2PFZA

Crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
TKWDLPTAYPASNLHVENLTQFVKDVDSLSGGKLKITLHNNASLYKAPEIKRAVQGNQAQIGEILLTNFANEDPVYELDGLPFLATGYDASFKLYQAQKPFLEKKLASQGMMLLYSVAWPPQGIFANRDIKQVSDMKGLKWRAYSPVTAKIAELVGAQPVTVQQAELAQAMATGVIDSYMSSGSTGFDTKTYEYIKKFYDTEAWLPKNAVLVNKKAFDALDPATQQALKKAGAQAEERGWKLSQEKNSWYKEQLAKNGMAIIAPTAELKSGLTEVGKRMLDDWLKKAGADGQAMIDAYRKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Putative exported protein
publication title Crystal Structures of two Bordetella pertussis Periplasmic Receptors Contribute to Defining a Novel Pyroglutamic Acid Binding DctP Subfamily.
pubmed doi rcsb
source organism Bordetella pertussis tohama i
total genus 113
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2pfzA00
4N6KA 4NHBA 3B50A 2PFZA 2WX9A 4PDHA 4NQ8A 4MNPA 4PETA 4PAFA 4X04A 2VPOA 4NN3A 2PFYA 4PCDA 4DI3D 4MEVA 2XA5A 4OA4A 4NAPA 2ZZVA 3FXBA 4MCOA 2HZLA 5IZZA 4PBQA 4P3LA 4PDDA 4N17A 4PFIA 4MNCA 4N8YA 4PGNA 4P1LA 4P56A 4NX1A 5IM2A 4PAKA 4OVRA 5I7IA 4N4UA 4N6DA 4NF0A 4UABA 4MMPA 4PFRA 4O94A 2V4CA 4OVSA 2XWVA 4PF6A 2XXKA 4LN5A 2WYPA 4MNIA 5LTCA 4PGPA 4P8BA 3GYYA 2XWOA 4MAGA 4P1EA 4PC9A 4PF8A 2VPNA 4XEQA 4YZZA 5I5PA 4P9KA 4MHFA 4N15A 4NGUA 2ZZWA 2CEYA 4PE3A 4O7MA 2ZZXA 3U65A 2XWIA 5CM6A 4NG7A 4OVQA 2XWKA 4PAIA 4N91A 4MX6A 4XFEA 4O8MA 4OVPA 4PBHA 4P47A 2HZKA 2HPGA 4X8RA 4MIJA 4XF5A 4YICA 2CEXA 4DI4B 4N8GA 5IGAA 4PFBA 4OVTA 2WYKA 4OANA
chains in the Genus database with same CATH superfamily
1DMBA 4KFQA 5HPQA 3CHGA 1NH7A 3B50A 3FXQA 4DXBA 4LZ5A 4F39A 3W9WA 2FIXA 2Y5LA 1A40A 2ZYMA 3IOUA 3AXFA 3HHGA 3T9VA 1D9VA 1H44A 3H6WA 2FA7A 1ZBMA 5IZ3A 2UXAA 2I3WA 1B3GA 3ONMA 4GD5A 4LA9A 1FPBA 1QUIA 5EQ7A 4F2QA 2QSXA 4TLLB 4N6DA 1B52A 3UN6A 3G3JA 1LBYA 2F6PA 4K3FA 1D3KA 4LN5A 4Q0CA 5ELVA 1B5IA 1Q1KA 2REJA 4F2OA 4N15A 3C4MA 1G0IA 4YKKA 1FPFA 4I8CA 4M1VA 1FBGA 1US5A 4G68A 1LB9A 2E0SA 4R72A 4ZE8A 4F31B 3ZKKA 4OVPA 3N6UA 3MVWA 1FJ9A 2A5SA 4MLQA 3IOVA 2GHAA 2PX1A 3FZVA 4R9FA 5IGAA 3MZ9A 2Q8JA 3TAJA 2WEFA 2QVRA 4G77A 3IJXB 1YYZA 2W7YA 3HO7A 1NUWA 1NMUA 4GQOA 2PFYA 4DIGA 1B7UA 2O1LA 4GLIA 1OQHA 3TTRA 2VOZA 1MM7A 3L6HA 2Y84A 4HE0A 1A54A 5EYFA 3TDJA 2Y7IA 2B65A 5J1DA 3D4CA 2YLNA 3PUZE 1FRPA 2DVZA 1B3LA 5I7IA 3MZ1A 4NE4A 1FBCA 1MY0A 3CR9A 4U22A 3RGYA 3MW0A 3KSXA 4WEDA 4BDRA 4G8MA 3MC2A 4NF6B 1LBBA 4YB6A 3MPLA 4KD5A 1BKAA 1B1HA 1JW1A 4QFLA 4PC9A 4F3PA 5DVIA 3SDFA 4G68B 2VD2A 3LC8A 4QF9A 4BDOA 5LOMA 1EZOA 1BTJA 1SPIA 3S4UA 3TZAA 2OX3A 4O3CA 1B3FA 3KSJA 3DLNA 4MX6A 2JJKA 1B1XA 4GFRA 4RPOA 1FTOA 3A29A 2CZIA 1SI1A 1WODA 3FGSA 3B6TA 4PFBA 4KHZE 5FHOA 2RC9A 4N6KA 4ELPA 1I6QA 4PDHA 1B4ZA 3LR1A 1FQBA 3LSWA 4NTLA 3VVFA 3BIGA 2KLFA 2DWIA 1IQ7A 4R2BA 1FW0A 5EYHA 2ZZVA 1DTZA 1USYE 2I0CA 3QK6A 3I3VA 5DYHA 3BFUA 3C9HA 1FTLA 5FHMA 5AA2D 1FQAA 5BWJA 3KC0A 1JW4A 4NX1A 1J1NA 2OCUA 3VE1B 5I2KA 1IMFA 1MPBA 4GXAA 1Q35A 4HE2A 1XC1A 4NF0A 4UABA 4ELOA 2GQ1A 4FATA 3T9HB 1FTKA 4MMPA 4PFRA 1MRPA 4JWYA 4OTEA 3LSFB 2XXKA 4GWXA 4Q30B 3A3UA 3O6IA 3TCHA 5ICQA 3C35A 4HXVA 1FBHA 4MBPA 1ANFA 1DPEA 2XHDA 4ESWA 2NOOA 1Y4TA 2IEEA 2CZKA 5JTYA 3DELB 2F36A 2F78A 4RA1A 1LAHE 1AH5A 4I40A 2XWIA 4QFNA 1FPGA 2DYXA 4G8HA 3VLWA 3LUYA 2RC7A 3PPPA 3ZS6A 2GH9A 3N26A 4NF5A 4XKPA 3ILUB 2L5VA 1POY1 3V83A 1HSJA 1MM6A 4GBWA 2X7PA 1NL5A 1LFIA 4KYDA 4F3SA 1NKXA 4EF1A 2QS3A 1Z7ME 2XXPA 3MP6A 4LQ2A 4R6HA 2Q88A 3OOAA 3KOSA 1MXXA 2M8CA 3O97A 2P1SA 3FVNA 3OENA 5KDTB 1Y1ZA 3OSQA 3W15C 4KCDA 1JEUA 1YZ0A 4HS7A 4N17A 1YAEA 4I62A 1EZPA 5TPAB 2RF1A 2XXYA 4XTCQ 2MKZA 2O7IA 1B32A 3FASA 4PAKA 4OVRA 1H45A 4KR5A 3M3LA 4TLMB 2VT5A 5F24A 1IXCA 4GF8A 4F29A 2WYPA 4QFOA 3PD9A 3TUSA 3GYYA 4R73A 2RKMA 1DK4A 1FPLA 1SDXA 2DE3A 2Q89A 2Z8EA 4ZEIA 2VP1A 4R9GA 1MXZA 4U1ZA 5TP9A 4GWOA 3UGWA 3OEKA 4KQPA 1R6ZA 3BFTA 4GX6A 1B5JA 1B2HA 3VXBA 2PBWA 4XFEA 3PMWA 4RJZA 4F3GA 2I0BA 1VDWA 3SEXA 1JVYA 1VFDA 3OELA 1P99A 2HZKA 3EN3A 4FAJA 1MQIA 4H8IA 2QS2A 1D9QA 4H8JA 2XWVA 1PB9A 1N84A 3KOTA 5EYGA 4NHBA 1CE2A 2Z8DA 2WX9A 1JQFA 4R74A 5ESYA 5H8QA 1IXHA 3LSLA 2UVIA 3HFUA 1MQJA 4QSCA 1B5HA 1LAFE 1FJ6A 3P7IA 3PU5A 1MY1A 2O7UA 1A55A 5ICTA 2A5TA 4DI3D 4I1DA 2HCAA 