4PGPA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound 3-indole acetic acid
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
PVTLNYANFPPASTFPCIQMEQWAHEVRTRTRGKVDVLTYPGGTLLGARNMLRGVMSGQADIGCISLAYHPGVFPVMSVFELPLGFTSAEAASSVLWELYSGLRPAELERVKVLTMFTSAPSHFMTVTPVRSLRDLQGMEIRGAGTLSAILEKLGATPVSMPMPEVPEAVQKGIIKGLFTSLDVMKDMNFAEMTGHVTRADQAVYPFAVIMNREAWERLSPDVQQVLDGLAAEHAAWTGRYLDAHVQDSMRWAEEKHGVQVHTLPEEDIAAMRRSVQPLFDAWAQRAADKGADPDAVMRTVDALKAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein, family 7
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
molecule tags Solute-binding protein
total genus 111
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pgpA00
5IGAA 4PF6A 4PE3A 3U65A 2CEYA 4PDDA 4LN5A 4XF5A 2CEXA 4OVTA 4N91A 4PAFA 4XEQA 4O94A 2ZZWA 4N4UA 4OANA 4MAGA 4MCOA 2XA5A 4MX6A 4N8YA 4PFIA 4YICA 4PDHA 4OVPA 2XWIA 4MNCA 4DI4B 4N15A 4MIJA 5I5PA 4P9KA 2HZLA 4PF8A 4MNIA 4PGNA 4O7MA 4P56A 2XXKA 4PBHA 2HPGA 4UABA 4MNPA 4MEVA 4NN3A 4PFBA 5CM6A 4YZZA 4OVSA 4NX1A 4PBQA 4PETA 4P3LA 3B50A 2PFYA 2HZKA 4PCDA 4N6DA 4O8MA 4P47A 4NF0A 4PC9A 3FXBA 2VPNA 3GYYA 2XWKA 2PFZA 4XFEA 2VPOA 4X8RA 2ZZXA 2WX9A 4MHFA 4N8GA 2WYPA 4P1EA 5LTCA 4N17A 4OVQA 4P8BA 4PAIA 2ZZVA 2WYKA 2XWVA 4PGPA 5IM2A 4NAPA 4OVRA 4P1LA 4N6KA 4NG7A 4PFRA 4OA4A 4DI3D 4MMPA 2V4CA 4NHBA 4PAKA 4X04A 5I7IA 5IZZA 4NGUA 2XWOA 4NQ8A
chains in the Genus database with same CATH superfamily
2F35A 1GVCA 3H7MA 1B51A 5ITOA 3VVEA 3MP6A 1MH3A 3UORA 5H8FB 2AL4A 3IL1B 3KN7A 1RYXA 1SI1A 3M3KA 4FBPA 4PAFA 2I3VA 2FIXA 4ZS9A 3PMVA 1EYKA 3G3JA 5ET7A 2NUVA 1NNKA 3OSRA 4JB7A 4ZEBA 4OENA 2X7QA 2Y7IA 3V8XB 3G3IA 4NE4A 3UGWA 2XX8A 3S9LC 3KSJA 4NF4A 3S9NC 3G3GA 1II5A 4NMYA 1B3HA 1JEVA 4G8NA 2PMSA 3BIGA 4R2FA 3GBAA 4N07A 3ZS6A 2O6AA 3TEPA 3QK6A 1TXFA 1MXYA 1FJ9A 1FPLA 1NV2A 2F36A 2XXPA 2P3NA 3TUSA 4JDFA 1FCKA 1KWHA 4DCXA 3EF7A 4R6KA 2P3VA 3RYDA 3C32A 1KA0A 5CBRA 3UIFA 4I62A 2XXIA 1VFDA 5EYGA 2GHBA 2PVUA 2NWJA 5FHOA 3IOUA 2ZMBA 1SDXA 1S50A 4PDDA 3W15C 1QGXA 2CEXA 2O7UA 1L5TA 2Q8MA 5I84A 3PUWE 2QVRA 1B5JA 4LQ5A 3M8UA 3KC0A 4RA1A 1F9BA 3SERA 5I57B 3PD9A 3LSWA 2ZNUA 3MZBA 2V84A 4FE8A 3GXAA 1JQFA 1B3LA 2I58A 3O97A 2V3UA 3EN3A 1SYIA 1KA1A 2RF1A 4QBAA 4UABA 2NOOA 1LAHE 2QS4A 4XIGQ 4ZE8A 4GWZA 3S9EA 3S4UA 3FBPA 3IB0A 2FNCA 1US4A 5IZ1A 3IFCA 4KYSA 1URSA 4G68B 3Q25A 2FBPA 1CNQA 1IXCA 3S9MC 3QUJA 3KZGA 4ELRA 1MPDA 3K1PA 2ABHA 1FBFA 4U21A 4YB7A 1FPKA 3ILTB 3ONMA 2D3IA 5I58B 3Q28A 1JP4A 3GZGA 3MPKA 1LSTA 4NWCA 4EQ9A 1AIVA 3E9XA 1IITA 2PYYA 4MLVA 3SEUA 3FJGA 4PFRA 4DXUA 4MMPA 1TWYA 1ZMGA 3DP4A 1NUZA 4IGRA 1LB9A 4IO5A 2ALUA 2XXTA 4KYDA 4FAJA 1I69A 4ELOA 3N26A 1USYH 4GL0A 2DYXA 3N6UA 3JV9A 1VSOA 4LZ8A 5FHNA 4I8CA 4RJZA 4KCDA 1DCUA 3FVKA 5DTBA 3B6QA 2XXUA 3O6IA 4YZZA 4OQOA 4MH5A 2DVZA 2P1SA 1Y4TA 3MVWA 3K6XA 4RYAA 2DWJA 4F31B 2QL3A 3BBRA 2VPNA 3HPIA 5HM4B 3P7IA 1MQGA 2B65A 2RC7A 3MW0A 5J1DA 2HAUA 3CHGA 4H5GA 3C31A 1G0IA 4GVOA 1SVXB 2CZHA 2WBDA 4ND9A 4ZEDA 3TCFA 4BLAA 3FVGA 1SW4A 3H6VA 1LBYA 2XXWA 3FVNA 3K6WA 2VD2A 1P1NA 2DE4A 4G68C 1NNTA 1FBPA 1GR2A 2ANJA 4ZEIA 4YKPA 4U2RA 3RQTA 3QIMA 4U1OA 4N91A 5ICQA 5DYHA 5AA4B 4OESA 4DXCA 1ZBMA 3SEXA 5JK4A 4NWDA 2AIXA 2I4BA 4OFJA 2UYEA 3KJ7A 4PFUA 3MYUA 4PDHA 4GRKA 4N15A 2OBGA 1NV3A 4TLMB 2DWAA 2HXWA 4NF6A 3IOTA 4F3BA 1T0KA 4KPTA 1QUJA 4KYEA 3T1BA 4F3GA 3K0VA 4NX1A 1DOTA 4P3LA 3O29A 1UTHA 1FBDA 3ZSFA 4GWWA 1D9VA 1JETA 1D4NA 3GYYA 4I3YA 1YTVA 1LBVA 4LUBA 1YPNA 4PFYA 2I0CA 1OLCA 5HBCA 2QS1A 2M8CA 1XVXA 2ZZXA 2FYIA 1FQAA 3H6UA 4HS7A 4QSEA 4QSCA 5L9MA 4N17A 3TKDA 3U1OA 1IUDA 2GRVA 3TDJA 3ROJA 2WYKA 4EXKA 4N81A 2REGA 4EDPA 1P1WA 3EHTA 4KFQA 4P1LA 3RPLA 4HE1A 2V93A 1ZTYA 1FQDA 1N04A 4YU0A 3K1NA 3DELB 4KI0E 3BFTA 4ZEFA 1LAGE 2HHMA 1SD3A 5IGAA 4PF6A 3RLFE 3CR9A 4IY6A 3PU5A 4EQBA 1H76A 3RGYA 4C0RA 4Z0IA 2O51A 4IO3A 1AWBA 3MVZA 4QHQA 5KZTA 4FIMA 5EQ8A 1OIBA 2Z23A 4GWUA 2OWTA 1IMDA 4QF9A 1M5FA 5DEXB 4G4PA 5I59B 2DVCA 2F34A 3E13X 4BDMA 2XXKA 4UACA 3TTLA 3R7XA 2UYFA 1MPCA 3ILUB 4HW8A 4PFBA 1NV7A 5CMMA 4X48A 2UVGA 2O69A 3C9HA 4G68A 4HCYA 3LSXA 2YLNA 4ZDMA 1URDA 2VP1A 1B0HA 1XVYA 1AOVA 3SKPA 1Y4CA 