2VD2A

The crystal structure of hisg from b. subtilis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
AMGKLLTMAMPKGRIFEEAAGLLRQAGYRLPEEFEDSRKLIIDVPEENLRFILAKPMDVTTYVEHGVADVGIAGKDVMLEEERDVYEVLDLNISKCHLAVAGLPNTDWSGVAPRIATKYPNVASSYFREQGEQVEIIKLNGSIELAPLIGLADRIVDIVSTGQTLKENGLVETEHICDITSRFIVNPVSYRMKDDVIDEMASRLSLVVEGET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ATP PHOSPHORIBOSYLTRANSFERASE
publication title The Crystal Structure of Hisg from B. Subtilis
rcsb
source organism Bacillus subtilis
total genus 52
structure length 212
sequence length 212
ec nomenclature ec 2.4.2.17: ATP phosphoribosyltransferase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01634 HisG ATP phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vd2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vd2A02
2ONSA 1IIWA 1PDAA 4BDNA 2RC9A 1ZMGA 2Z8EA 2VD3A 3G3HA 2R6GE 4R75A 2XXUA 3E3KA 1GR2A 2V25A 3CR9A 4GOTA 4RPNA 3UA8A 4GRKA 3FGSA 4XKRA 2DP8A 2KLFA 3A3CA 4ZEFA 2ESNA 3T9XB 3KSJA 1SW4A 3LSLA 2ONKE 3C36A 4IO3A 5LOMA 4FE8A 4HCYA 1Z7NE 3W9VA 3K1PA 2QS4A 1YCJA 3H6WA 4QSDA 4ELRA 5TP9B 4TLMB 1ZU0A 1MXVA 5I57A 4U22A 1BTJA 4M1VA 2OLBA 1NNFA 3G7WA 3VVFA 4OHNA 2Q89A 4AQ4A 4ESXA 2XXWA 5FTHA 1B6HA 1NH8A 1J1NA 4P0GA 1MY2A 2GHAA 4LA9A 3PGFA 2DE3A 2QMXA 3GBBA 3VDFA 2Y7PA 4QFKA 4NF6A 3TZAA 3CIJA 2ONRA 3A09A 4O3AA 1FQEA 4MLQA 1GTKA 3SESA 4PE5B 2GH9A 1MXXA 3CI8A 2RC7A 2QPQA 3T22A 3TUSA 3MP1A 3PUZE 1SW2A 2DVCA 5AA2A 3LSXA 2RF1A 1GV8A 4WEPA 3IL1B 4U21A 1POTA 5EHSA 2ZNTA 3UGWA 1LFGA 4KCCA 3CFLA 4F1YA 4JWOA 3MC2A 3C32A 3OENA 3PUWE 3PD9A 3Q28A 1DPEA 3U93A 5L8DA 1P1UA 3KEIA 1CB6A 5CBSA 1Y3NA 3THIA 2PVUA 2Q9TA 3TTKA 3SEVA 1EZOA 1PBQA 2O51A 2H99A 2B65A 1LFHA 2XX7A 1RYXA 4U1OA 3W15C 3EHUA 1FW0A 2X26A 2Q2CA 4R74A 4GLIA 3TEPA 3E13X 3D4CA 5ICTA 3LSFB 3OD7A 3FASA 3H6VA 4YKJA 2I3VA 4WXJA 1FTMA 3MZBA 2D21A 2ZXTA 1Y4TA 3QUFA 3CSGA 1BP5A 4DLDA 4BLAA 2PBWA 3O29A 1B9JA 4LVQA 3MBPA 3I3VA 1TT1A 1ZTYA 2XXIA 4RK2A 4JXIA 2PT2A 4U2RA 4PFUA 3OELA 4G77A 1O7TA 4ONYA 5F1QA 4YKPA 1M5BA 3RLFE 2O1LA 4KFQA 2F7CA 4LUBA 3A3UA 3MJNA 5H8SA 1B51A 1MY4A 4OESA 2OK2A 1FTOA 1D4NA 4LZ7A 2I0BA 1OQGA 1R9QA 3K6UA 4F3GA 1XVXA 1II5A 3O66A 1MY1A 4AB6A 4I8CA 3Q29A 1IXCA 5KZTA 5A5XA 4G68B 2PYYA 4H6DA 3TELA 4YMAA 3B6TA 2R9JA 1MRPA 4TOZA 3LC8A 4JWYA 2GFEA 1M5EA 4DCXA 4GF8A 5TPAB 2RC8A 3L6GA 2CZLA 4XXUA 1SQYA 2HAVA 1LAGE 3HPIA 3O9PA 3RTFB 4G68A 4NF8B 2Z8FA 4EQ9A 3RTWB 1DPPA 3DELB 2Q2AA 1N76A 1QVSA 5DT6A 4YZZA 1IUDA 1LLSA 1L5TA 3PMXA 3PV0E 2HZLA 1LBCA 1JNFA 1S9TA 2O7IA 4XTCQ 4MLVA 3SEYA 2XXVA 5ITOA 4DIGA 5ICQA 3RN8A 2FNCA 3TQLA 1PB7A 2NOOA 3TTLA 3PPRA 1MXUA 1D9VA 2UYEA 4ND9A 4F3PA 4IB2A 2XD3A 3EQ1A 3JZJA 3K6WA 1NNKA 4ZE9A 3VLVA 3O6HA 2E0SA 4F2OA 1QUIA 1ATGA 1URDA 3K2DA 1HSLA 3T96B 2UVIA 5AE4A 2UVHA 1H76A 3QSLA 3MQ9A 4QHQA 1D3KA 3TPAA 3MVWA 1Y4CA 5I59B 3V89B 3S9MC 4YKKA 5JEIA 1FTLA 5HPQA 5CMBA 1UQWA 2A5TB 1B05A 4R6KA 5IKBA 3MWBA 3I5OA 3S2VA 2NWJA 1B3HA 1Y20A 1B7UA 4R2BA 5AA3A 1DMBA 4Q0CA 5M2VA 3IOTA 4G4PA 2V3UA 4GWOA 3H3GA 3T66A 2I0CA 2O1MA 1URGA 4OMBA 4F2QA 4ZECA 4GVOA 3KOSA 4THIA 4OWDA 1OMPA 3Q26A 5I2KB 1MY0A 3V5AA 4U4SA 5F7VA 2I49A 4QRZA 4NWCA 4IGRA 4OFLA 4HS7A 3E9XA 1UTHA 3U8QA 2R71A 3HSTA 5DVFA 2ABHA 2RKMA 3RT8A 1ZJLA 3M3KA 3MVZA 2DWIA 3VLWA 3C31A 3KZGA 4L17A 3H6UA 4KYEA 1B5IA 2HEUA 3MPLA 2F97A 4OYVA 4GIZA 4I1DA 1US5A 4U4XA 1GGGA 5FHMA 1VE4A 2VD2A 5DYHA 4EF2A 4H65A 3MZ9A 4R73A 1A7LA 3P7IA 3JV9A 3FATA 3G3GA 4Z0IA 4PFTA 3VVDA 2G29A 4JBZA 1P99A 3U1OA 4F31B 3BKIB 1BLFA 3R7XA 4FJPA 4DXCA 4KPTA 2THIA 2ANJA 5ITPA 4IO2A 2O69A 2HFBA 3TFLA 3EPEA 4P0IA 4X9TA 5J1DA 2DXYA 2XXRA 4F1UA 5ELVA 1IXHA 4F29A 5CI5A 4QSCA 2RCBA 1IITA 4OENA 2V93A 3T9UA 1FCKA 3KN3A 3KJTA 5FHOA 1FTJA 3KJ7A 3SDFA 5H8NB 4G8HA 4ZEBA 1MQIA 2F78A 3TTRA 2XX8A 4OETA 3S4UA 1NNTA 4HW8A 3OEMA 5CRYA 3TCGA 1MPBA 1ANFA 4IO7A 3VV5A 1QKBA 2X7QA 3FXQA 3K01A 1CE2A 4BDRA 2HQ0A 2QJEA 5CMCA 4HTGA 1DSNA 1N7WA 2B3FA 3MUQA 3K00A 1FQBA 3HN0A 3EN3A 5JK4A 1WDNA 4FIMA 4QF9A 4G2ZA 2DQVA 4KQPA 3VFJA 3OO8A 2D5WA 2PX1A 1GVCA 2PMSA 1RYOA 4LONB 5TP9A 2UVJA 4BDLA 2I3WA 2OJTA 4R6YA 1URSA 3B7DA 1SYHA 5AA1A 4WKMA 1EH3A 4GXSB 4EDPA 1P1QA 3DP4A 1YPNA 4NF4B 5IAIA 3FXUA 5I84A 4PETA 4YMBA 3ZKLA 2VOZA 3GBAA 3VVEA 3PUVE 3H06B 3FZVA 3FD3A 4F39A 4UA8A 3LR1A 3FV2A 3CFXA 4DZ1A 4ECFA 4NF4A 1JW5A 4YB5A 4OZ9A 1B7HA 4F18A 3FJ7A 3K6VA 1RKMA 3EF7A 2H98A 1QJMA 3IO4A 1ZLQA 4UACA 4RY1A 3ZS6A 4FEDA 1EZPA 1B3FA 5JTYB 1PB9A 1XC1A 4JSDA 4N07A 4U23A 4DCYA 5B70A 5I56B 3TTNA 2YPNA 4WEDA 3TKDA 2RCAA 2XXQA 2H4IA 4EF1A 1H43A 2QS2A 3UIFA 1MXYA 2DSFA 3TYHA 3RY3A 3K1MA 2E1SA 3N94A 3MVXA 3DLNA 1LB8A 1TWYA 3ODBA 5K2YA 3UORA 3FXRA 1B3GA 1JETA 1LAFE 2HXWA 4FECA 3D4GA 3RQTA 1BIYA 3HV1A 3OO7A 4EXLA 2O7UA 1JQFA 3QUJA 1NKXA 4OEUA 3RNNA 2V3TA 2Z22A 3KSXA 3QIMA 2F7BA 3B6WA 3Q25A 1EU8A 2QMWA 3DP8A 2XXXA 4I62A 1A99A 1B58A 3H4ZA 2IEEA 3KOTA 1UTBB 3O28A 4IGTA 3V83A 1SD3A 4KYSA 3VE1B 2UVGA 2XXHA 1N0TA 3N5LA 2DOJA 5DVJA 3OEKA 1MG1A 1SVXB 2O68A 4E0WA 2XXPA 4NF5B 4MH5A 4RPOA 4IO4A 3E4RA 4ELQA 4IO5A 3PMWA 2GRVA 3CRBA 2Y7KA 1N84A 3OO6A 3SEUA 2V84A 5I2NB 1QULA 2VHAA 5DTBA 1JVXA 3RGYA 4IY6A 3R26A 4F3SA 1ZIUA 5CC2A 3U72A 1IXGA 4NF5A 3G3IA 3FVGA 1MM6A 3C35A 4X48A 4F1VA 2REGA 1MPDA 2I6EA 1O64A 5TPAA 2ZYNA 3MP8A 1TFAA 1IQ7A 3U94A 4FEBA 2QL3A 4H0WA 4QSEA 3M3LA 1MY3A 4ZZAA 4NF8A 5FHNA 4OQOA 3FJMA 1I6AA 4FORA 4C1TA 3M8UA 3V8XB 2QS1A 4GFRA 2F7AA 1QUKA 5L9MA 1FQFA 3C33A 2FA7A 3HCQA 4ZE8A 2BJJX 4EUOA 3FIRA 2HZKA 1LBBA 2VP1A 3FJGA 1LB9A 4FATA 3DM0A 3SKPA 3TCFA 1DTZA 3MVYA 1MQHA 1VFDA 1FTKA 3MAMA 3N26A 3GZGA 3VXBA 4NTLA 1LGBC 5H8QB 1B3EA 3H7MA 1B7ZA 1UIVA 1H3DA 1AIVA 4OFJA 1MQDA 1NMUA 1MM7A 1QUJA 2WKYA 4ELPA 2YLNA 3IB0A 3KGCA 1NL5A 2QRYA 3ONMA 3OXNA 4KCDA 3W9WA 5DVIA 3IJXB 5I59A 2OCUA 2ZMBA 3QYTA 2IA4A 3FVOA 4N13A 1OVBA 1MXZA 2ZYMA 4IY5A 2A5TA 3KG2A 3PPNA 1SW5A 3WAFA 1AH5A 4LQ2A 2ZYKA 3TQWA 4OXVA 1VSOA 5I58B 4OTEA 4DXBA 1MDP1 1OVTA 1TFDA 2D3IA 1B3LA 1XVYA 1I6BA 3TAJA 1B32A 1B2HA 3U92A 1QKAA 1LSTA 4R72A 1MDQA 2QS3A 3ECRA 5I2KA 2B3BA 1Y1MA 2XHDA 3AXFA 5AA4B 3L6HA 3O6IA 4BDOA 1Y3QA 2Q8JA 3MP6A 5I58A 1LAXA 2UXAA 4JB7A 1AOVA 4XIGQ 3M3FA 3TTMA 4BDMA 1Y9UA 3G3JA 1AL3A 5HBCA 2XX9A 2P0SA 1POY1 2Z23A 1XHYA 3KBRA 3T9HB 1MQGA 4ELOA 1SDXA 4HCWA 4F22A 3IOWA 5AA4A 2I48A 1SI1A 2X7PA 4KI0E 5B7DA 3USDA 4EXKA 1WVJA 1B5HA 1P1WA 1P1NA 3JYRA 4TLLB 1NNPA 3G3FA 3LBSA 2A5SA 3ZKKA 3IAZA 1NH7A 1B1XA 1MQJA 2P2AA 2PT1A 1FQCA 4N6PA 3C34A 4EQ7A 4G8NA 1I6QA 1TXFA 3LUYA 3KFMA 5I57B 4R2FA 1JEUA 4GL0A 3OSRA 4C1UA 5BUUA 5CMMA 4ISUA 3TDJA 4H8IA 4NMYA 3UP9A 4Q5TA 3K4UA 2XXYA 4LQ5A 3O2AA 1YTVA 1DTGA 4RK9A 3F11A 4QFOA 4OERA 3BFTA 3HHGA 4E0XA 2M8CA 3Q27A 1Y3PA 4GL8A 5H8NA 2DS9A 4NF6B 2F5XA 3IB1A 5AA2D 1SBPA 3IB2A 4NWDA 1O63A 4KHZE 2OWSA 3PUXE 2H9BA 3MW0A 1VFEA 1XS5A 1LFIA 5AA2B 2Q88A 4MF3A 4RA1A 4YICA 2F36A 4R9GA 5CMKA 1B46A 3N6TA 1M5FA 4RJZA 3FV1A 3UN6A 3VXCA 2ZYOA 3IORA 4ZDMA 4F3BA 1YAEA 3G3KA 3SETA 1R6ZA 2H25A 3MPKA 5K2XA 1A54A 5CBRA 5EHMA 1MPCA 4OEVA 4PFYA 1MH3A 4YB7A 1Y1ZA 2DWHA 1BKAA 2NXOA 1B40A 2ZNUA 2F6GA 4G8MA 5L9SA 4LP2B 3PU5A 1IEJA 1MS7A 1B1HA 4GQOA 1S7YA 2DVZA 3T93B 4U1ZA 5BWJA 1XOCA 1S50A 3LSWA 3CVGA 2NVUB 4I9DA 2AL5A 2W7YA 1B0LA 2HCAA 1XT8A 5TU0A 4XKQA 1H45A 1SI0A 4ZZEA 4ESWA 3QK6A 4LZ5A 1F9BA 4NEDA 1EZ9A 2VGQA 4JDFA 4RNSA 2XD2A 3BFUA 4F19A 2DE4A 4POWA 4FAJA 3PPOA 5CM6A 2ZNSA 3MZ1A 5JTYA 1UIUA 4JWXA 1SYIA 2DWAA 4GXAA 3PPPA 3CFZA 3T9VA 3S9LC 1Z7ME 5I56A 1ELJA 1OLCA 4AB5A 3DP6A 1Q1KA 2RINA 4R6HA 4JSOA 1A8EA 3OSQA 3O97A 1HSJA 2UYFA 2Y7IA 4NE4A 1FQDA 3B6QA 2G93A 1USYE 1B4HA 2P1SA 2Z8DA 3K1NA 4PP0A 1Q35A 3EHTA 2F8DA 4X1BA 4OVJA 2NUVA 2AIXA 3SEXA 1VR5A 3R6UA 2F35A 3O6GA 5L9OA 1SW1A 3C4MA 2ALUA 3CSBA 3UK4A 3IJOB 3KN8A 5A5XB 3PD8A 4X1DA 2CMOA 3CG1A 4YU0A 4R9FA 4H1XA 2Y7WA 3KN7A 3OMBA 4QFNA 4H5FA 1LCFA 4MBPA 3TODA 3OO9A 4Z7EA 3FVKA 2GHBA 1ZBMA 1LAHE 3CG3A 5KCJB 1UTBA 3IK6B 3EHSA 3FUZA 2OWTA 1JEVA 3IX1A 3HHFA 2Y84A 2I58A 3RT6B 1JW4A 4RYAA 1DOTA 1OLAA 5FTIA 3ZSFA 5KCJA 4H67A 4K3FA 4H5GA 2DXRA 1M5DA 3IR1A 3TMGA 5I2NA 1MH4A 1JVYA 4YAHX 4Q8RA 1OIBA 2I4CA 3H03A 2O6AA 2DE2A 3IOUA 1D9YA 1PBPA 3RPWA 1N3XA 4P11A 4O3BA 5H8HB 4ZEDA 1FQAA 5EYFA 4MFIA 1KWHA 1PEBA 1LCTA 5HM4B 3SEWA 4PQJA 5H8FB 4C0RA 3IO6A 4TQUQ 1WODA 2F6PA 3GXAA 2QSXA 2HAUA 4KR5A 2YJPA 3S9EA 1N7XA 5H8HA 1AMFA 1IXIA 4DDDA 3PUYE 2OZZA 2FYIA 2AL4A 4BDQA 1IZ1A 4EQBA 4QFLA 5H8FA 3N6UA 4ZS9A 2F34A 4PFWA 5ISUA 1R1NA 3OOAA 4ZEKA 2OBGA 4DE8A 1USYH 5H8QA 1H44A 1N04A 2REJA 1PC3A 1T0KA 3I6VA 2DYXA 1NFTA 2DWJA 2XXTA 1UTHB 2LAOA 4G68C 4LZ8A 2O84X 1B5JA 4DXUA 3PMVA 4KD5A 4M4GA 4GD5A 4LATA 1R9LA 4OFOA 2Y7RA 3H6TA 1QW0A 5KDTB 1HSEA 3K6XA 1I69A 4QFPA 1B52A 4KYDA 3RUMA 1B4ZA 1P1OA 3K0VA 1A40A 3FVNA 4ZEIA 4H8JA 4POXA 3BBRA 1A8FA 3IOVA 1PB8A 3S9NC 3ILTB 3C9HA 2I4BA 3GLBA 1US4A 5DEXB 3K02A 3PPQA 1N3WA 5KDTA 3ILUB 2H5YA 3QXMA 4Q30B 3TCHA 3SERA 4YB6A 3VLUA 2V3QA 3HO7A 4O3CA 1M5CA 4XKNA 4XKPA 4YKIA 3WAEA 2AYSA 4RXLA 1JW1A 5DEXA 3QAXA 1ZKBA 1OQHA 1A55A 1B0HA 4IO6A 1MXWA
