4PGPA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound 3-indole acetic acid
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
PVTLNYANFPPASTFPCIQMEQWAHEVRTRTRGKVDVLTYPGGTLLGARNMLRGVMSGQADIGCISLAYHPGVFPVMSVFELPLGFTSAEAASSVLWELYSGLRPAELERVKVLTMFTSAPSHFMTVTPVRSLRDLQGMEIRGAGTLSAILEKLGATPVSMPMPEVPEAVQKGIIKGLFTSLDVMKDMNFAEMTGHVTRADQAVYPFAVIMNREAWERLSPDVQQVLDGLAAEHAAWTGRYLDAHVQDSMRWAEEKHGVQVHTLPEEDIAAMRRSVQPLFDAWAQRAADKGADPDAVMRTVDALKAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein, family 7
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
molecule tags Solute-binding protein
total genus 111
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pgpA00
4N8YA 4PAFA 4PE3A 4X04A 4MIJA 4NN3A 4PBQA 4N4UA 5I5PA 4PFIA 4LN5A 3B50A 4XF5A 4MHFA 4PF8A 4X8RA 5IGAA 4MX6A 4PGNA 2XWKA 4MCOA 4P47A 4NAPA 5IM2A 5I7IA 4PFBA 2XA5A 2XWOA 5CM6A 4O8MA 3U65A 4NF0A 4O94A 4YICA 2WYPA 4NQ8A 2ZZWA 2CEYA 2XWVA 4NGUA 4PC9A 4OANA 4MEVA 4PFRA 4OVQA 4PBHA 3FXBA 4N17A 4P8BA 2VPNA 4MAGA 4MMPA 5LTCA 4PDHA 4PCDA 2HZKA 4OA4A 4P1LA 4OVRA 4N15A 4P9KA 2CEXA 4XFEA 4MNCA 2PFZA 4NX1A 4N8GA 4MNIA 4XEQA 2ZZXA 4P1EA 4OVPA 2HZLA 4PDDA 4PAIA 4P56A 4YZZA 4DI4B 4PAKA 4N91A 4OVSA 4PGPA 4NG7A 2ZZVA 4NHBA 2V4CA 4DI3D 2HPGA 2WYKA 4OVTA 4N6KA 3GYYA 4UABA 4PETA 2PFYA 2WX9A 2VPOA 4PF6A 4P3LA 5IZZA 4N6DA 2XXKA 2XWIA 4MNPA 4O7MA
chains in the Genus database with same CATH superfamily
4N8YA 4F3BA 3IJXB 5K2YA 1NUWA 1XVXA 2F7CA 1BTJA 1FTLA 2Q8JA 4QRZA 4R73A 5CMBA 2OWTA 2YPNA 4JB7A 4FJPA 3IO4A 3PMWA 1B58A 1EZPA 3D1RA 4IGTA 4P8BA 3VE1B 1MQDA 2REJA 3R26A 3G3FA 2DWJA 4LP2B 4GBVA 4N13A 3BFUA 3PPOA 4EDPA 3FD3A 4H1XA 4QSEA 4GF8A 4E0XA 1ZKBA 2CEXA 2XXWA 1Y1ZA 5M2VA 3IK6B 4C1UA 4R9GA 2ONRA 1BIYA 1DBZA 1LBCA 3FVNA 3HFUA 4GWXA 5AA2D 3GBBA 5TPAA 1JVXA 2M8CA 3EQ1A 4OVJA 4X1DA 1FQFA 2QMXA 4KCCA 4YKPA 1P1UA 3TKDA 2DYXA 5IZ1A 3U1OA 3QUJA 3QK6A 1Z7NE 1I6AA 4PFYA 1US5A 1G0IA 1B5IA 3OEKA 5H8QB 2O7IA 3T22A 2AL5A 3BKIB 1B1HA 3U8QA 4OZ9A 1WODA 2B65A 4KYDA 4ZEDA 3MUQA 2D21A 3IX1A 5I2NB 5I2KA 1XVYA 3N6TA 1AIVA 1LBYA 3TCGA 1EZOA 2DOJA 1FBDA 2GRVA 4O8MA 4GX6A 1EYJA 2UVGA 1IMFA 3ISPA 4ZZEA 1NNFA 4OANA 4PFRA 2Z23A 3RUMA 4AS5A 3DP8A 3VVFA 4HE0A 4PCDA 2PT2A 4XKPA 2ZYOA 1EZ9A 3K1MA 4JVIA 4QHQA 3TTMA 3PD8A 1NUZA 1FTKA 2R6GE 2NXOA 4OFJA 4G4PA 4G8HA 3ZKLA 2QS3A 2CMOA 4KYSA 3RN8A 3B7DA 1OQHA 3DELB 5AA1A 1LLSA 4G2ZA 2I49A 4NHBA 1TT1A 2O1MA 4I1DA 4EUOA 2HAUA 4I9DA 2V3TA 3N94A 4PFUA 2WBBA 2FYIA 3U94A 1NFTA 2B4LA 1NKXA 1NV3A 1A7LA 4JSDA 4QXDA 5FTHA 3QYTA 1YXIA 2H5YA 3G3KA 3OO9A 3E13X 3I5OA 5ITPA 4DXUA 5KZTA 1FPBA 5IAIA 4PTKA 4IR8A 5H8NA 3UA8A 3JZJA 3KG2A 1J1NA 1QKBA 3S9LC 5EQ7A 3KBZA 2XA5A 2QS4A 3C33A 1Q1KA 2OCUA 4I8CA 1A55A 4OHNA 4H8JA 4POXA 4GWZA 1FBEA 5EYFA 1MXVA 1SVXB 2OWSA 5TP9B 3ZSFA 4HS7A 1B0LA 4LUBA 3LBSA 1AL3A 5CI5A 1Q35A 4JVCA 3HN0A 4F3GA 4F39A 1Y3PA 3V5AA 3DP4A 4MJOA 3PUZE 3G3HA 3S9NC 5L9OA 3SDFA 1A40A 4U1OA 1FTMA 1URSA 1MY3A 4NTLA 1FTOA 1KA1A 1MXUA 1JQFA 4BDNA 1Y3NA 1JEUA 3LC8A 4O3BA 1I6BA 3D4CA 1MS7A 2DE4A 4X1BA 4EF1A 3FZVA 2RKMA 3TQWA 1VR5A 3LR1A 2HAVA 5ICQA 2OLBA 2I0BA 1FW0A 1VE4A 3NOHA 4R72A 3H6TA 2QMWA 2UVHA 4R6HA 4GWSA 1ZIUA 2Q88A 4NN3A 1FBPA 1MPCA 3T0JA 4IO3A 2P3VA 1M5BA 2XXXA 3KBRA 5EHSA 5ET5A 1LBBA 3VV5A 4E0WA 1IMBA 1DPEA 5H8FA 3K2DA 3E9XA 1FBGA 4NF0A 4ELQA 4O94A 5AA2B 2CEYA 1DPPA 1NL5A 3MP6A 4PC9A 5JK4A 1ZLQA 5I58A 4MMPA 1FSAA 2RCBA 3KSJA 2PBWA 1TWYA 4RK2A 3SEUA 3VLVA 3FBPA 4GIZA 3O97A 3RGYA 1INPA 2LAOA 1LAFE 5KDTA 5F1QA 4WXJA 4PDDA 3H3GA 4P56A 1SYHA 4LZ5A 1B3LA 3HV1A 3MVXA 1MPBA 3G3GA 4YB6A 1EYKA 2VD2A 3IB2A 1SI0A 1NV0A 2L5VA 4HE2A 3ILTB 2HQ0A 3KN8A 4DI3D 4GX4A 1O64A 4IY5A 4XKQA 4ESXA 4NMYA 3IOUA 2PFYA 3PU5A 3MVWA 4O7IA 1RDXA 4MF3A 1LFIA 5H8SA 4F1YA 5H8HA 2UYEA 1B5HA 4NF8A 1DSNA 3VLUA 3FJ7A 2F7BA 4MIJA 4PBQA 4PE5B 2E1SA 2O51A 5KCJA 2ONSA 5FBPA 4YKKA 4NF4B 4M1VA 2XXTA 1MY4A 5JTYA 2Y84A 3PD9A 2FBPA 1NNTA 4OFLA 4XTCQ 3FATA 4I3YA 4IO7A 1IMDA 5T3JA 3MWBA 3K00A 2QRYA 3OO6A 4KHZE 4GD5A 3USDA 4ESWA 1TFAA 4RPNA 4JDFA 1NV2A 4FEBA 1MY0A 5I56B 3PPPA 5EYHA 5ISUA 1JEVA 5A5LA 3FXRA 4EXLA 1R9QA 4OQOA 2GHBA 3KJ7A 