2PFZA

Crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
TKWDLPTAYPASNLHVENLTQFVKDVDSLSGGKLKITLHNNASLYKAPEIKRAVQGNQAQIGEILLTNFANEDPVYELDGLPFLATGYDASFKLYQAQKPFLEKKLASQGMMLLYSVAWPPQGIFANRDIKQVSDMKGLKWRAYSPVTAKIAELVGAQPVTVQQAELAQAMATGVIDSYMSSGSTGFDTKTYEYIKKFYDTEAWLPKNAVLVNKKAFDALDPATQQALKKAGAQAEERGWKLSQEKNSWYKEQLAKNGMAIIAPTAELKSGLTEVGKRMLDDWLKKAGADGQAMIDAYRKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of two Bordetella pertussis Periplasmic Receptors Contribute to Defining a Novel Pyroglutamic Acid Binding DctP Subfamily.
pubmed doi rcsb
source organism Bordetella pertussis tohama i
molecule tags Transport protein
molecule keywords Putative exported protein
total genus 113
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2pfzA00
4LN5A 4N17A 4PFIA 2HZKA 4MNPA 4N8YA 4P9KA 4PDDA 4PBHA 3GYYA 4PC9A 4UABA 4PDHA 4NHBA 4OANA 4OVRA 4P56A 4OVPA 4DI3D 5I5PA 4PAFA 4XF5A 4OVQA 4P8BA 2VPNA 2VPOA 4MAGA 4NGUA 5IGAA 4MCOA 3FXBA 4NN3A 4NQ8A 4MX6A 4PF8A 4NAPA 4N8GA 4PETA 4YICA 4OVTA 4NG7A 3U65A 5I7IA 4N4UA 4MEVA 4PAKA 2CEYA 4X8RA 4N6KA 4O7MA 4PE3A 4XEQA 4P47A 4OVSA 5IM2A 4MHFA 2HZLA 2HPGA 2XWKA 2XWVA 4N6DA 2XXKA 2ZZWA 4XFEA 4PCDA 4DI4B 4X04A 4O8MA 4PF6A 4P1LA 4PBQA 2WYPA 4PAIA 4MMPA 2CEXA 2WX9A 2WYKA 4N91A 5LTCA 2XA5A 4PGPA 2V4CA 5IZZA 4NX1A 4YZZA 2ZZVA 4MNIA 4OA4A 4N15A 4MIJA 4P1EA 4PFBA 4PFRA 2ZZXA 2XWIA 3B50A 2PFYA 4O94A 4NF0A 2PFZA 4P3LA 4PGNA 2XWOA 5CM6A 4MNCA
chains in the Genus database with same CATH superfamily
4LN5A 4RK9A 1B7HA 2RKMA 4GWZA 4F2OA 1M5FA 4R73A 3CRBA 4NF4A 4GXAA 1LBCA 4ONYA 4HCYA 3GYYA 5H8FA 4PDHA 4DXCA 1POY1 2F78A 4OESA 4ZDMA 4GXSB 2DWAA 1SDXA 4PQJA 3RNNA 2OZZA 4H6DA 3K6WA 1B0HA 3O2AA 3M8UA 2ONRA 4X1DA 1DCUA 1IXIA 4PETA 3R6UA 3O97A 1FPGA 1ANFA 4KXPA 1ZLQA 4GBWA 2ZNTA 4OZ9A 4ESWA 2AL4A 3WAEA 1JETA 5CBSA 5L9OA 4RYAA 1OQHA 3ILTB 3G3IA 4N6DA 3M3LA 2XXKA 2ZYMA 5IZ3B 4XFEA 1EZ9A 4O8MA 3SERA 5EQ8A 3G3KA 5B70A 3UP9A 4IB2A 1XT8A 4I9DA 1B6HA 5I58A 4HW8A 3VE1B 3O6HA 4MJOA 5I59A 1KWHA 4BDMA 4NF6A 5CI5A 3VXCA 4NX1A 4MLQA 1NL5A 3G3HA 3VVFA 4N15A 3PD9A 3IO6A 3FIRA 4XTCQ 2OCUA 3V5AA 3LBSA 2BJJX 1ZBMA 3K6XA 5FTIA 4G68B 4PGNA 1TFAA 4MNCA 2PBWA 3C33A 1IMAA 4YKKA 3FVNA 4PFIA 2FIXA 2Y7RA 2NUVA 4QFPA 2DWJA 4EDPA 4GX3A 1Q1KA 1FBDA 1MS7A 4BDOA 2VD2A 1I6BA 4PFWA 4I3YA 2OX3A 3L6HA 2RF1A 5KDTB 4TLLB 4OEVA 2QPQA 3RTWB 1OIBA 1YXIA 4JWYA 1NNTA 1MQIA 1SYHA 3VVEA 1MQGA 3IOVA 4MX6A 4OFJA 1MG1A 4I62A 4RPNA 4JVDA 5F7VA 2I6EA 4LZ5A 3B6TA 1B46A 3CSGA 3G3JA 4HCWA 4U23A 5AA3A 5I2KB 2DXYA 2XXVA 1BLFA 3GBAA 2Q9TA 4LATA 5A5LA 4MLVA 4GOTA 1YCJA 3ODBA 4OVJA 5IKBA 2Y7WA 2O84X 4O3BA 1ZU0A 5CMKA 2Y5KA 2BJIA 1R6ZA 2UXAA 1KZ8A 4LQ5A 1XI6A 4DCXA 1ZIUA 2F3DA 4ZZEA 3A3UA 4GFRA 4G8HA 1XOCA 2XXUA 4OA4A 1MXVA 4ZE9A 1LFIA 1N84A 5FBPA 3FASA 4QFLA 1SW1A 4Q0CA 1A7LA 3CFXA 5I57B 4F1UA 5DEXB 3TODA 3K1NA 5L8DA 3MZ1A 4PDDA 5TPAA 5I56B 4U4XA 4G2ZA 1CB6A 3S2VA 4OVPA 1QJMA 4XF5A 2OK2A 2G29A 5H8HB 1BTJA 1L5TA 3GBBA 2WBBA 1H76A 3O28A 1XHYA 1VFDA 3ZKKA 3K1MA 1IXHA 2V3UA 1KA1A 2I3WA 2QRYA 2ONSA 4N8GA 4GWYA 1DTGA 1MRPA 2UVHA 3K6UA 3EQ1A 2Y7PA 3IL1B 3OXNA 4Q30B 4H5FA 4OVSA 4F29A 3U8QA 4C1TA 1FPIA 4YKIA 1LBWA 1SI0A 5B7DA 1B3FA 1J1NA 5AE4A 3KBRA 3U72A 3CI8A 2UVIA 4RY1A 3KJTA 3IB0A 2DWIA 2ONKE 1PEBA 3SEXA 4LA9A 4DDDA 2DVCA 5A5XB 2OJTA 2P3VA 3JYRA 4G61A 3VDFA 4P0IA 3QSLA 1IUDA 5EQ9A 5HBCA 4MIJA 4PFBA 3HN0A 1IMDA 4YB5A 1B4ZA 4NF0A 3PPRA 4DXUA 5BWJA 1D4NA 1FTKA 1NNKA 5ICQA 2VD3A 3IFCA 4MNPA 5CMMA 1NI9A 1JP4A 2QVUA 4U1ZA 4OTEA 4OANA 4POWA 3E13X 1P1QA 4P8BA 3JZJA 3K00A 1B05A 4KFQA 3HCQA 2DDKA 4THIA 2VPOA 2Z8DA 3DP4A 2D21A 4RNSA 3LSFB 1Z7ME 1PDAA 3D1RA 4QRZA 3RGYA 2R71A 3MVWA 2PT2A 4PF8A 4F2QA 3O6GA 1WDNA 4C1UA 2JJKA 1JVXA 2PVUA 2UYEA 2ESNA 3CFZA 2ZNSA 5I7IA 4GL0A 2KR0A 2XXXA 1H45A 4O7MA 2RC8A 3H7MA 1FW0A 1FRPA 1FTMA 4AB5A 1DBZA 3QIMA 2XXHA 4R2BA 1PBQA 4P1LA 2KQZA 1WVJA 2P2AA 1XS5A 2H25A 1EU8A 2CZIA 4R6HA 2O7IA 3I5OA 1B2HA 5EHSA 2ABHA 4IO3A 5KZTA 3P7IA 1CE2A 3OELA 3NOHA 4IO5A 2F7CA 2W7YA 1NUZA 2NVUB 3H4ZA 2XD2A 3MYUA 1DPPA 4PE5B 1Y1MA 5ESYA 2WBDA 1EH3A 1FJ9A 3S9NC 2I0BA 1S50A 3TKDA 3B8BA 4LQ2A 4YU0A 4QFKA 