chains in the Genus database with same CATH superfamily
2ONSA 1IIWA 1PDAA 4BDNA 2RC9A 1ZMGA 2Z8EA 2VD3A 3G3HA 2R6GE 5IZZA 4R75A 2XXUA 2HPGA 3E3KA 1GR2A 2V25A 3CR9A 4GOTA 4RPNA 5ET7A 3UA8A 2QVUA 4GRKA 3FGSA 4XKRA 2DP8A 2KLFA 3A3CA 4ZEFA 1NUZA 2ESNA 3T9XB 3KSJA 1SW4A 3LSLA 2ONKE 3C36A 4IO3A 5LOMA 4FE8A 4HCYA 1Z7NE 3W9VA 1RDYA 3K1PA 2QS4A 1YCJA 3H6WA 4QSDA 4ELRA 5TP9B 4TLMB 1ZU0A 1MXVA 5I57A 4U22A 1BTJA 4M1VA 2OLBA 1NNFA 3G7WA 3VVFA 4OHNA 2Q89A 1FBCA 4AQ4A 4ESXA 2XXWA 5FTHA 1B6HA 1NH8A 1J1NA 4P0GA 1MY2A 2GHAA 4HE0A 4LA9A 3PGFA 2DE3A 1NV3A 2QMXA 4GBVA 3GBBA 3VDFA 2Y7PA 4QFKA 4NF6A 3TZAA 3CIJA 2ONRA 3A09A 5A5LA 4O3AA 1FQEA 4MLQA 1GTKA 3SESA 4PE5B 2GH9A 4NG7A 3IFCA 1MXXA 3CI8A 4MIJA 2RC7A 2QPQA 3T22A 3TUSA 3MP1A 3PUZE 4I40A 1SW2A 4GBWA 2DVCA 5AA2A 3LSXA 2RF1A 1GV8A 4WEPA 3IL1B 4U21A 1POTA 5EHSA 2ZNTA 3UGWA 4MNPA 1LFGA 4KCCA 3CFLA 4F1YA 4JWOA 3MC2A 3C32A 3OENA 4NGUA 3PUWE 3PD9A 3Q28A 1DPEA 3U93A 5L8DA 1P1UA 3KEIA 1CB6A 5CBSA 1Y3NA 3THIA 2PVUA 2Q9TA 3TTKA 3SEVA 1EZOA 1PBQA 2O51A 4PGNA 4N8GA 2H99A 2B65A 1LFHA 2XX7A 3EKIA 1RYXA 4U1OA 2HXRA 3W15C 3EHUA 1FW0A 2X26A 2Q2CA 4R74A 4GLIA 3TEPA 4N81A 3E13X 3D4CA 5ICTA 3LSFB 3OD7A 3FASA 3H6VA 4YKJA 2I3VA 4WXJA 1FTMA 2HHMA 3MZBA 2D21A 4OVQA 2ZXTA 1Y4TA 3QUFA 4MNCA 3CSGA 1BP5A 4DLDA 4BLAA 2PBWA 3O29A 1B9JA 4LVQA 3MBPA 3I3VA 1TT1A 1ZTYA 2XXIA 4RK2A 4JXIA 2PT2A 4U2RA 4H46A 4PFUA 3OELA 4G77A 1O7TA 4ONYA 5F1QA 4YKPA 3E79A 1M5BA 3RLFE 2O1LA 4KFQA 3BIHA 2F7CA 4LUBA 3A3UA 3MJNA 5H8SA 1B51A 1MY4A 4OESA 2OK2A 1FTOA 1D4NA 4LZ7A 2I0BA 1OQGA 1R9QA 4QXDA 3K6UA 4F3GA 1XVXA 1II5A 3O66A 1MY1A 4AB6A 4I8CA 3Q29A 1IXCA 3ISPA 5KZTA 5A5XA 4G68B 5DW8A 4HE1A 2PYYA 4H6DA 3TELA 4YMAA 3B6TA 2R9JA 1MRPA 4TOZA 3LC8A 4JWYA 2GFEA 1M5EA 4DCXA 4GF8A 2JJKA 2P3NA 5TPAB 1FBGA 2RC8A 3L6GA 2CZLA 4XXUA 2XWKA 1SQYA 2HAVA 1LAGE 3HPIA 3O9PA 3RTFB 4G68A 4NAPA 4NF8B 2Z8FA 4EQ9A 3RTWB 1DPPA 3DELB 2Q2AA 1N76A 1QVSA 5DT6A 4YZZA 1IUDA 1LLSA 1L5TA 1EYKA 3PMXA 3PV0E 2HZLA 1LBCA 1JNFA 1S9TA 2O7IA 4XTCQ 4MLVA 3SEYA 2XXVA 5ITOA 4DIGA 5ICQA 3RN8A 2FNCA 3TQLA 1PB7A 3HFUA 2NOOA 3TTLA 3PPRA 1MXUA 1D9VA 2FIXA 2UYEA 4ND9A 1FPLA 4F3PA 1FBFA 4IB2A 3CHGA 2XD3A 3EQ1A 3JZJA 3K6WA 1NNKA 4ZE9A 3VLVA 3O6HA 2E0SA 4JVDA 4F2OA 1QUIA 1ATGA 1URDA 5FBPA 3K2DA 1HSLA 3T96B 2UVIA 5AE4A 2UVHA 1H76A 3QSLA 3MQ9A 4QHQA 1D3KA 1LBVA 3TPAA 3MVWA 1Y4CA 5I59B 3V89B 3S9MC 4YKKA 5JEIA 5ET5A 1FTLA 2GQ1A 5CMBA 5HPQA 1UQWA 2A5TB 4N4UA 1B05A 4R6KA 5IKBA 3MWBA 1IMBA 3I5OA 3S2VA 2NWJA 1B3HA 1Y20A 1B7UA 4R2BA 5AA3A 1DMBA 4Q0CA 1G0IA 5M2VA 3IOTA 4G4PA 2V3UA 4GWOA 3H3GA 3T66A 2I0CA 2O1MA 1JP4A 1URGA 4OMBA 4F2QA 4ZECA 4GVOA 3KOSA 4PDDA 4THIA 4XF5A 4OWDA 2QVVA 1OMPA 3Q26A 5I2KB 1MY0A 3V5AA 4U4SA 5F7VA 2I49A 4QRZA 4GWZA 4NWCA 4IGRA 4OFLA 4HS7A 3E9XA 1UTHA 3U8QA 2R71A 3HSTA 5DVFA 2ABHA 2RKMA 4NQ8A 3RT8A 4PDHA 1ZJLA 1D9QA 3M3KA 3MVZA 2DWIA 3VLWA 3C31A 1FPBA 3KZGA 4L17A 3H6UA 4KYEA 1B5IA 2HEUA 1XI6A 3MPLA 2OWZA 2F97A 4OYVA 5IZ3B 4GIZA 4I1DA 1US5A 4U4XA 1GGGA 5EQ8A 5FHMA 1VE4A 2VD2A 5DYHA 4EF2A 4H65A 3MZ9A 4R73A 1NV1A 1KA1A 1A7LA 3P7IA 3JV9A 3FATA 3G3GA 4Z0IA 4PFTA 3VVDA 1NI9A 2G29A 4JBZA 1P99A 3U1OA 4F31B 3BKIB 1BLFA 3R7XA 4FJPA 1NUYA 4DXCA 4KPTA 2THIA 2ANJA 3PTYA 5ITPA 4IO2A 2O69A 5LDZA 1K9ZA 2HFBA 3TFLA 3EPEA 4P0IA 4X9TA 5J1DA 2DXYA 2XXRA 4OA4A 4F1UA 5ELVA 1IXHA 4F29A 5CI5A 4QSCA 4HXVA 2RCBA 4GWSA 2QVRA 1IMAA 1IITA 2CZIA 4OENA 2V93A 3T9UA 1FCKA 3KN3A 3KJTA 4MNIA 5FHOA 1FTJA 3KJ7A 1IMDA 3SDFA 5H8NB 1SPIA 4G8HA 2WBDA 4ZEBA 1MQIA 4GWUA 2F78A 3TTRA 2XX8A 4OETA 3S4UA 1EYJA 3T0JA 1NNTA 2VT5A 4HW8A 3OEMA 2BJIA 5CRYA 3TCGA 1MPBA 4PBQA 1ANFA 4IO7A 3VV5A 4QBAA 1QKBA 2X7QA 3FXQA 3K01A 1CE2A 4BDRA 2HQ0A 2QJEA 5CMCA 4HTGA 1DSNA 1N7WA 2B3FA 3MUQA 3K00A 5EQ9A 1FQBA 3HN0A 3EN3A 5JK4A 1WDNA 4FIMA 4QF9A 4G2ZA 1IMFA 2DQVA 4KQPA 4I3YA 3VFJA 5EQAA 1FSAA 3OO8A 2D5WA 2PX1A 1GVCA 2PMSA 4I3EA 1RYOA 4LONB 5TP9A 5I7IA 2UVJA 5ET8A 4BDLA 2I3WA 2OJTA 4R6YA 1URSA 2PCRA 3B7DA 1SYHA 5AA1A 4WKMA 4GWYA 1EH3A 4GXSB 1AWBA 1P1QA 4EDPA 3DP4A 4GX6A 1YPNA 4NF4B 5IAIA 3FXUA 5I84A 4PETA 4YMBA 3ZKLA 2VOZA 3GBAA 2Q8MA 4UABA 3VVEA 3PUVE 2CEXA 3H06B 2OX3A 3FZVA 3FD3A 4F39A 4UA8A 3LR1A 3FV2A 3CFXA 4PE3A 4P3LA 4GX3A 4DZ1A 2F3DA 4ECFA 4NF4A 1JW5A 4YB5A 2P3VA 2VPOA 4OZ9A 1NV2A 1B7HA 2CZKA 4F18A 3FJ7A 3K6VA 1RKMA 3EF7A 2H98A 3B50A 1QJMA 3IO4A 2PFZA 1ZLQA 4UACA 4RY1A 3ZS6A 1YXIA 4FEDA 4P9KA 1EZPA 2ZZWA 1B3FA 5JTYB 1RDZA 1PB9A 1XC1A 4DI3D 4JSDA 4MCOA 4N07A 4U23A 4DCYA 5B70A 5I56B 3TTNA 2YPNA 4WEDA 3TKDA 2RCAA 2XXQA 2H4IA 5F24A 4EF1A 1H43A 2QS2A 3UIFA 1MXYA 2DSFA 3TYHA 3K1MA 3RY3A 2E1SA 3N94A 4PBHA 3MVXA 3DLNA 1LB8A 1TWYA 1CNQA 3ODBA 1RDXA 1KZ8A 5K2YA 3UORA 3FXRA 4P56A 4X8RA 1B3GA 1JETA 1LAFE 2HXWA 4FECA 4P1EA 3D4GA 3RQTA 1BIYA 3HV1A 5LTCA 3OO7A 4EXLA 4DI4B 2O7UA 1JQFA 3QUJA 1NKXA 4OEUA 3RNNA 2V3TA 2Z22A 2MKZA 3KSXA 1FBEA 3QIMA 5I3SA 2F7BA 3B6WA 3Q25A 1EU8A 2QMWA 4H45A 4NX1A 3DP8A 2XXXA 4I62A 4N6DA 1A99A 2VPNA 1B58A 3H4ZA 2IEEA 1K9YA 3KOTA 1UTBB 3O28A 4IGTA 3V83A 4N8YA 4N17A 1SD3A 4KYSA 3VE1B 2UVGA 2XXHA 1N0TA 3N5LA 4OVSA 2DOJA 5DVJA 1VDWA 1FPJA 3OEKA 1MG1A 1SVXB 2O68A 4G61A 4E0WA 2XXPA 4NF5B 4MH5A 4RPOA 4IO4A 3E4RA 4ELQA 4IO5A 3PMWA 2GRVA 3CRBA 2Y7KA 1N84A 3GYYA 1IMCA 3OO6A 3SEUA 2V84A 5I2NB 3KC1A 3SZPA 1QULA 2VHAA 5DTBA 1JVXA 3RGYA 4IY6A 3R26A 4F3SA 4O7IA 1ZIUA 5CC2A 2B4MA 3U72A 1IXGA 1FPFA 4NF5A 3G3IA 3FVGA 1MM6A 3C35A 3E78A 4PCDA 4X48A 4F1VA 2REGA 1MPDA 2I6EA 1O64A 5TPAA 2ZYNA 3MP8A 1TFAA 1IQ7A 3U94A 4FEBA 2QL3A 4H0WA 4QSEA 3M3LA 1MY3A 4ZZAA 2WYKA 4MX6A 4NF8A 5FHNA 4OQOA 3FJMA 1EYIA 1LEVA 1I6AA 4FORA 4C1TA 3M8UA 4PFIA 3V8XB 2QS1A 4GFRA 3KBZA 2F7AA 1QUKA 5L9MA 1INPA 1FQFA 2B4LA 3C33A 2FA7A 3HCQA 4ZE8A 2BJJX 4EUOA 3FIRA 2HZKA 2WBBA 1LBBA 2VP1A 3FJGA 1LB9A 4FATA 3U65A 4P8BA 3DM0A 3SKPA 3TCFA 1DTZA 3MVYA 5EYGA 1MQHA 1VFDA 4NHBA 1FPIA 1FTKA 3MAMA 4AS5A 3N26A 3GZGA 3VXBA 4NTLA 1LGBC 5H8QB 1B3EA 3H7MA 1B7ZA 1UIVA 1H3DA 1AIVA 1NV5A 4OFJA 1FJ6A 1MQDA 1NMUA 1MM7A 1QUJA 2WKYA 4ELPA 2YLNA 3IB0A 3KGCA 1NL5A 2QRYA 3ONMA 3OXNA 4PF6A 4KCDA 4PGPA 3FBPA 3W9WA 1KA0A 5DVIA 3IJXB 1FPEA 5I59A 2OCUA 4PC9A 2ZMBA 3QYTA 2IA4A 3FVOA 4N13A 1OVBA 1MXZA 2ZYMA 4IY5A 2A5TA 3KG2A 4PTKA 3PPNA 3T1BA 1SW5A 3WAFA 1AH5A 4LQ2A 2ZYKA 3TQWA 4OXVA 1VSOA 5I58B 2XWIA 3LV0A 4OTEA 4DXBA 1MDP1 1OVTA 1TFDA 4PFBA 1YZ0A 2D3IA 1B3LA 1XVYA 3NOHA 3A29A 1I6BA 3TAJA 4AS4A 1B32A 1B2HA 3U92A 1QKAA 1LSTA 4O7MA 4R72A 1MDQA 2QS3A 4OANA 3ECRA 4PF8A 5I2KA 2B3BA 1Y1MA 2XHDA 3AXFA 5AA4B 3L6HA 3O6IA 4BDOA 1Y3QA 2Q8JA 3MP6A 5I58A 1LAXA 2UXAA 4JB7A 1AOVA 4XIGQ 1FPKA 1DK4A 3M3FA 3TTMA 4BDMA 4N6KA 1Y9UA 3G3JA 1AL3A 5HBCA 2XX9A 3FXBA 2P0SA 1POY1 2Z23A 2Q74A 1XHYA 3KBRA 3T9HB 1MQGA 1QGXA 4ELOA 1SDXA 4HCWA 2FIEA 4O94A 4F22A 3IOWA 5AA4A 2I48A 4GX4A 1SI1A 2X7PA 4KI0E 5IZ3A 5B7DA 2F3BA 3USDA 4EXKA 1WVJA 1B5HA 1P1WA 1P1NA 3JYRA 4TLLB 1NNPA 3G3FA 3LBSA 2A5SA 3ZKKA 3IAZA 4GWXA 1NH7A 4N15A 1B1XA 1MQJA 2P2AA 2PT1A 4MEVA 1FQCA 2ZZXA 4N6PA 3C34A 4EQ7A 4G8NA 2V4CA 1I6QA 1TXFA 3LUYA 3KFMA 5I57B 4R2FA 1JEUA 4GL0A 3OSRA 4C1UA 5BUUA 5CMMA 3MSTA 4ISUA 2ZZVA 4JVIA 4H8IA 3TDJA 4NMYA 3UP9A 4Q5TA 1NV4A 3K4UA 2XXYA 4LQ5A 3O2AA 1YTVA 1DTGA 4RK9A 2FHYA 3F11A 4QFOA 4PAIA 4OERA 3BFTA 3HHGA 4E0XA 2M8CA 3Q27A 1Y3PA 4GL8A 5H8NA 1NV6A 2DS9A 4NF6B 2F5XA 3B8BA 3IB1A 5AA2D 1SBPA 3IB2A 4NWDA 1O63A 4KHZE 1DCUA 2KR0A 2OWSA 3PUXE 2H9BA 3MW0A 1FPGA 1VFEA 1XS5A 1LFIA 2CEYA 4NF0A 5AA2B 2Q88A 3D1RA 4MF3A 4RA1A 4YICA 2F36A 4R9GA 5CMKA 1B46A 3N6TA 1M5FA 4RJZA 3FV1A 3UN6A 3VXCA 5I5PA 2ZYOA 3IORA 4ZDMA 4F3BA 1G0HA 4GWWA 1YAEA 3G3KA 2XWVA 3SETA 1R6ZA 2H25A 2WX9A 3MPKA 5K2XA 1A54A 5CBRA 5EHMA 1MPCA 4OEVA 4PFYA 1MH3A 4YB7A 1Y1ZA 1Q9DA 2DWHA 1FBDA 1BKAA 2NXOA 1B40A 2L5VA 2ZNUA 2F6GA 1FPDA 4G8MA 5L9SA 3KC0A 4LP2B 3PU5A 2WYPA 1IEJA 5J16A 