2ZZXA

Crystal structure of a periplasmic substrate binding protein in complex with lactate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
330
structure length
330
Chain Sequence
RRYRWRIQTAWDAGTVGYSLFQKFTERVKELTDGQLEVQPFPAGAVVGTFDMFDAVKTGVLDGMNPFTLYWAGRMPVTAFLSSYALGLDRPDQWETWFYSLGGLDIARRAFAEQGLFYVGPVQHDLNIIHSKKPIRRFEDFKGVKLRVPGGMIAEVFAAAGASTVLLPGGEVYPALERGVIDAADFVGPAVNYNLGFHQVAKYIIMGPPETPAIHQPVDLMDFTINLNRWRSLPKPLQERFIAAVHEYSWIHYAGIQKANLEAWPKYRQAGVEVIRLSNEDVRKFRRLAIPIWFKWAKMDKYSREAFASQLEYMKGIGYVTDEELKGLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter, solute-binding protein
publication title Crystal structure of a periplasmic substrate-binding protein in complex with calcium lactate
pubmed doi rcsb
source organism Thermus thermophilus
total genus 130
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2zzxA00
4OVTA 4PC9A 4DI4B 4OVQA 4NG7A 4PAIA 4PE3A 2PFZA 4NX1A 2XWOA 2XA5A 4N17A 4PFIA 4PETA 4MEVA 4MAGA 2CEXA 2HZLA 4PBHA 4N8GA 2ZZXA 4MNPA 4N6KA 5CM6A 3B50A 2XWIA 4MHFA 4DI3D 2WYKA 2VPNA 4NAPA 4N91A 4YZZA 4PCDA 4P8BA 4O8MA 4X04A 4MNCA 4UABA 4P47A 4PGPA 2V4CA 4P9KA 4O94A 4YICA 2ZZVA 4PDHA 4MNIA 5LTCA 2HZKA 3FXBA 4NHBA 4PFBA 2PFYA 4O7MA 4OVRA 5IM2A 4XF5A 4P56A 4LN5A 2HPGA 4PF8A 4MCOA 4P1EA 4MIJA 4N8YA 4N6DA 4PAKA 5IGAA 4XFEA 2XXKA 4P1LA 2ZZWA 4PAFA 3GYYA 2XWKA 4P3LA 4OVSA 4PF6A 4OVPA 4PBQA 4N15A 4N4UA 4XEQA 4PDDA 2XWVA 2VPOA 4PGNA 5IZZA 4NQ8A 4PFRA 4NF0A 4OA4A 2CEYA 2WX9A 4OANA 3U65A 2WYPA 4MMPA 4MX6A 4X8RA 4NGUA 5I5PA 4NN3A 5I7IA
chains in the Genus database with same CATH superfamily
5HM4B 5I2NA 1IQ7A 3ILTB 3K2DA 2F78A 4GXSB 5DT6A 1O7TA 3T9XB 2PYYA 1BIYA 1AWBA 2OJTA 3VLWA 4OFJA 4F19A 5B70A 2D3IA 5K2YA 2XXVA 4ZZAA 3T1BA 1Y20A 3ODBA 3P7IA 1FTOA 2I4BA 2O7UA 3HFUA 2QFLA 4I3EA 4EQ7A 1MXZA 2B3FA 2O69A 2XXYA 5ET7A 4WEDA 1NNPA 5AA2A 4LATA 4OEUA 4U1ZA 4UACA 4R75A 2VPNA 2WYKA 5ISUA 3KBZA 3FIRA 4P8BA 4U21A 1NNTA 1USYH 4QHQA 4I9DA 3I6VA 3D1RA 3MJNA 1N04A 2DP8A 1SW1A 1RYOA 3IB1A 4O94A 4QSDA 1FQFA 2D5WA 4ZEBA 4R2BA 2F7CA 4GBWA 3CSBA 1Q9DA 3E13X 2O68A 3W15C 5IM2A 3CSGA 1IIWA 4PFWA 2I3WA 4X9TA 3G3FA 3LSLA 1QJMA 2DWJA 1D4NA 2GHBA 3M3LA 1OMPA 3GYYA 4P1LA 4IB2A 1LBVA 3VVEA 3Q29A 1K9ZA 3CFXA 1VDWA 2REGA 4N15A 1ZTYA 3S9LC 3RT6B 5CC2A 2KQZA 4PDDA 5EYFA 2VPOA 1LEVA 4R74A 2FHYA 3BKIB 5ITPA 2QVUA 4NF0A 1OQGA 3UORA 1IMFA 2R71A 3KN8A 4P0GA 4XKPA 1DTZA 2VD2A 5CMKA 1H3DA 1MH4A 5I56A 4Q8RA 2REJA 4U23A 2VP1A 1XC1A 1NNFA 4OVQA 3MPLA 1LBWA 4XXUA 4IY5A 3OO9A 2Y7KA 4I3YA 1QW0A 1YZ0A 4FEDA 3HN0A 4L17A 1NV6A 4PFIA 3VXBA 1VR5A 2HZLA 3LR1A 1MQDA 2O1LA 4OZ9A 3SETA 3EHUA 3T22A 1IXCA 1AMFA 2ZXTA 2H5YA 1EU8A 4GWWA 2E0SA 4C1UA 4LVQA 1YXIA 1ZMGA 3QYTA 3G7WA 1DSNA 3IB0A 4YZZA 5I59A 4KHZE 4DLDA 4ZEIA 3MUQA 1O63A 2VD3A 4JB7A 4LZ8A 3FZVA 4H8IA 5I84A 1FW0A 2F5XA 2XXIA 5EYGA 2PFYA 1WODA 4LUBA 4KCCA 4PE5B 4BDOA 3N6UA 4NF8B 4DCYA 4IY6A 4WEPA 2YLNA 3FVNA 1MY4A 3E9XA 3PUVE 3R26A 2ZZWA 3GXAA 3O9PA 3LSFB 3O6GA 2P1SA 1KWHA 1S9TA 3KC0A 2VHAA 1B46A 4DXBA 4KYEA 4XIGQ 3ILUB 1CB6A 1B6HA 4OERA 4OA4A 5AA4B 1P1WA 4U1OA 4ZECA 5L9SA 2OX3A 3PD9A 2HQ0A 5FHNA 4NGUA 3OMBA 4G8MA 3V83A 3VFJA 3DP6A 1FPLA 4GF8A 4FORA 2R8TA 4NF4A 4H45A 4IO3A 1JEUA 4ND9A 1AIVA 4OQOA 1B51A 4MEVA 2ESNA 3IOWA 1MXWA 1MY3A 1Q1KA 1N3WA 4GQOA 4ISUA 4N8GA 1BK4A 1IXGA 1FQDA 1UIUA 4TQUQ 2QSXA 1SYIA 4GX3A 1ANFA 5IZ3A 2QS1A 3RNNA 4RPOA 3DP4A 3ECRA 4E0WA 4MLQA 4G77A 1VFEA 3PTYA 4P0IA 2PBWA 4NE4A 1B5JA 4LQ5A 2ABHA 3OOAA 1NKXA 1D9YA 3K6WA 2V4CA 1MDP1 4C0RA 1H43A 4KI0E 3MP6A 1MM7A 4ZDMA 5I58B 2DVZA 5CRYA 3MYUA 4O7MA 4OVRA 1M5FA 4O7IA 3MAMA 5L8DA 1NUZA 1DK4A 3D4CA 3KC1A 2I58A 4G2ZA 1VE4A 2RF1A 3OO6A 1DPEA 4GVOA 5T3JA 1EZOA 1IITA 2F6GA 4HS7A 3FJMA 1FJ6A 4PFRA 1EYIA 4DCXA 5H8SA 4OVJA 2AIXA 2WX9A 5L9MA 4EF2A 1VSOA 3GBBA 4FECA 4GX4A 1USYE 1YTVA 5ET6A 1ZKBA 1B7HA 2HAUA 1GV8A 3TQWA 1MDQA 2PVUA 3LV0A 3EKIA 4ZE9A 4YKJA 2MKZA 4HE1A 5TP9A 1NUXA 2Q74A 3TPAA 3CRBA 5CMCA 1NFTA 3FBPA 3EPEA 4QF9A 3LSWA 1N0TA 3KG2A 1JQFA 1PB8A 4Q30B 2QPQA 2UVGA 4PFYA 4KXPA 4HCWA 4RYAA 2P0SA 2Z8DA 3TELA 4PQJA 3TFLA 4NAPA 1I6BA 1ATGA 3HHFA 3LBSA 1D9VA 3SKPA 1IMBA 3FXUA 5M2VA 3FV2A 2P2AA 