1USYH 2NWJA 5J16A 3A3CA 1FTJA 2BJIA 4IO4A 1A99A 5IKBA 1SVXB 2DQVA 4PGNA 3QIMA 4OFOA 2O6AA 4GL0A 1DTGA 3MAMA 5L9MA 1LBWA 3PPRA 1MDP1 3PGFA 1JETA 3B6WA 1GTKA 4NWDA 2CZLA 2DWAA 2ZMBA 4POWA 3PPOA 5AA3A 2P3NA 4G4PA 1HSEA 3H6UA 5I2NB 4OVSA 3PUXE 2ONRA 5AE4A 2DXRA 4GOTA 1SQYA 1XT8A 3VV5A 4XIGQ 5DEXB 1Y3NA 4NMYA 5H8NA 3CFXA 3K01A 4KYSA 2XXRA 2PYYA 3E79A 3TTNA 3H6VA 1FPEA 4N81A 3D1RA 4OEUA 4QXDA 2H98A 2CZHA 1JP4A 3N94A 2NUVA 4WKMA 1RYXA 3TPAA 4R75A 4JWXA 3B8BA 3KFMA 1PBQA 4I3EA 1K9ZA 4FEDA 4X48A 3QYTA 3SERA 5HBCA 2I48A 3USDA 2XXHA 2A5TB 1LBZA 5ET8A 2PFZA 2REGA 3GBBA 1P1QA 4GVOA 3PUWE 5FTIA 4YKJA 4FBPA 1IMAA 2HFBA 4H6DA 3BKIB 3GXAA 4WXJA 2PT2A 3IOTA 2FIEA 4IO7A 4F19A 4Q5TA 3PPNA 3T0JA 5CRYA 4JDFA 3RYDA 1NNPA 3IAZA 2FYIA 3K02A 1JNFA 3ILTB 3THIA 2XX8A 5H8NB 3GZGA 4O94A 4XKRA 4ISUA 3M8UA 3MBPA 3MYUA 4DLDA 3TMGA 1FQFA 2F7AA 1EYKA 3IB0A 2B4MA 2D3IA 4ZEKA 4OZ9A 4E0WA 1FPDA 4PE3A 2V84A 2I58A 3S9EA 1OLAA 5CM6A 2R8TA 4NG7A 5EQAA 2DP8A 1IMCA 1IMBA 1Y3QA 3TYHA 4P0GA 1MQGA 2I4CA 4YMAA 4H5FA 3FVOA 3IFAA 3K4UA 4YICA 2CEXA 2FBPA 3PV0E 4NF6A 3H06B 4EF2A 3QUFA 3TEPA 1NNTA 1P1OA 3CFLA 4O3AA 2UVGA 4NF4B 1ZKBA 4IO5A 4F22A 3I6VA 3DP4A 1LFHA 3K6XA 4IGRA 2R6GE 1MXYA 1URGA 1URDA 2DE4A 2R71A 3KBZA 4PCDA 1DPPA 3HN0A 4RXLA 2F8DA 4PQJA 3FATA 1DOTA 1N3WA 2ZNSA 2ESNA 1N04A 3D4GA 1Y3PA 5I84A 1NUZA 3W9VA 1SD3A 5IZZA 4PBQA 1P1NA 5I56B 2Q2AA 2WBDA 4TQUQ 2PMSA 4U4SA 3K1NA 4ECFA 3O29A 3H6TA 1R1NA 1NV7A 3JYRA 1OQGA 1OVBA 2DDKA 3Q28A 2X7QA 3KZGA 4OEVA 1QW0A 1IUDA 3VLUA 1QUJA 1IIWA 2ABHA 2BJJX 1T0KA 3KG2A 4MAGA 3KGCA 2WBBA 1Z7NE 1F9BA 3G3GA 3KJ7A 2HHMA 4LVQA 3EHSA 2HXRA 3E4RA 2H9BA 3PUYE 2VGQA 3QMFA 1A8EA 3FXUA 2XD2A 1QGXA 4H46A 4OESA 1RDYA 2VD3A 3KC1A 3CI8A 1VR5A 3OO8A 4OETA 1OIBA 4NF8A 3S9LC 3RLFE 2Q2CA 3EF7A 4MCOA 2QVVA 4U23A 4O3BA 4R6KA 2I49A 2ZNTA 1CB6A 3JV9A 4QRZA 2XXWA 1YTVA 3QUJA 4PP0A 3PMVA 1NV1A 4P56A 1BIYA 1M5FA 4PTKA 2ZXTA 4IY5A 1IZ1A 3IO6A 5F1QA 1UTBA 3U93A 2DOJA 3HV1A 3TTMA 1FTMA 2B3BA 4LUBA 2G93A 3IR1A 5ITOA 5KCJB 2V4CA 3RT6B 3G3KA 1XS5A 1IXGA 4ONYA 3KN3A 4C0RA 4R2FA 3C32A 1LAXA 2XWOA 4P1EA 3CIJA 5KZTA 5KDTA 1NV4A 3UK4A 2ZZWA 1ATGA 2O1MA 2V93A 5TPAA 3FBPA 1Y9UA 3EHUA 3T22A 3FUZA 4EUOA 4PFTA 3N5LA 3VFJA 2PT1A 1FCKA 3Q27A 4ZEFA 3UA8A 3IO4A 3K6UA 3T96B 4FJPA 4G2ZA 2GFEA 4F18A 3T9UA 4NF8B 4BLAA 1B0HA 3RUMA 4HE1A 3V5AA 2ONKE 3FJGA 3MUQA 1NV2A 1AMFA 4P0IA 3KN8A 5BUUA 4NQ8A 5CI5A 1RKMA 1S7YA 5ET5A 2V25A 2VPOA 4THIA 2ZYNA 2FVZA 2XX9A 4DDDA 4KYEA 1B7ZA 1UTHB 3SESA 1SBPA 4ZDMA 2UVJA 2Y7KA 1UTBB 4BDNA 2HAVA 4L17A 2UYEA 3M3KA 4JSOA 4P1LA 3MVYA 3UORA 1GGGA 3SEVA 2F34A 1IITA 1NI9A 1B05A 1LSTA 3LUZA 3G3HA 3BBRA 3CFZA 1B46A 1PB7A 4GWSA 3FVGA 4YZZA 5F7VA 3MWBA 3QXMA 2UVHA 5CC2A 1FBEA 4IR8A 1FBDA 4IO2A 1HSLA 3O9PA 1KWHA 3ODBA 1FPJA 2LAOA 4FIMA 3SKPA 3CG1A 2Q74A 4GL8A 2OJTA 4O8MA 5IAIA 1S9TA 3VVEA 2O68A 4X8RA 2YJPA 3RTWB 5I2NA 1QKAA 1JW5A 3K2DA 3RY3A 3VDFA 4OFJA 2DVCA 2WYKA 2H4IA 5DEXA 4H0WA 2DSFA 2V3QA 2XXVA 2FHYA 1FPKA 4OERA 3VVDA 1NNFA 4U21A 4X9TA 4H5GA 4NN3A 4QBAA 4OVJA 4OA4A 5ITPA 1ZMGA 1R9QA 4OFLA 4DXCA 3PPQA 1QVSA 5FHNA 1I6AA 1WDNA 2P2AA 4LATA 4QSDA 1B9JA 4AB6A 3VLVA 5DW8A 4FORA 4C1UA 3HHFA 5FTHA 1M5EA 1UIVA 1ZIUA 4MNIA 1URSA 5TU0A 4YKPA 4H65A 4ZECA 1NV5A 2Q9TA 3C36A 5H8SA 4PF8A 1UIUA 4XEQA 3U8QA 4ZZAA 3TCGA 2AYSA 4I3YA 1MPDA 2Y7RA 2NXOA 2DE2A 4HCWA 2RC8A 4TOZA 1MXWA 4MJOA 1POTA 1IMEA 3KN7A 4Z7EA 4AS5A 3HSTA 1LBCA 5EQ8A 3T93B 2X26A 4MLVA 4X1BA 3CSBA 3DP8A 2Y5KA 4PBHA 4P47A 1NV6A 5DVFA 5I58B 5EHMA 4JVIA 4N8GA 4OYVA 3N6TA 2XXIA 5AA2B 1NFTA 3E9XA 3IB2A 3O6HA 4JSDA 3CG3A 1MXVA 3ROJA 1OVTA 3ISPA 1N3XA 2Q8MA 2GHBA 2QPQA 4LZ8A 1LB8A 2I3VA 3PUVE 3TELA 3K00A 2F7CA 1MPCA 4F3BA 2OWZA 1SW4A 1AOVA 5CMCA 1N7XA 1US4A 2Z22A 1QUKA 1PEBA 3R26A 3TODA 2AL4A 2CMOA 3RT8A 3KBRA 4XKQA 2XXXA 2OLBA 5AA4B 4NF4A 1NNKA 1FBFA 4HW8A 1MH4A 1Q9DA 4EXLA 2B3FA 3RN8A 4P11A 4X1DA 5K2YA 1XVXA 2QL3A 4YAHX 1BK4A 2OWTA 4FEBA 2OK2A 4GXSB 1NH8A 3CSGA 4P9KA 4MHFA 4WEPA 3CVGA 1FQDA 3SZPA 5I56A 1FTAA 2QVUA 2CEYA 4BDLA 1IMDA 1O7TA 4PAIA 4GWZA 4LQ5A 1FBPA 4JBZA 4N91A 4DE8A 1B3EA 4HTGA 5H8HB 4GWWA 1LFGA 2R9JA 1MH3A 3NOHA 4ELRA 4XF5A 3FV2A 