1ATGA 4N8YA 4OETA 3MQ9A 2IEEA 3VV5A 2RCAA 1FTAA 4QHQA 3SEWA 4BDNA 2DSFA 2F7AA 4R2FA 5H8QB 5IZ1A 4MAGA 4U4SA 3N6UA 2PX1A 4F1VA 4OYVA 5AA2D 1GR2A 1FPEA 3KZGA 2O1MA 4MEVA 2CEYA 4PAKA 4KD5A 2GRVA 3EN3A 5T3JA 5ISUA 3VXBA 4XIGQ 1N7XA 3KGCA 3GLBA 5I2NA 1MM7A 3GXAA 3IOWA 5DEXA 4ZEIA 4X04A 3C9HA 4QXDA 3QAXA 5F24A 5I57A 4FBPA 4LZ8A 4XKRA 1MPCA 1LFHA 1HSEA 4LP2B 2GQ1A 3SESA 3FBPA 2RC9A 3CHGA 5L9MA 1SYIA 4YZZA 1S7YA 4DIGA 4IO6A 3T96B 1H3DA 3TTNA 4OEUA 2F7BA 4Q5TA 2VT5A 1GVCA 4RJZA 1B52A 3FXUA 5AA1A 1F9BA 2DYXA 3SEYA 5H8SA 4NTLA 2ZXTA 1MQJA 5I2KA 4GBVA 4L17A 5HPQA 3FVGA 4KI0E 3W15C 1MQDA 2MKZA 4POXA 1MXXA 3U94A 1Y1ZA 2X7PA 3D4GA 4ELQA 2HEUA 5ICTA 4PFUA 1ZTYA 4MCOA 5DVIA 3FXBA 3HFUA 4R9GA 4GVOA 1MXYA 5K2XA 1ZKBA 4X1BA 4P0GA 3TAJA 4AS5A 2VOZA 3S9LC 3KN3A 4DLDA 1FPFA 3RQTA 1B4HA 4RXLA 2DWHA 1G0HA 3A29A 3MUQA 4YKJA 1DTZA 3IJXB 4DI4B 1LBXA 4H8IA 4BDRA 1D9QA 1NV7A 2DE3A 3M3KA 1NV2A 2E1SA 4IGTA 3H6VA 4NF6B 1B40A 1EZOA 5I59B 3T9VA 3TQLA 3VVDA 4FECA 3H6WA 3EHSA 3PPPA 3T9HB 1XVYA 1B5HA 4R6KA 1GGGA 2LAOA 4WKMA 3ZSFA 3MPKA 1NV0A 3N5LA 2B65A 1A54A 2E0SA 5IZ3A 3MJNA 3RT8A 2M8CA 4KQPA 2FVZA 4KCCA 1I6AA 1QKAA 4P56A 1A40A 1MY4A 5FHMA 1VDWA 4IO7A 1TT1A 1FQEA 1IMCA 1P1OA 2I3VA 4F39A 1MY2A 4JSOA 3UIFA 4DZ1A 2OLBA 4N07A 1SBPA 3ILUB 4BDQA 4BLAA 4NE4A 2DVZA 1AOVA 4N4UA 3QUFA 2DXRA 4X8RA 3MBPA 5FHOA 5H8FB 2KLFA 4P47A 1JW1A 1LB9A 3MVXA 1FPLA 2XWVA 3UN6A 5JEIA 1IMFA 4NF4B 1AH5A 4QBAA 4PCDA 3DP8A 3PPNA 3PTYA 1IIWA 3T93B 1B7UA 4PBQA 3KSJA 1LCTA 5AA2A 3C36A 4EF1A 2WEFA 1UIUA 5FTHA 2DE4A 3MSTA 1A99A 1FTOA 3PPQA 4JSDA 1Q9DA 2PFZA 1USYH 4KYSA 1FSAA 4F1YA 4PP0A 4JBZA 1SW2A 5CC2A 3IO4A 2QSXA 1LAHE 1FBPA 3HO7A 2O1LA 4JDFA 3C31A 4PC9A 2H99A 4NHBA 1Z7NE 3H6UA 4GIZA 4OVRA 1SPIA 1B51A 2FNCA 5HM4B 1B58A 2GHAA 5AA4B 1I6QA 4FEBA 5FHNA 1OVBA 3K4UA 4E0WA 5IAIA 2VPNA 3TELA 3EPEA 2RC7A 4IO4A 1AIVA 1M5DA 2FYIA 4WEDA 1QUKA 1K9ZA 3SEUA 4YMAA 4NQ8A 1MQHA 4H46A 3OO7A 2I4BA 1D3KA 1LLSA 3DLNA 1Y3PA 4R9FA 3FXRA 5AA4A 4FJPA 1SD3A 3FV1A 1US4A 3TZAA 1EYJA 2P1SA 1MH4A 1LFGA 3OD7A 4ZE8A 3E79A 4H8JA 4TQUQ 4ZECA 2QS2A 3CG1A 4OMBA 2ALUA 4HXVA 3OENA 5BUUA 2FA7A 4GD5A 1Q35A 3BFUA 3E3KA 5M2VA 3TTKA 1LAGE 1QUJA 3ZS6A 1LAFE 3ECRA 4H5GA 1O7TA 2XXRA 4DE8A 2O7UA 3K02A 3KN7A 4YB7A 3L6GA 4F22A 3FXQA 1G0IA 4FAJA 1BIYA 3I6VA 1ZJLA 1FQFA 3PGFA 1NH8A 2HFBA 4OFLA 4KYEA 1FQAA 4XXUA 1N3XA 2HZKA 1TWYA 3FJ7A 3ROJA 2O6AA 2QJEA 2CZLA 3K2DA 1MY0A 1PB7A 1II5A 2Y7IA 2OBGA 3THIA 4F3SA 4YKPA 5EYGA 3OSQA 3IOTA 1HSLA 4HE2A 3U93A 3WAFA 2RINA 4OVQA 3VLUA 3MZBA 2QL3A 2B3BA 4Z7EA 2DP8A 1AL3A 1FBCA 1B3LA 3CFLA 4F19A 2AYSA 3D4CA 1EYIA 4X9TA 4NN3A 3TDJA 1B1XA 1QVSA 1R9QA 5LDZA 2O69A 3FVKA 1MPBA 3B6WA 3MVZA 3EF7A 2V25A 4XEQA 5I84A 2HZLA 3TCGA 3KOSA 3U92A 4F3GA 1LGBC 2Z23A 4ZS9A 3H06B 4PAIA 4ECFA 3OEMA 2ZYNA 4ZEBA 4F31B 2WX9A 2WYKA 4PGPA 4G68C 5I3SA 1MY1A 1IITA 3E4RA 4P1EA 4UACA 4GWWA 3LC8A 3BIGA 3Q28A 4LUBA 1NV4A 4EQ9A 2F36A 2RCBA 3CIJA 2ZNUA 4WEPA 1NUWA 2A5TB 1DPEA 2X26A 3H03A 3QYTA 3HPIA 3Q26A 1UTHB 4MFIA 4ZZAA 1VR5A 1MXUA 1NKXA 3H6TA 3E78A 3C34A 1R9LA 5ELVA 3JV9A 1NV5A 3TTLA 1EZPA 4TLMB 1MPDA 1FQBA 4G8MA 4GWOA 4N6PA 1JW4A 1DMBA 1JEUA 2Z8EA 3T22A 2XXIA 4GQOA 1B32A 3HHGA 4M1VA 3EHTA 3QUJA 2UYFA 3N26A 1YTVA 4NG7A 2R8TA 3FZVA 3DELB 3PMVA 4LVQA 3TQWA 3KC0A 4GF8A 4F3BA 1USYE 3UK4A 4I8CA 1FBEA 2HQ0A 1FBHA 2GFEA 3H3GA 3RYDA 1O64A 2L5VA 2O51A 1NUYA 1NUXA 4GRKA 1Y4TA 1NV1A 1M5CA 3PPOA 2REGA 2F34A 4U1OA 1SQYA 1SI1A 4H45A 4MMPA 4O3AA 4FE8A 5CMBA 4U22A 3VLVA 3CVGA 3R26A 2XA5A 2UVGA 4FATA 3PV0E 4HTGA 2Q2AA 5CRYA 2D5WA 3MP8A 3N6TA 3PUWE 4MNIA 4NF5A 2YPNA 4PFRA 2XWIA 4O94A 4P3LA 2CZHA 3IB2A 3PUZE 4RA1A 3Q25A 4EQ7A 5JTYA 3M3FA 2XXYA 3IAZA 1LBVA 1FBGA 2D3IA 2GH9A 3W9VA 3OO9A 3MP1A 2HCAA 2Q8MA 4P9KA 5I2NB 3FGSA 3G7WA 3T0JA 3E9XA 1FJ6A 4N81A 3RTFB 4AQ4A 4LZ7A 5I5PA 1UTBA 2OWTA 4QSCA 2HHMA 4HS7A 2PYYA 4JVCA 5KCJB 3PMXA 5TU0A 4PFYA 1N3WA 2I58A 4JWOA 2Q74A 4KR5A 1MXWA 4FIMA 2R6GE 2HAVA 3KG2A 4LONB 5H8QA 2DS9A 4P11A 2XXTA 2H98A 3S9EA 4YICA 3TPAA 4ELPA 2O68A 3KBZA 3Q29A 2OWZA 3HV1A 1DSNA 2XD3A 1OVTA 5TP9B 2H4IA 3O66A 2I49A 1KA0A 4EUOA 4PF6A 3GZGA 1M5EA 4ZEDA 4WXJA 2DQVA 4NWCA 1QGXA 