2UVIA 1GR2A 2F6PA 2GFEA 1RYXA 5I57B 2NVUB 1LFGA 1Z7ME 3IK6B 2QMWA 1TXFA 1B5IA 3R6UA 1TWYA 1POTA 1L5TA 1ZU0A 1B7UA 4OWDA 3EHSA 1FQEA 3IL1B 3UIFA 1POY1 1Q35A 3MZ1A 3V5AA 2F3BA 4MIJA 4NTLA 1QUJA 4ZE8A 2VOZA 2V3UA 4JBZA 1OIBA 2OWZA 3K6UA 2XD2A 3T96B 1JW4A 2VT5A 4NMYA 4U22A 3TTRA 2H25A 4GBVA 1PC3A 5HBCA 3OENA 1FRPA 1IMCA 2XXPA 4GLIA 2Z23A 2WBDA 3EHTA 1YYZA 1JP4A 2X7PA 1IXIA 1S7YA 5DTBA 4BDMA 5KCJB 2CEXA 1R1NA 1LBXA 1WDNA 2DWIA 2NXOA 1FQCA 1ZIUA 3HCQA 2E1SA 2OLBA 4HXVA 3PPRA 2GRVA 1EZ9A 1A7LA 1UTBB 5JK4A 3CG3A 4PCDA 4KD5A 1LCFA 2QRYA 2Z8FA 1NV7A 4GWXA 4EF1A 2XXQA 4KPTA 1UTHB 1B9JA 5A5LA 4YICA 4EUOA 2CMOA 5I2NB 2GQ1A 3PPPA 5BWJA 1Y4TA 2CZHA 4DIGA 3KGCA 1P99A 1JVYA 4MCOA 1N3XA 3KJTA 3CHGA 3U8QA 2Q89A 1SW2A 3E3KA 3FGSA 2I0CA 3QUFA 4JVCA 1B58A 4GWZA 1YCJA 5DEXA 1URGA 3VV5A 5AA2B 2HHMA 4MMPA 3T9VA 4N81A 3RYDA 4OVTA 2Q9TA 3C32A 4AS5A 2F7BA 1SBPA 4AB5A 4X48A 2PFZA 3CFLA 3IFAA 3MWBA 4F2QA 1RDZA 3TUSA 4XKRA 4JSOA 1RDYA 4G68A 3IX1A 4PBHA 1HSJA 3MZBA 4GOTA 1EYJA 1FTMA 1A54A 2QS3A 3DM0A 4OTEA 4KR5A 3MSTA 3MVWA 4R73A 3RGYA 2OBGA 4HE2A 1TFDA 5EHSA 3IJXB 3Q25A 3K02A 2D21A 2ZYMA 4F1YA 1MRPA 2Y7RA 3TCHA 4RJZA 4RK2A 5I56B 1FPJA 4THIA 2ZMBA 5L9OA 4PDHA 1NH7A 5CMBA 1XT8A 1QUKA 5F1QA 4F2OA 4P1EA 1GGGA 1M5CA 1FPGA 1B32A 1DTGA 1I69A 5H8HB 3B6TA 3GLBA 4OFOA 1YPNA 4PBQA 4TLLB 1QKBA 5IZZA 3MC2A 1US5A 3CR9A 3FJ7A 2LAOA 4GD5A 3RTWB 3K6VA 5LDZA 1XOCA 4F31B 5AA3A 5HPQA 5CMMA 2FIEA 3C9HA 5EQ7A 5I59B 2IEEA 5IAIA 4MFIA 2L5VA 3SEUA 2QVVA 1MY2A 3S9EA 3HPIA 4NX1A 3E78A 4G68C 2XWOA 1DOTA 3MBPA 3G3IA 2F34A 3JYRA 1FPFA 1FSAA 3WAFA 2V25A 4WXJA 1FTJA 1FBFA 1SVXB 3U93A 1LB9A 4JSDA 2QS2A 4ELPA 3KOSA 5ICTA 1PB7A 1EZPA 1LAGE 2Y5LA 3RQTA 5H8FA 4JVDA 5CM6A 3FASA 3TTKA 4N13A 4ZS9A 3VLVA 1FTLA 1B5HA 1FCKA 2P3VA 4M1VA 1Y3PA 2F8DA 3JZJA 4QFLA 3OXNA 1XS5A 1H76A 2Y7WA 2RKMA 5CBSA 1M5DA 3E4RA 3TEPA 1US4A 2ZNUA 2PT2A 3PUYE 3IAZA 4NHBA 2V93A 1PBQA 3H4ZA 3C31A 3TCFA 4LN5A 4NF4B 4N8YA 2NWJA 1PB9A 4F18A 1B0LA 2XWKA 2NOOA 4FJPA 3C35A 1NL5A 4O3BA 1NNKA 4R6YA 3M3FA 4NQ8A 2CZLA 3GZGA 1Y1ZA 2HXWA 4YB5A 3SZPA 1BKAA 4QXDA 5IZ3B 2CEYA 5F24A 3FJGA 3T9UA 1FBHA 2PX1A 3G3KA 3LSXA 4NN3A 5TU0A 2V3TA 3BIHA 4OYVA 3JV9A 1N76A 3VDFA 3ZKLA 3CIJA 4UA8A 2H98A 2HXRA 2O51A 5J16A 1MQIA 4PFUA 3RLFE 4XTCQ 3R7XA 2AYSA 3O6HA 2XXHA 2H99A 3TCGA 5J1DA 3B7DA 3DLNA 4OENA 4NWDA 1FPDA 3H6UA 4TLMB 4MF3A 2FA7A 1MQHA 2B4MA 2Y84A 3MVXA 3PPQA 2Q8MA 2WKYA 3TAJA 4I8CA 1DCUA 3TTMA 5KDTA 1QVSA 5H8QA 4H5GA 4K3FA 1Z7NE 4YB7A 5TP9B 4GL0A 3QSLA 2HPGA 1FTAA 4U4SA 4EQ9A 1OQHA 2O7IA 3HSTA 4MBPA 3PPNA 3I5OA 4N4UA 2FIXA 1IUDA 1LBYA 5A5XA 1MXXA 1XVYA 2BJIA 2KLFA 3N26A 2GH9A 3KFMA 3G3JA 1N7XA 2UXAA 1B40A 4QFPA 1SQYA 4MX6A 4X8RA 3ONMA 2UYFA 1EH3A 1NV1A 4DI4B 4N07A 4OFLA 2JJKA 1DBZA 3K1NA 4EXLA 4YB6A 3PMXA 2DWAA 4N17A 1RDXA 1H45A 4H65A 3Q26A 4DE8A 3OELA 3OSRA 3A09A 5DVJA 1N7WA 3IO6A 2I4CA 3IORA 4RXLA 3TMGA 1FPIA 4HW8A 1MM6A 2DE2A 4PP0A 2OZZA 1IZ1A 2RC7A 4O8MA 4X04A 3O2AA 3T93B 4F1UA 1A99A 3RN8A 3VXCA 3BFTA 4NF5A 1FQBA 2M8CA 1Y3QA 1BP5A 2IA4A 2ZYKA 4PFBA 1B05A 1A40A 3OO8A 3HHGA 5I2KA 4X1DA 4MJOA 5IKBA 4YMAA 4LP2B 4PFTA 1FJ9A 1LAXA 3U94A 4PGNA 3RTFB 3PPOA 3TYHA 1LGBC 1FBDA 3I3VA 3ROJA 2XHDA 3B6QA 4G8HA 2RCBA 3FATA 3UN6A 1PEBA 3UP9A 4F3GA 3H6WA 4JWXA 4PAIA 2ONKE 4R6KA 2OWTA 3CFZA 1SDXA 4EXKA 4RNSA 3CVGA 3BBRA 4QRZA 4RA1A 3PUWE 5TPAA 3SDFA 1Y1MA 4MAGA 2DXYA 4YKPA 4NF6A 3USDA 1IMDA 3VVDA 1MPDA 1ZBMA 1BLFA 3MZ9A 3GBAA 2B3BA 4R72A 1MS7A 4N91A 4TOZA 5DEXB 1HSLA 5FTHA 3K00A 2QJEA 4JVIA 2Q2AA 2BJJX 4MNCA 2UVHA 5JTYA 3OEKA 2OWSA 2H4IA 4BDLA 1F9BA 4P9KA 4IR8A 1TT1A 3FVGA 4MNIA 5LTCA 1BTJA 2FBPA 3RPWA 1I6AA 4OXVA 5AE4A 5ITOA 2DDKA 1R6ZA 3K0VA 4Z0IA 3HO7A 3UA8A 2DQVA 4G68B 1LFHA 1MQGA 5H8NA 2O1MA 4GWOA 2Z22A 3NOHA 3H6TA 4JDFA 4H5FA 4OANA 3U65A 3M8UA 3W9VA 2I0BA 5I7IA 2WBBA 1LB8A 2XXWA 4F3BA 4PC9A 3KOTA 4IO2A 2XXTA 5JEIA 4BDQA 3HV1A 5AA1A 3VVFA 1FBCA 4M4GA 3TODA 1LLSA 2XA5A 1Y4CA 2QS4A 4PETA 3TZAA 4HE0A 1LCTA 1FBGA 3IR1A 2ANJA 1J1NA 4QBAA 3SEWA 2XXRA 4H1XA 1OVBA 1MPBA 3FVOA 3BFUA 3TTNA 2GHAA 4DI3D 1B2HA 2A5SA 1GTKA 4LA9A 3C33A 3PV0E 2OK2A 5F7VA 3A29A 2Y5KA 4EDPA 3IO4A 4UABA 3G3HA 2ZYOA 4JXIA 