1M5CA 3R6UA 4LZ8A 1JW4A 3TMGA 1IIWA 3KSXA 5IZ3A 4TQUQ 4AS4A 1BK4A 1RDYA 4YKJA 4PFTA 2F6GA 3IOTA 2A5TA 4Q0CA 3TCHA 3IR1A 2V84A 4MLVA 2P2AA 1CB6A 5HBCA 2XWIA 4I40A 1POTA 3W15C 1UTHA 5CMCA 3RQTA 1D9YA 1B7ZA 1R9LA 2F7AA 3BFTA 2F97A 3K6WA 3TTKA 4AB6A 3PUVE 5ET6A 3RTWB 3PPQA 3GLBA 3B50A 1SW4A 2F8DA 4PF8A 1N84A 1JVYA 4R9FA 1B4HA 2ZNTA 4U4SA 3ZKKA 3FASA 4P0IA 2E0SA 1EU8A 5EQAA 2UVIA 3OO8A 1OVBA 4DLDA 3KEIA 1QVSA 3TODA 5H8NB 1Y20A 5IKBA 4DXBA 2WYPA 1PDAA 1IMAA 2DXYA 2NUVA 4M4GA 2F34A 4U22A 1DOTA 3HO7A 2P0SA 2ZYKA 1EH3A 1LBVA 2CZKA 3IJOB 5AE4A 3TEPA 5EYGA 2XXUA 2O6AA 4OA4A 2CZLA 3RT8A 2QPQA 3TTLA 2I0CA 5TU0A 1FPEA 3CFLA 4NX1A 1FQDA 4QSCA 3EHTA 3KGCA 3TCFA 4Q30B 1UIUA 2KLFA 1IUDA 4RNSA 1RDZA 1MXXA 2RCAA 3H4ZA 2ONKE 2DVZA 4GL0A 1PC3A 3SERA 1N3WA 4OVTA 4ZS9A 3UK4A 2OX3A 1PB8A 3QSLA 5LOMA 5AA3A 1PBPA 1SQYA 2ZMBA 5IZZA 4RYAA 3S9EA 4KQPA 1N76A 1N7XA 5CBSA 3I6VA 4X04A 3OMBA 4O3CA 4IO5A 4GLIA 1POY1 4MHFA 1PEBA 2HHMA 4F2OA 3DM0A 2H4IA 1FJ9A 2QVVA 3OO7A 1A8FA 2Q8MA 2WKYA 3KFMA 4DXCA 1US4A 1LB9A 4PBHA 1MM6A 5J16A 5I84A 3TUSA 3RTFB 2D5WA 4OESA 1ZTYA 4G68A 3PUWE 1SPIA 4P9KA 4XFEA 1URDA 2G29A 3D4GA 3CIJA 1T0KA 2P3NA 1MH3A 3FGSA 1N7WA 1FQBA 3FVKA 2MKZA 3M3KA 3L6HA 2WBDA 4GWWA 1B05A 4ZE8A 2IA4A 1FPKA 2I4CA 5HPQA 1LBZA 5KDTB 1RYXA 3ECRA 4UABA 1B2HA 2XXQA 1NNKA 5B7DA 5DEXB 3OELA 3VDFA 4N6DA 2DXRA 1R6ZA 5A5XB 4O7MA 1SW2A 4PAFA 1URGA 1K9ZA 3MC2A 1LBXA 4RY1A 1ZU0A 3MAMA 4XXUA 4F1VA 1B0HA 3G7WA 1PBQA 1ZJLA 4KPTA 1MRPA 2DSFA 4NF8B 1WDNA 1H76A 5I7IA 2O69A 1CNQA 2GQ1A 4KYEA 3FJGA 3ONMA 3PUXE 4ZEIA 1Y3QA 3CI8A 4YB5A 3V83A 4Z0IA 4HE1A 2ABHA 4OEVA 3Q26A 2FA7A 1LGBC 2F6PA 3GBAA 5LTCA 4NF6A 1A54A 4QFNA 1LFHA 4HXVA 4POWA 4OVRA 4U1ZA 1IXHA 1LEVA 3KN3A 4ISUA 4NWCA 2RC7A 4NWDA 1JP4A 2B3BA 4QSDA 1JW5A 3E78A 4LZ7A 4MNIA 2Y7RA 2ZZXA 3QIMA 3VXBA 3OSRA 2UYFA 4H8IA 4BDOA 4LQ2A 3CFZA 1ZBMA 3B6WA 4NE4A 2Q2CA 4YAHX 5EQ8A 3KOSA 3C35A 1NV5A 2HPGA 3IOVA 1QUKA 4F2QA 1FPDA 3O6IA 2QVUA 2HCAA 3CSBA 4F1UA 4YMBA 2CZIA 1YAEA 3G3IA 5CBRA 3E3KA 5I57A 4KFQA 5IZ3B 1MPDA 3ODBA 2XXKA 3S9MC 4F19A 3VLWA 1Y4CA 1YTVA 2HXRA 1B7HA 2A5TB 4PE3A 4C1TA 3EPEA 3EKIA 1OVTA 4GVOA 1FPIA 4UACA 3VXCA 4FORA 3JYRA 1B5JA 4XKRA 2XXVA 1O63A 2V3QA 4BDRA 5ICTA 2OK2A 1FCKA 1WVJA 1ELJA 2F3BA 4HCWA 2H25A 1YYZA 3LUYA 2I3WA 4JWXA 5ET7A 4C0RA 3O6HA 1DTZA 1H45A 1B3EA 3LSLA 1I6QA 3A3CA 3Q29A 1R1NA 2Y5LA 3K6XA 5I59A 4FBPA 1MDQA 1MQJA 1P1WA 4IB2A 2VPNA 3TTRA 4JXIA 1B52A 2G93A 4LATA 4PDHA 2FHYA 2PFZA 1FPJA 2O84X 3AXFA 2XHDA 2F3DA 3IB1A 4IO6A 4F22A 4PAIA 1MXYA 2UXAA 2Y7IA 4Z7EA 2QFLA 1FBFA 4NG7A 1B32A 1NUYA 3K1NA 2Y5KA 2XD3A 2A5SA 1B51A 3A29A 4JBZA 4DE8A 1MY2A 2WEFA 1LAXA 5BUUA 2DE3A 2XX9A 5F24A 4ND9A 5CMKA 4ZE9A 3MW0A 3K02A 3TYHA 2KR0A 3QXMA 1QJMA 4XIGQ 4H6DA 3S2VA 1M5FA 3H6VA 4N4UA 1S9TA 3SEWA 2OWZA 2B3FA 3VVDA 4ZEBA 3TELA 3B6QA 3H06B 4XF5A 5TPAB 1FBHA 1XOCA 1QUIA 4PQJA 4JVDA 1S7YA 2O68A 1AOVA 3U92A 2PX1A 4MH5A 4F3SA 3MSTA 3K4UA 5IM2A 1EYIA 3IB0A 1NV4A 4RJZA 4PFBA 1N0TA 2DWAA 3LV0A 1UIVA 4EQBA 3DLNA 1HSLA 3TPAA 3U72A 1B3FA 5J1DA 1MQIA 1OLCA 1NMUA 1IMCA 4WEDA 3FV1A 2O1LA 4N17A 2XXYA 1Y4TA 4GQOA 1Y1MA 2HXWA 4GFRA 3C31A 4ECFA 4OXVA 4N15A 1YCJA 1MDP1 5I2KB 2DS9A 2XX7A 1B9JA 3N5LA 4U21A 3B8BA 4Q5TA 4RA1A 4YKIA 3C34A 1MM7A 3GXAA 1I69A 1USYE 4H5GA 1IZ1A 1IITA 1N04A 1OMPA 5EQ9A 2GFEA 5FHOA 4X48A 3OD7A 1H43A 4PETA 1SW5A 5TP9A 1H3DA 2R71A 3RT6B 3QUFA 2NVUB 5BWJA 1MQHA 5FHNA 1UQWA 2VT5A 1LB8A 1NV1A 1Q9DA 4H45A 5I5PA 3H7MA 4QF9A 1JNFA 4LN5A 1DTGA 2RC8A 2F5XA 5DVFA 1M5DA 1P1QA 3HSTA 3K01A 4MX6A 4U4XA 4P47A 2THIA 5I3SA 1IXGA 4GWOA 4G68C 3O29A 3QMFA 2DVCA 1HSEA 3PUYE 4BDMA 2NOOA 2Z8EA 2PMSA 2VOZA 4YICA 4NQ8A 1F9BA 3KC0A 3MPKA 4IGRA 3CSGA 1FPLA 3KJTA 1FJ6A 4DIGA 2RINA 3OEMA 1M5EA 3VVEA 3MP8A 4NF5A 2CZHA 5CMMA 3T9VA 3LUZA 5L9MA 1MQGA 3M3LA 1FQEA 2DP8A 2BJIA 4N8GA 4KI0E 3CR9A 4FAJA 3N6UA 4IO2A 3H6UA 4LONB 1UTBA 1ZMGA 4PAKA 2ZYNA 4EQ7A 2V4CA 3Q28A 4KD5A 3PV0E 3JV9A 3MZ9A 1B7UA 4ELOA 4H5FA 2V25A 2XD2A 5AA2A 2UVJA 5L8DA 3MQ9A 3RPWA 3HHFA 2VHAA 4YB7A 3SESA 1IEJA 4RXLA 2Z8FA 5AA4A 2B4MA 3CHGA 4EF2A 5I57B 3IOWA 1KZ8A 3FVOA 3IAZA 2ZXTA 4UA8A 1SYIA 4OENA 2Y7KA 5ET8A 