1MS7A 1B1HA 1YYZA 4GQOA 4FBPA 1S7YA 2DVZA 3T93B 4U1ZA 2XXKA 5BWJA 1XOCA 1S50A 3LSWA 3CVGA 2NVUB 4I9DA 2AL5A 2W7YA 2XWOA 1B0LA 2HCAA 1XT8A 4P1LA 5TU0A 4XKQA 1H45A 1SI0A 2XA5A 4ZZEA 4ESWA 5EYHA 3QK6A 4LZ5A 1F9BA 4NEDA 1EZ9A 2VGQA 4JDFA 4RNSA 2XD2A 2KQZA 3BFUA 4F19A 2DE4A 1FBPA 4POWA 4FAJA 3PPOA 5IM2A 5CM6A 2ZNSA 3MZ1A 5JTYA 1UIUA 4JWXA 1SYIA 4KXPA 2DWAA 4XEQA 4PFRA 4GXAA 3PPPA 3CFZA 3T9VA 3S9LC 1Z7ME 5I56A 1ELJA 1OLCA 4AB5A 3DP6A 1Q1KA 2RINA 4R6HA 4IR8A 3ROJA 4JSOA 1A8EA 3OSQA 3O97A 1HSJA 2UYFA 2FBPA 2Y7IA 4NE4A 1FQDA 3B6QA 2G93A 1USYE 1B4HA 2P1SA 2Z8DA 1IMEA 3K1NA 4PP0A 1Q35A 3EHTA 2F8DA 4X1BA 4OVJA 2NUVA 2AIXA 3SEXA 1VR5A 1LBWA 3R6UA 2F35A 3O6GA 5L9OA 1SW1A 2CZHA 2QFLA 3C4MA 2ALUA 3CSBA 4HE2A 3UK4A 3IJOB 3BIGA 3KN8A 5A5XB 3PD8A 4X1DA 2CMOA 3CG1A 4YU0A 4R9FA 4H1XA 2Y7WA 3KN7A 4P47A 3OMBA 2PFYA 4QFNA 4PAFA 4H5FA 1LCFA 4MBPA 3TODA 1NUXA 3OO9A 3LUZA 4Z7EA 3FVKA 2GHBA 1ZBMA 1LAHE 1FBHA 4MMPA 3CG3A 5KCJB 1UTBA 4X04A 3IK6B 4MJOA 5ET6A 3EHSA 3FUZA 2OWTA 1JEVA 3IX1A 3HHFA 3RYDA 2Y84A 2I58A 3RT6B 1JW4A 4RYAA 1DOTA 1OLAA 4XFEA 1NV0A 5IZ1A 5ESYA 5FTIA 3ZSFA 5KCJA 1NUWA 4H67A 4K3FA 4H5GA 1FJ9A 2DXRA 1M5DA 3QMFA 3IR1A 3TMGA 5I2NA 1MH4A 1JVYA 3IFAA 4YAHX 4Q8RA 1OIBA 2I4CA 3H03A 2O6AA 2DE2A 3IOUA 4LN5A 1D9YA 1PBPA 5T3JA 3RPWA 1N3XA 4P11A 4O3BA 5IGAA 5H8HB 4ZEDA 1FQAA 5EYFA 3RPLB 4MFIA 1FRPA 1KWHA 1PEBA 1LCTA 5HM4B 3SEWA 4PQJA 4OVTA 5H8FB 4C0RA 3IO6A 4TQUQ 1BK4A 1WODA 2F6PA 3GXAA 2QSXA 2HAUA 4KR5A 2YJPA 1LBZA 3S9EA 1N7XA 2DDKA 5H8HA 4MAGA 1AMFA 1IXIA 5EQ7A 4DDDA 3RPLA 3PUYE 2OZZA 2FYIA 2AL4A 4BDQA 1IZ1A 4EQBA 4QFLA 4O8MA 2WEFA 1LBXA 5H8FA 3MYUA 3N6UA 2Y5LA 4OVRA 4ZS9A 2F34A 4PFWA 5ISUA 1R1NA 3OOAA 4ZEKA 2OBGA 4DE8A 1USYH 5H8QA 4JVCA 1H44A 1N04A 2REJA 1PC3A 1T0KA 3I6VA 2DYXA 1NFTA 2DWJA 2XXTA 1UTHB 2LAOA 4G68C 4LZ8A 2R8TA 2O84X 1DBZA 1NV7A 1B5JA 4DXUA 3PMVA 4KD5A 4M4GA 4GD5A 4LATA 4PAKA 1R9LA 4OFOA 2Y7RA 3H6TA 1QW0A 5KDTB 4MHFA 1HSEA 3K6XA 1I69A 4N91A 2FVZA 4QFPA 1B52A 4KYDA 3RUMA 1B4ZA 1P1OA 3K0VA 1A40A 3FVNA 4ZEIA 4H8JA 4POXA 3BBRA 4NN3A 1A8FA 3IOVA 1PB8A 3S9NC 3ILTB 3C9HA 2I4BA 3GLBA 1LBYA 1US4A 5DEXB 3K02A 3PPQA 1N3WA 5KDTA 3ILUB 2H5YA 3QXMA 4OVPA 4Q30B 3TCHA 3SERA 4YB6A 3VLUA 2V3QA 3HO7A 4O3CA 1FTAA 1M5CA 4XKNA 4XKPA 4YKIA 3WAEA 2Y5KA 2AYSA 4RXLA 1JW1A 5DEXA 3QAXA 1ZKBA 1OQHA 1A55A 1B0HA 4IO6A 1MXWA
chains in the Genus database with same CATH topology
2ONSA 1IIWA 1PDAA 4BDNA 2RC9A 1ZMGA 2Z8EA 2VD3A 3G3HA 2R6GE 4R75A 2XXUA 3E3KA 1GR2A 2V25A 3CR9A 4GOTA 4RPNA 3UA8A 4GRKA 3FGSA 4XKRA 2DP8A 2KLFA 3A3CA 4ZEFA 2ESNA 3T9XB 3KSJA 1SW4A 3LSLA 2ONKE 3C36A 4IO3A 5LOMA 4FE8A 4HCYA 1Z7NE 3W9VA 3K1PA 2QS4A 1YCJA 3H6WA 4QSDA 4ELRA 5TP9B 4TLMB 1ZU0A 1MXVA 5I57A 4U22A 1BTJA 4M1VA 2OLBA 1NNFA 3G7WA 3VVFA 4OHNA 2Q89A 4AQ4A 4ESXA 2XXWA 5FTHA 1B6HA 1NH8A 1J1NA 4P0GA 1MY2A 2GHAA 4LA9A 3PGFA 2DE3A 2QMXA 3GBBA 3VDFA 2Y7PA 4QFKA 4NF6A 3TZAA 3CIJA 2ONRA 3A09A 4O3AA 1FQEA 4MLQA 1GTKA 3SESA 4PE5B 2GH9A 1MXXA 3CI8A 2RC7A 2QPQA 3T22A 3TUSA 3MP1A 3PUZE 1SW2A 2DVCA 5AA2A 3LSXA 2RF1A 1GV8A 4WEPA 3IL1B 4U21A 1POTA 5EHSA 2ZNTA 3UGWA 1LFGA 4KCCA 3CFLA 4F1YA 4JWOA 3MC2A 3C32A 3OENA 3PUWE 3PD9A 3Q28A 1DPEA 3U93A 5L8DA 1P1UA 3KEIA 1CB6A 5CBSA 1Y3NA 3THIA 2PVUA 2Q9TA 3TTKA 3SEVA 1EZOA 1PBQA 2O51A 2H99A 2B65A 1LFHA 2XX7A 1RYXA 4U1OA 3W15C 3EHUA 1FW0A 2X26A 2Q2CA 4R74A 4GLIA 3TEPA 3E13X 3D4CA 5ICTA 3LSFB 3OD7A 3FASA 3H6VA 4YKJA 2I3VA 4WXJA 1FTMA 3MZBA 2D21A 2ZXTA 1Y4TA 3QUFA 3CSGA 1BP5A 4DLDA 4BLAA 2PBWA 3O29A 1B9JA 4LVQA 3MBPA 3I3VA 1TT1A 1ZTYA 2XXIA 4RK2A 4JXIA 2PT2A 4U2RA 4PFUA 3OELA 4G77A 1O7TA 4ONYA 5F1QA 4YKPA 1M5BA 3RLFE 2O1LA 4KFQA 2F7CA 4LUBA 3A3UA 3MJNA 5H8SA 1B51A 1MY4A 4OESA 2OK2A 1FTOA 1D4NA 4LZ7A 2I0BA 1OQGA 1R9QA 3K6UA 4F3GA 1XVXA 1II5A 3O66A 1MY1A 4AB6A 4I8CA 3Q29A 1IXCA 5KZTA 5A5XA 4G68B 2PYYA 4H6DA 3TELA 4YMAA 3B6TA 2R9JA 1MRPA 4TOZA 3LC8A 4JWYA 2GFEA 1M5EA 4DCXA 4GF8A 5TPAB 2RC8A 3L6GA 2CZLA 4XXUA 1SQYA 2HAVA 1LAGE 3HPIA 3O9PA 3RTFB 4G68A 4NF8B 2Z8FA 4EQ9A 3RTWB 1DPPA 3DELB 2Q2AA 1N76A 1QVSA 5DT6A 4YZZA 1IUDA 1LLSA 1L5TA 3PMXA 3PV0E 2HZLA 1LBCA 1JNFA 1S9TA 2O7IA 4XTCQ 4MLVA 3SEYA 2XXVA 5ITOA 4DIGA 5ICQA 3RN8A 2FNCA 3TQLA 1PB7A 2NOOA 3TTLA 3PPRA 1MXUA 1D9VA 2UYEA 4ND9A 4F3PA 4IB2A 2XD3A 3EQ1A 3JZJA 3K6WA 1NNKA 4ZE9A 3VLVA 3O6HA 2E0SA 4F2OA 1QUIA 1ATGA 1URDA 3K2DA 1HSLA 3T96B 2UVIA 5AE4A 2UVHA 1H76A 3QSLA 3MQ9A 4QHQA 1D3KA 3TPAA 3MVWA 1Y4CA 5I59B 3V89B 3S9MC 4YKKA 5JEIA 1FTLA 5HPQA 5CMBA 1UQWA 2A5TB 1B05A 4R6KA 5IKBA 3MWBA 3I5OA 3S2VA 2NWJA 1B3HA 1Y20A 1B7UA 4R2BA 5AA3A 1DMBA 4Q0CA 5M2VA 3IOTA 4G4PA 2V3UA 4GWOA 3H3GA 3T66A 2I0CA 2O1MA 1URGA 4OMBA 4F2QA 4ZECA 4GVOA 3KOSA 4THIA 4OWDA 1OMPA 3Q26A 5I2KB 1MY0A 3V5AA 4U4SA 5F7VA 2I49A 4QRZA 4NWCA 4IGRA 4OFLA 4HS7A 3E9XA 1UTHA 3U8QA 2R71A 3HSTA 5DVFA 2ABHA 2RKMA 3RT8A 1ZJLA 3M3KA 3MVZA 2DWIA 3VLWA 3C31A 3KZGA 4L17A 3H6UA 4KYEA 1B5IA 2HEUA 3MPLA 2F97A 4OYVA 4GIZA 4I1DA 1US5A 4U4XA 1GGGA 5FHMA 1VE4A 2VD2A 5DYHA 4EF2A 4H65A 3MZ9A 4R73A 1A7LA 3P7IA 3JV9A 3FATA 3G3GA 4Z0IA 4PFTA 3VVDA 2G29A 4JBZA 1P99A 3U1OA 4F31B 3BKIB 1BLFA 3R7XA 4FJPA 4DXCA 4KPTA 2THIA 2ANJA 5ITPA 4IO2A 2O69A 2HFBA 3TFLA 3EPEA 4P0IA 4X9TA 5J1DA 2DXYA 2XXRA 4F1UA 5ELVA 1IXHA 4F29A 5CI5A 4QSCA 2RCBA 1IITA 4OENA 2V93A 3T9UA 1FCKA 3KN3A 3KJTA 5FHOA 1FTJA 3KJ7A 3SDFA 5H8NB 4G8HA 4ZEBA 1MQIA 2F78A 3TTRA 2XX8A 4OETA 3S4UA 1NNTA 4HW8A 3OEMA 5CRYA 3TCGA 1MPBA 1ANFA 4IO7A 3VV5A 1QKBA 2X7QA 3FXQA 3K01A 1CE2A 4BDRA 2HQ0A 2QJEA 5CMCA 4HTGA 1DSNA 1N7WA 2B3FA 3MUQA 3K00A 1FQBA 3HN0A 3EN3A 5JK4A 1WDNA 4FIMA 4QF9A 4G2ZA 2DQVA 4KQPA 3VFJA 3OO8A 2D5WA 2PX1A 1GVCA 2PMSA 1RYOA 4LONB 5TP9A 2UVJA 4BDLA 2I3WA 2OJTA 4R6YA 1URSA 3B7DA 1SYHA 5AA1A 4WKMA 1EH3A 4GXSB 4EDPA 1P1QA 3DP4A 1YPNA 4NF4B 5IAIA 3FXUA 5I84A 4PETA 4YMBA 3ZKLA 2VOZA 3GBAA 3VVEA 3PUVE 3H06B 3FZVA 3FD3A 4F39A 4UA8A 3LR1A 3FV2A 3CFXA 4DZ1A 4ECFA 4NF4A 1JW5A 4YB5A 4OZ9A 1B7HA 4F18A 3FJ7A 3K6VA 1RKMA 3EF7A 2H98A 1QJMA 3IO4A 1ZLQA 4UACA 4RY1A 3ZS6A 4FEDA 1EZPA 1B3FA 5JTYB 1PB9A 1XC1A 4JSDA 4N07A 4U23A 4DCYA 5B70A 5I56B 3TTNA 2YPNA 4WEDA 3TKDA 2RCAA 2XXQA 2H4IA 4EF1A 1H43A 2QS2A 3UIFA 1MXYA 2DSFA 3TYHA 3RY3A 3K1MA 2E1SA 3N94A 3MVXA 3DLNA 1LB8A 1TWYA 3ODBA 5K2YA 3UORA 3FXRA 1B3GA 1JETA 1LAFE 2HXWA 4FECA 3D4GA 3RQTA 1BIYA 3HV1A 3OO7A 4EXLA 2O7UA 1JQFA 3QUJA 1NKXA 4OEUA 3RNNA 2V3TA 2Z22A 3KSXA 3QIMA 2F7BA 3B6WA 3Q25A 1EU8A 2QMWA 3DP8A 2XXXA 4I62A 1A99A 1B58A 3H4ZA 2IEEA 3KOTA 1UTBB 3O28A 4IGTA 3V83A 1SD3A 4KYSA 3VE1B 2UVGA 2XXHA 1N0TA 3N5LA 2DOJA 5DVJA 3OEKA 1MG1A 1SVXB 2O68A 4E0WA 2XXPA 4NF5B 4MH5A 4RPOA 4IO4A 3E4RA 4ELQA 4IO5A 3PMWA 2GRVA 3CRBA 2Y7KA 1N84A 3OO6A 3SEUA 2V84A 5I2NB 1QULA 2VHAA 5DTBA 1JVXA 3RGYA 4IY6A 3R26A 4F3SA 1ZIUA 5CC2A 3U72A 1IXGA 4NF5A 3G3IA 3FVGA 1MM6A 3C35A 4X48A 4F1VA 2REGA 1MPDA 2I6EA 1O64A 5TPAA 2ZYNA 3MP8A 1TFAA 1IQ7A 3U94A 4FEBA 2QL3A 4H0WA 4QSEA 3M3LA 1MY3A 4ZZAA 4NF8A 5FHNA 4OQOA 3FJMA 1I6AA 4FORA 4C1TA 3M8UA 3V8XB 2QS1A 4GFRA 2F7AA 1QUKA 5L9MA 1FQFA 3C33A 2FA7A 3HCQA 4ZE8A 2BJJX 4EUOA 3FIRA 2HZKA 1LBBA 2VP1A 3FJGA 1LB9A 4FATA 3DM0A 3SKPA 3TCFA 1DTZA 3MVYA 1MQHA 1VFDA 1FTKA 3MAMA 3N26A 3GZGA 3VXBA 4NTLA 1LGBC 5H8QB 1B3EA 3H7MA 1B7ZA 1UIVA 1H3DA 1AIVA 4OFJA 1MQDA 1NMUA 1MM7A 1QUJA 2WKYA 4ELPA 2YLNA 3IB0A 3KGCA 1NL5A 2QRYA 3ONMA 3OXNA 4KCDA 3W9WA 5DVIA 3IJXB 5I59A 2OCUA 2ZMBA 3QYTA 2IA4A 3FVOA 4N13A 1OVBA 1MXZA 2ZYMA 4IY5A 2A5TA 3KG2A 3PPNA 1SW5A 3WAFA 1AH5A 4LQ2A 2ZYKA 3TQWA 4OXVA 1VSOA 5I58B 4OTEA 4DXBA 1MDP1 1OVTA 1TFDA 2D3IA 1B3LA 1XVYA 1I6BA 3TAJA 1B32A 1B2HA 3U92A 1QKAA 1LSTA 4R72A 1MDQA 2QS3A 3ECRA 5I2KA 2B3BA 1Y1MA 2XHDA 3AXFA 5AA4B 3L6HA 3O6IA 4BDOA 1Y3QA 2Q8JA 3MP6A 5I58A 1LAXA 2UXAA 4JB7A 1AOVA 4XIGQ 3M3FA 3TTMA 4BDMA 1Y9UA 3G3JA 1AL3A 5HBCA 2XX9A 2P0SA 1POY1 2Z23A 1XHYA 3KBRA 3T9HB 1MQGA 4ELOA 1SDXA 4HCWA 4F22A 3IOWA 5AA4A 2I48A 1SI1A 2X7PA 4KI0E 5B7DA 3USDA 4EXKA 1WVJA 1B5HA 1P1WA 1P1NA 3JYRA 4TLLB 1NNPA 3G3FA 3LBSA 2A5SA 3ZKKA 3IAZA 1NH7A 1B1XA 1MQJA 2P2AA 2PT1A 1FQCA 4N6PA 3C34A 4EQ7A 4G8NA 1I6QA 1TXFA 3LUYA 3KFMA 5I57B 4R2FA 1JEUA 4GL0A 3OSRA 4C1UA 5BUUA 5CMMA 4ISUA 3TDJA 4H8IA 4NMYA 3UP9A 4Q5TA 3K4UA 2XXYA 4LQ5A 3O2AA 1YTVA 1DTGA 4RK9A 3F11A 4QFOA 4OERA 3BFTA 3HHGA 4E0XA 2M8CA 3Q27A 1Y3PA 4GL8A 5H8NA 2DS9A 4NF6B 2F5XA 3IB1A 5AA2D 1SBPA 3IB2A 4NWDA 1O63A 4KHZE 2OWSA 3PUXE 2H9BA 3MW0A 1VFEA 1XS5A 1LFIA 5AA2B 2Q88A 4MF3A 