1RDZA 3QAXA 5A5XB 4AB5A 1FBHA 2I0BA 2WKYA 4BDNA 1VDWA 3KBRA 2GH9A 4DZ1A 1SQYA 1MXXA 1PBPA 5DVFA 3H3GA 4M1VA 1EH3A 4IO2A 4P1EA 3MPLA 5EQAA 1N0TA 4P8BA 5I2KA 4PAIA 4P0IA 4H67A 1B32A 2XXQA 4OXVA 2XWVA 2DWIA 2LAOA 3TFLA 5K2YA 2VGQA 3SDFA 3UP9A 1OVTA 1B9JA 1LCTA 4KHZE 2FA7A 1VFEA 3QMFA 2YPNA 4NF5B 4FEBA 3G3HA 1B3FA 4EXLA 1LEVA 4MF3A 4PE5B 2XA5A 1Q9DA 1IIWA 2Q2CA 4JVIA 3TTRA 3G7WA 4I9DA 3H6WA 3KOTA 1A54A 4JBZA 3LUZA 1SBPA 4O7MA 4P56A 3EHUA 1INPA 4WEPA 1PC3A 4NN3A 1QKAA 4XKQA 3JYRA 4WKMA 4OERA 4R9FA 3PUYE 5LDZA 4OWDA 5EHMA 1FTLA 4FATA 4G8HA 1A55A 4XKRA 3U72A 4NF8A 1Y3PA 4R72A 1JW1A 2R8TA 3BKIB 3VLWA 3T9XB 5EYFA 4ELQA 1BTJA 4XKNA 2UXAA 4HCWA 3HFUA 2CMOA 5DVJA 3KC1A 4JWXA 3MQ9A 1TFDA 2QS3A 5TPAB 5AA2B 1Y3QA 4OVQA 3SEWA 1IMAA 4F29A 4POXA 1MQHA 5I2NA 1NI9A 1FPGA 2HQ0A 3Q29A 4GIZA 1B4ZA 3CSGA 2XXVA 4DI3D 3C36A 5H8HB 1EU8A 3TPAA 2F6PA 3DP8A 1DMBA 2XWOA 2OWSA 1XOCA 3BIHA 4TQUQ 2CEYA 4OVJA 2R6GE 2DE3A 1R1NA 3LV0A 2B4LA 2ZYOA 2W7YA 2XHDA 4OVTA 3U92A 3PUVE 2X7PA 4IO6A 5IAIA 1XC1A 3ISPA 5IZ3B 2I48A 1SW1A 1GTKA 3OENA 4DDDA 3D1RA 1IMCA 3IX1A 2O7IA 3IJOB 4G61A 4QXDA 3MC2A 1ZLQA 2DSFA 3TQLA 2D5WA 3B50A 4RNSA 3TZAA 4O8MA 1NV0A 4IY5A 5J16A 2DP8A 4G8MA 1SI0A 4NF0A 3WAEA 2A5SA 4PFTA 1PBQA 2OZZA 4PQJA 4GWXA 2AYSA 2F7AA 1Y3NA 3O66A 1NH7A 3OO6A 3LC8A 1J1NA 1ZKBA 3QXMA 4EQ7A 4BDRA 1AH5A 4AS4A 4KD5A 1DTGA 3O6GA 3L6GA 5A5LA 5TU0A 1Y1MA 4OFLA 2NVUB 4ESWA 2F3BA 1Y1ZA 1QW0A 2V3TA 3VLUA 2Q88A 4ZECA 1DBZA 1MG1A 4R6YA 3FXRA 1FTJA 1B5IA 4KCCA 4XF5A 3B7DA 4C1UA 1P99A 5DEXA 3R6UA 2Z8EA 5I59A 1N3XA 3TODA 5JEIA 3T9VA 5KCJB 4MIJA 5FTIA 3MUQA 1NMUA 1OLAA 3N5LA 3RT8A 4AB6A 2F7CA 1NNFA 2F7BA 1BKAA 4GWSA 1FPIA 3C4MA 4MJOA 1LLSA 1B52A 3I6VA 3KSXA 4R73A 2P2AA 1S9TA 1FW0A 1P1QA 4PCDA 4P47A 4QFLA 3RT6B 4RK9A 2I49A 3A09A 3PPQA 3IK6B 1LBXA 4H8JA 2IEEA 1D9YA 1HSLA 4O3BA 2F3DA 1FBCA 1QKBA 3KJTA 4HXVA 4EUOA 1OMPA 4YKIA 3RUMA 1I6AA 4MLQA 1SPIA 4O3CA 3CIJA 3EPEA 5H8NA 1PB8A 1MRPA 3VVDA 2Z8DA 5IM2A 2DS9A 3QUFA 3IOVA 4NG7A 1B1HA 1MM7A 4DLDA 4OA4A 2O1LA 3T66A 3PUXE 2Y84A 3T93B 3RPWA 4P11A 3BFUA 4NF5A 3TAJA 4OFOA 4TOZA 1FSAA 4GXSB 2UVIA 1WVJA 1UIUA 2Y5LA 1M5EA 3MAMA 2D21A 4H8IA 5ITPA 4N4UA 3DP6A 5BUUA 1M5DA 3QYTA 1ANFA 1NL5A 1O64A 2XWIA 4DI4B 1B40A 1NNPA 3K4UA 3D4CA 4OEUA 5H8FA 1Z7NE 3K02A 1MDP1 2O1MA 4GX4A 3FGSA 4NF4B 2MKZA 5I56B 3RTFB 2WEFA 3IB1A 4DCYA 2UVJA 1FJ6A 4FECA 1ZU0A 4PETA 4K3FA 3OO8A 2XXXA 1MQJA 3PGFA 3VDFA 3D4GA 2O84X 3PPNA 3Q26A 1NH8A 4O7IA 3LBSA 2QMXA 1SYHA 1XT8A 2RCAA 3HV1A 1XS5A 4N13A 1SW2A 3C35A 1PB7A 2XXHA 4DIGA 5CC2A 4L17A 5LTCA 4F1UA 1YCJA 4RY1A 4E0WA 2CZIA 2V3QA 2OX3A 1CE2A 3TMGA 4P0GA 3CVGA 4OVRA 5H8HA 4N6KA 4QSDA 3JZJA 3HSTA 1PDAA 4JSDA 3QSLA 4G77A 1QVSA 1B46A 3OELA 4PAKA 3FXUA 4TLLB 4GX3A 1H43A 5EYHA 4PE3A 5B7DA 3HO7A 1I6BA 2KQZA 5HPQA 3TELA 1NV4A 3DLNA 5ET8A 3IR1A 3EHSA 3PPPA 3OSQA 1B7HA 2ZZWA 3U94A 2RCBA 1OQHA 3K2DA 4MAGA 4MCOA 1QUIA 4YAHX 5EQ7A 1NUXA 4P9KA 2KR0A 1DPPA 1FBEA 3PD8A 5CMBA 4PFWA 1MDQA 4Q5TA 1PB9A 2Y7WA 3K6VA 5I57A 4YB6A 4PBQA 3OO9A 1P1UA 3VFJA 1MY0A 1FQFA 4ISUA 3H03A 3MVXA 3ZKKA 4F2OA 1RDXA 1P1OA 3MP8A 4F3PA 3I3VA 1EZPA 2YJPA 1NUYA 1UQWA 1B1XA 3A3CA 2F97A 2E1SA 4WXJA 4XTCQ 1MM6A 3K1MA 3PTYA 4R9GA 1YYZA 3TYHA 2F8DA 2QFLA 1YZ0A 2Q89A 2FHYA 3OEMA 4JVDA 3KBZA 4IO4A 4I40A 1G0HA 1BP5A 3LSFB 3OD7A 1RDYA 4GD5A 3W9WA 4OEVA 5DW8A 5I58A 3OO7A 4GXAA 1LBZA 4GBWA 1I6QA 1N76A 2B4MA 4KXPA 1D9QA 1N7WA 4QFKA 5IZZA 1YXIA 1B5HA 4YKKA 3FV2A 3ECRA 2QPQA 3U65A 4YMBA 1N3WA 2ZNSA 2DE2A 4I3EA 4RPOA 1A7LA 3VV5A 2A5TB 4POWA 5ISUA 1IEJA 3SEVA 1DK4A 1FTMA 3CSBA 3V83A 5KCJA 3U8QA 1IQ7A 3MP1A 1EZOA 1MH4A 1MY1A 3UK4A 3MZ1A 2F78A 2HPGA 4U1ZA 1VE4A 1JVYA 5CRYA 4GL8A 1A99A 3T9HB 4FJPA 3FJ7A 4OYVA 2PBWA 4FEDA 3TCGA 2AL5A 1US5A 1IXIA 2DOJA 2PFZA 1PEBA 1LCFA 3PV0E 2XX7A 3VE1B 3LR1A 4MFIA 4Z7EA 4Q8RA 4IO7A 1MPBA 3O9PA 3VLVA 5F24A 5H8QB 1QJMA 1H44A 2QS2A 4QFPA 1R9QA 2RINA 3SEYA 1SW5A 1NV5A 3IOWA 3O2AA 3H6TA 1H45A 1VR5A 4MBPA 2DXYA 4C1TA 1WDNA 1EZ9A 4NAPA 3LSLA 2PCRA 1YAEA 1IMFA 1BLFA 4F18A 3UN6A 2V4CA 1LFGA 5FTHA 5I7IA 1USYE 4Q30B 3ZKLA 3FIRA 4JSOA 4LA9A 4OMBA 5F1QA 2HAVA 1FPFA 2DQVA 3G3FA 2RKMA 4NF6B 