4PGPA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound 3-indole acetic acid
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
PVTLNYANFPPASTFPCIQMEQWAHEVRTRTRGKVDVLTYPGGTLLGARNMLRGVMSGQADIGCISLAYHPGVFPVMSVFELPLGFTSAEAASSVLWELYSGLRPAELERVKVLTMFTSAPSHFMTVTPVRSLRDLQGMEIRGAGTLSAILEKLGATPVSMPMPEVPEAVQKGIIKGLFTSLDVMKDMNFAEMTGHVTRADQAVYPFAVIMNREAWERLSPDVQQVLDGLAAEHAAWTGRYLDAHVQDSMRWAEEKHGVQVHTLPEEDIAAMRRSVQPLFDAWAQRAADKGADPDAVMRTVDALKAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
molecule tags Solute-binding protein
molecule keywords Extracellular solute-binding protein, family 7
total genus 111
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4pgpA00
4MHFA 4PFIA 4X04A 4OANA 4XFEA 4O8MA 2HZLA 4PF6A 4P9KA 4PE3A 4MMPA 4MNPA 4MCOA 4PAFA 3B50A 2PFYA 5I5PA 4XEQA 4MIJA 4PGNA 2XXKA 2CEXA 4P1EA 4PBHA 4OVQA 3GYYA 2CEYA 4OVPA 4UABA 4OA4A 3U65A 4PF8A 4OVRA 4O7MA 4N6DA 5IM2A 4P3LA 4P8BA 4OVTA 4PBQA 2WX9A 4N4UA 2HPGA 4NF0A 4NN3A 4YICA 2XWKA 4OVSA 4P47A 2V4CA 2XWIA 4O94A 4PFBA 4PETA 4DI4B 4NQ8A 4N15A 4NX1A 4DI3D 2XWOA 2VPNA 4N91A 4PFRA 4N6KA 2WYPA 5CM6A 5IZZA 4NHBA 2PFZA 2ZZXA 4NG7A 4YZZA 4NAPA 4N8YA 4NGUA 2VPOA 4PC9A 2HZKA 2XWVA 4N17A 4LN5A 4PCDA 5LTCA 4PAKA 5I7IA 2WYKA 4P1LA 4MNCA 4MNIA 5IGAA 4P56A 4N8GA 2ZZWA 2ZZVA 4PDHA 4MEVA 4MX6A 4PAIA 4PGPA 2XA5A 3FXBA 4PDDA 4XF5A 4X8RA 4MAGA
chains in the Genus database with same CATH superfamily
4Q30B 1N0TA 1OMPA 3KZGA 3D4CA 1IMEA 1DBZA 3OO6A 4I1DA 2XX8A 4QFPA 3ZSFA 5H8HB 3UP9A 4PAFA 4C1UA 4H8JA 1MY4A 1Q9DA 4YKKA 4XXUA 2MKZA 1IMFA 1UTHA 2ZNSA 3TUSA 3Q29A 4PP0A 1MM7A 4FAJA 1Y1ZA 4GLIA 4ELPA 3CRBA 1K9ZA 3K6UA 5KZTA 1II5A 3BIHA 3HV1A 4LQ2A 4YICA 2DE3A 5I2KB 3RQTA 2B65A 4O3BA 2OJTA 2GQ1A 1H43A 3IB1A 1R6ZA 5BWJA 4I40A 4QRZA 1FTLA 2XWOA 1QGXA 3RPWA 4N91A 4NG7A 1EYIA 2RC7A 4N8YA 2HZKA 4ESWA 2B3FA 4LZ7A 4GL8A 1A8EA 2O68A 1IMCA 3EPEA 3NOHA 4PFTA 2OWTA 4OWDA 4C0RA 1O64A 3FIRA 4MX6A 2OBGA 1LSTA 1MPBA 4HE1A 5ICTA 1Q35A 4EQ9A 1MPCA 4XF5A 4KR5A 1LCFA 2DP8A 3S9LC 2F5XA 1FBCA 4EXLA 2O51A 3MUQA 2I58A 1ZU0A 1QVSA 4NF8B 5A5XB 3OMBA 1B5IA 3WAEA 1PEBA 5IZ1A 4NEDA 1AWBA 4QSCA 4PE3A 4OFJA 4RXLA 4RY1A 2JJKA 3HSTA 3DP4A 1H3DA 1DOTA 3I6VA 3L6GA 4U4XA 3CR9A 1PBPA 3KBRA 1UIVA 3H6UA 4IO4A 5I59B 1JW5A 3FGSA 4OFOA 2F35A 1M5EA 4OVRA 4KPTA 1K9YA 4P8BA 4PBQA 3E78A 2THIA 3PUYE 5ITPA 3OENA 3V83A 2Z8FA 1DPEA 5H8SA 4PETA 3IFCA 2HXWA 3QAXA 1EYKA 3R26A 3M8UA 4QSDA 3TAJA 3TCGA 3N6TA 1ZIUA 1NFTA 3C31A 2QJEA 4P0GA 4LATA 4PC9A 3G3GA 3LC8A 1LFIA 2Q8MA 3PD9A 2RINA 1I6QA 1TFAA 1GV8A 2OX3A 3RN8A 1WODA 5TPAB 2X7QA 3OXNA 4G4PA 4ZEFA 1R9LA 2DVCA 3SETA 2GH9A 4F3GA 4PDDA 3CHGA 5CRYA 5JTYA 1P1NA 3K6XA 1IEJA 3N5LA 3I3VA 3RNNA 4RK9A 3QUJA 1NV3A 3FV1A 1PB9A 3MAMA 4G8MA 3DM0A 4O8MA 3EQ1A 3TCFA 2HZLA 1LGBC 4KI0E 4GX6A 4PF6A 2I3VA 2QSXA 5H8FA 1QW0A 4OFLA 4I9DA 4PGNA 3G3KA 3UK4A 2B4LA 3T93B 3CFLA 1RDZA 4NWDA 1NV2A 4H45A 3SKPA 4RA1A 5FTHA 3G3FA 3O97A 1VSOA 3GBAA 1SYHA 2KLFA 3B8BA 4R9FA 1Z7NE 3TQLA 1FTKA 1A54A 4IO2A 1J1NA 1XVYA 1WVJA 3MVZA 2O6AA 3OO8A 1LBWA 4G68C 2FIXA 1MH3A 1FPEA 2CZKA 4AB6A 3QYTA 1MXZA 2Y7RA 2PFZA 4GWYA 3A3UA 2Y7KA 4F31B 5A5XA 4ELRA 4PFWA 3K0VA 2VPOA 1ZBMA 2I4BA 5EHSA 1IXIA 3UORA 1IUDA 4HTGA 2W7YA 4OHNA 3VLUA 1B3FA 1URGA 2PMSA 1GGGA 1MDP1 3R6UA 4TLMB 3RGYA 3VE1B 1ZMGA 1B32A 5F7VA 4HS7A 3B7DA 1A55A 4GX3A 2DSFA 3HFUA 4HCWA 4YAHX 1P1WA 3R7XA 2QS4A 5ISUA 2OZZA 3ECRA 1B7UA 1O63A 3K4UA 3MZ9A 1LB9A 1NMUA 3RT6B 1SVXB 1NV4A 3C33A 3LBSA 2I0BA 2VGQA 4YU0A 2Q2CA 4BDRA 4F3PA 3IJOB 3FUZA 1IMDA 3MVWA 1QKAA 3V8XB 1B9JA 4BDNA 3U65A 1B05A 2XXRA 5IM2A 4P3LA 4DXCA 1JEUA 4G68B 4N4UA 4FECA 2HXRA 3VV5A 4F1VA 1T0KA 3W9WA 3FATA 3QSLA 3U94A 4U21A 3Q26A 1PDAA 4NQ8A 2I49A 4EF1A 2GHAA 3CG3A 4POWA 2QVVA 1PC3A 2XD2A 3HPIA 4ZECA 3PV0E 2F7AA 2YPNA 2CMOA 2Y7WA 3TZAA 3E4RA 2XXHA 3PU5A 1DPPA 2ZMBA 5I56B 4N07A 3TTRA 2Z23A 4GWSA 1LEVA 3TKDA 2Q2AA 3KOTA 4PAKA 2Y7IA 1R9QA 2B3BA 1OQHA 3M3KA 1JVXA 3HN0A 1EZ9A 4QFOA 3PPQA 2HHMA 4PFYA 2XA5A 1P1UA 4H5FA 3EHUA 1SI1A 1NI9A 2ALUA 3W15C 3FD3A 3HHFA 3U92A 4DE8A 5AA1A 4TOZA 1AH5A 3PUWE 1XHYA 4YKPA 1FPKA 2M8CA 4GOTA 3AXFA 1PB8A 4P1EA 