5J1DA

X-ray crystal structure of phosphate binding protein (pbp) from stenotrophomonas maltophilia
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
373
structure length
373
Chain Sequence
ATAVTGGGASLPADLYKGSADSILPANFSYAVTGSGTGKKAFLENNSALFSTTGTVHFAGSDSVLSSTELNTYNSTYNVSGDANRYGALVQIPSVATSVTIPFNKAGSAVDLSVTQVCGIFSGKITSWSQLAGLGRTGDIQVVYRGESSGTSELLTRFLTSACQPADVSSSNLKLTNGVPAFSVQSTFANLFTTVPSNFIAAPATGGTALYNAVYAIDGRVGYVGPDAIPSLTDATKVAKVKGFSPDEVSVQATLETAAPPTGAAAENPANWVPVFGNPSAGYPIAGYTNFVFGQCYKNATVGANVRGFLTKHYGSTVVNGVEQGPNDVAIRAHKFIPLTKAWRDAVRARFATATNAGAVNNPATCSGIGRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of crystal structures of proteins of unknown identity using a marathon molecular replacement procedure: structure of Stenotrophomonas maltophilia phosphate-binding protein.
pubmed doi rcsb
molecule tags Protein binding
molecule keywords Phosphate binding protein
total genus 118
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2016-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5j1dA02
3.40.190.260 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5j1dA01
5TPAB 2DXYA 3MP1A 1MG1A 3KSJA 5A5XA 5AA4A 3PUZE 2YLNA 4FORA 3WAEA 5H8HB 5I57A 4IGTA 4YZZA 4HCWA 1H44A 3ZS6A 3IOVA 3FASA 2QMXA 4OQOA 5F1QA 1HSEA 1B0LA 1N7WA 3VLVA 4KCDA 3G3FA 3SESA 3T93B 3C31A 3H6VA 2Y84A 3IJOB 2Y7RA 1XVXA 4H5GA 1N76A 3LSLA 2NOOA 2KLFA 4ZECA 2DQVA 3H06B 3C9HA 2DVZA 3SEYA 2ALUA 1BP5A 2OCUA 3G3KA 3PPRA 2QS2A 2V84A 4G77A 4M1VA 3OSQA 3C35A 2I48A 4KQPA 4R6YA 4TLLB 5HPQA 4XKRA 3TUSA 1MQDA 1N0TA 3VVEA 4WEDA 3IK6B 3DM0A 2OK2A 3TFLA 3M8UA 5K2XA 2P0SA 5L8DA 1P1NA 2F5XA 4ESXA 2DVCA 3TODA 3S2VA 3S9NC 4GQOA 1TXFA 4GXSB 4JWOA 4LUBA 4WEPA 3MQ9A 1R9QA 4NMYA 3M3KA 3D4CA 3FXQA 4NEDA 2DWIA 1POY1 4N07A 3ODBA 2DE3A 4FATA 5TU0A 4F29A 1R1NA 3TQWA 1SDXA 4AB6A 3FV1A 4F39A 2Z23A 3QSLA 4I8CA 5AA4B 4G2ZA 1LFGA 1AH5A 2E1SA 5H8FA 5I56A 1NMUA 2OJTA 2ZMBA 5AA3A 1MY1A 1N7XA 4IY5A 1D9VA 4IO6A 1PEBA 4H1XA 1WDNA 1MM7A 3KEIA 4LZ8A 4X1BA 4R9GA 1PB7A 2F78A 3MVZA 2A5TB 3P7IA 3U93A 3B6QA 4YMAA 1LFHA 2XD2A 2XXXA 4KI0E 2G93A 4F22A 1TFAA 4LZ7A 1EZOA 1B58A 3LSXA 3CRBA 4QFOA 3OSRA 2ANJA 4JWXA 5CMKA 2QPQA 1RYOA 1TFDA 5DVJA 1I6AA 3MJNA 1J1NA 5F7VA 3PPNA 1MPBA 4F1YA 1P1WA 1Z7NE 1LCFA 1UIUA 1II5A 3MAMA 4R6HA 3S9EA 1DOTA 2XX9A 2F7BA 3EF7A 3IB1A 3CFXA 3O97A 2I0CA 2PX1A 2ZNTA 3MZ1A 4G8NA 4GXAA 3FVOA 3VVFA 1BIYA 3K6WA 3TZAA 3LSFB 1N84A 3E13X 3F11A 4O3CA 2M8CA 1B3GA 4RYAA 5AA2B 4U23A 1JW5A 3Q26A 3OD7A 4RA1A 1GVCA 2HAUA 2G29A 3RTFB 2HCAA 4PFTA 4QFLA 4XKNA 2D5WA 4O3AA 5B7DA 4HTGA 4RY1A 3S9MC 1IUDA 1LAGE 1MXXA 2I0BA 2XX8A 3OO6A 4N13A 5ELVA 2ZYMA 3I3VA 3QYTA 1GTKA 4YB7A 1LAHE 3MW0A 2DOJA 2GFEA 4LZ5A 3VXBA 1B52A 2YJPA 1CE2A 4P0IA 1B6HA 3LSWA 1UTBA 3MUQA 1MXVA 2QS1A 4MLVA 1ZLQA 3VDFA 2PT2A 2OZZA 1NKXA 3PD8A 4G68C 1IQ7A 1M5FA 2Q88A 2I49A 3KGCA 3PV0E 3EHTA 4JSOA 4POXA 1FQBA 4XIGQ 5I2KB 1JW4A 2H4IA 3IORA 1OMPA 3KN8A 4IB2A 4C1TA 2HAVA 5I58A 3EHSA 3H6TA 1Y9UA 1MQJA 4R75A 3U72A 4BDRA 4ECFA 4EF1A 3MP6A 5CBSA 4R72A 5CI5A 1MY0A 4KFQA 4JWYA 2E0SA 1FTKA 4OFOA 4U4SA 4TQUQ 2DXRA 3H4ZA 3PPPA 3UORA 4C0RA 4KR5A 2CZLA 1B4ZA 4TOZA 4P0GA 4E0WA 4OESA 3G3JA 1PB8A 1RYXA 3E3KA 3TYHA 3C36A 2XXHA 4MF3A 2V93A 5FHNA 3T9HB 1MXYA 1XVYA 4R9FA 2VGQA 5AE4A 4H6DA 1UQWA 1PBQA 3G3GA 3HPIA 1N04A 1Q35A 3HO7A 3IB2A 4YKKA 4ZEBA 4FAJA 3I6VA 2VD3A 4DXCA 3FJ7A 2RCAA 2F6GA 1Z7ME 1SW2A 3PPQA 3RNNA 1BTJA 4G8HA 3IOTA 3OO7A 4ZS9A 4XKQA 3T9XB 1MXWA 4EQ9A 5I59A 4KYDA 1SW1A 2V3UA 3S9LC 2RC9A 2DS9A 2HXWA 5L9MA 4YMBA 3TTKA 4OMBA 3V5AA 1JEUA 3CSGA 4IO3A 3UK4A 1I6QA 4R73A 4BLAA 4NF4A 3L6HA 2I4CA 4NTLA 1FQAA 1MY4A 3JZJA 1OQGA 1DTGA 4PQJA 3KN3A 4OZ9A 5DT6A 4ZE9A 4PFUA 3T9UA 4EDPA 1QVSA 2HFBA 2B65A 4JXIA 1S9TA 5ITPA 2Q8JA 4FEDA 4I9DA 1FTLA 3IO6A 3TTMA 4RNSA 2HZLA 3TTRA 4ELPA 5I57B 4PE5B 1POTA 2F35A 4IO5A 1M5CA 3FZVA 4N6PA 1B3HA 2UVJA 2AL4A 3TTLA 1DPPA 5CRYA 2DWHA 2ONRA 4Q0CA 3PU5A 3ILTB 3QAXA 4X1DA 4ZEFA 4ZEIA 3CG3A 1AIVA 5KZTA 1P1QA 3PD9A 2V3QA 4F3PA 5I2NB 3VVDA 3MPKA 1O64A 1R6ZA 3OOAA 3HN0A 4RXLA 1ZBMA 4F1UA 1T0KA 5EYFA 1B3EA 3FXUA 2UXAA 4ISUA 4EQBA 1D3KA 1IIWA 1LGBC 4OERA 4NF5A 2P1SA 4OFLA 2UYFA 2UYEA 1SW5A 2DYXA 3RGYA 4DIGA 1BKAA 1MRPA 1P99A 3FVKA 1ELJA 3KN7A 3TCGA 4G8MA 3DP6A 4JSDA 4H0WA 1VFEA 2REGA 3OXNA 4ZZAA 4DZ1A 2F7CA 1LAFE 2R71A 1XOCA 5JK4A 3QXMA 3IO4A 1FQDA 2O68A 1Y4CA 4OXVA 1URDA 1NL5A 3DP8A 4DE8A 1LCTA 1FTJA 4R6KA 4KHZE 3O66A 4P11A 3RY3A 4R2FA 5BUUA 4HS7A 2XXPA 5HBCA 3RUMA 5CMCA 3IAZA 3MP8A 3VLWA 3CI8A 1SW4A 3KJTA 3TMGA 4QFNA 3PPOA 3GZGA 3PMXA 1SYIA 3G3IA 1B9JA 1N3WA 2OWSA 3S4UA 5AA2A 2HQ0A 2H9BA 3LC8A 4QFPA 2O1LA 3SDFA 4ZDMA 4ELRA 4QRZA 4GD5A 1DSNA 2F36A 3FXRA 3MVXA 1AL3A 3WAFA 3R6UA 4GL8A 4QSEA 4QHQA 4U2RA 1ZJLA 5DEXB 4HW8A 2BJJX 1H76A 3K1NA 4QF9A 3O28A 1EU8A 3OELA 4OETA 4F19A 4ZEDA 5IKBA 2DWJA 3FVNA 3HCQA 2QS4A 3K02A 5DEXA 4C1UA 3KSXA 2GH9A 3HHFA 4OYVA 1MDP1 2F6PA 1ATGA 5H8QA 1QULA 1SQYA 1IXHA 4G4PA 3T22A 4LA9A 3KFMA 5H8FB 5I56B 1VFDA 1EZ9A 2B3BA 2RKMA 5ITOA 2XXQA 5ICQA 4GF8A 4E0XA 2RINA 3OO8A 4KD5A 2H99A 1KWHA 3VE1B 4GLIA 3AXFA 1IXGA 2H5YA 2XXUA 3H3GA 4NF8B 4MLQA 3W15C 4F3BA 1EH3A 3KZGA 1XT8A 4ELOA 4U1OA 2REJA 2AL5A 2YPNA 1OLAA 3Q27A 3VLUA 5DVIA 1NNKA 3B7DA 1Y3NA 3UN6A 2FNCA 4LQ5A 1LBBA 3QUFA 1JNFA 2DE2A 2Z8DA 4F18A 5BWJA 1QKAA 1SD3A 3CFZA 3SKPA 4Q30B 4DDDA 3I5OA 4F3SA 2QL3A 1UTBB 4JDFA 3TDJA 5B70A 1A40A 2I3VA 3M3LA 1JVXA 3IOUA 3RLFE 4YB6A 5EHMA 1MS7A 3K6XA 1B32A 1Y3PA 3N6TA 3V83A 3JV9A 1L5TA 4JB7A 3L6GA 4DCXA 2F97A 1SVXB 1A7LA 1B7UA 2RCBA 3SEVA 4R2BA 5EHSA 1URSA 2H25A 2DP8A 1AOVA 1B51A 1SI1A 1XC1A 3FJGA 3N26A 1ZMGA 4L17A 3GBAA 4BDQA 3UIFA 5I84A 1M5EA 3EQ1A 5TPAA 1A99A 1MH3A 1FQCA 4FE8A 3JYRA 2IEEA 4Q5TA 1OVBA 2R9JA 2Q9TA 5KCJB 2LAOA 3BBRA 1UIVA 4TLMB 4YB5A 1PDAA 4GWOA 4IGRA 4PETA 4ZE8A 3T9VA 1MXZA 3E9XA 3FVGA 1SBPA 1S50A 1VE4A 4RJZA 3B6TA 3QK6A 3TELA 3MZ9A 2Z8EA 3TCHA 1TT1A 1OLCA 2XX7A 3TAJA 2FYIA 3U92A 1B46A 1B5JA 1FQFA 5J1DA 4OFJA 4WXJA 1XHYA 1MH4A 4OHNA 4YKIA 3FGSA 4HCYA 1YPNA 5CMBA 3MWBA 2ZYKA 1GV8A 2D21A 4LQ2A 4H8JA 4LP2B 2QS3A 3MVWA 1NH7A 5HM4B 1DTZA 3GBBA 1US4A 2NWJA 1PBPA 1Y3QA 2O6AA 4PFWA 3ZKKA 2V3TA 4JBZA 3LBSA 2ONSA 3A09A 2AIXA 3C32A 4OEVA 1NNFA 4RPNA 3O2AA 2XXYA 3CR9A 3PUYE 4LVQA 5FHMA 3TPAA 1Y1MA 1ZTYA 1B2HA 3EN3A 2CMOA 2Y7WA 1HSLA 3FV2A 4K3FA 3DP4A 4GIZA 4GRKA 4OENA 2R6GE 4XKPA 2FA7A 3O6IA 4H67A 5KDTB 4OVJA 2XXWA 1JVYA 1NH8A 1LB9A 1HSJA 1TWYA 4QSDA 3U94A 1FW0A 2XXTA 4LATA 2A5SA 1Y1ZA 4DCYA 1B7HA 3DELB 3FJMA 1H3DA 3PMVA 4THIA 4X9TA 4BDOA 2I3WA 1A8FA 5CM6A 3Q29A 3A3UA 3CVGA 3HSTA 1UTHB 3O9PA 3VXCA 1B1HA 4ONYA 4PFYA 4WKMA 2UVHA 1O7TA 2O69A 2HZKA 3ZSFA 2PT1A 1B5HA 1DMBA 2NXOA 4NF8A 1B3LA 3LR1A 2B3FA 2X26A 4BDNA 3K4UA 3BKIB 2WKYA 3MZBA 3C34A 1JW1A 4EUOA 2UVIA 3C33A 4KCCA 3T66A 1PB9A 4FECA 2IA4A 3PUXE 3SEUA 3ZKLA 3FUZA 3MBPA 4IO7A 5JEIA 1B4HA 2DWAA 1AMFA 5H8QB 1O63A 2GHAA 3OO9A 3N5LA 4XXUA 5L9OA 3HV1A 1YCJA 4U21A 1IITA 3H03A 3GXAA 3H6UA 4NWDA 4RK2A 4Z0IA 2OWTA 3RT8A 2DE4A 2ESNA 4U4XA 4AQ4A 1B1XA 1A8EA 1JEVA 4BDLA 4EQ7A 3MC2A 2ZYOA 3HHGA 4KYEA 2Z22A 1RKMA 4PP0A 4U1ZA 3KG2A 3ONMA 1JQFA 3K6VA 3OEKA 2OLBA 3QIMA 4NF6A 3SETA 4NF4B 5FTHA 2P2AA 1ZIUA 1JETA 4NF6B 1MPCA 4RK9A 1R9LA 1B7ZA 4ZEKA 1H45A 2ZXTA 2ZNSA 1Y20A 1Q1KA 5K2YA 4ESWA 5IAIA 5I59B 2A5TA 1MQGA 3KJ7A 4H65A 4YKJA 1OIBA 2VP1A 1UTHA 5CC2A 1FQEA 2XXVA 2O1MA 1OVTA 3Q25A 3K1MA 5H8HA 5M2VA 2Q89A 3K2DA 1EZPA 3D4GA 4EXKA 1B40A 1VR5A 3CFLA 4UACA 3W9WA 1WVJA 3DLNA 3FD3A 1QUKA 2ABHA 1P1UA 3OMBA 1GGGA 2O7UA 3UA8A 3V89B 3RTWB 4EXLA 3IJXB 2RC8A 3ILUB 5H8SA 2F34A 3O6HA 4G68B 4EF2A 3K1PA 4ZZEA 5JTYA 1MXUA 1MPDA 1ANFA 2NUVA 4Z7EA 4QFKA 2O7IA 5DVFA 3U1OA 3FATA 1WODA 1SI0A 1LB8A 1S7YA 2PYYA 4AB5A 5AA2D 1IEJA 2O51A 3K01A 3IOWA 1QKBA 3KOSA 1H43A 3OENA 4GVOA 1OQHA 3O29A 3SERA 3CG1A 4DLDA 5TP9A 2GHBA 2Z8FA 5DYHA 2ZNUA 4R74A 5FHOA 1ZKBA 1FTMA 5I2NA 1LFIA 4DXBA 1BLFA 4H8IA 5L9SA 3N6UA 3EPEA 4ND9A 3R7XA 3PMWA 4I1DA 1USYE 4F1VA 2W7YA 4H5FA 1USYH 2XD3A 4F3GA 4IO2A 1MY2A 2QJEA 2X7PA 1FTOA 1NNPA 2X7QA 1A54A 1US5A 3M3FA 4OWDA 3USDA 2F8DA 4YICA 1LSTA 4F2OA 2Y7PA 3G3HA 4BDMA 1NFTA 2VHAA 3K00A 2XXIA 1D4NA 1MQIA 1N3XA 3CIJA 3MPLA 3MVYA 4G68A 3RT6B 5KCJA 1LAXA 2XXRA 1CB6A 3RN8A 3U8QA 5A5XB 2I58A 5DTBA 3BFUA 3CSBA 3T96B 3EHUA 2XHDA 2PBWA 2ZYNA 4DXUA 3G7WA 1DPEA 1GR2A 4YKPA 1D9YA 1QUIA 3IR1A 4OEUA 4U22A 2Y7IA 5ISUA 3N94A 2Q2CA 3PUWE 1I69A 4O3BA 2F7AA 3TCFA 3ECRA 5I58B 4MH5A 5H8NA 4MFIA 5LOMA 4YU0A 3A3CA 4NF5B 3PUVE 3Q28A 1SYHA 3PGFA 2H98A 4OTEA 1M5BA 2AYSA 3R26A 4IY6A 4QSCA 2RC7A 1A55A 1B05A 1M5DA 4MBPA 4Q8RA 5H8NB 3KBRA 2QRYA 5CMMA 3OEMA 1XS5A 3UP9A 4M4GA 2I6EA 3IB0A 4GL0A 2RF1A 4LONB 2PVUA 2UVGA 5AA1A 3W9VA 1LBCA 3TQLA 3SEWA 1LLSA 3B6WA 1B5IA 1NNTA 4POWA 3UGWA 3IX1A 3E4RA 2VD2A 1B3FA 1MM6A 3H7MA 3K6UA 3O6GA 1IXIA 3H6WA 2V25A 1PC3A 1QW0A 3BFTA 5KDTA 3TEPA 4FJPA 3THIA 4UA8A 2QSXA 2OBGA 3GLBA 2PMSA 1ZU0A 4FIMA 4GOTA 3VV5A 1P1OA 1B0HA 5CBRA 4NWCA 2GRVA 1MDQA 4IO4A 5I2KA 4XTCQ 2Q2AA 1QUJA 5FTIA 4I62A 3FIRA 2VOZA 1Y4TA 3LUYA 3TKDA 5ICTA 1IZ1A 1FCKA 2Y7KA 2QMWA 2D3IA 5TP9B 3K0VA 4YAHX 4KPTA 1VSOA 1MQHA 4KYSA 3SEXA 2THIA 4NE4A 3C4MA 1IXCA 4X48A 1I6BA 2HEUA 3QUJA 3TTNA 4F2QA 3VFJA 4FEBA 3IL1B 2ONKE 2NVUB 3V8XB 4RPOA 2O84X 1YAEA 4GFRA 3RPWA 3RQTA 1YTVA 1F9BA 5JTYB 4F31B 1MY3A 2I4BA 4ELQA 1URGA 2DSFA 3KOTA 1QJMA