3TTLA 3L6HA 4YMBA 1PDAA 3F11A 4MH5A 3RPLA 3ZSFA 2XX8A 4LZ5A 4ELQA 1PBPA 3PMWA 1B3GA 5EHMA 4P56A 2RC8A 3G3GA 4POXA 4NWCA 1QULA 4OHNA 2XXKA 4FATA 3S2VA 4OVPA 4R6HA 3MP8A 4WKMA 5H8FB 3FXQA 3M3KA 1D3KA 1Y3NA 2B4LA 1NV5A 1LSTA 1B3EA 3K01A 4GWUA 3TDJA 3SEVA 2ONRA 3PU5A 1CE2A 4ESXA 4H6DA 4YKKA 3SERA 2QL3A 4DXUA 2PT1A 1B1HA 3QK6A 4GIZA 2I48A 4XKQA 3Q28A 2R6GE 1XI6A 3N6TA 3KBRA 4KQPA 3MVZA 2F3DA 2QMXA 2ZZXA 2RCAA 2V84A 2A5TA 2XXXA 3D4GA 1FTKA 1P1OA 2ZNTA 2XX9A 1KA0A 2G29A 3QMFA 3BIGA 1T0KA 3PD8A 4FE8A 2ZYNA 3H7MA 3VE1B 1JNFA 5ELVA 1B0HA 1B4ZA 1B1XA 3QUJA 1DMBA 1TFAA 2HEUA 2ZZVA 1B3FA 1SYHA 4H46A 1FBEA 2HFBA 2DXRA 4ELOA 4RPNA 3U72A 4YKIA 1IMEA 4IO6A 5ET8A 3EQ1A 5CBRA 3S9NC 5DVIA 3DELB 1I6QA 5IGAA 3K6XA 1ELJA 1B52A 2AL5A 1R9LA 3O6IA 1UIVA 3IOTA 3WAEA 4KYDA 3MPKA 1Y9UA 3O28A 5B7DA 1G0HA 5H8HA 2WYPA 2I3VA 3T66A 4ZEDA 1NV2A 2F35A 5DYHA 4NG7A 2I49A 1MY0A 3KN3A 5FBPA 1AL3A 1FQAA 3THIA 3A3CA 1KA1A 1VFDA 2FNCA 1SPIA 4I62A 3B8BA 4QFKA 5EQ8A 4R9FA 5KDTB 5H8QB 3U92A 3LUYA 3PUXE 4ELRA 2DOJA 1WVJA 3TKDA 1IXHA 2UYEA 4MLVA 4U2RA 4QFNA 3KN7A 4MNPA 2DSFA 1NV0A 3IFCA 4JWYA 2XX7A 2R9JA 2NUVA 2XWIA 3B50A 1H44A 3E79A 5KZTA 1P1QA 3TQLA 1URDA 4H0WA 5A5XB 4I1DA 4R2FA 3PMVA 3KSJA 1M5BA 4BLAA 2Y7IA 4O3CA 4ONYA 1R9QA 1NV4A 2CZIA 1FPEA 3O97A 3LC8A 4F29A 4P11A 4O3AA 1MXYA 4POWA 1KZ8A 4GRKA 3N5LA 3QIMA 5BUUA 2I6EA 4PAKA 2DYXA 5ET5A 1P1UA 4PAFA 3MQ9A 3MVYA 1JW5A 1SW5A 1DPPA 4QSCA 3C36A 2ZNSA 2THIA 1G0IA 2DS9A 3FV1A 3V89B 4BDNA 2Z8EA 2X7QA 1UQWA 3FXRA 3FUZA 3RY3A 4YU0A 4PE3A 4IGRA 2Q8JA 4GFRA 1NUYA 5AA2D 1MQJA 3IB2A 4NF5B 4NF8A 1JEVA 1A55A 3L6GA 4Q0CA 3EF7A 4F3PA 1M5EA 2XD3A 5FHOA 3KZGA 1XHYA 1OLCA 5I2KB 4YAHX 3KEIA 4ECFA 5I3SA 2HAVA 4ESWA 2DE3A 5AA4A 3FVKA 3MW0A 2AL4A 4RK9A 4EQBA 1OVTA 2CZKA 4GXAA 4N6PA 4QSEA 1RKMA 4LQ2A 1FBPA 1NV3A 5DVFA 4DDDA 4AS4A 1A8FA 1SI0A 1B7ZA 2W7YA 1NI9A 2PMSA 2Q88A 1MXUA 3FXBA 1YAEA 3QXMA 3OSQA 2HCAA 4F1VA 5CI5A 4PF8A 5TPAB 1NH8A 1B4HA 3LUZA 1MG1A 4BDRA 3OEMA 3PUZE 4NF6B 4KYSA 4ZZEA 4DZ1A 2DVCA 1MY1A 3S4UA 4AQ4A 5EQAA 2FVZA 1CNQA 1B3LA 5I5PA 1MPCA 4Q5TA 4ZEKA 4JWOA 1LBCA 5I58A 1LBZA 4GX6A 1A8EA 5JTYB 1QKAA 4GWYA 4IO7A 5IZ1A 4G8NA 3K1PA 3SEYA 4F22A 2V3QA 1HSEA 2RC9A 3N94A 2FYIA 2G93A 1JW1A 2F7AA 3H3GA 4FEBA 3CI8A 2H9BA 2F97A 1JETA 4N6KA 2OCUA 4GL8A 5LOMA 3C34A 4MHFA 4HTGA 4E0XA 1IEJA 3O66A 3UGWA 3K4UA 4NEDA 3OO7A 5H8NB 1INPA 2F36A 2DWHA 2Q2CA 4F39A 4OEVA 3RUMA 4C1TA 3C4MA 4Z7EA 4IO5A 4P47A 4PGPA 1B3HA 1ZLQA 1IMAA 3IJOB 3A3UA 3ISPA 4XF5A 1NUWA 4DXCA 4R9GA 3K1MA 4XFEA 2ONSA 1LFIA 4RY1A 1LAHE 4F3SA 4OVSA 4PF6A 3W9WA 3T0JA 2Y7PA 4IGTA 4XEQA 4AB6A 1FPKA 3S9MC 3KSXA 1GVCA 1K9YA 4IO4A 4ZEFA 3QAXA 5I57A 4G61A 3SEXA 1QUIA 3DP8A 4H67A 2B65A 3SESA 3MP1A 4GWSA 4FBPA 4KFQA 4FAJA 1SW4A 1MXVA 3V8XB 5EYHA 2KR0A 1AOVA 3UK4A 3RPLB 1MH3A 1QGXA 3FD3A 5FHMA 2UVJA 3VLUA 2PCRA 3H03A 2XXUA 2ALUA 3U1OA 2DE4A 2VGQA 3Q27A 1P1NA 1ZJLA 1AH5A 5ESYA 5FTIA 3PGFA 4H8JA 1S50A 2RINA 4KCDA 2O84X 1II5A 3B6WA 4PTKA 3KJ7A 4OETA 1SI1A 5K2XA 3O29A 1JVXA 1SD3A 1LAFE 3ZKKA 3RT8A 5ICQA 2HZKA 1URSA 5KCJA 1EYKA 4X1BA 2YJPA 2YPNA 3CG1A 3ZS6A 1NMUA 1O64A 4N6DA 4XKNA 3IOUA 3H06B 3AXFA 3OD7A 4LZ7A 4LONB 2QVRA 5DW8A 2O6AA 2P3NA 4OMBA 3T9HB 4P3LA 4OESA 4U4XA 1LBBA 1D9QA 2WEFA 5EQ9A 4HCYA 2XWVA 1XVXA 1OLAA 1UTBA 2A5TB 4QFOA 3IOVA 3EN3A 4I40A 4G4PA 2X26A 1FPBA 1UTHA 4FIMA 3H6VA 1N84A
chains in the Genus database with same CATH topology
1NV2A 1NV1A 4DI4B 4NG7A 1FRPA 1IMCA 2JJKA 1DBZA 2WBDA 5FBPA 1AWBA 4F19A 1YYZA 1JP4A 1KA1A 1SPIA 3B8BA 4N17A 3T1BA 5EQ8A 1RDXA 2CEXA 1LBXA 3HFUA 2QFLA 4I3EA 4MNPA 1NV0A 5ET7A 3IFCA 1FPIA 2XWIA 3B50A 3E79A 2VPNA 2WYKA 4HXVA 2DE2A 3KBZA 5JK4A 4PCDA 4P8BA 4O8MA 4X04A 1NV7A 4GWXA 4F1UA 3D1RA 1NV4A 5A5LA 2CZIA 4O94A 4YICA 1FPEA 2GQ1A 4PFBA 4GBWA 2CZHA 1KZ8A 1Q9DA 5IM2A 4MCOA 4X9TA 4MJOA 4PAKA 3CHGA 5ET5A 4P1LA 4PAFA 3GYYA 1LBVA 1FJ9A 1K9ZA 1VDWA 4JVCA 4N15A 2KQZA 4GWZA 4PDDA 2VPOA 4PGNA 1LEVA 2FHYA 2QVUA 4NF0A 1FBDA 1IMFA 3ROJA 1G0IA 2HHMA 4MMPA 4N81A 3RYDA 4OVTA 4OVQA 2Q9TA 4AS5A 4PAIA 1LBWA 4PE3A 1NUYA 2PFZA 4I3YA 3IFAA 1YZ0A 1NV6A 4PFIA 1RDZA 4MAGA 1RDYA 2HZLA 4PBHA 1IMDA 1EYJA 5I3SA 4GWWA 2DE3A 