4H1XA 2AL4A 3GZGA 4OVQA 3UIFA 2UVGA 4RPOA 3MZ1A 1QUKA 4HW8A 4PF8A 1LBCA 3OSQA 4QFKA 2AL5A 1IZ1A 3H03A 2F8DA 2V3UA 1MPDA 3PUZE 3TODA 4BDLA 1GVCA 3SERA 3C34A 4NMYA 4F22A 4ECFA 3TYHA 4IR8A 1OVBA 4EDPA 3SZPA 1YXIA 3IR1A 3G3HA 1AIVA 5H8QB 3VXBA 4H5GA 3V5AA 3RT8A 2VP1A 3G3IA 2H9BA 1LAHE 4XKRA 1FQCA 3B6WA 4KD5A 2REJA 2A5SA 3D1RA 2PVUA 1CNQA 4POXA 4OXVA 3EF7A 2LAOA 3FXRA 3CFXA 4NF8A 3M3FA 4E0XA 3EHTA 4G61A 2XX9A 5DVFA 3IL1B 5H8QA 4MLVA 1NV6A 4MFIA 4OVJA 2XXQA 3MP1A 3UGWA 1IQ7A 2UVHA 2UXAA 1VFEA 4ZE8A 1LFHA 4R6KA 4X04A 4KYSA 4OANA 1SQYA 2DS9A 2X7PA 5A5LA 2NXOA 3B6TA 3VXCA 2ONSA 3OELA 4O3CA 2VHAA 5H8NB 2FBPA 2ZNTA 5IAIA 3KSJA 3K00A 1MG1A 4ND9A 3LUYA 1SDXA 3RPLA 1BP5A 5EYGA 1MQGA 3QMFA 4MF3A 2R71A 1N7WA 1NUWA 4UABA 3WAFA 4ZS9A 2Z8EA 3PGFA 1IIWA 4X48A 4NF6A 1SBPA 1KZ8A 1NV1A 2REGA 4KCCA 2L5VA 3EN3A 2I0CA 2XWIA 2DE4A 1MQDA 2OWZA 4LZ5A 3MPLA 2UYFA 4OZ9A 1NNFA 2QS3A 2WKYA 1RDXA 2WEFA 3PPOA 4GWXA 3S9EA 4NHBA 3IK6B 3QK6A 3VLWA 5EYFA 1FPJA 4NGUA 3VDFA 3IOUA 4KYEA 1B7HA 4PCDA 4UACA 5LTCA 1LAXA 2F97A 3U93A 3N94A 4LA9A 5I57A 2I3WA 1EU8A 1JEVA 3KG2A 1RYXA 3LSWA 2XXYA 1MDQA 3TTLA 3FXBA 5ET7A 1EZOA 1M5CA 1D9QA 4GFRA 1XOCA 4GIZA 1B5JA 4FIMA 1OIBA 2XXUA 2V3QA 3V89B 3CFZA 3BIGA 3LSFB 3OSRA 5ICQA 3GXAA 3IX1A 5TPAA 4GWUA 4BDMA 1SW2A 2PFYA 3C32A 4R2BA 1G0IA 2XXKA 4PBHA 3KJTA 3FXUA 3MPKA 4NF4A 3O2AA 2PT1A 4H65A 5DVIA 1FQDA 3CI8A 3S2VA 3SEWA 3DP6A 4GQOA 4JVIA 1ZJLA 1OVTA 3RTWB 2ZXTA 2QMXA 2HFBA 4OERA 3ILTB 2XWKA 3T0JA 1FQAA 3ONMA 3DLNA 3VVDA 5I58A 4LZ8A 4M1VA 2P3VA 1DTZA 2XWVA 1FRPA 3H6WA 3VVFA 1MY1A 2NWJA 1RKMA 1ELJA 3MWBA 2O1LA 2HCAA 5HPQA 1MY2A 3TEPA 3H7MA 4RPNA 1FJ6A 3SEUA 3FJ7A 3ROJA 3EKIA 5CMCA 4HCYA 4F2QA 3T1BA 4MHFA 4PFIA 5F24A 4XFEA 4H0WA 3K1MA 3UN6A 1Z7ME 4H6DA 3CIJA 2YLNA 2FVZA 3U1OA 2A5TA 1XC1A 4JSOA 4NF6B 3JV9A 1FPFA 4MCOA 1TWYA 3ZKLA 1ATGA 1B3EA 3MQ9A 4OENA 5ET6A 2F78A 3A3CA 2I4CA 3O29A 4C1TA 1SW1A 5B70A 4GWZA 2Y84A 5DEXA 3C4MA 4GBVA 3L6HA 2F3BA 3BKIB 4YMAA 4GXAA 4OVSA 3LV0A 2V4CA 1B6HA 4DXUA 4R9GA 4DI4B 4N15A 1RDYA 4NX1A 5K2XA 2HAUA 3OEKA 1Y4CA 5F1QA 3IAZA 1YZ0A 5CM6A 3Q28A 4YZZA 3DP8A 4NAPA 4OEUA 4R72A 4G77A 1FPGA 4U23A 1Y20A 4LN5A 1YYZA 2DWAA 2VD3A 5EQ9A 1NL5A 2FYIA 2R6GE 4HE0A 4EUOA 2XD3A 2OWSA 2CZHA 2FNCA 5ESYA 3PUVE 1ZTYA 3K1PA 3IFAA 5ET5A 1HSLA 3IB0A 2CZLA 5TP9B 4GL0A 3N6UA 2QFLA 4F18A 4QFLA 4PE5B 5AA2A 5CMMA 4U4SA 3PMVA 4DLDA 2ZYOA 3LSLA 1PBQA 2R8TA 1FBEA 1JP4A 4ZEBA 1HSEA 4ZEIA 5I5PA 2V25A 1DTGA 1MXYA 5JEIA 1JETA 5KCJB 2NOOA 3Q27A 4P0IA 5EQ8A 1B3GA 2O7IA 3HHGA 2ZYMA 2UVJA 1LB8A 1H76A 1B5HA 5H8NA 3KFMA 3MVXA 1RYOA 2D3IA 2CZIA 3F11A 2VPNA 2Y5LA 3T22A 4U1ZA 4MH5A 2UVIA 5AA3A 1Y4TA 5TP9A 1NUZA 4ISUA 4X9TA 1WDNA 5J16A 2QS1A 3SEVA 3OO9A 1FSAA 3CSGA 4F1YA 3T9VA 5I7IA 3PUXE 4FATA 2H99A 2AIXA 4P56A 2IA4A 1TXFA 2HEUA 3MSTA 4PAIA 3O6HA 1B4ZA 3E79A 4PGPA 1JNFA 2XXXA 1FQBA 4R2FA 2RC9A 1LBVA 3KC1A 2F6PA 1XVXA 3LR1A 4I8CA 1YAEA 2F7BA 4H8IA 3K2DA 5CBSA 1M5DA 4L17A 1IXCA 2OLBA 3BFUA 2Q8JA 1AOVA 5CBRA 3E13X 4JVDA 4HXVA 4EF2A 4JSDA 4ESXA 2KQZA 5I59A 3TPAA 2ANJA 1QUIA 3FJGA 2GRVA 3T66A 4DDDA 3S4UA 1O7TA 1XT8A 5LDZA 4IY5A 4KQPA 1JQFA 3JZJA 3PMXA 2AYSA 2Q74A 4KFQA 4QFNA 1B0LA 3KSXA 2HAVA 2G93A 3RPLB 2DDKA 2VT5A 1FQFA 4I3YA 1NUYA 1SI0A 5FHOA 2ONKE 3M3LA 5LOMA 1FBDA 3TELA 1R1NA 3QIMA 3SDFA 2FA7A 1B0HA 1XS5A 3KN3A 1YTVA 5JTYB 2WBBA 1NKXA 1FQEA 4IO7A 2ZNUA 3IB2A 1MRPA 1TT1A 4MNCA 4FE8A 2VD2A 4FEDA 4OTEA 5CC2A 1MH4A 2FHYA 5L9MA 1EYJA 2H98A 1LLSA 4QHQA 5AA2D 2O69A 4KXPA 1LCTA 2PCRA 4XKQA 2VOZA 2XXPA 2IEEA 2BJIA 3MP8A 3TDJA 1CE2A 3IO4A 3TMGA 3MBPA 4HE2A 2P2AA 4XEQA 1FPDA 4F2OA 2WBDA 2QS2A 3H6VA 3MP6A 3S9MC 1I6BA 5KDTA 3FXQA 4N81A 4OVPA 1PB7A 1ZKBA 4OQOA 1ANFA 2V3TA 4NWCA 2HQ0A 2NVUB 1LBBA 4JB7A 2H25A 2WX9A 1B4HA 4I3EA 2E1SA 3IORA 4F3BA 2NUVA 4I62A 1B52A 4U1OA 4O94A 1KA0A 4UA8A 3USDA 1Y1MA 2UYEA 4XKPA 2Z22A 4DI3D 1B3HA 4ELQA 4RNSA 1USYH 1B51A 4K3FA 4LP2B 3FVGA 2FIEA 5J1DA 1FPBA 1MXUA 1FW0A 1A8FA 5DT6A 2RKMA 5DW8A 3CVGA 1N7XA 1B2HA 1N84A 5EHMA 2G29A 4JWYA 2Q88A 4ZE9A 2RCBA 4X1DA 1S50A 4MNIA 2QVUA 2DXRA 2ZZWA 1JVYA 2F6GA 1IMAA 2O84X 2KR0A 4YB5A 4FORA 2DWJA 5I3SA 3W9VA 3KEIA 4G2ZA 