3IORA 3RPLA 2OWSA 1NUXA 4U1OA 2XD3A 5L9SA 4IO6A 3IFCA 3G7WA 4QFPA 4ZEBA 3HCQA 1FQCA 2QMWA 1B7HA 1G0HA 1II5A 2RCBA 1KZ8A 5HM4B 1ELJA 2AL5A 3C34A 4OXVA 2FNCA 3I5OA 4G68C 2Y7PA 3OEMA 4ZZEA 5H8FB 4YB7A 5IM2A 2IA4A 3T9XB 4FECA 2XXUA 3MSTA 3G3IA 2QS1A 4DCYA 3A09A 2Z8FA 3RNNA 5LDZA 1LAGE 2F7BA 1O64A 1WVJA 1IXIA 2PCRA 2QFLA 5AA1A 1NUYA 4C1TA 1EYJA 1B0LA 1PDAA 3PTYA 3K6VA 3MVZA 4ESXA 3QSLA 2OZZA 1FPIA 3O66A 2H99A 3Q29A 3TTKA 3U92A 3WAEA 2H5YA 2ZNUA 1TFAA 1SW5A 3RPLB 1EU8A 5IZ3B 1AIVA 3T66A 4PFWA 5KCJA 1Y1MA 5ET7A 1QKBA 1LGBC 3TTLA 3WAFA 1DBZA 2F3BA 2VHAA 1GR2A 2UYFA 2Y7WA 1BLFA 4KPTA 3IJOB 1YXIA 4MNPA 4DZ1A 4PAFA 1GVCA 1GV8A 1EZ9A 2DXYA 4O7IA 4IB2A 2QMXA 3SEUA 3K1MA 4Q8RA 4MEVA 2XA5A 4GBVA 3O2AA 4NAPA 1VSOA 1S50A 1SYHA 4M4GA 4PFUA 3FXBA 1TFDA 4E0XA 1B3HA 3S2VA 2PVUA 3K0VA 5M2VA 3RQTA 1NV0A 4OQOA 3MZBA 1LEVA 4N8YA 2F3DA 4NWCA 1H76A 4POXA 3ECRA 3F11A 1JVXA 1Y20A 2D5WA 1P1WA 3EQ1A 3FV1A 5ET6A 2DWHA 3FIRA 3E13X 2F35A 5B70A 3OSRA 1ZTYA 1XOCA 4GWYA 1PB8A 4R6YA 2O84X 1I6BA 3TCFA 1UTHA 4YMBA 4JVCA 3LSXA 1XI6A 2DS9A 1D9YA 2D21A 3OMBA 1MY3A 4OWDA 1JEVA 4PE5B 2XWKA 1LLSA 1I69A 3OD7A 3ZSFA 2HQ0A 1INPA 5JK4A 3DM0A 2AIXA 4MF3A 3C31A 3E3KA 3ZKLA 3MQ9A 3T1BA 2Z23A 5CMMA 3MJNA 3K6WA 1R9LA 5I57A 1P1UA 1ZJLA 3EHTA 3CRBA 2I4BA 4OMBA 4AS4A 3IX1A 4LZ7A 4I9DA 1CNQA 4RK9A 4X04A 3Q25A 2I6EA 3H4ZA 3KEIA 1B51A 3U1OA 3VXCA 1KA0A 1H3DA 4MFIA 3FJ7A 3RTFB 5DTBA 2P0SA 3U94A 2XX7A 3MP1A 1TXFA 1Y4CA 3MP8A 3G3FA 2B4LA 3RPWA 1VFEA 1DCUA 4F1YA 2QJEA 4BDQA 5ISUA 3R7XA 2QS4A 3LV0A 4H1XA 4N4UA 4EXKA 4GIZA 3IOWA 4H67A 5CBSA 4EQ7A 2OBGA 4KI0E 1XVYA 4DXUA 1AL3A 5A5XA 5LTCA 2KQZA 2RINA 4P8BA 1A8FA 4G61A 1N76A 3R6UA 1RDXA 5I5PA 4EDPA 4U2RA 4NGUA 1EYIA 3O28A 3Q26A 5EHSA 5A5LA 4IGTA 1TWYA 1TT1A 2KR0A 4EQBA 1B40A 4XXUA 3L6GA 4QHQA 3FVKA 4RPNA 2P3VA 1QJMA 1MQDA 1PBPA 2F6GA 1SYIA 4IY6A 5I57B 4PFYA 3HPIA 4OHNA 1FSAA 3PD8A 4N6PA 5I59A 1SW1A 3PMXA 4BDMA 3TFLA 3SEWA 5K2XA 1H43A 1M5CA 4GX3A 5CBRA 5I2KB 3V89B 4QSEA 3B6QA 1RYOA 4YB5A 3UIFA 1RDZA 2F5XA 1UQWA 4RNSA 5CMKA 1B6HA 2XXQA 3IK6B 2ANJA 4NEDA 3MPKA 3DP6A 3TQLA 4EQ9A 1SI0A 1LBVA 4OENA 4GWUA 5JTYB 4P3LA 4ZE9A 5JEIA 4PFIA 5I58A 3K1PA 1AWBA 2ALUA 1ZU0A 5EQ9A 5AA2A 2QRYA 5A5XB 1DSNA 4UA8A 1ZLQA 3MVXA 4JB7A 1LCTA 1SW2A 4H45A 4F1VA 3GBAA 2O51A 3SETA 4NF5B 2HAUA 4UACA 3LBSA 5DVJA 3SEYA 5FBPA 4PGPA 2V3TA 2NVUB 1FQEA 3C33A 4QFKA 2RCAA 1KA1A 4O7MA 3B7DA 2ZZXA 3U72A 3FJMA 2H25A 2E1SA 4HCYA 3TQWA 5I59B 1BP5A 5DT6A 1M5BA 3O6GA 1MDQA 1XHYA 2ZYOA 5AA4A 4JVDA 3FXRA 5I3SA 3JZJA 4ZS9A 2HPGA 4LP2B 2G29A 4ND9A 5CMBA 4DI4B 3GLBA 1K9YA 4FE8A 4OANA 4RYAA 1QULA 3H3GA 1OMPA 3M3FA 4MH5A 1IEJA 3EPEA 3OO9A 4KXPA 3OO7A 1B58A 4RY1A 4PETA 1N0TA 4IO3A 4DCXA 4YKIA 4F1UA 1MY2A 4XKNA 4ZEDA 4YU0A 1N7WA 1VE4A 5H8HA 4G8NA 1LCFA 2HZLA 3FD3A 2XXTA 3S9NC 1M5DA 3E78A 4GX4A 4PDDA 2ONSA 5L8DA 4MNCA 5TP9B 2THIA 1PC3A 3IL1B 2DWJA 4AQ4A 4N13A 3QAXA 5T3JA 2HEUA 1MQHA 2F97A 3S9MC 1B4HA 3TKDA 3V8XB 4AB5A 3OO6A 4ELQA 1D4NA 1LBXA 3EKIA 4JXIA 4U4XA 5IZ1A 1A7LA 4JWOA 4PF6A 2O69A 1NV3A 3IB1A 1EH3A 1O63A 2ZYKA 2GRVA 1OLCA 2YPNA 1MS7A 1L5TA 4LONB 5L9OA 2VPNA 1MY4A 5B7DA 3H7MA 2WKYA 4Z0IA 3H03A 5H8QB 3KJTA 3U65A 5H8FA 4OVQA 4RK2A 1MG1A 1YPNA 4KCCA 3OXNA 3BIHA 3UP9A 4N07A 2V3UA 4MIJA 1MXUA 2HXWA 4OVTA 4GRKA 1YCJA
chains in the Genus database with same CATH topology
5EYGA 4HE1A 4NHBA 3CHGA 1NV2A 3B50A 2WX9A 5ESYA 3W9WA 1YXIA 4MNPA 4NQ8A 2FIXA 3HFUA 2Y5LA 4PAFA 5ET5A 1FJ6A 4O7IA 2VPOA 4DI3D 4MEVA 2XA5A 2FVZA 4GBVA 5J16A 4NAPA 3FXBA 2BJIA 5IZ3A 1NV0A 1LEVA 1FPBA 4N8YA 4PGNA 2F3DA 4P1LA 5EQ7A 1LBWA 4N6DA 5ET6A 2P3NA 1NI9A 1LBYA 3LUZA 4OVSA 4LN5A 4GWYA 4GWSA 4YZZA 4N15A 4JVCA 1XI6A 1G0IA 3E79A 1FBEA 4IR8A 1FPFA 1FPEA 4N81A 1FBDA 4M1VA 3D1RA 2XWKA 1FBGA 1FPJA 4QXDA 2CZHA 1JP4A 2Q74A 1INPA 4O8MA 5JK4A 4OVPA 1FJ9A 4X8RA 3T1BA 3B8BA 5IGAA 4I3EA 1K9ZA 2WYKA 2WEFA 2QVRA 1YYZA 2V3QA 1LBZA 5ET8A 2FHYA 2PFZA 1FPKA 1NUWA 4AS4A 4X9TA 4FBPA 1IMAA 1CNQA 4X04A 4NN3A 4QBAA 2PFYA 1KA0A 4OA4A 2FIEA 4HE0A 4F19A 3T0JA 5J1DA 2B4LA 1DCUA 1FRPA 3RYDA 2DVZA 3LV0A 5I7IA 4N4UA 5DW8A 1FBCA 4O94A 2XWVA 3MYUA 4MNIA 5LTCA 2KQZA 4P8BA 1NV5A 2Q9TA 