3MW0A 3IOVA 4NF6B 1VFDA 2IEEA 3K00A 4PFYA 3EPEA 3FUZA 3EF7A 2REJA 1CB6A 4IO4A 3TMGA 4F29A 5I2KB 2VOZA 3M3LA 4P11A 1P1UA 4YB7A 1M5BA 1FQDA 1MXXA 1ZJLA 2XD2A 3FVNA 4FECA 5DVIA 1LBCA 2HEUA 2M8CA 4ZE8A 5ITPA 3EN3A 1TWYA 1FQEA 4GIZA 2HCAA 4Z7EA 4GXAA 2I6EA 1DMBA 4GLIA 1Y1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D21 A;  1BIY A;  4NE4 A;  5DEX A;  1SW4 A;  1JW1 A;  5TP9 A;  3RNN A;  2B3B A;  4LUB A;  3C9H A;  3C34 A;  3MQ9 A;  1PDA A;  1PB8 A;  4XKQ A;  2ZNS A;  5TPA A;  5CRY A;  3FVG A;  4JXI A;  1GV8 A;  4DE8 A;  3TTK A;  5FTI A;  4WXJ A;  5AA1 A;  2Q8J A;  1QJM A;  3MBP A;  3PMW A;  3QYT A;  3H6V A;  5DTB A;  1UIV A;  4U1Z A;  3H7M A;  4YMA A;  2O1L A;  4F2O A;  2I3W A;  3FXR A;  1QUI A;  3TUS A;  3CFX A;  3CSG A;  3LSX A;  4OZ9 A;  2I3V A;  4IY6 A;  3Q27 A;  2HFB A;  4FOR A;  4QFL A;  3RTW B;  2ZYO A;  4OES A;  4P0I A;  4UAC A;  2F5X A;  3IOT A;  1ATG A;  4O3C A;  4U22 A;  5FHM A;  1YPN A;  1OLA A;  3KJ7 A;  4GRK A;  3DLN A;  1I6A A;  3FGS A;  3M3F A;  4QFN A;  2RF1 A;  3USD A;  3PUY E;  3T22 A;  1Y4C A;  4THI A;  5H8S A;  4F1V A;  3MVW A;  2ZYM A;  3N26 A;  1B3H A;  4KI0 E;  4PFU A;  4ISU A;  5CM6 A;  1H76 A;  1IZ1 A;  1HSJ A;  1S50 A;  3IAZ A;  3K6U A;  1O64 A;  2A5S A;  2Q2A A;  4LVQ A;  1BP5 A;  1TT1 A;  4BDO A;  4G68 B;  3KBR A;  4U23 A;  1SYI A;  2PX1 A;  1L5T A;  1TXF A;  1ZIU A;  3UP9 A;  4DIG A;  3O97 A;  2DVZ A;  3S9L C;  4OEU A;  4F18 A;  1A55 A;  4RXL A;  1PEB A;  4BDR A;  1MDP 1;  5L9M A;  1O63 A;  2UYE A;  2XXI A;  2I4B A;  1B5I A;  4H0W A;  4H8I A;  3Q25 A;  3VLV A;  4I62 A;  1P1W A;  1NH7 A;  3LBS A;  3M3K A;  3PV0 E;  4I8C A;  4KCC A;  3PPQ A;  3UGW A;  5BUU A;  3HHF A;  1EH3 A;  4TLL B;  1D4N A;  4HCY A;  2HAV A;  1I69 A;  2QS2 A;  3OO6 A;  3OXN A;  3VE1 B;  4EQ9 A;  2H99 A;  1EU8 A;  3TTN A;  2UVJ A;  4YKK A;  3U1O A;  3D4G A;  1MY4 A;  4NF5 A;  1BKA A;  3IL1 B;  5H8F A;  1I6Q A;  4POX A;  2REG A;  2R71 A;  5KCJ B;  2KLF A;  4G8H A;  3N94 A;  3U72 A;  3L6G A;  1B7Z A;  3VVE A;  3SEY A;  1DTZ A;  5H8H B;  3TCF A;  2VGQ A;  3HO7 A;  5HPQ A;  4XIG Q;  1NKX A;  1ZKB A;  3FAT A;  5I2K A;  3K2D A;  3QUJ A;  1LAH E;  1FTL A;  1VR5 A;  4IO6 A;  1LAX A;  3T93 B;  3VLW A;  2QMW A;  4DXC A;  3U8Q A;  2V93 A;  3C4M A;  2DWI A;  1NMU A;  2WKY A;  2THI A;  1NNK A;  4R9F A;  5IAI A;  1ZTY A;  3CFZ A;  3LSF B;  1N3X A;  4ELQ A;  5F7V A;  3RY3 A;  2D3I A;  4XKR A;  1EZO A;  1PB9 A;  3PD9 A;  1OQG A;  4ZEB A;  3K02 A;  1B3L A;  4AQ4 A;  5AA2 B;  4TLM B;  2V3T A;  1J1N A;  4HTG A;  4YB5 A;  3DP4 A;  3H6T A;  5ICT A;  4ZZE A;  2YPN A;  1B51 A;  2OJT A;  4YIC A;  4PQJ A;  4BDM A;  3H06 B;  3ILT B;  3BKI B;  4QFO A;  1NNF A;  3KN3 A;  2F6P A;  1MH4 A;  2V84 A;  3PPR A;  4R6Y A;  1IQ7 A;  3SER A;  2NXO A;  2ZXT A;  4ZEK A;  2XXP A;  2DYX A;  4GF8 A;  1B2H A;  2A5T B;  1URG A;  3Q28 A;  2ONK E;  2VP1 A;  2ZNU A;  1LLS A;  4X48 A;  3TEL A;  3HN0 A;  1B0L A;  4H1X A;  3N6T A;  2DOJ A;  3PUV E;  4O3B A;  4ONY A;  2UVH A;  2RIN A;  3W9W A;  2H25 A;  4KYS A;  3RQT A;  3TDJ A;  3DEL B;  4FE8 A;  4R6H A;  1IIW A;  2CZL A;  2Z23 A;  3TQW A;  4PP0 A;  3AXF A;  3K1N A;  4LA9 A;  1A99 A;  2B3F A;  3A3U A;  3IJX B;  1B05 A;  1FQF A;  4I1D A;  1N04 A;  1Z7M E;  2OWT A;  2F8D A;  3DP6 A;  1QUL A;  4OVJ A;  1Q35 A;  4F19 A;  1Y4T A;  3GLB A;  2O51 A;  3UN6 A;  2I4C A;  2O6A A;  4ND9 A;  2ONR A;  1ZBM A;  2F6G A;  3B7D A;  3T9V A;  2DWA A;  3TFL A;  4YU0 A;  1B4Z A;  1B5J A;  2Q2C A;  3KOS A;  3O2A A;  2UVI A;  4JSO A;  4EUO A;  1IXC A;  3N5L A;  2QMX A;  3ZSF A;  1US4 A;  2Q9T A;  1GR2 A;  4F22 A;  4H5F A;  4MF3 A;  3TZA A;  1AOV A;  1AMF A;  1A8F A;  3TTM A;  2I48 A;  4OEN A;  2DWH A;  3GBA A;  3MC2 A;  4OHN A;  1MDQ A;  1XS5 A;  5HBC A;  4Q8R A;  3V5A A;  2XXW A;  4F3G A;  1UTB A;  2Y7R A;  3IO6 A;  4YZZ A;  4FAJ A;  5BWJ A;  1PB7 A;  1BLF A;  1SYH A;  5CMB A;  2F35 A;  4DZ1 A;  2HQ0 A;  3FV1 A;  1LST A;  2XX7 A;  2NVU B;  2Z8E A;  4OQO A;  1YTV A;  4U4X A;  1MY2 A;  1NNT A;  3C33 A;  1POT A;  3QUF A;  2ABH A;  5AE4 A;  4G68 A;  4HCW A;  3CVG A;  2NUV A;  4LZ7 A;  2PT2 A;  3FIR A;  4F3S A;  3S9E A;  5ELV A;  2OWS A;  3C36 A;  1MY3 A;  1SDX A;  3CR9 A;  4LZ8 A;  1POY 1;  3EHS A;  5AA3 A;  1WVJ A;  1QVS A;  1ZMG A;  4QSD A;  2F36 A;  3CSB A;  1QKB A;  2ZYN A;  4JWX A;  2DVC A;  3PUW E;  3U92 A;  3ZS6 A;  5CMC A;  1IXH A;  2XHD A;  4C0R A;  2QS4 A;  3T96 B;  5HM4 B;  1JEV A;  2DQV A;  4Q30 B;  1MY1 A;  3FD3 A;  1D3K A;  3T9U A;  3LSL A;  5I57 A;  4G4P A;  1B46 A;  4GQO A;  3RTF B;  2XXH A;  3QXM A;  2F78 A;  1GGG A;  2H4I A;  3BBR A;  3KG2 A;  4OEV A;  1VFE A;  1XVY A;  3OOA A;  4JDF A;  2ZNT A;  3MZ1 A;  1SBP A;  1RKM A;  4XXU A;  3Q29 A;  3UOR A;  4ESW A;  5CMK A;  1IUD A;  2OLB A;  1A54 A;  4BDL A;  1DPE A;  3OO9 A;  3RN8 A;  3U94 A;  2DXY A;  4KQP A;  3G7W A;  4WEP A;  5B70 A;  4F1Y A;  3A09 A;  3S9N C;  3RLF E;  4KYD A;  1FQC A;  1MQH A;  3TYH A;  