3MW0A 5IKBA 1S7YA 5I56A 3PPNA 2Q89A 1NV5A 1USYE 3K01A 3THIA 1I6AA 3MC2A 4FEBA 3MJNA 4P9KA 1A99A 4G8HA 2D5WA 4MNPA 5K2YA 1BKAA 3I5OA 1D9VA 4F19A 4GXSB 4IGRA 2BJJX 4O7MA 4N6DA 2XX7A 3PTYA 4AQ4A 1L5TA 1POY1 4OVTA 1G0HA 1IXHA 1M5BA 2QL3A 1A7LA 2HPGA 1KWHA 3FVNA 3TTMA 1LBXA 4O3AA 4XKNA 4XTCQ 3K6VA 3ISPA 4GBWA 1ZLQA 4N13A 4QXDA 1H45A 3C9HA 2DVZA 3KJ7A 4LONB 5KCJA 3PMWA 4N6KA 1FBPA 4JWOA 1QUJA 3LSXA 1Y3NA 3T9XB 1QJMA 1AMFA 3SEXA 3FASA 2E0SA 1B1HA 4N17A 1QULA 1US5A 4FBPA 5AA2B 4PTKA 1JW4A 4GRKA 1BIYA 3T9HB 3FBPA 1DSNA 4BLAA 1UTBB 2ZYNA 4U2RA 3GLBA 4N8GA 4F39A 2R9JA 4JXIA 4R6HA 4MEVA 1GR2A 1CB6A 1D9YA 4Z0IA 5FBPA 1LBYA 4O7IA 1FJ9A 2X26A 1UQWA 4YMBA 3O28A 5KDTB 3O66A 4JVCA 4EQBA 1UTBA 3K6WA 5ELVA 3H6TA 3K1NA 1B46A 3CSBA 2ABHA 4N6PA 4MIJA 4AS5A 3RLFE 4KCDA 3IO6A 2XXTA 4R74A 3TTNA 4WXJA 3RTFB 4GX4A 4EXKA 1FTMA 1OLCA 5EQ7A 5L9OA 1MXVA 2ONRA 2QVRA 4NN3A 4YB6A 3IOVA 4P47A 1IXGA 1SPIA 1S9TA 2XXVA 1FCKA 1MQHA 5B7DA 2O1MA 2PT2A 2RCAA 1POTA 4WEDA 2V84A 5H8FB 3GBBA 4H67A 4EQ7A 5T3JA 2Y7PA 5IZ3B 4ZZAA 4OETA 1SW4A 2ZZXA 3QUFA 5BUUA 3E9XA 2A5TB 1DK4A 1VFDA 1LAFE 3MVYA 4IB2A 1XI6A 2ZYKA 3ZKKA 5FTIA 3TTKA 4XIGQ 4LVQA 1MQIA 4TQUQ 2WYKA 4P1LA 1NNKA 1YCJA 3IJXB 4PDHA 3DELB 5AA4A 4X1BA 2QRYA 2QPQA 2DE2A 3RYDA 4DXBA 2RC8A 4F3SA 1Y9UA 4IO5A 4U22A 4R73A 4KHZE 3FVKA 2DQVA 3O6GA 4ONYA 4NF5A 1P1QA 3VVEA 4IO6A 2OCUA 5I2NA 4QSEA 4GF8A 1INPA 4RYAA 3FJMA 3K02A 1QKBA 1B40A 1VDWA 1FPLA 1B7ZA 3KBZA 4F29A 2OK2A 1DMBA 4OA4A 3UA8A 1N3XA 1MXWA 2P1SA 1US4A 4QF9A 4DCXA 1DCUA 3A29A 3PPPA 5JK4A 1AL3A 2F34A 4MBPA 5I57B 1FTJA 3H06B 5DTBA 3G7WA 1FPIA 1FBGA 1FBFA 1MM6A 5ITOA 5IZZA 2XXIA 3FZVA 1GTKA 4JDFA 4KYDA 3H3GA 4FJPA 4LQ5A 3QXMA 4ELOA 5EYHA 1OQGA 4Q5TA 5H8HA 1N04A 2Z8DA 5I2NB 1LAGE 4GWOA 4ZEKA 1D3KA 1MQJA 4DIGA 5DEXB 4YKIA 3KN8A 2ZZVA 3PD8A 5L8DA 1NNPA 4Q8RA 1H44A 2GFEA 5HM4B 3U72A 3OOAA 3KN7A 4BDOA 1Q1KA 1KA1A 1M5FA 1FTOA 2QMWA 1IITA 5TU0A 3Q25A 1JW1A 3RUMA 2H4IA 4MMPA 1B58A 3A09A 2YJPA 3B50A 3T96B 1IMBA 2CEXA 3O6IA 2F3DA 4WEPA 1MS7A 1SW5A 3P7IA 1BK4A 1F9BA 2CEYA 5I58B 3OO7A 1NUXA 2DWHA 5HBCA 4Q0CA 2PBWA 4IY6A 2Y5KA 4AB5A 4DZ1A 4GWWA 3OEMA 3KOSA 3H4ZA 1Y3PA 3VFJA 2I48A 2XHDA 4PFBA 4G8NA 2DXYA 4WKMA 1LFGA 1I69A 3ILUB 3FVOA 1MY0A 2P3NA 1B1XA 4F1UA 3SESA 5CMKA 1MXXA 4OYVA 4TLLB 4OMBA 4NF5B 3LUZA 3FV2A 1BLFA 5DYHA 2DWIA 5AE4A 2PX1A 3G3JA 2RF1A 4YB7A 2H5YA 2Q9TA 3BFTA 2DYXA 1P1OA 4NTLA 3RY3A 4Z7EA 3IOWA 3HO7A 1URDA 2GHBA 1YPNA 1B3LA 3E3KA 5I84A 3MYUA 4NF4B 1P99A 4H46A 3B6QA 3D4GA 4MLQA 3N26A 3TCHA 1NNTA 1URSA 2XXWA 3SEYA 2F36A 3CG1A 1VE4A 4G68A 5DVJA 4R6YA 3BBRA 3ODBA 3S9NC 3EHSA 3IOTA 2PYYA 4RK2A 4GD5A 3JYRA 1D4NA 3KGCA 1SD3A 3HCQA 3C35A 3PPRA 5FHMA 1MY3A 3GYYA 5EQAA 5AA4B 4M4GA 3O9PA 4JBZA 3ZS6A 4RJZA 5IZ3A 1LBZA 4THIA 4OESA 3KC0A 4AS4A 5M2VA 1FBHA 4NF0A 5CMBA 4ZZEA 1OLAA 1N3WA 4YKJA 4PFUA 1NV0A 1HSJA 2V93A 4LUBA 5ET8A 3C36A 4OEVA 1SYIA 4ZDMA 4PFRA 2DOJA 2WYPA 3T9UA 1BTJA 4QBAA 1TFDA 4IGTA 4IO3A 4MJOA 1Y3QA 1NV7A 4E0WA 3OD7A 1A40A 1VR5A 1NH8A 4ZEDA 2O7UA 3MZBA 5L9SA 4BDQA 4NE4A 5IGAA 5I2KA 2P0SA 3VLVA 2F7CA 1FTAA 3TQWA 4DCYA 2I6EA 3TFLA 4GVOA 4JWXA 2B4MA 4P11A 1NH7A 4R75A 1EZPA 2D21A 5CI5A 1UTHB 1UIUA 4PQJA 5FHNA 2ESNA 1EH3A 4X8RA 3U8QA 4MAGA 1N76A
chains in the Genus database with same CATH topology
4KXPA 4MHFA 4PFIA 4X04A 1FBCA 4OANA 4XFEA 5F24A 1NV5A 2PCRA 4O8MA 4JVCA 5A5LA 2HZLA 2BJIA 3BIGA 2FVZA 4PF6A 2R8TA 4GX6A 5IZ1A 1FBEA 1JP4A 1AWBA 2FBPA 4P9KA 4GWUA 4HE2A 4MMPA 4PE3A 1IMEA 1DBZA 1NV4A 4MNPA 2JJKA 1FPFA 4MCOA 4PAFA 3B50A 2PFYA 1INPA 1FPKA 4JVDA 4XEQA 4HXVA 4MIJA 4PGNA 1G0IA 1IMBA 1FPDA 2CEXA 2XXKA 5ET6A 3RPLA 2B4LA 5EYGA 2F3DA 2WBDA 4P1EA 1IMDA 4PBHA 3QMFA 5T3JA 4AS5A 4OVQA 5EQ8A 1RDZA 4F19A 1BK4A 1VDWA 1FPLA 4N81A 2CEYA 3GYYA 5EQAA 4OVPA 3KBZA 2KQZA 3RYDA 1Q9DA 1NUWA 4UABA 4OA4A 3U65A 1NUXA 4PF8A 2MKZA 1IMFA 4OVRA 1NV2A 4GWZA 4H45A 4O7MA 4N6DA 5IM2A 1K9YA 4P3LA 1LBZA 5IZ3A 3PTYA 2Y5KA 4P8BA 4JVIA 4GBVA 4GX4A 4OVTA 1G0HA 4PBQA 3KC0A 4AS4A 2WX9A 5LDZA 1KZ8A 1NV1A 3B8BA 4N4UA 5EQ7A 2HXRA 4GWWA 2L5VA 4I3EA 2F3BA 1DCUA 1K9ZA 2HPGA 2QVRA 3E78A 1FBHA 4F1VA 2Q74A 4NF0A 3A29A 4NN3A 3BIHA 