4G61A 4PC9A 1EYKA 1RDXA 4PF8A 4XEQA 5I5PA 2B4MA 4NGUA 1EYIA 4I3YA 5A5LA 2KR0A 2DE2A 4HCWA 1FPDA 4PE3A 1SPIA 2OX3A 5CM6A 2R8TA 4NG7A 4MJOA 5EQAA 1IMEA 2P3VA 1IMCA 1IMBA 4AS5A 4MX6A 2JJKA 5EQ8A 2Y5KA 4PBHA 4P47A 3IFAA 1FSAA 1NV6A 3A29A 2CZIA 4YICA 2CEXA 2FBPA 4JVIA 4N8GA 4PFBA 4GX3A 4N6KA 4PDHA 1RDZA 2F5XA 3ROJA 3BIGA 3ISPA 2DE4A 3KBZA 2Q8MA 4PCDA 2QPQA 5EYHA 2ZZVA 1LBVA 1NUZA 3W9VA 2OWZA 5IZZA 4PBQA 4GWUA 4P3LA 2WBDA 4PFIA 1AWBA 3KC0A 4NX1A 5EQ9A 1IMFA 4HE2A 4NF0A 4UABA 1FBFA 4H45A 4F1VA 1NV7A 1Q9DA 2GQ1A 2DDKA 4MMPA 4PFRA 2XXKA 4GWXA 5FBPA 4PGPA 1BK4A 4HXVA 1FBHA 4MAGA 2WBBA 4MHFA 4P9KA 3SZPA 2CZKA 1FTAA 1KA1A 2QVUA 2CEYA 2HHMA 1IMDA 4O7MA 4I40A 2ZZXA 2XWIA 2HXRA 4PAIA 4GWZA 4HCYA 1FBPA 4N91A 1FPGA 4JVDA 3QMFA 4GWWA 5I3SA 3NOHA 2HPGA 2L5VA 1QGXA 4XF5A 4DI4B 4H46A 1K9YA 3RPLA 4OANA 1RDYA 4GBWA 3KC1A 1NUXA 4KXPA 4PETA 3IFCA 4F1UA 4MCOA 1G0HA 2QVVA 2HZLA 1KZ8A 1YZ0A 3E78A 4GX4A 4PDDA 4N17A 4MNCA 1NV1A 4P56A 2MKZA 5IM2A 4PTKA 4PAKA 4OVRA 5T3JA 3MSTA 1LBXA 5LDZA 3EKIA 2VT5A 5F24A 2V4CA 5IZ1A 4PF6A 2WYPA 2PCRA 2QFLA 1NV3A 1NUYA 1EYJA 3GYYA 2XWOA 4P1EA 1DK4A 2VPNA 3PTYA 1FPLA 1NV4A 2ZZWA 1FPIA 2DE3A 3U65A 4OVQA 3FBPA 4GX6A 3BIHA 3RPLB 5IZ3B 4XFEA 1VDWA 2HZKA 5ET7A 4MIJA 1DBZA 1D9QA 2F3BA 4F18A 4OVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6K A;  4NHB A;  3B50 A;  2PFZ A;  2WX9 A;  4PDH A;  4NQ8 A;  4MNP A;  4PET A;  4PAF A;  4X04 A;  2VPO A;  4NN3 A;  2PFY A;  4PCD A;  4DI3 D;  4MEV A;  2XA5 A;  4OA4 A;  4NAP A;  2ZZV A;  3FXB A;  4MCO A;  2HZL A;  5IZZ A;  4PBQ A;  4P3L A;  4PDD A;  4N17 A;  4PFI A;  4MNC A;  4N8Y A;  4PGN A;  4P1L A;  4P56 A;  4NX1 A;  5IM2 A;  4PAK A;  4OVR A;  5I7I A;  4N4U A;  4N6D A;  4NF0 A;  4UAB A;  4MMP A;  4PFR A;  4O94 A;  2V4C A;  4OVS A;  2XWV A;  4PF6 A;  2XXK A;  4LN5 A;  2WYP A;  4MNI A;  5LTC A;  4PGP A;  4P8B A;  3GYY A;  2XWO A;  4MAG A;  4P1E A;  4PC9 A;  4PF8 A;  2VPN A;  4XEQ A;  4YZZ A;  5I5P A;  4P9K A;  4MHF A;  4N15 A;  4NGU A;  2ZZW A;  2CEY A;  4PE3 A;  4O7M A;  2ZZX A;  3U65 A;  2XWI A;  5CM6 A;  4NG7 A;  4OVQ A;  2XWK A;  4PAI A;  4N91 A;  4MX6 A;  4XFE A;  4O8M A;  4OVP A;  4PBH A;  4P47 A;  2HZK A;  2HPG A;  4X8R A;  4MIJ A;  4XF5 A;  4YIC A;  2CEX A;  4DI4 B;  4N8G A;  5IGA A;  4PFB A;  4OVT A;  2WYK A;  4OAN A; 
#chains in the Genus database with same CATH topology
 1DMB A;  4KFQ A;  5HPQ A;  3CHG A;  1NH7 A;  3B50 A;  3FXQ A;  4DXB A;  4LZ5 A;  4F39 A;  3W9W A;  2FIX A;  2Y5L A;  1A40 A;  2ZYM A;  3IOU A;  3AXF A;  3HHG A;  3T9V A;  1D9V A;  1H44 A;  3H6W A;  2FA7 A;  1ZBM A;  5IZ3 A;  2UXA A;  2I3W A;  1B3G A;  3ONM A;  4GD5 A;  4LA9 A;  1FPB A;  1QUI A;  5EQ7 A;  4F2Q A;  2QSX A;  4TLL B;  4N6D A;  1B52 A;  3UN6 A;  3G3J A;  1LBY A;  2F6P A;  4K3F A;  1D3K A;  4LN5 A;  4Q0C A;  5ELV A;  1B5I A;  1Q1K A;  2REJ A;  4F2O A;  4N15 A;  3C4M A;  1G0I A;  4YKK A;  1FPF A;  4I8C A;  4M1V A;  1FBG A;  1US5 A;  4G68 A;  1LB9 A;  2E0S A;  4R72 A;  4ZE8 A;  4F31 B;  3ZKK A;  4OVP A;  3N6U A;  3MVW A;  1FJ9 A;  2A5S A;  4MLQ A;  3IOV A;  2GHA A;  2PX1 A;  3FZV A;  4R9F A;  5IGA A;  3MZ9 A;  2Q8J A;  3TAJ A;  2WEF A;  2QVR A;  4G77 A;  3IJX B;  1YYZ A;  2W7Y A;  3HO7 A;  1NUW A;  1NMU A;  4GQO A;  2PFY A;  4DIG A;  1B7U A;  2O1L A;  4GLI A;  1OQH A;  3TTR A;  2VOZ A;  1MM7 A;  3L6H A;  2Y84 A;  4HE0 A;  1A54 A;  5EYF A;  3TDJ A;  2Y7I A;  2B65 A;  5J1D A;  3D4C A;  2YLN A;  3PUZ E;  1FRP A;  2DVZ A;  1B3L A;  5I7I A;  3MZ1 A;  4NE4 A;  1FBC A;  1MY0 A;  3CR9 A;  4U22 A;  3RGY A;  3MW0 A;  3KSX A;  4WED A;  4BDR A;  4G8M A;  3MC2 A;  4NF6 B;  1LBB A;  4YB6 A;  3MPL A;  4KD5 A;  1BKA A;  1B1H A;  1JW1 A;  4QFL A;  4PC9 A;  4F3P A;  5DVI A;  3SDF A;  4G68 B;  2VD2 A;  3LC8 A;  4QF9 A;  4BDO A;  5LOM A;  1EZO A;  1BTJ A;  1SPI A;  3S4U A;  3TZA A;  2OX3 A;  4O3C A;  1B3F A;  3KSJ A;  3DLN A;  4MX6 A;  2JJK A;  1B1X A;  4GFR A;  4RPO A;  1FTO A;  3A29 A;  2CZI A;  1SI1 A;  1WOD A;  3FGS A;  3B6T A;  4PFB A;  4KHZ E;  5FHO A;  2RC9 A;  4N6K A;  4ELP A;  1I6Q A;  4PDH A;  1B4Z A;  3LR1 A;  1FQB A;  3LSW A;  4NTL