4KYDA 1Y4CA 2OWSA 1TFDA 4I40A 1H44A 4OWDA 3KN8A 4H0WA 3HHFA 3IK6B 2V3TA 2H9BA 4KCDA 4QFOA 3SKPA 5CM6A 1B0LA 1NNFA 3MW0A 1LBZA 3T1BA 5DW8A 4FEDA 4R6YA 3KSXA 4PBHA 1ZMGA 2UVJA 3LR1A 5J16A 4JB7A 1BP5A 1VFEA 1EYKA 1D9VA 3BBRA 3PUVE 3RPLA 1GTKA 3V8XB 1MXZA 5DVFA 2VP1A 2QMXA 3QXMA 5ITOA 5CMCA 2X7QA 3TTRA 2Y7KA 2F8DA 1LB8A 1QW0A 3SDFA 4PTKA 4JWXA 3RPLB 4GWUA 1YAEA 3U65A 1LBBA 3OO6A 3UGWA 4PE3A 3T9XB 5JK4A 3ONMA 4K3FA 5IM2A 3VFJA 2ZYOA 2ZYKA 3IOUA 1SW4A 3KEIA 2PT1A 4O7IA 4OFOA 2DOJA 3IORA 4H67A 2B4LA 3O29A 2QVVA 2F6GA 1SVXB 4KHZE 3PMWA 1LCFA 2NXOA 5ET6A 1A55A 3IX1A 4F3PA 5A5XA 2A5SA 3UORA 1JVYA 5DVJA 3RLFE 2FBPA 2THIA 3CSBA 3TYHA 1S9TA 1YYZA 5CBRA 1N0TA 2IA4A 4X48A 4QSDA 3FJMA 1NMUA 2XX8A 5TP9A 3BFTA 3G3GA 4H65A 3SZPA 1VSOA 3RUMA 4AB6A 1XC1A 3KC1A 2XX7A 4JXIA 1N76A 4IY5A 1M5BA 5DTBA 3PUYE 3K0VA 1PBPA 2HAUA 2XHDA 2ZMBA 1WODA 4ESXA 4QFNA 3FD3A 2REJA 3C35A 3I3VA 4OVTA 5KCJA 4OHNA 5EYHA 5H8HA 4YAHX 2PMSA 1UTBB 3G3FA 1JNFA 3LV0A 4ISUA 4NWDA 3LUYA 2XX9A 2XXQA 2NWJA 1B5IA 2VGQA 2Q89A 5TPAB 5I56A 1INPA 2P0SA 2AL5A 1RDZA 2FHYA 1FQDA 3CG3A 3A3CA 2B3FA 1YZ0A 5JTYB 4DXBA 2NOOA 4O3CA 3RY3A 4RK2A 4OQOA 3HSTA 4OENA 4MBPA 4U21A 1UIVA 3MVYA 4NF5B 5ET5A 3K6VA 4EQBA 1YPNA 3IB1A 1N04A 5IZZA 2XXWA 1MH3A 1IZ1A 1PB9A 1DOTA 4MH5A 4NEDA 1TXFA 3A09A 3FUZA 1IXGA 3Q27A 1LAXA 1JEVA 2QS1A 4HE1A 1QUIA 1OQGA 3BIHA 1HSJA 1K9YA 3ZKLA 1B5JA 3LSWA 1LEVA 1IEJA 1FTJA 2G93A 3AXFA 4QF9A 4PAFA 5DT6A 3B7DA 2PCRA 2Y84A 1IMBA 1FQCA 1NV6A 1SW5A 1IQ7A 3KFMA 2QS3A 3RN8A 3OO8A 3PUXE 5ET8A 2Z8FA 4ELRA 1T0KA 4AS4A 4XKNA 3TCHA 1O63A 3FV2A 4EF2A 3FJGA 3BKIB 3N94A 1PB8A 5KDTA 2F5XA 3MZ9A 1GV8A 4GWXA 5J1DA 4Q8RA 4DCYA 1UTHA 1URDA 2A5TA 1BKAA 3LSLA 2HPGA 1MDP1 4KPTA 1BK4A 2ZZWA 3SETA 1P1UA 5EQAA 2F3BA 1B9JA 3C4MA 1FTLA 2YJPA 4G68A 4G8NA 3DP6A 2AIXA 3FATA 2CEXA 1Y3NA 2F97A 3MPLA 2ANJA 4N91A 2Y5LA 1RDYA 4YMBA 3S9MC 3R7XA 1MM6A 3B6QA 5F1QA 2V4CA 1N7WA 4R75A 4JVIA 2ZZVA 3IJOB 5ET7A 2V93A 5I58B 3TUSA 1RKMA 3TMGA 3TCFA 3RPWA 4XKPA 1R1NA 4GX4A 3C32A 2I4CA 2Z22A 4IR8A 1OLAA 4UABA 3EKIA 3V83A 1B7ZA 3TTMA 4GX6A 1A8FA 3F11A 4GWSA 3MC2A 4BDLA 4G77A 1Y3QA 2QFLA 1B3GA 2P3NA 4HE0A 4C0RA 1IMEA 4Z0IA 1FPJA 4NAPA 4FORA 3T66A 3ISPA 3LSXA 2DE2A 1RYOA 3S4UA 1P99A 3DM0A 1ELJA 2GHBA 3SEVA 1MDQA 3QMFA 4NMYA 5EQ7A 4N6KA 1JW5A 2I0CA 3T9UA 2I48A 5ITPA 4G4PA 4TOZA 4EXLA 1FPBA 3MWBA 2XWKA 2CMOA 1FCKA 3W9WA 3TEPA 1UQWA 3VLWA 4IY6A 3PD8A 3OEKA 1Y20A 4H1XA 2WYPA 5EHMA 1OLCA 2HXRA 1VE4A 1B1HA 2QMWA 1PC3A 1NH7A 2R9JA 2WKYA 4NF8B 3PU5A 5EYFA 3EHUA 3KOTA 4UA8A 3K1PA 2QVRA 4YB6A 1DK4A 5LOMA 1CNQA 1FPDA 2V3QA 4GLIA 3B50A 4N13A 2PFYA 4EXKA 1QKBA 2YLNA 2XWOA 1LBYA 1JQFA 4XKQA 1URGA 1RDXA 4N17A 1FBFA 3OSRA 2B4MA 2Q2CA 3USDA 4ELOA 1LSTA 4QSEA 4R72A 3V89B 1NNPA 1MY3A 2FIEA 4PFTA 3TFLA 1AMFA 1US5A 5K2YA 1H43A 4IGRA 4DI3D 4ZEKA 4RPOA 3O9PA 3RT6B 5DYHA 1P1NA 1POTA 1I69A 2XXPA 1IXCA 3U1OA 5H8NA 4NGUA 5IGAA 5H8NB 3MP6A 1P1WA 4R74A 3IFAA 1RYXA 3CR9A 2F35A 4U2RA 3UA8A 1B3HA 3FVOA 1NFTA 2QS4A 5L9SA 2H5YA 1QULA 3LUZA 2CZKA 1Y9UA 4MHFA 1NV3A 2Q88A 4I3EA 4OXVA 1A8EA 4ZEFA 3IR1A 4I1DA 2HXWA 1AWBA 4MF3A 4IO2A 3OOAA 3MAMA 3OMBA 2VHAA 4F18A 2V84A 2Q8JA 5LTCA 3QK6A 4ND9A 1XVXA 3O6IA 1FPKA 1D9YA 3K01A 4NF8A 4GL8A 1OMPA 1URSA 2ZZXA 5AA2B 3KJ7A 4M4GA 2F6PA 1B3EA 4OERA 4E0XA
chains in the Genus database with same CATH topology
1LBYA 1NV0A 1YYZA 4LN5A 3B8BA 4HE1A 1IMAA 1RDXA 1LBVA 1FBGA 1FBFA 4GWZA 1LBZA 2HZKA 2FIXA 4N17A 4PFIA 2VT5A 1NV4A 2B4MA 1FBPA 3BIHA 3T1BA 4GX4A 5IZ3A 3IFCA 3W9VA 4MNPA 4N8YA 1K9YA 5DW8A 3ROJA 2Q8MA 4IR8A 4GX3A 2FIEA 4P9KA 4PDDA 4HCYA 1NI9A 1NUWA 1JP4A 2FVZA 2QVUA 3GYYA 1FBDA 4PBHA 3SZPA 3T0JA 4PC9A 1LEVA 3EKIA 1FJ6A 4UABA 4PDHA 4N81A 5IM2A 4NHBA 4OANA 5EYGA 4GBVA 4I3YA 4OVRA 5J16A 2OX3A 1SPIA 4F1UA 4P56A 4OVPA 4DI3D 5I5PA 4HE2A 4PAFA 1FTAA 4XF5A 1EYKA 3KC1A 4OVQA 4GX6A 2PCRA 3E78A 4P8BA 2HHMA 3RPLA 4GWSA 4JVCA 2MKZA 2VPNA 1VDWA 1IMBA 2DDKA 2VPOA 5CM6A 1NV6A 2QPQA 1NV5A 1YXIA 2WBBA 1FBCA 2Q74A 4F19A 5ET8A 2QFLA 1IMCA 1K9ZA 2P3NA 4HE0A 3D1RA 5IZ1A 5A5LA 4MAGA 4NGUA 5IGAA 1KA1A 1DCUA 4MCOA 4AS4A 1EYIA 3FXBA 4X9TA 1IMEA 4NN3A 4NQ8A 4MX6A 4PF8A 1FPJA 