3W9WA 1LBXA 2XWKA 4OVSA 4YICA 2DE3A 3LV0A 4P47A 5JK4A 2V4CA 2XWIA 2DE4A 4O94A 4PFBA 1KA0A 1SPIA 4PETA 3IFCA 4DI4B 2OWZA 1NV0A 2DDKA 3ISPA 4GBWA 4NQ8A 3RPLB 4N15A 4QXDA 1LBWA 2VT5A 5ET8A 3T0JA 2FIXA 1RDYA 2GQ1A 2QVVA 2P3NA 4NX1A 2DVZA 4I40A 4F1UA 4IR8A 4I3YA 4DI3D 2XWOA 2CZIA 1FPEA 1NUYA 1FPIA 2VPNA 1FBGA 1QGXA 2Y5LA 4N91A 2CZKA 4PFRA 3SZPA 5I5PA 1RDXA 1EYKA 2WEFA 1FBFA 1YXIA 1YZ0A 1FBPA 2WYPA 4GWXA 4N6KA 4QBAA 5IZ3B 5CM6A 1NUZA 3LUZA 4NHBA 5IZZA 1FBDA 2FIEA 2PFZA 1FPBA 1EYIA 2ZZXA 4GWYA 4NG7A 4X9TA 4M1VA 4YZZA 4NAPA 1DK4A 5J16A 1FPJA 4MJOA 4N8YA 1NV7A 4NGUA 2VPOA 4PC9A 5DW8A 1XI6A 2HZKA 5EYHA 2P3VA 2Q9TA 1FPGA 2XWVA 4GWSA 1LEVA 4N17A 2Q8MA 1FSAA 2WBBA 3T1BA 4LN5A 1FRPA 1YYZA 4FBPA 4PCDA 2OX3A 5LTCA 4PTKA 4PAKA 5EQ9A 5I7IA 3D1RA 1IMCA 2WYKA 3NOHA 4P1LA 4HE0A 1CNQA 3FBPA 4MNCA 4MNIA 5IGAA 4P56A 4N8GA 5J1DA 2QVUA 2ZZWA 2ZZVA 4PDHA 4MEVA 1IMAA 2CZHA 2QPQA 4G61A 5ESYA 4MX6A 2DE2A 2HHMA 3MSTA 4PAIA 3MYUA 2FHYA 1FTAA 3IFAA 2KR0A 3E79A 2XA5A 4HE1A 4PGPA 5ET5A 1EYJA 1NV6A 3FXBA 4H46A 5ET7A 1D9QA 1FJ6A 3ROJA 5I3SA 2B4MA 4PDDA 3CHGA 2QFLA 3W9VA 5FBPA 4F18A 1LBYA 4O7IA 3EKIA 4XF5A 1FJ9A 1KA1A 4X8RA 1LBVA 3KC1A 4GX3A 3HFUA 4HCYA 4HCWA 4MAGA 2V3QA 1NI9A 2F5XA 1NV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHF A;  4PFI A;  4X04 A;  4OAN A;  4XFE A;  4O8M A;  2HZL A;  4PF6 A;  4P9K A;  4PE3 A;  4MMP A;  4MNP A;  4MCO A;  4PAF A;  3B50 A;  2PFY A;  5I5P A;  4XEQ A;  4MIJ A;  4PGN A;  2XXK A;  2CEX A;  4P1E A;  4PBH A;  4OVQ A;  3GYY A;  2CEY A;  4OVP A;  4UAB A;  4OA4 A;  3U65 A;  4PF8 A;  4OVR A;  4O7M A;  4N6D A;  5IM2 A;  4P3L A;  4P8B A;  4OVT A;  4PBQ A;  2WX9 A;  4N4U A;  2HPG A;  4NF0 A;  4NN3 A;  4YIC A;  2XWK A;  4OVS A;  4P47 A;  2V4C A;  2XWI A;  4O94 A;  4PFB A;  4PET A;  4DI4 B;  4NQ8 A;  4N15 A;  4NX1 A;  4DI3 D;  2XWO A;  2VPN A;  4N91 A;  4PFR A;  4N6K A;  2WYP A;  5CM6 A;  5IZZ A;  4NHB A;  2PFZ A;  2ZZX A;  4NG7 A;  4YZZ A;  4NAP A;  4N8Y A;  4NGU A;  2VPO A;  4PC9 A;  2HZK A;  2XWV A;  4N17 A;  4LN5 A;  4PCD A;  5LTC A;  4PAK A;  5I7I A;  2WYK A;  4P1L A;  4MNC A;  4MNI A;  5IGA A;  4P56 A;  4N8G A;  2ZZW A;  2ZZV A;  4PDH A;  4MEV A;  4MX6 A;  4PAI A;  4PGP A;  2XA5 A;  3FXB A;  4PDD A;  4XF5 A;  4X8R A;  4MAG A; 
#chains in the Genus database with same CATH topology
 4Q30 B;  1N0T A;  1OMP A;  3KZG A;  3D4C A;  1IME A;  1DBZ A;  3OO6 A;  4I1D A;  2XX8 A;  4QFP A;  3ZSF A;  5H8H B;  3UP9 A;  4PAF A;  4C1U A;  4H8J A;  1MY4 A;  1Q9D A;  4YKK A;  4XXU A;  2MKZ A;  1IMF A;  1UTH A;  2ZNS A;  3TUS A;  3Q29 A;  4PP0 A;  1MM7 A;  4FAJ A;  1Y1Z A;  4GLI A;  4ELP A;  3CRB A;  1K9Z A;  3K6U A;  5KZT A;  1II5 A;  3BIH A;  3HV1 A;  4LQ2 A;  4YIC A;  2DE3 A;  5I2K B;  3RQT A;  2B65 A;  4O3B A;  2OJT A;  2GQ1 A;  1H43 A;  3IB1 A;  1R6Z A;  5BWJ A;  4I40 A;  4QRZ A;  1FTL A;  2XWO A;  1QGX A;  3RPW A;  4N91 A;  4NG7 A;  1EYI A;  2RC7 A;  4N8Y A;  2HZK A;  4ESW A;  2B3F A;  4LZ7 A;  4GL8 A;  1A8E A;  2O68 A;  1IMC A;  3EPE A;  3NOH A;  4PFT A;  2OWT A;  4OWD A;  4C0R A;  1O64 A;  3FIR A;  4MX6 A;  2OBG A;  1LST A;  1MPB A;  4HE1 A;  5ICT A;  1Q35 A;  4EQ9 A;  1MPC A;  4XF5 A;  4KR5 A;  1LCF A;  2DP8 A;  3S9L C;  2F5X A;  1FBC A;  4EXL A;  2O51 A;  3MUQ A;  2I58 A;  1ZU0 A;  1QVS A;  4NF8 B;  5A5X B;  3OMB A;  1B5I A;  3WAE A;  1PEB A;  5IZ1 A;  4NED A;  1AWB A;  4QSC A;  4PE3 A;  4OFJ A;  4RXL A;  4RY1 A;  2JJK A;  3HST A;  3DP4 A;  1H3D A;  1DOT A;  3I6V A;  3L6G A;  4U4X A;  3CR9 A;  1PBP A;  3KBR A;  1UIV A;  3H6U A;  4IO4 A;  5I59 B;  1JW5 A;  3FGS A;  4OFO A;  2F35 A;  1M5E A;  4OVR A;  4KPT A;  1K9Y A;  4P8B A;  4PBQ A;  3E78 A;  2THI A;  3PUY E;  5ITP A;  3OEN A;  3V83 A;  2Z8F A;  1DPE A;  5H8S A;  4PET A;  3IFC A;  2HXW A;  3QAX A;  1EYK A;  3R26 A;  3M8U A;  4QSD A;  3TAJ A;  3TCG A;  3N6T A;  1ZIU A;  1NFT A;  3C31 A;  2QJE A;  4P0G A;  4LAT A;  4PC9 A;  3G3G A;  3LC8 A;  1LFI A;  2Q8M A;  3PD9 A;  2RIN A;  1I6Q A;  1TFA A;  1GV8 A;  2OX3 A;  3RN8 A;  1WOD A;  5TPA B;  2X7Q A;  3OXN A;  4G4P A;  4ZEF A;  1R9L A;  2DVC A;  3SET A;  