A;  3VVF A;  3BIG A;  2KLF A;  2DWI A;  1IQ7 A;  4R2B A;  1FW0 A;  5EYH A;  2ZZV A;  1DTZ A;  1USY E;  2I0C A;  3QK6 A;  3I3V A;  5DYH A;  3BFU A;  3C9H A;  1FTL A;  5FHM A;  5AA2 D;  1FQA A;  5BWJ A;  3KC0 A;  1JW4 A;  4NX1 A;  1J1N A;  2OCU A;  3VE1 B;  5I2K A;  1IMF A;  1MPB A;  4GXA A;  1Q35 A;  4HE2 A;  1XC1 A;  4NF0 A;  4UAB A;  4ELO A;  2GQ1 A;  4FAT A;  3T9H B;  1FTK A;  4MMP A;  4PFR A;  1MRP A;  4JWY A;  4OTE A;  3LSF B;  2XXK A;  4GWX A;  4Q30 B;  3A3U A;  3O6I A;  3TCH A;  5ICQ A;  3C35 A;  4HXV A;  1FBH A;  4MBP A;  1ANF A;  1DPE A;  2XHD A;  4ESW A;  2NOO A;  1Y4T A;  2IEE A;  2CZK A;  5JTY A;  3DEL B;  2F36 A;  2F78 A;  4RA1 A;  1LAH E;  1AH5 A;  4I40 A;  2XWI A;  4QFN A;  1FPG A;  2DYX A;  4G8H A;  3VLW A;  3LUY A;  2RC7 A;  3PPP A;  3ZS6 A;  2GH9 A;  3N26 A;  4NF5 A;  4XKP A;  3ILU B;  2L5V A;  1POY 1;  3V83 A;  1HSJ A;  1MM6 A;  4GBW A;  2X7P A;  1NL5 A;  1LFI A;  4KYD A;  4F3S A;  1NKX A;  4EF1 A;  2QS3 A;  1Z7M E;  2XXP A;  3MP6 A;  4LQ2 A;  4R6H A;  2Q88 A;  3OOA A;  3KOS A;  1MXX A;  2M8C A;  3O97 A;  2P1S A;  3FVN A;  3OEN A;  5KDT B;  1Y1Z A;  3OSQ A;  3W15 C;  4KCD A;  1JEU A;  1YZ0 A;  4HS7 A;  4N17 A;  1YAE A;  4I62 A;  1EZP A;  5TPA B;  2RF1 A;  2XXY A;  4XTC Q;  2MKZ A;  2O7I A;  1B32 A;  3FAS A;  4PAK A;  4OVR A;  1H45 A;  4KR5 A;  3M3L A;  4TLM B;  2VT5 A;  5F24 A;  1IXC A;  4GF8 A;  4F29 A;  2WYP A;  4QFO A;  3PD9 A;  3TUS A;  3GYY A;  4R73 A;  2RKM A;  1DK4 A;  1FPL A;  1SDX A;  2DE3 A;  2Q89 A;  2Z8E A;  4ZEI A;  2VP1 A;  4R9G A;  1MXZ A;  4U1Z A;  5TP9 A;  4GWO A;  3UGW A;  3OEK A;  4KQP A;  1R6Z A;  3BFT A;  4GX6 A;  1B5J A;  1B2H A;  3VXB A;  2PBW A;  4XFE A;  3PMW A;  4RJZ A;  4F3G A;  2I0B A;  1VDW A;  3SEX A;  1JVY A;  1VFD A;  3OEL A;  1P99 A;  2HZK A;  3EN3 A;  4FAJ A;  1MQI A;  4H8I A;  2QS2 A;  1D9Q A;  4H8J A;  2XWV A;  1PB9 A;  1N84 A;  3KOT A;  5EYG A;  4NHB A;  1CE2 A;  2Z8D A;  2WX9 A;  1JQF A;  4R74 A;  5ESY A;  5H8Q A;  1IXH A;  3LSL A;  2UVI A;  3HFU A;  1MQJ A;  4QSC A;  1B5H A;  1LAF E;  1FJ6 A;  3P7I A;  3PU5 A;  1MY1 A;  2O7U A;  1A55 A;  5ICT A;  2A5T A;  4DI3 D;  4I1D A;  2HCA A;  1USY H;  2NWJ A;  5J16 A;  3A3C A;  1FTJ A;  2BJI A;  4IO4 A;  1A99 A;  5IKB A;  1SVX B;  2DQV A;  4PGN A;  3QIM A;  4OFO A;  2O6A A;  4GL0 A;  1DTG A;  3MAM A;  5L9M A;  1LBW A;  3PPR A;  1MDP 1;  3PGF A;  1JET A;  3B6W A;  1GTK A;  4NWD A;  2CZL A;  2DWA A;  2ZMB A;  4POW A;  3PPO A;  5AA3 A;  2P3N A;  4G4P A;  1HSE A;  3H6U A;  5I2N B;  4OVS A;  3PUX E;  2ONR A;  5AE4 A;  2DXR A;  4GOT A;  1SQY A;  1XT8 A;  3VV5 A;  4XIG Q;  5DEX B;  1Y3N A;  4NMY A;  5H8N A;  3CFX A;  3K01 A;  4KYS A;  2XXR A;  2PYY A;  3E79 A;  3TTN A;  3H6V A;  1FPE A;  4N81 A;  3D1R A;  4OEU A;  4QXD A;  2H98 A;  2CZH A;  1JP4 A;  3N94 A;  2NUV A;  4WKM A;  1RYX A;  3TPA A;  4R75 A;  4JWX A;  3B8B A;  3KFM A;  1PBQ A;  4I3E A;  1K9Z A;  4FED A;  4X48 A;  3QYT A;  3SER A;  5HBC A;  2I48 A;  3USD A;  2XXH A;  2A5T B;  1LBZ A;  5ET8 A;  2PFZ A;  2REG A;  3GBB A;  1P1Q A;  4GVO A;  3PUW E;  5FTI A;  4YKJ A;  4FBP A;  1IMA A;  2HFB A;  4H6D A;  3BKI B;  3GXA A;  4WXJ A;  2PT2 A;  3IOT A;  2FIE A;  4IO7 A;  4F19 A;  4Q5T A;  3PPN A;  3T0J A;  5CRY A;  4JDF A;  3RYD A;  1NNP A;  3IAZ A;  2FYI A;  3K02 A;  1JNF A;  3ILT B;  3THI A;  2XX8 A;  5H8N B;  3GZG A;  4O94 A;  4XKR A;  4ISU A;  3M8U A;  3MBP A;  3MYU A;  4DLD A;  3TMG A;  1FQF A;  2F7A A;  1EYK A;  3IB0 A;  2B4M A;  2D3I A;  4ZEK A;  4OZ9 A;  4E0W A;  1FPD A;  4PE3 A;  2V84 A;  2I58 A;  3S9E A;  1OLA A;  5CM6 A;  2R8T A;  4NG7 A;  5EQA A;  2DP8 A;  1IMC A;  1IMB A;  1Y3Q A;  3TYH A;  4P0G A;  1MQG A;  2I4C A;  4YMA A;  4H5F A;  3FVO A;  3IFA A;  3K4U A;  4YIC A;  2CEX A;  2FBP A;  3PV0 E;  4NF6 A;  3H06 B;  4EF2 A;  3QUF A;  3TEP A;  1NNT A;  1P1O A;  3CFL A;  4O3A A;  2UVG A;  4NF4 B;  1ZKB A;  4IO5 A;  4F22 A;  3I6V A;  3DP4 A;  1LFH A;  3K6X A;  4IGR A;  2R6G E;  1MXY A;  1URG A;  1URD A;  2DE4 A;  2R71 A;  3KBZ A;  4PCD A;  1DPP A;  3HN0 A;  4RXL A;  2F8D A;  4PQJ A;  3FAT A;  1DOT