1FTJA 4RPOA 1RKMA 4PGNA 4X9TA 5CC2A 1NH7A 2VP1A 3TDJA 4FATA 3SEXA 4AQ4A 2F78A 3F11A 1B40A 1KA0A 4G61A 1IQ7A 5CM6A 1SBPA 2RC9A 4P11A 3FJMA 3GZGA 5DW8A 3CFXA 4GWYA 4R75A 4NGUA 1LAGE 4OVQA 3FXBA 2XXPA 3KC1A 4TLMB 2GH9A 3U93A 3FUZA 2PVUA 5DVJA 4HCYA 2JJKA 5I59B 3FIRA 1FPGA 3K6UA 2QSXA 4I3EA 1MY1A 1AWBA 1Z7ME 3KN7A 1P1NA 5H8FB 2XXRA 4OEUA 4YZZA 2PT1A 2HFBA 4PGPA 1B6HA 4NF4A 4OERA 1DMBA 1GGGA 1O7TA 3FXUA 5I58B 2ZNSA 4OTEA 4GX3A 3R7XA 2DE2A 4ELPA 1D3KA 2AIXA 4P3LA 4L17A 2X7PA 3UIFA 3O9PA 1SD3A 4GL8A 4MLQA 3H03A 4WEPA 3C9HA 4PFIA 2BJJX 3PMXA 4GOTA 2XX8A 4R2FA 5I56A 1B3GA 5IGAA 3KOTA 4GRKA 2OBGA 3OENA 2KQZA 4FECA 1B3HA 1G0HA 4WKMA 1IXIA 2DWHA 2VGQA 2W7YA 5CRYA 3U65A 1TXFA 3EHUA 3TQLA 1TFDA 3ROJA 2ZZWA 4XKNA 4QFLA 2XWVA 1B4ZA 3T9UA 5H8HB 1A99A 2VD3A 4BDLA 2Q9TA 1LFGA 3M3FA 4TLLB 1YPNA 4N81A 2FVZA 2X26A 1NH8A 5L9SA 2QS1A 5FTIA 3O28A 2XXHA 3V89B 1QUJA 2FNCA 5KCJB 3T66A 1GVCA 3RPLA 3H6WA 3T9HB 2DDKA 3LSWA 5DT6A 4N6PA 4AB5A 3C36A 4EQ9A 2HZLA 2I4BA 5JTYB 3BIGA 1D9QA 2XXIA 5K2XA 4U2RA 1VSOA 3SEYA 3CRBA 2Q2AA 3S4UA 4H0WA 2RF1A 3MYUA 2ZZVA 3PPNA 4GBWA 1DK4A 4ZDMA 1NUXA 3PTYA 2AL4A 1HSJA 2WX9A 2ZNUA 3FVGA 1NI9A 1N3XA 3EHSA 3SEVA 4LA9A 2I6EA 2DQVA 3MVYA 1BP5A 3MPLA 5B70A 4PFWA 3FV2A 1YZ0A 3E79A 1H44A 3LSFB 1DCUA 3C32A 4OYVA 4QFKA 2QS2A 1AMFA 5ELVA 3PMVA 4DDDA 1GV8A 4IY6A 3BBRA 1VFDA 4YU0A 4NAPA 3SETA 5JEIA 2ALUA 2I48A 3FXQA 1LCFA 3HHGA 3ILUB 3C4MA 2PCRA 1GTKA 1XC1A 3T1BA 1LCTA 3L6GA 1QKAA 2Z8DA 3OSQA 3RY3A 4ONYA 1UTHB 3MJNA 4QFOA 4MAGA 3HPIA 5LDZA 4H67A 1D9VA 3I3VA 4LVQA 4PP0A 2I58A 3OOAA 4JSOA 5F7VA 1FBCA 3CG3A 3WAEA 4JWOA 2V93A 4NF5B 4F3PA 1BKAA 3O2AA 2YJPA 4LQ5A 4N91A 1IXCA 3K6VA 4Q8RA 4MFIA 1S50A 4F31B 3A3UA 5FHMA 1Y9UA 5DYHA 5H8QA 2R9JA 4R74A 2IEEA 2F36A 3HCQA 3Q25A 1UTBB 2VPOA 3SKPA 3T96B 4DZ1A 4G77A 3RLFE 1QGXA 1KWHA 5I2NA 2R8TA 3OXNA 3E4RA 1L5TA 3MZ1A 2H9BA 4FEDA 3RYDA 1II5A 1OQGA 1FQCA 4NEDA 3MBPA 2PYYA 4H65A 1FRPA 2OZZA 4OFOA 1XS5A 4G8NA 1SDXA 1LSTA 2XWKA 5AA4B 3TZAA 3IFCA 2DWIA 4ZEKA 1MH4A 3G3JA 3O6GA 5DTBA 1JETA 4F29A 1OIBA 3PPRA 5ITOA 2Z22A 2ANJA 3UP9A 2F35A 4GXSB 4QFPA 2ESNA 1OLAA 3N26A 1XHYA 4QBAA 4OMBA 4ZEFA 4TOZA 4RK9A 1ANFA 1B46A 1LBWA 1FPFA 4F18A 5DEXA 3TAJA 1NV7A 4THIA 4P1LA 3V8XB 5A5XA 2QL3A 3UGWA 1D4NA 1USYH 4MNCA 4U23A 1IMEA 2HEUA 2O7UA 4KCDA 3ZS6A 2I3VA 4P1EA 4OVPA 4P0GA 3UORA 3IORA 4OWDA 2Q74A 3MZBA 3O66A 4KXPA 5DVIA 3IO6A 2Y7PA 4DI4B 3QAXA 4MBPA 4DCXA 4OVSA 3BIHA 4I62A 3EN3A 3PGFA 3W9WA 2WYKA 3DP6A 3UN6A 1K9YA 4BDQA 4GXAA 1RYOA 3THIA 1VFEA 3GYYA 1QW0A 2D3IA 2H98A 4FIMA 1AH5A 1FQAA 4PF6A 4HW8A 4R6YA 3VFJA 4ZECA 4G68B 3CG1A 3P7IA 4MNPA 1PB7A 3T93B 2FIXA 3SZPA 3IFAA 2YLNA 1MXWA 1XT8A 3A09A 4KR5A 3CVGA 3TFLA 5HM4B 3MP1A 4X8RA 2Y7WA 2GHAA 2QVRA 4MCOA 2X7QA 2P1SA 1B1XA 4R2BA 3WAFA 2OJTA 1ATGA 1GR2A 1NNPA 2XWOA 2AYSA 3RNNA 1BLFA 4OETA 3K1PA 4G8MA 1PB9A 4MEVA 1NV6A 2V3UA 3K0VA 1FTAA 3B6TA 2QJEA 4R6KA 2HZKA 4BLAA 4H46A 1SI1A 5EHMA 3T9XB 1MXZA 1VDWA 1LAHE 1JW1A 3MVZA 2ZYMA 1A8EA 1XI6A 1P99A 3W9VA 1MG1A 4XEQA 4YMAA 4HTGA 3M8UA 4O3AA 2REGA 3IL1B 2H99A 2NWJA 5ESYA 4ZZAA 3RPLB 4K3FA 3TTNA 4DCYA 3LSXA 4EXKA 2FIEA 4FE8A 4N6KA 4N07A 4GWUA 1SW1A 3EF7A 3Q27A 1CE2A 4NF6B 2Q89A 4JWYA 3KZGA 1P1OA 4ELRA 4IO4A 1QULA
chains in the Genus database with same CATH topology
4N8YA 4PE3A 4MIJA 4PBQA 3EKIA 1NUWA 4PFIA 1FPIA 5IGAA 2V3QA 5FBPA 2F3BA 2KQZA 4M1VA 4HCWA 1YYZA 5ET7A 1G0HA 3U65A 2FBPA 3ROJA 2ZZWA 2Y5LA 3D1RA 4I3YA 2XWVA 4FBPA 1IMDA 5T3JA 2Q9TA 4P8BA 2VPNA 4N81A 2FVZA 4PDHA 4GBVA 2FHYA 1NV2A 2CEXA 2PFZA 3RPLA 5EYHA 1FPJA 1DBZA 2DDKA 5A5LA 3HFUA 2F3DA 4GWXA 2HZLA 4PAIA 3BIGA 1D9QA 2QFLA 1FBFA 5IZ3A 3MYUA 4NG7A 2ZZVA 4AS4A 1BK4A 1RDYA 4GBWA 1NUYA 2Y5KA 3A29A 1DK4A 1NUXA 3PTYA 2WEFA 5IZ1A 2WX9A 2DE3A 5F24A 1NI9A 2XWIA 4I40A 1G0IA 2KR0A 1YZ0A 3E79A 1DCUA 4N4UA 2OWZA 5ET6A 3B50A 4XF5A 1FBHA 4PF8A 4JVDA 3MSTA 4NAPA 5IM2A 1EYIA 1NV4A 1LBYA 4PFBA 5EQAA 3LV0A 1FBDA 4O8MA 4GX6A 1EYJA 2WYPA 5J1DA 1IMAA 1IMFA 3ISPA 2PCRA 4OANA 1IMCA 3T1BA 4PFRA 4N17A 1LBVA 4AS5A 4MAGA 2CZKA 4HE0A 5LDZA 4PCDA 5EYGA 4OA4A 2QPQA 4N15A 1FPEA 4NX1A 1FBCA 4JVIA 3B8BA 1NUZA 1RDZA 4N91A 4NHBA 