4RA1A 4YICA 2F36A 4R9GA 5CMKA 1B46A 3N6TA 1M5FA 4RJZA 3FV1A 3UN6A 3VXCA 2ZYOA 3IORA 4ZDMA 4F3BA 1YAEA 3G3KA 3SETA 1R6ZA 2H25A 3MPKA 5K2XA 1A54A 5CBRA 5EHMA 1MPCA 4OEVA 4PFYA 1MH3A 4YB7A 1Y1ZA 2DWHA 1BKAA 2NXOA 1B40A 2ZNUA 2F6GA 4G8MA 5L9SA 4LP2B 3PU5A 1IEJA 1MS7A 1B1HA 4GQOA 1S7YA 2DVZA 3T93B 4U1ZA 5BWJA 1XOCA 1S50A 3LSWA 3CVGA 2NVUB 4I9DA 2AL5A 2W7YA 1B0LA 2HCAA 1XT8A 5TU0A 4XKQA 1H45A 1SI0A 4ZZEA 4ESWA 3QK6A 4LZ5A 1F9BA 4NEDA 1EZ9A 2VGQA 4JDFA 4RNSA 2XD2A 3BFUA 4F19A 2DE4A 4POWA 4FAJA 3PPOA 5CM6A 2ZNSA 3MZ1A 5JTYA 1UIUA 4JWXA 1SYIA 2DWAA 4GXAA 3PPPA 3CFZA 3T9VA 3S9LC 1Z7ME 5I56A 1ELJA 1OLCA 4AB5A 3DP6A 1Q1KA 2RINA 4R6HA 4JSOA 1A8EA 3OSQA 3O97A 1HSJA 2UYFA 2Y7IA 4NE4A 1FQDA 3B6QA 2G93A 1USYE 1B4HA 2P1SA 2Z8DA 3K1NA 4PP0A 1Q35A 3EHTA 2F8DA 4X1BA 4OVJA 2NUVA 2AIXA 3SEXA 1VR5A 3R6UA 2F35A 3O6GA 5L9OA 1SW1A 3C4MA 2ALUA 3CSBA 3UK4A 3IJOB 3KN8A 5A5XB 3PD8A 4X1DA 2CMOA 3CG1A 4YU0A 4R9FA 4H1XA 2Y7WA 3KN7A 3OMBA 4QFNA 4H5FA 1LCFA 4MBPA 3TODA 3OO9A 4Z7EA 3FVKA 2GHBA 1ZBMA 1LAHE 3CG3A 5KCJB 1UTBA 3IK6B 3EHSA 3FUZA 2OWTA 1JEVA 3IX1A 3HHFA 2Y84A 2I58A 3RT6B 1JW4A 4RYAA 1DOTA 1OLAA 5FTIA 3ZSFA 5KCJA 4H67A 4K3FA 4H5GA 2DXRA 1M5DA 3IR1A 3TMGA 5I2NA 1MH4A 1JVYA 4YAHX 4Q8RA 1OIBA 2I4CA 3H03A 2O6AA 2DE2A 3IOUA 1D9YA 1PBPA 3RPWA 1N3XA 4P11A 4O3BA 5H8HB 4ZEDA 1FQAA 5EYFA 4MFIA 1KWHA 1PEBA 1LCTA 5HM4B 3SEWA 4PQJA 5H8FB 4C0RA 3IO6A 4TQUQ 1WODA 2F6PA 3GXAA 2QSXA 2HAUA 4KR5A 2YJPA 3S9EA 1N7XA 5H8HA 1AMFA 1IXIA 4DDDA 3PUYE 2OZZA 2FYIA 2AL4A 4BDQA 1IZ1A 4EQBA 4QFLA 5H8FA 3N6UA 4ZS9A 2F34A 4PFWA 5ISUA 1R1NA 3OOAA 4ZEKA 2OBGA 4DE8A 1USYH 5H8QA 1H44A 1N04A 2REJA 1PC3A 1T0KA 3I6VA 2DYXA 1NFTA 2DWJA 2XXTA 1UTHB 2LAOA 4G68C 4LZ8A 2O84X 1B5JA 4DXUA 3PMVA 4KD5A 4M4GA 4GD5A 4LATA 1R9LA 4OFOA 2Y7RA 3H6TA 1QW0A 5KDTB 1HSEA 3K6XA 1I69A 4QFPA 1B52A 4KYDA 3RUMA 1B4ZA 1P1OA 3K0VA 1A40A 3FVNA 4ZEIA 4H8JA 4POXA 3BBRA 1A8FA 3IOVA 1PB8A 3S9NC 3ILTB 3C9HA 2I4BA 3GLBA 1US4A 5DEXB 3K02A 3PPQA 1N3WA 5KDTA 3ILUB 2H5YA 3QXMA 4Q30B 3TCHA 3SERA 4YB6A 3VLUA 2V3QA 3HO7A 4O3CA 1M5CA 4XKNA 4XKPA 4YKIA 3WAEA 2AYSA 4RXLA 1JW1A 5DEXA 3QAXA 1ZKBA 1OQHA 1A55A 1B0HA 4IO6A 1MXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ONS A;  1IIW A;  1PDA A;  4BDN A;  2RC9 A;  1ZMG A;  2Z8E A;  2VD3 A;  3G3H A;  2R6G E;  4R75 A;  2XXU A;  3E3K A;  1GR2 A;  2V25 A;  3CR9 A;  4GOT A;  4RPN A;  3UA8 A;  4GRK A;  3FGS A;  4XKR A;  2DP8 A;  2KLF A;  3A3C A;  4ZEF A;  2ESN A;  3T9X B;  3KSJ A;  1SW4 A;  3LSL A;  2ONK E;  3C36 A;  4IO3 A;  5LOM A;  4FE8 A;  4HCY A;  1Z7N E;  3W9V A;  3K1P A;  2QS4 A;  1YCJ A;  3H6W A;  4QSD A;  4ELR A;  5TP9 B;  4TLM B;  1ZU0 A;  1MXV A;  5I57 A;  4U22 A;  1BTJ A;  4M1V A;  2OLB A;  1NNF A;  3G7W A;  3VVF A;  4OHN A;  2Q89 A;  4AQ4 A;  4ESX A;  2XXW A;  5FTH A;  1B6H A;  1NH8 A;  1J1N A;  4P0G A;  1MY2 A;  2GHA A;  4LA9 A;  3PGF A;  2DE3 A;  2QMX A;  3GBB A;  3VDF A;  2Y7P A;  4QFK A;  4NF6 A;  3TZA A;  3CIJ A;  2ONR A;  3A09 A;  4O3A A;  1FQE A;  4MLQ A;  1GTK A;  3SES A;  4PE5 B;  2GH9 A;  1MXX A;  3CI8 A;  2RC7 A;  2QPQ A;  3T22 A;  3TUS A;  3MP1 A;  3PUZ E;  1SW2 A;  2DVC A;  5AA2 A;  3LSX A;  2RF1 A;  1GV8 A;  4WEP A;  3IL1 B;  4U21 A;  1POT A;  5EHS A;  2ZNT A;  3UGW A;  1LFG A;  4KCC A;  3CFL A;  4F1Y A;  4JWO A;  3MC2 A;  3C32 A;  3OEN A;  3PUW E;  3PD9 A;  3Q28 A;  1DPE A;  3U93 A;  5L8D A;  1P1U A;  3KEI A;  1CB6 A;  5CBS A;  1Y3N A;  3THI A;  2PVU A;  2Q9T A;  3TTK A;  3SEV A;  1EZO A;  1PBQ A;  2O51 A;  2H99 A;  2B65 A;  1LFH A;  2XX7 A;  1RYX A;  4U1O A;  3W15 C;  3EHU A;  1FW0 A;  2X26 A;  2Q2C A;  4R74 A;  4GLI A;  3TEP A;  3E13 X;  3D4C A;  5ICT A;  3LSF B;  3OD7 A;  3FAS A;  3H6V A;  4YKJ A;  2I3V A;  4WXJ A;  1FTM A;  3MZB A;  2D21 A;  2ZXT A;  1Y4T A;  3QUF A;  3CSG A;  1BP5 A;  4DLD A;  4BLA A;  2PBW A;  3O29 A;  1B9J A;  4LVQ A;  3MBP A;  3I3V A;  1TT1 A;  1ZTY A;  2XXI A;  4RK2 A;  4JXI A;  2PT2 A;  4U2R A;  4PFU A;  3OEL A;  4G77 A;  1O7T A;  4ONY A;  5F1Q A;  4YKP A;  1M5B A;  3RLF E;  2O1L A;  4KFQ A;  2F7C A;  4LUB A;  3A3U A;  3MJN A;  5H8S A;  1B51 A;  1MY4 A;  4OES A;  2OK2 A;  1FTO A;  1D4N A;  4LZ7 A;  2I0B A;  1OQG A;  1R9Q A;  3K6U A;  4F3G A;  1XVX A;  1II5 A;  3O66 A;  1MY1 A;  4AB6 A;  4I8C A;  3Q29 A;  1IXC A;  5KZT A;  5A5X A;  4G68 B;  2PYY A;  4H6D A;  3TEL A;  4YMA A;  3B6T A;  2R9J A;  1MRP A;  4TOZ A;  3LC8 A;  4JWY A;  2GFE A;  1M5E A;  4DCX A;  4GF8 A;  5TPA B;  2RC8 A;  3L6G A;  2CZL A;  4XXU A;  1SQY A;  2HAV A;  1LAG E;  3HPI A;  3O9P A;  3RTF B;  4G68 A;  4NF8 B;  2Z8F A;  4EQ9 A;  3RTW B;  1DPP A;  3DEL B;  2Q2A A;  1N76 A;  1QVS A;  5DT6 A;  4YZZ A;  1IUD A;  1LLS A;  1L5T A;  3PMX A;  3PV0 E;  2HZL A;  1LBC A;  1JNF A;  1S9T A;  2O7I A;  4XTC Q;  4MLV A;  3SEY A;  2XXV A;  5ITO A;  4DIG A;  5ICQ A;  3RN8 A;  2FNC A;  3TQL A;  1PB7 A;  2NOO A;  3TTL A;  3PPR A;  1MXU A;  1D9V A;  2UYE A;  4ND9 A;  4F3P A;  4IB2 A;  2XD3 A;  3EQ1 A;  3JZJ A;  3K6W A;  1NNK A;  4ZE9 A;  3VLV A;  3O6H A;  2E0S A;  4F2O A;  1QUI A;  1ATG A;  1URD A;  3K2D A;  1HSL A;  3T96 B;  2UVI A;  5AE4 A;  2UVH A;  1H76 A;  3QSL A;  3MQ9 A;  4QHQ A;  1D3K A;  3TPA A;  3MVW A;  1Y4C A;  5I59 B;  3V89 B;  3S9M C;  4YKK A;  5JEI A;  1FTL A;  5HPQ A;  5CMB A;  1UQW A;  2A5T B;  1B05 A;  4R6K A;  5IKB A;  3MWB A;  3I5O A;  3S2V A;  2NWJ A;  1B3H A;  1Y20 A;  1B7U A;  4R2B A;  5AA3 A;  1DMB A;  4Q0C A;  5M2V A;  3IOT A;  4G4P A;  2V3U A;  4GWO A;  3H3G A;  3T66 A;  2I0C A;  2O1M A;  1URG A;  4OMB A;  4F2Q A;  4ZEC A;  4GVO A;  3KOS A;  4THI A;  4OWD A;  1OMP A;  3Q26 A;  5I2K B;  1MY0 A;  3V5A A;  4U4S A;  5F7V A;  2I49 A;  4QRZ A;  4NWC A;  4IGR A;  4OFL A;  4HS7 A;  3E9X A;  1UTH A;  3U8Q A;  2R71 A;  3HST A;  5DVF A;  2ABH A;  2RKM A;  3RT8 A;  1ZJL A;  3M3K A;  3MVZ A;  2DWI A;  3VLW A;  3C31 A;  3KZG A;  4L17 A;  3H6U A;  4KYE A;  1B5I A;  2HEU A;  3MPL A;  2F97 A;  4OYV A;  4GIZ A;  4I1D A;  1US5 A;  4U4X A;  1GGG A;  5FHM A;  1VE4 A;  2VD2 A;  5DYH A;  4EF2 A;  4H65 A;  3MZ9 A;  4R73 A;  1A7L A;  3P7I A;  3JV9 A;  3FAT A;  3G3G A;  4Z0I A;  4PFT A;  3VVD A;  2G29 A;  4JBZ A;  1P99 A;  3U1O A;  4F31 B;  3BKI B;  1BLF A;  3R7X A;  4FJP A;  4DXC A;  4KPT A;  2THI A;  2ANJ A;  5ITP A;  4IO2 A;  2O69 A;  2HFB A;  3TFL A;  3EPE A;  4P0I A;  4X9T A;  5J1D A;  2DXY A;  2XXR A;  4F1U A;  5ELV A;  1IXH A;  4F29 A;  5CI5 A;  4QSC A;  2RCB A;  1IIT A;  4OEN A;  2V93 A;  3T9U A;  1FCK A;  3KN3 A;  3KJT A;  5FHO A;  1FTJ A;  3KJ7 A;  3SDF A;  5H8N B;  4G8H A;  4ZEB A;  1MQI A;  2F78 A;  3TTR A;  2XX8 A;  4OET A;  3S4U A;  1NNT A;  4HW8 A;  3OEM A;  5CRY A;  3TCG A;  1MPB A;  1ANF A;  4IO7 A;  3VV5 A;  1QKB A;  2X7Q A;  3FXQ A;  3K01 A;  1CE2 A;  4BDR A;  2HQ0 A;  2QJE A;  5CMC A;  4HTG A;  1DSN A;  1N7W A;  2B3F A;  3MUQ A;  3K00 A;  1FQB A;  3HN0 A;  3EN3 A;  5JK4 A;  1WDN A;  4FIM A;  4QF9 A;  4G2Z A;  2DQV A;  4KQP A;  3VFJ A;  3OO8 A;  2D5W A;  2PX1 A;  1GVC A;  2PMS A;  1RYO A;  4LON B;  5TP9 A;  2UVJ A;  4BDL A;  2I3W A;  2OJT A;  4R6Y A;  1URS A;  3B7D A;  1SYH A;  5AA1 A;  4WKM A;  1EH3 A;  4GXS B;  4EDP A;  1P1Q A;  3DP4 A;  1YPN A;  4NF4 B;  5IAI A;  3FXU A;  5I84 A;  4PET A;  4YMB A;  3ZKL A;  2VOZ A;  3GBA A;  3VVE A;  3PUV E;  3H06 B;  3FZV A;  3FD3 A;  4F39 A;  4UA8 A;  3LR1 A;  3FV2 A;  3CFX A;  4DZ1 A;  4ECF A;  4NF4 A;  1JW5 A;  4YB5 A;  4OZ9 A;  1B7H A;  4F18 A;  3FJ7 A;  3K6V A;  1RKM A;  3EF7 A;  2H98 A;  1QJM A;  3IO4 A;  1ZLQ A;  4UAC A;  4RY1 A;  3ZS6 A;  4FED A;  1EZP A;  1B3F A;  5JTY B;  1PB9 A;  1XC1 A;  4JSD A;  4N07 A;  4U23 A;  4DCY A;  5B70 A;  5I56 B;  3TTN A;  2YPN A;  4WED A;  3TKD A;  2RCA A;  2XXQ A;  2H4I A;  4EF1 A;  1H43 A;  2QS2 A;  3UIF A;  1MXY A;  2DSF A;  3TYH A;  3RY3 A;  3K1M A;  2E1S A;  3N94 A;  3MVX A;  3DLN A;  1LB8 A;  1TWY A;  3ODB A;  5K2Y A;  3UOR A;  3FXR A;  1B3G A;  1JET A;  1LAF E;  2HXW A;  4FEC A;  3D4G A;  3RQT A;  1BIY A;  3HV1 A;  3OO7 A;  4EXL A;  2O7U A;  1JQF A;  3QUJ A;  1NKX A;  4OEU A;  3RNN A;  2V3T A;  2Z22 A;  3KSX A;  3QIM A;  2F7B A;  3B6W A;  3Q25 A;  1EU8 A;  2QMW A;  3DP8 A;  2XXX A;  4I62 A;  1A99 A;  1B58 A;  3H4Z A;  2IEE A;  3KOT A;  1UTB B;  3O28 A;  4IGT A;  3V83 A;  1SD3 A;  4KYS A;  3VE1 B;  2UVG A;  2XXH A;  1N0T A;  3N5L A;  2DOJ A;  5DVJ A;  3OEK A;  1MG1 A;  1SVX B;  2O68 A;  4E0W A;  2XXP A;  4NF5 B;  4MH5 A;  4RPO A;  4IO4 A;  3E4R A;  4ELQ A;  4IO5 A;  3PMW A;  2GRV A;  3CRB A;  2Y7K A;  1N84 A;  3OO6 A;  3SEU A;  2V84 A;  5I2N B;  1QUL A;  2VHA A;  5DTB A;  1JVX A;  3RGY A;  4IY6 A;  3R26 A;  4F3S A;  1ZIU A;  5CC2 A;  3U72 A;  1IXG A;  4NF5 A;  3G3I A;  3FVG A;  1MM6 A;  3C35 A;  4X48 A;  4F1V A;  2REG A;  1MPD A;  2I6E A;  1O64 A;  5TPA A;  2ZYN A;  3MP8 A;  1TFA A;  1IQ7 A;  3U94 A;  4FEB A;  2QL3 A;  4H0W A;  4QSE A;  3M3L A;  1MY3 A;  4ZZA A;  4NF8 A;  5FHN A;  4OQO A;  3FJM A;  1I6A A;  4FOR A;  4C1T A;  3M8U A;  3V8X B;  2QS1 A;  4GFR A;  2F7A A;  1QUK A;  5L9M A;  1FQF A;  3C33 A;  2FA7 A;  3HCQ A;  4ZE8 A;  2BJJ X;  4EUO A;  3FIR A;  2HZK A;  1LBB A;  2VP1 A;  3FJG A;  1LB9 A;  4FAT A;  3DM0 A;  3SKP A;  3TCF A;  1DTZ A;  3MVY A;  1MQH A;  1VFD A;  1FTK A;  3MAM A;  3N26 A;  3GZG A;  3VXB A;  4NTL A;  1LGB C;  5H8Q B;  1B3E A;  3H7M A;  1B7Z A;  1UIV A;  1H3D A;  1AIV A;  4OFJ A;  1MQD A;  1NMU A;  1MM7 A;  1QUJ A;  2WKY A;  4ELP A;  2YLN A;  3IB0 A;  3KGC A;  1NL5 A;  2QRY A;  3ONM A;  3OXN A;  4KCD A;  3W9W A;  5DVI A;  3IJX B;  5I59 A;  2OCU A;  2ZMB A;  3QYT A;  2IA4 A;  3FVO A;  4N13 A;  1OVB A;  1MXZ A;  2ZYM A;  4IY5 A;  2A5T A;  3KG2 A;  3PPN A;  1SW5 A;  3WAF A;  1AH5 A;  4LQ2 A;  2ZYK A;  3TQW A;  4OXV A;  1VSO A;  5I58 B;  4OTE A;  4DXB A;  1MDP 1;  1OVT A;  1TFD A;  2D3I A;  1B3L A;  1XVY A;  1I6B A;  3TAJ A;  1B32 A;  1B2H A;  3U92 A;  1QKA A;  1LST A;  4R72 A;  1MDQ A;  2QS3 A;  3ECR A;  5I2K A;  2B3B A;  1Y1M A;  2XHD A;  3AXF A;  5AA4 B;  3L6H A;  3O6I A;  4BDO A;  1Y3Q A;  2Q8J A;  3MP6 A;  5I58 A;  1LAX A;  2UXA A;  4JB7 A;  1AOV A;  4XIG Q;  3M3F A;  3TTM A;  4BDM A;  1Y9U A;  3G3J A;  1AL3 A;  5HBC A;  2XX9 A;  2P0S A;  1POY 1;  2Z23 A;  1XHY A;  3KBR A;  3T9H B;  1MQG A;  4ELO A;  1SDX A;  4HCW A;  4F22 A;  3IOW A;  5AA4 A;  2I48 A;  1SI1 A;  2X7P A;  4KI0 E;  5B7D A;  3USD A;  4EXK A;  1WVJ A;  1B5H A;  1P1W A;  1P1N A;  3JYR A;  4TLL B;  1NNP A;  3G3F A;  3LBS A;  2A5S A;  3ZKK A;  3IAZ A;  1NH7 A;  1B1X A;  1MQJ A;  2P2A A;  2PT1 A;  1FQC A;  4N6P A;  3C34 A;  4EQ7 A;  4G8N A;  1I6Q A;  1TXF A;  3LUY A;  3KFM A;  5I57 B;  4R2F A;  1JEU A;  4GL0 A;  3OSR A;  4C1U A;  5BUU A;  5CMM A;  4ISU A;  3TDJ A;  4H8I A;  4NMY A;  3UP9 A;  4Q5T A;  3K4U A;  2XXY A;  4LQ5 A;  3O2A A;  1YTV A;  1DTG A;  4RK9 A;  3F11 A;  4QFO A;  4OER A;  3BFT A;  3HHG A;  4E0X A;  2M8C A;  3Q27 A;  1Y3P A;  4GL8 A;  5H8N A;  2DS9 A;  4NF6 B;  2F5X A;  3IB1 A;  5AA2 D;  1SBP A;  3IB2 A;  4NWD A;  1O63 A;  4KHZ E;  2OWS A;  3PUX E;  2H9B A;  3MW0 A;  1VFE A;  1XS5 A;  1LFI A;  5AA2 B;  2Q88 A;  4MF3 A;  4RA1 A;  4YIC A;  2F36 A;  4R9G A;  5CMK A;  1B46 A;  3N6T A;  1M5F A;  4RJZ A;  3FV1 A;  3UN6 A;  3VXC A;  2ZYO A;  3IOR A;  4ZDM A;  4F3B A;  1YAE A;  3G3K A;  3SET A;  1R6Z A;  2H25 A;  3MPK A;  5K2X A;  1A54 A;  5CBR A;  5EHM A;  1MPC A;  4OEV A;  4PFY A;  1MH3 A;  4YB7 A;  1Y1Z A;  2DWH A;  1BKA A;  2NXO A;  1B40 A;  2ZNU A;  2F6G A;  4G8M A;  5L9S A;  4LP2 B;  3PU5 A;  1IEJ A;  1MS7 A;  1B1H A;  4GQO A;  1S7Y A;  2DVZ A;  3T93 B;  4U1Z A;  5BWJ A;  1XOC A;  1S50 A;  3LSW A;  3CVG A;  2NVU B;  4I9D A;  2AL5 A;  2W7Y A;  1B0L A;  2HCA A;  1XT8 A;  5TU0 A;  4XKQ A;  1H45 A;  1SI0 A;  4ZZE A;  4ESW A;  3QK6 A;  4LZ5 A;  1F9B A;  4NED A;  1EZ9 A;  2VGQ A;  4JDF A;  4RNS A;  2XD2 A;  3BFU A;  4F19 A;  2DE4 A;  4POW A;  4FAJ A;  3PPO A;  5CM6 A;  2ZNS A;  3MZ1 A;  5JTY A;  1UIU A;  4JWX A;  1SYI A;  2DWA A;  4GXA A;  3PPP A;  3CFZ A;  3T9V A;  3S9L C;  1Z7M E;  5I56 A;  1ELJ A;  1OLC A;  4AB5 A;  3DP6 A;  1Q1K A;  2RIN A;  4R6H A;  4JSO A;  1A8E A;  3OSQ A;  3O97 A;  1HSJ A;  2UYF A;  2Y7I A;  4NE4 A;  1FQD A;  3B6Q A;  2G93 A;  1USY E;  1B4H A;  2P1S A;  2Z8D A;  3K1N A;  4PP0 A;  1Q35 A;  3EHT A;  2F8D A;  4X1B A;  4OVJ A;  2NUV A;  2AIX A;  3SEX A;  1VR5 A;  3R6U A;  2F35 A;  3O6G A;  5L9O A;  1SW1 A;  3C4M A;  2ALU A;  3CSB A;  3UK4 A;  3IJO B;  3KN8 A;  5A5X B;  3PD8 A;  4X1D A;  2CMO A;  3CG1 A;  4YU0 A;  4R9F A;  4H1X A;  2Y7W A;  3KN7 A;  3OMB A;  4QFN A;  4H5F A;  1LCF A;  4MBP A;  3TOD A;  3OO9 A;  4Z7E A;  3FVK A;  2GHB A;  1ZBM A;  1LAH E;  3CG3 A;  5KCJ B;  1UTB A;  3IK6 B;  3EHS A;  3FUZ A;  2OWT A;  1JEV A;  3IX1 A;  3HHF A;  2Y84 A;  2I58 A;  3RT6 B;  1JW4 A;  4RYA A;  1DOT A;  1OLA A;  5FTI A;  3ZSF A;  5KCJ A;  4H67 A;  4K3F A;  4H5G A;  2DXR A;  1M5D A;  3IR1 A;  3TMG A;  5I2N A;  1MH4 A;  1JVY A;  4YAH X;  4Q8R A;  1OIB A;  2I4C A;  3H03 A;  2O6A A;  2DE2 A;  3IOU A;  1D9Y A;  1PBP A;  3RPW A;  1N3X A;  4P11 A;  4O3B A;  5H8H B;  4ZED A;  1FQA A;  5EYF A;  4MFI A;  1KWH A;  1PEB A;  1LCT A;  5HM4 B;  3SEW A;  4PQJ A;  5H8F B;  4C0R A;  3IO6 A;  4TQU Q;  1WOD A;  2F6P A;  3GXA A;  2QSX A;  2HAU A;  4KR5 A;  2YJP A;  3S9E A;  1N7X A;  5H8H A;  1AMF A;  1IXI A;  4DDD A;  3PUY E;  2OZZ A;  2FYI A;  2AL4 A;  4BDQ A;  1IZ1 A;  4EQB A;  4QFL A;  5H8F A;  3N6U A;  4ZS9 A;  2F34 A;  4PFW A;  5ISU A;  1R1N A;  3OOA A;  4ZEK A;  2OBG A;  4DE8 A;  1USY H;  5H8Q A;  1H44 A;  1N04 A;  2REJ A;  1PC3 A;  1T0K A;  3I6V A;  2DYX A;  1NFT A;  2DWJ A;  2XXT A;  1UTH B;  2LAO A;  4G68 C;  4LZ8 A;  2O84 X;  1B5J A;  4DXU A;  3PMV A;  4KD5 A;  4M4G A;  4GD5 A;  4LAT A;  1R9L A;  4OFO A;  2Y7R A;  3H6T A;  1QW0 A;  5KDT B;  1HSE A;  3K6X A;  1I69 A;  4QFP A;  1B52 A;  4KYD A;  3RUM A;  1B4Z A;  1P1O A;  3K0V A;  1A40 A;  3FVN A;  4ZEI A;  4H8J A;  4POX A;  3BBR A;  1A8F A;  3IOV A;  1PB8 A;  3S9N C;  3ILT B;  3C9H A;  2I4B A;  3GLB A;  1US4 A;  5DEX B;  3K02 A;  3PPQ A;  1N3W A;  5KDT A;  3ILU B;  2H5Y A;  3QXM A;  4Q30 B;  3TCH A;  3SER A;  4YB6 A;  3VLU A;  2V3Q A;  3HO7 A;  4O3C A;  1M5C A;  4XKN A;  4XKP A;  4YKI A;  3WAE A;  2AYS A;  4RXL A;  1JW1 A;  5DEX A;  3QAX A;  1ZKB A;  1OQH A;  1A55 A;  1B0H A;  4IO6 A;  1MXW A; 
#chains in the Genus database with same CATH topology
 2ONS A;  1IIW A;  1PDA A;  4BDN A;  2RC9 A;  1ZMG A;  2Z8E A;  2VD3 A;  3G3H A;  2R6G E;  5IZZ A;  4R75 A;  2XXU A;  2HPG A;  3E3K A;  1GR2 A;  2V25 A;  3CR9 A;  4GOT A;  4RPN A;  5ET7 A;  3UA8 A;  2QVU A;  4GRK A;  3FGS A;  4XKR A;  2DP8 A;  2KLF A;  3A3C A;  4ZEF A;  1NUZ A;  2ESN A;  3T9X B;  3KSJ A;  1SW4 A;  3LSL A;  2ONK E;  3C36 A;  4IO3 A;  5LOM A;  4FE8 A;  4HCY A;  1Z7N E;  3W9V A;  1RDY A;  3K1P A;  2QS4 A;  1YCJ A;  3H6W A;  4QSD A;  4ELR A;  5TP9 B;  4TLM B;  1ZU0 A;  1MXV A;  5I57 A;  4U22 A;  1BTJ A;  4M1V A;  2OLB A;  1NNF A;  3G7W A;  3VVF A;  4OHN A;  2Q89 A;  1FBC A;  4AQ4 A;  4ESX A;  2XXW A;  5FTH A;  1B6H A;  1NH8 A;  1J1N A;  4P0G A;  1MY2 A;  2GHA A;  4HE0 A;  4LA9 A;  3PGF A;  2DE3 A;  1NV3 A;  2QMX A;  4GBV A;  3GBB A;  3VDF A;  2Y7P A;  4QFK A;  4NF6 A;  3TZA A;  3CIJ A;  2ONR A;  3A09 A;  5A5L A;  4O3A A;  1FQE A;  4MLQ A;  1GTK A;  3SES A;  4PE5 B;  2GH9 A;  4NG7 A;  3IFC A;  1MXX A;  3CI8 A;  4MIJ A;  2RC7 A;  2QPQ A;  3T22 A;  3TUS A;  3MP1 A;  3PUZ E;  4I40 A;  1SW2 A;  4GBW A;  2DVC A;  5AA2 A;  3LSX A;  2RF1 A;  1GV8 A;  4WEP A;  3IL1 B;  4U21 A;  1POT A;  5EHS A;  2ZNT A;  3UGW A;  4MNP A;  1LFG A;  4KCC A;  3CFL A;  4F1Y A;  4JWO A;  3MC2 A;  3C32 A;  3OEN A;  4NGU A;  3PUW E;  3PD9 A;  3Q28 A;  1DPE A;  3U93 A;  5L8D A;  1P1U A;  3KEI A;  1CB6 A;  5CBS A;  1Y3N A;  3THI A;  2PVU A;  2Q9T A;  3TTK A;  3SEV A;  1EZO A;  1PBQ A;  2O51 A;  4PGN A;  4N8G A;  2H99 A;  2B65 A;  1LFH A;  2XX7 A;  3EKI A;  1RYX A;  4U1O A;  2HXR A;  3W15 C;  3EHU A;  1FW0 A;  2X26 A;  2Q2C A;  4R74 A;  4GLI A;  3TEP A;  4N81 A;  3E13 X;  3D4C A;  5ICT A;  3LSF B;  3OD7 A;  3FAS A;  3H6V A;  4YKJ A;  2I3V A;  4WXJ A;  1FTM A;  2HHM A;  3MZB A;  2D21 A;  4OVQ A;  2ZXT A;  1Y4T A;  3QUF A;  4MNC A;  3CSG A;  1BP5 A;  4DLD A;  4BLA A;  2PBW A;  3O29 A;  1B9J A;  4LVQ A;  3MBP A;  3I3V A;  1TT1 A;  1ZTY A;  2XXI A;  4RK2 A;  4JXI A;  2PT2 A;  4U2R A;  4H46 A;  4PFU A;  3OEL A;  4G77 A;  1O7T A;  4ONY A;  5F1Q A;  4YKP A;  3E79 A;  1M5B A;  3RLF E;  2O1L A;  4KFQ A;  3BIH A;  2F7C A;  4LUB A;  3A3U A;  3MJN A;  5H8S A;  1B51 A;  1MY4 A;  4OES A;  2OK2 A;  1FTO A;  1D4N A;  4LZ7 A;  2I0B A;  1OQG A;  1R9Q