chains in the Genus database with same CATH superfamily
2DXYA 1MG1A 3PUZE 4OVTA 4YZZA 1H44A 4OQOA 3G3FA 3SESA 3T93B 3H6VA 2WEFA 4H5GA 4I40A 4ZECA 3H06B 4O8MA 3SEYA 1BP5A 3PPRA 4R6YA 3OSQA 4WEDA 2ZZXA 5K2XA 5L8DA 2F5XA 2DVCA 3TODA 3S2VA 4LUBA 1R9QA 2DWIA 3ODBA 4PF6A 4AB6A 3FV1A 1LBVA 5I56A 2OJTA 1MY1A 4IO6A 1PEBA 1LFHA 4F22A 1FBPA 3CRBA 1I6AA 3MJNA 1MPBA 4R6HA 1LCFA 3MZ1A 2ZNTA 1BIYA 3LSFB 5I3SA 2M8CA 4MIJA 4RYAA 1BK4A 2HCAA 4PFTA 3S9MC 2XX8A 5ELVA 2ZYMA 2DOJA 4LZ5A 1B52A 3BIHA 1CE2A 5ET8A 1UTBA 4MLVA 4NGUA 4G68C 5F24A 1IQ7A 2I49A 3EHTA 4POXA 1FQBA 5I58A 3IORA 3KN8A 4IB2A 3EHSA 1Y9UA 5IGAA 4R72A 1MY0A 4KFQA 4JWYA 1FBEA 4N8YA 4U4SA 2DXRA 3PPPA 2PFZA 3C36A 2V93A 1MXYA 3IB2A 4ZEBA 3RNNA 4N17A 1BTJA 2FBPA 4G8HA 1RDYA 4XKQA 4KYDA 1SW1A 2V3UA 2RC9A 5L9MA 3TTKA 3UK4A 1I6QA 2DDKA 2I4CA 1OQGA 2Q8JA 1FTLA 3TTMA 4RNSA 1NV2A 2HZLA 4ELPA 1POTA 1DPPA 2ONRA 3ILTB 3QAXA 4X1DA 2V3QA 1B3EA 4ISUA 2UXAA 1LGBC 4NF5A 5LDZA 2QFLA 5IZZA 2DYXA 4DIGA 1VFEA 4ZZAA 1FPIA 3IO4A 1FQDA 2O68A 1NL5A 4DE8A 3RY3A 4HS7A 5HBCA 3VLWA 4Q8RA 3TMGA 4QFNA 2OWSA 2H9BA 3LC8A 2HPGA 4ZDMA 4ELRA 1DSNA 2F36A 5EQ8A 4QSEA 2BJJX 3OELA 3HCQA 3KSXA 5H8QA 5H8FB 1VFDA 5ITOA 4GF8A 2RINA 3OO8A 3H3GA 4F3BA 4U1OA 2REJA 3Q27A 3VLUA 4LQ5A 1JNFA 4MCOA 3CFZA 4DDDA 3I5OA 1UTBB 4JDFA 1A40A 2I3VA 3V83A 3L6GA 1IMBA 1A7LA 2VPNA 3FJGA 4L17A 4BDQA 1ZMGA 1NV1A 3HFUA 5A5LA 3BBRA 4YB5A 1PDAA 4GX3A 3E9XA 1VE4A 4P1EA 4MX6A 2FYIA 5J1DA 3FGSA 4HCYA 4XEQA 4NAPA 2ZYKA 4PBHA 3GBBA 1US4A 3D1RA 2AIXA 4RPNA 1NNFA 1LEVA 1Y1MA 1ZTYA 3EN3A 2CMOA 4GRKA 3O6IA 4H67A 4OVRA 4QSDA 1FW0A 3FJMA 4GBWA 1A8FA 3Q29A 4PCDA 3A3UA 3CVGA 3VXCA 2XWVA 4GX6A 2NXOA 4BDNA 3C33A 4KCCA 3SEUA 3PUXE 1B4HA 3OO9A 4XXUA 3HV1A 1IITA 3H6UA 2DE4A 4EQ7A 1B1XA 1A8EA 4PP0A 1JQFA 3OEKA 2CEYA 1NUXA 1ZIUA 4NF6B 1B7ZA 1Y20A 1Q1KA 5K2YA 4ESWA 3KJ7A 4H65A 3Q25A 5M2VA 2XXVA 5H8HA 1IMAA 2Q89A 4PTKA 3DLNA 2ABHA 2Y5LA 3UA8A 3V89B 4EXLA 3IJXB 4EF2A 4ZZEA 2NUVA 4Z7EA 2O7IA 3FATA 4AB5A 4N81A 4PGNA 3KOSA 1QKBA 3SERA 1H43A 4GVOA 1NV4A 4NQ8A 5TP9A 5FHOA 5DYHA 5I2NA 1BLFA 3R7XA 4I1DA 2WX9A 4H5FA 2QVVA 4F3GA 4PE3A 3USDA 4YICA 4F2OA 3G3HA 4BDMA 2VHAA 3MPLA 1INPA 1LAXA 2I58A 3EHUA 1FJ6A 1GR2A 2Q8MA 3PUWE 2Q2CA 2F7AA 5H8NA 5LOMA 5ISUA 1B05A 3KBRA 3UP9A 2I6EA 2RF1A 3SEWA 1B5IA 3IX1A 3K6UA 4FJPA 4N15A 4UA8A 3GLBA 1B0HA 5CBRA 4NWCA 5FTIA 4DI4B 3FIRA 1IZ1A 2Y7KA 1MQHA 4MMPA 4F2QA 3V8XB 2ONKE 3LUZA 3RQTA 1F9BA 4F31B 5EYGA 2DSFA 3KOTA 3RPLA 4DI3D 5AA4A 4FORA 4HCWA 3ZS6A 3IOVA 3FASA 1HSEA 2L5VA 3IJOB 2Y7RA 3IFAA 2KLFA 3U65A 2ZZVA 2ALUA 4G77A 3G3KA 2QS2A 5EQ9A 2I48A 4KQPA 4MNIA 1MQDA 1N0TA 4HE1A 2KQZA 4H46A 3S9NC 2WBDA 4GQOA 4GXSB 4WEPA 3M3KA 1POY1 3B8BA 4F39A 2Z23A 3QSLA 4I8CA 4G2ZA 5EYHA 2E1SA 5H8FA 2XWKA 2ZMBA 1IMDA 1MM7A 3KEIA 4LZ8A 2G93A 1TFAA 4LZ7A 1B58A 4QFOA 1RYOA 1J1NA 3B50A 1Z7NE 1II5A 1DOTA 2I0CA 4BDOA 1T0KA 1N84A 3F11A 4QXDA 2VT5A 1B3GA 5AA2B 4U23A 3Q26A 4RA1A 4GWWA 3RTFB 5I7IA 2D5WA 4RY1A 3OO6A 4PFBA 3I3VA 3QYTA 1GTKA 4YB7A 1LAHE 2YJPA 4P0IA 3LSWA 2QS1A 3RPLB 3VDFA 2OZZA 3PD8A 2Q88A 3PV0E 4XIGQ 4JSOA 2H4IA 2HAVA 4BDRA 1IMEA 1MQJA 3MP6A 1CNQA 1FTKA 3UORA 4OESA 2XXHA 4MF3A 4R9FA 1FJ9A 3HPIA 3I6VA 2VD3A 3FJ7A 1EYIA 2RCAA 3PPQA 2WBBA 3OO7A 5I59A 4EQ9A 3V5AA 4BLAA 3L6HA 1XI6A 1MY4A 4PQJA 1DTGA 5DT6A 4ZE9A 4PFUA 3T9UA 2B65A 4JXIA 1S9TA 1FPJA 4FEDA 4I9DA 3IO6A 3TTRA 4PE5B 4IO5A 2F35A 3FZVA 5CRYA 2DWHA 4Q0CA 1SPIA 4ZEFA 1O64A 1R6ZA 3HN0A 4EQBA 1D3KA 1IIWA 1SW5A 1P99A 3FVKA 3DP6A 2REGA 3OXNA 4DZ1A 5ET6A 2R71A 1XOCA 3DP8A 4R6KA 2XWOA 3O66A 4P11A 3IAZA 1B9JA 5AA2A 5LTCA 2O1LA 4GD5A 3R6UA 4GL8A 3BIGA 4QHQA 4HW8A 1H76A 3K1NA 4QF9A 3O28A 5IKBA 4P8BA 2DWJA 4C1UA 4OVPA 2GH9A 4LA9A 5I56B 4KD5A 4HXVA 3VE1B 5ET7A 1IXGA 2H5YA 3W15C 2YPNA 1OLAA 3B7DA 3UN6A 2FNCA 4OVQA 1IMFA 2DE2A 5ET5A 3SKPA 3MYUA 4YB6A 1B32A 1Y3PA 3JV9A 1L5TA 1G0IA 2RCBA 3SEVA 4R2BA 2H25A 1SI1A 3GBAA 5I84A 1M5EA 1A99A 3JYRA 4Q5TA 5KCJB 2FHYA 4ZE8A 4PETA 1FPKA 3FVGA 1SBPA 4OANA 4RJZA 3B6TA 3QK6A 2Z8EA 3TCHA 1TT1A 3TAJA 2B4LA 1B46A 4OFJA 4P1LA 1MH4A 4N91A 5CMBA 2D21A 4LQ2A 4LP2B 3MVWA 1DTZA 4PAIA 1Y3QA 4JBZA 3LBSA 3C32A 3A09A 3PUYE 3CR9A 4LVQA 1B2HA 4K3FA 3FV2A 3DP4A 2R6GE 4OVJA 1TWYA 1Y1ZA 3PMVA 3HSTA 3O9PA 1UTHB 4WKMA 3ZSFA 4PGPA 4PF8A 3LR1A 4PDHA 2B3FA 3K4UA 3BKIB 3MZBA 3C34A 3KC0A 2OX3A 2UVIA 2IA4A 5IM2A 3ZKLA 4IO7A 1AMFA 3N5LA 4Z0IA 3H03A 3GXAA 4NWDA 2OWTA 3MC2A 4KYEA 4P47A 3T1BA 3K6VA 1FPBA 1FBFA 4ZEKA 1R9LA 2ZXTA 4N6DA 4YKJA 1UTHA 3IFCA 3K1MA 1EZPA 3D4GA 1NV7A 1WVJA 3FD3A 1P1UA 2O7UA 4GWZA 4HE0A 3RTWB 2RC8A 2F34A 3O6HA 4G68B 3K1PA 3LV0A 1S7YA 4JVCA 2PYYA 3K01A 2O51A 3IOWA 3O29A 3CG1A 2GHBA 2Z8FA 2WYPA 1LFIA 4DXBA 3N6UA 3EPEA 4ND9A 1USYE 2W7YA 2XD3A 1FTOA 1NNPA 2X7QA 1US5A 3M3FA 4OWDA 2XXIA 1D4NA 5KCJA 3RYDA 2XXRA 3BFUA 4IR8A 3T96B 2XHDA 2PBWA 2HHMA 4YKPA 1QUIA 4HE2A 3N94A 4O3BA 3ECRA 4MFIA 4YU0A 4NF5B 3PGFA 1M5BA 2AYSA 1M5DA 5CMMA 3OEMA 4ELOA 2F3BA 3W9VA 4POWA 3UGWA 3H7MA 1MM6A 3H6WA 4GOTA 4FIMA 1YZ0A 3FBPA 4XTCQ 3ROJA 2Q2AA 3A29A 2QMWA 5TP9B 4YAHX 4KYSA 2THIA 2CZKA 2HEUA 3VFJA 1YAEA 1FTAA 1YTVA 1LBWA 1URGA 4GX4A 1QJMA 4GBVA 5TPAB 1FBGA 2YLNA 3WAEA 5H8HB 5I57A 2QMXA 1N7WA 2ZZWA 3LSLA 2NOOA 2DQVA 1K9ZA 4TLLB 3C35A 1YXIA 3DM0A 2OK2A 3TFLA 3M8UA 4ESXA 3D4CA 4NEDA 4N07A 2DE3A 4FATA 5TU0A 4F29A 3TQWA 5AA4B 1LFGA 1D9VA 4H1XA 4X1BA 1PB7A 2F78A 3P7IA 2A5TB 3U93A 3B6QA 4N6KA 4YMAA 2XD2A 2XXXA 4KI0E 4KXPA 1EZOA 2GQ1A 3LSXA 2R8TA 4JWXA 5CMKA 1TFDA 5F7VA 3O97A 4X9TA 4KCDA 4G8NA 3CFXA 3VVFA 1JW5A 3OD7A 2G29A 4HTGA 1IUDA 1LAGE 2I0BA 4N13A 3E78A 2MKZA 4PFRA 1B6HA 1MXVA 1ZLQA 2PT2A 1M5FA 4C1TA 1OMPA 3H6TA 4R75A 5CI5A 2E0SA 4OFOA 3H4ZA 1B4ZA 4E0WA 1PB8A 1RYXA 3E3KA 3T9HB 1XVYA 2VGQA 4H6DA 1FPEA 3G3GA 4YKKA 4FAJA 4DXCA 2F6GA 1SW2A 4NHBA 1MXWA 3S9LC 1FPGA 2DS9A 2HXWA 4P9KA 4YMBA 4OMBA 1JEUA 3CSGA 4R73A 2WYKA 4NF4A 4NTLA 1FQAA 4OZ9A 4EDPA 2HFBA 5ITPA 5EQAA 4JVIA 5I57B 4N6PA 1M5CA 2AL4A 1NUZA 3PU5A 1EYJA 4ZEIA 1AIVA 3PD9A 4F3PA 5I2NB 4RXLA 1ZBMA 3FXUA 4OERA 5IZ3B 2P1SA 4OFLA 2UYEA 3RGYA 3KN7A 4G8MA 4JSDA 1LAFE 2OWZA 5JK4A 1URDA 1FTJA 4KHZE 3RUMA 3KJTA 4MJOA 1SYIA 3S4UA 2FIEA 2HQ0A 4QRZA 1FRPA 2F3DA 4U2RA 1ZJLA 4F19A 4OETA 1EU8A 4ZEDA 5DEXA 2QS4A 2F6PA 1ATGA 1SQYA 4G4PA 3T22A 1EZ9A 2XXQA 4E0XA 4MAGA 1KWHA 1EH3A 1NUWA 2AL5A 5DVIA 3QUFA 2Z8DA 4PDDA 1QKAA 1SD3A 4FBPA 4Q30B 3TDJA 3M3LA 1JVXA 5EHMA 1LBZA 1MS7A 4AS5A 4JB7A 4DCXA 1SVXB 3GYYA 5EHSA 1AOVA 1XC1A 3SZPA 3EQ1A 1MH3A 1FQCA 4FE8A 2IEEA 2R9JA 2LAOA 4TLMB 3T9VA 4GWOA 5EQ7A 3TELA 3MZ9A 2XX7A 1B5JA 1FQFA 1XHYA 4OHNA 1NV6A 4H8JA 2NWJA 2O6AA 4PFWA 2V3TA 1FBHA 2ONSA 4OEVA 2XXYA 1NV0A 4OENA 4XKPA 3KBZA 2FA7A 2XXWA 1LB9A 1KA0A 2QVRA 3U94A 2XXTA 4LATA 4DCYA 1B7HA 1H3DA 1Q9DA 4THIA 2I3WA 5CM6A 1B1HA 4ONYA 2VPOA 2UVHA 1O7TA 2O69A 2HZKA 4LN5A 1B5HA 2WKYA 1JW1A 2FVZA 4O7MA 4FECA 3FUZA 2DWAA 5H8QB 2GHAA 5L9OA 1YCJA 4RK2A 4NX1A 2ESNA 4U4XA 1JEVA 4N8GA 2ZYOA 4NG7A 2Z22A 1RKMA 2OLBA 3QIMA 4NF6A 1YYZA 3SETA 4NF4B 2P2AA 1JETA 4RK9A 1FPLA 1H45A 3MSTA 1OIBA 2VP1A 3EKIA 2O1MA 4JVDA 4EXKA 1B40A 3W9WA 3CFLA 1QUKA 3OMBA 1GGGA 4GWXA 3ILUB 5H8SA 5JTYA 1ANFA 4QFKA 5DVFA 3U1OA 1SI0A 1LB8A 5AA2D 3OENA 1RDXA 2ZNUA 4R74A 1ZKBA 4QBAA 4OVSA 5L9SA 4H8IA 4O7IA 1USYH 1MY2A 2X7PA 1A54A 5DW8A 2F8DA 1LSTA 4MLQA 4KR5A 1MQIA 3CIJA 3MVYA 4G68A 3RN8A 3U8QA 5A5XB 5FBPA 5DTBA 3CSBA 4DXUA 1DPEA 1D9YA 3IR1A 4U22A 3TCFA 1I69A 2XXKA 5I58B 4MH5A 3A3CA 4OTEA 3PUVE 3Q28A 1SYHA 4F1VA 4QSCA 4P3LA 3R26A 4IY6A 2RC7A 5H8NB 4MBPA 5AA1A 4M4GA 3IB0A 4GL0A 4LONB 1LBCA 3TQLA 2V4CA 3B6WA 2VD2A 4MNCA 1B3FA 3O6GA 2V25A 1PC3A 1QW0A 3BFTA 5KDTA 3THIA 2QSXA 2BJIA 1ZU0A 2GRVA 2CZHA 4IO4A 1NI9A 2XA5A 4I62A 3TKDA 4NF0A 5T3JA 3SEXA 4NE4A 1I6BA 3QUJA 1LBXA 4FEBA 2NVUB 2P3VA 1MY3A 4PAKA 3MP1A 3KSJA 5A5XA 1DCUA 4NN3A 4IGTA 4MNPA 2CEXA 5F1QA 1B0LA 3VLVA 3C31A 2Y84A 1XVXA 1N76A 3QMFA 3C9HA 2DVZA 2OCUA 4M1VA 4EUOA 2V84A 5HPQA 4XKRA 3TUSA 3VVEA 3IK6B 2P0SA 3ISPA 1P1NA 1TXFA 4JWOA 3MQ9A 4NMYA 3FXQA 1FBDA 4AS4A 1R1NA 3NOHA 1SDXA 1AH5A 1NV5A 1NMUA 5AA3A 1N7XA 4IY5A 1KA1A 1WDNA 4R9GA 3MVZA 3OSRA 2ANJA 2P3NA 2QPQA 5DVJA 4F1YA 3PPNA 1P1WA 1UIUA 3MAMA 2XX9A 2F7BA 3EF7A 3IB1A 4GXAA 2PX1A 3FVOA 3K6WA 3TZAA 3E13X 2Q74A 4O3CA 4MHFA 1GVCA 2HAUA 4QFLA 4XKNA 4O3AA 5B7DA 1MXXA 3MW0A 2GFEA 3VXBA 3MUQA 1FBCA 1NKXA 5IZ3A 3KGCA 5I2KB 1JW4A 3U72A 4ECFA 4EF1A 5CBSA 4MEVA 4TQUQ 4C0RA 2CZLA 4TOZA 4P0GA 3G3JA 2Y5KA 3TYHA 5FHNA 5AE4A 1UQWA 1PBQA 1RDZA 1N04A 1Q35A 3HO7A 1LBYA 1Z7ME 3IOTA 3T9XB 4ZS9A 4P56A 4IO3A 3JZJA 3KN3A 2PFYA 4I3YA 1QVSA 1FSAA 1B3HA 2UVJA 2B4MA 3TTLA 4UABA 1NV3A 3CG3A 5KZTA 1P1QA 2CZIA 4X8RA 4H45A 3VVDA 3MPKA 5IZ1A 3OOAA 2PCRA 4F1UA 5EYFA 5I5PA 1FPFA 2XWIA 5ESYA 2UYFA 2QVUA 