3H03 A;  1N76 A;  2GRV A;  3FJG A;  4C1T A;  1AH5 A;  1AL3 A;  3A3C A;  3FVK A;  3HCQ A;  5CMM A;  4ZDM A;  4ELO A;  1TFA A;  1R1N A;  1USY E;  2H9B A;  3V83 A;  3IOW A;  4EXK A;  1MQD A;  3FJM A;  3S4U A;  1OLC A;  5DT6 A;  4RYA A;  5I56 A;  3O66 A;  1LBB A;  2B65 A;  5I84 A;  1BTJ A;  2ESN A;  2OK2 A;  4LON B;  3JV9 A;  3O29 A;  2I49 A;  3O9P A;  4RK2 A;  4GWO A;  1FCK A;  4IB2 A;  1MQG A;  1NFT A;  3R26 A;  4EF1 A;  1I6B A;  2ZMB A;  2P1S A;  3E13 X;  2W7Y A;  1B4H A;  3IJO B;  3N6U A;  4HW8 A;  3ONM A;  1SI0 A;  2O1M A;  2QL3 A;  4KCD A;  4BDQ A;  4EXL A;  3Q26 A;  3OEL A;  3IOR A;  5K2Y A;  1B1H A;  1R9Q A;  2H5Y A;  5L8D A;  1S7Y A;  3C32 A;  1M5C A;  2Y7K A;  3EQ1 A;  3MAM A;  3MPL A;  1QKA A;  4KR5 A;  1Y20 A;  3WAF A;  3TAJ A;  1PC3 A;  3U93 A;  3G3I A;  2GH9 A;  3MP8 A;  2G29 A;  1NH8 A;  3W9V A;  1SVX B;  5JTY B;  4NTL A;  4RA1 A;  1GTK A;  1P99 A;  1B7H A;  2XXT A;  2QS3 A;  4N07 A;  3RGY A;  3KN7 A;  1LFG A;  3MJN A;  2UYF A;  2RCA A;  1B3F A;  5AA2 A;  4WKM A;  1JET A;  1US5 A;  4KPT A;  3PUZ E;  1A7L A;  2XXU A;  4LQ5 A;  3DP8 A;  4YMB A;  2O7U A;  1RYX A;  2QS1 A;  4N13 A;  1SQY A;  1HSL A;  2R9J A;  4IO7 A;  4H5G A;  4OTE A;  3VXB A;  3QIM A;  4ZZA A;  5LOM A;  3KGC A;  4IO3 A;  5CBR A;  1ANF A;  3LR1 A;  5FHO A;  1A40 A;  4GXS B;  1EZ9 A;  1PBP A;  1OIB A;  3KEI A;  1B3G A;  1XVX A;  4NMY A;  3PUX E;  1B7U A;  2O7I A;  2PMS A;  4I9D A;  2UVG A;  4JWY A;  4LQ2 A;  3ECR A;  3G3J A;  3MZB A;  3O6H A;  2VHA A;  4QFK A;  1UTB B;  3B6W A;  2Z8F A;  3H3G A;  2BJJ X;  3G3H A;  3TCH A;  3EHT A;  3DM0 A;  3PPO A;  4LZ5 A;  4R73 A;  2PVU A;  2VD3 A;  1MG1 A;  2DWJ A;  3BFT A;  3P7I A;  1SI1 A;  4R74 A;  3FXQ A;  2XX8 A;  3MVZ A;  4ZEF A;  1GVC A;  1MPC A;  2ALU A;  4IO5 A;  2FNC A;  4JB7 A;  4FAT A;  1LAG E;  2GHA A;  3OO8 A;  2OBG A;  2Q88 A;  3GZG A;  2DE2 A;  3K1M A;  2O69 A;  2ZYK A;  5I2N B;  4FEB A;  4NWD A;  1MRP A;  3EHU A;  3OD7 A;  5I58 A;  4EF2 A;  1XHY A;  3S9M C;  2RC8 A;  1UTH B;  3MWB A;  3SEW A;  3TPA A;  5JTY A;  2O84 X;  4EQ7 A;  1T0K A;  3VXC A;  4QRZ A;  3G3G A;  4GL8 A;  4MLV A;  2OZZ A;  1OVT A;  1JVY A;  1B0H A;  3K1P A;  3VV5 A;  2FA7 A;  4F2Q A;  2D5W A;  3RUM A;  4XTC Q;  3F11 A;  1SW1 A;  2AIX A;  3FZV A;  1SW5 A;  3CFL A;  1LFI A;  1OVB A;  1S9T A;  2Y7P A;  3SDF A;  1IXG A;  3SEU A;  5I59 A;  1LCT A;  3KJT A;  4LP2 B;  3RPW A;  4OWD A;  1AIV A;  2A5T A;  2H98 A;  2I0C A;  1UIU A;  1URS A;  4GOT A;  4PFT A;  4U21 A;  2ONS A;  3SES A;  4IGT A;  3FXU A;  2Q89 A;  4ZED A;  1MPB A;  2XXX A;  3KSJ A;  4FJP A;  4M1V A;  4DDD A;  3OMB A;  2X7Q A;  4OFJ A;  3O6G A;  2R6G E;  3IOU A;  4OXV A;  4AB5 A;  5H8Q A;  3ZKK A;  4DCX A;  5KZT A;  4G68 C;  2F7B A;  2QRY A;  3OEM A;  3PD8 A;  5EHM A;  4F39 A;  1FQB A;  5AA2 D;  1IIT A;  5I59 B;  3TTR A;  3T9H B;  5ITO A;  2NOO A;  3B6Q A;  3BFU A;  4RY1 A;  1Q1K A;  1TFD A;  2F7C A;  3OEN A;  4NF6 A;  3IX1 A;  5DVF A;  5FTH A;  3T66 A;  4M4G A;  3KOT A;  4F3B A;  1MH3 A;  5M2V A;  3QAX A;  2F97 A;  4FIM A;  2XXV A;  2I0B A;  1UQW A;  4OYV A;  4TOZ A;  2F34 A;  4G77 A;  2V3U A;  3HPI A;  4POW A;  3V89 B;  2LAO A;  4PFW A;  1JQF A;  4RPN A;  1B32 A;  3MVY A;  1XOC A;  1XT8 A;  1UTH A;  2QSX A;  3K4U A;  3OEK A;  3THI A;  1XC1 A;  5L9S A;  4H67 A;  3K6W A;  4OMB A;  1D9Y A;  1P1Q A;  3VVD A;  1QUK A;  1H44 A;  3VDF A;  1N0T A;  4X1B A;  4ESX A;  2HXW A;  3KSX A;  3H4Z A;  3JYR A;  3KZG A;  3MP6 A;  1JW4 A;  1M5F A;  5H8F B;  3K6X A;  1EZP A;  4U2R A;  2Y84 A;  1MXY A;  1LB9 A;  1DOT A;  4KYE A;  1DSN A;  3OO7 A;  3PMX A;  1A8E A;  1YCJ A;  4WED A;  4NF4 B;  4YKJ A;  1H45 A;  1Y3Q A;  5CI5 A;  5CBS A;  4QFP A;  1DPP A;  5F1Q A;  1R6Z A;  3TTL A;  4DXU A;  1PBQ A;  4JBZ A;  1B1X A;  4K3F A;  1ZU0 A;  3FAS A;  2RC7 A;  2DE3 A;  4F1U A;  4F3P A;  3TQL A;  3W15 C;  4O3A A;  3GXA A;  3C35 A;  4ZEC A;  5A5X A;  4X1D A;  2QPQ A;  1R9L A;  2XX9 A;  3G3K A;  1LFH A;  4X9T A;  1M5D A;  1B40 A;  1SD3 A;  3K01 A;  2E1S A;  4DXB A;  1NL5 A;  1WDN A;  5I57 B;  3UIF A;  3TKD A;  3CI8 A;  3E9X A;  3MVX A;  4IGR A;  2V3Q A;  3LC8 A;  3CIJ A;  3PGF A;  4ZEI A;  3T9X B;  1Y9U A;  3R6U A;  5H8N B;  4AB6 A;  2ANJ A;  1FTJ A;  3MP1 A;  1H3D A;  3O28 A;  1MM6 A;  2HZK A;  5DEX B;  1JVX A;  1P1N A;  4JSD A;  2G93 A;  3OSR A;  4ZE9 A;  1YAE A;  4GL0 A;  5I56 B;  4FED A;  4KFQ A;  4NF8 A;  4OFO A;  4QHQ A;  5TPA B;  3I3V A;  1B3E A;  3K0V A;  3VVF A;  4F31 B;  4G8M A;  5TU0 A;  1FTM A;  1USY H;  2E0S A;  1Z7N E;  4JWO A;  1B9J A;  3E3K A;  1NNP A;  1HSE A;  2NWJ A;  5TP9 B;  4GVO A;  5AA4 A;  1Y3P A;  1N7X A;  3FJ7 A;  4H65 A;  4HS7 A;  4NF4 A;  4RPO A;  3MUQ A;  2V25 A;  5JEI A;  3I5O A;  4XKP A;  2XXR A;  4R9G A;  2DP8 A;  2DXR A;  3MZ9 A;  2Z22 A;  1MPD A;  2GFE A;  3TEP A;  4BDN A;  1LCF A;  2DE4 A;  2IA4 A;  2RC9 A;  4KHZ E;  4BLA A;  1Y3N A;  2CMO A;  3PMV A;  2Z8D A;  4E0W A;  5JK4 A;  1VSO A;  