A;  4QXD A;  3K6U A;  4F3G A;  1XVX A;  1II5 A;  3O66 A;  1MY1 A;  4AB6 A;  4I8C A;  3Q29 A;  1IXC A;  3ISP A;  5KZT A;  5A5X A;  4G68 B;  5DW8 A;  4HE1 A;  2PYY A;  4H6D A;  3TEL A;  4YMA A;  3B6T A;  2R9J A;  1MRP A;  4TOZ A;  3LC8 A;  4JWY A;  2GFE A;  1M5E A;  4DCX A;  4GF8 A;  2JJK A;  2P3N A;  5TPA B;  1FBG A;  2RC8 A;  3L6G A;  2CZL A;  4XXU A;  2XWK A;  1SQY A;  2HAV A;  1LAG E;  3HPI A;  3O9P A;  3RTF B;  4G68 A;  4NAP A;  4NF8 B;  2Z8F A;  4EQ9 A;  3RTW B;  1DPP A;  3DEL B;  2Q2A A;  1N76 A;  1QVS A;  5DT6 A;  4YZZ A;  1IUD A;  1LLS A;  1L5T A;  1EYK A;  3PMX A;  3PV0 E;  2HZL A;  1LBC A;  1JNF A;  1S9T A;  2O7I A;  4XTC Q;  4MLV A;  3SEY A;  2XXV A;  5ITO A;  4DIG A;  5ICQ A;  3RN8 A;  2FNC A;  3TQL A;  1PB7 A;  3HFU A;  2NOO A;  3TTL A;  3PPR A;  1MXU A;  1D9V A;  2FIX A;  2UYE A;  4ND9 A;  1FPL A;  4F3P A;  1FBF A;  4IB2 A;  3CHG A;  2XD3 A;  3EQ1 A;  3JZJ A;  3K6W A;  1NNK A;  4ZE9 A;  3VLV A;  3O6H A;  2E0S A;  4JVD A;  4F2O A;  1QUI A;  1ATG A;  1URD A;  5FBP A;  3K2D A;  1HSL A;  3T96 B;  2UVI A;  5AE4 A;  2UVH A;  1H76 A;  3QSL A;  3MQ9 A;  4QHQ A;  1D3K A;  1LBV A;  3TPA A;  3MVW A;  1Y4C A;  5I59 B;  3V89 B;  3S9M C;  4YKK A;  5JEI A;  5ET5 A;  1FTL A;  2GQ1 A;  5CMB A;  5HPQ A;  1UQW A;  2A5T B;  4N4U A;  1B05 A;  4R6K A;  5IKB A;  3MWB A;  1IMB A;  3I5O A;  3S2V A;  2NWJ A;  1B3H A;  1Y20 A;  1B7U A;  4R2B A;  5AA3 A;  1DMB A;  4Q0C A;  1G0I A;  5M2V A;  3IOT A;  4G4P A;  2V3U A;  4GWO A;  3H3G A;  3T66 A;  2I0C A;  2O1M A;  1JP4 A;  1URG A;  4OMB A;  4F2Q A;  4ZEC A;  4GVO A;  3KOS A;  4PDD A;  4THI A;  4XF5 A;  4OWD A;  2QVV A;  1OMP A;  3Q26 A;  5I2K B;  1MY0 A;  3V5A A;  4U4S A;  5F7V A;  2I49 A;  4QRZ A;  4GWZ A;  4NWC A;  4IGR A;  4OFL A;  4HS7 A;  3E9X A;  1UTH A;  3U8Q A;  2R71 A;  3HST A;  5DVF A;  2ABH A;  2RKM A;  4NQ8 A;  3RT8 A;  4PDH A;  1ZJL A;  1D9Q A;  3M3K A;  3MVZ A;  2DWI A;  3VLW A;  3C31 A;  1FPB A;  3KZG A;  4L17 A;  3H6U A;  4KYE A;  1B5I A;  2HEU A;  1XI6 A;  3MPL A;  2OWZ A;  2F97 A;  4OYV A;  5IZ3 B;  4GIZ A;  4I1D A;  1US5 A;  4U4X A;  1GGG A;  5EQ8 A;  5FHM A;  1VE4 A;  2VD2 A;  5DYH A;  4EF2 A;  4H65 A;  3MZ9 A;  4R73 A;  1NV1 A;  1KA1 A;  1A7L A;  3P7I A;  3JV9 A;  3FAT A;  3G3G A;  4Z0I A;  4PFT A;  3VVD A;  1NI9 A;  2G29 A;  4JBZ A;  1P99 A;  3U1O A;  4F31 B;  3BKI B;  1BLF A;  3R7X A;  4FJP A;  1NUY A;  4DXC A;  4KPT A;  2THI A;  2ANJ A;  3PTY A;  5ITP A;  4IO2 A;  2O69 A;  5LDZ A;  1K9Z A;  2HFB A;  3TFL A;  3EPE A;  4P0I A;  4X9T A;  5J1D A;  2DXY A;  2XXR A;  4OA4 A;  4F1U A;  5ELV A;  1IXH A;  4F29 A;  5CI5 A;  4QSC A;  4HXV A;  2RCB A;  4GWS A;  2QVR A;  1IMA A;  1IIT A;  2CZI A;  4OEN A;  2V93 A;  3T9U A;  1FCK A;  3KN3 A;  3KJT A;  4MNI A;  5FHO A;  1FTJ A;  3KJ7 A;  1IMD A;  3SDF A;  5H8N B;  1SPI A;  4G8H A;  2WBD A;  4ZEB A;  1MQI A;  4GWU A;  2F78 A;  3TTR A;  2XX8 A;  4OET A;  3S4U A;  1EYJ A;  3T0J A;  1NNT A;  2VT5 A;  4HW8 A;  3OEM A;  2BJI A;  5CRY A;  3TCG A;  1MPB A;  4PBQ A;  1ANF A;  4IO7 A;  3VV5 A;  4QBA A;  1QKB A;  2X7Q A;  3FXQ A;  3K01 A;  1CE2 A;  4BDR A;  2HQ0 A;  2QJE A;  5CMC A;  4HTG A;  1DSN A;  1N7W A;  2B3F A;  3MUQ A;  3K00 A;  5EQ9 A;  1FQB A;  3HN0 A;  3EN3 A;  5JK4 A;  1WDN A;  4FIM A;  4QF9 A;  4G2Z A;  1IMF A;  2DQV A;  4KQP A;  4I3Y A;  3VFJ A;  5EQA A;  1FSA A;  3OO8 A;  2D5W A;  2PX1 A;  1GVC A;  2PMS A;  4I3E A;  1RYO A;  4LON B;  5TP9 A;  5I7I A;  2UVJ A;  5ET8 A;  4BDL A;  2I3W A;  2OJT A;  4R6Y A;  1URS A;  2PCR A;  3B7D A;  1SYH A;  5AA1 A;  4WKM A;  4GWY A;  1EH3 A;  4GXS B;  1AWB A;  1P1Q A;  4EDP A;  3DP4 A;  4GX6 A;  1YPN A;  4NF4 B;  5IAI A;  3FXU A;  5I84 A;  4PET A;  4YMB A;  3ZKL A;  2VOZ A;  3GBA A;  2Q8M A;  4UAB A;  3VVE A;  3PUV E;  2CEX A;  3H06 B;  2OX3 A;  3FZV A;  3FD3 A;  4F39 A;  4UA8 A;  3LR1 A;  3FV2 A;  3CFX A;  4PE3 A;  4P3L A;  4GX3 A;  4DZ1 A;  2F3D A;  4ECF A;  4NF4 A;  1JW5 A;  4YB5 A;  2P3V A;  2VPO A;  4OZ9 A;  1NV2 A;  1B7H A;  2CZK A;  4F18 A;  3FJ7 A;  3K6V A;  1RKM A;  3EF7 A;  2H98 A;  3B50 A;  1QJM A;  3IO4 A;  2PFZ A;  1ZLQ A;  4UAC A;  4RY1 A;  3ZS6 A;  1YXI A;  4FED A;  4P9K A;  1EZP A;  2ZZW A;  1B3F A;  5JTY B;  1RDZ A;  1PB9 A;  1XC1 A;  4DI3 D;  4JSD A;  4MCO A;  4N07 A;  4U23 A;  4DCY A;  5B70 A;  5I56 B;  3TTN A;  2YPN A;  4WED A;  3TKD A;  2RCA A;  2XXQ A;  2H4I A;  5F24 A;  4EF1 A;  1H43 A;  2QS2 A;  3UIF A;  1MXY A;  2DSF A;  3TYH A;  3K1M A;  3RY3 A;  2E1S A;  3N94 A;  4PBH A;  3MVX A;  3DLN A;  1LB8 A;  1TWY A;  1CNQ A;  3ODB A;  1RDX A;  1KZ8 A;  5K2Y A;  3UOR A;  3FXR A;  4P56 A;  4X8R A;  1B3G A;  1JET A;  1LAF E;  2HXW A;  4FEC A;  4P1E A;  3D4G A;  3RQT A;  1BIY A;  3HV1 A;  5LTC A;  3OO7 A;  4EXL A;  4DI4 B;  2O7U A;  1JQF A;  3QUJ A;  1NKX A;  4OEU A;  3RNN A;  2V3T A;  2Z22 A;  2MKZ A;  3KSX A;  1FBE A;  3QIM A;  5I3S A;  2F7B A;  3B6W A;  3Q25 A;  1EU8 A;  2QMW A;  4H45 A;  4NX1 A;  3DP8 A;  2XXX A;  4I62 A;  4N6D A;  1A99 A;  2VPN A;  1B58 A;  3H4Z A;  2IEE A;  1K9Y A;  3KOT A;  1UTB B;  3O28 A;  4IGT A;  3V83 A;  4N8Y A;  4N17 A;  1SD3 A;  4KYS A;  3VE1 B;  2UVG A;  2XXH A;  1N0T A;  3N5L A;  4OVS A;  2DOJ A;  5DVJ A;  1VDW A;  1FPJ A;  3OEK A;  1MG1 A;  1SVX B;  2O68 A;  4G61 A;  4E0W A;  2XXP A;  4NF5 B;  4MH5 A;  4RPO A;  4IO4 A;  3E4R A;  4ELQ A;  4IO5 A;  3PMW A;  2GRV A;  3CRB A;  2Y7K A;  1N84 A;  3GYY A;  1IMC A;  3OO6 A;  3SEU A;  2V84 A;  5I2N B;  3KC1 A;  3SZP A;  1QUL A;  2VHA A;  5DTB A;  1JVX A;  3RGY A;  4IY6 A;  3R26 A;  4F3S A;  4O7I A;  1ZIU A;  5CC2 A;  2B4M A;  3U72 A;  1IXG A;  1FPF A;  4NF5 A;  3G3I A;  3FVG A;  1MM6 A;  3C35 A;  3E78 A;  4PCD A;  4X48 A;  4F1V A;  2REG A;  1MPD A;  2I6E A;  1O64 A;  5TPA A;  2ZYN A;  3MP8 A;  1TFA A;  1IQ7 A;  3U94 A;  4FEB A;  2QL3 A;  4H0W A;  4QSE A;  3M3L A;  1MY3 A;  4ZZA A;  2WYK A;  4MX6 A;  4NF8 A;  5FHN A;  4OQO A;  3FJM A;  1EYI A;  1LEV A;  1I6A A;  4FOR A;  4C1T A;  3M8U A;  4PFI A;  3V8X B;  2QS1 A;  4GFR A;  3KBZ A;  2F7A A;  1QUK A;  5L9M A;  1INP A;  1FQF A;  2B4L A;  3C33 A;  2FA7 A;  3HCQ A;  4ZE8 A;  2BJJ X;  4EUO A;  3FIR A;  2HZK A;  2WBB A;  1LBB A;  2VP1 A;  3FJG A;  1LB9 A;  4FAT A;  3U65 A;  4P8B A;  3DM0 A;  3SKP A;  3TCF A;  1DTZ A;  3MVY A;  5EYG A;  1MQH A;  1VFD A;  4NHB A;  1FPI A;  1FTK A;  3MAM A;  4AS5 A;  3N26 A;  3GZG A;  3VXB A;  4NTL A;  1LGB C;  5H8Q B;  1B3E A;  3H7M A;  1B7Z A;  1UIV A;  1H3D A;  1AIV A;  1NV5 A;  4OFJ A;  1FJ6 A;  1MQD A;  1NMU A;  1MM7 A;  1QUJ A;  2WKY A;  4ELP A;  2YLN A;  3IB0 A;  3KGC A;  1NL5 A;  2QRY A;  3ONM A;  3OXN A;  4PF6 A;  4KCD A;  4PGP A;  3FBP A;  3W9W A;  1KA0 A;  5DVI A;  3IJX B;  1FPE A;  5I59 A;  2OCU A;  4PC9 A;  2ZMB A;  3QYT A;  2IA4 A;  3FVO A;  4N13 A;  1OVB A;  1MXZ A;  2ZYM A;  4IY5 A;  2A5T A;  3KG2 A;  4PTK A;  3PPN A;  3T1B A;  1SW5 A;  3WAF A;  1AH5 A;  4LQ2 A;  2ZYK A;  3TQW A;  4OXV A;  1VSO A;  5I58 B;  2XWI A;  3LV0 A;  4OTE A;  4DXB A;  1MDP 1;  1OVT A;  1TFD A;  4PFB A;  1YZ0 A;  2D3I A;  1B3L A;  1XVY A;  3NOH A;  3A29 A;  1I6B A;  3TAJ A;  4AS4 A;  1B32 A;  1B2H A;  3U92 A;  1QKA A;  1LST A;  4O7M A;  4R72 A;  1MDQ A;  2QS3 A;  4OAN A;  3ECR A;  4PF8 A;  5I2K A;  2B3B A;  1Y1M A;  2XHD A;  3AXF A;  5AA4 B;  3L6H A;  3O6I A;  4BDO A;  1Y3Q A;  2Q8J A;  3MP6 A;  5I58 A;  1LAX A;  2UXA A;  4JB7 A;  1AOV A;  4XIG Q;  1FPK A;  1DK4 A;  3M3F A;  3TTM A;  4BDM A;  4N6K A;  1Y9U A;  3G3J A;  1AL3 A;  5HBC A;  2XX9 A;  3FXB A;  2P0S A;  1POY 1;  2Z23 A;  2Q74 A;  1XHY A;  3KBR A;  3T9H B;  1MQG A;  1QGX A;  4ELO A;  1SDX A;  4HCW A;  2FIE A;  4O94 A;  4F22 A;  3IOW A;  5AA4 A;  2I48 A;  4GX4 A;  1SI1 A;  2X7P A;  4KI0 E;  5IZ3 A;  5B7D A;  2F3B A;  3USD A;  4EXK A;  1WVJ A;  1B5H A;  1P1W A;  1P1N A;  3JYR A;  4TLL B;  1NNP A;  3G3F A;  3LBS A;  2A5S A;  3ZKK A;  3IAZ A;  4GWX A;  1NH7 A;  4N15 A;  1B1X A;  1MQJ A;  2P2A A;  2PT1 A;  4MEV A;  1FQC A;  2ZZX A;  4N6P A;  3C34 A;  4EQ7 A;  4G8N A;  2V4C A;  1I6Q A;  1TXF A;  3LUY A;  3KFM A;  5I57 B;  4R2F A;  1JEU A;  4GL0 A;  3OSR A;  4C1U A;  5BUU A;  5CMM A;  3MST A;  4ISU A;  2ZZV A;  4JVI A;  4H8I A;  3TDJ A;  4NMY A;  3UP9 A;  4Q5T A;  1NV4 A;  3K4U A;  2XXY A;  4LQ5 A;  3O2A A;  1YTV A;  1DTG A;  4RK9 A;  2FHY