1BKAA 1EYKA 1MRPA 1ELJA 3TCGA 4H0WA 2F7CA 3QXMA 4OXVA 1Y4CA 1LCTA 5BUUA 4R2FA 2XXPA 3FXBA 5CMCA 3MP8A 3CI8A 1SW4A 3PPOA 3GZGA 3PMXA 3G3IA 1N3WA 3CHGA 4GWUA 4QFPA 3SDFA 3FXRA 3MVXA 1AL3A 3WAFA 5DEXB 3FVNA 3K02A 3HHFA 4OYVA 1MDP1 1QULA 1IXHA 3KFMA 2B3BA 5ICQA 2RKMA 1IMCA 2H99A 4GLIA 3AXFA 2XXUA 4NF8B 3KZGA 1XT8A 1NNKA 1K9YA 1Y3NA 1G0HA 1LBBA 4F18A 5BWJA 4F3SA 2QL3A 5B70A 3IOUA 3RLFE 3K6XA 3N6TA 2F97A 1B7UA 1URSA 2DP8A 1B51A 3N26A 3UIFA 5TPAA 4I3EA 1OVBA 2Q9TA 1UIVA 4IGRA 1MXZA 1S50A 2HXRA 1OLCA 4PBQA 3U92A 4PFIA 4WXJA 4YKIA 1YPNA 1JP4A 3MWBA 1GV8A 2QS3A 1NH7A 5HM4B 3S9EA 1PBPA 3ZKKA 3O2AA 5FHMA 3TPAA 2Y7WA 1HSLA 4GIZA 5KDTB 1JVYA 1NH8A 1HSJA 2A5SA 3DELB 1AWBA 4PAFA 4PFYA 2PT1A 1DMBA 4NF8A 1B3LA 2X26A 3T66A 1PB9A 3MBPA 3E79A 5JEIA 1O63A 4U21A 3RT8A 2JJKA 4AQ4A 1VDWA 4BDLA 3HHGA 4U1ZA 3KG2A 3ONMA 1D9QA 4GWYA 1KZ8A 5FTHA 1MPCA 2ZNSA 1FPDA 5IAIA 5I59B 5J16A 2A5TA 1MQGA 5CC2A 1FQEA 1OVTA 3K2DA 1VR5A 4UACA 1NUYA 2KR0A 1MXUA 1MPDA 3PTYA 1WODA 1IEJA 1OQHA 4DLDA 1QGXA 1DBZA 4GWSA 1FTMA 3PMWA 4XFEA 4IO2A 2QJEA 2Y7PA 1NFTA 3K00A 1N3XA 4PC9A 3RT6B 1CB6A 2FIXA 2ZYNA 3G7WA 4G61A 4OEUA 2Y7IA 2H98A 1A55A 2QRYA 1XS5A 1DK4A 4N4UA 2PVUA 2UVGA 3T0JA 1LLSA 1NNTA 3KC1A 3E4RA 4OA4A 1IXIA 4X04A 3TEPA 2OBGA 2PMSA 3VV5A 1P1OA 1MDQA 5I2KA 1QUJA 2VOZA 1Y4TA 3LUYA 5ICTA 1FCKA 4O94A 2D3IA 3K0VA 4KPTA 1VSOA 3C4MA 1IXCA 4X48A 3TTNA 3IL1B 4RPOA 2O84X 4GFRA 3RPWA 5JTYB 2I4BA 4ELQA 4XF5A
chains in the Genus database with same CATH topology
2DXYA 1MG1A 3PUZE 4OVTA 4YZZA 1H44A 4OQOA 3G3FA 3SESA 3T93B 3H6VA 4H5GA 2WEFA 4I40A 4ZECA 3H06B 4O8MA 3SEYA 1BP5A 3PPRA 4R6YA 3OSQA 4WEDA 2ZZXA 5K2XA 5L8DA 2F5XA 2DVCA 3TODA 3S2VA 4LUBA 1R9QA 2DWIA 3ODBA 4PF6A 4AB6A 3FV1A 1LBVA 5I56A 2OJTA 1MY1A 4IO6A 1PEBA 1LFHA 4F22A 1FBPA 3CRBA 1I6AA 3MJNA 1MPBA 4R6HA 1LCFA 3MZ1A 2ZNTA 1BIYA 3LSFB 4MIJA 2M8CA 4RYAA 5I3SA 1BK4A 2HCAA 4PFTA 3S9MC 2XX8A 5ELVA 2ZYMA 2DOJA 4LZ5A 1B52A 3BIHA 1CE2A 5ET8A 1UTBA 4MLVA 4NGUA 4G68C 1IQ7A 5F24A 2I49A 3EHTA 4POXA 1FQBA 5I58A 3IORA 3KN8A 4IB2A 3EHSA 1Y9UA 5IGAA 4R72A 1MY0A 4KFQA 4JWYA 1FBEA 4N8YA 4U4SA 2DXRA 3PPPA 2PFZA 3C36A 2V93A 1MXYA 3IB2A 4ZEBA 3RNNA 4N17A 1BTJA 2FBPA 4G8HA 1RDYA 4XKQA 4KYDA 1SW1A 2V3UA 2RC9A 5L9MA 3TTKA 3UK4A 1I6QA 2I4CA 2DDKA 1OQGA 2Q8JA 1FTLA 3TTMA 4RNSA 1NV2A 2HZLA 4ELPA 1POTA 1DPPA 2ONRA 3ILTB 3QAXA 4X1DA 2V3QA 1B3EA 4ISUA 2UXAA 1LGBC 4NF5A 5LDZA 2QFLA 5IZZA 2DYXA 4DIGA 1VFEA 4ZZAA 1FPIA 3IO4A 1FQDA 2O68A 1NL5A 4DE8A 3RY3A 4HS7A 5HBCA 3VLWA 4Q8RA 3TMGA 4QFNA 2OWSA 2H9BA 3LC8A 2HPGA 4ZDMA 4ELRA 1DSNA 2F36A 5EQ8A 4QSEA 2BJJX 3OELA 3HCQA 3KSXA 5H8QA 5H8FB 1VFDA 5ITOA 4GF8A 2RINA 3OO8A 3H3GA 4F3BA 4U1OA 2REJA 3Q27A 3VLUA 4LQ5A 1JNFA 4MCOA 3CFZA 4DDDA 3I5OA 1UTBB 4JDFA 1A40A 2I3VA 3V83A 3L6GA 1IMBA 1A7LA 2VPNA 3FJGA 4L17A 4BDQA 1ZMGA 1NV1A 3HFUA 5A5LA 3BBRA 4YB5A 1PDAA 4GX3A 3E9XA 1VE4A 4P1EA 4MX6A 2FYIA 5J1DA 3FGSA 4HCYA 4XEQA 4NAPA 2ZYKA 4PBHA 3GBBA 1US4A 3D1RA 2AIXA 4RPNA 1NNFA 1LEVA 1Y1MA 1ZTYA 3EN3A 2CMOA 4GRKA 3O6IA 4H67A 4OVRA 4QSDA 1FW0A 3FJMA 4GBWA 1A8FA 3Q29A 4PCDA 3A3UA 3CVGA 3VXCA 2XWVA 4GX6A 2NXOA 4BDNA 3C33A 4KCCA 3SEUA 3PUXE 1B4HA 3OO9A 4XXUA 3HV1A 1IITA 3H6UA 2DE4A 4EQ7A 1B1XA 1A8EA 4PP0A 1JQFA 3OEKA 2CEYA 1NUXA 1ZIUA 4NF6B 1B7ZA 1Y20A 1Q1KA 5K2YA 4ESWA 3KJ7A 4H65A 3Q25A 2XXVA 5M2VA 5H8HA 1IMAA 2Q89A 4PTKA 3DLNA 2ABHA 2Y5LA 3UA8A 3V89B 4EXLA 3IJXB 4EF2A 4ZZEA 2NUVA 4Z7EA 2O7IA 3FATA 4AB5A 4N81A 4PGNA 3KOSA 1QKBA 3SERA 1H43A 4GVOA 1NV4A 4NQ8A 5TP9A 5FHOA 5DYHA 5I2NA 1BLFA 3R7XA 4I1DA 2WX9A 4H5FA 2QVVA 4F3GA 4PE3A 3USDA 4YICA 4F2OA 3G3HA 4BDMA 2VHAA 3MPLA 1INPA 1LAXA 2I58A 3EHUA 1FJ6A 1GR2A 2Q8MA 3PUWE 2Q2CA 2F7AA 5H8NA 5LOMA 5ISUA 1B05A 3KBRA 3UP9A 2I6EA 2RF1A 3SEWA 1B5IA 3IX1A 3K6UA 4FJPA 4UA8A 4N15A 3GLBA 1B0HA 5CBRA 4NWCA 5FTIA 4DI4B 3FIRA 1IZ1A 2Y7KA 1MQHA 4MMPA 4F2QA 3V8XB 2ONKE 3LUZA 3RQTA 1F9BA 4F31B 5EYGA 2DSFA 3KOTA 3RPLA 4DI3D 5AA4A 4FORA 4HCWA 3ZS6A 3IOVA 3FASA 1HSEA 2L5VA 3IJOB 2Y7RA 3IFAA 2KLFA 3U65A 2ZZVA 2ALUA 4G77A 3G3KA 2QS2A 5EQ9A 2I48A 4KQPA 4MNIA 1MQDA 1N0TA 4HE1A 2KQZA 4H46A 3S9NC 2WBDA 4GQOA 4GXSB 4WEPA 3M3KA 1POY1 3B8BA 4F39A 2Z23A 3QSLA 4I8CA 4G2ZA 5EYHA 2E1SA 5H8FA 2XWKA 2ZMBA 1IMDA 1MM7A 3KEIA 4LZ8A 2G93A 1TFAA 4LZ7A 1B58A 4QFOA 1RYOA 1J1NA 3B50A 1Z7NE 1II5A 1DOTA 2I0CA 4BDOA 1T0KA 1N84A 3F11A 4QXDA 2VT5A 1B3GA 5AA2B 4U23A 3Q26A 4RA1A 3RTFB 4GWWA 5I7IA 2D5WA 4RY1A 3OO6A 4PFBA 3I3VA 3QYTA 1GTKA 4YB7A 1LAHE 2YJPA 4P0IA 3LSWA 2QS1A 3RPLB 3VDFA 2OZZA 3PD8A 2Q88A 3PV0E 4XIGQ 4JSOA 2H4IA 2HAVA 4BDRA 1IMEA 1MQJA 3MP6A 1CNQA 1FTKA 3UORA 4OESA 2XXHA 4MF3A 4R9FA 1FJ9A 3HPIA 3I6VA 2VD3A 3FJ7A 2RCAA 1EYIA 3PPQA 3OO7A 5I59A 2WBBA 4EQ9A 3V5AA 4BLAA 3L6HA 1XI6A 1MY4A 4PQJA 1DTGA 5DT6A 4ZE9A 4PFUA 3T9UA 2B65A 4JXIA 1S9TA 4FEDA 4I9DA 1FPJA 3IO6A 3TTRA 4PE5B 4IO5A 2F35A 3FZVA 5CRYA 2DWHA 4Q0CA 4ZEFA 1SPIA 1O64A 1R6ZA 3HN0A 4EQBA 1D3KA 1IIWA 1SW5A 1P99A 3FVKA 3DP6A 2REGA 3OXNA 4DZ1A 5ET6A 2R71A 1XOCA 3DP8A 4R6KA 2XWOA 3O66A 4P11A 3IAZA 1B9JA 5AA2A 5LTCA 2O1LA 4GD5A 3R6UA 4GL8A 3BIGA 4QHQA 4HW8A 1H76A 3K1NA 4QF9A 3O28A 5IKBA 4P8BA 2DWJA 4C1UA 4OVPA 2GH9A 4LA9A 5I56B 4KD5A 4HXVA 3VE1B 3W15C 1IXGA 2H5YA 5ET7A 2YPNA 1OLAA 3B7DA 3UN6A 2FNCA 4OVQA 1IMFA 2DE2A 5ET5A 3SKPA 3MYUA 4YB6A 1B32A 1Y3PA 3JV9A 1L5TA 1G0IA 2RCBA 3SEVA 4R2BA 2H25A 1SI1A 3GBAA 5I84A 1M5EA 1A99A 3JYRA 4Q5TA 5KCJB 2FHYA 4ZE8A 4PETA 1FPKA 3FVGA 1SBPA 4OANA 4RJZA 3B6TA 3QK6A 2Z8EA 3TCHA 1TT1A 3TAJA 2B4LA 1B46A 4OFJA 4P1LA 1MH4A 4N91A 5CMBA 2D21A 4LQ2A 4LP2B 3MVWA 1DTZA 4PAIA 1Y3QA 4JBZA 3LBSA 3C32A 3A09A 3PUYE 3CR9A 4LVQA 1B2HA 4K3FA 3FV2A 3DP4A 2R6GE 4OVJA 1TWYA 1Y1ZA 3PMVA 3HSTA 3O9PA 1UTHB 4WKMA 3ZSFA 4PGPA 4PF8A 3LR1A 4PDHA 2B3FA 3K4UA 3BKIB 3MZBA 3C34A 3KC0A 2OX3A 2UVIA 2IA4A 3ZKLA 5IM2A 4IO7A 1AMFA 3N5LA 4Z0IA 3H03A 3GXAA 4NWDA 2OWTA 3MC2A 4KYEA 4P47A 3T1BA 3K6VA 1FPBA 1FBFA 4ZEKA 1R9LA 2ZXTA 4N6DA 4YKJA 1UTHA 3IFCA 3K1MA 1EZPA 3D4GA 1WVJA 3FD3A 1NV7A 1P1UA 2O7UA 4GWZA 4HE0A 3RTWB 2RC8A 2F34A 3O6HA 4G68B 3K1PA 3LV0A 1S7YA 4JVCA 2PYYA 3K01A 2O51A 3IOWA 3O29A 3CG1A 2GHBA 2Z8FA 2WYPA 1LFIA 4DXBA 3N6UA 3EPEA 4ND9A 1USYE 2W7YA 2XD3A 1FTOA 1NNPA 2X7QA 1US5A 3M3FA 4OWDA 2XXIA 1D4NA 5KCJA 3RYDA 2XXRA 3BFUA 4IR8A 3T96B 2XHDA 2PBWA 2HHMA 4YKPA 1QUIA 4HE2A 3N94A 4O3BA 3ECRA 4MFIA 4YU0A 4NF5B 3PGFA 1M5BA 2AYSA 1M5DA 5CMMA 3OEMA 4ELOA 2F3BA 3W9VA 4POWA 3UGWA 3H7MA 1MM6A 3H6WA 4GOTA 4FIMA 1YZ0A 3FBPA 4XTCQ 3ROJA 2Q2AA 3A29A 2QMWA 5TP9B 4YAHX 4KYSA 2THIA 2CZKA 2HEUA 3VFJA 1YAEA 1FTAA 1YTVA 1LBWA 1URGA 4GX4A 1QJMA 4GBVA 5TPAB 1FBGA 2YLNA 3WAEA 5H8HB 5I57A 2QMXA 1N7WA 2ZZWA 3LSLA 2NOOA 2DQVA 1K9ZA 4TLLB 3C35A 1YXIA 3DM0A 2OK2A 3TFLA 3M8UA 4ESXA 3D4CA 4NEDA 4N07A 2DE3A 4FATA 5TU0A 4F29A 3TQWA 5AA4B 1LFGA 1D9VA 4H1XA 4X1BA 1PB7A 2F78A 3P7IA 2A5TB 3U93A 3B6QA 4YMAA 4N6KA 2XD2A 2XXXA 4KI0E 4KXPA 1EZOA 2GQ1A 3LSXA 2R8TA 4JWXA 5CMKA 1TFDA 5F7VA 3O97A 4X9TA 4KCDA 4G8NA 3CFXA 3VVFA 1JW5A 3OD7A 2G29A 4HTGA 1IUDA 1LAGE 2I0BA 4N13A 3E78A 2MKZA 4PFRA 1B6HA 1MXVA 1ZLQA 2PT2A 1M5FA 4C1TA 1OMPA 3H6TA 4R75A 5CI5A 2E0SA 4OFOA 3H4ZA 1B4ZA 4E0WA 1PB8A 1RYXA 3E3KA 3T9HB 1XVYA 2VGQA 4H6DA 3G3GA 1FPEA 4YKKA 4FAJA 4DXCA 2F6GA 1SW2A 4NHBA 1MXWA 3S9LC 1FPGA 2DS9A 2HXWA 4P9KA 4YMBA 4OMBA 1JEUA 3CSGA 4R73A 2WYKA 4NF4A 4NTLA 1FQAA 4OZ9A 4EDPA 2HFBA 5ITPA 5EQAA 4JVIA 5I57B 4N6PA 1M5CA 2AL4A 1NUZA 3PU5A 4ZEIA 1EYJA 1AIVA 3PD9A 4F3PA 5I2NB 4RXLA 1ZBMA 3FXUA 4OERA 5IZ3B 2P1SA 4OFLA 2UYEA 3RGYA 3KN7A 4G8MA 4JSDA 1LAFE 2OWZA 5JK4A 1URDA 1FTJA 4KHZE 3RUMA 3KJTA 4MJOA 1SYIA 3S4UA 2FIEA 2HQ0A 4QRZA 1FRPA 2F3DA 4U2RA 1ZJLA 4F19A 4OETA 1EU8A 4ZEDA 5DEXA 2QS4A 2F6PA 1ATGA 1SQYA 4G4PA 3T22A 1EZ9A 2XXQA 4E0XA 4MAGA 1KWHA 1EH3A 1NUWA 2AL5A 5DVIA 3QUFA 2Z8DA 4PDDA 1QKAA 1SD3A 4FBPA 4Q30B 3TDJA 3M3LA 1JVXA 5EHMA 1LBZA 1MS7A 4AS5A 4JB7A 4DCXA 1SVXB 3GYYA 5EHSA 1AOVA 1XC1A 3SZPA 3EQ1A 1MH3A 1FQCA 4FE8A 2IEEA 2R9JA 2LAOA 4TLMB 3T9VA 4GWOA 5EQ7A 3TELA 3MZ9A 2XX7A 1B5JA 1FQFA 1XHYA 4OHNA 1NV6A 4H8JA 2NWJA 2O6AA 4PFWA 2V3TA 2ONSA 1FBHA 4OEVA 2XXYA 1NV0A 4OENA 4XKPA 3KBZA 2FA7A 2XXWA 1LB9A 1KA0A 2QVRA 3U94A 2XXTA 4LATA 4DCYA 1B7HA 1H3DA 1Q9DA 4THIA 2I3WA 5CM6A 1B1HA 4ONYA 2VPOA 2UVHA 1O7TA 2O69A 2HZKA 4LN5A 1B5HA 2WKYA 1JW1A 2FVZA 4O7MA 4FECA 3FUZA 2DWAA 5H8QB 2GHAA 5L9OA 1YCJA 4RK2A 4NX1A 2ESNA 4U4XA 1JEVA 4N8GA 2ZYOA 4NG7A 2Z22A 1RKMA 2OLBA 3QIMA 4NF6A 3SETA 1YYZA 4NF4B 2P2AA 1JETA 4RK9A 1FPLA 1H45A 3MSTA 1OIBA 2VP1A 3EKIA 2O1MA 4JVDA 4EXKA 1B40A 3W9WA 3CFLA 1QUKA 3OMBA 1GGGA 4GWXA 3ILUB 5H8SA 5JTYA 1ANFA 4QFKA 5DVFA 3U1OA 1SI0A 1LB8A 5AA2D 3OENA 1RDXA 2ZNUA 4R74A 1ZKBA 4QBAA 5L9SA 4OVSA 4H8IA 4O7IA 1USYH 1MY2A 2X7PA 1A54A 5DW8A 2F8DA 1LSTA 4MLQA 4KR5A 1MQIA 3CIJA 3MVYA 4G68A 3RN8A 3U8QA 5A5XB 5FBPA 5DTBA 3CSBA 4DXUA 1DPEA 1D9YA 3IR1A 4U22A 3TCFA 1I69A 2XXKA 5I58B 4MH5A 3A3CA 4OTEA 3PUVE 3Q28A 1SYHA 4F1VA 4QSCA 4P3LA 3R26A 4IY6A 2RC7A 5H8NB 4MBPA 4M4GA 4LONB 3IB0A 4GL0A 5AA1A 1LBCA 3TQLA 2V4CA 3B6WA 2VD2A 