A;  1N3W A;  2ZNS A;  2ESN A;  1N04 A;  3D4G A;  1Y3P A;  5I84 A;  1NUZ A;  3W9V A;  1SD3 A;  5IZZ A;  4PBQ A;  1P1N A;  5I56 B;  2Q2A A;  2WBD A;  4TQU Q;  2PMS A;  4U4S A;  3K1N A;  4ECF A;  3O29 A;  3H6T A;  1R1N A;  1NV7 A;  3JYR A;  1OQG A;  1OVB A;  2DDK A;  3Q28 A;  2X7Q A;  3KZG A;  4OEV A;  1QW0 A;  1IUD A;  3VLU A;  1QUJ A;  1IIW A;  2ABH A;  2BJJ X;  1T0K A;  3KG2 A;  4MAG A;  3KGC A;  2WBB A;  1Z7N E;  1F9B A;  3G3G A;  3KJ7 A;  2HHM A;  4LVQ A;  3EHS A;  2HXR A;  3E4R A;  2H9B A;  3PUY E;  2VGQ A;  3QMF A;  1A8E A;  3FXU A;  2XD2 A;  1QGX A;  4H46 A;  4OES A;  1RDY A;  2VD3 A;  3KC1 A;  3CI8 A;  1VR5 A;  3OO8 A;  4OET A;  1OIB A;  4NF8 A;  3S9L C;  3RLF E;  2Q2C A;  3EF7 A;  4MCO A;  2QVV A;  4U23 A;  4O3B A;  4R6K A;  2I49 A;  2ZNT A;  1CB6 A;  3JV9 A;  4QRZ A;  2XXW A;  1YTV A;  3QUJ A;  4PP0 A;  3PMV A;  1NV1 A;  4P56 A;  1BIY A;  1M5F A;  4PTK A;  2ZXT A;  4IY5 A;  1IZ1 A;  3IO6 A;  5F1Q A;  1UTB A;  3U93 A;  2DOJ A;  3HV1 A;  3TTM A;  1FTM A;  2B3B A;  4LUB A;  2G93 A;  3IR1 A;  5ITO A;  5KCJ B;  2V4C A;  3RT6 B;  3G3K A;  1XS5 A;  1IXG A;  4ONY A;  3KN3 A;  4C0R A;  4R2F A;  3C32 A;  1LAX A;  2XWO A;  4P1E A;  3CIJ A;  5KZT A;  5KDT A;  1NV4 A;  3UK4 A;  2ZZW A;  1ATG A;  2O1M A;  2V93 A;  5TPA A;  3FBP A;  1Y9U A;  3EHU A;  3T22 A;  3FUZ A;  4EUO A;  4PFT A;  3N5L A;  3VFJ A;  2PT1 A;  1FCK A;  3Q27 A;  4ZEF A;  3UA8 A;  3IO4 A;  3K6U A;  3T96 B;  4FJP A;  4G2Z A;  2GFE A;  4F18 A;  3T9U A;  4NF8 B;  4BLA A;  1B0H A;  3RUM A;  4HE1 A;  3V5A A;  2ONK E;  3FJG A;  3MUQ A;  1NV2 A;  1AMF A;  4P0I A;  3KN8 A;  5BUU A;  4NQ8 A;  5CI5 A;  1RKM A;  1S7Y A;  5ET5 A;  2V25 A;  2VPO A;  4THI A;  2ZYN A;  2FVZ A;  2XX9 A;  4DDD A;  4KYE A;  1B7Z A;  1UTH B;  3SES A;  1SBP A;  4ZDM A;  2UVJ A;  2Y7K A;  1UTB B;  4BDN A;  2HAV A;  4L17 A;  2UYE A;  3M3K A;  4JSO A;  4P1L A;  3MVY A;  3UOR A;  1GGG A;  3SEV A;  2F34 A;  1IIT A;  1NI9 A;  1B05 A;  1LST A;  3LUZ A;  3G3H A;  3BBR A;  3CFZ A;  1B46 A;  1PB7 A;  4GWS A;  3FVG A;  4YZZ A;  5F7V A;  3MWB A;  3QXM A;  2UVH A;  5CC2 A;  1FBE A;  4IR8 A;  1FBD A;  4IO2 A;  1HSL A;  3O9P A;  1KWH A;  3ODB A;  1FPJ A;  2LAO A;  4FIM A;  3SKP A;  3CG1 A;  2Q74 A;  4GL8 A;  2OJT A;  4O8M A;  5IAI A;  1S9T A;  3VVE A;  2O68 A;  4X8R A;  2YJP A;  3RTW B;  5I2N A;  1QKA A;  1JW5 A;  3K2D A;  3RY3 A;  3VDF A;  4OFJ A;  2DVC A;  2WYK A;  2H4I A;  5DEX A;  4H0W A;  2DSF A;  2V3Q A;  2XXV A;  2FHY A;  1FPK A;  4OER A;  3VVD A;  1NNF A;  4U21 A;  4X9T A;  4H5G A;  4NN3 A;  4QBA A;  4OVJ A;  4OA4 A;  5ITP A;  1ZMG A;  1R9Q A;  4OFL A;  4DXC A;  3PPQ A;  1QVS A;  5FHN A;  1I6A A;  1WDN A;  2P2A A;  4LAT A;  4QSD A;  1B9J A;  4AB6 A;  3VLV A;  5DW8 A;  4FOR A;  4C1U A;  3HHF A;  5FTH A;  1M5E A;  1UIV A;  1ZIU A;  4MNI A;  1URS A;  5TU0 A;  4YKP A;  4H65 A;  4ZEC A;  1NV5 A;  2Q9T A;  3C36 A;  5H8S A;  4PF8 A;  1UIU A;  4XEQ A;  3U8Q A;  4ZZA A;  3TCG A;  2AYS A;  4I3Y A;  1MPD A;  2Y7R A;  2NXO A;  2DE2 A;  4HCW A;  2RC8 A;  4TOZ A;  1MXW A;  4MJO A;  1POT A;  1IME A;  3KN7 A;  4Z7E A;  4AS5 A;  3HST A;  1LBC A;  5EQ8 A;  3T93 B;  2X26 A;  4MLV A;  4X1B A;  3CSB A;  3DP8 A;  2Y5K A;  4PBH A;  4P47 A;  1NV6 A;  5DVF A;  5I58 B;  5EHM A;  4JVI A;  4N8G A;  4OYV A;  3N6T A;  2XXI A;  5AA2 B;  1NFT A;  3E9X A;  3IB2 A;  3O6H A;  4JSD A;  3CG3 A;  1MXV A;  3ROJ A;  1OVT A;  3ISP A;  1N3X A;  2Q8M A;  2GHB A;  2QPQ A;  4LZ8 A;  1LB8 A;  2I3V A;  3PUV E;  3TEL A;  3K00 A;  2F7C A;  1MPC A;  4F3B A;  2OWZ A;  1SW4 A;  1AOV A;  5CMC A;  1N7X A;  1US4 A;  2Z22 A;  1QUK A;  1PEB A;  3R26 A;  3TOD A;  2AL4 A;  2CMO A;  3RT8 A;  3KBR A;  4XKQ A;  2XXX A;  2OLB A;  5AA4 B;  4NF4 A;  1NNK A;  1FBF A;  4HW8 A;  1MH4 A;  1Q9D A;  4EXL A;  2B3F A;  3RN8 A;  4P11 A;  4X1D A;  5K2Y A;  1XVX A;  2QL3 A;  4YAH X;  1BK4 A;  2OWT A;  4FEB A;  2OK2 A;  4GXS B;  1NH8 A;  3CSG A;  4P9K A;  4MHF A;  4WEP A;  3CVG A;  1FQD A;  3SZP A;  5I56 A;  1FTA A;  2QVU A;  2CEY A;  4BDL A;  1IMD A;  1O7T A;  4PAI A;  4GWZ A;  4LQ5 A;  1FBP A;  4JBZ A;  