4R2BA 2OLBA 2GHAA 4X9TA 1MY3A 2I4CA 4XEQA 5L8DA 3G3KA 2FIEA 1Z7ME 2QRYA 3OEKA 1R9LA 4KQPA 3HCQA 2IA4A 2VOZA 1JNFA 2Z22A 2OWZA 2XXYA 1UTHB 5FHMA 4JVCA 2HZLA 2ZYKA 1MXUA 3KFMA 3TTKA 4H0WA 5I56A 2I6EA 4MNPA 2Y7RA 4YMAA 4GBVA 5AA4A 2XD2A 4MEVA 3NOHA 5CM6A 1FPDA 1B6HA 3CRBA 3B6WA 1JVXA 4H6DA 3B8BA 1NV1A 2PFYA 2CZLA 1UIVA 4M4GA 1LFHA 1TFAA 3F11A 3V5AA 3FXBA 3IB2A 1FTAA 1RKMA 2PT1A 1ZJLA 2UVHA 2Z8FA 2BJJX 1MS7A 5AA1A 4R75A 1IXHA 3C34A 4GQOA 1UTBB 4H46A 1K9YA 3RPLB 1BIYA 1MQIA 4IGTA 1XI6A 1FBGA 1MY2A 4OHNA 3L6HA 2WBBA 2ZZVA 3GBBA 5K2XA 3SESA 1EYIA 5JTYB 1WODA 4F3SA 4AQ4A 2VHAA 4JWOA 4GWYA 4R74A 4LATA 4OTEA 4NHBA 2DWHA 4E0XA 5M2VA 3MBPA 1MXZA 4X04A 1IZ1A 1TT1A 1B3EA 5DT6A 2RC9A 3TQWA 3FJMA 1MXVA 2PX1A 2X26A 4LQ2A 5ELVA 4HTGA 4JWYA 2H99A 2HXRA 1Q1KA 4NEDA 2L5VA 1FTOA 4N8YA 3N94A 4XKPA 4MNCA 3PMWA 5CMKA 3EKIA 3B6TA 1A40A 2ZNTA 3IORA 3IAZA 4PBHA 4KR5A 3MWBA 2VT5A 3N6TA 3T22A 4PTKA 1LBBA 1Y9UA 3WAFA 4ONYA 3K6UA 1AL3A 1FRPA 1M5CA 2QJEA 1LAXA 3KEIA 2THIA 3FVOA 2QSXA 4N6DA 4U4XA 4HE2A 3FZVA 4PP0A 4H5FA 1MXWA 5I2KB 4JXIA 1A8FA 5TP9B 2JJKA 2PT2A 1MQDA 2HCAA 3S2VA 3RN8A 1M5BA 4WEDA 1FPJA 3TTMA 3FV1A 4ZZAA 4F1YA 2VD3A 4BDLA 2Q8JA 3AXFA 3RY3A 5ET6A 2G29A 5AA3A 5A5XA 1B0LA 2XXRA 5KDTB 1ELJA 2FVZA 4H45A 3E3KA 1Q35A 4YB5A 4LVQA 3EQ1A 1LBCA 1IXGA 4F1VA 1B05A 2A5TA 3FASA 5ET5A 4GX6A 1IMEA 4F22A 3K00A 3T9UA 4OANA 2QMWA 1A8EA 1NFTA 4LZ5A 4MX6A 2XX9A 4OVPA 5I5PA 1GGGA 4DXBA 1B7ZA 3ODBA 1XHYA 4NF8B 4G2ZA 1N7XA 5I3SA 3A3UA 2GFEA 4OVSA 3DM0A 4AS5A 3HN0A 5T3JA 2ZYNA 4UA8A 1B2HA 4N6PA 4ZEKA 3MZ9A 3RNNA 1IMBA 3H4ZA 2OCUA 1AMFA 1GV8A 2VPOA 3CG3A 5I2NB 1H3DA 5CI5A 2HFBA 5BWJA 5H8QA 2DDKA 2ONRA 4MHFA 4N8GA 2WYPA 3O28A 2ESNA 3UA8A 1RYOA 1NV6A 3OOAA 4LP2B 1CB6A 4F2QA 1FQEA 4LZ7A 3M3FA 4Q0CA 3SETA 3SZPA 1LGBC 3KN3A 3PPRA 4F19A 5TPAA 4IB2A 5AA2A 1HSJA 1R6ZA 4OZ9A 1B3GA 3CFZA 4THIA 1BK4A 3K01A 3KG2A 3RTWB 4U4SA 5IKBA 4XXUA 4LN5A 1S7YA 4ECFA 2Q9TA 5LOMA 4BDQA 4IR8A 3MJNA 3E78A 4DE8A 3CG1A 3VXCA 4GLIA 4YICA 5CBSA 3MVYA 1JW5A 5EQ9A 3KOSA 4LONB 4QFOA 4PF8A 1ATGA 1OVBA 2G93A 4PGNA 1NUWA 2R9JA 1FQBA 1N84A 1EYJA 4O3AA 5IZ3A 1LBWA 4GWOA 1FQCA 3IJXB 4GF8A 5L9OA 3USDA 5F7VA 2Y5KA 3Q27A 2Q74A 4RK2A 1LB8A 3A29A 1UTBA 4XFEA 3U93A 1D3KA 3VXBA 1FPEA 2GQ1A 3TCHA 2WX9A 3H06B 1HSEA 4GOTA 4EF1A 3HHGA 2ZXTA 2F6GA 2H9BA 1JEUA 5B70A 4FORA 2XD3A 4NTLA 2H25A 4QRZA 2DXRA 2NXOA 3CI8A 5JTYA 5L9SA 3FATA 4HE0A 4R6HA 3VVFA 3OMBA 3KN8A 3O6HA 5FBPA 1QUKA 2QVUA 4ESXA 2QVVA 5H8SA 2H5YA 1B7UA 3FD3A 4NQ8A 3T96B 2Q2AA 3HHFA 3FUZA 3C33A 2F5XA 2H4IA 1KZ8A 3CFXA 3I5OA 1OQGA 5CMCA 1DPEA 1FTKA 2Y7KA 4O94A 3FXQA 2KLFA 5ICTA 2B3BA 3PMXA 3GLBA 4PFIA 2I3WA 3PUZE 4H65A 1URGA 3IFAA 3W9VA 2BJIA 4ZE9A 4U22A 1POTA 4U23A 2V25A 2ONKE 1K9ZA 4MNIA 2H98A 2ZYMA 1NKXA 4BDOA 2E0SA 1JW4A 1LFIA 2OK2A 1LAFE 3LUYA 1B58A 2P0SA 4ZZEA 4H1XA 1B4HA 3IO4A 2O68A 3PPOA 2B3FA 3T0JA 4I1DA 2HZKA 3CFLA 4PC9A 2CZKA 2XWKA 5TP9A 4X1DA 3TTNA 4F39A 5H8NB 1DSNA 4RPNA 1O63A 3M3LA 4OETA 4X8RA 5AE4A 3THIA 4EF2A 2OJTA 4GFRA 3E79A 2R71A 3V89B 3OXNA 4X1BA 1Y20A 5KDTA 4ELPA 5ESYA 3IO6A 4PGPA 2RC8A 4RXLA 3R26A 1QULA 4YKJA 1POY1 1DTZA 5AA2D 1ZIUA 2HEUA 3E4RA 2ONSA 1FPBA 1MY4A 2REJA 4QFNA 5DVIA 1O7TA 2Y7PA 5EHSA 3MSTA 4NGUA 3KGCA
chains in the Genus database with same CATH topology
5IGAA 4PF6A 1FSAA 1AWBA 2Y5LA 4FBPA 5EQ8A 4PAFA 2HXRA 4GWUA 4N4UA 2FIXA 1IMDA 2L5VA 4N8YA 2XWIA 4MNCA 4DI4B 1EYKA 5ET7A 3EKIA 4GX4A 2XXKA 4PBHA 2MKZA 2VT5A 4PTKA 2WEFA 4PFBA 1NV7A 1FJ6A 1FRPA 4PETA 4HCYA 4N6DA 4HE2A 4O7IA 3BIGA 1RDZA 1FBHA 1VDWA 1FJ9A 2JJKA 1FPLA 1NV2A 1FPJA 4M1VA 2P3NA 4P1EA 5LTCA 4F1UA 5EQAA 5ET6A 2CZIA 2V3QA 4P8BA 2OX3A 4PAIA 2XWVA 2P3VA 3RYDA 2FVZA 4H45A 4OVRA 4N6KA 1KA0A 4PAKA 5EYGA 4F1VA 4GX3A 5EYHA 4PE3A 2KQZA 1NV4A 5ET8A 3QMFA 4PDDA 5ET5A 1QGXA 2CEXA 4GX6A 1IMEA 2Q8MA 2QVRA 1LEVA 3KC0A 2ZZWA 4OANA 4MAGA 4MCOA 2XA5A 4MX6A 4OVPA 1Q9DA 5EQ7A 1NUXA 5I5PA 4JVIA 4P9KA 2KR0A 1FBEA 3LUZA 4O7MA 4P56A 1KA1A 4QBAA 4UABA 1INPA 5I3SA 4NN3A 4OVSA 4GWZA 4PBQA 4AS5A 3FBPA 5IZ1A 3IFCA 5T3JA 5LDZA 2FBPA 1RDXA 1CNQA 1IMBA 1NUYA 1FBFA 2R8TA 3PTYA 2VPOA 1YYZA 1FPKA 4HCWA 3HFUA 2QFLA 1YZ0A 