4NAPA 3IFAA 4H46A 4N8GA 3ISPA 4PETA 3HFUA 4F1VA 2JJKA 5LDZA 4M1VA 4JVDA 1FPGA 2DE2A 4GWYA 4YICA 4OVTA 4KXPA 4GBWA 4PTKA 5EYHA 3RPLB 1FPEA 4GWUA 4NG7A 3U65A 5I7IA 2DVZA 2F5XA 2R8TA 3LV0A 4HCWA 4MEVA 3QMFA 2KR0A 4N4UA 2CEYA 4PAKA 3W9WA 4AS5A 3KBZA 4GWXA 5EQ7A 3KC0A 2OWZA 4N6KA 3LUZA 1EYJA 4O7MA 4PE3A 4X8RA 1FPFA 4XEQA 5T3JA 5J1DA 5JK4A 2CZKA 1INPA 1FPBA 1FRPA 2Q9TA 4OVSA 1FBEA 1G0HA 4MHFA 4P47A 1FBHA 2HZLA 2HPGA 1FPLA 1NV3A 1RDZA 2XWKA 2XWVA 3A29A 3E79A 4N6DA 1DBZA 3RYDA 1IMFA 2L5VA 4I3EA 1BK4A 2XXKA 1FPIA 2FHYA 1NUYA 1KA0A 2ZZWA 4XFEA 5IZ3B 4QBAA 4PCDA 1LBXA 1LBWA 1NUXA 4O7IA 4DI4B 3PTYA 4X04A 1AWBA 1NV1A 4HXVA 4O8MA 4QXDA 5EQAA 2F3BA 1YZ0A 2B4LA 4FBPA 4P1LA 2KQZA 4PF6A 5EQ8A 5F24A 2Y5KA 4PBQA 2BJIA 2WYPA 1D9QA 4H45A 4PAIA 4MMPA 1NV7A 2HXRA 2QVVA 2CZIA 2DE3A 1KZ8A 2CEXA 2GQ1A 4F18A 1NV2A 1XI6A 2WEFA 2WX9A 1QGXA 2WYKA 4N91A 2Y5LA 1RDYA 5ET5A 5LTCA 2F3DA 2DE4A 2XA5A 3FBPA 2P3VA 4PGPA 3CHGA 5I3SA 3MSTA 4MJOA 1FPKA 2V4CA 4G61A 5IZZA 2QVRA 3NOHA 4I40A 4NX1A 1DK4A 5ET6A 4JVIA 5EQ9A 1NUZA 4YZZA 1CNQA 2ZZVA 4MNIA 4OA4A 1G0IA 4MIJA 1FPDA 4N15A 4P1EA 4PFBA 5ET7A 2V3QA 4PFRA 2ZZXA 1IMDA 1Q9DA 2XWIA 3B50A 3MYUA 2PFYA 4O94A 5FBPA 4NF0A 2PFZA 4P3LA 2FBPA 1FSAA 4GWWA 4PGNA 2CZHA 2WBDA 2XWOA 5ESYA 4MNCA 1FJ9A 3BIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LN5 A;  4N17 A;  4PFI A;  2HZK A;  4MNP A;  4N8Y A;  4P9K A;  4PDD A;  4PBH A;  3GYY A;  4PC9 A;  4UAB A;  4PDH A;  4NHB A;  4OAN A;  4OVR A;  4P56 A;  4OVP A;  4DI3 D;  5I5P A;  4PAF A;  4XF5 A;  4OVQ A;  4P8B A;  2VPN A;  2VPO A;  4MAG A;  4NGU A;  5IGA A;  4MCO A;  3FXB A;  4NN3 A;  4NQ8 A;  4MX6 A;  4PF8 A;  4NAP A;  4N8G A;  4PET A;  4YIC A;  4OVT A;  4NG7 A;  3U65 A;  5I7I A;  4N4U A;  4MEV A;  4PAK A;  2CEY A;  4X8R A;  4N6K A;  4O7M A;  4PE3 A;  4XEQ A;  4P47 A;  4OVS A;  5IM2 A;  4MHF A;  2HZL A;  2HPG A;  2XWK A;  2XWV A;  4N6D A;  2XXK A;  2ZZW A;  4XFE A;  4PCD A;  4DI4 B;  4X04 A;  4O8M A;  4PF6 A;  4P1L A;  4PBQ A;  2WYP A;  4PAI A;  4MMP A;  2CEX A;  2WX9 A;  2WYK A;  4N91 A;  5LTC A;  2XA5 A;  4PGP A;  2V4C A;  5IZZ A;  4NX1 A;  4YZZ A;  2ZZV A;  4MNI A;  4OA4 A;  4N15 A;  4MIJ A;  4P1E A;  4PFB A;  4PFR A;  2ZZX A;  2XWI A;  3B50 A;  2PFY A;  4O94 A;  4NF0 A;  2PFZ A;  4P3L A;  4PGN A;  2XWO A;  5CM6 A;  4MNC A; 
#chains in the Genus database with same CATH topology
 4LN5 A;  4RK9 A;  1B7H A;  2RKM A;  4GWZ A;  4F2O A;  1M5F A;  4R73 A;  3CRB A;  4NF4 A;  4GXA A;  1LBC A;  4ONY A;  4HCY A;  3GYY A;  5H8F A;  4PDH A;  4DXC A;  1POY 1;  2F78 A;  4OES A;  4ZDM A;  4GXS B;  2DWA A;  1SDX A;  4PQJ A;  3RNN A;  2OZZ A;  4H6D A;  3K6W A;  1B0H A;  3O2A A;  3M8U A;  2ONR A;  4X1D A;  1DCU A;  1IXI A;  4PET A;  3R6U A;  3O97 A;  1FPG A;  1ANF A;  4KXP A;  1ZLQ A;  4GBW A;  2ZNT A;  4OZ9 A;  4ESW A;  2AL4 A;  3WAE A;  1JET A;  5CBS A;  5L9O A;  4RYA A;  1OQH A;  3ILT B;  3G3I A;  4N6D A;  3M3L A;  2XXK A;  2ZYM A;  5IZ3 B;  4XFE A;  1EZ9 A;  4O8M A;  3SER A;  5EQ8 A;  3G3K A;  5B70 A;  3UP9 A;  4IB2 A;  1XT8 A;  4I9D A;  1B6H A;  5I58 A;  4HW8 A;  3VE1 B;  3O6H A;  4MJO A;  5I59 A;  1KWH A;  4BDM A;  4NF6 A;  5CI5 A;  3VXC A;  4NX1 A;  4MLQ A;  1NL5 A;  3G3H A;  3VVF A;  4N15 A;  3PD9 A;  3IO6 A;  3FIR A;  4XTC Q;  2OCU A;  3V5A A;  3LBS A;  2BJJ X;  1ZBM A;  3K6X A;  5FTI A;  4G68 B;  4PGN A;  1TFA A;  4MNC A;  2PBW A;  3C33 A;  1IMA A;  4YKK A;  3FVN A;  4PFI A;  2FIX A;  2Y7R A;  2NUV A;  4QFP A;  2DWJ A;  4EDP A;  4GX3 A;  1Q1K A;  1FBD A;  1MS7 A;  4BDO A;  2VD2 A;  1I6B A;  4PFW A;  4I3Y A;  2OX3 A;  3L6H A;  2RF1 A;  5KDT B;  4TLL B;  4OEV A;  2QPQ A;  3RTW B;  1OIB A;  1YXI A;  4JWY A;  1NNT A;  1MQI A;  1SYH A;  3VVE A;  1MQG A;  3IOV A;  4MX6 A;  4OFJ A;  1MG1 A;  4I62 A;  4RPN A;  4JVD A;  5F7V A;  2I6E A;  4LZ5 A;  3B6T A;  1B46 A;  3CSG A;  3G3J A;  4HCW A;  4U23 A;  5AA3 A;  5I2K B;  2DXY A;  2XXV A;  1BLF A;  3GBA A;  2Q9T A;  4LAT A;  5A5L A;  4MLV A;  4GOT A;  1YCJ A;  3ODB A;  4OVJ A;  5IKB A;  2Y7W A;  2O84 X;  4O3B A;  1ZU0 A;  5CMK A;  2Y5K A;  2BJI A;  1R6Z A;  2UXA A;  1KZ8 