2DVZA 4OVTA 5EQ9A 2OX3A 4PETA 2WBBA 2VPOA 2B4LA 5IZZA 1QGXA 2R8TA 1NV3A 4QXDA 2VT5A 3RYDA 4X04A 1NV1A 1YXIA 1Q9DA 4H45A 1FRPA 5I5PA 4LN5A 1FPBA 2F5XA 4MHFA 4PTKA 4IR8A 2HHMA 4MX6A 2XWKA 4P47A 1FJ9A 5EQ7A 2QVVA 5I3SA 3KBZA 3IFCA 2XA5A 3QMFA 2Q8MA 4GWZA 1FBEA 4YICA 4NQ8A 3KC0A 1FPLA 1FJ6A 4PBHA 4JVCA 5J16A 4QBAA 1LBWA 1FPFA 4F18A 2CZHA 1NV7A 3LUZA 4P1LA 4MJOA 1SPIA 4P9KA 4XFEA 4MNCA 1IMEA 2P3NA 2BJIA 4N8GA 4P1EA 4OVPA 2MKZA 2Q74A 1KA1A 4KXPA 2WBDA 4GWWA 4DI4B 4PAKA 4OVSA 1FPKA 3BIHA 2V4CA 3W9WA 2WYKA 1LBZA 1K9YA 2DE4A 3GYYA 4UABA 4PF6A 4N6DA 3NOHA 4MNPA 4O7MA 4PAFA 2B4MA 4GWSA 4NN3A 1FBPA 1K9ZA 2FIXA 1LBXA 3CHGA 3SZPA 3T0JA 3IFAA 2P3VA 4F1VA 1KZ8A 5ET8A 4X8RA 5ET5A 4PGNA 2QVRA 4X9TA 4MCOA 1IMBA 5I7IA 1CNQA 2GQ1A 1KA0A 4G61A 2XWOA 5CM6A 1FBGA 4NF0A 4O94A 5DW8A 4GWYA 4HE1A 2CEYA 4NGUA 4PC9A 4MEVA 5JK4A 1NV6A 4OVQA 1FTAA 3FXBA 4MMPA 1FSAA 3KC1A 5LTCA 2HZKA 4H46A 4HXVA 4OVRA 1LEVA 1VDWA 4HCYA 2JJKA 1JP4A 3FBPA 1FPGA 1XI6A 3E78A 4I3EA 4MNIA 3W9VA 4XEQA 2ZZXA 1AWBA 1INPA 4PDDA 4P56A 4YZZA 5ESYA 1EYKA 4PGPA 5EQ8A 1NV0A 2L5VA 4HE2A 3RPLB 4DI3D 1NV5A 2HPGA 4GX4A 2FIEA 1FPDA 4N6KA 2QVUA 4F1UA 4GWUA 2CZIA 4GX3A 2PFYA 2DE2A 5IZ3B 4O7IA 1RDXA 4P3LA 2XXKA 4F19A 2HXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N8Y A;  4PAF A;  4PE3 A;  4X04 A;  4MIJ A;  4NN3 A;  4PBQ A;  4N4U A;  5I5P A;  4PFI A;  4LN5 A;  3B50 A;  4XF5 A;  4MHF A;  4PF8 A;  4X8R A;  5IGA A;  4MX6 A;  4PGN A;  2XWK A;  4MCO A;  4P47 A;  4NAP A;  5IM2 A;  5I7I A;  4PFB A;  2XA5 A;  2XWO A;  5CM6 A;  4O8M A;  3U65 A;  4NF0 A;  4O94 A;  4YIC A;  2WYP A;  4NQ8 A;  2ZZW A;  2CEY A;  2XWV A;  4NGU A;  4PC9 A;  4OAN A;  4MEV A;  4PFR A;  4OVQ A;  4PBH A;  3FXB A;  4N17 A;  4P8B A;  2VPN A;  4MAG A;  4MMP A;  5LTC A;  4PDH A;  4PCD A;  2HZK A;  4OA4 A;  4P1L A;  4OVR A;  4N15 A;  4P9K A;  2CEX A;  4XFE A;  4MNC A;  2PFZ A;  4NX1 A;  4N8G A;  4MNI A;  4XEQ A;  2ZZX A;  4P1E A;  4OVP A;  2HZL A;  4PDD A;  4PAI A;  4P56 A;  4YZZ A;  4DI4 B;  4PAK A;  4N91 A;  4OVS A;  4PGP A;  4NG7 A;  2ZZV A;  4NHB A;  2V4C A;  4DI3 D;  2HPG A;  2WYK A;  4OVT A;  4N6K A;  3GYY A;  4UAB A;  4PET A;  2PFY A;  2WX9 A;  2VPO A;  4PF6 A;  4P3L A;  5IZZ A;  4N6D A;  2XXK A;  2XWI A;  4MNP A;  4O7M A; 
#chains in the Genus database with same CATH topology
 4N8Y A;  4F3B A;  3IJX B;  5K2Y A;  1NUW A;  1XVX A;  2F7C A;  1BTJ A;  1FTL A;  2Q8J A;  4QRZ A;  4R73 A;  5CMB A;  2OWT A;  2YPN A;  4JB7 A;  4FJP A;  3IO4 A;  3PMW A;  1B58 A;  1EZP A;  3D1R A;  4IGT A;  4P8B A;  3VE1 B;  1MQD A;  2REJ A;  3R26 A;  3G3F A;  2DWJ A;  4LP2 B;  4GBV A;  4N13 A;  3BFU A;  3PPO A;  4EDP A;  3FD3 A;  4H1X A;  4QSE A;  4GF8 A;  4E0X A;  1ZKB A;  2CEX A;  2XXW A;  1Y1Z A;  5M2V A;  3IK6 B;  4C1U A;  4R9G A;  2ONR A;  1BIY A;  1DBZ A;  1LBC A;  3FVN A;  3HFU A;  4GWX A;  5AA2 D;  3GBB A;  5TPA A;  1JVX A;  2M8C A;  3EQ1 A;  4OVJ A;  4X1D A;  1FQF A;  2QMX A;  4KCC A;  4YKP A;  1P1U A;  3TKD A;  2DYX A;  5IZ1 A;  3U1O A;  3QUJ A;  3QK6 A;  1Z7N E;  1I6A A;  4PFY A;  1US5 A;  1G0I A;  1B5I A;  3OEK A;  5H8Q B;  2O7I A;  3T22 A;  2AL5 A;  3BKI B;  1B1H A;  3U8Q A;  4OZ9 A;  1WOD A;  2B65 A;  4KYD A;  4ZED A;  3MUQ A;  2D21 A;  3IX1 A;  5I2N B;  5I2K A;  1XVY A;  3N6T A;  1AIV A;  1LBY A;  3TCG A;  1EZO A;  2DOJ A;  1FBD A;  2GRV A;  4O8M A;  4GX6 A;  1EYJ A;  2UVG A;  1IMF A;  3ISP A;  4ZZE A;  1NNF A;  4OAN A;  4PFR A;  2Z23 A;  3RUM A;  4AS5 A;  3DP8 A;  3VVF A;  4HE0 A;  4PCD A;  2PT2 A;  4XKP A;  2ZYO A;  1EZ9 A;  3K1M A;  4JVI A;  4QHQ A;  3TTM A;  3PD8 A;  1NUZ A;  1FTK A;  2R6G E;  2NXO A;  4OFJ A;  4G4P A;  4G8H A;  3ZKL A;  2QS3 A;  2CMO A;  4KYS A;  3RN8 A;  3B7D A;  1OQH A;  3DEL B;  5AA1 A;  1LLS A;  4G2Z A;  2I49 A;  4NHB A;  1TT1 A;  2O1M A;  4I1D A;  4EUO A;  2HAU A;  4I9D A;  2V3T A;  3N94 A;  4PFU A;  2WBB A;  2FYI A;  3U94 A;  1NFT A;  2B4L A;  1NKX A;  1NV3 A;  1A7L A;  4JSD A;  4QXD A;  5FTH A;  3QYT A;  1YXI A;  2H5Y A;  3G3K A;  3OO9 A;  3E13 X;  3I5O A;  5ITP A;  4DXU A;  5KZT A;  1FPB A;  5IAI A;  4PTK A;  4IR8 A;  