2GH9 A;  4F3G A;  4PDD A;  3CHG A;  5CRY A;  5JTY A;  1P1N A;  3K6X A;  1IEJ A;  3N5L A;  3I3V A;  3RNN A;  4RK9 A;  3QUJ A;  1NV3 A;  3FV1 A;  1PB9 A;  3MAM A;  4G8M A;  3DM0 A;  4O8M A;  3EQ1 A;  3TCF A;  2HZL A;  1LGB C;  4KI0 E;  4GX6 A;  4PF6 A;  2I3V A;  2QSX A;  5H8F A;  1QW0 A;  4OFL A;  4I9D A;  4PGN A;  3G3K A;  3UK4 A;  2B4L A;  3T93 B;  3CFL A;  1RDZ A;  4NWD A;  1NV2 A;  4H45 A;  3SKP A;  4RA1 A;  5FTH A;  3G3F A;  3O97 A;  1VSO A;  3GBA A;  1SYH A;  2KLF A;  3B8B A;  4R9F A;  1Z7N E;  3TQL A;  1FTK A;  1A54 A;  4IO2 A;  1J1N A;  1XVY A;  1WVJ A;  3MVZ A;  2O6A A;  3OO8 A;  1LBW A;  4G68 C;  2FIX A;  1MH3 A;  1FPE A;  2CZK A;  4AB6 A;  3QYT A;  1MXZ A;  2Y7R A;  2PFZ A;  4GWY A;  3A3U A;  2Y7K A;  4F31 B;  5A5X A;  4ELR A;  4PFW A;  3K0V A;  2VPO A;  1ZBM A;  2I4B A;  5EHS A;  1IXI A;  3UOR A;  1IUD A;  4HTG A;  2W7Y A;  4OHN A;  3VLU A;  1B3F A;  1URG A;  2PMS A;  1GGG A;  1MDP 1;  3R6U A;  4TLM B;  3RGY A;  3VE1 B;  1ZMG A;  1B32 A;  5F7V A;  4HS7 A;  3B7D A;  1A55 A;  4GX3 A;  2DSF A;  3HFU A;  4HCW A;  4YAH X;  1P1W A;  3R7X A;  2QS4 A;  5ISU A;  2OZZ A;  3ECR A;  1B7U A;  1O63 A;  3K4U A;  3MZ9 A;  1LB9 A;  1NMU A;  3RT6 B;  1SVX B;  1NV4 A;  3C33 A;  3LBS A;  2I0B A;  2VGQ A;  4YU0 A;  2Q2C A;  4BDR A;  4F3P A;  3IJO B;  3FUZ A;  1IMD A;  3MVW A;  1QKA A;  3V8X B;  1B9J A;  4BDN A;  3U65 A;  1B05 A;  2XXR A;  5IM2 A;  4P3L A;  4DXC A;  1JEU A;  4G68 B;  4N4U A;  4FEC A;  2HXR A;  3VV5 A;  4F1V A;  1T0K A;  3W9W A;  3FAT A;  3QSL A;  3U94 A;  4U21 A;  3Q26 A;  1PDA A;  4NQ8 A;  2I49 A;  4EF1 A;  2GHA A;  3CG3 A;  4POW A;  2QVV A;  1PC3 A;  2XD2 A;  3HPI A;  4ZEC A;  3PV0 E;  2F7A A;  2YPN A;  2CMO A;  2Y7W A;  3TZA A;  3E4R A;  2XXH A;  3PU5 A;  1DPP A;  2ZMB A;  5I56 B;  4N07 A;  3TTR A;  2Z23 A;  4GWS A;  1LEV A;  3TKD A;  2Q2A A;  3KOT A;  4PAK A;  2Y7I A;  1R9Q A;  2B3B A;  1OQH A;  3M3K A;  1JVX A;  3HN0 A;  1EZ9 A;  4QFO A;  3PPQ A;  2HHM A;  4PFY A;  2XA5 A;  1P1U A;  4H5F A;  3EHU A;  1SI1 A;  1NI9 A;  2ALU A;  3W15 C;  3FD3 A;  3HHF A;  3U92 A;  4DE8 A;  5AA1 A;  4TOZ A;  1AH5 A;  3PUW E;  1XHY A;  4YKP A;  1FPK A;  2M8C A;  4GOT A;  3AXF A;  1PB8 A;  4P1E A;  4H1X A;  2AL4 A;  3GZG A;  4OVQ A;  3UIF A;  2UVG A;  4RPO A;  3MZ1 A;  1QUK A;  4HW8 A;  4PF8 A;  1LBC A;  3OSQ A;  4QFK A;  2AL5 A;  1IZ1 A;  3H03 A;  2F8D A;  2V3U A;  1MPD A;  3PUZ E;  3TOD A;  4BDL A;  1GVC A;  3SER A;  3C34 A;  4NMY A;  4F22 A;  4ECF A;  3TYH A;  4IR8 A;  1OVB A;  4EDP A;  3SZP A;  1YXI A;  3IR1 A;  3G3H A;  1AIV A;  5H8Q B;  3VXB A;  4H5G A;  3V5A A;  3RT8 A;  2VP1 A;  3G3I A;  2H9B A;  1LAH E;  4XKR A;  1FQC A;  3B6W A;  4KD5 A;  2REJ A;  2A5S A;  3D1R A;  2PVU A;  1CNQ A;  4POX A;  4OXV A;  3EF7 A;  2LAO A;  3FXR A;  3CFX A;  4NF8 A;  3M3F A;  4E0X A;  3EHT A;  4G61 A;  2XX9 A;  5DVF A;  3IL1 B;  5H8Q A;  4MLV A;  1NV6 A;  4MFI A;  4OVJ A;  2XXQ A;  3MP1 A;  3UGW A;  1IQ7 A;  2UVH A;  2UXA A;  1VFE A;  4ZE8 A;  1LFH A;  4R6K A;  4X04 A;  4KYS A;  4OAN A;  1SQY A;  2DS9 A;  2X7P A;  5A5L A;  2NXO A;  3B6T A;  3VXC A;  2ONS A;  3OEL A;  4O3C A;  2VHA A;  5H8N B;  2FBP A;  2ZNT A;  5IAI A;  3KSJ A;  3K00 A;  1MG1 A;  4ND9 A;  3LUY A;  1SDX A;  3RPL A;  1BP5 A;  5EYG A;  1MQG A;  3QMF A;  4MF3 A;  2R71 A;  1N7W A;  1NUW A;  4UAB A;  3WAF A;  4ZS9 A;  2Z8E A;  3PGF A;  1IIW A;  4X48 A;  4NF6 A;  1SBP A;  1KZ8 A;  1NV1 A;  2REG A;  4KCC A;  2L5V A;  3EN3 A;  2I0C A;  2XWI A;  2DE4 A;  1MQD A;  2OWZ A;  4LZ5 A;  3MPL A;  2UYF A;  4OZ9 A;  1NNF A;  2QS3 A;  2WKY A;  1RDX A;  2WEF A;  3PPO A;  4GWX A;  3S9E A;  4NHB A;  3IK6 B;  3QK6 A;  3VLW A;  5EYF A;  1FPJ A;  4NGU A;  3VDF A;  3IOU A;  4KYE A;  1B7H A;  4PCD A;  4UAC A;  5LTC A;  1LAX A;  2F97 A;  3U93 A;  3N94 A;  4LA9 A;  5I57 A;  2I3W A;  1EU8 A;  1JEV A;  3KG2 A;  1RYX A;  3LSW A;  2XXY A;  1MDQ A;  3TTL A;  3FXB A;  5ET7 A;  1EZO A;  1M5C A;  1D9Q A;  4GFR A;  1XOC A;  4GIZ A;  1B5J A;  4FIM A;  1OIB A;  2XXU A;  2V3Q A;  3V89 B;  3CFZ A;  3BIG A;  3LSF B;  3OSR A;  5ICQ A;  3GXA