2Y7W A;  4GD5 A;  5EHS A;  1LGB C;  1RYO A;  2QJE A;  5H8H A;  3PPN A;  5K2X A;  4DLD A;  3KFM A;  5I2N A;  3UK4 A;  3IB2 A;  1Y1M A;  4Q0C A;  3C31 A;  4NF5 B;  1B58 A;  2DS9 A;  4G2Z A;  5EYF A;  2X26 A;  3PPP A;  1MXU A;  4R72 A;  4OER A;  5L9O A;  1N84 A;  5B7D A;  3VLU A;  4ECF A;  5DVJ A;  5AA4 B;  3FV2 A;  4RJZ A;  4Z0I A;  2VD2 A;  4RNS A;  4DCY A;  1IEJ A;  4R6K A;  4H6D A;  5KDT A;  3VFJ A;  3H6W A;  1MXV A;  3MPK A;  4G8N A;  4ELR A;  3D4C A;  1SW2 A;  5ICQ A;  1OMP A;  1JEU A;  1O7T A;  2AL5 A;  2O68 A;  3O6I A;  4NED A;  5H8Q B;  3HST A;  1FW0 A;  3B6T A;  3L6H A;  1DTG A;  4R2F A;  1MXZ A;  1OQH A;  3E4R A;  1FQA A;  4ELP A;  1B6H A;  5KCJ A;  4PE5 B;  4YAH X;  4H8J A;  1QW0 A;  2XXY A;  1KWH A;  3H6U A;  3ILU B;  4E0X A;  1LAF E;  3LSW A;  4YKI A;  3QK6 A;  3RT8 A;  5ISU A;  4NF8 B;  1IXI A;  3S2V A;  4EDP A;  2HZL A;  3LUY A;  3WAE A;  2X7P A;  1FTO A;  1FTK A;  1MQI A;  1MXW A;  1MY0 A;  3SET A;  2PT1 A;  5CC2 A;  4YB6 A;  4ZS9 A;  3SEX A;  3IK6 B;  1MS7 A;  3V8X B;  2Y7I A;  2YLN A;  5J1D A;  1MQJ A;  3IB1 A;  4P0G A;  2XD3 A;  2PBW A;  2FYI A;  4QSC A;  3QSL A;  1B52 A;  1JNF A;  3CRB A;  4MLQ A;  4QSE A;  3PU5 A;  3HHG A;  4YKP A;  5H8N A;  3ZKL A;  5I58 B;  2YJP A;  4N6P A;  5IKB A;  2RKM A;  1URD A;  2OCU A;  1VE4 A;  4QF9 A;  3ODB A;  1P1O A;  4TQU Q;  3UA8 A;  2RCB A;  2DSF A;  4RK9 A;  5A5X B;  1D9V A;  1N3W A;  3IR1 A;  4MFI A;  3G3F A;  3HV1 A;  1H43 A;  2AL4 A;  3M8U A;  5DYH A;  2F7A A;  3K6V A;  2AYS A;  3I6V A;  2GHB A;  1N7W A;  3CG1 A;  5FHN A;  2P0S A;  1QUJ A;  3OSQ A;  2I58 A;  3IB0 A;  4IY5 A;  4U4S A;  4NWC A;  1WOD A;  2HAU A;  3RT6 B;  4EQB A;  4GFR A;  3SKP A;  1B5H A;  2UXA A;  4KD5 A;  4Q5T A;  1CE2 A;  3KN8 A;  3TCG A;  3TOD A;  4OET A;  5KDT B;  4R2B A;  1ZLQ A;  3GBB A;  3FVO A;  2PYY A;  1II5 A;  4IO2 A;  2P2A A;  1MM7 A;  4LAT A;  4OFL A;  4UA8 A;  1F9B A;  1M5E A;  4MBP A;  4PET A;  4U1O A;  4R75 A;  4XKN A;  4C1U A;  4MH5 A;  1JW5 A;  3R7X A;  2XXQ A;  4L17 A;  3CG3 A;  3IO4 A;  3JZJ A;  1ELJ A;  1LB8 A;  3SEV A;  3MW0 A;  3IOV A;  4NF6 B;  1VFD A;  2IEE A;  3K00 A;  4PFY A;  3EPE A;  3FUZ A;  3EF7 A;  2REJ A;  1CB6 A;  4IO4 A;  3TMG A;  4F29 A;  5I2K B;  2VOZ A;  3M3L A;  4P11 A;  1P1U A;  4YB7 A;  1M5B A;  1FQD A;  1MXX A;  1ZJL A;  2XD2 A;  3FVN A;  4FEC A;  5DVI A;  1LBC A;  2HEU A;  2M8C A;  4ZE8 A;  5ITP A;  3EN3 A;  1TWY A;  1FQE A;  4GIZ A;  2HCA A;  4Z7E A;  4GXA A;  2I6E A;  1DMB A;  4GLI A;  1Y1Z A; 
#chains in the Genus database with same CATH topology
 1IMD A;  1JW1 A;  3RNN A;  1PB8 A;  5TPA A;  3TTK A;  2Q8J A;  3PMW A;  2FHY A;  3TUS A;  4PAK A;  3CFX A;  3CSG A;  3LSX A;  2I3V A;  3Q27 A;  2HFB A;  4UAC A;  3IOT A;  5FHM A;  1YPN A;  4GX6 A;  2RF1 A;  3USD A;  3N26 A;  4KI0 E;  1B3H A;  1HSJ A;  3IAZ A;  4LVQ A;  2A5S A;  3LV0 A;  4BDO A;  3KBR A;  1SYI A;  3UP9 A;  4F18 A;  1A55 A;  1PEB A;  5L9M A;  2QVU A;  2WYP A;  4I62 A;  1P1W A;  4KCC A;  1LBV A;  5ET7 A;  4TLL B;  4HCY A;  5EQ8 A;  1EU8 A;  4NF5 A;  2CEY A;  2REG A;  1FPF A;  3SEY A;  5H8H B;  3HO7 A;  4XIG Q;  1ZKB A;  3FAT A;  3K2D A;  3QUJ A;  3VLW A;  5KZT A;  2DWI A;  4R9F A;  5IAI A;  3RPL A;  5F7V A;  3RY3 A;  2D3I A;  4XKR A;  3DP4 A;  4ZZE A;  4P1L A;  4PQJ A;  5EYH A;  5EQ9 A;  4BDM A;  3KN3 A;  2F6P A;  4R6Y A;  2V84 A;  3PPR A;  1NV6 A;  2NXO A;  2DYX A;  1URG A;  2ONK E;  1NV2 A;  4H1X A;  4HXV A;  3KC1 A;  3RQT A;  3TDJ A;  3DEL B;  4FE8 A;  4R6H A;  1A99 A;  3IJX B;  1N04 A;  2OWT A;  3DP6 A;  1Q35 A;  3GLB A;  2O51 A;  5IZZ A;  4ND9 A;  1ZBM A;  2CZI A;  3TFL A;  2Q2C A;  3KOS A;  3O2A A;  1IXC A;  1XI6 A;  2QMX A;  1AMF A;  2VPO A;  3QMF A;  3KBZ A;  3V5A A;  5BWJ A;  1BLF A;  4P3L A;  5CMB A;  2HQ0 A;  2ZZV A;  2XX7 A;  2NVU B;  3C33 A;  4G68 A;  5ELV A;  3C36 A;  4LZ8 A;  1POY 1;  1QVS A;  2OX3 A;  3ZS6 A;  3PUW E;  2XHD A;  2QS4 A;  3T96 B;  5HM4 B;  3FD3 A;  3QXM A;  2F78 A;  1XVY A;  3OOA A;  4JDF A;  3MZ1 A;  5CMK A;  3OO9 A;  3U94 A;  2DXY A;  3A09 A;  4KYD A;  1FPK A;  3TYH A;  1N76 A;  4ZDM A;  1USY E;  1MQD A;  5I7I A;  5DT6 A;  4RYA A;  1LBB A;  2BJI A;  1NUX A;  3O29 A;  2I49 A;  3IJO B;  3N6U A;  1SI0 A;  2O1M A;  5K2Y A;  2H5Y A;  3EQ1 A;  1M5C A;  2GH9 A;  5JTY B;  4NTL A;  4RA1 A;  4N07 A;  1B7H A;  2XXT A;  3RGY A;  1LFG A;  1A7L A;  1NUZ A;  1SPI A;  1SQY A;  1HSL A;  4OTE A;  2VPN A;  2FBP A;  4ZZA A;  4IO3 A;  4MNI A;  1PBP A;  1OIB A;  2PMS A;  1LBX A;  3ECR A;  2VHA A;  1UTB B;  2BJJ X;  3G3H A;  4GBV A;  3DM0 A;  4R74 A;  2XX8 A;  1GVC A;  4IO5 A;  2ALU A;  2FNC A;  2Q88 A;  4FEB A;  3OD7 A;  5I58 A;  1IME A;  4EQ7 A;  1B0H A;  2PFY A;  4F2Q A;  3MST A;  1EYK A;  1SW1 A;  1FPI A;  1LFI A;  1OVB A;  5I59 A;  1LCT A;  1LBW A;  3KJT A;  1AIV A;  4PFT A;  4U21 A;  1YZ0 A;  2ONS A;  4IGT A;  2Q89 A;  4FJP A;  3KSJ A;  4M1V A;  4MJO A;  3ISP A;  4G68 C;  4PF6 A;  3PD8 A;  5AA2 D;  