5H8N A;  3UA8 A;  3JZJ A;  3KG2 A;  1J1N A;  1QKB A;  3S9L C;  5EQ7 A;  3KBZ A;  2XA5 A;  2QS4 A;  3C33 A;  1Q1K A;  2OCU A;  4I8C A;  1A55 A;  4OHN A;  4H8J A;  4POX A;  4GWZ A;  1FBE A;  5EYF A;  1MXV A;  1SVX B;  2OWS A;  5TP9 B;  3ZSF A;  4HS7 A;  1B0L A;  4LUB A;  3LBS A;  1AL3 A;  5CI5 A;  1Q35 A;  4JVC A;  3HN0 A;  4F3G A;  4F39 A;  1Y3P A;  3V5A A;  3DP4 A;  4MJO A;  3PUZ E;  3G3H A;  3S9N C;  5L9O A;  3SDF A;  1A40 A;  4U1O A;  1FTM A;  1URS A;  1MY3 A;  4NTL A;  1FTO A;  1KA1 A;  1MXU A;  1JQF A;  4BDN A;  1Y3N A;  1JEU A;  3LC8 A;  4O3B A;  1I6B A;  3D4C A;  1MS7 A;  2DE4 A;  4X1B A;  4EF1 A;  3FZV A;  2RKM A;  3TQW A;  1VR5 A;  3LR1 A;  2HAV A;  5ICQ A;  2OLB A;  2I0B A;  1FW0 A;  1VE4 A;  3NOH A;  4R72 A;  3H6T A;  2QMW A;  2UVH A;  4R6H A;  4GWS A;  1ZIU A;  2Q88 A;  4NN3 A;  1FBP A;  1MPC A;  3T0J A;  4IO3 A;  2P3V A;  1M5B A;  2XXX A;  3KBR A;  5EHS A;  5ET5 A;  1LBB A;  3VV5 A;  4E0W A;  1IMB A;  1DPE A;  5H8F A;  3K2D A;  3E9X A;  1FBG A;  4NF0 A;  4ELQ A;  4O94 A;  5AA2 B;  2CEY A;  1DPP A;  1NL5 A;  3MP6 A;  4PC9 A;  5JK4 A;  1ZLQ A;  5I58 A;  4MMP A;  1FSA A;  2RCB A;  3KSJ A;  2PBW A;  1TWY A;  4RK2 A;  3SEU A;  3VLV A;  3FBP A;  4GIZ A;  3O97 A;  3RGY A;  1INP A;  2LAO A;  1LAF E;  5KDT A;  5F1Q A;  4WXJ A;  4PDD A;  3H3G A;  4P56 A;  1SYH A;  4LZ5 A;  1B3L A;  3HV1 A;  3MVX A;  1MPB A;  3G3G A;  4YB6 A;  1EYK A;  2VD2 A;  3IB2 A;  1SI0 A;  1NV0 A;  2L5V A;  4HE2 A;  3ILT B;  2HQ0 A;  3KN8 A;  4DI3 D;  4GX4 A;  1O64 A;  4IY5 A;  4XKQ A;  4ESX A;  4NMY A;  3IOU A;  2PFY A;  3PU5 A;  3MVW A;  4O7I A;  1RDX A;  4MF3 A;  1LFI A;  5H8S A;  4F1Y A;  5H8H A;  2UYE A;  1B5H A;  4NF8 A;  1DSN A;  3VLU A;  3FJ7 A;  2F7B A;  4MIJ A;  4PBQ A;  4PE5 B;  2E1S A;  2O51 A;  5KCJ A;  2ONS A;  5FBP A;  4YKK A;  4NF4 B;  4M1V A;  2XXT A;  1MY4 A;  5JTY A;  2Y84 A;  3PD9 A;  2FBP A;  1NNT A;  4OFL A;  4XTC Q;  3FAT A;  4I3Y A;  4IO7 A;  1IMD A;  5T3J A;  3MWB A;  3K00 A;  2QRY A;  3OO6 A;  4KHZ E;  4GD5 A;  3USD A;  4ESW A;  1TFA A;  4RPN A;  4JDF A;  1NV2 A;  4FEB A;  1MY0 A;  5I56 B;  3PPP A;  5EYH A;  5ISU A;  1JEV A;  5A5L A;  3FXR A;  4EXL A;  1R9Q A;  4OQO A;  2GHB A;  3KJ7 A;  1M5C A;  3R6U A;  4LZ8 A;  1JW4 A;  3TMG A;  1IIW A;  3KSX A;  5IZ3 A;  4TQU Q;  4AS4 A;  1BK4 A;  1RDY A;  4YKJ A;  4PFT A;  2F6G A;  3IOT A;  2A5T A;  4Q0C A;  3TCH A;  3IR1 A;  2V84 A;  4MLV A;  2P2A A;  1CB6 A;  5HBC A;  2XWI A;  4I40 A;  1POT A;  3W15 C;  1UTH A;  5CMC A;  3RQT A;  1D9Y A;  1B7Z A;  1R9L A;  2F7A A;  3BFT A;  2F97 A;  3K6W A;  3TTK A;  4AB6 A;  3PUV E;  5ET6 A;  3RTW B;  3PPQ A;  3GLB A;  3B50 A;  1SW4 A;  2F8D A;  4PF8 A;  1N84 A;  1JVY A;  4R9F A;  1B4H A;  2ZNT A;  4U4S A;  3ZKK A;  3FAS A;  4P0I A;  2E0S A;  1EU8 A;  5EQA A;  2UVI A;  3OO8 A;  1OVB A;  4DLD A;  3KEI A;  1QVS A;  3TOD A;  5H8N B;  1Y20 A;  5IKB A;  4DXB A;  2WYP A;  1PDA A;  1IMA A;  2DXY A;  2NUV A;  4M4G A;  2F34 A;  4U22 A;  1DOT A;  3HO7 A;  2P0S A;  2ZYK A;  1EH3 A;  1LBV A;  2CZK A;  3IJO B;  5AE4 A;  3TEP A;  5EYG A;  2XXU A;  2O6A A;  4OA4 A;  2CZL A;  3RT8 A;  2QPQ A;  3TTL A;  2I0C A;  5TU0 A;  1FPE A;  3CFL A;  4NX1 A;  1FQD A;  4QSC A;  3EHT A;  3KGC A;  3TCF A;  4Q30 B;  1UIU A;  2KLF A;  1IUD A;  4RNS A;  1RDZ A;  1MXX A;  2RCA A;  3H4Z A;  2ONK E;  2DVZ A;  4GL0 A;  1PC3 A;  3SER A;  1N3W A;  4OVT A;  4ZS9 A;  3UK4 A;  2OX3 A;  1PB8 A;  3QSL A;  5LOM A;  5AA3 A;  1PBP A;  1SQY A;  2ZMB A;  5IZZ A;  4RYA A;  3S9E A;  4KQP A;  1N76 A;  1N7X A;  5CBS A;  3I6V A;  4X04 A;  3OMB A;  4O3C A;  4IO5 A;  4GLI A;  1POY 1;  4MHF A;  1PEB A;  2HHM A;  4F2O A;  3DM0 A;  2H4I A;  1FJ9 A;  2QVV A;  3OO7 A;  1A8F A;  2Q8M A;  2WKY A;  3KFM A;  4DXC A;  1US4 A;  1LB9 A;  4PBH A;  1MM6 A;  5J16 A;  5I84 A;  3TUS A;  3RTF B;  2D5W A;  4OES A;  1ZTY A;  4G68 A;  3PUW E;  1SPI A;  4P9K A;  4XFE A;  1URD A;  2G29 A;  3D4G A;  3CIJ A;  1T0K A;  2P3N A;  1MH3 A;  3FGS A;  1N7W A;  1FQB A;  3FVK A;  2MKZ A;  3M3K A;  3L6H A;  2WBD A;  4GWW A;  1B05 A;  4ZE8 A;  2IA4 A;  1FPK