4N91 A;  4DE8 A;  1B3E A;  4HTG A;  5H8H B;  4GWW A;  1LFG A;  2R9J A;  1MH3 A;  3NOH A;  4ELR A;  4XF5 A;  3FV2 A;  3IOR A;  3RPL A;  2OWS A;  1NUX A;  4U1O A;  2XD3 A;  5L9S A;  4IO6 A;  3IFC A;  3G7W A;  4QFP A;  4ZEB A;  3HCQ A;  1FQC A;  2QMW A;  1B7H A;  1G0H A;  1II5 A;  2RCB A;  1KZ8 A;  5HM4 B;  1ELJ A;  2AL5 A;  3C34 A;  4OXV A;  2FNC A;  3I5O A;  4G68 C;  2Y7P A;  3OEM A;  4ZZE A;  5H8F B;  4YB7 A;  5IM2 A;  2IA4 A;  3T9X B;  4FEC A;  2XXU A;  3MST A;  3G3I A;  2QS1 A;  4DCY A;  3A09 A;  2Z8F A;  3RNN A;  5LDZ A;  1LAG E;  2F7B A;  1O64 A;  1WVJ A;  1IXI A;  2PCR A;  2QFL A;  5AA1 A;  1NUY A;  4C1T A;  1EYJ A;  1B0L A;  1PDA A;  3PTY A;  3K6V A;  3MVZ A;  4ESX A;  3QSL A;  2OZZ A;  1FPI A;  3O66 A;  2H99 A;  3Q29 A;  3TTK A;  3U92 A;  3WAE A;  2H5Y A;  2ZNU A;  1TFA A;  1SW5 A;  3RPL B;  1EU8 A;  5IZ3 B;  1AIV A;  3T66 A;  4PFW A;  5KCJ A;  1Y1M A;  5ET7 A;  1QKB A;  1LGB C;  3TTL A;  3WAF A;  1DBZ A;  2F3B A;  2VHA A;  1GR2 A;  2UYF A;  2Y7W A;  1BLF A;  4KPT A;  3IJO B;  1YXI A;  4MNP A;  4DZ1 A;  4PAF A;  1GVC A;  1GV8 A;  1EZ9 A;  2DXY A;  4O7I A;  4IB2 A;  2QMX A;  3SEU A;  3K1M A;  4Q8R A;  4MEV A;  2XA5 A;  4GBV A;  3O2A A;  4NAP A;  1VSO A;  1S50 A;  1SYH A;  4M4G A;  4PFU A;  3FXB A;  1TFD A;  4E0X A;  1B3H A;  3S2V A;  2PVU A;  3K0V A;  5M2V A;  3RQT A;  1NV0 A;  4OQO A;  3MZB A;  1LEV A;  4N8Y A;  2F3D A;  4NWC A;  1H76 A;  4POX A;  3ECR A;  3F11 A;  1JVX A;  1Y20 A;  2D5W A;  1P1W A;  3EQ1 A;  3FV1 A;  5ET6 A;  2DWH A;  3FIR A;  3E13 X;  2F35 A;  5B70 A;  3OSR A;  1ZTY A;  1XOC A;  4GWY A;  1PB8 A;  4R6Y A;  2O84 X;  1I6B A;  3TCF A;  1UTH A;  4YMB A;  4JVC A;  3LSX A;  1XI6 A;  2DS9 A;  1D9Y A;  2D21 A;  3OMB A;  1MY3 A;  4OWD A;  1JEV A;  4PE5 B;  2XWK A;  1LLS A;  1I69 A;  3OD7 A;  3ZSF A;  2HQ0 A;  1INP A;  5JK4 A;  3DM0 A;  2AIX A;  4MF3 A;  3C31 A;  3E3K A;  3ZKL A;  3MQ9 A;  3T1B A;  2Z23 A;  5CMM A;  3MJN A;  3K6W A;  1R9L A;  5I57 A;  1P1U A;  1ZJL A;  3EHT A;  3CRB A;  2I4B A;  4OMB A;  4AS4 A;  3IX1 A;  4LZ7 A;  4I9D A;  1CNQ A;  4RK9 A;  4X04 A;  3Q25 A;  2I6E A;  3H4Z A;  3KEI A;  1B51 A;  3U1O A;  3VXC A;  1KA0 A;  1H3D A;  4MFI A;  3FJ7 A;  3RTF B;  5DTB A;  2P0S A;  3U94 A;  2XX7 A;  3MP1 A;  1TXF A;  1Y4C A;  3MP8 A;  3G3F A;  2B4L A;  3RPW A;  1VFE A;  1DCU A;  4F1Y A;  2QJE A;  4BDQ A;  5ISU A;  3R7X A;  2QS4 A;  3LV0 A;  4H1X A;  4N4U A;  4EXK A;  4GIZ A;  3IOW A;  4H67 A;  5CBS A;  4EQ7 A;  2OBG A;  4KI0 E;  1XVY A;  4DXU A;  1AL3 A;  5A5X A;  5LTC A;  2KQZ A;  2RIN A;  4P8B A;  1A8F A;  4G61 A;  1N76 A;  3R6U A;  1RDX A;  5I5P A;  4EDP A;  4U2R A;  4NGU A;  1EYI A;  3O28 A;  3Q26 A;  5EHS A;  5A5L A;  4IGT A;  1TWY A;  1TT1 A;  2KR0 A;  4EQB A;  1B40 A;  4XXU A;  3L6G A;  4QHQ A;  3FVK A;  4RPN A;  2P3V A;  1QJM A;  1MQD A;  1PBP A;  2F6G A;  1SYI A;  4IY6 A;  5I57 B;  4PFY A;  3HPI A;  4OHN A;  1FSA A;  3PD8 A;  4N6P A;  5I59 A;  1SW1 A;  3PMX A;  4BDM A;  3TFL A;  3SEW A;  5K2X A;  1H43 A;  1M5C A;  4GX3 A;  5CBR A;  5I2K B;  3V89 B;  4QSE A;  3B6Q A;  1RYO A;  4YB5 A;  3UIF A;  1RDZ A;  2F5X A;  1UQW A;  4RNS A;  5CMK A;  1B6H A;  2XXQ A;  3IK6 B;  2ANJ A;  4NED A;  3MPK A;  3DP6 A;  3TQL A;  4EQ9 A;  1SI0 A;  1LBV A;  4OEN A;  4GWU A;  5JTY B;  4P3L A;  4ZE9 A;  5JEI A;  4PFI A;  5I58 A;  3K1P A;  1AWB A;  2ALU A;  1ZU0 A;  5EQ9 A;  5AA2 A;  2QRY A;  5A5X B;  1DSN A;  4UA8 A;  1ZLQ A;  3MVX A;  4JB7 A;  1LCT A;  1SW2 A;  4H45 A;  4F1V A;  3GBA A;  2O51 A;  3SET A;  4NF5 B;  2HAU A;  4UAC A;  3LBS A;  5DVJ A;  3SEY A;  5FBP A;  4PGP A;  2V3T A;  2NVU B;  1FQE A;  3C33 A;  4QFK A;  2RCA A;  1KA1 A;  4O7M A;  3B7D A;  2ZZX A;  3U72 A;  3FJM A;  2H25 A;  2E1S A;  4HCY A;  3TQW A;  5I59 B;  1BP5 A;  5DT6 A;  1M5B A;  3O6G A;  1MDQ A;  1XHY A;  2ZYO A;  5AA4 A;  4JVD A;  3FXR A;  5I3S A;  3JZJ A;  4ZS9 A;  2HPG A;  4LP2 B;  2G29 A;  4ND9 A;  5CMB A;  4DI4 B;  3GLB A;  1K9Y A;  4FE8 A;  4OAN A;  4RYA A;  1QUL A;  3H3G A;  1OMP A;  3M3F A;  4MH5 A;  1IEJ A;  3EPE A;  3OO9 A;  4KXP A;  3OO7 A;  1B58 A;  4RY1 