1IIT A;  5I59 B;  3TTR A;  1Q1K A;  3T66 A;  4M4G A;  4F3B A;  4OYV A;  2F34 A;  4QXD A;  4POW A;  1FJ9 A;  2XXK A;  5L9S A;  3VVD A;  1P1Q A;  5H8F B;  3K6X A;  1EZP A;  1DOT A;  4WED A;  4NGU A;  5CBS A;  1DPP A;  3TTL A;  5IM2 A;  1ZU0 A;  4N6D A;  4F1U A;  3C35 A;  4ZEC A;  1M5D A;  1B40 A;  3K01 A;  1EYI A;  5I57 B;  3CI8 A;  1LBY A;  4NG7 A;  1FTJ A;  3MP1 A;  1H3D A;  3O28 A;  1P1N A;  4JSD A;  2G93 A;  2Q8M A;  4ZE9 A;  1YAE A;  4GL0 A;  4FED A;  3ROJ A;  3I3V A;  4PAF A;  3T1B A;  4OVR A;  4JWO A;  4H65 A;  4NF4 A;  3MUQ A;  2V25 A;  3MZ9 A;  4P8B A;  1MPD A;  2GFE A;  1LCF A;  2B4M A;  2RC9 A;  4BLA A;  2Z8D A;  5JK4 A;  5K2X A;  5I2N A;  3UK4 A;  1YXI A;  2DS9 A;  4G2Z A;  2X26 A;  4OER A;  3VLU A;  4MNC A;  5A5L A;  2CZH A;  4H6D A;  3H6W A;  1MXV A;  4G8N A;  4AS5 A;  4ELR A;  5ICQ A;  1OMP A;  3B6T A;  1LEV A;  4ELP A;  1B6H A;  5KCJ A;  4PE5 B;  4YAH X;  1KWH A;  4E0X A;  3RT8 A;  5ISU A;  1MXW A;  1MY0 A;  4ZS9 A;  3V8X B;  1MS7 A;  5J1D A;  3IB1 A;  4P0G A;  2XD3 A;  4UAB A;  2PBW A;  3QSL A;  1B52 A;  5LDZ A;  3ZKL A;  3HHG A;  2YJP A;  4N6P A;  1URD A;  3ODB A;  3HV1 A;  1H43 A;  3K6V A;  2GHB A;  3CG1 A;  4IY5 A;  3RT6 B;  4EQB A;  3SKP A;  4Q5T A;  3TOD A;  4OET A;  5KDT B;  3BIH A;  1FBH A;  3FVO A;  2PYY A;  4LAT A;  4OFL A;  4R75 A;  4XF5 A;  2XXQ A;  4L17 A;  1ELJ A;  1LB8 A;  2IEE A;  3EPE A;  4NQ8 A;  3LUZ A;  4FEC A;  1M5B A;  1FQD A;  2XD2 A;  1JP4 A;  2XA5 A;  5ITP A;  2I6E A;  4GLI A;  1BIY A;  5DEX A;  4DI4 B;  1SW4 A;  5IZ1 A;  3C34 A;  1PDA A;  4XKQ A;  4DE8 A;  4WXJ A;  5AA1 A;  3QYT A;  2P3N A;  4F2O A;  2I3W A;  1QUI A;  3RTW B;  4OES A;  4P0I A;  2F5X A;  1QGX A;  1I6A A;  4QFN A;  2PFZ A;  1Y4C A;  5CM6 A;  1H76 A;  1EYJ A;  1O64 A;  4G68 B;  3S9L C;  4DIG A;  2DVZ A;  4OEU A;  4RXL A;  1O63 A;  2UYE A;  1B5I A;  3Q25 A;  3VLV A;  1FBE A;  3M3K A;  4I8C A;  4EQ9 A;  2QS2 A;  3U1O A;  3A29 A;  1MY4 A;  3IL1 B;  1IMC A;  2KLF A;  4G8H A;  3U72 A;  3L6G A;  1B7Z A;  3VVE A;  1DTZ A;  2VGQ A;  5HPQ A;  3T93 B;  4DXC A;  1FTL A;  4MX6 A;  4PAI A;  1NNK A;  3CFZ A;  3LSF B;  1EZO A;  3PD9 A;  1CNQ A;  4N91 A;  3H6T A;  2YPN A;  3BKI B;  1K9Y A;  4PBQ A;  2VP1 A;  3TEL A;  3IFA A;  1B0L A;  4ONY A;  2H25 A;  4KYS A;  1IIW A;  3A3U A;  2L5V A;  4I1D A;  1Z7M E;  4F19 A;  3B7D A;  4YU0 A;  4JSO A;  2Q9T A;  1GR2 A;  1A8F A;  2DWH A;  3GBA A;  5HBC A;  4G61 A;  2XXW A;  4F3G A;  4O94 A;  1AWB A;  1UTB A;  2Y7R A;  3FXB A;  4OVT A;  1PB7 A;  4H45 A;  1SYH A;  2F35 A;  4PFI A;  2Z8E A;  1YTV A;  4HE1 A;  3QUF A;  2ABH A;  4LZ7 A;  2PT2 A;  3NOH A;  1WVJ A;  2KR0 A;  2F36 A;  2V4C A;  3CSB A;  2ZYN A;  2DVC A;  4C0R A;  5CMC A;  2DQV A;  1MY1 A;  1B46 A;  3RTF B;  1GGG A;  3KG2 A;  1VFE A;  3Q29 A;  4GX4 A;  1A54 A;  4BDL A;  4KQP A;  3G7W A;  4F1Y A;  3S9N C;  3H03 A;  1AH5 A;  1AL3 A;  3FVK A;  5CMM A;  2F3D A;  4ELO A;  3V83 A;  1OLC A;  3O66 A;  2ESN A;  3E79 A;  4LON B;  3JV9 A;  3O9P A;  4IB2 A;  1MQG A;  3R26 A;  2ZMB A;  3E13 X;  2W7Y A;  4KCD A;  4EXL A;  3IOR A;  1S7Y A;  4KR5 A;  3WAF A;  3MPL A;  1Y20 A;  2G29 A;  1NH8 A;  3W9V A;  5CBR A;  1GTK A;  2QS3 A;  3KN7 A;  3CHG A;  1BK4 A;  1D9Q A;  4KPT A;  3PUZ E;  2XXU A;  4LQ5 A;  1RYX A;  4N13 A;  1NV0 A;  2CZK A;  3QIM A;  1ANF A;  5FHO A;  4GXS B;  4JWY A;  3G3J A;  3MZB A;  4I3E A;  3B6W A;  2Z8F A;  3TCH A;  4LZ5 A;  3PPO A;  2PVU A;  3P7I A;  1MG1 A;  2DWJ A;  1Y1Z A;  1SI1 A;  4I3Y A;  4FAT A;  1LAG E;  2OBG A;  3GZG A;  1KA0 A;  1NV5 A;  2DE2 A;  2O69 A;  1FPD A;  4EF2 A;  3S9M C;  2RC8 A;  1UTH B;  1DBZ A;  3MWB A;  3G3G A;  2OZZ A;  1JVY A;  3K1P A;  2FA7 A;  4N17 A;  2AIX A;  5LTC A;  4LP2 B;  4OWD A;  1URS A;  4ZED A;  5EQ7 A;  1FRP A;  2X7Q A;  1RDZ A;  3ZKK A;  2F7B A;  4BDQ A;  3UA8 A;  5AE4 A;  3IX1 A;  3KOT A;  1MH3 A;  5M2V A;  3QAX A;  2F97 A;  2V3U A;  3E78 A;  3V89 B;  2LAO A;  4PFW A;  1JQF A;  1KA1 A;  4O7M A;  1QUK A;  1H44 A;  1N0T A;  4PFB A;  4ESX A;  2HXW A;  3KSX A;  3H4Z A;  3JYR A;  1JW4 A;  4U2R A;  2Y84 A;  1DSN A;  1A8E A;  1YCJ A;  4YKJ A;  1H45 A;  1FJ6 A;  4P56 A;  4QBA A;  3FAS A;  2RC7 A;  4O7I A;  3TQL A;  4O3A A;  2QPQ A;  4HE0 A;  2JJK A;  3UIF A;  3TKD A;  4IGR A;  3PGF A;  1FBP A;  4OAN A;  2HHM A;  1MM6 A;  2HZK A;  5DEX B;  5ET6 A;  1NV3 A;  5TPA B;  1B3E A;  1USY H;  1Z7N E;  5IGA A;  1B9J A;  5AA4 A;  1Y3P A;  1N7X A;  2Q74 A;  4N15 A;  2XWI A;  5EYG A;  2DXR A;  5I3S A;  2Z22 A;  1YYZ A;  2IA4 A;  2ZZW A;  4I40 A;  4X8R A;  3SZP A;  1VSO A;  4GD5 A;  3PPN A;  3IB2 A;  1Y1M A;  3C31 A;  4NF5 B;  1FTA A;  4N6K A;  4OVP A;  5B7D A;  4ECF A;  3FV2 A;  4RJZ A;  4Z0I A;  4RNS A;  5KDT A;  3MPK A;  3D4C A;  2O68 A;  4OVS A;  2AL5 A;  4NED A;  3E4R A;  1FQA A;  4H8J A;  2FVZ A;  3H6U A;  1LAF E;  3QK6 A;  3S2V A;  3WAE A;  1FTO A;  1MQI A;  3SET A;  4MCO A;  2B4L A;  2FYI A;  4QSC A;  5H8N A;  4QSE A;  3PU5 A;  4YKP