3MSTA 1YXIA 4HE2A 2CZKA 4N91A 4YZZA 4JVIA 4MNCA 1FBPA 1NV3A 1FPJA 4AS4A 4P9KA 4IR8A 4PDHA 4MNIA 2F5XA 5LTCA 1NI9A 5EYGA 3FXBA 2PFYA 2FBPA 4F1VA 4PF8A 4P1EA 2DDKA 1FPGA 3LUZA 2ZZWA 4PBQA 5IZZA 3KC0A 3NOHA 5EQAA 4OA4A 5LDZA 2FVZA 2OX3A 4OANA 3U65A 1CNQA 2FIEA 3W9VA 5EQ7A 4NGUA 5I5PA 5I7IA 2WBBA 4PC9A 2L5VA 2QVVA 1LBZA 1FPLA 4GX6A 4GWYA 4NX1A 3E78A 2XWOA 1FBCA 2R8TA 2XA5A 4H45A 1FPFA 1FSAA 4PETA 4MEVA 5IZ1A 4HE0A 1FBFA 1FBGA 2V3QA 4N8GA 4QBAA 1BK4A 2Y5LA 4N6KA 4GX3A 4JVDA 5CM6A 5IZ3A 4MHFA 4DI3D 2P3VA 1INPA 3PTYA 4M1VA 3A29A 2Y5KA 4UABA 4P47A 4PGPA 2V4CA 1IMAA 3RPLA 4NHBA 2DVZA 3MYUA 4O7MA 3ISPA 4OVRA 4XF5A 1NUWA 4P56A 4LN5A 4O7IA 4N8YA 1NUZA 1DK4A 4F18A 4XFEA 2XXKA 3KC1A 2XWKA 4OVSA 4PF6A 4OVPA 3W9WA 3T0JA 5T3JA 4XEQA 1FPKA 1FJ6A 4NQ8A 4PFRA 1EYIA 3SZPA 4QXDA 1K9YA 5IZ3B 2CEYA 5F24A 2WX9A 2B4LA 1NV5A 4GWUA 4GX4A 5ET6A 4G61A 4NN3A 1FBHA 3BIHA 3LV0A 3EKIA 4GWSA 4FBPA 2MKZA 4HE1A 5EYHA 1NUXA 2KR0A 2Q74A 1XI6A 3RPLB 1QGXA 2HXRA 3FBPA 2PCRA 5J16A 2F3DA 2DE4A 2ZZXA 2QPQA 5ESYA 4KXPA 5J1DA 4HCWA 1KA0A 3QMFA 3BIGA 4NAPA 1FPDA 1IMBA 4PTKA 2B4MA 2Q8MA 2ZZVA 4H46A 1FBEA 1DCUA 2HZKA 1EYKA 1IMEA 5ET8A 2HPGA 2F3BA 1FTAA 4MIJA 4N6DA 5IGAA 2QVRA 5DW8A 2P3NA 4P3LA 1D9QA 2WEFA 4N4UA 5EQ9A 4HCYA 2FIXA 2XWVA 1LBYA 2OWZA 2BJIA 2VT5A 4I40A 1FPBA 1G0HA 2WYPA 4GBVA 4MX6A 4X8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVT A;  4PC9 A;  4DI4 B;  4OVQ A;  4NG7 A;  4PAI A;  4PE3 A;  2PFZ A;  4NX1 A;  2XWO A;  2XA5 A;  4N17 A;  4PFI A;  4PET A;  4MEV A;  4MAG A;  2CEX A;  2HZL A;  4PBH A;  4N8G A;  2ZZX A;  4MNP A;  4N6K A;  5CM6 A;  3B50 A;  2XWI A;  4MHF A;  4DI3 D;  2WYK A;  2VPN A;  4NAP A;  4N91 A;  4YZZ A;  4PCD A;  4P8B A;  4O8M A;  4X04 A;  4MNC A;  4UAB A;  4P47 A;  4PGP A;  2V4C A;  4P9K A;  4O94 A;  4YIC A;  2ZZV A;  4PDH A;  4MNI A;  5LTC A;  2HZK A;  3FXB A;  4NHB A;  4PFB A;  2PFY A;  4O7M A;  4OVR A;  5IM2 A;  4XF5 A;  4P56 A;  4LN5 A;  2HPG A;  4PF8 A;  4MCO A;  4P1E A;  4MIJ A;  4N8Y A;  4N6D A;  4PAK A;  5IGA A;  4XFE A;  2XXK A;  4P1L A;  2ZZW A;  4PAF A;  3GYY A;  2XWK A;  4P3L A;  4OVS A;  4PF6 A;  4OVP A;  4PBQ A;  4N15 A;  4N4U A;  4XEQ A;  4PDD A;  2XWV A;  2VPO A;  4PGN A;  5IZZ A;  4NQ8 A;  4PFR A;  4NF0 A;  4OA4 A;  2CEY A;  2WX9 A;  4OAN A;  3U65 A;  2WYP A;  4MMP A;  4MX6 A;  4X8R A;  4NGU A;  5I5P A;  4NN3 A;  5I7I A; 
#chains in the Genus database with same CATH topology
 5HM4 B;  5I2N A;  1IQ7 A;  3ILT B;  3K2D A;  2F78 A;  4GXS B;  5DT6 A;  1O7T A;  3T9X B;  2PYY A;  1BIY A;  1AWB A;  2OJT A;  3VLW A;  4OFJ A;  4F19 A;  5B70 A;  2D3I A;  5K2Y A;  2XXV A;  4ZZA A;  3T1B A;  1Y20 A;  3ODB A;  3P7I A;  1FTO A;  2I4B A;  2O7U A;  3HFU A;  2QFL A;  4I3E A;  4EQ7 A;  1MXZ A;  2B3F A;  2O69 A;  2XXY A;  5ET7 A;  4WED A;  1NNP A;  5AA2 A;  4LAT A;  4OEU A;  4U1Z A;  4UAC A;  4R75 A;  2VPN A;  2WYK A;  5ISU A;  3KBZ A;  3FIR A;  4P8B A;  4U21 A;  1NNT A;  1USY H;  4QHQ A;  4I9D A;  3I6V A;  3D1R A;  3MJN A;  1N04 A;  2DP8 A;  1SW1 A;  1RYO A;  3IB1 A;  4O94 A;  4QSD A;  1FQF A;  2D5W A;  4ZEB A;  4R2B A;  2F7C A;  4GBW A;  3CSB A;  1Q9D A;  3E13 X;  2O68 A;  3W15 C;  5IM2 A;  3CSG A;  1IIW A;  4PFW A;  2I3W A;  4X9T A;  3G3F A;  3LSL A;  1QJM A;  2DWJ A;  1D4N A;  2GHB A;  3M3L A;  1OMP A;  3GYY A;  4P1L A;  4IB2 A;  1LBV A;  3VVE A;  3Q29 A;  1K9Z A;  3CFX A;  1VDW A;  2REG A;  4N15 A;  1ZTY A;  3S9L C;  3RT6 B;  5CC2 A;  2KQZ A;  4PDD A;  5EYF A;  2VPO A;  1LEV A;  4R74 A;  2FHY A;  3BKI B;  5ITP A;  2QVU A;  4NF0 A;  1OQG A;  3UOR A;  1IMF A;  2R71 A;  3KN8 A;  4P0G A;  4XKP A;  1DTZ A;  2VD2 A;  5CMK A;  1H3D A;  1MH4 A;  5I56 A;  4Q8R A;  2REJ A;  4U23 A;  2VP1 A;  1XC1 A;  1NNF A;  4OVQ A;  3MPL A;  1LBW A;  4XXU A;  4IY5 A;  3OO9 A;  2Y7K A;  4I3Y A;  1QW0 A;  1YZ0 A;  4FED A;  3HN0 A;  4L17 A;  1NV6 A;  4PFI A;  3VXB A;  1VR5 A;  2HZL A;  3LR1 A;  1MQD A;  2O1L A;  4OZ9 A;  3SET A;  3EHU A;  3T22 A;  1IXC A;  1AMF A;  2ZXT A;  2H5Y A;  1EU8 A;  4GWW A;  2E0S A;  4C1U A;  4LVQ A;  1YXI A;  1ZMG A;  3QYT A;  3G7W A;  1DSN A;  3IB0 A;  4YZZ A;  5I59 A;  