4MNCA 1B3FA 3O6GA 2V25A 1PC3A 1QW0A 3BFTA 5KDTA 3THIA 2QSXA 2BJIA 1ZU0A 2GRVA 4IO4A 2CZHA 1NI9A 2XA5A 4I62A 3TKDA 4NF0A 5T3JA 3SEXA 4NE4A 1I6BA 3QUJA 1LBXA 4FEBA 2NVUB 2P3VA 1MY3A 4PAKA 3MP1A 3KSJA 5A5XA 1DCUA 4NN3A 4IGTA 4MNPA 5F1QA 2CEXA 1B0LA 3VLVA 3C31A 2Y84A 1XVXA 1N76A 3QMFA 3C9HA 2DVZA 2OCUA 4M1VA 4EUOA 2V84A 5HPQA 4XKRA 3TUSA 3VVEA 3IK6B 2P0SA 3ISPA 1P1NA 1TXFA 4JWOA 3MQ9A 4NMYA 3FXQA 1FBDA 4AS4A 1R1NA 3NOHA 1SDXA 1AH5A 1NV5A 1NMUA 5AA3A 1N7XA 4IY5A 1KA1A 1WDNA 4R9GA 3MVZA 3OSRA 2ANJA 2P3NA 2QPQA 5DVJA 4F1YA 3PPNA 1P1WA 1UIUA 3MAMA 2XX9A 2F7BA 3EF7A 3IB1A 4GXAA 2PX1A 3FVOA 3K6WA 3TZAA 3E13X 4O3CA 2Q74A 4MHFA 1GVCA 2HAUA 4QFLA 4XKNA 4O3AA 5B7DA 1MXXA 3MW0A 2GFEA 3VXBA 3MUQA 1FBCA 1NKXA 5IZ3A 3KGCA 5I2KB 1JW4A 3U72A 4ECFA 4EF1A 5CBSA 4MEVA 4TQUQ 4C0RA 2CZLA 4TOZA 4P0GA 3G3JA 2Y5KA 3TYHA 5FHNA 5AE4A 1UQWA 1PBQA 1RDZA 1N04A 1Q35A 3HO7A 1LBYA 1Z7ME 3IOTA 3T9XB 4ZS9A 4P56A 4IO3A 3JZJA 3KN3A 2PFYA 4I3YA 1QVSA 1FSAA 1B3HA 2UVJA 2B4MA 3TTLA 4UABA 1NV3A 3CG3A 5KZTA 1P1QA 2CZIA 4X8RA 4H45A 3VVDA 3MPKA 5IZ1A 3OOAA 2PCRA 4F1UA 5EYFA 5I5PA 1FPFA 2XWIA 5ESYA 2UYFA 2QVUA 1BKAA 1EYKA 1MRPA 1ELJA 3TCGA 4H0WA 2F7CA 3QXMA 4OXVA 1Y4CA 1LCTA 5BUUA 4R2FA 2XXPA 3FXBA 5CMCA 3MP8A 3CI8A 1SW4A 3PPOA 3GZGA 3PMXA 3G3IA 1N3WA 3CHGA 4GWUA 4QFPA 3SDFA 3FXRA 3MVXA 1AL3A 3WAFA 5DEXB 3FVNA 3K02A 3HHFA 4OYVA 1MDP1 1QULA 1IXHA 3KFMA 2B3BA 5ICQA 2RKMA 1IMCA 2H99A 4GLIA 3AXFA 2XXUA 4NF8B 3KZGA 1XT8A 1NNKA 1K9YA 1Y3NA 1G0HA 1LBBA 4F18A 5BWJA 4F3SA 2QL3A 5B70A 3IOUA 3RLFE 3K6XA 3N6TA 2F97A 1B7UA 1URSA 2DP8A 1B51A 3N26A 3UIFA 5TPAA 4I3EA 1OVBA 2Q9TA 1UIVA 4IGRA 1MXZA 1S50A 2HXRA 1OLCA 4PBQA 3U92A 4PFIA 4WXJA 4YKIA 1YPNA 3MWBA 1JP4A 1GV8A 2QS3A 1NH7A 5HM4B 3S9EA 1PBPA 3ZKKA 3O2AA 5FHMA 3TPAA 2Y7WA 1HSLA 4GIZA 5KDTB 1JVYA 1NH8A 1HSJA 2A5SA 3DELB 1AWBA 4PAFA 4PFYA 2PT1A 1DMBA 4NF8A 1B3LA 2X26A 3T66A 1PB9A 3MBPA 3E79A 5JEIA 1O63A 4U21A 3RT8A 2JJKA 4AQ4A 1VDWA 4BDLA 3HHGA 4U1ZA 3KG2A 3ONMA 1D9QA 4GWYA 1KZ8A 5FTHA 1MPCA 2ZNSA 1FPDA 5IAIA 5I59B 5J16A 2A5TA 1MQGA 5CC2A 1FQEA 1OVTA 3K2DA 1VR5A 4UACA 1NUYA 2KR0A 1MXUA 1MPDA 3PTYA 1WODA 1IEJA 1OQHA 4DLDA 1QGXA 1DBZA 4GWSA 1FTMA 3PMWA 4XFEA 4IO2A 2QJEA 2Y7PA 1NFTA 3K00A 1N3XA 4PC9A 3RT6B 1CB6A 2FIXA 2ZYNA 3G7WA 4G61A 4OEUA 2Y7IA 2H98A 1A55A 2QRYA 1XS5A 1DK4A 4N4UA 2PVUA 2UVGA 3T0JA 1LLSA 1NNTA 3KC1A 3E4RA 4OA4A 1IXIA 4X04A 3TEPA 2OBGA 2PMSA 3VV5A 1P1OA 1MDQA 5I2KA 1QUJA 2VOZA 1Y4TA 3LUYA 5ICTA 1FCKA 4O94A 2D3IA 3K0VA 4KPTA 1VSOA 3C4MA 1IXCA 4X48A 3TTNA 3IL1B 4RPOA 2O84X 4GFRA 3RPWA 5JTYB 2I4BA 4ELQA 4XF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TPA B;  2DXY A;  3MP1 A;  1MG1 A;  3KSJ A;  5A5X A;  5AA4 A;  3PUZ E;  2YLN A;  4FOR A;  3WAE A;  5H8H B;  5I57 A;  4IGT A;  4YZZ A;  4HCW A;  1H44 A;  3ZS6 A;  3IOV A;  3FAS A;  2QMX A;  4OQO A;  5F1Q A;  1HSE A;  1B0L A;  1N7W A;  3VLV A;  4KCD A;  3G3F A;  3SES A;  3T93 B;  3C31 A;  3H6V A;  2Y84 A;  3IJO B;  2Y7R A;  1XVX A;  4H5G A;  1N76 A;  3LSL A;  2NOO A;  2KLF A;  4ZEC A;  2DQV A;  3H06 B;  3C9H A;  2DVZ A;  3SEY A;  2ALU A;  1BP5 A;  2OCU A;  3G3K A;  3PPR A;  2QS2 A;  2V84 A;  4G77 A;  4M1V A;  3OSQ A;  3C35 A;  2I48 A;  4KQP A;  4R6Y A;  4TLL B;  5HPQ A;  4XKR A;  3TUS A;  1MQD A;  1N0T A;  3VVE A;  4WED A;  3IK6 B;  3DM0 A;  2OK2 A;  3TFL A;  3M8U A;  5K2X A;  2P0S A;  5L8D A;  1P1N A;  2F5X A;  4ESX A;  2DVC A;  3TOD A;  3S2V A;  3S9N C;  4GQO A;  1TXF A;  4GXS B;  4JWO A;  4LUB A;  4WEP A;  3MQ9 A;  1R9Q A;  4NMY A;  3M3K A;  3D4C A;  3FXQ A;  4NED A;  2DWI A;  1POY 1;  4N07 A;  3ODB A;  2DE3 A;  4FAT A;  5TU0 A;  4F29 A;  1R1N A;  3TQW A;  1SDX A;  4AB6 A;  3FV1 A;  4F39 A;  2Z23 A;  3QSL A;  4I8C A;  5AA4 B;  4G2Z A;  1LFG A;  1AH5 A;  2E1S A;  5H8F A;  5I56 A;  1NMU A;  2OJT A;  2ZMB A;  5AA3 A;  1MY1 A;  1N7X A;  4IY5 A;  1D9V A;  4IO6 A;  1PEB A;  4H1X A;  1WDN A;  1MM7 A;  3KEI A;  4LZ8 A;  4X1B A;  4R9G A;  1PB7 A;  2F78 A;  3MVZ A;  2A5T B;  3P7I A;  3U93 A;  3B6Q A;  4YMA A;  1LFH A;  2XD2 A;  2XXX A;  4KI0 E;  2G93 A;  4F22 A;  1TFA A;  4LZ7 A;  1EZO A;  1B58 A;  3LSX A;  3CRB A;  4QFO A;  3OSR A;  2ANJ A;  4JWX A;  5CMK A;  2QPQ A;  1RYO A;  1TFD A;  5DVJ A;  1I6A A;  3MJN A;  1J1N A;  5F7V A;  3PPN A;  1MPB A;  4F1Y A;  1P1W A;  1Z7N E;  1LCF A;  1UIU A;  1II5 A;  3MAM A;  4R6H A;  3S9E A;  1DOT A;  2XX9 A;  2F7B A;  3EF7 A;  3IB1 A;  3CFX A;  3O97 A;  2I0C A;  2PX1 A;  2ZNT A;  3MZ1 A;  4G8N A;  4GXA A;  3FVO A;  3VVF A;  1BIY A;  3K6W A;  3TZA A;  3LSF B;  1N84 A;  3E13 X;  3F11 A;  4O3C A;  2M8C A;  1B3G A;  4RYA A;  5AA2 B;  4U23 A;  1JW5 A;  3Q26 A;  3OD7 A;  4RA1 A;  1GVC A;  2HAU A;  2G29 A;  3RTF B;  2HCA A;  4PFT A;  4QFL A;  4XKN A;  2D5W A;  4O3A A;  5B7D A;  4HTG A;  4RY1 A;  3S9M C;  1IUD A;  1LAG E;  1MXX A;  2I0B A;  2XX8 A;  3OO6 A;  4N13 A;  5ELV A;  2ZYM A;  3I3V A;  3QYT A;  1GTK A;  4YB7 A;  1LAH E;  3MW0 A;  2DOJ A;  2GFE A;  4LZ5 A;  3VXB A;  1B52 A;  2YJP A;  1CE2 A;  4P0I A;  1B6H A;  3LSW A;  1UTB A;  3MUQ A;  1MXV A;  2QS1 A;  4MLV A;  1ZLQ A;  3VDF A;  2PT2 A;  2OZZ A;  1NKX A;  3PD8 A;  4G68 C;  1IQ7 A;  1M5F A;  2Q88 A;  2I49 A;  3KGC A;  3PV0 E;  3EHT A;  4JSO A;  4POX A;  1FQB A;  4XIG Q;  5I2K B;  1JW4 A;  2H4I A;  3IOR A;  1OMP A;  3KN8 A;  4IB2 A;  4C1T A;  2HAV A;  5I58 A;  3EHS A;  3H6T A;  1Y9U A;  1MQJ A;  4R75 A;  3U72 A;  4BDR A;  4ECF A;  4EF1 A;  3MP6 A;  5CBS A;  4R72 A;  5CI5 A;  1MY0 A;  4KFQ A;  4JWY A;  2E0S A;  1FTK A;  4OFO A;  4U4S A;  4TQU Q;  2DXR A;  3H4Z A;  3PPP A;  3UOR A;  4C0R A;  4KR5 A;  2CZL A;  1B4Z A;  4TOZ A;  4P0G A;  4E0W A;  4OES A;  3G3J A;  1PB8 A;  1RYX A;  3E3K A;  3TYH A;  3C36 A;  2XXH A;  4MF3 A;  2V93 A;  5FHN A;  3T9H B;  1MXY A;  1XVY A;  4R9F A;  2VGQ A;  5AE4 A;  4H6D A;  1UQW A;  1PBQ A;  3G3G A;  3HPI A;  1N04 A;  1Q35 A;  3HO7 A;  3IB2 A;  4YKK A;  4ZEB A;  4FAJ A;  3I6V A;  2VD3 A;  4DXC A;  3FJ7 A;  2RCA A;  2F6G A;  1Z7M E;  1SW2 A;  3PPQ A;  3RNN A;  1BTJ A;  4G8H A;  3IOT A;  3OO7 A;  4ZS9 A;  4XKQ A;  3T9X B;  1MXW A;  4EQ9 A;  5I59 A;  4KYD A;  1SW1 A;  2V3U A;  3S9L C;  2RC9 A;  2DS9 A;  2HXW A;  5L9M A;  4YMB A;  3TTK A;  4OMB A;  3V5A A;  1JEU A;  3CSG A;  4IO3 A;  3UK4 A;  1I6Q A;  4R73 A;  4BLA A;  4NF4 A;  3L6H A;  2I4C A;  4NTL A;  1FQA A;  1MY4 A;  3JZJ A;  1OQG A;  1DTG A;  4PQJ A;  3KN3 A;  4OZ9 A;  5DT6 A;  4ZE9 A;  4PFU A;  3T9U A;  4EDP A;  1QVS A;  2HFB A;  2B65 A;  4JXI A;  1S9T A;  5ITP A;  2Q8J A;  4FED A;  4I9D A;  1FTL A;  3IO6 A;  3TTM A;  4RNS A;  2HZL A;  3TTR A;  4ELP A;  5I57 B;  4PE5 B;  1POT A;  2F35 A;  4IO5 A;  1M5C A;  3FZV A;  4N6P A;  1B3H A;  2UVJ A;  2AL4 A;  3TTL A;  1DPP A;  5CRY A;  2DWH A;  2ONR A;  4Q0C A;  3PU5 A;  3ILT B;  3QAX A;  4X1D A;  4ZEF A;  4ZEI A;  3CG3 A;  1AIV A;  5KZT A;  1P1Q A;  3PD9 A;  2V3Q A;  4F3P A;  5I2N B;  3VVD A;  3MPK A;  1O64 A;  1R6Z A;  3OOA A;  3HN0 A;  4RXL A;  1ZBM A;  4F1U A;  1T0K A;  5EYF A;  1B3E A;  3FXU A;  2UXA A;  4ISU A;  4EQB A;  1D3K A;  1IIW A;  1LGB C;  4OER A;  4NF5 A;  2P1S A;  4OFL A;  2UYF A;  2UYE A;  1SW5 A;  2DYX A;  3RGY A;  4DIG A;  1BKA A;  1MRP A;  1P99 A;  3FVK A;  1ELJ A;  3KN7 A;  3TCG A;  4G8M A;  3DP6 A;  4JSD A;  4H0W A;  1VFE A;  2REG A;  3OXN A;  4ZZA A;  4DZ1 A;  2F7C A;  1LAF E;  2R71 A;  1XOC A;  5JK4 A;  3QXM A;  3IO4 A;  1FQD A;  2O68 A;  1Y4C A;  4OXV A;  1URD A;  1NL5 A;  3DP8 A;  4DE8 A;  1LCT A;  1FTJ A;  4R6K A;  4KHZ E;  3O66 A;  4P11 A;  3RY3 A;  4R2F A;  5BUU A;  4HS7 A;  2XXP A;  5HBC A;  3RUM A;  5CMC A;  3IAZ A;  3MP8 A;  3VLW A;  3CI8 A;  1SW4 A;  3KJT A;  3TMG A;  4QFN A;  3PPO A;  3GZG A;  3PMX A;  1SYI A;  3G3I A;  1B9J A;  1N3W A;  2OWS A;  3S4U A;  5AA2 A;  2HQ0 A;  2H9B A;  3LC8 A;  4QFP A;  2O1L A;  3SDF A;  4ZDM A;  4ELR A;  4QRZ A;  4GD5 A;  1DSN A;  2F36 A;  3FXR A;  3MVX A;  1AL3 A;  3WAF A;  3R6U A;  4GL8 A;  4QSE A;  4QHQ A;  4U2R A;  1ZJL A;  5DEX B;  4HW8 A;  2BJJ X;  1H76 A;  3K1N A;  4QF9 A;  3O28 A;  1EU8 A;  3OEL A;  4OET A;  4F19 A;  4ZED A;  5IKB A;  2DWJ A;  3FVN A;  3HCQ A;  2QS4 A;  3K02 A;  5DEX A;  4C1U A;  3KSX A;  2GH9 A;  3HHF A;  4OYV A;  1MDP 1;  2F6P A;  1ATG A;  5H8Q A;  1QUL A;  1SQY A;  1IXH A;  4G4P A;  3T22 A;  4LA9 A;  3KFM A;  5H8F B;  5I56 B;  1VFD A;  1EZ9 A;  2B3B A;  2RKM A;  5ITO A;  2XXQ A;  5ICQ A;  4GF8 A;  4E0X A;  2RIN A;  3OO8 A;  4KD5 A;  2H99 A;  1KWH A;  3VE1 B;  4GLI A;  3AXF A;  1IXG A;  2H5Y A;  2XXU A;  3H3G A;  4NF8 B;  4MLQ A;  3W15 C;  4F3B A;  1EH3 A;  3KZG A;  1XT8 A;  4ELO A;  4U1O A;  2REJ A;  2AL5 A;  2YPN A;  1OLA A;  3Q27 A;  3VLU A;  5DVI A;  1NNK A;  3B7D A;  1Y3N A;  3UN6 A;  2FNC A;  4LQ5 A;  1LBB A;  3QUF A;  1JNF A;  2DE2 A;  2Z8D A;  4F18 A;  5BWJ A;  1QKA A;  1SD3 A;  3CFZ A;  3SKP A;  4Q30 B;  4DDD A;  3I5O A;  4F3S A;  2QL3 A;  1UTB B;  4JDF A;  3TDJ A;  5B70 A;  