A;  2RKM A;  1VE4 A;  3FBP A;  2DSF A;  4PCD A;  1D9V A;  4OA4 A;  5DYH A;  5FHN A;  1QUJ A;  2I58 A;  4NWC A;  4JVD A;  3KN8 A;  4NF0 A;  1G0I A;  4UA8 A;  4U1O A;  4XKN A;  4C1U A;  1JW5 A;  3IO4 A;  3SEV A;  3IOV A;  1VFD A;  3K00 A;  4PFY A;  3FUZ A;  2REJ A;  5I2K B;  3M3L A;  1G0H A;  1ZJL A;  3FVN A;  2XWK A;  4GIZ A;  2HCA A;  5ESY A;  4LUB A;  3C9H A;  3MQ9 A;  2ZNS A;  1GV8 A;  5FTI A;  5AA3 A;  1QJM A;  3MBP A;  1Q9D A;  4YMA A;  4IY6 A;  4FOR A;  4QFL A;  3VDF A;  4O3C A;  1ATG A;  3FGS A;  3PUY E;  3T22 A;  4THI A;  5H8S A;  2DDK A;  4F1V A;  3MVW A;  2ZYM A;  4PFU A;  4ISU A;  1IZ1 A;  3K6U A;  2Q2A A;  4O8M A;  1TT1 A;  4OVQ A;  1L5T A;  2PX1 A;  5ET8 A;  3O97 A;  4BDR A;  1MDP 1;  4H8I A;  2I4B A;  4MIJ A;  2HPG A;  4PGN A;  3PPQ A;  1EH3 A;  1D4N A;  2Y5K A;  3VE1 B;  3OXN A;  2H99 A;  4YKK A;  1BKA A;  1I6Q A;  4POX A;  4GX3 A;  1VR5 A;  3U8Q A;  2WKY A;  1ZTY A;  3RPL B;  1PB9 A;  2WEF A;  4ZEB A;  1B3L A;  4TLM B;  4YB5 A;  5ICT A;  2OJT A;  3H06 B;  1FPG A;  3ILT B;  4QFO A;  5DW8 A;  1NNF A;  1MH4 A;  1IQ7 A;  4P47 A;  3SER A;  2ZXT A;  4GWW A;  2VT5 A;  2XXP A;  4GF8 A;  1B2H A;  1KZ8 A;  3Q28 A;  2ZNU A;  3HN0 A;  4O3B A;  2DOJ A;  2Z23 A;  3TQW A;  4PDD A;  3AXF A;  4LA9 A;  2B3F A;  3B8B A;  1FQF A;  1QUL A;  3UN6 A;  2O6A A;  4EUO A;  2UVI A;  3RYD A;  3ZSF A;  1US4 A;  4F22 A;  4H5F A;  3TTM A;  3MC2 A;  4OHN A;  1XS5 A;  4PE3 A;  4Q8R A;  1FBF A;  4KXP A;  4DZ1 A;  1MY2 A;  1NNT A;  1POT A;  4HCW A;  3CVG A;  4F3S A;  2OWS A;  3CR9 A;  1MY3 A;  1SDX A;  3EHS A;  2WBD A;  1IXH A;  1JEV A;  3LSL A;  5I57 A;  4G4P A;  2GQ1 A;  4GQO A;  2H4I A;  3BBR A;  2WYK A;  2ZNT A;  1SBP A;  1RKM A;  4XXU A;  3UOR A;  4ESW A;  1DPE A;  3RN8 A;  5B70 A;  4WEP A;  3RLF E;  1FQC A;  1MQH A;  4C1T A;  3A3C A;  3HCQ A;  1TFA A;  1R1N A;  3IOW A;  3S4U A;  5I56 A;  2B65 A;  5I84 A;  1BTJ A;  1FPL A;  2OK2 A;  4GWO A;  1FCK A;  1I6B A;  2P1S A;  4HW8 A;  2QL3 A;  5FBP A;  4N8Y A;  1R9Q A;  3C32 A;  3MAM A;  1QKA A;  1FPB A;  3TAJ A;  1PC3 A;  3MP8 A;  1SVX B;  3MJN A;  5AA2 A;  4WKM A;  1US5 A;  4PTK A;  4YMB A;  4IO7 A;  4H5G A;  3VXB A;  5LOM A;  3KGC A;  4NN3 A;  3KEI A;  4NMY A;  1B3G A;  1XVX A;  2KQZ A;  3PUX E;  4I9D A;  4QFK A;  4GWU A;  3H3G A;  3BFT A;  3FXQ A;  4ZEF A;  1MPC A;  4JB7 A;  2GHA A;  3K1M A;  2ZYK A;  4IR8 A;  5I2N B;  4NWD A;  1MRP A;  4N4U A;  3EHU A;  1NI9 A;  3SEW A;  5JTY A;  2O84 X;  1T0K A;  3VXC A;  4GL8 A;  4MLV A;  1OVT A;  3VV5 A;  4PGP A;  2D5W A;  4XTC Q;  3F11 A;  3CFL A;  3SDF A;  3SEU A;  2A5T A;  1UIU A;  3FXU A;  1MPB A;  3OMB A;  3O6G A;  4OXV A;  4DCX A;  4AB5 A;  5H8Q A;  2QRY A;  4F39 A;  1FQB A;  4RY1 A;  3W15 C;  2F7C A;  1TFD A;  1RDY A;  3OEN A;  5FTH A;  2XXV A;  2MKZ A;  1UQW A;  4G77 A;  4RPN A;  3MVY A;  1XT8 A;  4OMB A;  1D9Y A;  4GBW A;  4X1B A;  4MNP A;  1M5F A;  4KYE A;  3OO7 A;  4NF4 B;  4X04 A;  4QFP A;  5F1Q A;  4DXU A;  1PBQ A;  1VDW A;  1B1X A;  4K3F A;  2DE3 A;  4X1D A;  1R9L A;  2XX9 A;  1NUY A;  4DXB A;  3E9X A;  2V3Q A;  3CIJ A;  3T0J A;  3T9X B;  5H8N B;  3R6U A;  5F24 A;  2ANJ A;  2WBB A;  5EQA A;  4NHB A;  2FIE A;  4KFQ A;  2XWV A;  4PFR A;  5TU0 A;  3E3K A;  1HSE A;  5TP9 B;  4GVO A;  4RPO A;  1NV1 A;  2XXR A;  4R9G A;  2DP8 A;  3TEP A;  2DE4 A;  4E0W A;  1DCU A;  2XWO A;  5EYF A;  1B58 A;  3HFU A;  1MXU A;  4R72 A;  5L9O A;  1N84 A;  1FBC A;  2VD2 A;  1FSA A;  4DCY A;  1IEJ A;  3VFJ A;  1SW2 A;  1JEU A;  3O6I A;  2QFL A;  1FW0 A;  3L6H A;  1MXZ A;  3LSW A;  4EDP A;  2F3B A;  2X7P A;  5CC2 A;  1FTK A;  4N81 A;  2YLN A;  1MQJ A;  3PTY A;  1JNF A;  3CRB A;  5IKB A;  4QF9 A;  1P1O A;  2RCB A;  5A5X B;  4GWY A;  4MFI A;  3M8U A;  2AL4 A;  2F7A A;  2AYS A;  3I6V A;  1N7W A;  3IB0 A;  1B5H A;  1CE2 A;  4R2B A;  1ZLQ A;  1II5 A;  4IO2 A;  2P2A A;  1MM7 A;  4PET A;  3JZJ A;  3MW0 A;  4NF6 B;  3EF7 A;  1CB6 A;  4F29 A;  5DVI A;  4EF1 A;  3MYU A;  1LBC A;  2M8C A;  3IFC A;  1TWY A;  4Z7E A;  1DMB A;  2D21 A;  4GWX A;  4NE4 A;  5TP9 A;  2B3B A;  5CRY A;  3FVG A;  4JXI A;  1FBG A;  5DTB A;  3H6V A;  1UIV A;  4U1Z A;  3H7M A;  2O1L A;  3FXR A;  4OZ9 A;  2ZYO A;  4U22 A;  1OLA A;  3KJ7 A;  4GRK A;  3DLN A;  3M3F A;  2R8T A;  1S50 A;  1BP5 A;  4U23 A;  1TXF A;  1ZIU A;  2XXI A;  4H0W A;  1NH7 A;  3LBS A;  3PV0 E;  3UGW A;  2OWZ A;  5BUU A;  3HHF A;  2HAV A;  1I69 A;  3OO6 A;  3TTN A;  2UVJ A;  3D4G A;  5KCJ B;  5H8F A;  2R71 A;  3N94 A;  3TCF A;  2ZZX A;  1NKX A;  5I2K A;  4IO6 A;  1LAH E;  1LAX A;  2QMW A;  2V93 A;  3C4M A;  1FPE A;  1NMU A;  2THI A;  2CEX A;  4ELQ A;  1N3X A;  4MMP A;  1OQG A;  3K02 A;  4AQ4 A;  5AA2 B;  2V3T A;  1J1N A;  4HTG A;  1B51 A;  4YIC A;  5IZ3 A;  2WX9 A;  4ZEK A;  2A5T B;  2P3V A;  1LLS A;  4X48 A;  5T3J A;  3N6T A;  3PUV E;  2UVH A;  2RIN A;  3W9W A;  4XEQ A;  2CZL A;  3BIG A;  4PP0 A;  3K1N A;  1INP A;  1B05 A;  4OVJ A;  2F8D A;  1Y4T A;  2I4C A;  