A;  2I4C A;  5HPQ A;  1LBZ A;  5KDT B;  1RYX A;  3ECR A;  4UAB A;  1B2H A;  2XXQ A;  1NNK A;  5B7D A;  5DEX B;  3OEL A;  3VDF A;  4N6D A;  2DXR A;  1R6Z A;  5A5X B;  4O7M A;  1SW2 A;  4PAF A;  1URG A;  1K9Z A;  3MC2 A;  1LBX A;  4RY1 A;  1ZU0 A;  3MAM A;  4XXU A;  4F1V A;  1B0H A;  3G7W A;  1PBQ A;  1ZJL A;  4KPT A;  1MRP A;  2DSF A;  4NF8 B;  1WDN A;  1H76 A;  5I7I A;  2O69 A;  1CNQ A;  2GQ1 A;  4KYE A;  3FJG A;  3ONM A;  3PUX E;  4ZEI A;  1Y3Q A;  3CI8 A;  4YB5 A;  3V83 A;  4Z0I A;  4HE1 A;  2ABH A;  4OEV A;  3Q26 A;  2FA7 A;  1LGB C;  2F6P A;  3GBA A;  5LTC A;  4NF6 A;  1A54 A;  4QFN A;  1LFH A;  4HXV A;  4POW A;  4OVR A;  4U1Z A;  1IXH A;  1LEV A;  3KN3 A;  4ISU A;  4NWC A;  2RC7 A;  4NWD A;  1JP4 A;  2B3B A;  4QSD A;  1JW5 A;  3E78 A;  4LZ7 A;  4MNI A;  2Y7R A;  2ZZX A;  3QIM A;  3VXB A;  3OSR A;  2UYF A;  4H8I A;  4BDO A;  4LQ2 A;  3CFZ A;  1ZBM A;  3B6W A;  4NE4 A;  2Q2C A;  4YAH X;  5EQ8 A;  3KOS A;  3C35 A;  1NV5 A;  2HPG A;  3IOV A;  1QUK A;  4F2Q A;  1FPD A;  3O6I A;  2QVU A;  2HCA A;  3CSB A;  4F1U A;  4YMB A;  2CZI A;  1YAE A;  3G3I A;  5CBR A;  3E3K A;  5I57 A;  4KFQ A;  5IZ3 B;  1MPD A;  3ODB A;  2XXK A;  3S9M C;  4F19 A;  3VLW A;  1Y4C A;  1YTV A;  2HXR A;  1B7H A;  2A5T B;  4PE3 A;  4C1T A;  3EPE A;  3EKI A;  1OVT A;  4GVO A;  1FPI A;  4UAC A;  3VXC A;  4FOR A;  3JYR A;  1B5J A;  4XKR A;  2XXV A;  1O63 A;  2V3Q A;  4BDR A;  5ICT A;  2OK2 A;  1FCK A;  1WVJ A;  1ELJ A;  2F3B A;  4HCW A;  2H25 A;  1YYZ A;  3LUY A;  2I3W A;  4JWX A;  5ET7 A;  4C0R A;  3O6H A;  1DTZ A;  1H45 A;  1B3E A;  3LSL A;  1I6Q A;  3A3C A;  3Q29 A;  1R1N A;  2Y5L A;  3K6X A;  5I59 A;  4FBP A;  1MDQ A;  1MQJ A;  1P1W A;  4IB2 A;  2VPN A;  3TTR A;  4JXI A;  1B52 A;  2G93 A;  4LAT A;  4PDH A;  2FHY A;  2PFZ A;  1FPJ A;  2O84 X;  3AXF A;  2XHD A;  2F3D A;  3IB1 A;  4IO6 A;  4F22 A;  4PAI A;  1MXY A;  2UXA A;  2Y7I A;  4Z7E A;  2QFL A;  1FBF A;  4NG7 A;  1B32 A;  1NUY A;  3K1N A;  2Y5K A;  2XD3 A;  2A5S A;  1B51 A;  3A29 A;  4JBZ A;  4DE8 A;  1MY2 A;  2WEF A;  1LAX A;  5BUU A;  2DE3 A;  2XX9 A;  5F24 A;  4ND9 A;  5CMK A;  4ZE9 A;  3MW0 A;  3K02 A;  3TYH A;  2KR0 A;  3QXM A;  1QJM A;  4XIG Q;  4H6D A;  3S2V A;  1M5F A;  3H6V A;  4N4U A;  1S9T A;  3SEW A;  2OWZ A;  2B3F A;  3VVD A;  4ZEB A;  3TEL A;  3B6Q A;  3H06 B;  4XF5 A;  5TPA B;  1FBH A;  1XOC A;  1QUI A;  4PQJ A;  4JVD A;  1S7Y A;  2O68 A;  1AOV A;  3U92 A;  2PX1 A;  4MH5 A;  4F3S A;  3MST A;  3K4U A;  5IM2 A;  1EYI A;  3IB0 A;  1NV4 A;  4RJZ A;  4PFB A;  1N0T A;  2DWA A;  3LV0 A;  1UIV A;  4EQB A;  3DLN A;  1HSL A;  3TPA A;  3U72 A;  1B3F A;  5J1D A;  1MQI A;  1OLC A;  1NMU A;  1IMC A;  4WED A;  3FV1 A;  2O1L A;  4N17 A;  2XXY A;  1Y4T A;  4GQO A;  1Y1M A;  2HXW A;  4GFR A;  3C31 A;  4ECF A;  4OXV A;  4N15 A;  1YCJ A;  1MDP 1;  5I2K B;  2DS9 A;  2XX7 A;  1B9J A;  3N5L A;  4U21 A;  3B8B A;  4Q5T A;  4RA1 A;  4YKI A;  3C34 A;  1MM7 A;  3GXA A;  1I69 A;  1USY E;  4H5G A;  1IZ1 A;  1IIT A;  1N04 A;  1OMP A;  5EQ9 A;  2GFE A;  5FHO A;  4X48 A;  3OD7 A;  1H43 A;  4PET A;  1SW5 A;  5TP9 A;  1H3D A;  2R71 A;  3RT6 B;  3QUF A;  2NVU B;  5BWJ A;  1MQH A;  5FHN A;  1UQW A;  2VT5 A;  1LB8 A;  1NV1 A;  1Q9D A;  4H45 A;  5I5P A;  3H7M A;  4QF9 A;  1JNF A;  4LN5 A;  1DTG A;  2RC8 A;  2F5X A;  5DVF A;  1M5D A;  1P1Q A;  3HST A;  3K01 A;  4MX6 A;  4U4X A;  4P47 A;  2THI A;  5I3S A;  1IXG A;  4GWO A;  4G68 C;  3O29 A;  3QMF A;  2DVC A;  1HSE A;  3PUY E;  4BDM A;  2NOO A;  2Z8E A;  2PMS A;  2VOZ A;  4YIC A;  4NQ8 A;  1F9B A;  3KC0 A;  3MPK A;  4IGR A;  3CSG A;  1FPL A;  3KJT A;  1FJ6 A;  4DIG A;  2RIN A;  3OEM A;  1M5E A;  3VVE A;  3MP8 A;  4NF5 A;  2CZH A;  5CMM A;  3T9V A;  3LUZ A;  5L9M A;  1MQG A;  3M3L A;  1FQE A;  2DP8 A;  2BJI A;  4N8G A;  4KI0 E;  3CR9 A;  4FAJ A;  3N6U A;  4IO2 A;  3H6U A;  4LON B;  1UTB A;  1ZMG A;  4PAK A;  2ZYN A;  4EQ7 A;  2V4C A;  3Q28 A;  4KD5 A;  3PV0 E;  3JV9 A;  3MZ9 A;  1B7U A;  4ELO A;  4H5F A;  2V25 A;  2XD2 A;  5AA2 A;  2UVJ A;  5L8D A;  3MQ9 A;  3RPW A;  3HHF A;  2VHA A;  4YB7 