A;  4LQ5 A;  1XI6 A;  4DCX A;  1ZIU A;  2F3D A;  4ZZE A;  3A3U A;  4GFR A;  4G8H A;  1XOC A;  2XXU A;  4OA4 A;  1MXV A;  4ZE9 A;  1LFI A;  1N84 A;  5FBP A;  3FAS A;  4QFL A;  1SW1 A;  4Q0C A;  1A7L A;  3CFX A;  5I57 B;  4F1U A;  5DEX B;  3TOD A;  3K1N A;  5L8D A;  3MZ1 A;  4PDD A;  5TPA A;  5I56 B;  4U4X A;  4G2Z A;  1CB6 A;  3S2V A;  4OVP A;  1QJM A;  4XF5 A;  2OK2 A;  2G29 A;  5H8H B;  1BTJ A;  1L5T A;  3GBB A;  2WBB A;  1H76 A;  3O28 A;  1XHY A;  1VFD A;  3ZKK A;  3K1M A;  1IXH A;  2V3U A;  1KA1 A;  2I3W A;  2QRY A;  2ONS A;  4N8G A;  4GWY A;  1DTG A;  1MRP A;  2UVH A;  3K6U A;  3EQ1 A;  2Y7P A;  3IL1 B;  3OXN A;  4Q30 B;  4H5F A;  4OVS A;  4F29 A;  3U8Q A;  4C1T A;  1FPI A;  4YKI A;  1LBW A;  1SI0 A;  5B7D A;  1B3F A;  1J1N A;  5AE4 A;  3KBR A;  3U72 A;  3CI8 A;  2UVI A;  4RY1 A;  3KJT A;  3IB0 A;  2DWI A;  2ONK E;  1PEB A;  3SEX A;  4LA9 A;  4DDD A;  2DVC A;  5A5X B;  2OJT A;  2P3V A;  3JYR A;  4G61 A;  3VDF A;  4P0I A;  3QSL A;  1IUD A;  5EQ9 A;  5HBC A;  4MIJ A;  4PFB A;  3HN0 A;  1IMD A;  4YB5 A;  1B4Z A;  4NF0 A;  3PPR A;  4DXU A;  5BWJ A;  1D4N A;  1FTK A;  1NNK A;  5ICQ A;  2VD3 A;  3IFC A;  4MNP A;  5CMM A;  1NI9 A;  1JP4 A;  2QVU A;  4U1Z A;  4OTE A;  4OAN A;  4POW A;  3E13 X;  1P1Q A;  4P8B A;  3JZJ A;  3K00 A;  1B05 A;  4KFQ A;  3HCQ A;  2DDK A;  4THI A;  2VPO A;  2Z8D A;  3DP4 A;  2D21 A;  4RNS A;  3LSF B;  1Z7M E;  1PDA A;  3D1R A;  4QRZ A;  3RGY A;  2R71 A;  3MVW A;  2PT2 A;  4PF8 A;  4F2Q A;  3O6G A;  1WDN A;  4C1U A;  2JJK A;  1JVX A;  2PVU A;  2UYE A;  2ESN A;  3CFZ A;  2ZNS A;  5I7I A;  4GL0 A;  2KR0 A;  2XXX A;  1H45 A;  4O7M A;  2RC8 A;  3H7M A;  1FW0 A;  1FRP A;  1FTM A;  4AB5 A;  1DBZ A;  3QIM A;  2XXH A;  4R2B A;  1PBQ A;  4P1L A;  2KQZ A;  1WVJ A;  2P2A A;  1XS5 A;  2H25 A;  1EU8 A;  2CZI A;  4R6H A;  2O7I A;  3I5O A;  1B2H A;  5EHS A;  2ABH A;  4IO3 A;  5KZT A;  3P7I A;  1CE2 A;  3OEL A;  3NOH A;  4IO5 A;  2F7C A;  2W7Y A;  1NUZ A;  2NVU B;  3H4Z A;  2XD2 A;  3MYU A;  1DPP A;  4PE5 B;  1Y1M A;  5ESY A;  2WBD A;  1EH3 A;  1FJ9 A;  3S9N C;  2I0B A;  1S50 A;  3TKD A;  3B8B A;  4LQ2 A;  4YU0 A;  4QFK A;  1ATG A;  4N8Y A;  4OET A;  3MQ9 A;  2IEE A;  3VV5 A;  2RCA A;  1FTA A;  4QHQ A;  3SEW A;  4BDN A;  2DSF A;  2F7A A;  4R2F A;  5H8Q B;  5IZ1 A;  4MAG A;  4U4S A;  3N6U A;  2PX1 A;  4F1V A;  4OYV A;  5AA2 D;  1GR2 A;  1FPE A;  3KZG A;  2O1M A;  4MEV A;  2CEY A;  4PAK A;  4KD5 A;  2GRV A;  3EN3 A;  5T3J A;  5ISU A;  3VXB A;  4XIG Q;  1N7X A;  3KGC A;  3GLB A;  5I2N A;  1MM7 A;  3GXA A;  3IOW A;  5DEX A;  4ZEI A;  4X04 A;  3C9H A;  4QXD A;  3QAX A;  5F24 A;  5I57 A;  4FBP A;  4LZ8 A;  4XKR A;  1MPC A;  1LFH A;  1HSE A;  4LP2 B;  2GQ1 A;  3SES A;  3FBP A;  2RC9 A;  3CHG A;  5L9M A;  1SYI A;  4YZZ A;  1S7Y A;  4DIG A;  4IO6 A;  3T96 B;  1H3D A;  3TTN A;  4OEU A;  2F7B A;  4Q5T A;  2VT5 A;  1GVC A;  4RJZ A;  1B52 A;  3FXU A;  5AA1 A;  1F9B A;  2DYX A;  3SEY A;  5H8S A;  4NTL A;  2ZXT A;  1MQJ A;  5I2K A;  4GBV A;  4L17 A;  5HPQ A;  3FVG A;  4KI0 E;  3W15 C;  1MQD A;  2MKZ A;  4POX A;  1MXX A;  3U94 A;  1Y1Z A;  2X7P A;  3D4G A;  4ELQ A;  2HEU A;  5ICT A;  4PFU A;  1ZTY A;  4MCO A;  5DVI A;  3FXB A;  3HFU A;  4R9G A;  4GVO A;  1MXY A;  5K2X A;  1ZKB A;  4X1B A;  4P0G A;  3TAJ A;  4AS5 A;  2VOZ A;  3S9L C;  3KN3 A;  4DLD A;  1FPF A;  3RQT A;  1B4H A;  4RXL A;  2DWH A;  1G0H A;  3A29 A;  3MUQ A;  4YKJ A;  1DTZ A;  3IJX B;  4DI4 B;  1LBX A;  4H8I A;  4BDR A;  1D9Q A;  1NV7 A;  2DE3 A;  3M3K A;  1NV2 A;  2E1S A;  4IGT A;  3H6V A;  4NF6 B;  1B40 A;  1EZO A;  5I59 B;  3T9V A;  3TQL A;  3VVD A;  4FEC A;  3H6W A;  3EHS A;  3PPP A;  3T9H B;  1XVY A;  1B5H A;  4R6K A;  1GGG A;  2LAO A;  4WKM A;  3ZSF A;  3MPK A;  1NV0 A;  3N5L A;  2B65 A;  1A54 A;  2E0S A;  5IZ3 A;  3MJN A;  3RT8 A;  2M8C A;  4KQP A;  2FVZ A;  4KCC A;  1I6A A;  1QKA A;  4P56 A;  1A40 A;  1MY4 A;  5FHM A;  1VDW A;  4IO7 A;  1TT1 A;  1FQE A;  1IMC A;  1P1O A;  2I3V A;  4F39 A;  1MY2 A;  4JSO A;  3UIF A;  4DZ1 A;  2OLB A;  4N07 A;  1SBP A;  3ILU B;  4BDQ A;  4BLA A;  4NE4 A;  