2ONR A;  2F6G A;  4MHF A;  3T9V A;  2DWA A;  1B4Z A;  1B5J A;  4MF3 A;  3TZA A;  1AOV A;  4PF8 A;  2I48 A;  4OEN A;  1MDQ A;  4FBP A;  3IO6 A;  4YZZ A;  4FAJ A;  3FV1 A;  1LST A;  3B50 A;  4OQO A;  4U4X A;  2NUV A;  4GWS A;  3FIR A;  3S9E A;  1ZMG A;  4QSD A;  1QKB A;  1RDX A;  4JWX A;  3U92 A;  4Q30 B;  3T9U A;  1D3K A;  2XXH A;  4OEV A;  1NV4 A;  1IUD A;  2OLB A;  5ET5 A;  2GRV A;  3FJG A;  1K9Z A;  2H9B A;  4EXK A;  1IMA A;  3FJM A;  4XFE A;  4RK2 A;  1NFT A;  4H46 A;  4PDH A;  1B4H A;  3ONM A;  3Q26 A;  3OEL A;  1B1H A;  5L8D A;  2Y7K A;  3U93 A;  3G3I A;  2Y5L A;  1P99 A;  4P1E A;  2UYF A;  2RCA A;  1B3F A;  1JET A;  3DP8 A;  2O7U A;  2QS1 A;  4JVI A;  2R9J A;  3KC0 A;  3LR1 A;  1A40 A;  1EZ9 A;  1B7U A;  2O7I A;  2UVG A;  4LQ2 A;  1LBZ A;  3O6H A;  3EHT A;  4R73 A;  4PC9 A;  2VD3 A;  3MVZ A;  3EKI A;  3OO8 A;  1IMF A;  1XHY A;  3GYY A;  3TPA A;  4QRZ A;  4HE2 A;  4NX1 A;  3RUM A;  3FZV A;  1SW5 A;  1S9T A;  2Y7P A;  1IXG A;  4NAP A;  4JVC A;  3RPW A;  2I0C A;  2H98 A;  3SES A;  2QVV A;  4GOT A;  1NV7 A;  2XXX A;  4DDD A;  4OFJ A;  2R6G E;  3IOU A;  5IZ3 B;  3OEM A;  5EHM A;  3T9H B;  5ITO A;  2NOO A;  3B6Q A;  3BFU A;  5DVF A;  4NF6 A;  1DK4 A;  4FIM A;  2I0B A;  4TOZ A;  5I5P A;  3HPI A;  3D1R A;  1B32 A;  1XOC A;  1UTH A;  2QSX A;  3K4U A;  3OEK A;  3THI A;  1XC1 A;  4H67 A;  3K6W A;  1FBD A;  3MP6 A;  3KZG A;  1MXY A;  1LB9 A;  3PMX A;  3U65 A;  1Y3Q A;  5CI5 A;  1R6Z A;  4JBZ A;  4F3P A;  3GXA A;  5A5X A;  3G3K A;  1LFH A;  4X9T A;  1SD3 A;  2E1S A;  4DI3 D;  4N8G A;  1NL5 A;  1WDN A;  3MVX A;  4ZEI A;  3LC8 A;  1NUW A;  1Y9U A;  4AB6 A;  1JVX A;  3OSR A;  5I56 B;  2HXR A;  4NF8 A;  4OFO A;  4QHQ A;  3K0V A;  3VVF A;  4F31 B;  4G8M A;  1FTM A;  2E0S A;  1NNP A;  1FPJ A;  2NWJ A;  3FJ7 A;  4HS7 A;  5JEI A;  3I5O A;  4XKP A;  1IMB A;  4BDN A;  4KHZ E;  1Y3N A;  2CMO A;  3PMV A;  2Y7W A;  5EHS A;  5H8H A;  1LGB C;  1RYO A;  2QJE A;  4DLD A;  3KFM A;  4Q0C A;  3PPP A;  5DVJ A;  5AA4 B;  4R6K A;  4P9K A;  1O7T A;  5H8Q B;  3HST A;  4R2F A;  1DTG A;  1OQH A;  4MEV A;  1QW0 A;  2XXY A;  3ILU B;  4YKI A;  4NF8 B;  1IXI A;  2HZL A;  3LUY A;  2PT1 A;  4YB6 A;  3SEX A;  3IK6 B;  2Y7I A;  4MAG A;  4AS4 A;  4MLQ A;  5I58 B;  4PBH A;  2OCU A;  4TQU Q;  4RK9 A;  3IR1 A;  1N3W A;  3G3F A;  2P0S A;  3OSQ A;  4U4S A;  1WOD A;  2HAU A;  4GFR A;  2UXA A;  4KD5 A;  2PCR A;  2FIX A;  3TCG A;  2QVR A;  3GBB A;  1F9B A;  1M5E A;  4MBP A;  4MH5 A;  3R7X A;  3CG3 A;  4GWZ A;  4IO4 A;  4LN5 A;  3TMG A;  2VOZ A;  4P11 A;  1P1U A;  4YB7 A;  1MXX A;  4ZE8 A;  5J16 A;  2HEU A;  3EN3 A;  1FQE A;  4GXA A;  3N5L A; 
#chains in the Genus database with same CATH homology
 2D21 A;  1BIY A;  4NE4 A;  5DEX A;  1SW4 A;  1JW1 A;  5TP9 A;  3RNN A;  2B3B A;  4LUB A;  3C9H A;  3C34 A;  3MQ9 A;  1PDA A;  1PB8 A;  4XKQ A;  2ZNS A;  5TPA A;  5CRY A;  3FVG A;  4JXI A;  1GV8 A;  4DE8 A;  3TTK A;  5FTI A;  4WXJ A;  5AA1 A;  2Q8J A;  1QJM A;  3MBP A;  3PMW A;  3QYT A;  3H6V A;  5DTB A;  1UIV A;  4U1Z A;  3H7M A;  4YMA A;  2O1L A;  4F2O A;  2I3W A;  3FXR A;  1QUI A;  3TUS A;  3CFX A;  3CSG A;  3LSX A;  4OZ9 A;  2I3V A;  4IY6 A;  3Q27 A;  2HFB A;  4FOR A;  4QFL A;  3RTW B;  2ZYO A;  4OES A;  4P0I A;  4UAC A;  2F5X A;  3IOT A;  1ATG A;  4O3C A;  4U22 A;  5FHM A;  1YPN A;  1OLA A;  3KJ7 A;  4GRK A;  3DLN A;  1I6A A;  3FGS A;  3M3F A;  4QFN A;  2RF1 A;  3USD A;  3PUY E;  3T22 A;  1Y4C A;  4THI A;  5H8S A;  4F1V A;  3MVW A;  2ZYM A;  3N26 A;  1B3H A;  4KI0 E;  4PFU A;  4ISU A;  5CM6 A;  1H76 A;  1IZ1 A;  1HSJ A;  1S50 A;  3IAZ A;  3K6U A;  1O64 A;  2A5S A;  2Q2A A;  4LVQ A;  1BP5 A;  1TT1 A;  4BDO A;  4G68 B;  3KBR A;  4U23 A;  1SYI A;  2PX1 A;  1L5T A;  1TXF A;  1ZIU A;  3UP9 A;  4DIG A;  3O97 A;  2DVZ A;  3S9L C;  4OEU A;  4F18 A;  1A55 A;  4RXL A;  1PEB A;  4BDR A;  1MDP 1;  5L9M A;  1O63 A;  2UYE A;  2XXI A;  2I4B A;  1B5I A;  4H0W A;  4H8I A;  3Q25 A;  3VLV A;  4I62 A;  1P1W A;  1NH7 A;  3LBS A;  3M3K A;  3PV0 E;  4I8C A;  4KCC A;  3PPQ A;  3UGW A;  5BUU A;  3HHF A;  1EH3 A;  4TLL B;  1D4N A;  4HCY A;  2HAV A;  1I69 A;  2QS2 A;  3OO6 A;  3OXN A;  3VE1 B;  4EQ9 A;  2H99 A;  1EU8 A;  3TTN A;  2UVJ A;  4YKK A;  3U1O A;  3D4G A;  1MY4 A;  4NF5 A;  1BKA A;  3IL1 B;  5H8F A;  1I6Q A;  4POX A;  2REG A;  2R71 A;  5KCJ B;  2KLF A;  4G8H A;  3N94 A;  3U72 A;  3L6G A;  1B7Z A;  3VVE A;  3SEY A;  1DTZ A;  5H8H B;  3TCF A;  2VGQ A;  3HO7 A;  5HPQ A;  4XIG Q;  1NKX A;  1ZKB A;  3FAT A;  5I2K A;  3K2D A;  3QUJ A;  1LAH E;  1FTL A;  1VR5 A;  4IO6 A;  1LAX A;  3T93 B;  3VLW A;  2QMW A;  4DXC A;  3U8Q A;  2V93 A;  3C4M A;  2DWI A;  1NMU A;  2WKY A;  2THI A;  1NNK A;  4R9F A;  5IAI A;  1ZTY A;  3CFZ A;  3LSF B;  1N3X A;  4ELQ A;  5F7V A;  3RY3 A;  2D3I A;  4XKR A;  1EZO A;  1PB9 A;  3PD9 A;  1OQG A;  4ZEB A;  3K02 A;  1B3L A;  4AQ4 A;  5AA2 B;  4TLM B;  2V3T A;  1J1N A;  4HTG A;  4YB5 A;  3DP4 A;  