2FHYA 2DDKA 4JVDA 3KC1A 1JP4A 4MHFA 4N8GA 3KBZA 2WYPA 4I40A 1G0HA 1NV6A 4OVQA 1IMAA 1RDYA 3W9WA 5DW8A 1NI9A 1LBZA 1FPGA 4GBWA 4PFRA 3SZPA 4DI3D 4MMPA 2B4MA 4F19A 4KXPA 1D9QA 5IZZA 2XWOA 1NUZA 1YXIA 1BK4A 2QPQA 3U65A 3BIHA 2CEYA 4LN5A 2DE2A 4I3EA 2DE3A 2Q9TA 3LV0A 2B4LA 4OVTA 4IR8A 3E78A 1DK4A 4YICA 3ISPA 5IZ3B 5EQ9A 4PF8A 1DCUA 4PGNA 2HPGA 3D1RA 1NUWA 1IMCA 4G61A 4QXDA 1EYJA 4YZZA 5IZ3A 1LBWA 2DVZA 3B50A 4O8MA 1NV0A 5J16A 4NF0A 2Y5KA 2VPNA 2Q74A 2PFZA 3A29A 4XFEA 4GWXA 1FPEA 2GQ1A 5J1DA 2WX9A 3CHGA 5F24A 4AS4A 1G0IA 2CZHA 2WBDA 1NV5A 5A5LA 4HE0A 4NAPA 2PCRA 1LBYA 1IMFA 2F3BA 4F18A 5FBPA 2V4CA 2QVUA 5I7IA 2QVVA 1DBZA 4NQ8A 2DE4A 1FBPA 1FPFA 2F5XA 4XF5A 1KZ8A 4X9TA 4N91A 4XEQA 2FIEA 4O94A 5JK4A 4PFIA 4PDHA 3MYUA 3W9VA 3IFAA 2BJIA 2OWZA 4N15A 4MIJA 1NV3A 4JVCA 2HZLA 1K9ZA 4MNIA 4MNPA 3T1BA 4GWSA 4GBVA 1FPIA 4MEVA 3NOHA 5CM6A 1FPDA 4MJOA 4NX1A 4P3LA 3B8BA 1NV1A 3T0JA 2PFYA 1FBDA 2HZKA 4PCDA 4GWWA 4P47A 4PC9A 2CZKA 3FXBA 1FTAA 3GYYA 2XWKA 4I3YA 1LBVA 4H46A 1LBXA 1K9YA 4X8RA 2ZZXA 3RPLB 2F3DA 1FBCA 4HXVA 1SPIA 1XI6A 3E79A 4N17A 1FBGA 2WBBA 3ROJA 2ZZVA 5ESYA 2WYKA 4N81A 4PGPA 1EYIA 5IM2A 4P1LA 3RPLA 4NG7A 4HE1A 4GWYA 4OA4A 1FPBA 4NHBA 4X04A 3MSTA 4NGUA 2HHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGA A;  4PF6 A;  4PE3 A;  3U65 A;  2CEY A;  4PDD A;  4LN5 A;  4XF5 A;  2CEX A;  4OVT A;  4N91 A;  4PAF A;  4XEQ A;  4O94 A;  2ZZW A;  4N4U A;  4OAN A;  4MAG A;  4MCO A;  2XA5 A;  4MX6 A;  4N8Y A;  4PFI A;  4YIC A;  4PDH A;  4OVP A;  2XWI A;  4MNC A;  4DI4 B;  4N15 A;  4MIJ A;  5I5P A;  4P9K A;  2HZL A;  4PF8 A;  4MNI A;  4PGN A;  4O7M A;  4P56 A;  2XXK A;  4PBH A;  2HPG A;  4UAB A;  4MNP A;  4MEV A;  4NN3 A;  4PFB A;  5CM6 A;  4YZZ A;  4OVS A;  4NX1 A;  4PBQ A;  4PET A;  4P3L A;  3B50 A;  2PFY A;  2HZK A;  4PCD A;  4N6D A;  4O8M A;  4P47 A;  4NF0 A;  4PC9 A;  3FXB A;  2VPN A;  3GYY A;  2XWK A;  2PFZ A;  4XFE A;  2VPO A;  4X8R A;  2ZZX A;  2WX9 A;  4MHF A;  4N8G A;  2WYP A;  4P1E A;  5LTC A;  4N17 A;  4OVQ A;  4P8B A;  4PAI A;  2ZZV A;  2WYK A;  2XWV A;  4PGP A;  5IM2 A;  4NAP A;  4OVR A;  4P1L A;  4N6K A;  4NG7 A;  4PFR A;  4OA4 A;  4DI3 D;  4MMP A;  2V4C A;  4NHB A;  4PAK A;  4X04 A;  5I7I A;  5IZZ A;  4NGU A;  2XWO A;  4NQ8 A; 
#chains in the Genus database with same CATH topology
 2F35 A;  1GVC A;  3H7M A;  1B51 A;  5ITO A;  3VVE A;  3MP6 A;  1MH3 A;  3UOR A;  5H8F B;  2AL4 A;  3IL1 B;  3KN7 A;  1RYX A;  1SI1 A;  3M3K A;  4FBP A;  4PAF A;  2I3V A;  2FIX A;  4ZS9 A;  3PMV A;  1EYK A;  3G3J A;  5ET7 A;  2NUV A;  1NNK A;  3OSR A;  4JB7 A;  4ZEB A;  4OEN A;  2X7Q A;  2Y7I A;  3V8X B;  3G3I A;  4NE4 A;  3UGW A;  2XX8 A;  3S9L C;  3KSJ A;  4NF4 A;  3S9N C;  3G3G A;  1II5 A;  4NMY A;  1B3H A;  1JEV A;  4G8N A;  2PMS A;  3BIG A;  4R2F A;  3GBA A;  4N07 A;  3ZS6 A;  2O6A A;  3TEP A;  3QK6 A;  1TXF A;  1MXY A;  1FJ9 A;  1FPL A;  1NV2 A;  2F36 A;  2XXP A;  2P3N A;  3TUS A;  4JDF A;  1FCK A;  1KWH A;  4DCX A;  3EF7 A;  4R6K A;  2P3V A;  3RYD A;  3C32 A;  1KA0 A;  5CBR A;  3UIF A;  4I62 A;  2XXI A;  1VFD A;  5EYG A;  2GHB A;  2PVU A;  2NWJ A;  5FHO A;  3IOU A;  2ZMB A;  1SDX A;  1S50 A;  4PDD A;  3W15 C;  1QGX A;  2CEX A;  2O7U A;  1L5T A;  2Q8M A;  5I84 A;  3PUW E;  2QVR A;  1B5J A;  4LQ5 A;  3M8U A;  3KC0 A;  4RA1 A;  1F9B A;  3SER A;  5I57 B;  3PD9 A;  3LSW A;  2ZNU A;  3MZB A;  2V84 A;  4FE8 A;  3GXA A;  1JQF A;  1B3L A;  2I58 A;  3O97 A;  2V3U A;  3EN3 A;  1SYI A;  1KA1 A;  2RF1 A;  4QBA A;  4UAB A;  2NOO A;  1LAH E;  2QS4 A;  4XIG Q;  4ZE8 A;  4GWZ A;  3S9E A;  3S4U A;  3FBP A;  3IB0 A;  2FNC A;  1US4 A;  5IZ1 A;  3IFC A;  4KYS A;  1URS A;  4G68 B;  3Q25 A;  2FBP A;  1CNQ A;  1IXC A;  3S9M C;  3QUJ A;  3KZG A;  4ELR A;  1MPD A;  3K1P A;  2ABH A;  1FBF A;  4U21 A;  4YB7 A;  1FPK A;  3ILT B;  3ONM A;  2D3I A;  5I58 B;  3Q28 A;  1JP4 A;  3GZG A;  3MPK A;  1LST A;  4NWC A;  4EQ9 A;  1AIV A;  3E9X A;  1IIT A;  2PYY A;  4MLV A;  3SEU A;  3FJG A;  4PFR A;  4DXU A;  4MMP A;  1TWY A;  1ZMG A;  3DP4 A;  1NUZ A;  4IGR A;  1LB9 A;  4IO5 A;  2ALU A;  2XXT A;  