1A40 A;  2I3V A;  3M3L A;  1JVX A;  3IOU A;  3RLF E;  4YB6 A;  5EHM A;  1MS7 A;  3K6X A;  1B32 A;  1Y3P A;  3N6T A;  3V83 A;  3JV9 A;  1L5T A;  4JB7 A;  3L6G A;  4DCX A;  2F97 A;  1SVX B;  1A7L A;  1B7U A;  2RCB A;  3SEV A;  4R2B A;  5EHS A;  1URS A;  2H25 A;  2DP8 A;  1AOV A;  1B51 A;  1SI1 A;  1XC1 A;  3FJG A;  3N26 A;  1ZMG A;  4L17 A;  3GBA A;  4BDQ A;  3UIF A;  5I84 A;  1M5E A;  3EQ1 A;  5TPA A;  1A99 A;  1MH3 A;  1FQC A;  4FE8 A;  3JYR A;  2IEE A;  4Q5T A;  1OVB A;  2R9J A;  2Q9T A;  5KCJ B;  2LAO A;  3BBR A;  1UIV A;  4TLM B;  4YB5 A;  1PDA A;  4GWO A;  4IGR A;  4PET A;  4ZE8 A;  3T9V A;  1MXZ A;  3E9X A;  3FVG A;  1SBP A;  1S50 A;  1VE4 A;  4RJZ A;  3B6T A;  3QK6 A;  3TEL A;  3MZ9 A;  2Z8E A;  3TCH A;  1TT1 A;  1OLC A;  2XX7 A;  3TAJ A;  2FYI A;  3U92 A;  1B46 A;  1B5J A;  1FQF A;  5J1D A;  4OFJ A;  4WXJ A;  1XHY A;  1MH4 A;  4OHN A;  4YKI A;  3FGS A;  4HCY A;  1YPN A;  5CMB A;  3MWB A;  2ZYK A;  1GV8 A;  2D21 A;  4LQ2 A;  4H8J A;  4LP2 B;  2QS3 A;  3MVW A;  1NH7 A;  5HM4 B;  1DTZ A;  3GBB A;  1US4 A;  2NWJ A;  1PBP A;  1Y3Q A;  2O6A A;  4PFW A;  3ZKK A;  2V3T A;  4JBZ A;  3LBS A;  2ONS A;  3A09 A;  2AIX A;  3C32 A;  4OEV A;  1NNF A;  4RPN A;  3O2A A;  2XXY A;  3CR9 A;  3PUY E;  4LVQ A;  5FHM A;  3TPA A;  1Y1M A;  1ZTY A;  1B2H A;  3EN3 A;  2CMO A;  2Y7W A;  1HSL A;  3FV2 A;  4K3F A;  3DP4 A;  4GIZ A;  4GRK A;  4OEN A;  2R6G E;  4XKP A;  2FA7 A;  3O6I A;  4H67 A;  5KDT B;  4OVJ A;  2XXW A;  1JVY A;  1NH8 A;  1LB9 A;  1HSJ A;  1TWY A;  4QSD A;  3U94 A;  1FW0 A;  2XXT A;  4LAT A;  2A5S A;  1Y1Z A;  4DCY A;  1B7H A;  3DEL B;  3FJM A;  1H3D A;  3PMV A;  4THI A;  4X9T A;  4BDO A;  2I3W A;  1A8F A;  5CM6 A;  3Q29 A;  3A3U A;  3CVG A;  3HST A;  1UTH B;  3O9P A;  3VXC A;  1B1H A;  4ONY A;  4PFY A;  4WKM A;  2UVH A;  1O7T A;  2O69 A;  2HZK A;  3ZSF A;  2PT1 A;  1B5H A;  1DMB A;  2NXO A;  4NF8 A;  1B3L A;  3LR1 A;  2B3F A;  2X26 A;  4BDN A;  3K4U A;  3BKI B;  2WKY A;  3MZB A;  3C34 A;  1JW1 A;  4EUO A;  2UVI A;  3C33 A;  4KCC A;  3T66 A;  1PB9 A;  4FEC A;  2IA4 A;  3PUX E;  3SEU A;  3ZKL A;  3FUZ A;  3MBP A;  4IO7 A;  5JEI A;  1B4H A;  2DWA A;  1AMF A;  5H8Q B;  1O63 A;  2GHA A;  3OO9 A;  3N5L A;  4XXU A;  5L9O A;  3HV1 A;  1YCJ A;  4U21 A;  1IIT A;  3H03 A;  3GXA A;  3H6U A;  4NWD A;  4RK2 A;  4Z0I A;  2OWT A;  3RT8 A;  2DE4 A;  2ESN A;  4U4X A;  4AQ4 A;  1B1X A;  1A8E A;  1JEV A;  4BDL A;  4EQ7 A;  3MC2 A;  2ZYO A;  3HHG A;  4KYE A;  2Z22 A;  1RKM A;  4PP0 A;  4U1Z A;  3KG2 A;  3ONM A;  1JQF A;  3K6V A;  3OEK A;  2OLB A;  3QIM A;  4NF6 A;  3SET A;  4NF4 B;  5FTH A;  2P2A A;  1ZIU A;  1JET A;  4NF6 B;  1MPC A;  4RK9 A;  1R9L A;  1B7Z A;  4ZEK A;  1H45 A;  2ZXT A;  2ZNS A;  1Y20 A;  1Q1K A;  5K2Y A;  4ESW A;  5IAI A;  5I59 B;  2A5T A;  1MQG A;  3KJ7 A;  4H65 A;  4YKJ A;  1OIB A;  2VP1 A;  1UTH A;  5CC2 A;  1FQE A;  2XXV A;  2O1M A;  1OVT A;  3Q25 A;  3K1M A;  5H8H A;  5M2V A;  2Q89 A;  3K2D A;  1EZP A;  3D4G A;  4EXK A;  1B40 A;  1VR5 A;  3CFL A;  4UAC A;  3W9W A;  1WVJ A;  3DLN A;  3FD3 A;  1QUK A;  2ABH A;  1P1U A;  3OMB A;  1GGG A;  2O7U A;  3UA8 A;  3V89 B;  3RTW B;  4EXL A;  3IJX B;  2RC8 A;  3ILU B;  5H8S A;  2F34 A;  3O6H A;  4G68 B;  4EF2 A;  3K1P A;  4ZZE A;  5JTY A;  1MXU A;  1MPD A;  1ANF A;  2NUV A;  4Z7E A;  4QFK A;  2O7I A;  5DVF A;  3U1O A;  3FAT A;  1WOD A;  1SI0 A;  1LB8 A;  1S7Y A;  2PYY A;  4AB5 A;  5AA2 D;  1IEJ A;  2O51 A;  3K01 A;  3IOW A;  1QKB A;  3KOS A;  1H43 A;  3OEN A;  4GVO A;  1OQH A;  3O29 A;  3SER A;  3CG1 A;  4DLD A;  5TP9 A;  2GHB A;  2Z8F A;  5DYH A;  2ZNU A;  4R74 A;  5FHO A;  1ZKB A;  1FTM A;  5I2N A;  1LFI A;  4DXB A;  1BLF A;  4H8I A;  5L9S A;  3N6U A;  3EPE A;  4ND9 A;  3R7X A;  3PMW A;  4I1D A;  1USY E;  4F1V A;  2W7Y A;  4H5F A;  1USY H;  2XD3 A;  4F3G A;  4IO2 A;  1MY2 A;  2QJE A;  2X7P A;  1FTO A;  1NNP A;  2X7Q A;  1A54 A;  1US5 A;  3M3F A;  4OWD A;  3USD A;  2F8D A;  4YIC A;  1LST A;  4F2O A;  2Y7P A;  3G3H A;  4BDM A;  1NFT A;  2VHA A;  3K00 A;  2XXI A;  1D4N A;  1MQI A;  1N3X A;  3CIJ A;  3MPL A;  3MVY A;  4G68 A;  3RT6 B;  5KCJ A;  1LAX A;  2XXR A;  1CB6 A;  3RN8 A;  3U8Q A;  5A5X B;  2I58 A;  5DTB A;  3BFU A;  3CSB A;  3T96 B;  3EHU A;  2XHD A;  2PBW A;  2ZYN A;  4DXU A;  3G7W A;  1DPE A;  1GR2 A;  4YKP A;  1D9Y A;  1QUI A;  3IR1 A;  4OEU A;  4U22 A;  2Y7I A;  5ISU A;  3N94 A;  2Q2C A;  3PUW E;  1I69 A;  4O3B A;  2F7A A;  3TCF A;  3ECR A;  5I58 B;  4MH5 A;  5H8N A;  4MFI A;  5LOM A;  4YU0 A;  3A3C A;  4NF5 B;  3PUV E;  3Q28 A;  1SYH A;  3PGF A;  2H98 A;  4OTE A;  1M5B A;  2AYS A;  3R26 A;  4IY6 A;  4QSC A;  2RC7 A;  1A55 A;  1B05 A;  1M5D A;  4MBP A;  4Q8R A;  5H8N B;  3KBR A;  2QRY A;  5CMM A;  3OEM A;  1XS5 A;  3UP9 A;  4M4G A;  2I6E A;  3IB0 A;  4GL0 A;  2RF1 A;  4LON B;  2PVU A;  2UVG A;  5AA1 A;  3W9V A;  1LBC A;  3TQL A;  3SEW A;  1LLS A;  3B6W A;  1B5I A;  1NNT A;  4POW A;  3UGW A;  3IX1 A;  3E4R A;  2VD2 A;  1B3F A;  1MM6 A;  3H7M A;  3K6U A;  3O6G A;  1IXI A;  3H6W A;  2V25 A;  1PC3 A;  1QW0 A;  3BFT A;  5KDT A;  3TEP A;  4FJP A;  3THI A;  4UA8 A;  2QSX A;  2OBG A;  3GLB A;  2PMS A;  1ZU0 A;  4FIM A;  4GOT A;  3VV5 A;  1P1O A;  1B0H A;  5CBR A;  4NWC A;  2GRV A;  1MDQ A;  4IO4 A;  5I2K A;  4XTC Q;  2Q2A A;  1QUJ A;  5FTI A;  4I62 A;  3FIR A;  2VOZ A;  1Y4T A;  3LUY A;  3TKD A;  5ICT A;  1IZ1 A;  1FCK A;  2Y7K A;  2QMW A;  2D3I A;  5TP9 B;  3K0V A;  4YAH X;  4KPT A;  1VSO A;  1MQH A;  4KYS A;  3SEX A;  2THI A;  4NE4 A;  3C4M A;  1IXC A;  4X48 A;  1I6B A;  2HEU A;  3QUJ A;  3TTN A;  4F2Q A;  3VFJ A;  4FEB A;  3IL1 B;  2ONK E;  2NVU B;  3V8X B;  4RPO A;  2O84 X;  1YAE A;  4GFR A;  3RPW A;  3RQT A;  1YTV A;  1F9B A;  5JTY B;  4F31 B;  1MY3 A;  2I4B A;  4ELQ A;  1URG A;  2DSF A;  3KOT A;  1QJM A; 
#chains in the Genus database with same CATH topology
 2DXY A;  1MG1 A;  3PUZ E;  4OVT A;  4YZZ A;  1H44 A;  4OQO A;  3G3F A;  3SES A;  3T93 B;  3H6V A;  2WEF A;  4H5G A;  4I40 A;  4ZEC A;  3H06 B;  4O8M A;  3SEY A;  1BP5 A;  3PPR A;  4R6Y A;  3OSQ A;  4WED A;  2ZZX A;  5K2X A;  5L8D A;  2F5X A;  2DVC A;  3TOD A;  3S2V A;  4LUB A;  1R9Q A;  2DWI A;  3ODB A;  4PF6 A;  4AB6 A;  3FV1 A;  1LBV A;  5I56 A;  2OJT A;  1MY1 A;  4IO6 A;  1PEB A;  1LFH A;  4F22 A;  1FBP A;  3CRB A;  1I6A A;  3MJN A;  1MPB A;  4R6H A;  1LCF A;  3MZ1 A;  2ZNT A;  1BIY A;  3LSF B;  5I3S A;  2M8C A;  4MIJ A;  4RYA A;  1BK4 A;  2HCA A;  4PFT A;  3S9M C;  2XX8 A;  5ELV A;  2ZYM A;  2DOJ A;  4LZ5 A;  1B52 A;  3BIH A;  1CE2 A;  5ET8 A;  1UTB A;  4MLV A;  4NGU A;  4G68 C;  5F24 A;  1IQ7 A;  2I49 A;  3EHT A;  4POX A;  1FQB A;  5I58 A;  3IOR A;  3KN8 A;  4IB2 A;  3EHS A;  1Y9U A;  5IGA A;  4R72 A;  1MY0 A;  4KFQ A;  4JWY A;  1FBE A;  4N8Y A;  4U4S A;  2DXR A;  3PPP A;  2PFZ A;  3C36 A;  2V93 A;  1MXY A;  3IB2 A;  4ZEB A;  3RNN A;  4N17 A;  1BTJ A;  2FBP A;  4G8H A;  1RDY A;  4XKQ A;  4KYD A;  1SW1 A;  2V3U A;  2RC9 A;  5L9M A;  3TTK A;  3UK4 A;  1I6Q A;  2DDK A;  2I4C A;  1OQG A;  2Q8J A;  1FTL A;  3TTM A;  4RNS A;  1NV2 A;  2HZL A;  4ELP A;  1POT A;  1DPP A;  2ONR A;  3ILT B;  3QAX A;  4X1D A;  2V3Q A;  1B3E A;  4ISU A;  2UXA A;  1LGB C;  4NF5 A;  5LDZ A;  2QFL A;  5IZZ A;  2DYX A;  4DIG A;  1VFE A;  4ZZA A;  1FPI A;  3IO4 A;  1FQD A;  2O68 A;  1NL5 A;  4DE8 A;  3RY3 A;  4HS7 A;  5HBC A;  3VLW A;  4Q8R A;  3TMG A;  4QFN A;  2OWS A;  2H9B A;  3LC8 A;  2HPG A;  4ZDM A;  4ELR A;  1DSN A;  2F36 A;  5EQ8 A;  4QSE A;  2BJJ X;  3OEL A;  3HCQ A;  3KSX A;  5H8Q A;  5H8F B;  1VFD A;  5ITO A;  4GF8 A;  2RIN A;  3OO8 A;  3H3G A;  4F3B A;  4U1O A;  2REJ A;  3Q27 A;  3VLU A;  4LQ5 A;  1JNF A;  4MCO A;  3CFZ A;  4DDD A;  3I5O A;  1UTB B;  4JDF A;  1A40 A;  2I3V A;  3V83 A;  3L6G A;  1IMB A;  1A7L A;  2VPN A;  3FJG A;  4L17 A;  4BDQ A;  1ZMG A;  1NV1 A;  3HFU A;  5A5L A;  3BBR A;  4YB5 A;  1PDA A;  4GX3 A;  3E9X A;  1VE4 A;  4P1E A;  4MX6 A;  2FYI A;  5J1D A;  3FGS A;  4HCY A;  4XEQ A;  4NAP A;  2ZYK A;  4PBH A;  3GBB A;  1US4 A;  3D1R A;  2AIX A;  4RPN A;  1NNF A;  1LEV A;  1Y1M A;  1ZTY A;  3EN3 A;  2CMO A;  4GRK A;  3O6I A;  4H67 A;  4OVR A;  4QSD A;  1FW0 A;  3FJM A;  4GBW A;  1A8F A;  3Q29 A;  4PCD A;  3A3U A;  3CVG A;  3VXC A;  2XWV A;  4GX6 A;  2NXO A;  4BDN A;  3C33 A;  4KCC A;  3SEU A;  3PUX E;  1B4H A;  3OO9 A;  4XXU A;  3HV1 A;  1IIT A;  3H6U A;  2DE4 A;  4EQ7 A;  1B1X A;  1A8E A;  4PP0 A;  1JQF A;  3OEK A;  2CEY A;  1NUX A;  1ZIU A;  4NF6 B;  1B7Z A;  1Y20 A;  1Q1K A;  5K2Y A;  4ESW A;  3KJ7 A;  4H65 A;  3Q25 A;  5M2V A;  2XXV A;  5H8H A;  1IMA A;  2Q89 A;  4PTK A;  3DLN A;  2ABH A;  2Y5L A;  3UA8 A;  3V89 B;  4EXL A;  3IJX B;  4EF2 A;  4ZZE A;  2NUV A;  4Z7E A;  2O7I A;  3FAT A;  4AB5 A;  4N81 A;  4PGN A;  3KOS A;  1QKB A;  3SER A;  1H43 A;  4GVO A;  1NV4 A;  4NQ8 A;  5TP9 A;  5FHO A;  5DYH A;  5I2N A;  1BLF A;  3R7X A;  