4KHZ E;  4DLD A;  4ZEI A;  3MUQ A;  1O63 A;  2VD3 A;  4JB7 A;  4LZ8 A;  3FZV A;  4H8I A;  5I84 A;  1FW0 A;  2F5X A;  2XXI A;  5EYG A;  2PFY A;  1WOD A;  4LUB A;  4KCC A;  4PE5 B;  4BDO A;  3N6U A;  4NF8 B;  4DCY A;  4IY6 A;  4WEP A;  2YLN A;  3FVN A;  1MY4 A;  3E9X A;  3PUV E;  3R26 A;  2ZZW A;  3GXA A;  3O9P A;  3LSF B;  3O6G A;  2P1S A;  1KWH A;  1S9T A;  3KC0 A;  2VHA A;  1B46 A;  4DXB A;  4KYE A;  4XIG Q;  3ILU B;  1CB6 A;  1B6H A;  4OER A;  4OA4 A;  5AA4 B;  1P1W A;  4U1O A;  4ZEC A;  5L9S A;  2OX3 A;  3PD9 A;  2HQ0 A;  5FHN A;  4NGU A;  3OMB A;  4G8M A;  3V83 A;  3VFJ A;  3DP6 A;  1FPL A;  4GF8 A;  4FOR A;  2R8T A;  4NF4 A;  4H45 A;  4IO3 A;  1JEU A;  4ND9 A;  1AIV A;  4OQO A;  1B51 A;  4MEV A;  2ESN A;  3IOW A;  1MXW A;  1MY3 A;  1Q1K A;  1N3W A;  4GQO A;  4ISU A;  4N8G A;  1BK4 A;  1IXG A;  1FQD A;  1UIU A;  4TQU Q;  2QSX A;  1SYI A;  4GX3 A;  1ANF A;  5IZ3 A;  2QS1 A;  3RNN A;  4RPO A;  3DP4 A;  3ECR A;  4E0W A;  4MLQ A;  4G77 A;  1VFE A;  3PTY A;  4P0I A;  2PBW A;  4NE4 A;  1B5J A;  4LQ5 A;  2ABH A;  3OOA A;  1NKX A;  1D9Y A;  3K6W A;  2V4C A;  1MDP 1;  4C0R A;  1H43 A;  4KI0 E;  3MP6 A;  1MM7 A;  4ZDM A;  5I58 B;  2DVZ A;  5CRY A;  3MYU A;  4O7M A;  4OVR A;  1M5F A;  4O7I A;  3MAM A;  5L8D A;  1NUZ A;  1DK4 A;  3D4C A;  3KC1 A;  2I58 A;  4G2Z A;  1VE4 A;  2RF1 A;  3OO6 A;  1DPE A;  4GVO A;  5T3J A;  1EZO A;  1IIT A;  2F6G A;  4HS7 A;  3FJM A;  1FJ6 A;  4PFR A;  1EYI A;  4DCX A;  5H8S A;  4OVJ A;  2AIX A;  2WX9 A;  5L9M A;  4EF2 A;  1VSO A;  3GBB A;  4FEC A;  4GX4 A;  1USY E;  1YTV A;  5ET6 A;  1ZKB A;  1B7H A;  2HAU A;  1GV8 A;  3TQW A;  1MDQ A;  2PVU A;  3LV0 A;  3EKI A;  4ZE9 A;  4YKJ A;  2MKZ A;  4HE1 A;  5TP9 A;  1NUX A;  2Q74 A;  3TPA A;  3CRB A;  5CMC A;  1NFT A;  3FBP A;  3EPE A;  4QF9 A;  3LSW A;  1N0T A;  3KG2 A;  1JQF A;  1PB8 A;  4Q30 B;  2QPQ A;  2UVG A;  4PFY A;  4KXP A;  4HCW A;  4RYA A;  2P0S A;  2Z8D A;  3TEL A;  4PQJ A;  3TFL A;  4NAP A;  1I6B A;  1ATG A;  3HHF A;  3LBS A;  1D9V A;  3SKP A;  1IMB A;  3FXU A;  5M2V A;  3FV2 A;  2P2A A;  2UVI A;  1GR2 A;  2F6P A;  2GFE A;  1RYX A;  5I57 B;  2NVU B;  1LFG A;  1Z7M E;  3IK6 B;  2QMW A;  1TXF A;  1B5I A;  3R6U A;  1TWY A;  1POT A;  1L5T A;  1ZU0 A;  1B7U A;  4OWD A;  3EHS A;  1FQE A;  3IL1 B;  3UIF A;  1POY 1;  1Q35 A;  3MZ1 A;  3V5A A;  2F3B A;  4MIJ A;  4NTL A;  1QUJ A;  4ZE8 A;  2VOZ A;  2V3U A;  4JBZ A;  1OIB A;  2OWZ A;  3K6U A;  2XD2 A;  3T96 B;  1JW4 A;  2VT5 A;  4NMY A;  4U22 A;  3TTR A;  2H25 A;  4GBV A;  1PC3 A;  5HBC A;  3OEN A;  1FRP A;  1IMC A;  2XXP A;  4GLI A;  2Z23 A;  2WBD A;  3EHT A;  1YYZ A;  1JP4 A;  2X7P A;  1IXI A;  1S7Y A;  5DTB A;  4BDM A;  5KCJ B;  2CEX A;  1R1N A;  1LBX A;  1WDN A;  2DWI A;  2NXO A;  1FQC A;  1ZIU A;  3HCQ A;  2E1S A;  2OLB A;  4HXV A;  3PPR A;  2GRV A;  1EZ9 A;  1A7L A;  1UTB B;  5JK4 A;  3CG3 A;  4PCD A;  4KD5 A;  1LCF A;  2QRY A;  2Z8F A;  1NV7 A;  4GWX A;  4EF1 A;  2XXQ A;  4KPT A;  1UTH B;  1B9J A;  5A5L A;  4YIC A;  4EUO A;  2CMO A;  5I2N B;  2GQ1 A;  3PPP A;  5BWJ A;  1Y4T A;  2CZH A;  4DIG A;  3KGC A;  1P99 A;  1JVY A;  4MCO A;  1N3X A;  3KJT A;  3CHG A;  3U8Q A;  2Q89 A;  1SW2 A;  3E3K A;  3FGS A;  2I0C A;  3QUF A;  4JVC A;  1B58 A;  4GWZ A;  1YCJ A;  5DEX A;  1URG A;  3VV5 A;  5AA2 B;  2HHM A;  4MMP A;  3T9V A;  4N81 A;  3RYD A;  4OVT A;  2Q9T A;  3C32 A;  4AS5 A;  2F7B A;  1SBP A;  4AB5 A;  4X48 A;  2PFZ A;  3CFL A;  3IFA A;  3MWB A;  4F2Q A;  1RDZ A;  3TUS A;  4XKR A;  4JSO A;  1RDY A;  4G68 A;  3IX1 A;  4PBH A;  1HSJ A;  3MZB A;  4GOT A;  1EYJ A;  1FTM A;  1A54 A;  2QS3 A;  3DM0 A;  4OTE A;  4KR5 A;  3MST A;  3MVW A;  4R73 A;  3RGY A;  2OBG A;  4HE2 A;  1TFD A;  5EHS A;  3IJX B;  3Q25 A;  3K02 A;  2D21 A;  2ZYM A;  4F1Y A;  1MRP A;  2Y7R A;  3TCH A;  4RJZ A;  4RK2 A;  5I56 B;  1FPJ A;  4THI A;  2ZMB A;  5L9O A;  4PDH A;  1NH7 A;  5CMB A;  1XT8 A;  1QUK A;  5F1Q A;  4F2O A;  4P1E A;  1GGG A;  1M5C A;  1FPG A;  1B32 A;  1DTG A;  1I69 A;  5H8H B;  3B6T A;  3GLB A;  4OFO A;  1YPN A;  4PBQ A;  4TLL B;  1QKB A;  5IZZ A;  3MC2 A;  1US5 A;  