4KYD A;  4FAJ A;  1I69 A;  4ELO A;  3N26 A;  1USY H;  4GL0 A;  2DYX A;  3N6U A;  3JV9 A;  1VSO A;  4LZ8 A;  5FHN A;  4I8C A;  4RJZ A;  4KCD A;  1DCU A;  3FVK A;  5DTB A;  3B6Q A;  2XXU A;  3O6I A;  4YZZ A;  4OQO A;  4MH5 A;  2DVZ A;  2P1S A;  1Y4T A;  3MVW A;  3K6X A;  4RYA A;  2DWJ A;  4F31 B;  2QL3 A;  3BBR A;  2VPN A;  3HPI A;  5HM4 B;  3P7I A;  1MQG A;  2B65 A;  2RC7 A;  3MW0 A;  5J1D A;  2HAU A;  3CHG A;  4H5G A;  3C31 A;  1G0I A;  4GVO A;  1SVX B;  2CZH A;  2WBD A;  4ND9 A;  4ZED A;  3TCF A;  4BLA A;  3FVG A;  1SW4 A;  3H6V A;  1LBY A;  2XXW A;  3FVN A;  3K6W A;  2VD2 A;  1P1N A;  2DE4 A;  4G68 C;  1NNT A;  1FBP A;  1GR2 A;  2ANJ A;  4ZEI A;  4YKP A;  4U2R A;  3RQT A;  3QIM A;  4U1O A;  4N91 A;  5ICQ A;  5DYH A;  5AA4 B;  4OES A;  4DXC A;  1ZBM A;  3SEX A;  5JK4 A;  4NWD A;  2AIX A;  2I4B A;  4OFJ A;  2UYE A;  3KJ7 A;  4PFU A;  3MYU A;  4PDH A;  4GRK A;  4N15 A;  2OBG A;  1NV3 A;  4TLM B;  2DWA A;  2HXW A;  4NF6 A;  3IOT A;  4F3B A;  1T0K A;  4KPT A;  1QUJ A;  4KYE A;  3T1B A;  4F3G A;  3K0V A;  4NX1 A;  1DOT A;  4P3L A;  3O29 A;  1UTH A;  1FBD A;  3ZSF A;  4GWW A;  1D9V A;  1JET A;  1D4N A;  3GYY A;  4I3Y A;  1YTV A;  1LBV A;  4LUB A;  1YPN A;  4PFY A;  2I0C A;  1OLC A;  5HBC A;  2QS1 A;  2M8C A;  1XVX A;  2ZZX A;  2FYI A;  1FQA A;  3H6U A;  4HS7 A;  4QSE A;  4QSC A;  5L9M A;  4N17 A;  3TKD A;  3U1O A;  1IUD A;  2GRV A;  3TDJ A;  3ROJ A;  2WYK A;  4EXK A;  4N81 A;  2REG A;  4EDP A;  1P1W A;  3EHT A;  4KFQ A;  4P1L A;  3RPL A;  4HE1 A;  2V93 A;  1ZTY A;  1FQD A;  1N04 A;  4YU0 A;  3K1N A;  3DEL B;  4KI0 E;  3BFT A;  4ZEF A;  1LAG E;  2HHM A;  1SD3 A;  5IGA A;  4PF6 A;  3RLF E;  3CR9 A;  4IY6 A;  3PU5 A;  4EQB A;  1H76 A;  3RGY A;  4C0R A;  4Z0I A;  2O51 A;  4IO3 A;  1AWB A;  3MVZ A;  4QHQ A;  5KZT A;  4FIM A;  5EQ8 A;  1OIB A;  2Z23 A;  4GWU A;  2OWT A;  1IMD A;  4QF9 A;  1M5F A;  5DEX B;  4G4P A;  5I59 B;  2DVC A;  2F34 A;  3E13 X;  4BDM A;  2XXK A;  4UAC A;  3TTL A;  3R7X A;  2UYF A;  1MPC A;  3ILU B;  4HW8 A;  4PFB A;  1NV7 A;  5CMM A;  4X48 A;  2UVG A;  2O69 A;  3C9H A;  4G68 A;  4HCY A;  3LSX A;  2YLN A;  4ZDM A;  1URD A;  2VP1 A;  1B0H A;  1XVY A;  1AOV A;  3SKP A;  1Y4C A;  1RDZ A;  3QAX A;  5A5X B;  4AB5 A;  1FBH A;  2I0B A;  2WKY A;  4BDN A;  1VDW A;  3KBR A;  2GH9 A;  4DZ1 A;  1SQY A;  1MXX A;  1PBP A;  5DVF A;  3H3G A;  4M1V A;  1EH3 A;  4IO2 A;  4P1E A;  3MPL A;  5EQA A;  1N0T A;  4P8B A;  5I2K A;  4PAI A;  4P0I A;  4H67 A;  1B32 A;  2XXQ A;  4OXV A;  2XWV A;  2DWI A;  2LAO A;  3TFL A;  5K2Y A;  2VGQ A;  3SDF A;  3UP9 A;  1OVT A;  1B9J A;  1LCT A;  4KHZ E;  2FA7 A;  1VFE A;  3QMF A;  2YPN A;  4NF5 B;  4FEB A;  3G3H A;  1B3F A;  4EXL A;  1LEV A;  4MF3 A;  4PE5 B;  2XA5 A;  1Q9D A;  1IIW A;  2Q2C A;  4JVI A;  3TTR A;  3G7W A;  4I9D A;  3H6W A;  3KOT A;  1A54 A;  4JBZ A;  3LUZ A;  1SBP A;  4O7M A;  4P56 A;  3EHU A;  1INP A;  4WEP A;  1PC3 A;  4NN3 A;  1QKA A;  4XKQ A;  3JYR A;  4WKM A;  4OER A;  4R9F A;  3PUY E;  5LDZ A;  4OWD A;  5EHM A;  1FTL A;  4FAT A;  4G8H A;  1A55 A;  4XKR A;  3U72 A;  4NF8 A;  1Y3P A;  4R72 A;  1JW1 A;  2R8T A;  3BKI B;  3VLW A;  3T9X B;  5EYF A;  4ELQ A;  1BTJ A;  4XKN A;  2UXA A;  4HCW A;  3HFU A;  2CMO A;  5DVJ A;  3KC1 A;  4JWX A;  3MQ9 A;  1TFD A;  2QS3 A;  5TPA B;  5AA2 B;  1Y3Q A;  4OVQ A;  3SEW A;  1IMA A;  4F29 A;  4POX A;  1MQH A;  5I2N A;  1NI9 A;  1FPG A;  2HQ0 A;  3Q29 A;  4GIZ A;  1B4Z A;  3CSG A;  2XXV A;  4DI3 D;  3C36 A;  5H8H B;  1EU8 A;  3TPA A;  2F6P A;  3DP8 A;  1DMB A;  2XWO A;  2OWS A;  1XOC A;  3BIH A;  4TQU Q;  2CEY A;  4OVJ A;  2R6G E;  2DE3 A;  1R1N A;  3LV0 A;  2B4L A;  2ZYO A;  2W7Y A;  2XHD A;  4OVT A;  3U92 A;  3PUV E;  2X7P A;  4IO6 A;  5IAI A;  1XC1 A;  3ISP A;  5IZ3 B;  2I48 A;  1SW1 A;  1GTK A;  3OEN A;  4DDD A;  3D1R A;  1IMC A;  3IX1 A;  2O7I A;  3IJO B;  4G61 A;  4QXD A;  3MC2 A;  1ZLQ A;  2DSF A;  3TQL A;  2D5W A;  3B50 A;  4RNS A;  3TZA A;  4O8M A;  1NV0 A;  4IY5 A;  5J16 A;  2DP8 A;  4G8M A;  1SI0 A;  4NF0 A;  3WAE A;  2A5S A;  4PFT A;  1PBQ A;  2OZZ A;  4PQJ A;  4GWX A;  2AYS A;  2F7A A;  1Y3N A;  3O66 A;  1NH7 A;  3OO6 A;  3LC8 A;  1J1N A;  1ZKB A;  3QXM A;  4EQ7 A;  4BDR A;  1AH5 A;  4AS4 A;  4KD5 A;  1DTG A;  3O6G A;  3L6G A;  5A5L A;  5TU0 A;  1Y1M A;  4OFL A;  2NVU B;  4ESW A;  2F3B A;  1Y1Z A;  1QW0 A;  2V3T A;  3VLU A;  2Q88 A;  4ZEC A;  1DBZ A;  1MG1 A;  4R6Y A;  3FXR A;  1FTJ A;  1B5I A;  4KCC A;  4XF5 A;  3B7D A;  4C1U A;  1P99 A;  5DEX A;  3R6U A;  2Z8E A;  5I59 A;  1N3X A;  3TOD A;  5JEI A;  3T9V A;  5KCJ B;  4MIJ A;  5FTI A;  3MUQ A;  1NMU A;  1OLA A;  3N5L A;  3RT8 A;  4AB6 A;  2F7C A;  1NNF A;  2F7B A;  1BKA A;  4GWS A;  1FPI A;  3C4M A;  4MJO A;  1LLS A;  1B52 A;  3I6V A;  3KSX A;  4R73 A;  2P2A A;  1S9T A;  1FW0 A;  1P1Q A;  4PCD A;  4P47 A;  4QFL A;  3RT6 B;  4RK9 A;  2I49 A;  3A09 A;  3PPQ A;  3IK6 B;  1LBX A;  4H8J A;  2IEE A;  1D9Y A;  1HSL A;  4O3B A;  2F3D A;  1FBC A;  1QKB A;  3KJT A;  4HXV A;  4EUO A;  1OMP A;  4YKI A;  3RUM A;  1I6A A;  4MLQ A;  1SPI A;  4O3C A;  3CIJ A;  3EPE A;  5H8N A;  1PB8 A;  1MRP A;  3VVD A;  2Z8D A;  5IM2 A;  2DS9 A;  3QUF A;  3IOV A;  4NG7 A;  1B1H A;  1MM7 A;  4DLD A;  4OA4 A;  2O1L A;  3T66 A;  3PUX E;  2Y84 A;  3T93 B;  3RPW A;  4P11 A;  3BFU A;  4NF5 A;  3TAJ A;  4OFO A;  4TOZ A;  1FSA A;  4GXS B;  2UVI A;  1WVJ A;  1UIU A;  2Y5L A;  1M5E A;  3MAM A;  2D21 A;  4H8I A;  5ITP A;  4N4U A;  3DP6 A;  5BUU A;  1M5D A;  3QYT A;  1ANF A;  1NL5 A;  1O64 A;  2XWI A;  4DI4 B;  1B40 A;  1NNP A;  3K4U A;  3D4C A;  4OEU A;  5H8F A;  1Z7N E;  3K02 A;  1MDP 1;  2O1M A;  4GX4 A;  3FGS A;  4NF4 B;  2MKZ A;  5I56 B;  3RTF B;  2WEF A;  3IB1 A;  4DCY A;  2UVJ A;  1FJ6 A;  4FEC A;  1ZU0 A;  4PET A;  4K3F A;  3OO8 A;  2XXX A;  1MQJ A;  3PGF A;  3VDF A;  3D4G A;  2O84 X;  3PPN A;  3Q26 A;  1NH8 A;  4O7I A;  3LBS A;  2QMX A;  1SYH A;  1XT8 A;  2RCA A;  3HV1 A;  1XS5 A;  4N13 A;  1SW2 A;  3C35 A;  1PB7 A;  2XXH A;  4DIG A;  5CC2 A;  4L17 A;  5LTC A;  4F1U A;  1YCJ A;  4RY1 A;  4E0W A;  2CZI A;  2V3Q A;  2OX3 A;  1CE2 A;  3TMG A;  4P0G A;  3CVG A;  4OVR A;  5H8H A;  4N6K A;  4QSD A;  3JZJ A;  3HST A;  1PDA A;  4JSD A;  3QSL A;  4G77 A;  1QVS A;  1B46 A;  3OEL A;  4PAK A;  3FXU A;  4TLL B;  4GX3 A;  1H43 A;  5EYH A;  4PE3 A;  5B7D A;  3HO7 A;  1I6B A;  2KQZ A;  5HPQ A;  3TEL A;  1NV4 A;  3DLN A;  5ET8 A;  3IR1 A;  3EHS A;  3PPP A;  3OSQ A;  1B7H A;  2ZZW A;  3U94 A;  2RCB A;  1OQH A;  3K2D A;  4MAG A;  4MCO A;  1QUI A;  4YAH X;  5EQ7 A;  1NUX A;  4P9K A;  2KR0 A;  1DPP A;  1FBE A;  3PD8 A;  5CMB A;  4PFW A;  1MDQ A;  4Q5T A;  1PB9 A;  2Y7W A;  3K6V A;  5I57 A;  4YB6 A;  4PBQ A;  3OO9 A;  1P1U A;  3VFJ A;  1MY0 A;  1FQF A;  4ISU A;  3H03 A;  3MVX A;  3ZKK A;  4F2O A;  1RDX A;  1P1O A;  3MP8 A;  4F3P A;  3I3V A;  1EZP A;  2YJP A;  1NUY A;  1UQW A;  1B1X A;  3A3C A;  2F97 A;  2E1S A;  4WXJ A;  4XTC Q;  1MM6 A;  3K1M A;  3PTY A;  4R9G A;  1YYZ A;  3TYH A;  2F8D A;  2QFL A;  1YZ0 A;  2Q89 A;  2FHY A;  3OEM A;  4JVD A;  3KBZ A;  4IO4 A;  4I40 A;  1G0H A;  1BP5 A;  3LSF B;  3OD7 A;  1RDY A;  4GD5 A;  3W9W A;  4OEV A;  5DW8 A;  5I58 A;  3OO7 A;  4GXA A;  1LBZ A;  4GBW A;  1I6Q A;  1N76 A;  2B4M A;  4KXP A;  1D9Q A;  1N7W A;  4QFK A;  5IZZ A;  1YXI A;  1B5H A;  4YKK A;  3FV2 A;  3ECR A;  2QPQ A;  3U65 A;  4YMB A;  1N3W A;  2ZNS A;  2DE2 A;  4I3E A;  4RPO A;  1A7L A;  3VV5 A;  2A5T B;  4POW A;  5ISU A;  1IEJ A;  3SEV A;  1DK4 A;  1FTM A;  3CSB A;  3V83 A;  5KCJ A;  3U8Q A;  1IQ7 A;  3MP1 A;  1EZO A;  1MH4 A;  1MY1 A;  3UK4 A;  3MZ1 A;  2F78 A;  2HPG A;  4U1Z A;  1VE4 A;  1JVY A;  5CRY A;  4GL8 A;  1A99 A;  3T9H B;  4FJP A;  3FJ7 A;  4OYV A;  2PBW A;  4FED A;  3TCG A;  2AL5 A;  1US5 A;  1IXI A;  2DOJ A;  2PFZ A;  1PEB A;  1LCF A;  3PV0 E;  2XX7 A;  3VE1 B;  3LR1 A;  4MFI A;  4Z7E A;  4Q8R A;  4IO7 A;  1MPB A;  3O9P A;  3VLV A;  5F24 A;  5H8Q B;  1QJM A;  1H44 A;  2QS2 A;  4QFP A;  1R9Q A;  2RIN A;  3SEY A;  1SW5 A;  1NV5 A;  3IOW A;  3O2A A;  3H6T A;  1H45 A;  1VR5 A;  4MBP A;  2DXY A;  4C1T A;  1WDN A;  1EZ9 A;  4NAP A;  3LSL A;  2PCR A;  1YAE A;  1IMF A;  1BLF A;  4F18 