A;  3SES A;  1IEJ A;  4RXL A;  2Z8F A;  5AA4 A;  2B4M A;  3CHG A;  4EF2 A;  5I57 B;  3IOW A;  1KZ8 A;  3FVO A;  3IAZ A;  2ZXT A;  4UA8 A;  1SYI A;  4OEN A;  2Y7K A;  5ET8 A;  1FTJ A;  4RPO A;  1RKM A;  4PGN A;  4X9T A;  5CC2 A;  1NH7 A;  2VP1 A;  3TDJ A;  4FAT A;  3SEX A;  4AQ4 A;  2F78 A;  3F11 A;  1B40 A;  1KA0 A;  4G61 A;  1IQ7 A;  5CM6 A;  1SBP A;  2RC9 A;  4P11 A;  3FJM A;  3GZG A;  5DW8 A;  3CFX A;  4GWY A;  4R75 A;  4NGU A;  1LAG E;  4OVQ A;  3FXB A;  2XXP A;  3KC1 A;  4TLM B;  2GH9 A;  3U93 A;  3FUZ A;  2PVU A;  5DVJ A;  4HCY A;  2JJK A;  5I59 B;  3FIR A;  1FPG A;  3K6U A;  2QSX A;  4I3E A;  1MY1 A;  1AWB A;  1Z7M E;  3KN7 A;  1P1N A;  5H8F B;  2XXR A;  4OEU A;  4YZZ A;  2PT1 A;  2HFB A;  4PGP A;  1B6H A;  4NF4 A;  4OER A;  1DMB A;  1GGG A;  1O7T A;  3FXU A;  5I58 B;  2ZNS A;  4OTE A;  4GX3 A;  3R7X A;  2DE2 A;  4ELP A;  1D3K A;  2AIX A;  4P3L A;  4L17 A;  2X7P A;  3UIF A;  3O9P A;  1SD3 A;  4GL8 A;  4MLQ A;  3H03 A;  4WEP A;  3C9H A;  4PFI A;  2BJJ X;  3PMX A;  4GOT A;  2XX8 A;  4R2F A;  5I56 A;  1B3G A;  5IGA A;  3KOT A;  4GRK A;  2OBG A;  3OEN A;  2KQZ A;  4FEC A;  1B3H A;  1G0H A;  4WKM A;  1IXI A;  2DWH A;  2VGQ A;  2W7Y A;  5CRY A;  3U65 A;  1TXF A;  3EHU A;  3TQL A;  1TFD A;  3ROJ A;  2ZZW A;  4XKN A;  4QFL A;  2XWV A;  1B4Z A;  3T9U A;  5H8H B;  1A99 A;  2VD3 A;  4BDL A;  2Q9T A;  1LFG A;  3M3F A;  4TLL B;  1YPN A;  4N81 A;  2FVZ A;  2X26 A;  1NH8 A;  5L9S A;  2QS1 A;  5FTI A;  3O28 A;  2XXH A;  3V89 B;  1QUJ A;  2FNC A;  5KCJ B;  3T66 A;  1GVC A;  3RPL A;  3H6W A;  3T9H B;  2DDK A;  3LSW A;  5DT6 A;  4N6P A;  4AB5 A;  3C36 A;  4EQ9 A;  2HZL A;  2I4B A;  5JTY B;  3BIG A;  1D9Q A;  2XXI A;  5K2X A;  4U2R A;  1VSO A;  3SEY A;  3CRB A;  2Q2A A;  3S4U A;  4H0W A;  2RF1 A;  3MYU A;  2ZZV A;  3PPN A;  4GBW A;  1DK4 A;  4ZDM A;  1NUX A;  3PTY A;  2AL4 A;  1HSJ A;  2WX9 A;  2ZNU A;  3FVG A;  1NI9 A;  1N3X A;  3EHS A;  3SEV A;  4LA9 A;  2I6E A;  2DQV A;  3MVY A;  1BP5 A;  3MPL A;  5B70 A;  4PFW A;  3FV2 A;  1YZ0 A;  3E79 A;  1H44 A;  3LSF B;  1DCU A;  3C32 A;  4OYV A;  4QFK A;  2QS2 A;  1AMF A;  5ELV A;  3PMV A;  4DDD A;  1GV8 A;  4IY6 A;  3BBR A;  1VFD A;  4YU0 A;  4NAP A;  3SET A;  5JEI A;  2ALU A;  2I48 A;  3FXQ A;  1LCF A;  3HHG A;  3ILU B;  3C4M A;  2PCR A;  1GTK A;  1XC1 A;  3T1B A;  1LCT A;  3L6G A;  1QKA A;  2Z8D A;  3OSQ A;  3RY3 A;  4ONY A;  1UTH B;  3MJN A;  4QFO A;  4MAG A;  3HPI A;  5LDZ A;  4H67 A;  1D9V A;  3I3V A;  4LVQ A;  4PP0 A;  2I58 A;  3OOA A;  4JSO A;  5F7V A;  1FBC A;  3CG3 A;  3WAE A;  4JWO A;  2V93 A;  4NF5 B;  4F3P A;  1BKA A;  3O2A A;  2YJP A;  4LQ5 A;  4N91 A;  1IXC A;  3K6V A;  4Q8R A;  4MFI A;  1S50 A;  4F31 B;  3A3U A;  5FHM A;  1Y9U A;  5DYH A;  5H8Q A;  2R9J A;  4R74 A;  2IEE A;  2F36 A;  3HCQ A;  3Q25 A;  1UTB B;  2VPO A;  3SKP A;  3T96 B;  4DZ1 A;  4G77 A;  3RLF E;  1QGX A;  1KWH A;  5I2N A;  2R8T A;  3OXN A;  3E4R A;  1L5T A;  3MZ1 A;  2H9B A;  4FED A;  3RYD A;  1II5 A;  1OQG A;  1FQC A;  4NED A;  3MBP A;  2PYY A;  4H65 A;  1FRP A;  2OZZ A;  4OFO A;  1XS5 A;  4G8N A;  1SDX A;  1LST A;  2XWK A;  5AA4 B;  3TZA A;  3IFC A;  2DWI A;  4ZEK A;  1MH4 A;  3G3J A;  3O6G A;  5DTB A;  1JET A;  4F29 A;  1OIB A;  3PPR A;  5ITO A;  2Z22 A;  2ANJ A;  3UP9 A;  2F35 A;  4GXS B;  4QFP A;  2ESN A;  1OLA A;  3N26 A;  1XHY A;  4QBA A;  4OMB A;  4ZEF A;  4TOZ A;  4RK9 A;  1ANF A;  1B46 A;  1LBW A;  1FPF A;  4F18 A;  5DEX A;  3TAJ A;  1NV7 A;  4THI A;  4P1L A;  3V8X B;  5A5X A;  2QL3 A;  3UGW A;  1D4N A;  1USY H;  4MNC A;  4U23 A;  1IME A;  2HEU A;  2O7U A;  4KCD A;  3ZS6 A;  2I3V A;  4P1E A;  4OVP A;  4P0G A;  3UOR A;  3IOR A;  4OWD A;  2Q74 A;  3MZB A;  3O66 A;  4KXP A;  5DVI A;  3IO6 A;  2Y7P A;  4DI4 B;  3QAX A;  4MBP A;  4DCX A;  4OVS A;  3BIH A;  4I62 A;  3EN3 A;  3PGF A;  3W9W A;  2WYK A;  3DP6 A;  3UN6 A;  1K9Y A;  4BDQ A;  4GXA A;  1RYO A;  3THI A;  1VFE A;  3GYY A;  1QW0 A;  2D3I A;  2H98 A;  4FIM A;  1AH5 A;  1FQA A;  4PF6 A;  4HW8 A;  4R6Y A;  3VFJ A;  4ZEC A;  4G68 B;  3CG1 A;  3P7I A;  4MNP A;  1PB7 A;  