3CR9 A;  3FJ7 A;  2LAO A;  4GD5 A;  3RTW B;  3K6V A;  5LDZ A;  1XOC A;  4F31 B;  5AA3 A;  5HPQ A;  5CMM A;  2FIE A;  3C9H A;  5EQ7 A;  5I59 B;  2IEE A;  5IAI A;  4MFI A;  2L5V A;  3SEU A;  2QVV A;  1MY2 A;  3S9E A;  3HPI A;  4NX1 A;  3E78 A;  4G68 C;  2XWO A;  1DOT A;  3MBP A;  3G3I A;  2F34 A;  3JYR A;  1FPF A;  1FSA A;  3WAF A;  2V25 A;  4WXJ A;  1FTJ A;  1FBF A;  1SVX B;  3U93 A;  1LB9 A;  4JSD A;  2QS2 A;  4ELP A;  3KOS A;  5ICT A;  1PB7 A;  1EZP A;  1LAG E;  2Y5L A;  3RQT A;  5H8F A;  4JVD A;  5CM6 A;  3FAS A;  3TTK A;  4N13 A;  4ZS9 A;  3VLV A;  1FTL A;  1B5H A;  1FCK A;  2P3V A;  4M1V A;  1Y3P A;  2F8D A;  3JZJ A;  4QFL A;  3OXN A;  1XS5 A;  1H76 A;  2Y7W A;  2RKM A;  5CBS A;  1M5D A;  3E4R A;  3TEP A;  1US4 A;  2ZNU A;  2PT2 A;  3PUY E;  3IAZ A;  4NHB A;  2V93 A;  1PBQ A;  3H4Z A;  3C31 A;  3TCF A;  4LN5 A;  4NF4 B;  4N8Y A;  2NWJ A;  1PB9 A;  4F18 A;  1B0L A;  2XWK A;  2NOO A;  4FJP A;  3C35 A;  1NL5 A;  4O3B A;  1NNK A;  4R6Y A;  3M3F A;  4NQ8 A;  2CZL A;  3GZG A;  1Y1Z A;  2HXW A;  4YB5 A;  3SZP A;  1BKA A;  4QXD A;  5IZ3 B;  2CEY A;  5F24 A;  3FJG A;  3T9U A;  1FBH A;  2PX1 A;  3G3K A;  3LSX A;  4NN3 A;  5TU0 A;  2V3T A;  3BIH A;  4OYV A;  3JV9 A;  1N76 A;  3VDF A;  3ZKL A;  3CIJ A;  4UA8 A;  2H98 A;  2HXR A;  2O51 A;  5J16 A;  1MQI A;  4PFU A;  3RLF E;  4XTC Q;  3R7X A;  2AYS A;  3O6H A;  2XXH A;  2H99 A;  3TCG A;  5J1D A;  3B7D A;  3DLN A;  4OEN A;  4NWD A;  1FPD A;  3H6U A;  4TLM B;  4MF3 A;  2FA7 A;  1MQH A;  2B4M A;  2Y84 A;  3MVX A;  3PPQ A;  2Q8M A;  2WKY A;  3TAJ A;  4I8C A;  1DCU A;  3TTM A;  5KDT A;  1QVS A;  5H8Q A;  4H5G A;  4K3F A;  1Z7N E;  4YB7 A;  5TP9 B;  4GL0 A;  3QSL A;  2HPG A;  1FTA A;  4U4S A;  4EQ9 A;  1OQH A;  2O7I A;  3HST A;  4MBP A;  3PPN A;  3I5O A;  4N4U A;  2FIX A;  1IUD A;  1LBY A;  5A5X A;  1MXX A;  1XVY A;  2BJI A;  2KLF A;  3N26 A;  2GH9 A;  3KFM A;  3G3J A;  1N7X A;  2UXA A;  1B40 A;  4QFP A;  1SQY A;  4MX6 A;  4X8R A;  3ONM A;  2UYF A;  1EH3 A;  1NV1 A;  4DI4 B;  4N07 A;  4OFL A;  2JJK A;  1DBZ A;  3K1N A;  4EXL A;  4YB6 A;  3PMX A;  2DWA A;  4N17 A;  1RDX A;  1H45 A;  4H65 A;  3Q26 A;  4DE8 A;  3OEL A;  3OSR A;  3A09 A;  5DVJ A;  1N7W A;  3IO6 A;  2I4C A;  3IOR A;  4RXL A;  3TMG A;  1FPI A;  4HW8 A;  1MM6 A;  2DE2 A;  4PP0 A;  2OZZ A;  1IZ1 A;  2RC7 A;  4O8M A;  4X04 A;  3O2A A;  3T93 B;  4F1U A;  1A99 A;  3RN8 A;  3VXC A;  3BFT A;  4NF5 A;  1FQB A;  2M8C A;  1Y3Q A;  1BP5 A;  2IA4 A;  2ZYK A;  4PFB A;  1B05 A;  1A40 A;  3OO8 A;  3HHG A;  5I2K A;  4X1D A;  4MJO A;  5IKB A;  4YMA A;  4LP2 B;  4PFT A;  1FJ9 A;  1LAX A;  3U94 A;  4PGN A;  3RTF B;  3PPO A;  3TYH A;  1LGB C;  1FBD A;  3I3V A;  3ROJ A;  2XHD A;  3B6Q A;  4G8H A;  2RCB A;  3FAT A;  3UN6 A;  1PEB A;  3UP9 A;  4F3G A;  3H6W A;  4JWX A;  4PAI A;  2ONK E;  4R6K A;  2OWT A;  3CFZ A;  1SDX A;  4EXK A;  4RNS A;  3CVG A;  3BBR A;  4QRZ A;  4RA1 A;  3PUW E;  5TPA A;  3SDF A;  1Y1M A;  4MAG A;  2DXY A;  4YKP A;  4NF6 A;  3USD A;  1IMD A;  3VVD A;  1MPD A;  1ZBM A;  1BLF A;  3MZ9 A;  3GBA A;  2B3B A;  4R72 A;  1MS7 A;  4N91 A;  4TOZ A;  5DEX B;  1HSL A;  5FTH A;  3K00 A;  2QJE A;  4JVI A;  2Q2A A;  2BJJ X;  4MNC A;  2UVH A;  5JTY A;  3OEK A;  2OWS A;  2H4I A;  4BDL A;  1F9B A;  4P9K A;  4IR8 A;  1TT1 A;  3FVG A;  4MNI A;  5LTC A;  1BTJ A;  2FBP A;  3RPW A;  1I6A A;  4OXV A;  5AE4 A;  5ITO A;  2DDK A;  1R6Z A;  3K0V A;  4Z0I A;  3HO7 A;  3UA8 A;  2DQV A;  4G68 B;  1LFH A;  1MQG A;  5H8N A;  2O1M A;  4GWO A;  2Z22 A;  3NOH A;  3H6T A;  4JDF A;  4H5F A;  4OAN A;  3U65 A;  3M8U A;  3W9V A;  2I0B A;  5I7I A;  2WBB A;  1LB8 A;  2XXW A;  4F3B A;  4PC9 A;  3KOT A;  4IO2 A;  2XXT A;  5JEI A;  4BDQ A;  3HV1 A;  5AA1 A;  3VVF A;  1FBC A;  4M4G A;  3TOD A;  1LLS A;  2XA5 A;  1Y4C A;  2QS4 A;  4PET A;  3TZA A;  4HE0 A;  1LCT A;  1FBG A;  3IR1 A;  2ANJ A;  1J1N A;  4QBA A;  3SEW A;  2XXR A;  4H1X A;  1OVB A;  1MPB A;  3FVO A;  3BFU A;  3TTN A;  2GHA A;  4DI3 D;  1B2H A;  2A5S A;  1GTK A;  4LA9 A;  3C33 A;  3PV0 E;  2OK2 A;  5F7V A;  3A29 A;  2Y5K A;  4EDP A;  3IO4 A;  4UAB