2DVZ A;  1AOV A;  4N4U A;  3QUF A;  2DXR A;  4X8R A;  3MBP A;  5FHO A;  5H8F B;  2KLF A;  4P47 A;  1JW1 A;  1LB9 A;  3MVX A;  1FPL A;  2XWV A;  3UN6 A;  5JEI A;  1IMF A;  4NF4 B;  1AH5 A;  4QBA A;  4PCD A;  3DP8 A;  3PPN A;  3PTY A;  1IIW A;  3T93 B;  1B7U A;  4PBQ A;  3KSJ A;  1LCT A;  5AA2 A;  3C36 A;  4EF1 A;  2WEF A;  1UIU A;  5FTH A;  2DE4 A;  3MST A;  1A99 A;  1FTO A;  3PPQ A;  4JSD A;  1Q9D A;  2PFZ A;  1USY H;  4KYS A;  1FSA A;  4F1Y A;  4PP0 A;  4JBZ A;  1SW2 A;  5CC2 A;  3IO4 A;  2QSX A;  1LAH E;  1FBP A;  3HO7 A;  2O1L A;  4JDF A;  3C31 A;  4PC9 A;  2H99 A;  4NHB A;  1Z7N E;  3H6U A;  4GIZ A;  4OVR A;  1SPI A;  1B51 A;  2FNC A;  5HM4 B;  1B58 A;  2GHA A;  5AA4 B;  1I6Q A;  4FEB A;  5FHN A;  1OVB A;  3K4U A;  4E0W A;  5IAI A;  2VPN A;  3TEL A;  3EPE A;  2RC7 A;  4IO4 A;  1AIV A;  1M5D A;  2FYI A;  4WED A;  1QUK A;  1K9Z A;  3SEU A;  4YMA A;  4NQ8 A;  1MQH A;  4H46 A;  3OO7 A;  2I4B A;  1D3K A;  1LLS A;  3DLN A;  1Y3P A;  4R9F A;  3FXR A;  5AA4 A;  4FJP A;  1SD3 A;  3FV1 A;  1US4 A;  3TZA A;  1EYJ A;  2P1S A;  1MH4 A;  1LFG A;  3OD7 A;  4ZE8 A;  3E79 A;  4H8J A;  4TQU Q;  4ZEC A;  2QS2 A;  3CG1 A;  4OMB A;  2ALU A;  4HXV A;  3OEN A;  5BUU A;  2FA7 A;  4GD5 A;  1Q35 A;  3BFU A;  3E3K A;  5M2V A;  3TTK A;  1LAG E;  1QUJ A;  3ZS6 A;  1LAF E;  3ECR A;  4H5G A;  1O7T A;  2XXR A;  4DE8 A;  2O7U A;  3K02 A;  3KN7 A;  4YB7 A;  3L6G A;  4F22 A;  3FXQ A;  1G0I A;  4FAJ A;  1BIY A;  3I6V A;  1ZJL A;  1FQF A;  3PGF A;  1NH8 A;  2HFB A;  4OFL A;  4KYE A;  1FQA A;  4XXU A;  1N3X A;  2HZK A;  1TWY A;  3FJ7 A;  3ROJ A;  2O6A A;  2QJE A;  2CZL A;  3K2D A;  1MY0 A;  1PB7 A;  1II5 A;  2Y7I A;  2OBG A;  3THI A;  4F3S A;  4YKP A;  5EYG A;  3OSQ A;  3IOT A;  1HSL A;  4HE2 A;  3U93 A;  3WAF A;  2RIN A;  4OVQ A;  3VLU A;  3MZB A;  2QL3 A;  2B3B A;  4Z7E A;  2DP8 A;  1AL3 A;  1FBC A;  1B3L A;  3CFL A;  4F19 A;  2AYS A;  3D4C A;  1EYI A;  4X9T A;  4NN3 A;  3TDJ A;  1B1X A;  1QVS A;  1R9Q A;  5LDZ A;  2O69 A;  3FVK A;  1MPB A;  3B6W A;  3MVZ A;  3EF7 A;  2V25 A;  4XEQ A;  5I84 A;  2HZL A;  3TCG A;  3KOS A;  3U92 A;  4F3G A;  1LGB C;  2Z23 A;  4ZS9 A;  3H06 B;  4PAI A;  4ECF A;  3OEM A;  2ZYN A;  4ZEB A;  4F31 B;  2WX9 A;  2WYK A;  4PGP A;  4G68 C;  5I3S A;  1MY1 A;  1IIT A;  3E4R A;  4P1E A;  4UAC A;  4GWW A;  3LC8 A;  3BIG A;  3Q28 A;  4LUB A;  1NV4 A;  4EQ9 A;  2F36 A;  2RCB A;  3CIJ A;  2ZNU A;  4WEP A;  1NUW A;  2A5T B;  1DPE A;  2X26 A;  3H03 A;  3QYT A;  3HPI A;  3Q26 A;  1UTH B;  4MFI A;  4ZZA A;  1VR5 A;  1MXU A;  1NKX A;  3H6T A;  3E78 A;  3C34 A;  1R9L A;  5ELV A;  3JV9 A;  1NV5 A;  3TTL A;  1EZP A;  4TLM B;  1MPD A;  1FQB A;  4G8M A;  4GWO A;  4N6P A;  1JW4 A;  1DMB A;  1JEU A;  2Z8E A;  3T22 A;  2XXI A;  4GQO A;  1B32 A;  3HHG A;  4M1V A;  3EHT A;  3QUJ A;  2UYF A;  3N26 A;  1YTV A;  4NG7 A;  2R8T A;  3FZV A;  3DEL B;  3PMV A;  4LVQ A;  3TQW A;  3KC0 A;  4GF8 A;  4F3B A;  1USY E;  3UK4 A;  4I8C A;  1FBE A;  2HQ0 A;  1FBH A;  2GFE A;  3H3G A;  3RYD A;  1O64 A;  2L5V A;  2O51 A;  1NUY A;  1NUX A;  4GRK A;  1Y4T A;  1NV1 A;  1M5C A;  3PPO A;  2REG A;  2F34 A;  4U1O A;  1SQY A;  1SI1 A;  4H45 A;  4MMP A;  4O3A A;  4FE8 A;  5CMB A;  4U22 A;  3VLV A;  3CVG A;  3R26 A;  2XA5 A;  2UVG A;  4FAT A;  3PV0 E;  4HTG A;  2Q2A A;  5CRY A;  2D5W A;  3MP8 A;  3N6T A;  3PUW E;  4MNI A;  4NF5 A;  2YPN A;  4PFR A;  2XWI A;  4O94 A;  4P3L A;  2CZH A;  3IB2 A;  3PUZ E;  4RA1 A;  3Q25 A;  4EQ7 A;  5JTY A;  3M3F A;  2XXY A;  3IAZ A;  1LBV A;  1FBG A;  2D3I A;  2GH9 A;  3W9V A;  3OO9 A;  3MP1 A;  2HCA A;  2Q8M A;  4P9K A;  5I2N B;  3FGS A;  3G7W A;  3T0J A;  3E9X A;  1FJ6 A;  4N81 A;  3RTF B;  4AQ4 A;  4LZ7 A;  5I5P A;  1UTB A;  2OWT A;  4QSC A;  2HHM A;  4HS7 A;  2PYY A;  4JVC A;  5KCJ B;  3PMX A;  5TU0 A;  4PFY A;  1N3W A;  2I58 A;  4JWO A;  2Q74 A;  4KR5 A;  1MXW A;  4FIM A;  2R6G E;  2HAV A;  3KG2 A;  4LON B;  5H8Q A;  2DS9 A;  4P11 A;  2XXT A;  2H98 A;  3S9E A;  4YIC A;  3TPA A;  4ELP A;  2O68 A;  3KBZ A;  3Q29 A;  2OWZ A;  3HV1 A;  1DSN A;  2XD3 A;  1OVT A;  5TP9 B;  2H4I