A;  3IX1 A;  5TPA A;  4GWU A;  4BDM A;  1SW2 A;  2PFY A;  3C32 A;  4R2B A;  1G0I A;  2XXK A;  4PBH A;  3KJT A;  3FXU A;  3MPK A;  4NF4 A;  3O2A A;  2PT1 A;  4H65 A;  5DVI A;  1FQD A;  3CI8 A;  3S2V A;  3SEW A;  3DP6 A;  4GQO A;  4JVI A;  1ZJL A;  1OVT A;  3RTW B;  2ZXT A;  2QMX A;  2HFB A;  4OER A;  3ILT B;  2XWK A;  3T0J A;  1FQA A;  3ONM A;  3DLN A;  3VVD A;  5I58 A;  4LZ8 A;  4M1V A;  2P3V A;  1DTZ A;  2XWV A;  1FRP A;  3H6W A;  3VVF A;  1MY1 A;  2NWJ A;  1RKM A;  1ELJ A;  3MWB A;  2O1L A;  2HCA A;  5HPQ A;  1MY2 A;  3TEP A;  3H7M A;  4RPN A;  1FJ6 A;  3SEU A;  3FJ7 A;  3ROJ A;  3EKI A;  5CMC A;  4HCY A;  4F2Q A;  3T1B A;  4MHF A;  4PFI A;  5F24 A;  4XFE A;  4H0W A;  3K1M A;  3UN6 A;  1Z7M E;  4H6D A;  3CIJ A;  2YLN A;  2FVZ A;  3U1O A;  2A5T A;  1XC1 A;  4JSO A;  4NF6 B;  3JV9 A;  1FPF A;  4MCO A;  1TWY A;  3ZKL A;  1ATG A;  1B3E A;  3MQ9 A;  4OEN A;  5ET6 A;  2F78 A;  3A3C A;  2I4C A;  3O29 A;  4C1T A;  1SW1 A;  5B70 A;  4GWZ A;  2Y84 A;  5DEX A;  3C4M A;  4GBV A;  3L6H A;  2F3B A;  3BKI B;  4YMA A;  4GXA A;  4OVS A;  3LV0 A;  2V4C A;  1B6H A;  4DXU A;  4R9G A;  4DI4 B;  4N15 A;  1RDY A;  4NX1 A;  5K2X A;  2HAU A;  3OEK A;  1Y4C A;  5F1Q A;  3IAZ A;  1YZ0 A;  5CM6 A;  3Q28 A;  4YZZ A;  3DP8 A;  4NAP A;  4OEU A;  4R72 A;  4G77 A;  1FPG A;  4U23 A;  1Y20 A;  4LN5 A;  1YYZ A;  2DWA A;  2VD3 A;  5EQ9 A;  1NL5 A;  2FYI A;  2R6G E;  4HE0 A;  4EUO A;  2XD3 A;  2OWS A;  2CZH A;  2FNC A;  5ESY A;  3PUV E;  1ZTY A;  3K1P A;  3IFA A;  5ET5 A;  1HSL A;  3IB0 A;  2CZL A;  5TP9 B;  4GL0 A;  3N6U A;  2QFL A;  4F18 A;  4QFL A;  4PE5 B;  5AA2 A;  5CMM A;  4U4S A;  3PMV A;  4DLD A;  2ZYO A;  3LSL A;  1PBQ A;  2R8T A;  1FBE A;  1JP4 A;  4ZEB A;  1HSE A;  4ZEI A;  5I5P A;  2V25 A;  1DTG A;  1MXY A;  5JEI A;  1JET A;  5KCJ B;  2NOO A;  3Q27 A;  4P0I A;  5EQ8 A;  1B3G A;  2O7I A;  3HHG A;  2ZYM A;  2UVJ A;  1LB8 A;  1H76 A;  1B5H A;  5H8N A;  3KFM A;  3MVX A;  1RYO A;  2D3I A;  2CZI A;  3F11 A;  2VPN A;  2Y5L A;  3T22 A;  4U1Z A;  4MH5 A;  2UVI A;  5AA3 A;  1Y4T A;  5TP9 A;  1NUZ A;  4ISU A;  4X9T A;  1WDN A;  5J16 A;  2QS1 A;  3SEV A;  3OO9 A;  1FSA A;  3CSG A;  4F1Y A;  3T9V A;  5I7I A;  3PUX E;  4FAT A;  2H99 A;  2AIX A;  4P56 A;  2IA4 A;  1TXF A;  2HEU A;  3MST A;  4PAI A;  3O6H A;  1B4Z A;  3E79 A;  4PGP A;  1JNF A;  2XXX A;  1FQB A;  4R2F A;  2RC9 A;  1LBV A;  3KC1 A;  2F6P A;  1XVX A;  3LR1 A;  4I8C A;  1YAE A;  2F7B A;  4H8I A;  3K2D A;  5CBS A;  1M5D A;  4L17 A;  1IXC A;  2OLB A;  3BFU A;  2Q8J A;  1AOV A;  5CBR A;  3E13 X;  4JVD A;  4HXV A;  4EF2 A;  4JSD A;  4ESX A;  2KQZ A;  5I59 A;  3TPA A;  2ANJ A;  1QUI A;  3FJG A;  2GRV A;  3T66 A;  4DDD A;  3S4U A;  1O7T A;  1XT8 A;  5LDZ A;  4IY5 A;  4KQP A;  1JQF A;  3JZJ A;  3PMX A;  2AYS A;  2Q74 A;  4KFQ A;  4QFN A;  1B0L A;  3KSX A;  2HAV A;  2G93 A;  3RPL B;  2DDK A;  2VT5 A;  1FQF A;  4I3Y A;  1NUY A;  1SI0 A;  5FHO A;  2ONK E;  3M3L A;  5LOM A;  1FBD A;  3TEL A;  1R1N A;  3QIM A;  3SDF A;  2FA7 A;  1B0H A;  1XS5 A;  3KN3 A;  1YTV A;  5JTY B;  2WBB A;  1NKX A;  1FQE A;  4IO7 A;  2ZNU A;  3IB2 A;  1MRP A;  1TT1 A;  4MNC A;  4FE8 A;  2VD2 A;  4FED A;  4OTE A;  5CC2 A;  1MH4 A;  2FHY A;  5L9M A;  1EYJ A;  2H98 A;  1LLS A;  4QHQ A;  5AA2 D;  2O69 A;  4KXP A;  1LCT A;  2PCR A;  4XKQ A;  2VOZ A;  2XXP A;  2IEE A;  2BJI A;  3MP8 A;  3TDJ A;  1CE2 A;  3IO4 A;  3TMG A;  3MBP A;  4HE2 A;  2P2A A;  4XEQ A;  1FPD A;  4F2O A;  2WBD A;  2QS2 A;  3H6V A;  3MP6 A;  3S9M C;  1I6B A;  5KDT A;  3FXQ A;  4N81 A;  4OVP A;  1PB7 A;  1ZKB A;  4OQO A;  1ANF A;  2V3T A;  4NWC A;  2HQ0 A;  2NVU B;  1LBB A;  4JB7 A;  2H25 A;  2WX9 A;  1B4H A;  4I3E A;  2E1S A;  3IOR A;  4F3B A;  2NUV A;  4I62 A;  1B52 A;  4U1O A;  4O94 A;  1KA0 A;  4UA8 A;  3USD A;  1Y1M A;  2UYE A;  4XKP A;  2Z22 A;  4DI3 D;  1B3H A;  4ELQ A;  4RNS A;  1USY H;  1B51 A;  4K3F A;  4LP2 B;  3FVG A;  2FIE A;  5J1D A;  1FPB A;  1MXU A;  1FW0 A;  1A8F A;  5DT6 A;  2RKM A;  5DW8 A;  3CVG A;  1N7X A;  1B2H A;  1N84 A;  5EHM A;  2G29 A;  4JWY A;  2Q88 A;  4ZE9 A;  