A;  3F11 A;  4QFO A;  4PAI A;  4OER A;  3BFT A;  3HHG A;  4E0X A;  2M8C A;  3Q27 A;  1Y3P A;  4GL8 A;  5H8N A;  1NV6 A;  2DS9 A;  4NF6 B;  2F5X A;  3B8B A;  3IB1 A;  5AA2 D;  1SBP A;  3IB2 A;  4NWD A;  1O63 A;  4KHZ E;  1DCU A;  2KR0 A;  2OWS A;  3PUX E;  2H9B A;  3MW0 A;  1FPG A;  1VFE A;  1XS5 A;  1LFI A;  2CEY A;  4NF0 A;  5AA2 B;  2Q88 A;  3D1R A;  4MF3 A;  4RA1 A;  4YIC A;  2F36 A;  4R9G A;  5CMK A;  1B46 A;  3N6T A;  1M5F A;  4RJZ A;  3FV1 A;  3UN6 A;  3VXC A;  5I5P A;  2ZYO A;  3IOR A;  4ZDM A;  4F3B A;  1G0H A;  4GWW A;  1YAE A;  3G3K A;  2XWV A;  3SET A;  1R6Z A;  2H25 A;  2WX9 A;  3MPK A;  5K2X A;  1A54 A;  5CBR A;  5EHM A;  1MPC A;  4OEV A;  4PFY A;  1MH3 A;  4YB7 A;  1Y1Z A;  1Q9D A;  2DWH A;  1FBD A;  1BKA A;  2NXO A;  1B40 A;  2L5V A;  2ZNU A;  2F6G A;  1FPD A;  4G8M A;  5L9S A;  3KC0 A;  4LP2 B;  3PU5 A;  2WYP A;  1IEJ A;  5J16 A;  1MS7 A;  1B1H A;  1YYZ A;  4GQO A;  4FBP A;  1S7Y A;  2DVZ A;  3T93 B;  4U1Z A;  2XXK A;  5BWJ A;  1XOC A;  1S50 A;  3LSW A;  3CVG A;  2NVU B;  4I9D A;  2AL5 A;  2W7Y A;  2XWO A;  1B0L A;  2HCA A;  1XT8 A;  4P1L A;  5TU0 A;  4XKQ A;  1H45 A;  1SI0 A;  2XA5 A;  4ZZE A;  4ESW A;  5EYH A;  3QK6 A;  4LZ5 A;  1F9B A;  4NED A;  1EZ9 A;  2VGQ A;  4JDF A;  4RNS A;  2XD2 A;  2KQZ A;  3BFU A;  4F19 A;  2DE4 A;  1FBP A;  4POW A;  4FAJ A;  3PPO A;  5IM2 A;  5CM6 A;  2ZNS A;  3MZ1 A;  5JTY A;  1UIU A;  4JWX A;  1SYI A;  4KXP A;  2DWA A;  4XEQ A;  4PFR A;  4GXA A;  3PPP A;  3CFZ A;  3T9V A;  3S9L C;  1Z7M E;  5I56 A;  1ELJ A;  1OLC A;  4AB5 A;  3DP6 A;  1Q1K A;  2RIN A;  4R6H A;  4IR8 A;  3ROJ A;  4JSO A;  1A8E A;  3OSQ A;  3O97 A;  1HSJ A;  2UYF A;  2FBP A;  2Y7I A;  4NE4 A;  1FQD A;  3B6Q A;  2G93 A;  1USY E;  1B4H A;  2P1S A;  2Z8D A;  1IME A;  3K1N A;  4PP0 A;  1Q35 A;  3EHT A;  2F8D A;  4X1B A;  4OVJ A;  2NUV A;  2AIX A;  3SEX A;  1VR5 A;  1LBW A;  3R6U A;  2F35 A;  3O6G A;  5L9O A;  1SW1 A;  2CZH A;  2QFL A;  3C4M A;  2ALU A;  3CSB A;  4HE2 A;  3UK4 A;  3IJO B;  3BIG A;  3KN8 A;  5A5X B;  3PD8 A;  4X1D A;  2CMO A;  3CG1 A;  4YU0 A;  4R9F A;  4H1X A;  2Y7W A;  3KN7 A;  4P47 A;  3OMB A;  2PFY A;  4QFN A;  4PAF A;  4H5F A;  1LCF A;  4MBP A;  3TOD A;  1NUX A;  3OO9 A;  3LUZ A;  4Z7E A;  3FVK A;  2GHB A;  1ZBM A;  1LAH E;  1FBH A;  4MMP A;  3CG3 A;  5KCJ B;  1UTB A;  4X04 A;  3IK6 B;  4MJO A;  5ET6 A;  3EHS A;  3FUZ A;  2OWT A;  1JEV A;  3IX1 A;  3HHF A;  3RYD A;  2Y84 A;  2I58 A;  3RT6 B;  1JW4 A;  4RYA A;  1DOT A;  1OLA A;  4XFE A;  1NV0 A;  5IZ1 A;  5ESY A;  5FTI A;  3ZSF A;  5KCJ A;  1NUW A;  4H67 A;  4K3F A;  4H5G A;  1FJ9 A;  2DXR A;  1M5D A;  3QMF A;  3IR1 A;  3TMG A;  5I2N A;  1MH4 A;  1JVY A;  3IFA A;  4YAH X;  4Q8R A;  1OIB A;  2I4C A;  3H03 A;  2O6A A;  2DE2 A;  3IOU A;  4LN5 A;  1D9Y A;  1PBP A;  5T3J A;  3RPW A;  1N3X A;  4P11 A;  4O3B A;  5IGA A;  5H8H B;  4ZED A;  1FQA A;  5EYF A;  3RPL B;  4MFI A;  1FRP A;  1KWH A;  1PEB A;  1LCT A;  5HM4 B;  3SEW A;  4PQJ A;  4OVT A;  5H8F B;  4C0R A;  3IO6 A;  4TQU Q;  1BK4 A;  1WOD A;  2F6P A;  3GXA A;  2QSX A;  2HAU A;  4KR5 A;  2YJP A;  1LBZ A;  3S9E A;  1N7X A;  2DDK A;  5H8H A;  4MAG A;  1AMF A;  1IXI A;  5EQ7 A;  4DDD A;  3RPL A;  3PUY E;  2OZZ A;  2FYI A;  2AL4 A;  4BDQ A;  1IZ1 A;  4EQB A;  4QFL A;  4O8M A;  2WEF A;  1LBX A;  5H8F A;  3MYU A;  3N6U A;  2Y5L A;  4OVR A;  4ZS9 A;  2F34 A;  4PFW A;  5ISU A;  1R1N A;  3OOA A;  4ZEK A;  2OBG A;  4DE8 A;  1USY H;  5H8Q A;  4JVC A;  1H44 A;  1N04 A;  2REJ A;  1PC3 A;  1T0K A;  3I6V A;  2DYX A;  1NFT A;  2DWJ A;  2XXT A;  1UTH B;  2LAO A;  4G68 C;  4LZ8 A;  2R8T A;  2O84 X;  1DBZ A;  1NV7 A;  1B5J A;  4DXU A;  3PMV A;  4KD5 A;  4M4G A;  4GD5 A;  4LAT A;  4PAK A;  1R9L A;  4OFO A;  2Y7R A;  3H6T A;  1QW0 A;  5KDT B;  4MHF A;  1HSE A;  3K6X A;  1I69 A;  4N91 A;  2FVZ A;  4QFP A;  1B52 A;  4KYD A;  3RUM A;  1B4Z A;  1P1O A;  3K0V A;  1A40 A;  3FVN A;  4ZEI A;  4H8J A;  4POX A;  3BBR A;  4NN3 A;  1A8F A;  3IOV A;  1PB8 A;  3S9N C;  3ILT B;  3C9H A;  2I4B A;  3GLB A;  1LBY A;  1US4 A;  5DEX B;  3K02 A;  3PPQ A;  1N3W A;  5KDT A;  3ILU B;  2H5Y A;  3QXM A;  4OVP A;  4Q30 B;  3TCH A;  3SER A;  4YB6 A;  3VLU A;  2V3Q A;  3HO7 A;  4O3C A;  1FTA A;  1M5C A;  4XKN A;  4XKP A;  4YKI A;  3WAE A;  2Y5K A;  2AYS A;  4RXL A;  1JW1 A;  5DEX A;  3QAX A;  1ZKB A;  1OQH A;  1A55 A;  1B0H A;  4IO6 A;  1MXW A; 
#chains in the Genus database with same CATH homology
 2ONS A;  1IIW A;  1PDA A;  4BDN A;  2RC9 A;  1ZMG A;  2Z8E A;  2VD3 A;  3G3H A;  2R6G E;  4R75 A;  2XXU A;  3E3K A;  1GR2 A;  2V25 A;  3CR9 A;  4GOT A;  4RPN A;  3UA8 A;  4GRK A;  3FGS A;  4XKR A;  2DP8 A;  2KLF A;  3A3C A;  4ZEF A;  2ESN A;  3T9X B;  3KSJ A;  1SW4 A;  3LSL A;  2ONK E;  3C36 A;  4IO3 A;  5LOM A;  4FE8 A;  4HCY A;  1Z7N E;  3W9V A;  3K1P A;  2QS4 A;  1YCJ A;  3H6W A;  4QSD A;  4ELR A;  5TP9 B;  4TLM B;  1ZU0 A;  1MXV A;  5I57 A;  4U22 A;  1BTJ A;  4M1V A;  2OLB A;  1NNF A;  3G7W A;  3VVF A;  4OHN A;  2Q89 A;  4AQ4 A;  4ESX A;  2XXW A;  5FTH A;  1B6H A;  1NH8 A;  1J1N A;  4P0G A;  1MY2 A;  2GHA A;  4LA9 A;  3PGF A;  2DE3 A;  2QMX A;  3GBB A;  3VDF A;  2Y7P A;  4QFK A;  4NF6 A;  3TZA A;  3CIJ A;  2ONR A;  3A09 A;  4O3A A;  1FQE A;  4MLQ A;  1GTK A;  3SES A;  4PE5 B;  2GH9 A;  1MXX A;  3CI8 A;  2RC7 A;  2QPQ A;  3T22 A;  3TUS A;  3MP1 A;  3PUZ E;  1SW2 A;  2DVC A;  5AA2 A;  3LSX A;  2RF1 A;  1GV8 A;  4WEP A;  3IL1 B;  4U21 A;  1POT A;  5EHS A;  2ZNT A;  3UGW A;  1LFG A;  4KCC A;  3CFL A;  4F1Y A;  4JWO A;  3MC2 A;  3C32 A;  3OEN A;  3PUW E;  3PD9 A;  3Q28 A;  1DPE A;  3U93 A;  5L8D A;  1P1U A;  3KEI A;  1CB6 A;  5CBS A;  1Y3N A;  3THI A;  2PVU A;  2Q9T A;  3TTK A;  3SEV A;  1EZO A;  1PBQ A;  2O51 A;  2H99 A;  2B65 A;  1LFH A;  2XX7 A;  1RYX A;  4U1O A;  3W15 C;  3EHU A;  1FW0 A;  2X26 A;  2Q2C A;  4R74 A;  4GLI A;  3TEP A;  3E13 X;  3D4C A;  5ICT A;  3LSF B;  3OD7 A;  3FAS A;  3H6V A;  4YKJ A;  2I3V A;  4WXJ A;  1FTM A;  3MZB A;  2D21 A;  2ZXT A;  1Y4T A;  3QUF A;  3CSG A;  1BP5 A;  4DLD A;  4BLA A;  2PBW A;  3O29 A;  1B9J A;  4LVQ A;  3MBP A;  3I3V A;  1TT1 A;  1ZTY A;  2XXI A;  4RK2 A;  4JXI A;  2PT2 A;  4U2R A;  4PFU A;  3OEL A;  4G77 A;  1O7T A;  4ONY A;  5F1Q A;  4YKP A;  1M5B A;  3RLF E;  2O1L A;  4KFQ A;  2F7C A;  4LUB A;  3A3U A;  3MJN A;  5H8S A;  1B51 A;  1MY4 A;  4OES A;  2OK2 A;  1FTO A;  1D4N A;  4LZ7 A;  2I0B A;  1OQG A;  1R9Q A;  3K6U A;  4F3G A;  1XVX A;  1II5 A;  3O66 A;  1MY1 A;  4AB6 A;  4I8C A;  3Q29 A;  1IXC A;  5KZT A;  5A5X A;  4G68 B;  2PYY A;  4H6D A;  3TEL A;  4YMA A;  3B6T A;  2R9J A;  1MRP A;  4TOZ A;  3LC8 A;  4JWY A;  2GFE A;  1M5E A;  4DCX A;  4GF8 A;  5TPA B;  2RC8 A;  3L6G A;  2CZL A;  4XXU A;  1SQY A;  2HAV A;  1LAG E;  3HPI A;  3O9P A;  3RTF B;  4G68 A;  4NF8 B;  2Z8F A;  4EQ9 A;  3RTW B;  1DPP A;  3DEL B;  2Q2A A;  1N76 A;  1QVS A;  5DT6 A;  4YZZ A;  1IUD A;  1LLS A;  1L5T A;  3PMX A;  3PV0 E;  2HZL A;  1LBC A;  1JNF A;  1S9T A;  2O7I A;  4XTC Q;  4MLV A;  3SEY A;  2XXV A;  5ITO A;  4DIG A;  5ICQ A;  3RN8 A;  2FNC A;  3TQL A;  1PB7 A;  2NOO A;  3TTL A;  3PPR A;  1MXU A;  1D9V A;  2UYE A;  4ND9 A;  4F3P A;  4IB2 A;  2XD3 A;  3EQ1 A;  3JZJ A;  3K6W A;  1NNK A;  4ZE9 A;  3VLV A;  3O6H A;  2E0S A;  4F2O A;  1QUI A;  1ATG A;  1URD A;  3K2D A;  1HSL A;  3T96 B;  2UVI A;  5AE4 A;  2UVH A;  1H76 A;  3QSL A;  3MQ9 A;  4QHQ A;  1D3K A;  3TPA A;  3MVW A;  1Y4C A;  5I59 B;  3V89 B;  3S9M C;  4YKK A;  5JEI A;  1FTL A;  5HPQ A;  5CMB A;  1UQW A;  2A5T B;  1B05 A;  4R6K A;  5IKB A;  3MWB A;  3I5O A;  3S2V A;  2NWJ A;  1B3H A;  1Y20 A;  1B7U A;  4R2B A;  5AA3 A;  1DMB A;  4Q0C A;  5M2V A;  3IOT A;  4G4P A;  2V3U A;  4GWO A;  3H3G A;  3T66 A;  2I0C A;  2O1M A;  1URG A;  4OMB A;  4F2Q A;  4ZEC A;  4GVO A;  3KOS A;  4THI A;  4OWD A;  1OMP A;  3Q26 A;  5I2K B;  1MY0 A;  3V5A A;  4U4S A;  5F7V A;  2I49 A;  4QRZ A;  4NWC A;  4IGR A;  4OFL A;  4HS7 A;  3E9X A;  1UTH A;  3U8Q A;  2R71 A;  3HST A;  5DVF A;  2ABH A;  2RKM A;  3RT8 A;  1ZJL A;  3M3K A;  3MVZ A;  2DWI A;  3VLW A;  3C31 A;  3KZG A;  4L17 A;  3H6U A;  4KYE A;  1B5I A;  2HEU A;  3MPL A;  2F97 A;  4OYV A;  4GIZ A;  4I1D A;  1US5 A;  4U4X A;  1GGG A;  5FHM A;  1VE4 A;  2VD2 A;  5DYH A;  4EF2 A;  4H65 A;  3MZ9 A;  4R73 