A;  3O66 A;  2I49 A;  1KA0 A;  4EUO A;  4PF6 A;  3GZG A;  1M5E A;  4ZED A;  4WXJ A;  2DQV A;  4NWC A;  1QGX A;  4KYD A;  1Y4C A;  2OWS A;  1TFD A;  4I40 A;  1H44 A;  4OWD A;  3KN8 A;  4H0W A;  3HHF A;  3IK6 B;  2V3T A;  2H9B A;  4KCD A;  4QFO A;  3SKP A;  5CM6 A;  1B0L A;  1NNF A;  3MW0 A;  1LBZ A;  3T1B A;  5DW8 A;  4FED A;  4R6Y A;  3KSX A;  4PBH A;  1ZMG A;  2UVJ A;  3LR1 A;  5J16 A;  4JB7 A;  1BP5 A;  1VFE A;  1EYK A;  1D9V A;  3BBR A;  3PUV E;  3RPL A;  1GTK A;  3V8X B;  1MXZ A;  5DVF A;  2VP1 A;  2QMX A;  3QXM A;  5ITO A;  5CMC A;  2X7Q A;  3TTR A;  2Y7K A;  2F8D A;  1LB8 A;  1QW0 A;  3SDF A;  4PTK A;  4JWX A;  3RPL B;  4GWU A;  1YAE A;  3U65 A;  1LBB A;  3OO6 A;  3UGW A;  4PE3 A;  3T9X B;  5JK4 A;  3ONM A;  4K3F A;  5IM2 A;  3VFJ A;  2ZYO A;  2ZYK A;  3IOU A;  1SW4 A;  3KEI A;  2PT1 A;  4O7I A;  4OFO A;  2DOJ A;  3IOR A;  4H67 A;  2B4L A;  3O29 A;  2QVV A;  2F6G A;  1SVX B;  4KHZ E;  3PMW A;  1LCF A;  2NXO A;  5ET6 A;  1A55 A;  3IX1 A;  4F3P A;  5A5X A;  2A5S A;  3UOR A;  1JVY A;  5DVJ A;  3RLF E;  2FBP A;  2THI A;  3CSB A;  3TYH A;  1S9T A;  1YYZ A;  5CBR A;  1N0T A;  2IA4 A;  4X48 A;  4QSD A;  3FJM A;  1NMU A;  2XX8 A;  5TP9 A;  3BFT A;  3G3G A;  4H65 A;  3SZP A;  1VSO A;  3RUM A;  4AB6 A;  1XC1 A;  3KC1 A;  2XX7 A;  4JXI A;  1N76 A;  4IY5 A;  1M5B A;  5DTB A;  3PUY E;  3K0V A;  1PBP A;  2HAU A;  2XHD A;  2ZMB A;  1WOD A;  4ESX A;  4QFN A;  3FD3 A;  2REJ A;  3C35 A;  3I3V A;  4OVT A;  5KCJ A;  4OHN A;  5EYH A;  5H8H A;  4YAH X;  2PMS A;  1UTB B;  3G3F A;  1JNF A;  3LV0 A;  4ISU A;  4NWD A;  3LUY A;  2XX9 A;  2XXQ A;  2NWJ A;  1B5I A;  2VGQ A;  2Q89 A;  5TPA B;  5I56 A;  1INP A;  2P0S A;  2AL5 A;  1RDZ A;  2FHY A;  1FQD A;  3CG3 A;  3A3C A;  2B3F A;  1YZ0 A;  5JTY B;  4DXB A;  2NOO A;  4O3C A;  3RY3 A;  4RK2 A;  4OQO A;  3HST A;  4OEN A;  4MBP A;  4U21 A;  1UIV A;  3MVY A;  4NF5 B;  5ET5 A;  3K6V A;  4EQB A;  1YPN A;  3IB1 A;  1N04 A;  5IZZ A;  2XXW A;  1MH3 A;  1IZ1 A;  1PB9 A;  1DOT A;  4MH5 A;  4NED A;  1TXF A;  3A09 A;  3FUZ A;  1IXG A;  3Q27 A;  1LAX A;  1JEV A;  2QS1 A;  4HE1 A;  1QUI A;  1OQG A;  3BIH A;  1HSJ A;  1K9Y A;  3ZKL A;  1B5J A;  3LSW A;  1LEV A;  1IEJ A;  1FTJ A;  2G93 A;  3AXF A;  4QF9 A;  4PAF A;  5DT6 A;  3B7D A;  2PCR A;  2Y84 A;  1IMB A;  1FQC A;  1NV6 A;  1SW5 A;  1IQ7 A;  3KFM A;  2QS3 A;  3RN8 A;  3OO8 A;  3PUX E;  5ET8 A;  2Z8F A;  4ELR A;  1T0K A;  4AS4 A;  4XKN A;  3TCH A;  1O63 A;  3FV2 A;  4EF2 A;  3FJG A;  3BKI B;  3N94 A;  1PB8 A;  5KDT A;  2F5X A;  3MZ9 A;  1GV8 A;  4GWX A;  5J1D A;  4Q8R A;  4DCY A;  1UTH A;  1URD A;  2A5T A;  1BKA A;  3LSL A;  2HPG A;  1MDP 1;  4KPT A;  1BK4 A;  2ZZW A;  3SET A;  1P1U A;  5EQA A;  2F3B A;  1B9J A;  3C4M A;  1FTL A;  2YJP A;  4G68 A;  4G8N A;  3DP6 A;  2AIX A;  3FAT A;  2CEX A;  1Y3N A;  2F97 A;  3MPL A;  2ANJ A;  4N91 A;  2Y5L A;  1RDY A;  4YMB A;  3S9M C;  3R7X A;  1MM6 A;  3B6Q A;  5F1Q A;  2V4C A;  1N7W A;  4R75 A;  4JVI A;  2ZZV A;  3IJO B;  5ET7 A;  2V93 A;  5I58 B;  3TUS A;  1RKM A;  3TMG A;  3TCF A;  3RPW A;  4XKP A;  1R1N A;  4GX4 A;  3C32 A;  2I4C A;  2Z22 A;  4IR8 A;  1OLA A;  4UAB A;  3EKI A;  3V83 A;  1B7Z A;  3TTM A;  4GX6 A;  1A8F A;  3F11 A;  4GWS A;  3MC2 A;  4BDL A;  4G77 A;  1Y3Q A;  2QFL A;  1B3G A;  2P3N A;  4HE0 A;  4C0R A;  1IME A;  4Z0I A;  1FPJ A;  4NAP A;  4FOR A;  3T66 A;  3ISP A;  3LSX A;  2DE2 A;  1RYO A;  3S4U A;  1P99 A;  3DM0 A;  1ELJ A;  2GHB A;  3SEV A;  1MDQ A;  3QMF A;  4NMY A;  5EQ7 A;  4N6K A;  1JW5 A;  2I0C A;  3T9U A;  2I48 A;  5ITP A;  4G4P A;  4TOZ A;  4EXL A;  1FPB A;  3MWB A;  2XWK A;  2CMO A;  1FCK A;  3W9W A;  3TEP A;  1UQW A;  3VLW A;  4IY6 A;  3PD8 A;  3OEK A;  1Y20 A;  4H1X A;  2WYP A;  5EHM A;  1OLC A;  2HXR A;  1VE4 A;  1B1H A;  2QMW A;  1PC3 A;  1NH7 A;  2R9J A;  2WKY A;  4NF8 B;  3PU5 A;  5EYF A;  3EHU A;  3KOT A;  4UA8 A;  3K1P A;  2QVR A;  4YB6 A;  1DK4 A;  5LOM A;  1CNQ A;  1FPD A;  2V3Q A;  4GLI A;  3B50 A;  4N13 A;  2PFY A;  4EXK A;  1QKB A;  2YLN A;  2XWO A;  1LBY A;  1JQF A;  4XKQ A;  1URG A;  1RDX A;  4N17 A;  