2RCB A;  4X1D A;  1S50 A;  4MNI A;  2QVU A;  2DXR A;  2ZZW A;  1JVY A;  2F6G A;  1IMA A;  2O84 X;  2KR0 A;  4YB5 A;  4FOR A;  2DWJ A;  5I3S A;  3W9V A;  3KEI A;  4G2Z A;  3MW0 A;  5IKB A;  1S7Y A;  5I56 A;  3PPN A;  2Q89 A;  1NV5 A;  1USY E;  3K01 A;  3THI A;  1I6A A;  3MC2 A;  4FEB A;  3MJN A;  4P9K A;  1A99 A;  4G8H A;  2D5W A;  4MNP A;  5K2Y A;  1BKA A;  3I5O A;  1D9V A;  4F19 A;  4GXS B;  4IGR A;  2BJJ X;  4O7M A;  4N6D A;  2XX7 A;  3PTY A;  4AQ4 A;  1L5T A;  1POY 1;  4OVT A;  1G0H A;  1IXH A;  1M5B A;  2QL3 A;  1A7L A;  2HPG A;  1KWH A;  3FVN A;  3TTM A;  1LBX A;  4O3A A;  4XKN A;  4XTC Q;  3K6V A;  3ISP A;  4GBW A;  1ZLQ A;  4N13 A;  4QXD A;  1H45 A;  3C9H A;  2DVZ A;  3KJ7 A;  4LON B;  5KCJ A;  3PMW A;  4N6K A;  1FBP A;  4JWO A;  1QUJ A;  3LSX A;  1Y3N A;  3T9X B;  1QJM A;  1AMF A;  3SEX A;  3FAS A;  2E0S A;  1B1H A;  4N17 A;  1QUL A;  1US5 A;  4FBP A;  5AA2 B;  4PTK A;  1JW4 A;  4GRK A;  1BIY A;  3T9H B;  3FBP A;  1DSN A;  4BLA A;  1UTB B;  2ZYN A;  4U2R A;  3GLB A;  4N8G A;  4F39 A;  2R9J A;  4JXI A;  4R6H A;  4MEV A;  1GR2 A;  1CB6 A;  1D9Y A;  4Z0I A;  5FBP A;  1LBY A;  4O7I A;  1FJ9 A;  2X26 A;  1UQW A;  4YMB A;  3O28 A;  5KDT B;  3O66 A;  4JVC A;  4EQB A;  1UTB A;  3K6W A;  5ELV A;  3H6T A;  3K1N A;  1B46 A;  3CSB A;  2ABH A;  4N6P A;  4MIJ A;  4AS5 A;  3RLF E;  4KCD A;  3IO6 A;  2XXT A;  4R74 A;  3TTN A;  4WXJ A;  3RTF B;  4GX4 A;  4EXK A;  1FTM A;  1OLC A;  5EQ7 A;  5L9O A;  1MXV A;  2ONR A;  2QVR A;  4NN3 A;  4YB6 A;  3IOV A;  4P47 A;  1IXG A;  1SPI A;  1S9T A;  2XXV A;  1FCK A;  1MQH A;  5B7D A;  2O1M A;  2PT2 A;  2RCA A;  1POT A;  4WED A;  2V84 A;  5H8F B;  3GBB A;  4H67 A;  4EQ7 A;  5T3J A;  2Y7P A;  5IZ3 B;  4ZZA A;  4OET A;  1SW4 A;  2ZZX A;  3QUF A;  5BUU A;  3E9X A;  2A5T B;  1DK4 A;  1VFD A;  1LAF E;  3MVY A;  4IB2 A;  1XI6 A;  2ZYK A;  3ZKK A;  5FTI A;  3TTK A;  4XIG Q;  4LVQ A;  1MQI A;  4TQU Q;  2WYK A;  4P1L A;  1NNK A;  1YCJ A;  3IJX B;  4PDH A;  3DEL B;  5AA4 A;  4X1B A;  2QRY A;  2QPQ A;  2DE2 A;  3RYD A;  4DXB A;  2RC8 A;  4F3S A;  1Y9U A;  4IO5 A;  4U22 A;  4R73 A;  4KHZ E;  3FVK A;  2DQV A;  3O6G A;  4ONY A;  4NF5 A;  1P1Q A;  3VVE A;  4IO6 A;  2OCU A;  5I2N A;  4QSE A;  4GF8 A;  1INP A;  4RYA A;  3FJM A;  3K02 A;  1QKB A;  1B40 A;  1VDW A;  1FPL A;  1B7Z A;  3KBZ A;  4F29 A;  2OK2 A;  1DMB A;  4OA4 A;  3UA8 A;  1N3X A;  1MXW A;  2P1S A;  1US4 A;  4QF9 A;  4DCX A;  1DCU A;  3A29 A;  3PPP A;  5JK4 A;  1AL3 A;  2F34 A;  4MBP A;  5I57 B;  1FTJ A;  3H06 B;  5DTB A;  3G7W A;  1FPI A;  1FBG A;  1FBF A;  1MM6 A;  5ITO A;  5IZZ A;  2XXI A;  3FZV A;  1GTK A;  4JDF A;  4KYD A;  3H3G A;  4FJP A;  4LQ5 A;  3QXM A;  4ELO A;  5EYH A;  1OQG A;  4Q5T A;  5H8H A;  1N04 A;  2Z8D A;  5I2N B;  1LAG E;  4GWO A;  4ZEK A;  1D3K A;  1MQJ A;  4DIG A;  5DEX B;  4YKI A;  3KN8 A;  2ZZV A;  3PD8 A;  5L8D A;  1NNP A;  4Q8R A;  1H44 A;  2GFE A;  5HM4 B;  3U72 A;  3OOA A;  3KN7 A;  4BDO A;  1Q1K A;  1KA1 A;  1M5F A;  1FTO A;  2QMW A;  1IIT A;  5TU0 A;  3Q25 A;  1JW1 A;  3RUM A;  2H4I A;  4MMP A;  1B58 A;  3A09 A;  2YJP A;  3B50 A;  3T96 B;  1IMB A;  2CEX A;  3O6I A;  2F3D A;  4WEP A;  1MS7 A;  1SW5 A;  3P7I A;  1BK4 A;  1F9B A;  2CEY A;  5I58 B;  3OO7 A;  1NUX A;  2DWH A;  5HBC A;  4Q0C A;  2PBW A;  4IY6 A;  2Y5K A;  4AB5 A;  4DZ1 A;  4GWW A;  3OEM A;  3KOS A;  3H4Z A;  1Y3P A;  3VFJ A;  2I48 A;  2XHD A;  4PFB A;  4G8N A;  2DXY A;  4WKM A;  1LFG A;  1I69 A;  3ILU B;  3FVO A;  1MY0 A;  2P3N A;  1B1X A;  4F1U A;  3SES A;  5CMK A;  1MXX A;  4OYV A;  4TLL B;  4OMB A;  4NF5 B;  3LUZ A;  3FV2 A;  1BLF A;  5DYH A;  2DWI A;  5AE4 A;  2PX1 A;  3G3J A;  2RF1 A;  4YB7 A;  2H5Y A;  2Q9T A;  3BFT A;  2DYX A;  1P1O A;  4NTL A;  3RY3 A;  4Z7E A;  3IOW A;  3HO7 A;  1URD A;  2GHB A;  1YPN A;  1B3L A;  3E3K A;  5I84 A;  3MYU A;  4NF4 B;  1P99 A;  4H46 A;  3B6Q A;  3D4G A;  4MLQ A;  3N26 A;  3TCH A;  1NNT A;  1URS A;  2XXW A;  3SEY A;  2F36 A;  3CG1 A;  1VE4 A;  4G68 A;  5DVJ A;  4R6Y A;  3BBR A;  3ODB A;  3S9N C;  3EHS A;  3IOT A;  2PYY A;  4RK2 A;  