A;  3UN6 A;  2V4C A;  1LFG A;  5FTH A;  5I7I A;  1USY E;  4Q30 B;  3ZKL A;  3FIR A;  4JSO A;  4LA9 A;  4OMB A;  5F1Q A;  2HAV A;  1FPF A;  2DQV A;  3G3F A;  2RKM A;  4NF6 B;  4R2B A;  2OLB A;  2GHA A;  4X9T A;  1MY3 A;  2I4C A;  4XEQ A;  5L8D A;  3G3K A;  2FIE A;  1Z7M E;  2QRY A;  3OEK A;  1R9L A;  4KQP A;  3HCQ A;  2IA4 A;  2VOZ A;  1JNF A;  2Z22 A;  2OWZ A;  2XXY A;  1UTH B;  5FHM A;  4JVC A;  2HZL A;  2ZYK A;  1MXU A;  3KFM A;  3TTK A;  4H0W A;  5I56 A;  2I6E A;  4MNP A;  2Y7R A;  4YMA A;  4GBV A;  5AA4 A;  2XD2 A;  4MEV A;  3NOH A;  5CM6 A;  1FPD A;  1B6H A;  3CRB A;  3B6W A;  1JVX A;  4H6D A;  3B8B A;  1NV1 A;  2PFY A;  2CZL A;  1UIV A;  4M4G A;  1LFH A;  1TFA A;  3F11 A;  3V5A A;  3FXB A;  3IB2 A;  1FTA A;  1RKM A;  2PT1 A;  1ZJL A;  2UVH A;  2Z8F A;  2BJJ X;  1MS7 A;  5AA1 A;  4R75 A;  1IXH A;  3C34 A;  4GQO A;  1UTB B;  4H46 A;  1K9Y A;  3RPL B;  1BIY A;  1MQI A;  4IGT A;  1XI6 A;  1FBG A;  1MY2 A;  4OHN A;  3L6H A;  2WBB A;  2ZZV A;  3GBB A;  5K2X A;  3SES A;  1EYI A;  5JTY B;  1WOD A;  4F3S A;  4AQ4 A;  2VHA A;  4JWO A;  4GWY A;  4R74 A;  4LAT A;  4OTE A;  4NHB A;  2DWH A;  4E0X A;  5M2V A;  3MBP A;  1MXZ A;  4X04 A;  1IZ1 A;  1TT1 A;  1B3E A;  5DT6 A;  2RC9 A;  3TQW A;  3FJM A;  1MXV A;  2PX1 A;  2X26 A;  4LQ2 A;  5ELV A;  4HTG A;  4JWY A;  2H99 A;  2HXR A;  1Q1K A;  4NED A;  2L5V A;  1FTO A;  4N8Y A;  3N94 A;  4XKP A;  4MNC A;  3PMW A;  5CMK A;  3EKI A;  3B6T A;  1A40 A;  2ZNT A;  3IOR A;  3IAZ A;  4PBH A;  4KR5 A;  3MWB A;  2VT5 A;  3N6T A;  3T22 A;  4PTK A;  1LBB A;  1Y9U A;  3WAF A;  4ONY A;  3K6U A;  1AL3 A;  1FRP A;  1M5C A;  2QJE A;  1LAX A;  3KEI A;  2THI A;  3FVO A;  2QSX A;  4N6D A;  4U4X A;  4HE2 A;  3FZV A;  4PP0 A;  4H5F A;  1MXW A;  5I2K B;  4JXI A;  1A8F A;  5TP9 B;  2JJK A;  2PT2 A;  1MQD A;  2HCA A;  3S2V A;  3RN8 A;  1M5B A;  4WED A;  1FPJ A;  3TTM A;  3FV1 A;  4ZZA A;  4F1Y A;  2VD3 A;  4BDL A;  2Q8J A;  3AXF A;  3RY3 A;  5ET6 A;  2G29 A;  5AA3 A;  5A5X A;  1B0L A;  2XXR A;  5KDT B;  1ELJ A;  2FVZ A;  4H45 A;  3E3K A;  1Q35 A;  4YB5 A;  4LVQ A;  3EQ1 A;  1LBC A;  1IXG A;  4F1V A;  1B05 A;  2A5T A;  3FAS A;  5ET5 A;  4GX6 A;  1IME A;  4F22 A;  3K00 A;  3T9U A;  4OAN A;  2QMW A;  1A8E A;  1NFT A;  4LZ5 A;  4MX6 A;  2XX9 A;  4OVP A;  5I5P A;  1GGG A;  4DXB A;  1B7Z A;  3ODB A;  1XHY A;  4NF8 B;  4G2Z A;  1N7X A;  5I3S A;  3A3U A;  2GFE A;  4OVS A;  3DM0 A;  4AS5 A;  3HN0 A;  5T3J A;  2ZYN A;  4UA8 A;  1B2H A;  4N6P A;  4ZEK A;  3MZ9 A;  3RNN A;  1IMB A;  3H4Z A;  2OCU A;  1AMF A;  1GV8 A;  2VPO A;  3CG3 A;  5I2N B;  1H3D A;  5CI5 A;  2HFB A;  5BWJ A;  5H8Q A;  2DDK A;  2ONR A;  4MHF A;  4N8G A;  2WYP A;  3O28 A;  2ESN A;  3UA8 A;  1RYO A;  1NV6 A;  3OOA A;  4LP2 B;  1CB6 A;  4F2Q A;  1FQE A;  4LZ7 A;  3M3F A;  4Q0C A;  3SET A;  3SZP A;  1LGB C;  3KN3 A;  3PPR A;  4F19 A;  5TPA A;  4IB2 A;  5AA2 A;  1HSJ A;  1R6Z A;  4OZ9 A;  1B3G A;  3CFZ A;  4THI A;  1BK4 A;  3K01 A;  3KG2 A;  3RTW B;  4U4S A;  5IKB A;  4XXU A;  4LN5 A;  1S7Y A;  4ECF A;  2Q9T A;  5LOM A;  4BDQ A;  4IR8 A;  3MJN A;  3E78 A;  4DE8 A;  3CG1 A;  3VXC A;  4GLI A;  4YIC A;  5CBS A;  3MVY A;  1JW5 A;  5EQ9 A;  3KOS A;  4LON B;  4QFO A;  4PF8 A;  1ATG A;  1OVB A;  2G93 A;  4PGN A;  1NUW A;  2R9J A;  1FQB A;  1N84 A;  1EYJ A;  4O3A A;  5IZ3 A;  1LBW A;  4GWO A;  1FQC A;  3IJX B;  4GF8 A;  5L9O A;  3USD A;  5F7V A;  2Y5K A;  3Q27 A;  2Q74 A;  4RK2 A;  1LB8 A;  3A29 A;  1UTB A;  4XFE A;  3U93 A;  1D3K A;  3VXB A;  1FPE A;  2GQ1 A;  3TCH A;  2WX9 A;  3H06 B;  1HSE A;  4GOT A;  4EF1 A;  3HHG A;  2ZXT A;  2F6G A;  2H9B A;  1JEU A;  5B70 A;  4FOR A;  2XD3 A;  4NTL A;  2H25 A;  4QRZ A;  2DXR A;  2NXO A;  3CI8 A;  5JTY A;  5L9S A;  3FAT A;  4HE0 A;  4R6H A;  3VVF A;  3OMB A;  3KN8 A;  3O6H A;  5FBP A;  1QUK A;  2QVU A;  4ESX A;  2QVV A;  5H8S A;  2H5Y A;  1B7U A;  3FD3 A;  4NQ8 A;  3T96 B;  2Q2A A;  3HHF A;  3FUZ A;  3C33 A;  2F5X A;  2H4I A;  1KZ8 A;  3CFX A;  3I5O A;  1OQG A;  5CMC A;  1DPE A;  1FTK A;  2Y7K A;  4O94 A;  3FXQ A;  2KLF A;  5ICT A;  2B3B A;  