A;  1A7L A;  3P7I A;  3JV9 A;  3FAT A;  3G3G A;  4Z0I A;  4PFT A;  3VVD A;  2G29 A;  4JBZ A;  1P99 A;  3U1O A;  4F31 B;  3BKI B;  1BLF A;  3R7X A;  4FJP A;  4DXC A;  4KPT A;  2THI A;  2ANJ A;  5ITP A;  4IO2 A;  2O69 A;  2HFB A;  3TFL A;  3EPE A;  4P0I A;  4X9T A;  5J1D A;  2DXY A;  2XXR A;  4F1U A;  5ELV A;  1IXH A;  4F29 A;  5CI5 A;  4QSC A;  2RCB A;  1IIT A;  4OEN A;  2V93 A;  3T9U A;  1FCK A;  3KN3 A;  3KJT A;  5FHO A;  1FTJ A;  3KJ7 A;  3SDF A;  5H8N B;  4G8H A;  4ZEB A;  1MQI A;  2F78 A;  3TTR A;  2XX8 A;  4OET A;  3S4U A;  1NNT A;  4HW8 A;  3OEM A;  5CRY A;  3TCG A;  1MPB A;  1ANF A;  4IO7 A;  3VV5 A;  1QKB A;  2X7Q A;  3FXQ A;  3K01 A;  1CE2 A;  4BDR A;  2HQ0 A;  2QJE A;  5CMC A;  4HTG A;  1DSN A;  1N7W A;  2B3F A;  3MUQ A;  3K00 A;  1FQB A;  3HN0 A;  3EN3 A;  5JK4 A;  1WDN A;  4FIM A;  4QF9 A;  4G2Z A;  2DQV A;  4KQP A;  3VFJ A;  3OO8 A;  2D5W A;  2PX1 A;  1GVC A;  2PMS A;  1RYO A;  4LON B;  5TP9 A;  2UVJ A;  4BDL A;  2I3W A;  2OJT A;  4R6Y A;  1URS A;  3B7D A;  1SYH A;  5AA1 A;  4WKM A;  1EH3 A;  4GXS B;  4EDP A;  1P1Q A;  3DP4 A;  1YPN A;  4NF4 B;  5IAI A;  3FXU A;  5I84 A;  4PET A;  4YMB A;  3ZKL A;  2VOZ A;  3GBA A;  3VVE A;  3PUV E;  3H06 B;  3FZV A;  3FD3 A;  4F39 A;  4UA8 A;  3LR1 A;  3FV2 A;  3CFX A;  4DZ1 A;  4ECF A;  4NF4 A;  1JW5 A;  4YB5 A;  4OZ9 A;  1B7H A;  4F18 A;  3FJ7 A;  3K6V A;  1RKM A;  3EF7 A;  2H98 A;  1QJM A;  3IO4 A;  1ZLQ A;  4UAC A;  4RY1 A;  3ZS6 A;  4FED A;  1EZP A;  1B3F A;  5JTY B;  1PB9 A;  1XC1 A;  4JSD A;  4N07 A;  4U23 A;  4DCY A;  5B70 A;  5I56 B;  3TTN A;  2YPN A;  4WED A;  3TKD A;  2RCA A;  2XXQ A;  2H4I A;  4EF1 A;  1H43 A;  2QS2 A;  3UIF A;  1MXY A;  2DSF A;  3TYH A;  3RY3 A;  3K1M A;  2E1S A;  3N94 A;  3MVX A;  3DLN A;  1LB8 A;  1TWY A;  3ODB A;  5K2Y A;  3UOR A;  3FXR A;  1B3G A;  1JET A;  1LAF E;  2HXW A;  4FEC A;  3D4G A;  3RQT A;  1BIY A;  3HV1 A;  3OO7 A;  4EXL A;  2O7U A;  1JQF A;  3QUJ A;  1NKX A;  4OEU A;  3RNN A;  2V3T A;  2Z22 A;  3KSX A;  3QIM A;  2F7B A;  3B6W A;  3Q25 A;  1EU8 A;  2QMW A;  3DP8 A;  2XXX A;  4I62 A;  1A99 A;  1B58 A;  3H4Z A;  2IEE A;  3KOT A;  1UTB B;  3O28 A;  4IGT A;  3V83 A;  1SD3 A;  4KYS A;  3VE1 B;  2UVG A;  2XXH A;  1N0T A;  3N5L A;  2DOJ A;  5DVJ A;  3OEK A;  1MG1 A;  1SVX B;  2O68 A;  4E0W A;  2XXP A;  4NF5 B;  4MH5 A;  4RPO A;  4IO4 A;  3E4R A;  4ELQ A;  4IO5 A;  3PMW A;  2GRV A;  3CRB A;  2Y7K A;  1N84 A;  3OO6 A;  3SEU A;  2V84 A;  5I2N B;  1QUL A;  2VHA A;  5DTB A;  1JVX A;  3RGY A;  4IY6 A;  3R26 A;  4F3S A;  1ZIU A;  5CC2 A;  3U72 A;  1IXG A;  4NF5 A;  3G3I A;  3FVG A;  1MM6 A;  3C35 A;  4X48 A;  4F1V A;  2REG A;  1MPD A;  2I6E A;  1O64 A;  5TPA A;  2ZYN A;  3MP8 A;  1TFA A;  1IQ7 A;  3U94 A;  4FEB A;  2QL3 A;  4H0W A;  4QSE A;  3M3L A;  1MY3 A;  4ZZA A;  4NF8 A;  5FHN A;  4OQO A;  3FJM A;  1I6A A;  4FOR A;  4C1T A;  3M8U A;  3V8X B;  2QS1 A;  4GFR A;  2F7A A;  1QUK A;  5L9M A;  1FQF A;  3C33 A;  2FA7 A;  3HCQ A;  4ZE8 A;  2BJJ X;  4EUO A;  3FIR A;  2HZK A;  1LBB A;  2VP1 A;  3FJG A;  1LB9 A;  4FAT A;  3DM0 A;  3SKP A;  3TCF A;  1DTZ A;  3MVY A;  1MQH A;  1VFD A;  1FTK A;  3MAM A;  3N26 A;  3GZG A;  3VXB A;  4NTL A;  1LGB C;  5H8Q B;  1B3E A;  3H7M A;  1B7Z A;  1UIV A;  1H3D A;  1AIV A;  4OFJ A;  1MQD A;  1NMU A;  1MM7 A;  1QUJ A;  2WKY A;  4ELP A;  2YLN A;  3IB0 A;  3KGC A;  1NL5 A;  2QRY A;  3ONM A;  3OXN A;  4KCD A;  3W9W A;  5DVI A;  3IJX B;  5I59 A;  2OCU A;  2ZMB A;  3QYT A;  2IA4 A;  3FVO A;  4N13 A;  1OVB A;  1MXZ A;  2ZYM A;  4IY5 A;  2A5T A;  3KG2 A;  3PPN A;  1SW5 A;  3WAF A;  1AH5 A;  4LQ2 A;  2ZYK A;  3TQW A;  4OXV A;  1VSO A;  5I58 B;  4OTE A;  4DXB A;  1MDP 1;  1OVT A;  1TFD A;  2D3I A;  1B3L A;  1XVY A;  1I6B A;  3TAJ A;  1B32 A;  1B2H A;  3U92 A;  1QKA A;  1LST A;  4R72 A;  1MDQ A;  2QS3 A;  3ECR A;  5I2K A;  2B3B A;  1Y1M A;  2XHD A;  3AXF A;  5AA4 B;  3L6H A;  3O6I A;  4BDO A;  1Y3Q A;  2Q8J A;  3MP6 A;  5I58 A;  1LAX A;  2UXA A;  4JB7 A;  1AOV A;  4XIG Q;  3M3F A;  3TTM A;  4BDM A;  1Y9U A;  3G3J A;  1AL3 A;  5HBC A;  2XX9 A;  2P0S A;  1POY 1;  2Z23 A;  1XHY A;  3KBR A;  3T9H B;  1MQG A;  4ELO A;  1SDX A;  4HCW A;  4F22 A;  3IOW A;  5AA4 A;  2I48 A;  1SI1 A;  2X7P A;  4KI0 E;  5B7D A;  3USD A;  4EXK A;  1WVJ A;  1B5H A;  1P1W A;  1P1N A;  3JYR A;  4TLL B;  1NNP A;  3G3F A;  3LBS A;  2A5S A;  3ZKK A;  3IAZ A;  1NH7 A;  1B1X A;  1MQJ A;  2P2A A;  2PT1 A;  1FQC A;  4N6P A;  3C34 A;  4EQ7 A;  4G8N A;  1I6Q A;  1TXF A;  3LUY A;  3KFM A;  5I57 B;  4R2F A;  1JEU A;  4GL0 A;  3OSR A;  4C1U A;  5BUU A;  5CMM A;  4ISU A;  3TDJ A;  4H8I A;  4NMY A;  3UP9 A;  4Q5T A;  3K4U A;  2XXY A;  4LQ5 A;  3O2A A;  1YTV A;  1DTG A;  4RK9 A;  3F11 A;  4QFO A;  4OER A;  3BFT A;  3HHG A;  4E0X A;  2M8C A;  3Q27 A;  1Y3P A;  4GL8 A;  5H8N A;  2DS9 A;  4NF6 B;  2F5X A;  3IB1 A;  5AA2 D;  1SBP A;  3IB2 A;  4NWD A;  1O63 A;  4KHZ E;  2OWS A;  3PUX E;  2H9B A;  3MW0 A;  1VFE A;  1XS5 A;  1LFI A;  5AA2 B;  2Q88 A;  4MF3 A;  4RA1 A;  4YIC A;  2F36 A;  4R9G A;  5CMK A;  1B46 A;  3N6T A;  1M5F A;  4RJZ A;  3FV1 A;  3UN6 A;  3VXC A;  2ZYO A;  3IOR A;  4ZDM A;  4F3B A;  1YAE A;  3G3K A;  3SET A;  1R6Z A;  2H25 A;  3MPK A;  5K2X A;  1A54 A;  5CBR A;  5EHM A;  1MPC A;  4OEV A;  4PFY A;  1MH3 A;  4YB7 A;  1Y1Z A;  2DWH A;  1BKA A;  2NXO A;  1B40 A;  2ZNU A;  2F6G A;  4G8M A;  5L9S A;  4LP2 B;  3PU5 A;  1IEJ A;  1MS7 A;  1B1H A;  4GQO A;  1S7Y A;  2DVZ A;  3T93 B;  4U1Z A;  5BWJ A;  1XOC A;  1S50 A;  3LSW A;  3CVG A;  2NVU B;  4I9D A;  2AL5 A;  2W7Y A;  1B0L A;  2HCA A;  1XT8 A;  5TU0 A;  4XKQ A;  1H45 A;  1SI0 A;  4ZZE A;  4ESW A;  3QK6 A;  4LZ5 A;  1F9B A;  4NED A;  1EZ9 A;  2VGQ A;  4JDF A;  4RNS A;  2XD2 A;  3BFU A;  4F19 A;  2DE4 A;  4POW A;  4FAJ A;  3PPO A;  5CM6 A;  2ZNS A;  3MZ1 A;  5JTY A;  1UIU A;  4JWX A;  1SYI A;  2DWA A;  4GXA A;  3PPP A;  3CFZ A;  3T9V A;  3S9L C;  1Z7M E;  5I56 A;  1ELJ A;  1OLC A;  4AB5 A;  3DP6 A;  1Q1K A;  2RIN A;  4R6H A;  4JSO A;  1A8E A;  3OSQ A;  3O97 A;  1HSJ A;  2UYF A;  2Y7I A;  4NE4 A;  1FQD A;  3B6Q A;  2G93 A;  1USY E;  1B4H A;  2P1S A;  2Z8D A;  3K1N A;  4PP0 A;  1Q35 A;  3EHT A;  2F8D A;  4X1B A;  4OVJ A;  2NUV A;  2AIX A;  3SEX A;  1VR5 A;  3R6U A;  2F35 A;  3O6G A;  5L9O A;  1SW1 A;  3C4M A;  2ALU A;  3CSB A;  3UK4 A;  3IJO B;  3KN8 A;  5A5X B;  3PD8 A;  4X1D A;  2CMO A;  3CG1 A;  4YU0 A;  4R9F A;  4H1X A;  2Y7W A;  3KN7 A;  3OMB A;  4QFN A;  4H5F A;  1LCF A;  4MBP A;  3TOD A;  3OO9 A;  4Z7E A;  3FVK A;  2GHB A;  1ZBM A;  1LAH E;  3CG3 A;  5KCJ B;  1UTB A;  3IK6 B;  3EHS A;  3FUZ A;  2OWT A;  1JEV A;  3IX1 A;  3HHF A;  2Y84 A;  2I58 A;  3RT6 B;  1JW4 A;  4RYA A;  1DOT A;  1OLA A;  5FTI A;  3ZSF A;  5KCJ A;  4H67 A;  4K3F A;  4H5G A;  2DXR A;  1M5D A;  3IR1 A;  3TMG A;  5I2N A;  1MH4 A;  1JVY A;  4YAH X;  4Q8R A;  1OIB A;  2I4C A;  3H03 A;  2O6A A;  2DE2 A;  3IOU A;  1D9Y A;  1PBP A;  3RPW A;  1N3X A;  4P11 A;  4O3B A;  5H8H B;  4ZED A;  1FQA A;  5EYF A;  4MFI A;  1KWH A;  1PEB A;  1LCT A;  5HM4 B;  3SEW A;  4PQJ A;  5H8F B;  4C0R A;  3IO6 A;  4TQU Q;  1WOD A;  2F6P A;  3GXA A;  2QSX A;  2HAU A;  4KR5 A;  2YJP A;  3S9E A;  1N7X A;  5H8H A;  1AMF A;  1IXI A;  4DDD A;  3PUY E;  2OZZ A;  2FYI A;  2AL4 A;  4BDQ A;  1IZ1 A;  4EQB A;  4QFL A;  5H8F A;  3N6U A;  4ZS9 A;  2F34 A;  4PFW A;  5ISU A;  1R1N A;  3OOA A;  4ZEK A;  2OBG A;  4DE8 A;  1USY H;  5H8Q A;  1H44 A;  1N04 A;  2REJ A;  1PC3 A;  1T0K A;  3I6V A;  2DYX A;  1NFT A;  2DWJ A;  2XXT A;  1UTH B;  2LAO A;  4G68 C;  4LZ8 A;  2O84 X;  1B5J A;  4DXU A;  3PMV A;  4KD5 A;  4M4G A;  4GD5 A;  4LAT A;  1R9L A;  4OFO A;  2Y7R A;  3H6T A;  1QW0 A;  5KDT B;  1HSE A;  3K6X A;  1I69 A;  4QFP A;  1B52 A;  4KYD A;  3RUM A;  1B4Z A;  1P1O A;  3K0V A;  1A40 A;  3FVN A;  4ZEI A;  4H8J A;  4POX A;  3BBR A;  1A8F A;  3IOV A;  1PB8 A;  3S9N C;  3ILT B;  3C9H A;  2I4B A;  3GLB A;  1US4 A;  5DEX B;  3K02 A;  3PPQ A;  1N3W A;  5KDT A;  3ILU B;  2H5Y A;  3QXM A;  4Q30 B;  3TCH A;  3SER A;  4YB6 A;  3VLU A;  2V3Q A;  3HO7 A;  4O3C A;  1M5C A;  4XKN A;  4XKP A;  4YKI A;  3WAE A;  2AYS A;  4RXL A;  1JW1 A;  5DEX A;  3QAX A;  1ZKB A;  1OQH A;  1A55 A;  1B0H A;  4IO6 A;  1MXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...