4GD5 A;  3JYR A;  1D4N A;  3KGC A;  1SD3 A;  3HCQ A;  3C35 A;  3PPR A;  5FHM A;  1MY3 A;  3GYY A;  5EQA A;  5AA4 B;  4M4G A;  3O9P A;  4JBZ A;  3ZS6 A;  4RJZ A;  5IZ3 A;  1LBZ A;  4THI A;  4OES A;  3KC0 A;  4AS4 A;  5M2V A;  1FBH A;  4NF0 A;  5CMB A;  4ZZE A;  1OLA A;  1N3W A;  4YKJ A;  4PFU A;  1NV0 A;  1HSJ A;  2V93 A;  4LUB A;  5ET8 A;  3C36 A;  4OEV A;  1SYI A;  4ZDM A;  4PFR A;  2DOJ A;  2WYP A;  3T9U A;  1BTJ A;  4QBA A;  1TFD A;  4IGT A;  4IO3 A;  4MJO A;  1Y3Q A;  1NV7 A;  4E0W A;  3OD7 A;  1A40 A;  1VR5 A;  1NH8 A;  4ZED A;  2O7U A;  3MZB A;  5L9S A;  4BDQ A;  4NE4 A;  5IGA A;  5I2K A;  2P0S A;  3VLV A;  2F7C A;  1FTA A;  3TQW A;  4DCY A;  2I6E A;  3TFL A;  4GVO A;  4JWX A;  2B4M A;  4P11 A;  1NH7 A;  4R75 A;  1EZP A;  2D21 A;  5CI5 A;  1UTH B;  1UIU A;  4PQJ A;  5FHN A;  2ESN A;  1EH3 A;  4X8R A;  3U8Q A;  4MAG A;  1N76 A; 
#chains in the Genus database with same CATH homology
 4KXP A;  4MHF A;  4PFI A;  4X04 A;  1FBC A;  4OAN A;  4XFE A;  5F24 A;  1NV5 A;  2PCR A;  4O8M A;  4JVC A;  5A5L A;  2HZL A;  2BJI A;  3BIG A;  2FVZ A;  4PF6 A;  2R8T A;  4GX6 A;  5IZ1 A;  1FBE A;  1JP4 A;  1AWB A;  2FBP A;  4P9K A;  4GWU A;  4HE2 A;  4MMP A;  4PE3 A;  1IME A;  1DBZ A;  1NV4 A;  4MNP A;  2JJK A;  1FPF A;  4MCO A;  4PAF A;  3B50 A;  2PFY A;  1INP A;  1FPK A;  4JVD A;  4XEQ A;  4HXV A;  4MIJ A;  4PGN A;  1G0I A;  1IMB A;  1FPD A;  2CEX A;  2XXK A;  5ET6 A;  3RPL A;  2B4L A;  5EYG A;  2F3D A;  2WBD A;  4P1E A;  1IMD A;  4PBH A;  3QMF A;  5T3J A;  4AS5 A;  4OVQ A;  5EQ8 A;  1RDZ A;  4F19 A;  1BK4 A;  1VDW A;  1FPL A;  4N81 A;  2CEY A;  3GYY A;  5EQA A;  4OVP A;  3KBZ A;  2KQZ A;  3RYD A;  1Q9D A;  1NUW A;  4UAB A;  4OA4 A;  3U65 A;  1NUX A;  4PF8 A;  2MKZ A;  1IMF A;  4OVR A;  1NV2 A;  4GWZ A;  4H45 A;  4O7M A;  4N6D A;  5IM2 A;  1K9Y A;  4P3L A;  1LBZ A;  5IZ3 A;  3PTY A;  2Y5K A;  4P8B A;  4JVI A;  4GBV A;  4GX4 A;  4OVT A;  1G0H A;  4PBQ A;  3KC0 A;  4AS4 A;  2WX9 A;  5LDZ A;  1KZ8 A;  1NV1 A;  3B8B A;  4N4U A;  5EQ7 A;  2HXR A;  4GWW A;  2L5V A;  4I3E A;  2F3B A;  1DCU A;  1K9Z A;  2HPG A;  2QVR A;  3E78 A;  1FBH A;  4F1V A;  2Q74 A;  4NF0 A;  3A29 A;  4NN3 A;  3BIH A;  3W9W A;  1LBX A;  2XWK A;  4OVS A;  4YIC A;  2DE3 A;  3LV0 A;  4P47 A;  5JK4 A;  2V4C A;  2XWI A;  2DE4 A;  4O94 A;  4PFB A;  1KA0 A;  1SPI A;  4PET A;  3IFC A;  4DI4 B;  2OWZ A;  1NV0 A;  2DDK A;  3ISP A;  4GBW A;  4NQ8 A;  3RPL B;  4N15 A;  4QXD A;  1LBW A;  2VT5 A;  5ET8 A;  3T0J A;  2FIX A;  1RDY A;  2GQ1 A;  2QVV A;  2P3N A;  4NX1 A;  2DVZ A;  4I40 A;  4F1U A;  4IR8 A;  4I3Y A;  4DI3 D;  2XWO A;  2CZI A;  1FPE A;  1NUY A;  1FPI A;  2VPN A;  1FBG A;  1QGX A;  2Y5L A;  4N91 A;  2CZK A;  4PFR A;  3SZP A;  5I5P A;  1RDX A;  1EYK A;  2WEF A;  1FBF A;  1YXI A;  1YZ0 A;  1FBP A;  2WYP A;  4GWX A;  4N6K A;  4QBA A;  5IZ3 B;  5CM6 A;  1NUZ A;  3LUZ A;  4NHB A;  5IZZ A;  1FBD A;  2FIE A;  2PFZ A;  1FPB A;  1EYI A;  2ZZX A;  4GWY A;  4NG7 A;  4X9T A;  4M1V A;  4YZZ A;  4NAP A;  1DK4 A;  5J16 A;  1FPJ A;  4MJO A;  4N8Y A;  1NV7 A;  4NGU A;  2VPO A;  4PC9 A;  5DW8 A;  1XI6 A;  2HZK A;  5EYH A;  2P3V A;  2Q9T A;  1FPG A;  2XWV A;  4GWS A;  1LEV A;  4N17 A;  2Q8M A;  1FSA A;  2WBB A;  3T1B A;  4LN5 A;  1FRP A;  1YYZ A;  4FBP A;  4PCD A;  2OX3 A;  5LTC A;  4PTK A;  4PAK A;  5EQ9 A;  5I7I A;  3D1R A;  1IMC A;  2WYK A;  3NOH A;  4P1L A;  4HE0 A;  1CNQ A;  3FBP A;  4MNC A;  4MNI A;  5IGA A;  4P56 A;  4N8G A;  5J1D A;  2QVU A;  2ZZW A;  2ZZV A;  4PDH A;  4MEV A;  1IMA A;  2CZH A;  2QPQ A;  4G61 A;  5ESY A;  4MX6 A;  2DE2 A;  2HHM A;  3MST A;  4PAI A;  3MYU A;  2FHY A;  1FTA A;  3IFA A;  2KR0 A;  3E79 A;  2XA5 A;  4HE1 A;  4PGP A;  5ET5 A;  1EYJ A;  1NV6 A;  3FXB A;  4H46 A;  5ET7 A;  1D9Q A;  1FJ6 A;  3ROJ A;  5I3S A;  2B4M A;  4PDD A;  3CHG A;  2QFL A;  3W9V A;  5FBP A;  4F18 A;  1LBY A;  4O7I A;  3EKI A;  4XF5 A;  1FJ9 A;  1KA1 A;  4X8R A;  1LBV A;  3KC1 A;  4GX3 A;  3HFU A;  4HCY A;  4HCW A;  4MAG A;  2V3Q A;  1NI9 A;  2F5X A;  1NV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...