1FBF A;  3OSR A;  2B4M A;  2Q2C A;  3USD A;  4ELO A;  1LST A;  4QSE A;  4R72 A;  3V89 B;  1NNP A;  1MY3 A;  2FIE A;  4PFT A;  3TFL A;  1AMF A;  1US5 A;  5K2Y A;  1H43 A;  4IGR A;  4DI3 D;  4ZEK A;  4RPO A;  3O9P A;  3RT6 B;  5DYH A;  1P1N A;  1POT A;  1I69 A;  2XXP A;  1IXC A;  3U1O A;  5H8N A;  4NGU A;  5IGA A;  5H8N B;  3MP6 A;  1P1W A;  4R74 A;  3IFA A;  1RYX A;  3CR9 A;  2F35 A;  4U2R A;  3UA8 A;  1B3H A;  3FVO A;  1NFT A;  2QS4 A;  5L9S A;  2H5Y A;  1QUL A;  3LUZ A;  2CZK A;  1Y9U A;  4MHF A;  1NV3 A;  2Q88 A;  4I3E A;  4OXV A;  1A8E A;  4ZEF A;  3IR1 A;  4I1D A;  2HXW A;  1AWB A;  4MF3 A;  4IO2 A;  3OOA A;  3MAM A;  3OMB A;  2VHA A;  4F18 A;  2V84 A;  2Q8J A;  5LTC A;  3QK6 A;  4ND9 A;  1XVX A;  3O6I A;  1FPK A;  1D9Y A;  3K01 A;  4NF8 A;  4GL8 A;  1OMP A;  1URS A;  2ZZX A;  5AA2 B;  3KJ7 A;  4M4G A;  2F6P A;  1B3E A;  4OER A;  4E0X A; 
#chains in the Genus database with same CATH homology
 1LBY A;  1NV0 A;  1YYZ A;  4LN5 A;  3B8B A;  4HE1 A;  1IMA A;  1RDX A;  1LBV A;  1FBG A;  1FBF A;  4GWZ A;  1LBZ A;  2HZK A;  2FIX A;  4N17 A;  4PFI A;  2VT5 A;  1NV4 A;  2B4M A;  1FBP A;  3BIH A;  3T1B A;  4GX4 A;  5IZ3 A;  3IFC A;  3W9V A;  4MNP A;  4N8Y A;  1K9Y A;  5DW8 A;  3ROJ A;  2Q8M A;  4IR8 A;  4GX3 A;  2FIE A;  4P9K A;  4PDD A;  4HCY A;  1NI9 A;  1NUW A;  1JP4 A;  2FVZ A;  2QVU A;  3GYY A;  1FBD A;  4PBH A;  3SZP A;  3T0J A;  4PC9 A;  1LEV A;  3EKI A;  1FJ6 A;  4UAB A;  4PDH A;  4N81 A;  5IM2 A;  4NHB A;  4OAN A;  5EYG A;  4GBV A;  4I3Y A;  4OVR A;  5J16 A;  2OX3 A;  1SPI A;  4F1U A;  4P56 A;  4OVP A;  4DI3 D;  5I5P A;  4HE2 A;  4PAF A;  1FTA A;  4XF5 A;  1EYK A;  3KC1 A;  4OVQ A;  4GX6 A;  2PCR A;  3E78 A;  4P8B A;  2HHM A;  3RPL A;  4GWS A;  4JVC A;  2MKZ A;  2VPN A;  1VDW A;  1IMB A;  2DDK A;  2VPO A;  5CM6 A;  1NV6 A;  2QPQ A;  1NV5 A;  1YXI A;  2WBB A;  1FBC A;  2Q74 A;  4F19 A;  5ET8 A;  2QFL A;  1IMC A;  1K9Z A;  2P3N A;  4HE0 A;  3D1R A;  5IZ1 A;  5A5L A;  4MAG A;  4NGU A;  5IGA A;  1KA1 A;  1DCU A;  4MCO A;  4AS4 A;  1EYI A;  3FXB A;  4X9T A;  1IME A;  4NN3 A;  4NQ8 A;  4MX6 A;  4PF8 A;  1FPJ A;  4NAP A;  3IFA A;  4H46 A;  4N8G A;  3ISP A;  4PET A;  3HFU A;  4F1V A;  2JJK A;  5LDZ A;  4M1V A;  4JVD A;  1FPG A;  2DE2 A;  4GWY A;  4YIC A;  4OVT A;  4KXP A;  4GBW A;  4PTK A;  5EYH A;  3RPL B;  1FPE A;  4GWU A;  4NG7 A;  3U65 A;  5I7I A;  2DVZ A;  2F5X A;  2R8T A;  3LV0 A;  4HCW A;  4MEV A;  3QMF A;  2KR0 A;  4N4U A;  2CEY A;  4PAK A;  3W9W A;  4AS5 A;  3KBZ A;  4GWX A;  5EQ7 A;  3KC0 A;  2OWZ A;  4N6K A;  3LUZ A;  1EYJ A;  4O7M A;  4PE3 A;  4X8R A;  1FPF A;  4XEQ A;  5T3J A;  5J1D A;  5JK4 A;  2CZK A;  1INP A;  1FPB A;  1FRP A;  2Q9T A;  4OVS A;  1FBE A;  1G0H A;  4MHF A;  4P47 A;  1FBH A;  2HZL A;  2HPG A;  1FPL A;  1NV3 A;  1RDZ A;  2XWK A;  2XWV A;  3A29 A;  3E79 A;  4N6D A;  1DBZ A;  3RYD A;  1IMF A;  2L5V A;  4I3E A;  1BK4 A;  2XXK A;  1FPI A;  2FHY A;  1NUY A;  1KA0 A;  2ZZW A;  4XFE A;  5IZ3 B;  4QBA A;  4PCD A;  1LBX A;  1LBW A;  1NUX A;  4O7I A;  4DI4 B;  3PTY A;  4X04 A;  1AWB A;  1NV1 A;  4HXV A;  4O8M A;  4QXD A;  5EQA A;  2F3B A;  1YZ0 A;  2B4L A;  4FBP A;  4P1L A;  2KQZ A;  4PF6 A;  5EQ8 A;  5F24 A;  2Y5K A;  4PBQ A;  2BJI A;  2WYP A;  1D9Q A;  4H45 A;  4PAI A;  4MMP A;  1NV7 A;  2HXR A;  2QVV A;  2CZI A;  2DE3 A;  1KZ8 A;  2CEX A;  2GQ1 A;  4F18 A;  1NV2 A;  1XI6 A;  2WEF A;  2WX9 A;  1QGX A;  2WYK A;  4N91 A;  2Y5L A;  1RDY A;  5ET5 A;  5LTC A;  2F3D A;  2DE4 A;  2XA5 A;  3FBP A;  2P3V A;  4PGP A;  3CHG A;  5I3S A;  3MST A;  4MJO A;  1FPK A;  2V4C A;  4G61 A;  5IZZ A;  2QVR A;  3NOH A;  4I40 A;  4NX1 A;  1DK4 A;  5ET6 A;  4JVI A;  5EQ9 A;  1NUZ A;  4YZZ A;  1CNQ A;  2ZZV A;  4MNI A;  4OA4 A;  1G0I A;  4MIJ A;  1FPD A;  4N15 A;  4P1E A;  4PFB A;  5ET7 A;  2V3Q A;  4PFR A;  2ZZX A;  1IMD A;  1Q9D A;  2XWI A;  3B50 A;  3MYU A;  2PFY A;  4O94 A;  5FBP A;  4NF0 A;  2PFZ A;  4P3L A;  2FBP A;  1FSA A;  4GWW A;  4PGN A;  2CZH A;  2WBD A;  2XWO A;  5ESY A;  4MNC A;  1FJ9 A;  3BIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...