4I1D A;  2WX9 A;  4H5F A;  2QVV A;  4F3G A;  4PE3 A;  3USD A;  4YIC A;  4F2O A;  3G3H A;  4BDM A;  2VHA A;  3MPL A;  1INP A;  1LAX A;  2I58 A;  3EHU A;  1FJ6 A;  1GR2 A;  2Q8M A;  3PUW E;  2Q2C A;  2F7A A;  5H8N A;  5LOM A;  5ISU A;  1B05 A;  3KBR A;  3UP9 A;  2I6E A;  2RF1 A;  3SEW A;  1B5I A;  3IX1 A;  3K6U A;  4FJP A;  4N15 A;  4UA8 A;  3GLB A;  1B0H A;  5CBR A;  4NWC A;  5FTI A;  4DI4 B;  3FIR A;  1IZ1 A;  2Y7K A;  1MQH A;  4MMP A;  4F2Q A;  3V8X B;  2ONK E;  3LUZ A;  3RQT A;  1F9B A;  4F31 B;  5EYG A;  2DSF A;  3KOT A;  3RPL A;  4DI3 D;  5AA4 A;  4FOR A;  4HCW A;  3ZS6 A;  3IOV A;  3FAS A;  1HSE A;  2L5V A;  3IJO B;  2Y7R A;  3IFA A;  2KLF A;  3U65 A;  2ZZV A;  2ALU A;  4G77 A;  3G3K A;  2QS2 A;  5EQ9 A;  2I48 A;  4KQP A;  4MNI A;  1MQD A;  1N0T A;  4HE1 A;  2KQZ A;  4H46 A;  3S9N C;  2WBD A;  4GQO A;  4GXS B;  4WEP A;  3M3K A;  1POY 1;  3B8B A;  4F39 A;  2Z23 A;  3QSL A;  4I8C A;  4G2Z A;  5EYH A;  2E1S A;  5H8F A;  2XWK A;  2ZMB A;  1IMD A;  1MM7 A;  3KEI A;  4LZ8 A;  2G93 A;  1TFA A;  4LZ7 A;  1B58 A;  4QFO A;  1RYO A;  1J1N A;  3B50 A;  1Z7N E;  1II5 A;  1DOT A;  2I0C A;  4BDO A;  1T0K A;  1N84 A;  3F11 A;  4QXD A;  2VT5 A;  1B3G A;  5AA2 B;  4U23 A;  3Q26 A;  4RA1 A;  4GWW A;  3RTF B;  5I7I A;  2D5W A;  4RY1 A;  3OO6 A;  4PFB A;  3I3V A;  3QYT A;  1GTK A;  4YB7 A;  1LAH E;  2YJP A;  4P0I A;  3LSW A;  2QS1 A;  3RPL B;  3VDF A;  2OZZ A;  3PD8 A;  2Q88 A;  3PV0 E;  4XIG Q;  4JSO A;  2H4I A;  2HAV A;  4BDR A;  1IME A;  1MQJ A;  3MP6 A;  1CNQ A;  1FTK A;  3UOR A;  4OES A;  2XXH A;  4MF3 A;  4R9F A;  1FJ9 A;  3HPI A;  3I6V A;  2VD3 A;  3FJ7 A;  1EYI A;  2RCA A;  3PPQ A;  2WBB A;  3OO7 A;  5I59 A;  4EQ9 A;  3V5A A;  4BLA A;  3L6H A;  1XI6 A;  1MY4 A;  4PQJ A;  1DTG A;  5DT6 A;  4ZE9 A;  4PFU A;  3T9U A;  2B65 A;  4JXI A;  1S9T A;  1FPJ A;  4FED A;  4I9D A;  3IO6 A;  3TTR A;  4PE5 B;  4IO5 A;  2F35 A;  3FZV A;  5CRY A;  2DWH A;  4Q0C A;  1SPI A;  4ZEF A;  1O64 A;  1R6Z A;  3HN0 A;  4EQB A;  1D3K A;  1IIW A;  1SW5 A;  1P99 A;  3FVK A;  3DP6 A;  2REG A;  3OXN A;  4DZ1 A;  5ET6 A;  2R71 A;  1XOC A;  3DP8 A;  4R6K A;  2XWO A;  3O66 A;  4P11 A;  3IAZ A;  1B9J A;  5AA2 A;  5LTC A;  2O1L A;  4GD5 A;  3R6U A;  4GL8 A;  3BIG A;  4QHQ A;  4HW8 A;  1H76 A;  3K1N A;  4QF9 A;  3O28 A;  5IKB A;  4P8B A;  2DWJ A;  4C1U A;  4OVP A;  2GH9 A;  4LA9 A;  5I56 B;  4KD5 A;  4HXV A;  3VE1 B;  5ET7 A;  1IXG A;  2H5Y A;  3W15 C;  2YPN A;  1OLA A;  3B7D A;  3UN6 A;  2FNC A;  4OVQ A;  1IMF A;  2DE2 A;  5ET5 A;  3SKP A;  3MYU A;  4YB6 A;  1B32 A;  1Y3P A;  3JV9 A;  1L5T A;  1G0I A;  2RCB A;  3SEV A;  4R2B A;  2H25 A;  1SI1 A;  3GBA A;  5I84 A;  1M5E A;  1A99 A;  3JYR A;  4Q5T A;  5KCJ B;  2FHY A;  4ZE8 A;  4PET A;  1FPK A;  3FVG A;  1SBP A;  4OAN A;  4RJZ A;  3B6T A;  3QK6 A;  2Z8E A;  3TCH A;  1TT1 A;  3TAJ A;  2B4L A;  1B46 A;  4OFJ A;  4P1L A;  1MH4 A;  4N91 A;  5CMB A;  2D21 A;  4LQ2 A;  4LP2 B;  3MVW A;  1DTZ A;  4PAI A;  1Y3Q A;  4JBZ A;  3LBS A;  3C32 A;  3A09 A;  3PUY E;  3CR9 A;  4LVQ A;  1B2H A;  4K3F A;  3FV2 A;  3DP4 A;  2R6G E;  4OVJ A;  1TWY A;  1Y1Z A;  3PMV A;  3HST A;  3O9P A;  1UTH B;  4WKM A;  3ZSF A;  4PGP A;  4PF8 A;  3LR1 A;  4PDH A;  2B3F A;  3K4U A;  3BKI B;  3MZB A;  3C34 A;  3KC0 A;  2OX3 A;  2UVI A;  2IA4 A;  5IM2 A;  3ZKL A;  4IO7 A;  1AMF A;  3N5L A;  4Z0I A;  3H03 A;  3GXA A;  4NWD A;  2OWT A;  3MC2 A;  4KYE A;  4P47 A;  3T1B A;  3K6V A;  1FPB A;  1FBF A;  4ZEK A;  1R9L A;  2ZXT A;  4N6D A;  4YKJ A;  1UTH A;  3IFC A;  3K1M A;  1EZP A;  3D4G A;  1NV7 A;  1WVJ A;  3FD3 A;  1P1U A;  2O7U A;  4GWZ A;  4HE0 A;  3RTW B;  2RC8 A;  2F34 A;  3O6H A;  4G68 B;  3K1P A;  3LV0 A;  1S7Y A;  4JVC A;  2PYY A;  3K01 A;  2O51 A;  3IOW A;  3O29 A;  3CG1 A;  2GHB A;  2Z8F A;  2WYP A;  1LFI A;  4DXB A;  3N6U A;  3EPE A;  4ND9 A;  1USY E;  2W7Y A;  2XD3 A;  1FTO A;  1NNP A;  2X7Q A;  1US5 A;  3M3F A;  4OWD A;  2XXI A;  1D4N A;  5KCJ A;  3RYD A;  2XXR A;  3BFU A;  4IR8 A;  3T96 B;  2XHD A;  2PBW A;  2HHM A;  4YKP A;  1QUI A;  4HE2 A;  3N94 A;  4O3B A;  3ECR A;  4MFI A;  4YU0 A;  4NF5 B;  3PGF A;  1M5B A;  2AYS A;  1M5D A;  5CMM A;  3OEM A;  4ELO A;  2F3B A;  3W9V A;  4POW A;  3UGW A;  3H7M A;  1MM6 A;  3H6W A;  4GOT A;  4FIM A;  1YZ0 A;  3FBP A;  4XTC Q;  3ROJ A;  2Q2A A;  3A29 A;  2QMW A;  5TP9 B;  4YAH X;  4KYS A;  2THI A;  2CZK A;  2HEU A;  3VFJ A;  1YAE A;  1FTA A;  1YTV A;  1LBW A;  1URG A;  4GX4 A;  1QJM A;  4GBV A;  5TPA B;  1FBG A;  2YLN A;  3WAE A;  5H8H B;  5I57 A;  2QMX A;  1N7W A;  2ZZW A;  3LSL A;  2NOO A;  2DQV A;  1K9Z A;  4TLL B;  3C35 A;  1YXI A;  3DM0 A;  2OK2 A;  3TFL A;  3M8U A;  4ESX A;  3D4C A;  4NED A;  4N07 A;  2DE3 A;  4FAT A;  5TU0 A;  4F29 A;  3TQW A;  5AA4 B;  1LFG A;  1D9V A;  4H1X A;  4X1B A;  1PB7 A;  2F78 A;  3P7I A;  2A5T B;  3U93 A;  3B6Q A;  4N6K A;  4YMA A;  2XD2 A;  2XXX A;  4KI0 E;  4KXP A;  1EZO A;  2GQ1 A;  3LSX A;  2R8T A;  4JWX A;  5CMK A;  1TFD A;  5F7V A;  3O97 A;  4X9T A;  4KCD A;  4G8N A;  3CFX A;  3VVF A;  1JW5 A;  3OD7 A;  2G29 A;  4HTG A;  1IUD A;  1LAG E;  2I0B A;  4N13 A;  3E78 A;  2MKZ A;  4PFR A;  1B6H A;  1MXV A;  1ZLQ A;  2PT2 A;  1M5F A;  4C1T A;  1OMP A;  3H6T A;  4R75 A;  5CI5 A;  2E0S A;  4OFO A;  3H4Z A;  1B4Z A;  4E0W A;  1PB8 A;  1RYX A;  3E3K A;  3T9H B;  1XVY A;  2VGQ A;  4H6D A;  1FPE A;  3G3G A;  4YKK A;  4FAJ A;  4DXC A;  2F6G A;  1SW2 A;  4NHB A;  1MXW A;  3S9L C;  1FPG A;  2DS9 A;  2HXW A;  4P9K A;  4YMB A;  4OMB A;  1JEU A;  3CSG A;  4R73 A;  2WYK A;  4NF4 A;  4NTL A;  1FQA A;  4OZ9 A;  4EDP A;  2HFB A;  5ITP A;  5EQA A;  4JVI A;  5I57 B;  4N6P A;  1M5C A;  2AL4 A;  1NUZ A;  3PU5 A;  1EYJ A;  4ZEI A;  1AIV A;  3PD9 A;  4F3P A;  5I2N B;  4RXL A;  1ZBM A;  3FXU A;  4OER A;  5IZ3 B;  2P1S A;  4OFL A;  2UYE A;  3RGY A;  3KN7 A;  4G8M A;  4JSD A;  1LAF E;  2OWZ A;  5JK4 A;  1URD A;  1FTJ A;  4KHZ E;  3RUM A;  3KJT A;  4MJO A;  1SYI A;  3S4U A;  2FIE A;  2HQ0 A;  4QRZ A;  1FRP A;  2F3D A;  4U2R A;  1ZJL A;  4F19 A;  4OET A;  1EU8 A;  4ZED A;  5DEX A;  2QS4 A;  2F6P A;  1ATG A;  1SQY A;  4G4P A;  3T22 A;  1EZ9 A;  2XXQ A;  4E0X A;  4MAG A;  1KWH A;  1EH3 A;  1NUW A;  2AL5 A;  5DVI A;  3QUF A;  2Z8D A;  4PDD A;  1QKA A;  1SD3 A;  4FBP A;  4Q30 B;  3TDJ A;  3M3L A;  1JVX A;  5EHM A;  1LBZ A;  1MS7 A;  4AS5 A;  4JB7 A;  4DCX A;  1SVX B;  3GYY A;  5EHS A;  1AOV A;  1XC1 A;  3SZP A;  3EQ1 A;  1MH3 A;  1FQC A;  4FE8 A;  2IEE A;  2R9J A;  2LAO A;  4TLM B;  3T9V A;  4GWO A;  5EQ7 A;  3TEL A;  3MZ9 A;  2XX7 A;  1B5J A;  1FQF A;  1XHY A;  4OHN A;  1NV6 A;  4H8J A;  2NWJ A;  2O6A A;  4PFW A;  2V3T A;  1FBH A;  2ONS A;  4OEV A;  2XXY A;  1NV0 A;  4OEN A;  4XKP A;  3KBZ A;  2FA7 A;  2XXW A;  1LB9 A;  1KA0 A;  2QVR A;  3U94 A;  2XXT A;  4LAT A;  4DCY A;  1B7H A;  1H3D A;  1Q9D A;  4THI A;  2I3W A;  5CM6 A;  1B1H A;  4ONY A;  2VPO A;  2UVH A;  1O7T A;  2O69 A;  2HZK A;  4LN5 A;  1B5H A;  2WKY A;  1JW1 A;  2FVZ A;  4O7M A;  4FEC A;  3FUZ A;  2DWA A;  5H8Q B;  2GHA A;  5L9O A;  1YCJ A;  4RK2 A;  4NX1 A;  2ESN A;  4U4X A;  1JEV A;  4N8G A;  2ZYO A;  4NG7 A;  2Z22 A;  1RKM A;  2OLB A;  3QIM A;  4NF6 A;  1YYZ A;  3SET A;  4NF4 B;  2P2A A;  1JET A;  4RK9 A;  1FPL A;  1H45 A;  3MST A;  1OIB A;  2VP1 A;  3EKI A;  2O1M A;  4JVD A;  4EXK A;  1B40 A;  3W9W A;  3CFL A;  1QUK A;  3OMB A;  1GGG A;  4GWX A;  3ILU B;  5H8S A;  5JTY A;  1ANF A;  4QFK A;  5DVF A;  3U1O A;  1SI0 A;  1LB8 A;  5AA2 D;  3OEN A;  1RDX A;  2ZNU A;  4R74 A;  1ZKB A;  4QBA A;  4OVS A;  5L9S A;  4H8I A;  4O7I A;  1USY H;  1MY2 A;  2X7P A;  1A54 A;  5DW8 A;  2F8D A;  1LST A;  4MLQ A;  4KR5 A;  1MQI A;  3CIJ A;  3MVY A;  4G68 A;  3RN8 A;  3U8Q A;  5A5X B;  5FBP A;  5DTB A;  3CSB A;  4DXU A;  1DPE A;  1D9Y A;  3IR1 A;  4U22 A;  3TCF A;  1I69 A;  2XXK A;  5I58 B;  4MH5 A;  3A3C A;  4OTE A;  3PUV E;  3Q28 A;  1SYH A;  4F1V A;  4QSC A;  4P3L A;  3R26 A;  4IY6 A;  2RC7 A;  5H8N B;  4MBP A;  5AA1 A;  4M4G A;  3IB0 A;  4GL0 A;  4LON B;  1LBC A;  3TQL A;  2V4C A;  3B6W A;  2VD2 A;  4MNC A;  1B3F A;  3O6G A;  2V25 A;  1PC3 A;  1QW0 A;  3BFT A;  5KDT A;  3THI A;  2QSX A;  2BJI A;  1ZU0 A;  2GRV A;  2CZH A;  4IO4 A;  1NI9 A;  2XA5 A;  4I62 A;  3TKD A;  4NF0 A;  5T3J A;  3SEX A;  4NE4 A;  1I6B A;  3QUJ A;  1LBX A;  4FEB A;  2NVU B;  2P3V A;  1MY3 A;  4PAK A;  3MP1 A;  3KSJ A;  5A5X A;  1DCU A;  4NN3 A;  4IGT A;  4MNP A;  2CEX A;  5F1Q A;  1B0L A;  3VLV A;  3C31 A;  2Y84 A;  1XVX A;  1N76 A;  3QMF A;  3C9H A;  2DVZ A;  2OCU A;  4M1V A;  4EUO A;  2V84 A;  5HPQ A;  4XKR A;  3TUS A;  3VVE A;  3IK6 B;  2P0S A;  3ISP A;  1P1N A;  1TXF A;  4JWO A;  3MQ9 A;  4NMY A;  3FXQ A;  1FBD A;  4AS4 A;  1R1N A;  3NOH A;  1SDX A;  1AH5 A;  1NV5 A;  1NMU A;  5AA3 A;  1N7X A;  4IY5 A;  1KA1 A;  1WDN A;  4R9G A;  3MVZ A;  3OSR A;  2ANJ A;  2P3N A;  2QPQ A;  5DVJ A;  4F1Y A;  