A;  3G3H A;  2ZYO A;  4JXI A;  3TTL A;  3L6H A;  4YMB A;  1PDA A;  3F11 A;  4MH5 A;  3RPL A;  3ZSF A;  2XX8 A;  4LZ5 A;  4ELQ A;  1PBP A;  3PMW A;  1B3G A;  5EHM A;  4P56 A;  2RC8 A;  3G3G A;  4POX A;  4NWC A;  1QUL A;  4OHN A;  2XXK A;  4FAT A;  3S2V A;  4OVP A;  4R6H A;  3MP8 A;  4WKM A;  5H8F B;  3FXQ A;  3M3K A;  1D3K A;  1Y3N A;  2B4L A;  1NV5 A;  1LST A;  1B3E A;  3K01 A;  4GWU A;  3TDJ A;  3SEV A;  2ONR A;  3PU5 A;  1CE2 A;  4ESX A;  4H6D A;  4YKK A;  3SER A;  2QL3 A;  4DXU A;  2PT1 A;  1B1H A;  3QK6 A;  4GIZ A;  2I48 A;  4XKQ A;  3Q28 A;  2R6G E;  1XI6 A;  3N6T A;  3KBR A;  4KQP A;  3MVZ A;  2F3D A;  2QMX A;  2ZZX A;  2RCA A;  2V84 A;  2A5T A;  2XXX A;  3D4G A;  1FTK A;  1P1O A;  2ZNT A;  2XX9 A;  1KA0 A;  2G29 A;  3QMF A;  3BIG A;  1T0K A;  3PD8 A;  4FE8 A;  2ZYN A;  3H7M A;  3VE1 B;  1JNF A;  5ELV A;  1B0H A;  1B4Z A;  1B1X A;  3QUJ A;  1DMB A;  1TFA A;  2HEU A;  2ZZV A;  1B3F A;  1SYH A;  4H46 A;  1FBE A;  2HFB A;  2DXR A;  4ELO A;  4RPN A;  3U72 A;  4YKI A;  1IME A;  4IO6 A;  5ET8 A;  3EQ1 A;  5CBR A;  3S9N C;  5DVI A;  3DEL B;  1I6Q A;  5IGA A;  3K6X A;  1ELJ A;  1B52 A;  2AL5 A;  1R9L A;  3O6I A;  1UIV A;  3IOT A;  3WAE A;  4KYD A;  3MPK A;  1Y9U A;  3O28 A;  5B7D A;  1G0H A;  5H8H A;  2WYP A;  2I3V A;  3T66 A;  4ZED A;  1NV2 A;  2F35 A;  5DYH A;  4NG7 A;  2I49 A;  1MY0 A;  3KN3 A;  5FBP A;  1AL3 A;  1FQA A;  3THI A;  3A3C A;  1KA1 A;  1VFD A;  2FNC A;  1SPI A;  4I62 A;  3B8B A;  4QFK A;  5EQ8 A;  4R9F A;  5KDT B;  5H8Q B;  3U92 A;  3LUY A;  3PUX E;  4ELR A;  2DOJ A;  1WVJ A;  3TKD A;  1IXH A;  2UYE A;  4MLV A;  4U2R A;  4QFN A;  3KN7 A;  4MNP A;  2DSF A;  1NV0 A;  3IFC A;  4JWY A;  2XX7 A;  2R9J A;  2NUV A;  2XWI A;  3B50 A;  1H44 A;  3E79 A;  5KZT A;  1P1Q A;  3TQL A;  1URD A;  4H0W A;  5A5X B;  4I1D A;  4R2F A;  3PMV A;  3KSJ A;  1M5B A;  4BLA A;  2Y7I A;  4O3C A;  4ONY A;  1R9Q A;  1NV4 A;  2CZI A;  1FPE A;  3O97 A;  3LC8 A;  4F29 A;  4P11 A;  4O3A A;  1MXY A;  4POW A;  1KZ8 A;  4GRK A;  3N5L A;  3QIM A;  5BUU A;  2I6E A;  4PAK A;  2DYX A;  5ET5 A;  1P1U A;  4PAF A;  3MQ9 A;  3MVY A;  1JW5 A;  1SW5 A;  1DPP A;  4QSC A;  3C36 A;  2ZNS A;  2THI A;  1G0I A;  2DS9 A;  3FV1 A;  3V89 B;  4BDN A;  2Z8E A;  2X7Q A;  1UQW A;  3FXR A;  3FUZ A;  3RY3 A;  4YU0 A;  4PE3 A;  4IGR A;  2Q8J A;  4GFR A;  1NUY A;  5AA2 D;  1MQJ A;  3IB2 A;  4NF5 B;  4NF8 A;  1JEV A;  1A55 A;  3L6G A;  4Q0C A;  3EF7 A;  4F3P A;  1M5E A;  2XD3 A;  5FHO A;  3KZG A;  1XHY A;  1OLC A;  5I2K B;  4YAH X;  3KEI A;  4ECF A;  5I3S A;  2HAV A;  4ESW A;  2DE3 A;  5AA4 A;  3FVK A;  3MW0 A;  2AL4 A;  4RK9 A;  4EQB A;  1OVT A;  2CZK A;  4GXA A;  4N6P A;  4QSE A;  1RKM A;  4LQ2 A;  1FBP A;  1NV3 A;  5DVF A;  4DDD A;  4AS4 A;  1A8F A;  1SI0 A;  1B7Z A;  2W7Y A;  1NI9 A;  2PMS A;  2Q88 A;  1MXU A;  3FXB A;  1YAE A;  3QXM A;  3OSQ A;  2HCA A;  4F1V A;  5CI5 A;  4PF8 A;  5TPA B;  1NH8 A;  1B4H A;  3LUZ A;  1MG1 A;  4BDR A;  3OEM A;  3PUZ E;  4NF6 B;  4KYS A;  4ZZE A;  4DZ1 A;  2DVC A;  1MY1 A;  3S4U A;  4AQ4 A;  5EQA A;  2FVZ A;  1CNQ A;  1B3L A;  5I5P A;  1MPC A;  4Q5T A;  4ZEK A;  4JWO A;  1LBC A;  5I58 A;  1LBZ A;  4GX6 A;  1A8E A;  5JTY B;  1QKA A;  4GWY A;  4IO7 A;  5IZ1 A;  4G8N A;  3K1P A;  3SEY A;  4F22 A;  2V3Q A;  1HSE A;  2RC9 A;  3N94 A;  2FYI A;  2G93 A;  1JW1 A;  2F7A A;  3H3G A;  4FEB A;  3CI8 A;  2H9B A;  2F97 A;  1JET A;  4N6K A;  2OCU A;  4GL8 A;  5LOM A;  3C34 A;  4MHF A;  4HTG A;  4E0X A;  1IEJ A;  3O66 A;  3UGW A;  3K4U A;  4NED A;  3OO7 A;  5H8N B;  1INP A;  2F36 A;  2DWH A;  2Q2C A;  4F39 A;  4OEV A;  3RUM A;  4C1T A;  3C4M A;  4Z7E A;  4IO5 A;  4P47 A;  4PGP A;  1B3H A;  1ZLQ A;  1IMA A;  3IJO B;  3A3U A;  3ISP A;  4XF5 A;  1NUW A;  4DXC A;  4R9G A;  3K1M A;  4XFE A;  2ONS A;  1LFI A;  4RY1 A;  1LAH E;  4F3S A;  4OVS A;  4PF6 A;  3W9W A;  3T0J A;  2Y7P A;  4IGT A;  4XEQ A;  4AB6 A;  1FPK A;  3S9M C;  3KSX A;  1GVC A;  1K9Y A;  4IO4 A;  4ZEF A;  3QAX A;  5I57 A;  4G61 A;  3SEX A;  1QUI A;  3DP8 A;  4H67 A;  2B65 A;  3SES A;  3MP1 A;  4GWS A;  4FBP A;  4KFQ A;  4FAJ A;  