3H6T A;  5ICT A;  4ZZE A;  2YPN A;  1B51 A;  2OJT A;  4YIC A;  4PQJ A;  4BDM A;  3H06 B;  3ILT B;  3BKI B;  4QFO A;  1NNF A;  3KN3 A;  2F6P A;  1MH4 A;  2V84 A;  3PPR A;  4R6Y A;  1IQ7 A;  3SER A;  2NXO A;  2ZXT A;  4ZEK A;  2XXP A;  2DYX A;  4GF8 A;  1B2H A;  2A5T B;  1URG A;  3Q28 A;  2ONK E;  2VP1 A;  2ZNU A;  1LLS A;  4X48 A;  3TEL A;  3HN0 A;  1B0L A;  4H1X A;  3N6T A;  2DOJ A;  3PUV E;  4O3B A;  4ONY A;  2UVH A;  2RIN A;  3W9W A;  2H25 A;  4KYS A;  3RQT A;  3TDJ A;  3DEL B;  4FE8 A;  4R6H A;  1IIW A;  2CZL A;  2Z23 A;  3TQW A;  4PP0 A;  3AXF A;  3K1N A;  4LA9 A;  1A99 A;  2B3F A;  3A3U A;  3IJX B;  1B05 A;  1FQF A;  4I1D A;  1N04 A;  1Z7M E;  2OWT A;  2F8D A;  3DP6 A;  1QUL A;  4OVJ A;  1Q35 A;  4F19 A;  1Y4T A;  3GLB A;  2O51 A;  3UN6 A;  2I4C A;  2O6A A;  4ND9 A;  2ONR A;  1ZBM A;  2F6G A;  3B7D A;  3T9V A;  2DWA A;  3TFL A;  4YU0 A;  1B4Z A;  1B5J A;  2Q2C A;  3KOS A;  3O2A A;  2UVI A;  4JSO A;  4EUO A;  1IXC A;  3N5L A;  2QMX A;  3ZSF A;  1US4 A;  2Q9T A;  1GR2 A;  4F22 A;  4H5F A;  4MF3 A;  3TZA A;  1AOV A;  1AMF A;  1A8F A;  3TTM A;  2I48 A;  4OEN A;  2DWH A;  3GBA A;  3MC2 A;  4OHN A;  1MDQ A;  1XS5 A;  5HBC A;  4Q8R A;  3V5A A;  2XXW A;  4F3G A;  1UTB A;  2Y7R A;  3IO6 A;  4YZZ A;  4FAJ A;  5BWJ A;  1PB7 A;  1BLF A;  1SYH A;  5CMB A;  2F35 A;  4DZ1 A;  2HQ0 A;  3FV1 A;  1LST A;  2XX7 A;  2NVU B;  2Z8E A;  4OQO A;  1YTV A;  4U4X A;  1MY2 A;  1NNT A;  3C33 A;  1POT A;  3QUF A;  2ABH A;  5AE4 A;  4G68 A;  4HCW A;  3CVG A;  2NUV A;  4LZ7 A;  2PT2 A;  3FIR A;  4F3S A;  3S9E A;  5ELV A;  2OWS A;  3C36 A;  1MY3 A;  1SDX A;  3CR9 A;  4LZ8 A;  1POY 1;  3EHS A;  5AA3 A;  1WVJ A;  1QVS A;  1ZMG A;  4QSD A;  2F36 A;  3CSB A;  1QKB A;  2ZYN A;  4JWX A;  2DVC A;  3PUW E;  3U92 A;  3ZS6 A;  5CMC A;  1IXH A;  2XHD A;  4C0R A;  2QS4 A;  3T96 B;  5HM4 B;  1JEV A;  2DQV A;  4Q30 B;  1MY1 A;  3FD3 A;  1D3K A;  3T9U A;  3LSL A;  5I57 A;  4G4P A;  1B46 A;  4GQO A;  3RTF B;  2XXH A;  3QXM A;  2F78 A;  1GGG A;  2H4I A;  3BBR A;  3KG2 A;  4OEV A;  1VFE A;  1XVY A;  3OOA A;  4JDF A;  2ZNT A;  3MZ1 A;  1SBP A;  1RKM A;  4XXU A;  3Q29 A;  3UOR A;  4ESW A;  5CMK A;  1IUD A;  2OLB A;  1A54 A;  4BDL A;  1DPE A;  3OO9 A;  3RN8 A;  3U94 A;  2DXY A;  4KQP A;  3G7W A;  4WEP A;  5B70 A;  4F1Y A;  3A09 A;  3S9N C;  3RLF E;  4KYD A;  1FQC A;  1MQH A;  3TYH A;  3H03 A;  1N76 A;  2GRV A;  3FJG A;  4C1T A;  1AH5 A;  1AL3 A;  3A3C A;  3FVK A;  3HCQ A;  5CMM A;  4ZDM A;  4ELO A;  1TFA A;  1R1N A;  1USY E;  2H9B A;  3V83 A;  3IOW A;  4EXK A;  1MQD A;  3FJM A;  3S4U A;  1OLC A;  5DT6 A;  4RYA A;  5I56 A;  3O66 A;  1LBB A;  2B65 A;  5I84 A;  1BTJ A;  2ESN A;  2OK2 A;  4LON B;  3JV9 A;  3O29 A;  2I49 A;  3O9P A;  4RK2 A;  4GWO A;  1FCK A;  4IB2 A;  1MQG A;  1NFT A;  3R26 A;  4EF1 A;  1I6B A;  2ZMB A;  2P1S A;  3E13 X;  2W7Y A;  1B4H A;  3IJO B;  3N6U A;  4HW8 A;  3ONM A;  1SI0 A;  2O1M A;  2QL3 A;  4KCD A;  4BDQ A;  4EXL A;  3Q26 A;  3OEL A;  3IOR A;  5K2Y A;  1B1H A;  1R9Q A;  2H5Y A;  5L8D A;  1S7Y A;  3C32 A;  1M5C A;  2Y7K A;  3EQ1 A;  3MAM A;  3MPL A;  1QKA A;  4KR5 A;  1Y20 A;  3WAF A;  3TAJ A;  1PC3 A;  3U93 A;  3G3I A;  2GH9 A;  3MP8 A;  2G29 A;  1NH8 A;  3W9V A;  1SVX B;  5JTY B;  4NTL A;  4RA1 A;  1GTK A;  1P99 A;  1B7H A;  2XXT A;  2QS3 A;  4N07 A;  3RGY A;  3KN7 A;  1LFG A;  3MJN A;  2UYF A;  2RCA A;  1B3F A;  5AA2 A;  4WKM A;  1JET A;  1US5 A;  4KPT A;  3PUZ E;  1A7L A;  2XXU A;  4LQ5 A;  3DP8 A;  4YMB A;  2O7U A;  1RYX A;  2QS1 A;  4N13 A;  1SQY A;  1HSL A;  2R9J A;  4IO7 A;  4H5G A;  4OTE A;  3VXB A;  3QIM A;  4ZZA A;  5LOM A;  3KGC A;  4IO3 A;  5CBR A;  1ANF A;  3LR1 A;  5FHO A;  1A40 A;  4GXS B;  1EZ9 A;  1PBP A;  1OIB A;  3KEI A;  1B3G A;  1XVX A;  4NMY A;  3PUX E;  1B7U A;  2O7I A;  2PMS A;  4I9D A;  2UVG A;  4JWY A;  4LQ2 A;  3ECR A;  3G3J A;  3MZB A;  3O6H A;  2VHA A;  4QFK A;  1UTB B;  3B6W A;  2Z8F A;  3H3G A;  2BJJ X;  3G3H A;  3TCH A;  3EHT A;  3DM0 A;  3PPO A;  4LZ5 A;  4R73 A;  2PVU A;  2VD3 A;  1MG1 A;  2DWJ A;  3BFT A;  3P7I A;  1SI1 A;  4R74 A;  3FXQ A;  2XX8 A;  3MVZ A;  4ZEF A;  1GVC A;  1MPC A;  2ALU A;  4IO5 A;  2FNC A;  4JB7 A;  4FAT A;  1LAG E;  2GHA A;  3OO8 A;  2OBG A;  2Q88 A;  3GZG A;  2DE2 A;  3K1M A;  2O69 A;  2ZYK A;  5I2N B;  4FEB A;  4NWD A;  1MRP A;  3EHU A;  3OD7 A;  5I58 A;  4EF2 A;  1XHY A;  3S9M C;  2RC8 A;  1UTH B;  3MWB A;  3SEW A;  3TPA A;  5JTY A;  2O84 X;  4EQ7 A;  1T0K A;  3VXC A;  4QRZ A;  3G3G A;  4GL8 A;  4MLV A;  2OZZ A;  1OVT A;  1JVY A;  1B0H A;  3K1P A;  3VV5 A;  2FA7 A;  4F2Q A;  2D5W A;  3RUM A;  4XTC Q;  3F11 A;  1SW1 A;  2AIX A;  3FZV A;  1SW5 A;  3CFL A;  1LFI A;  1OVB A;  1S9T A;  2Y7P A;  3SDF A;  1IXG A;  3SEU A;  5I59 A;  1LCT A;  3KJT A;  4LP2 B;  3RPW A;  4OWD A;  1AIV A;  2A5T A;  2H98 A;  2I0C A;  1UIU A;  1URS A;  4GOT A;  4PFT A;  4U21 A;  2ONS A;  3SES A;  4IGT A;  3FXU A;  2Q89 A;  4ZED A;  