3PPN A;  1P1W A;  1UIU A;  3MAM A;  2XX9 A;  2F7B A;  3EF7 A;  3IB1 A;  4GXA A;  2PX1 A;  3FVO A;  3K6W A;  3TZA A;  3E13 X;  2Q74 A;  4O3C A;  4MHF A;  1GVC A;  2HAU A;  4QFL A;  4XKN A;  4O3A A;  5B7D A;  1MXX A;  3MW0 A;  2GFE A;  3VXB A;  3MUQ A;  1FBC A;  1NKX A;  5IZ3 A;  3KGC A;  5I2K B;  1JW4 A;  3U72 A;  4ECF A;  4EF1 A;  5CBS A;  4MEV A;  4TQU Q;  4C0R A;  2CZL A;  4TOZ A;  4P0G A;  3G3J A;  2Y5K A;  3TYH A;  5FHN A;  5AE4 A;  1UQW A;  1PBQ A;  1RDZ A;  1N04 A;  1Q35 A;  3HO7 A;  1LBY A;  1Z7M E;  3IOT A;  3T9X B;  4ZS9 A;  4P56 A;  4IO3 A;  3JZJ A;  3KN3 A;  2PFY A;  4I3Y A;  1QVS A;  1FSA A;  1B3H A;  2UVJ A;  2B4M A;  3TTL A;  4UAB A;  1NV3 A;  3CG3 A;  5KZT A;  1P1Q A;  2CZI A;  4X8R A;  4H45 A;  3VVD A;  3MPK A;  5IZ1 A;  3OOA A;  2PCR A;  4F1U A;  5EYF A;  5I5P A;  1FPF A;  2XWI A;  5ESY A;  2UYF A;  2QVU A;  1BKA A;  1EYK A;  1MRP A;  1ELJ A;  3TCG A;  4H0W A;  2F7C A;  3QXM A;  4OXV A;  1Y4C A;  1LCT A;  5BUU A;  4R2F A;  2XXP A;  3FXB A;  5CMC A;  3MP8 A;  3CI8 A;  1SW4 A;  3PPO A;  3GZG A;  3PMX A;  3G3I A;  1N3W A;  3CHG A;  4GWU A;  4QFP A;  3SDF A;  3FXR A;  3MVX A;  1AL3 A;  3WAF A;  5DEX B;  3FVN A;  3K02 A;  3HHF A;  4OYV A;  1MDP 1;  1QUL A;  1IXH A;  3KFM A;  2B3B A;  5ICQ A;  2RKM A;  1IMC A;  2H99 A;  4GLI A;  3AXF A;  2XXU A;  4NF8 B;  3KZG A;  1XT8 A;  1NNK A;  1K9Y A;  1Y3N A;  1G0H A;  1LBB A;  4F18 A;  5BWJ A;  4F3S A;  2QL3 A;  5B70 A;  3IOU A;  3RLF E;  3K6X A;  3N6T A;  2F97 A;  1B7U A;  1URS A;  2DP8 A;  1B51 A;  3N26 A;  3UIF A;  5TPA A;  4I3E A;  1OVB A;  2Q9T A;  1UIV A;  4IGR A;  1MXZ A;  1S50 A;  2HXR A;  1OLC A;  4PBQ A;  3U92 A;  4PFI A;  4WXJ A;  4YKI A;  1YPN A;  1JP4 A;  3MWB A;  1GV8 A;  2QS3 A;  1NH7 A;  5HM4 B;  3S9E A;  1PBP A;  3ZKK A;  3O2A A;  5FHM A;  3TPA A;  2Y7W A;  1HSL A;  4GIZ A;  5KDT B;  1JVY A;  1NH8 A;  1HSJ A;  2A5S A;  3DEL B;  1AWB A;  4PAF A;  4PFY A;  2PT1 A;  1DMB A;  4NF8 A;  1B3L A;  2X26 A;  3T66 A;  1PB9 A;  3MBP A;  3E79 A;  5JEI A;  1O63 A;  4U21 A;  3RT8 A;  2JJK A;  4AQ4 A;  1VDW A;  4BDL A;  3HHG A;  4U1Z A;  3KG2 A;  3ONM A;  1D9Q A;  4GWY A;  1KZ8 A;  5FTH A;  1MPC A;  2ZNS A;  1FPD A;  5IAI A;  5I59 B;  5J16 A;  2A5T A;  1MQG A;  5CC2 A;  1FQE A;  1OVT A;  3K2D A;  1VR5 A;  4UAC A;  1NUY A;  2KR0 A;  1MXU A;  1MPD A;  3PTY A;  1WOD A;  1IEJ A;  1OQH A;  4DLD A;  1QGX A;  1DBZ A;  4GWS A;  1FTM A;  3PMW A;  4XFE A;  4IO2 A;  2QJE A;  2Y7P A;  1NFT A;  3K00 A;  1N3X A;  4PC9 A;  3RT6 B;  1CB6 A;  2FIX A;  2ZYN A;  3G7W A;  4G61 A;  4OEU A;  2Y7I A;  2H98 A;  1A55 A;  2QRY A;  1XS5 A;  1DK4 A;  4N4U A;  2PVU A;  2UVG A;  3T0J A;  1LLS A;  1NNT A;  3KC1 A;  3E4R A;  4OA4 A;  1IXI A;  4X04 A;  3TEP A;  2OBG A;  2PMS A;  3VV5 A;  1P1O A;  1MDQ A;  5I2K A;  1QUJ A;  2VOZ A;  1Y4T A;  3LUY A;  5ICT A;  1FCK A;  4O94 A;  2D3I A;  3K0V A;  4KPT A;  1VSO A;  3C4M A;  1IXC A;  4X48 A;  3TTN A;  3IL1 B;  4RPO A;  2O84 X;  4GFR A;  3RPW A;  5JTY B;  2I4B A;  4ELQ A;  4XF5 A; 
#chains in the Genus database with same CATH homology
 2DXY A;  1MG1 A;  3PUZ E;  4OVT A;  4YZZ A;  1H44 A;  4OQO A;  3G3F A;  3SES A;  3T93 B;  3H6V A;  4H5G A;  2WEF A;  4I40 A;  4ZEC A;  3H06 B;  4O8M A;  3SEY A;  1BP5 A;  3PPR A;  4R6Y A;  3OSQ A;  4WED A;  2ZZX A;  5K2X A;  5L8D A;  2F5X A;  2DVC A;  3TOD A;  3S2V A;  4LUB A;  1R9Q A;  2DWI A;  3ODB A;  4PF6 A;  4AB6 A;  3FV1 A;  1LBV A;  5I56 A;  2OJT A;  1MY1 A;  4IO6 A;  1PEB A;  1LFH A;  4F22 A;  1FBP A;  3CRB A;  1I6A A;  3MJN A;  1MPB A;  4R6H A;  1LCF A;  3MZ1 A;  2ZNT A;  1BIY A;  3LSF B;  4MIJ A;  2M8C A;  4RYA A;  5I3S A;  1BK4 A;  2HCA A;  4PFT A;  3S9M C;  2XX8 A;  5ELV A;  2ZYM A;  2DOJ A;  4LZ5 A;  1B52 A;  3BIH A;  1CE2 A;  5ET8 A;  1UTB A;  4MLV A;  4NGU A;  4G68 C;  1IQ7 A;  5F24 A;  2I49 A;  3EHT A;  4POX A;  1FQB A;  5I58 A;  3IOR A;  3KN8 A;  4IB2 A;  3EHS A;  1Y9U A;  5IGA A;  4R72 A;  1MY0 A;  4KFQ A;  4JWY A;  1FBE A;  4N8Y A;  4U4S A;  2DXR A;  3PPP A;  2PFZ A;  3C36 A;  2V93 A;  1MXY A;  3IB2 A;  4ZEB A;  3RNN A;  4N17 A;  1BTJ A;  2FBP A;  4G8H A;  1RDY A;  4XKQ A;  4KYD A;  1SW1 A;  2V3U A;  2RC9 A;  5L9M A;  3TTK A;  3UK4 A;  1I6Q A;  2I4C A;  2DDK A;  1OQG A;  2Q8J A;  1FTL A;  3TTM A;  4RNS A;  1NV2 A;  2HZL A;  4ELP A;  1POT A;  1DPP A;  2ONR A;  3ILT B;  3QAX A;  4X1D A;  2V3Q A;  1B3E A;  4ISU A;  2UXA A;  1LGB C;  4NF5 A;  5LDZ A;  2QFL A;  5IZZ A;  2DYX A;  4DIG A;  1VFE A;  4ZZA A;  1FPI A;  3IO4 A;  1FQD A;  2O68 A;  1NL5 A;  4DE8 A;  3RY3 A;  4HS7 A;  5HBC A;  3VLW A;  4Q8R A;  3TMG A;  4QFN A;  2OWS A;  2H9B A;  3LC8 A;  2HPG A;  4ZDM A;  4ELR A;  1DSN A;  2F36 A;  5EQ8 A;  4QSE A;  2BJJ X;  3OEL A;  3HCQ A;  3KSX A;  5H8Q A;  5H8F B;  1VFD A;  5ITO A;  4GF8 A;  2RIN A;  3OO8 A;  3H3G A;  4F3B A;  4U1O A;  2REJ A;  3Q27 A;  3VLU A;  4LQ5 A;  1JNF A;  4MCO A;  3CFZ A;  4DDD A;  3I5O A;  1UTB B;  4JDF A;  1A40 A;  2I3V A;  3V83 A;  3L6G A;  1IMB A;  1A7L A;  2VPN A;  3FJG A;  4L17 A;  4BDQ A;  1ZMG A;  1NV1 A;  3HFU A;  5A5L A;  3BBR A;  4YB5 A;  1PDA A;  4GX3 A;  3E9X A;  1VE4 A;  4P1E A;  4MX6 A;  2FYI A;  5J1D A;  3FGS A;  4HCY A;  4XEQ A;  4NAP A;  2ZYK A;  4PBH A;  3GBB A;  1US4 A;  3D1R A;  2AIX A;  4RPN A;  1NNF A;  1LEV A;  1Y1M A;  1ZTY A;  3EN3 A;  2CMO A;  4GRK A;  3O6I A;  4H67 A;  4OVR A;  4QSD A;  1FW0 A;  3FJM A;  4GBW A;  1A8F A;  3Q29 A;  4PCD A;  3A3U A;  3CVG A;  3VXC A;  2XWV A;  4GX6 A;  2NXO A;  4BDN A;  3C33 A;  4KCC A;  3SEU A;  3PUX E;  1B4H A;  3OO9 A;  4XXU A;  3HV1 A;  1IIT A;  3H6U A;  2DE4 A;  4EQ7 A;  1B1X A;  1A8E A;  4PP0 A;  1JQF A;  3OEK A;  2CEY A;  1NUX A;  1ZIU A;  4NF6 B;  1B7Z A;  1Y20 A;  1Q1K A;  5K2Y A;  4ESW A;  3KJ7 A;  4H65 A;  3Q25 A;  2XXV A;  5M2V A;  5H8H A;  1IMA A;  2Q89 A;  4PTK A;  3DLN A;  2ABH A;  2Y5L A;  3UA8 A;  3V89 B;  4EXL A;  3IJX B;  4EF2 A;  4ZZE A;  2NUV A;  4Z7E A;  2O7I A;  3FAT A;  4AB5 A;  4N81 A;  4PGN A;  3KOS A;  1QKB A;  3SER A;  1H43 A;  4GVO A;  1NV4 A;  4NQ8 A;  5TP9 A;  5FHO A;  5DYH A;  5I2N A;  1BLF A;  3R7X A;  4I1D A;  2WX9 A;  4H5F A;  2QVV A;  4F3G A;  4PE3 A;  3USD A;  4YIC A;  4F2O A;  3G3H A;  4BDM A;  2VHA A;  3MPL A;  1INP A;  1LAX A;  2I58 A;  3EHU A;  1FJ6 A;  1GR2 A;  2Q8M A;  3PUW E;  2Q2C A;  2F7A A;  5H8N A;  5LOM A;  5ISU A;  1B05 A;  3KBR A;  3UP9 A;  2I6E A;  2RF1 A;  3SEW A;  1B5I A;  3IX1 A;  3K6U A;  4FJP A;  4UA8 A;  4N15 A;  3GLB A;  1B0H A;  5CBR A;  4NWC A;  5FTI A;  4DI4 B;  3FIR A;  1IZ1 A;  2Y7K A;  1MQH A;  4MMP A;  4F2Q A;  3V8X B;  2ONK E;  3LUZ A;  3RQT A;  1F9B A;  4F31 B;  5EYG A;  2DSF A;  3KOT A;  3RPL A;  4DI3 D;  5AA4 A;  4FOR A;  4HCW A;  3ZS6 A;  3IOV A;  3FAS A;  1HSE A;  2L5V A;  3IJO B;  2Y7R A;  3IFA A;  2KLF A;  3U65 A;  2ZZV A;  2ALU A;  4G77 A;  3G3K A;  2QS2 A;  5EQ9 A;  2I48 A;  4KQP A;  4MNI A;  1MQD A;  1N0T A;  4HE1 A;  2KQZ A;  4H46 A;  3S9N C;  2WBD A;  4GQO A;  4GXS B;  4WEP A;  3M3K A;  1POY 1;  3B8B A;  4F39 A;  2Z23 A;  3QSL A;  4I8C A;  4G2Z A;  5EYH A;  2E1S A;  5H8F A;  2XWK A;  2ZMB A;  1IMD A;  1MM7 A;  3KEI A;  4LZ8 A;  2G93 A;  1TFA A;  4LZ7 A;  1B58 A;  4QFO A;  1RYO A;  1J1N A;  3B50 A;  1Z7N E;  1II5 A;  1DOT A;  2I0C A;  4BDO A;  1T0K A;  1N84 A;  3F11 A;  4QXD A;  2VT5 A;  1B3G A;  5AA2 B;  4U23 A;  3Q26 A;  4RA1 A;  3RTF B;  4GWW A;  5I7I A;  2D5W A;  4RY1 A;  3OO6 A;  4PFB A;  3I3V A;  3QYT A;  1GTK A;  4YB7 A;  1LAH E;  2YJP A;  4P0I A;  3LSW A;  2QS1 A;  3RPL B;  3VDF A;  2OZZ A;  3PD8 A;  2Q88 A;  3PV0 E;  4XIG Q;  4JSO A;  2H4I A;  2HAV A;  4BDR A;  1IME A;  1MQJ A;  3MP6 A;  1CNQ A;  1FTK A;  3UOR A;  4OES A;  2XXH A;  4MF3 A;  4R9F A;  1FJ9 A;  3HPI A;  3I6V A;  2VD3 A;  3FJ7 A;  2RCA A;  1EYI A;  3PPQ A;  3OO7 A;  5I59 A;  2WBB A;  4EQ9 A;  3V5A A;  4BLA A;  3L6H A;  1XI6 A;  1MY4 A;  4PQJ A;  1DTG A;  5DT6 A;  4ZE9 A;  4PFU A;  3T9U A;  2B65 A;  4JXI A;  1S9T A;  4FED A;  4I9D A;  1FPJ A;  3IO6 A;  3TTR A;  4PE5 B;  4IO5 A;  2F35 A;  3FZV A;  5CRY A;  2DWH A;  4Q0C A;  4ZEF A;  1SPI A;  1O64 A;  1R6Z A;  3HN0 A;  4EQB A;  1D3K A;  1IIW A;  1SW5 A;  1P99 A;  3FVK A;  3DP6 A;  2REG A;  3OXN A;  4DZ1 A;  5ET6 A;  2R71 A;  1XOC A;  3DP8 A;  4R6K A;  2XWO A;  3O66 A;  4P11 A;  3IAZ A;  1B9J A;  5AA2 A;  5LTC A;  2O1L A;  4GD5 A;  3R6U A;  4GL8 A;  3BIG A;  4QHQ A;  4HW8 A;  1H76 A;  3K1N A;  4QF9 A;  3O28 A;  5IKB A;  4P8B A;  2DWJ A;  4C1U A;  4OVP A;  2GH9 A;  4LA9 A;  5I56 B;  4KD5 A;  4HXV A;  3VE1 B;  3W15 C;  1IXG A;  2H5Y A;  5ET7 A;  2YPN A;  1OLA A;  3B7D A;  3UN6 A;  2FNC A;  4OVQ A;  1IMF A;  2DE2 A;  5ET5 A;  3SKP A;  3MYU A;  4YB6 A;  1B32 A;  1Y3P A;  3JV9 A;  1L5T A;  1G0I A;  2RCB A;  3SEV A;  4R2B A;  2H25 A;  1SI1 A;  3GBA A;  5I84 A;  1M5E A;  1A99 A;  3JYR A;  4Q5T A;  5KCJ B;  2FHY A;  4ZE8 A;  4PET A;  1FPK A;  3FVG A;  