1SW4 A;  1MXV A;  3V8X B;  5EYH A;  2KR0 A;  1AOV A;  3UK4 A;  3RPL B;  1MH3 A;  1QGX A;  3FD3 A;  5FHM A;  2UVJ A;  3VLU A;  2PCR A;  3H03 A;  2XXU A;  2ALU A;  3U1O A;  2DE4 A;  2VGQ A;  3Q27 A;  1P1N A;  1ZJL A;  1AH5 A;  5ESY A;  5FTI A;  3PGF A;  4H8J A;  1S50 A;  2RIN A;  4KCD A;  2O84 X;  1II5 A;  3B6W A;  4PTK A;  3KJ7 A;  4OET A;  1SI1 A;  5K2X A;  3O29 A;  1JVX A;  1SD3 A;  1LAF E;  3ZKK A;  3RT8 A;  5ICQ A;  2HZK A;  1URS A;  5KCJ A;  1EYK A;  4X1B A;  2YJP A;  2YPN A;  3CG1 A;  3ZS6 A;  1NMU A;  1O64 A;  4N6D A;  4XKN A;  3IOU A;  3H06 B;  3AXF A;  3OD7 A;  4LZ7 A;  4LON B;  2QVR A;  5DW8 A;  2O6A A;  2P3N A;  4OMB A;  3T9H B;  4P3L A;  4OES A;  4U4X A;  1LBB A;  1D9Q A;  2WEF A;  5EQ9 A;  4HCY A;  2XWV A;  1XVX A;  1OLA A;  1UTB A;  2A5T B;  4QFO A;  3IOV A;  3EN3 A;  4I40 A;  4G4P A;  2X26 A;  1FPB A;  1UTH A;  4FIM A;  3H6V A;  1N84 A; 
#chains in the Genus database with same CATH homology
 1NV2 A;  1NV1 A;  4DI4 B;  4NG7 A;  1FRP A;  1IMC A;  2JJK A;  1DBZ A;  2WBD A;  5FBP A;  1AWB A;  4F19 A;  1YYZ A;  1JP4 A;  1KA1 A;  1SPI A;  3B8B A;  4N17 A;  3T1B A;  5EQ8 A;  1RDX A;  2CEX A;  1LBX A;  3HFU A;  2QFL A;  4I3E A;  4MNP A;  1NV0 A;  5ET7 A;  3IFC A;  1FPI A;  2XWI A;  3B50 A;  3E79 A;  2VPN A;  2WYK A;  4HXV A;  2DE2 A;  3KBZ A;  5JK4 A;  4PCD A;  4P8B A;  4O8M A;  4X04 A;  1NV7 A;  4GWX A;  4F1U A;  3D1R A;  1NV4 A;  5A5L A;  2CZI A;  4O94 A;  4YIC A;  1FPE A;  2GQ1 A;  4PFB A;  4GBW A;  2CZH A;  1KZ8 A;  1Q9D A;  5IM2 A;  4MCO A;  4X9T A;  4MJO A;  4PAK A;  3CHG A;  5ET5 A;  4P1L A;  4PAF A;  3GYY A;  1LBV A;  1FJ9 A;  1K9Z A;  1VDW A;  4JVC A;  4N15 A;  2KQZ A;  4GWZ A;  4PDD A;  2VPO A;  4PGN A;  1LEV A;  2FHY A;  2QVU A;  4NF0 A;  1FBD A;  1IMF A;  3ROJ A;  1G0I A;  2HHM A;  4MMP A;  4N81 A;  3RYD A;  4OVT A;  4OVQ A;  2Q9T A;  4AS5 A;  4PAI A;  1LBW A;  4PE3 A;  1NUY A;  2PFZ A;  4I3Y A;  3IFA A;  1YZ0 A;  1NV6 A;  4PFI A;  1RDZ A;  4MAG A;  1RDY A;  2HZL A;  4PBH A;  1IMD A;  1EYJ A;  5I3S A;  4GWW A;  2DE3 A;  3MST A;  1YXI A;  4HE2 A;  2CZK A;  4N91 A;  4YZZ A;  4JVI A;  4MNC A;  1FBP A;  1NV3 A;  1FPJ A;  4AS4 A;  4P9K A;  4IR8 A;  4PDH A;  4MNI A;  2F5X A;  5LTC A;  1NI9 A;  5EYG A;  3FXB A;  2PFY A;  2FBP A;  4F1V A;  4PF8 A;  4P1E A;  2DDK A;  1FPG A;  3LUZ A;  2ZZW A;  4PBQ A;  5IZZ A;  3KC0 A;  3NOH A;  5EQA A;  4OA4 A;  5LDZ A;  2FVZ A;  2OX3 A;  4OAN A;  3U65 A;  1CNQ A;  2FIE A;  3W9V A;  5EQ7 A;  4NGU A;  5I5P A;  5I7I A;  2WBB A;  4PC9 A;  2L5V A;  2QVV A;  1LBZ A;  1FPL A;  4GX6 A;  4GWY A;  4NX1 A;  3E78 A;  2XWO A;  1FBC A;  2R8T A;  2XA5 A;  4H45 A;  1FPF A;  1FSA A;  4PET A;  4MEV A;  5IZ1 A;  4HE0 A;  1FBF A;  1FBG A;  2V3Q A;  4N8G A;  4QBA A;  1BK4 A;  2Y5L A;  4N6K A;  4GX3 A;  4JVD A;  5CM6 A;  5IZ3 A;  4MHF A;  4DI3 D;  2P3V A;  1INP A;  3PTY A;  4M1V A;  3A29 A;  2Y5K A;  4UAB A;  4P47 A;  4PGP A;  2V4C A;  1IMA A;  3RPL A;  4NHB A;  2DVZ A;  3MYU A;  4O7M A;  3ISP A;  4OVR A;  4XF5 A;  1NUW A;  4P56 A;  4LN5 A;  4O7I A;  4N8Y A;  1NUZ A;  1DK4 A;  4F18 A;  4XFE A;  2XXK A;  3KC1 A;  2XWK A;  4OVS A;  4PF6 A;  4OVP A;  3W9W A;  3T0J A;  5T3J A;  4XEQ A;  1FPK A;  1FJ6 A;  4NQ8 A;  4PFR A;  1EYI A;  3SZP A;  4QXD A;  1K9Y A;  5IZ3 B;  2CEY A;  5F24 A;  2WX9 A;  2B4L A;  1NV5 A;  4GWU A;  4GX4 A;  5ET6 A;  4G61 A;  4NN3 A;  1FBH A;  3BIH A;  3LV0 A;  3EKI A;  4GWS A;  4FBP A;  2MKZ A;  4HE1 A;  5EYH A;  1NUX A;  2KR0 A;  2Q74 A;  1XI6 A;  3RPL B;  1QGX A;  2HXR A;  3FBP A;  2PCR A;  5J16 A;  2F3D A;  2DE4 A;  2ZZX A;  2QPQ A;  5ESY A;  4KXP A;  5J1D A;  4HCW A;  1KA0 A;  3QMF A;  3BIG A;  4NAP A;  1FPD A;  1IMB A;  4PTK A;  2B4M A;  2Q8M A;  2ZZV A;  4H46 A;  1FBE A;  1DCU A;  2HZK A;  1EYK A;  1IME A;  5ET8 A;  2HPG A;  2F3B A;  1FTA A;  4MIJ A;  4N6D A;  5IGA A;  2QVR A;  5DW8 A;  2P3N A;  4P3L A;  1D9Q A;  2WEF A;  4N4U A;  5EQ9 A;  4HCY A;  2FIX A;  2XWV A;  1LBY A;  2OWZ A;  2BJI A;  2VT5 A;  4I40 A;  1FPB A;  1G0H A;  2WYP A;  4GBV A;  4MX6 A;  4X8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...