3T93 B;  2FIX A;  3SZP A;  3IFA A;  2YLN A;  1MXW A;  1XT8 A;  3A09 A;  4KR5 A;  3CVG A;  3TFL A;  5HM4 B;  3MP1 A;  4X8R A;  2Y7W A;  2GHA A;  2QVR A;  4MCO A;  2X7Q A;  2P1S A;  1B1X A;  4R2B A;  3WAF A;  2OJT A;  1ATG A;  1GR2 A;  1NNP A;  2XWO A;  2AYS A;  3RNN A;  1BLF A;  4OET A;  3K1P A;  4G8M A;  1PB9 A;  4MEV A;  1NV6 A;  2V3U A;  3K0V A;  1FTA A;  3B6T A;  2QJE A;  4R6K A;  2HZK A;  4BLA A;  4H46 A;  1SI1 A;  5EHM A;  3T9X B;  1MXZ A;  1VDW A;  1LAH E;  1JW1 A;  3MVZ A;  2ZYM A;  1A8E A;  1XI6 A;  1P99 A;  3W9V A;  1MG1 A;  4XEQ A;  4YMA A;  4HTG A;  3M8U A;  4O3A A;  2REG A;  3IL1 B;  2H99 A;  2NWJ A;  5ESY A;  4ZZA A;  3RPL B;  4K3F A;  3TTN A;  4DCY A;  3LSX A;  4EXK A;  2FIE A;  4FE8 A;  4N6K A;  4N07 A;  4GWU A;  1SW1 A;  3EF7 A;  3Q27 A;  1CE2 A;  4NF6 B;  2Q89 A;  4JWY A;  3KZG A;  1P1O A;  4ELR A;  4IO4 A;  1QUL A; 
#chains in the Genus database with same CATH homology
 4N8Y A;  4PE3 A;  4MIJ A;  4PBQ A;  3EKI A;  1NUW A;  4PFI A;  1FPI A;  5IGA A;  2V3Q A;  5FBP A;  2F3B A;  2KQZ A;  4M1V A;  4HCW A;  1YYZ A;  5ET7 A;  1G0H A;  3U65 A;  2FBP A;  3ROJ A;  2ZZW A;  2Y5L A;  3D1R A;  4I3Y A;  2XWV A;  4FBP A;  1IMD A;  5T3J A;  2Q9T A;  4P8B A;  2VPN A;  4N81 A;  2FVZ A;  4PDH A;  4GBV A;  2FHY A;  1NV2 A;  2CEX A;  2PFZ A;  3RPL A;  5EYH A;  1FPJ A;  1DBZ A;  2DDK A;  5A5L A;  3HFU A;  2F3D A;  4GWX A;  2HZL A;  4PAI A;  3BIG A;  1D9Q A;  2QFL A;  1FBF A;  5IZ3 A;  3MYU A;  4NG7 A;  2ZZV A;  4AS4 A;  1BK4 A;  1RDY A;  4GBW A;  1NUY A;  2Y5K A;  3A29 A;  1DK4 A;  1NUX A;  3PTY A;  2WEF A;  5IZ1 A;  2WX9 A;  2DE3 A;  5F24 A;  1NI9 A;  2XWI A;  4I40 A;  1G0I A;  2KR0 A;  1YZ0 A;  3E79 A;  1DCU A;  4N4U A;  2OWZ A;  5ET6 A;  3B50 A;  4XF5 A;  1FBH A;  4PF8 A;  4JVD A;  3MST A;  4NAP A;  5IM2 A;  1EYI A;  1NV4 A;  1LBY A;  4PFB A;  5EQA A;  3LV0 A;  1FBD A;  4O8M A;  4GX6 A;  1EYJ A;  2WYP A;  5J1D A;  1IMA A;  1IMF A;  3ISP A;  2PCR A;  4OAN A;  1IMC A;  3T1B A;  4PFR A;  4N17 A;  1LBV A;  4AS5 A;  4MAG A;  2CZK A;  4HE0 A;  5LDZ A;  4PCD A;  5EYG A;  4OA4 A;  2QPQ A;  4N15 A;  1FPE A;  4NX1 A;  1FBC A;  4JVI A;  3B8B A;  1NUZ A;  1RDZ A;  4N91 A;  4NHB A;  2DVZ A;  4OVT A;  5EQ9 A;  2OX3 A;  4PET A;  2WBB A;  2VPO A;  2B4L A;  5IZZ A;  1QGX A;  2R8T A;  1NV3 A;  4QXD A;  2VT5 A;  3RYD A;  4X04 A;  1NV1 A;  1YXI A;  1Q9D A;  4H45 A;  1FRP A;  5I5P A;  4LN5 A;  1FPB A;  2F5X A;  4MHF A;  4PTK A;  4IR8 A;  2HHM A;  4MX6 A;  2XWK A;  4P47 A;  1FJ9 A;  5EQ7 A;  2QVV A;  5I3S A;  3KBZ A;  3IFC A;  2XA5 A;  3QMF A;  2Q8M A;  4GWZ A;  1FBE A;  4YIC A;  4NQ8 A;  3KC0 A;  1FPL A;  1FJ6 A;  4PBH A;  4JVC A;  5J16 A;  4QBA A;  1LBW A;  1FPF A;  4F18 A;  2CZH A;  1NV7 A;  3LUZ A;  4P1L A;  4MJO A;  1SPI A;  4P9K A;  4XFE A;  4MNC A;  1IME A;  2P3N A;  2BJI A;  4N8G A;  4P1E A;  4OVP A;  2MKZ A;  2Q74 A;  1KA1 A;  4KXP A;  2WBD A;  4GWW A;  4DI4 B;  4PAK A;  4OVS A;  1FPK A;  3BIH A;  2V4C A;  3W9W A;  2WYK A;  1LBZ A;  1K9Y A;  2DE4 A;  3GYY A;  4UAB A;  4PF6 A;  4N6D A;  3NOH A;  4MNP A;  4O7M A;  4PAF A;  2B4M A;  4GWS A;  4NN3 A;  1FBP A;  1K9Z A;  2FIX A;  1LBX A;  3CHG A;  3SZP A;  3T0J A;  3IFA A;  2P3V A;  4F1V A;  1KZ8 A;  5ET8 A;  4X8R A;  5ET5 A;  4PGN A;  2QVR A;  4X9T A;  4MCO A;  1IMB A;  5I7I A;  1CNQ A;  2GQ1 A;  1KA0 A;  4G61 A;  2XWO A;  5CM6 A;  1FBG A;  4NF0 A;  4O94 A;  5DW8 A;  4GWY A;  4HE1 A;  2CEY A;  4NGU A;  4PC9 A;  4MEV A;  5JK4 A;  1NV6 A;  4OVQ A;  1FTA A;  3FXB A;  4MMP A;  1FSA A;  3KC1 A;  5LTC A;  2HZK A;  4H46 A;  4HXV A;  4OVR A;  1LEV A;  1VDW A;  4HCY A;  2JJK A;  1JP4 A;  3FBP A;  1FPG A;  1XI6 A;  3E78 A;  4I3E A;  4MNI A;  3W9V A;  4XEQ A;  2ZZX A;  1AWB A;  1INP A;  4PDD A;  4P56 A;  4YZZ A;  5ESY A;  1EYK A;  4PGP A;  5EQ8 A;  1NV0 A;  2L5V A;  4HE2 A;  3RPL B;  4DI3 D;  1NV5 A;  2HPG A;  4GX4 A;  2FIE A;  1FPD A;  4N6K A;  2QVU A;  4F1U A;  4GWU A;  2CZI A;  4GX3 A;  2PFY A;  2DE2 A;  5IZ3 B;  4O7I A;  1RDX A;  4P3L A;  2XXK A;  4F19 A;  2HXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...