3PMX A;  3GLB A;  4PFI A;  2I3W A;  3PUZ E;  4H65 A;  1URG A;  3IFA A;  3W9V A;  2BJI A;  4ZE9 A;  4U22 A;  1POT A;  4U23 A;  2V25 A;  2ONK E;  1K9Z A;  4MNI A;  2H98 A;  2ZYM A;  1NKX A;  4BDO A;  2E0S A;  1JW4 A;  1LFI A;  2OK2 A;  1LAF E;  3LUY A;  1B58 A;  2P0S A;  4ZZE A;  4H1X A;  1B4H A;  3IO4 A;  2O68 A;  3PPO A;  2B3F A;  3T0J A;  4I1D A;  2HZK A;  3CFL A;  4PC9 A;  2CZK A;  2XWK A;  5TP9 A;  4X1D A;  3TTN A;  4F39 A;  5H8N B;  1DSN A;  4RPN A;  1O63 A;  3M3L A;  4OET A;  4X8R A;  5AE4 A;  3THI A;  4EF2 A;  2OJT A;  4GFR A;  3E79 A;  2R71 A;  3V89 B;  3OXN A;  4X1B A;  1Y20 A;  5KDT A;  4ELP A;  5ESY A;  3IO6 A;  4PGP A;  2RC8 A;  4RXL A;  3R26 A;  1QUL A;  4YKJ A;  1POY 1;  1DTZ A;  5AA2 D;  1ZIU A;  2HEU A;  3E4R A;  2ONS A;  1FPB A;  1MY4 A;  2REJ A;  4QFN A;  5DVI A;  1O7T A;  2Y7P A;  5EHS A;  3MST A;  4NGU A;  3KGC A; 
#chains in the Genus database with same CATH homology
 5IGA A;  4PF6 A;  1FSA A;  1AWB A;  2Y5L A;  4FBP A;  5EQ8 A;  4PAF A;  2HXR A;  4GWU A;  4N4U A;  2FIX A;  1IMD A;  2L5V A;  4N8Y A;  2XWI A;  4MNC A;  4DI4 B;  1EYK A;  5ET7 A;  3EKI A;  4GX4 A;  2XXK A;  4PBH A;  2MKZ A;  2VT5 A;  4PTK A;  2WEF A;  4PFB A;  1NV7 A;  1FJ6 A;  1FRP A;  4PET A;  4HCY A;  4N6D A;  4HE2 A;  4O7I A;  3BIG A;  1RDZ A;  1FBH A;  1VDW A;  1FJ9 A;  2JJK A;  1FPL A;  1NV2 A;  1FPJ A;  4M1V A;  2P3N A;  4P1E A;  5LTC A;  4F1U A;  5EQA A;  5ET6 A;  2CZI A;  2V3Q A;  4P8B A;  2OX3 A;  4PAI A;  2XWV A;  2P3V A;  3RYD A;  2FVZ A;  4H45 A;  4OVR A;  4N6K A;  1KA0 A;  4PAK A;  5EYG A;  4F1V A;  4GX3 A;  5EYH A;  4PE3 A;  2KQZ A;  1NV4 A;  5ET8 A;  3QMF A;  4PDD A;  5ET5 A;  1QGX A;  2CEX A;  4GX6 A;  1IME A;  2Q8M A;  2QVR A;  1LEV A;  3KC0 A;  2ZZW A;  4OAN A;  4MAG A;  4MCO A;  2XA5 A;  4MX6 A;  4OVP A;  1Q9D A;  5EQ7 A;  1NUX A;  5I5P A;  4JVI A;  4P9K A;  2KR0 A;  1FBE A;  3LUZ A;  4O7M A;  4P56 A;  1KA1 A;  4QBA A;  4UAB A;  1INP A;  5I3S A;  4NN3 A;  4OVS A;  4GWZ A;  4PBQ A;  4AS5 A;  3FBP A;  5IZ1 A;  3IFC A;  5T3J A;  5LDZ A;  2FBP A;  1RDX A;  1CNQ A;  1IMB A;  1NUY A;  1FBF A;  2R8T A;  3PTY A;  2VPO A;  1YYZ A;  1FPK A;  4HCW A;  3HFU A;  2QFL A;  1YZ0 A;  2FHY A;  2DDK A;  4JVD A;  3KC1 A;  1JP4 A;  4MHF A;  4N8G A;  3KBZ A;  2WYP A;  4I40 A;  1G0H A;  1NV6 A;  4OVQ A;  1IMA A;  1RDY A;  3W9W A;  5DW8 A;  1NI9 A;  1LBZ A;  1FPG A;  4GBW A;  4PFR A;  3SZP A;  4DI3 D;  4MMP A;  2B4M A;  4F19 A;  4KXP A;  1D9Q A;  5IZZ A;  2XWO A;  1NUZ A;  1YXI A;  1BK4 A;  2QPQ A;  3U65 A;  3BIH A;  2CEY A;  4LN5 A;  2DE2 A;  4I3E A;  2DE3 A;  2Q9T A;  3LV0 A;  2B4L A;  4OVT A;  4IR8 A;  3E78 A;  1DK4 A;  4YIC A;  3ISP A;  5IZ3 B;  5EQ9 A;  4PF8 A;  1DCU A;  4PGN A;  2HPG A;  3D1R A;  1NUW A;  1IMC A;  4G61 A;  4QXD A;  1EYJ A;  4YZZ A;  5IZ3 A;  1LBW A;  2DVZ A;  3B50 A;  4O8M A;  1NV0 A;  5J16 A;  4NF0 A;  2Y5K A;  2VPN A;  2Q74 A;  2PFZ A;  3A29 A;  4XFE A;  4GWX A;  1FPE A;  2GQ1 A;  5J1D A;  2WX9 A;  3CHG A;  5F24 A;  4AS4 A;  1G0I A;  2CZH A;  2WBD A;  1NV5 A;  5A5L A;  4HE0 A;  4NAP A;  2PCR A;  1LBY A;  1IMF A;  2F3B A;  4F18 A;  5FBP A;  2V4C A;  2QVU A;  5I7I A;  2QVV A;  1DBZ A;  4NQ8 A;  2DE4 A;  1FBP A;  1FPF A;  2F5X A;  4XF5 A;  1KZ8 A;  4X9T A;  4N91 A;  4XEQ A;  2FIE A;  4O94 A;  5JK4 A;  4PFI A;  4PDH A;  3MYU A;  3W9V A;  3IFA A;  2BJI A;  2OWZ A;  4N15 A;  4MIJ A;  1NV3 A;  4JVC A;  2HZL A;  1K9Z A;  4MNI A;  4MNP A;  3T1B A;  4GWS A;  4GBV A;  1FPI A;  4MEV A;  3NOH A;  5CM6 A;  1FPD A;  4MJO A;  4NX1 A;  4P3L A;  3B8B A;  1NV1 A;  3T0J A;  2PFY A;  1FBD A;  2HZK A;  4PCD A;  4GWW A;  4P47 A;  4PC9 A;  2CZK A;  3FXB A;  1FTA A;  3GYY A;  2XWK A;  4I3Y A;  1LBV A;  4H46 A;  1LBX A;  1K9Y A;  4X8R A;  2ZZX A;  3RPL B;  2F3D A;  1FBC A;  4HXV A;  1SPI A;  1XI6 A;  3E79 A;  4N17 A;  1FBG A;  2WBB A;  3ROJ A;  2ZZV A;  5ESY A;  2WYK A;  4N81 A;  4PGP A;  1EYI A;  5IM2 A;  4P1L A;  3RPL A;  4NG7 A;  4HE1 A;  4GWY A;  4OA4 A;  1FPB A;  4NHB A;  4X04 A;  3MST A;  4NGU A;  2HHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...