1MPB A;  2XXX A;  3KSJ A;  4FJP A;  4M1V A;  4DDD A;  3OMB A;  2X7Q A;  4OFJ A;  3O6G A;  2R6G E;  3IOU A;  4OXV A;  4AB5 A;  5H8Q A;  3ZKK A;  4DCX A;  5KZT A;  4G68 C;  2F7B A;  2QRY A;  3OEM A;  3PD8 A;  5EHM A;  4F39 A;  1FQB A;  5AA2 D;  1IIT A;  5I59 B;  3TTR A;  3T9H B;  5ITO A;  2NOO A;  3B6Q A;  3BFU A;  4RY1 A;  1Q1K A;  1TFD A;  2F7C A;  3OEN A;  4NF6 A;  3IX1 A;  5DVF A;  5FTH A;  3T66 A;  4M4G A;  3KOT A;  4F3B A;  1MH3 A;  5M2V A;  3QAX A;  2F97 A;  4FIM A;  2XXV A;  2I0B A;  1UQW A;  4OYV A;  4TOZ A;  2F34 A;  4G77 A;  2V3U A;  3HPI A;  4POW A;  3V89 B;  2LAO A;  4PFW A;  1JQF A;  4RPN A;  1B32 A;  3MVY A;  1XOC A;  1XT8 A;  1UTH A;  2QSX A;  3K4U A;  3OEK A;  3THI A;  1XC1 A;  5L9S A;  4H67 A;  3K6W A;  4OMB A;  1D9Y A;  1P1Q A;  3VVD A;  1QUK A;  1H44 A;  3VDF A;  1N0T A;  4X1B A;  4ESX A;  2HXW A;  3KSX A;  3H4Z A;  3JYR A;  3KZG A;  3MP6 A;  1JW4 A;  1M5F A;  5H8F B;  3K6X A;  1EZP A;  4U2R A;  2Y84 A;  1MXY A;  1LB9 A;  1DOT A;  4KYE A;  1DSN A;  3OO7 A;  3PMX A;  1A8E A;  1YCJ A;  4WED A;  4NF4 B;  4YKJ A;  1H45 A;  1Y3Q A;  5CI5 A;  5CBS A;  4QFP A;  1DPP A;  5F1Q A;  1R6Z A;  3TTL A;  4DXU A;  1PBQ A;  4JBZ A;  1B1X A;  4K3F A;  1ZU0 A;  3FAS A;  2RC7 A;  2DE3 A;  4F1U A;  4F3P A;  3TQL A;  3W15 C;  4O3A A;  3GXA A;  3C35 A;  4ZEC A;  5A5X A;  4X1D A;  2QPQ A;  1R9L A;  2XX9 A;  3G3K A;  1LFH A;  4X9T A;  1M5D A;  1B40 A;  1SD3 A;  3K01 A;  2E1S A;  4DXB A;  1NL5 A;  1WDN A;  5I57 B;  3UIF A;  3TKD A;  3CI8 A;  3E9X A;  3MVX A;  4IGR A;  2V3Q A;  3LC8 A;  3CIJ A;  3PGF A;  4ZEI A;  3T9X B;  1Y9U A;  3R6U A;  5H8N B;  4AB6 A;  2ANJ A;  1FTJ A;  3MP1 A;  1H3D A;  3O28 A;  1MM6 A;  2HZK A;  5DEX B;  1JVX A;  1P1N A;  4JSD A;  2G93 A;  3OSR A;  4ZE9 A;  1YAE A;  4GL0 A;  5I56 B;  4FED A;  4KFQ A;  4NF8 A;  4OFO A;  4QHQ A;  5TPA B;  3I3V A;  1B3E A;  3K0V A;  3VVF A;  4F31 B;  4G8M A;  5TU0 A;  1FTM A;  1USY H;  2E0S A;  1Z7N E;  4JWO A;  1B9J A;  3E3K A;  1NNP A;  1HSE A;  2NWJ A;  5TP9 B;  4GVO A;  5AA4 A;  1Y3P A;  1N7X A;  3FJ7 A;  4H65 A;  4HS7 A;  4NF4 A;  4RPO A;  3MUQ A;  2V25 A;  5JEI A;  3I5O A;  4XKP A;  2XXR A;  4R9G A;  2DP8 A;  2DXR A;  3MZ9 A;  2Z22 A;  1MPD A;  2GFE A;  3TEP A;  4BDN A;  1LCF A;  2DE4 A;  2IA4 A;  2RC9 A;  4KHZ E;  4BLA A;  1Y3N A;  2CMO A;  3PMV A;  2Z8D A;  4E0W A;  5JK4 A;  1VSO A;  2Y7W A;  4GD5 A;  5EHS A;  1LGB C;  1RYO A;  2QJE A;  5H8H A;  3PPN A;  5K2X A;  4DLD A;  3KFM A;  5I2N A;  3UK4 A;  3IB2 A;  1Y1M A;  4Q0C A;  3C31 A;  4NF5 B;  1B58 A;  2DS9 A;  4G2Z A;  5EYF A;  2X26 A;  3PPP A;  1MXU A;  4R72 A;  4OER A;  5L9O A;  1N84 A;  5B7D A;  3VLU A;  4ECF A;  5DVJ A;  5AA4 B;  3FV2 A;  4RJZ A;  4Z0I A;  2VD2 A;  4RNS A;  4DCY A;  1IEJ A;  4R6K A;  4H6D A;  5KDT A;  3VFJ A;  3H6W A;  1MXV A;  3MPK A;  4G8N A;  4ELR A;  3D4C A;  1SW2 A;  5ICQ A;  1OMP A;  1JEU A;  1O7T A;  2AL5 A;  2O68 A;  3O6I A;  4NED A;  5H8Q B;  3HST A;  1FW0 A;  3B6T A;  3L6H A;  1DTG A;  4R2F A;  1MXZ A;  1OQH A;  3E4R A;  1FQA A;  4ELP A;  1B6H A;  5KCJ A;  4PE5 B;  4YAH X;  4H8J A;  1QW0 A;  2XXY A;  1KWH A;  3H6U A;  3ILU B;  4E0X A;  1LAF E;  3LSW A;  4YKI A;  3QK6 A;  3RT8 A;  5ISU A;  4NF8 B;  1IXI A;  3S2V A;  4EDP A;  2HZL A;  3LUY A;  3WAE A;  2X7P A;  1FTO A;  1FTK A;  1MQI A;  1MXW A;  1MY0 A;  3SET A;  2PT1 A;  5CC2 A;  4YB6 A;  4ZS9 A;  3SEX A;  3IK6 B;  1MS7 A;  3V8X B;  2Y7I A;  2YLN A;  5J1D A;  1MQJ A;  3IB1 A;  4P0G A;  2XD3 A;  2PBW A;  2FYI A;  4QSC A;  3QSL A;  1B52 A;  1JNF A;  3CRB A;  4MLQ A;  4QSE A;  3PU5 A;  3HHG A;  4YKP A;  5H8N A;  3ZKL A;  5I58 B;  2YJP A;  4N6P A;  5IKB A;  2RKM A;  1URD A;  2OCU A;  1VE4 A;  4QF9 A;  3ODB A;  1P1O A;  4TQU Q;  3UA8 A;  2RCB A;  2DSF A;  4RK9 A;  5A5X B;  1D9V A;  1N3W A;  3IR1 A;  4MFI A;  3G3F A;  3HV1 A;  1H43 A;  2AL4 A;  3M8U A;  5DYH A;  2F7A A;  3K6V A;  2AYS A;  3I6V A;  2GHB A;  1N7W A;  3CG1 A;  5FHN A;  2P0S A;  1QUJ A;  3OSQ A;  2I58 A;  3IB0 A;  4IY5 A;  4U4S A;  4NWC A;  1WOD A;  2HAU A;  3RT6 B;  4EQB A;  4GFR A;  3SKP A;  1B5H A;  2UXA A;  4KD5 A;  4Q5T A;  1CE2 A;  3KN8 A;  3TCG A;  3TOD A;  4OET A;  5KDT B;  4R2B A;  1ZLQ A;  3GBB A;  3FVO A;  2PYY A;  1II5 A;  4IO2 A;  2P2A A;  1MM7 A;  4LAT A;  4OFL A;  4UA8 A;  1F9B A;  1M5E A;  4MBP A;  4PET A;  4U1O A;  4R75 A;  4XKN A;  4C1U A;  4MH5 A;  1JW5 A;  3R7X A;  2XXQ A;  4L17 A;  3CG3 A;  3IO4 A;  3JZJ A;  1ELJ A;  1LB8 A;  3SEV A;  3MW0 A;  3IOV A;  4NF6 B;  1VFD A;  2IEE A;  3K00 A;  4PFY A;  3EPE A;  3FUZ A;  3EF7 A;  2REJ A;  1CB6 A;  4IO4 A;  3TMG A;  4F29 A;  5I2K B;  2VOZ A;  3M3L A;  4P11 A;  1P1U A;  4YB7 A;  1M5B A;  1FQD A;  1MXX A;  1ZJL A;  2XD2 A;  3FVN A;  4FEC A;  5DVI A;  1LBC A;  2HEU A;  2M8C A;  4ZE8 A;  5ITP A;  3EN3 A;  1TWY A;  1FQE A;  4GIZ A;  2HCA A;  4Z7E A;  4GXA A;  2I6E A;  1DMB A;  4GLI A;  1Y1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...