A;  4PET A;  1N0T A;  4IO3 A;  4DCX A;  4YKI A;  4F1U A;  1MY2 A;  4XKN A;  4ZED A;  4YU0 A;  1N7W A;  1VE4 A;  5H8H A;  4G8N A;  1LCF A;  2HZL A;  3FD3 A;  2XXT A;  3S9N C;  1M5D A;  3E78 A;  4GX4 A;  4PDD A;  2ONS A;  5L8D A;  4MNC A;  5TP9 B;  2THI A;  1PC3 A;  3IL1 B;  2DWJ A;  4AQ4 A;  4N13 A;  3QAX A;  5T3J A;  2HEU A;  1MQH A;  2F97 A;  3S9M C;  1B4H A;  3TKD A;  3V8X B;  4AB5 A;  3OO6 A;  4ELQ A;  1D4N A;  1LBX A;  3EKI A;  4JXI A;  4U4X A;  5IZ1 A;  1A7L A;  4JWO A;  4PF6 A;  2O69 A;  1NV3 A;  3IB1 A;  1EH3 A;  1O63 A;  2ZYK A;  2GRV A;  1OLC A;  2YPN A;  1MS7 A;  1L5T A;  4LON B;  5L9O A;  2VPN A;  1MY4 A;  5B7D A;  3H7M A;  2WKY A;  4Z0I A;  3H03 A;  5H8Q B;  3KJT A;  3U65 A;  5H8F A;  4OVQ A;  4RK2 A;  1MG1 A;  1YPN A;  4KCC A;  3OXN A;  3BIH A;  3UP9 A;  4N07 A;  2V3U A;  4MIJ A;  1MXU A;  2HXW A;  4OVT A;  4GRK A;  1YCJ A; 
#chains in the Genus database with same CATH homology
 5EYG A;  4HE1 A;  4NHB A;  3CHG A;  1NV2 A;  3B50 A;  2WX9 A;  5ESY A;  3W9W A;  1YXI A;  4MNP A;  4NQ8 A;  2FIX A;  3HFU A;  2Y5L A;  4PAF A;  5ET5 A;  1FJ6 A;  4O7I A;  2VPO A;  4DI3 D;  4MEV A;  2XA5 A;  2FVZ A;  4GBV A;  5J16 A;  4NAP A;  3FXB A;  2BJI A;  5IZ3 A;  1NV0 A;  1LEV A;  1FPB A;  4N8Y A;  4PGN A;  2F3D A;  4P1L A;  5EQ7 A;  1LBW A;  4N6D A;  5ET6 A;  2P3N A;  1NI9 A;  1LBY A;  3LUZ A;  4OVS A;  4LN5 A;  4GWY A;  4GWS A;  4YZZ A;  4N15 A;  4JVC A;  1XI6 A;  1G0I A;  3E79 A;  1FBE A;  4IR8 A;  1FPF A;  1FPE A;  4N81 A;  1FBD A;  4M1V A;  3D1R A;  2XWK A;  1FBG A;  1FPJ A;  4QXD A;  2CZH A;  1JP4 A;  2Q74 A;  1INP A;  4O8M A;  5JK4 A;  4OVP A;  1FJ9 A;  4X8R A;  3T1B A;  3B8B A;  5IGA A;  4I3E A;  1K9Z A;  2WYK A;  2WEF A;  2QVR A;  1YYZ A;  2V3Q A;  1LBZ A;  5ET8 A;  2FHY A;  2PFZ A;  1FPK A;  1NUW A;  4AS4 A;  4X9T A;  4FBP A;  1IMA A;  1CNQ A;  4X04 A;  4NN3 A;  4QBA A;  2PFY A;  1KA0 A;  4OA4 A;  2FIE A;  4HE0 A;  4F19 A;  3T0J A;  5J1D A;  2B4L A;  1DCU A;  1FRP A;  3RYD A;  2DVZ A;  3LV0 A;  5I7I A;  4N4U A;  5DW8 A;  1FBC A;  4O94 A;  2XWV A;  3MYU A;  4MNI A;  5LTC A;  2KQZ A;  4P8B A;  1NV5 A;  2Q9T A;  4G61 A;  4PC9 A;  1EYK A;  1RDX A;  4PF8 A;  4XEQ A;  5I5P A;  2B4M A;  4NGU A;  1EYI A;  4I3Y A;  5A5L A;  2KR0 A;  2DE2 A;  4HCW A;  1FPD A;  4PE3 A;  1SPI A;  2OX3 A;  5CM6 A;  2R8T A;  4NG7 A;  4MJO A;  5EQA A;  1IME A;  2P3V A;  1IMC A;  1IMB A;  4AS5 A;  4MX6 A;  2JJK A;  5EQ8 A;  2Y5K A;  4PBH A;  4P47 A;  3IFA A;  1FSA A;  1NV6 A;  3A29 A;  2CZI A;  4YIC A;  2CEX A;  2FBP A;  4JVI A;  4N8G A;  4PFB A;  4GX3 A;  4N6K A;  4PDH A;  1RDZ A;  2F5X A;  3ROJ A;  3BIG A;  3ISP A;  2DE4 A;  3KBZ A;  2Q8M A;  4PCD A;  2QPQ A;  5EYH A;  2ZZV A;  1LBV A;  1NUZ A;  3W9V A;  2OWZ A;  5IZZ A;  4PBQ A;  4GWU A;  4P3L A;  2WBD A;  4PFI A;  1AWB A;  3KC0 A;  4NX1 A;  5EQ9 A;  1IMF A;  4HE2 A;  4NF0 A;  4UAB A;  1FBF A;  4H45 A;  4F1V A;  1NV7 A;  1Q9D A;  2GQ1 A;  2DDK A;  4MMP A;  4PFR A;  2XXK A;  4GWX A;  5FBP A;  4PGP A;  1BK4 A;  4HXV A;  1FBH A;  4MAG A;  2WBB A;  4MHF A;  4P9K A;  3SZP A;  2CZK A;  1FTA A;  1KA1 A;  2QVU A;  2CEY A;  2HHM A;  1IMD A;  4O7M A;  4I40 A;  2ZZX A;  2XWI A;  2HXR A;  4PAI A;  4GWZ A;  4HCY A;  1FBP A;  4N91 A;  1FPG A;  4JVD A;  3QMF A;  4GWW A;  5I3S A;  3NOH A;  2HPG A;  2L5V A;  1QGX A;  4XF5 A;  4DI4 B;  4H46 A;  1K9Y A;  3RPL A;  4OAN A;  1RDY A;  4GBW A;  3KC1 A;  1NUX A;  4KXP A;  4PET A;  3IFC A;  4F1U A;  4MCO A;  1G0H A;  2QVV A;  2HZL A;  1KZ8 A;  1YZ0 A;  3E78 A;  4GX4 A;  4PDD A;  4N17 A;  4MNC A;  1NV1 A;  4P56 A;  2MKZ A;  5IM2 A;  4PTK A;  4PAK A;  4OVR A;  5T3J A;  3MST A;  1LBX A;  5LDZ A;  3EKI A;  2VT5 A;  5F24 A;  2V4C A;  5IZ1 A;  4PF6 A;  2WYP A;  2PCR A;  2QFL A;  1NV3 A;  1NUY A;  1EYJ A;  3GYY A;  2XWO A;  4P1E A;  1DK4 A;  2VPN A;  3PTY A;  1FPL A;  1NV4 A;  2ZZW A;  1FPI A;  2DE3 A;  3U65 A;  4OVQ A;  3FBP A;  4GX6 A;  3BIH A;  3RPL B;  5IZ3 B;  4XFE A;  1VDW A;  2HZK A;  5ET7 A;  4MIJ A;  1DBZ A;  1D9Q A;  2F3B A;  4F18 A;  4OVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...