1SBP A;  4OAN A;  4RJZ A;  3B6T A;  3QK6 A;  2Z8E A;  3TCH A;  1TT1 A;  3TAJ A;  2B4L A;  1B46 A;  4OFJ A;  4P1L A;  1MH4 A;  4N91 A;  5CMB A;  2D21 A;  4LQ2 A;  4LP2 B;  3MVW A;  1DTZ A;  4PAI A;  1Y3Q A;  4JBZ A;  3LBS A;  3C32 A;  3A09 A;  3PUY E;  3CR9 A;  4LVQ A;  1B2H A;  4K3F A;  3FV2 A;  3DP4 A;  2R6G E;  4OVJ A;  1TWY A;  1Y1Z A;  3PMV A;  3HST A;  3O9P A;  1UTH B;  4WKM A;  3ZSF A;  4PGP A;  4PF8 A;  3LR1 A;  4PDH A;  2B3F A;  3K4U A;  3BKI B;  3MZB A;  3C34 A;  3KC0 A;  2OX3 A;  2UVI A;  2IA4 A;  3ZKL A;  5IM2 A;  4IO7 A;  1AMF A;  3N5L A;  4Z0I A;  3H03 A;  3GXA A;  4NWD A;  2OWT A;  3MC2 A;  4KYE A;  4P47 A;  3T1B A;  3K6V A;  1FPB A;  1FBF A;  4ZEK A;  1R9L A;  2ZXT A;  4N6D A;  4YKJ A;  1UTH A;  3IFC A;  3K1M A;  1EZP A;  3D4G A;  1WVJ A;  3FD3 A;  1NV7 A;  1P1U A;  2O7U A;  4GWZ A;  4HE0 A;  3RTW B;  2RC8 A;  2F34 A;  3O6H A;  4G68 B;  3K1P A;  3LV0 A;  1S7Y A;  4JVC A;  2PYY A;  3K01 A;  2O51 A;  3IOW A;  3O29 A;  3CG1 A;  2GHB A;  2Z8F A;  2WYP A;  1LFI A;  4DXB A;  3N6U A;  3EPE A;  4ND9 A;  1USY E;  2W7Y A;  2XD3 A;  1FTO A;  1NNP A;  2X7Q A;  1US5 A;  3M3F A;  4OWD A;  2XXI A;  1D4N A;  5KCJ A;  3RYD A;  2XXR A;  3BFU A;  4IR8 A;  3T96 B;  2XHD A;  2PBW A;  2HHM A;  4YKP A;  1QUI A;  4HE2 A;  3N94 A;  4O3B A;  3ECR A;  4MFI A;  4YU0 A;  4NF5 B;  3PGF A;  1M5B A;  2AYS A;  1M5D A;  5CMM A;  3OEM A;  4ELO A;  2F3B A;  3W9V A;  4POW A;  3UGW A;  3H7M A;  1MM6 A;  3H6W A;  4GOT A;  4FIM A;  1YZ0 A;  3FBP A;  4XTC Q;  3ROJ A;  2Q2A A;  3A29 A;  2QMW A;  5TP9 B;  4YAH X;  4KYS A;  2THI A;  2CZK A;  2HEU A;  3VFJ A;  1YAE A;  1FTA A;  1YTV A;  1LBW A;  1URG A;  4GX4 A;  1QJM A;  4GBV A;  5TPA B;  1FBG A;  2YLN A;  3WAE A;  5H8H B;  5I57 A;  2QMX A;  1N7W A;  2ZZW A;  3LSL A;  2NOO A;  2DQV A;  1K9Z A;  4TLL B;  3C35 A;  1YXI A;  3DM0 A;  2OK2 A;  3TFL A;  3M8U A;  4ESX A;  3D4C A;  4NED A;  4N07 A;  2DE3 A;  4FAT A;  5TU0 A;  4F29 A;  3TQW A;  5AA4 B;  1LFG A;  1D9V A;  4H1X A;  4X1B A;  1PB7 A;  2F78 A;  3P7I A;  2A5T B;  3U93 A;  3B6Q A;  4YMA A;  4N6K A;  2XD2 A;  2XXX A;  4KI0 E;  4KXP A;  1EZO A;  2GQ1 A;  3LSX A;  2R8T A;  4JWX A;  5CMK A;  1TFD A;  5F7V A;  3O97 A;  4X9T A;  4KCD A;  4G8N A;  3CFX A;  3VVF A;  1JW5 A;  3OD7 A;  2G29 A;  4HTG A;  1IUD A;  1LAG E;  2I0B A;  4N13 A;  3E78 A;  2MKZ A;  4PFR A;  1B6H A;  1MXV A;  1ZLQ A;  2PT2 A;  1M5F A;  4C1T A;  1OMP A;  3H6T A;  4R75 A;  5CI5 A;  2E0S A;  4OFO A;  3H4Z A;  1B4Z A;  4E0W A;  1PB8 A;  1RYX A;  3E3K A;  3T9H B;  1XVY A;  2VGQ A;  4H6D A;  3G3G A;  1FPE A;  4YKK A;  4FAJ A;  4DXC A;  2F6G A;  1SW2 A;  4NHB A;  1MXW A;  3S9L C;  1FPG A;  2DS9 A;  2HXW A;  4P9K A;  4YMB A;  4OMB A;  1JEU A;  3CSG A;  4R73 A;  2WYK A;  4NF4 A;  4NTL A;  1FQA A;  4OZ9 A;  4EDP A;  2HFB A;  5ITP A;  5EQA A;  4JVI A;  5I57 B;  4N6P A;  1M5C A;  2AL4 A;  1NUZ A;  3PU5 A;  4ZEI A;  1EYJ A;  1AIV A;  3PD9 A;  4F3P A;  5I2N B;  4RXL A;  1ZBM A;  3FXU A;  4OER A;  5IZ3 B;  2P1S A;  4OFL A;  2UYE A;  3RGY A;  3KN7 A;  4G8M A;  4JSD A;  1LAF E;  2OWZ A;  5JK4 A;  1URD A;  1FTJ A;  4KHZ E;  3RUM A;  3KJT A;  4MJO A;  1SYI A;  3S4U A;  2FIE A;  2HQ0 A;  4QRZ A;  1FRP A;  2F3D A;  4U2R A;  1ZJL A;  4F19 A;  4OET A;  1EU8 A;  4ZED A;  5DEX A;  2QS4 A;  2F6P A;  1ATG A;  1SQY A;  4G4P A;  3T22 A;  1EZ9 A;  2XXQ A;  4E0X A;  4MAG A;  1KWH A;  1EH3 A;  1NUW A;  2AL5 A;  5DVI A;  3QUF A;  2Z8D A;  4PDD A;  1QKA A;  1SD3 A;  4FBP A;  4Q30 B;  3TDJ A;  3M3L A;  1JVX A;  5EHM A;  1LBZ A;  1MS7 A;  4AS5 A;  4JB7 A;  4DCX A;  1SVX B;  3GYY A;  5EHS A;  1AOV A;  1XC1 A;  3SZP A;  3EQ1 A;  1MH3 A;  1FQC A;  4FE8 A;  2IEE A;  2R9J A;  2LAO A;  4TLM B;  3T9V A;  4GWO A;  5EQ7 A;  3TEL A;  3MZ9 A;  2XX7 A;  1B5J A;  1FQF A;  1XHY A;  4OHN A;  1NV6 A;  4H8J A;  2NWJ A;  2O6A A;  4PFW A;  2V3T A;  2ONS A;  1FBH A;  4OEV A;  2XXY A;  1NV0 A;  4OEN A;  4XKP A;  3KBZ A;  2FA7 A;  2XXW A;  1LB9 A;  1KA0 A;  2QVR A;  3U94 A;  2XXT A;  4LAT A;  4DCY A;  1B7H A;  1H3D A;  1Q9D A;  4THI A;  2I3W A;  5CM6 A;  1B1H A;  4ONY A;  2VPO A;  2UVH A;  1O7T A;  2O69 A;  2HZK A;  4LN5 A;  1B5H A;  2WKY A;  1JW1 A;  2FVZ A;  4O7M A;  4FEC A;  3FUZ A;  2DWA A;  5H8Q B;  2GHA A;  5L9O A;  1YCJ A;  4RK2 A;  4NX1 A;  2ESN A;  4U4X A;  1JEV A;  4N8G A;  2ZYO A;  4NG7 A;  2Z22 A;  1RKM A;  2OLB A;  3QIM A;  4NF6 A;  3SET A;  1YYZ A;  4NF4 B;  2P2A A;  1JET A;  4RK9 A;  1FPL A;  1H45 A;  3MST A;  1OIB A;  2VP1 A;  3EKI A;  2O1M A;  4JVD A;  4EXK A;  1B40 A;  3W9W A;  3CFL A;  1QUK A;  3OMB A;  1GGG A;  4GWX A;  3ILU B;  5H8S A;  5JTY A;  1ANF A;  4QFK A;  5DVF A;  3U1O A;  1SI0 A;  1LB8 A;  5AA2 D;  3OEN A;  1RDX A;  2ZNU A;  4R74 A;  1ZKB A;  4QBA A;  5L9S A;  4OVS A;  4H8I A;  4O7I A;  1USY H;  1MY2 A;  2X7P A;  1A54 A;  5DW8 A;  2F8D A;  1LST A;  4MLQ A;  4KR5 A;  1MQI A;  3CIJ A;  3MVY A;  4G68 A;  3RN8 A;  3U8Q A;  5A5X B;  5FBP A;  5DTB A;  3CSB A;  4DXU A;  1DPE A;  1D9Y A;  3IR1 A;  4U22 A;  3TCF A;  1I69 A;  2XXK A;  5I58 B;  4MH5 A;  3A3C A;  4OTE A;  3PUV E;  3Q28 A;  1SYH A;  4F1V A;  4QSC A;  4P3L A;  3R26 A;  4IY6 A;  2RC7 A;  5H8N B;  4MBP A;  4M4G A;  4LON B;  3IB0 A;  4GL0 A;  5AA1 A;  1LBC A;  3TQL A;  2V4C A;  3B6W A;  2VD2 A;  4MNC A;  1B3F A;  3O6G A;  2V25 A;  1PC3 A;  1QW0 A;  3BFT A;  5KDT A;  3THI A;  2QSX A;  2BJI A;  1ZU0 A;  2GRV A;  4IO4 A;  2CZH A;  1NI9 A;  2XA5 A;  4I62 A;  3TKD A;  4NF0 A;  5T3J A;  3SEX A;  4NE4 A;  1I6B A;  3QUJ A;  1LBX A;  4FEB A;  2NVU B;  2P3V A;  1MY3 A;  4PAK A;  3MP1 A;  3KSJ A;  5A5X A;  1DCU A;  4NN3 A;  4IGT A;  4MNP A;  5F1Q A;  2CEX A;  1B0L A;  3VLV A;  3C31 A;  2Y84 A;  1XVX A;  1N76 A;  3QMF A;  3C9H A;  2DVZ A;  2OCU A;  4M1V A;  4EUO A;  2V84 A;  5HPQ A;  4XKR A;  3TUS A;  3VVE A;  3IK6 B;  2P0S A;  3ISP A;  1P1N A;  1TXF A;  4JWO A;  3MQ9 A;  4NMY A;  3FXQ A;  1FBD A;  4AS4 A;  1R1N A;  3NOH A;  1SDX A;  1AH5 A;  1NV5 A;  1NMU A;  5AA3 A;  1N7X A;  4IY5 A;  1KA1 A;  1WDN A;  4R9G A;  3MVZ A;  3OSR A;  2ANJ A;  2P3N A;  2QPQ A;  5DVJ A;  4F1Y A;  3PPN A;  1P1W A;  1UIU A;  3MAM A;  2XX9 A;  2F7B A;  3EF7 A;  3IB1 A;  4GXA A;  2PX1 A;  3FVO A;  3K6W A;  3TZA A;  3E13 X;  4O3C A;  2Q74 A;  4MHF A;  1GVC A;  2HAU A;  4QFL A;  4XKN A;  4O3A A;  5B7D A;  1MXX A;  3MW0 A;  2GFE A;  3VXB A;  3MUQ A;  1FBC A;  1NKX A;  5IZ3 A;  3KGC A;  5I2K B;  1JW4 A;  3U72 A;  4ECF A;  4EF1 A;  5CBS A;  4MEV A;  4TQU Q;  4C0R A;  2CZL A;  4TOZ A;  4P0G A;  3G3J A;  2Y5K A;  3TYH A;  5FHN A;  5AE4 A;  1UQW A;  1PBQ A;  1RDZ A;  1N04 A;  1Q35 A;  3HO7 A;  1LBY A;  1Z7M E;  3IOT A;  3T9X B;  4ZS9 A;  4P56 A;  4IO3 A;  3JZJ A;  3KN3 A;  2PFY A;  4I3Y A;  1QVS A;  1FSA A;  1B3H A;  2UVJ A;  2B4M A;  3TTL A;  4UAB A;  1NV3 A;  3CG3 A;  5KZT A;  1P1Q A;  2CZI A;  4X8R A;  4H45 A;  3VVD A;  3MPK A;  5IZ1 A;  3OOA A;  2PCR A;  4F1U A;  5EYF A;  5I5P A;  1FPF A;  2XWI A;  5ESY A;  2UYF A;  2QVU A;  1BKA A;  1EYK A;  1MRP A;  1ELJ A;  3TCG A;  4H0W A;  2F7C A;  3QXM A;  4OXV A;  1Y4C A;  1LCT A;  5BUU A;  4R2F A;  2XXP A;  3FXB A;  5CMC A;  3MP8 A;  3CI8 A;  1SW4 A;  3PPO A;  3GZG A;  3PMX A;  3G3I A;  1N3W A;  3CHG A;  4GWU A;  4QFP A;  3SDF A;  3FXR A;  3MVX A;  1AL3 A;  3WAF A;  5DEX B;  3FVN A;  3K02 A;  3HHF A;  4OYV A;  1MDP 1;  1QUL A;  1IXH A;  3KFM A;  2B3B A;  5ICQ A;  2RKM A;  1IMC A;  2H99 A;  4GLI A;  3AXF A;  2XXU A;  4NF8 B;  3KZG A;  1XT8 A;  1NNK A;  1K9Y A;  1Y3N A;  1G0H A;  1LBB A;  4F18 A;  5BWJ A;  4F3S A;  2QL3 A;  5B70 A;  3IOU A;  3RLF E;  3K6X A;  3N6T A;  2F97 A;  1B7U A;  1URS A;  2DP8 A;  1B51 A;  3N26 A;  3UIF A;  5TPA A;  4I3E A;  1OVB A;  2Q9T A;  1UIV A;  4IGR A;  1MXZ A;  1S50 A;  2HXR A;  1OLC A;  4PBQ A;  3U92 A;  4PFI A;  4WXJ A;  4YKI A;  1YPN A;  3MWB A;  1JP4 A;  1GV8 A;  2QS3 A;  1NH7 A;  5HM4 B;  3S9E A;  1PBP A;  3ZKK A;  3O2A A;  5FHM A;  3TPA A;  2Y7W A;  1HSL A;  4GIZ A;  5KDT B;  1JVY A;  1NH8 A;  1HSJ A;  2A5S A;  3DEL B;  1AWB A;  4PAF A;  4PFY A;  2PT1 A;  1DMB A;  4NF8 A;  1B3L A;  2X26 A;  3T66 A;  1PB9 A;  3MBP A;  3E79 A;  5JEI A;  1O63 A;  4U21 A;  3RT8 A;  2JJK A;  4AQ4 A;  1VDW A;  4BDL A;  3HHG A;  4U1Z A;  3KG2 A;  3ONM A;  1D9Q A;  4GWY A;  1KZ8 A;  5FTH A;  1MPC A;  2ZNS A;  1FPD A;  5IAI A;  5I59 B;  5J16 A;  2A5T A;  1MQG A;  5CC2 A;  1FQE A;  1OVT A;  3K2D A;  1VR5 A;  4UAC A;  1NUY A;  2KR0 A;  1MXU A;  1MPD A;  3PTY A;  1WOD A;  1IEJ A;  1OQH A;  4DLD A;  1QGX A;  1DBZ A;  4GWS A;  1FTM A;  3PMW A;  4XFE A;  4IO2 A;  2QJE A;  2Y7P A;  1NFT A;  3K00 A;  1N3X A;  4PC9 A;  3RT6 B;  1CB6 A;  2FIX A;  2ZYN A;  3G7W A;  4G61 A;  4OEU A;  2Y7I A;  2H98 A;  1A55 A;  2QRY A;  1XS5 A;  1DK4 A;  4N4U A;  2PVU A;  2UVG A;  3T0J A;  1LLS A;  1NNT A;  3KC1 A;  3E4R A;  4OA4 A;  1IXI A;  4X04 A;  3TEP A;  2OBG A;  2PMS A;  3VV5 A;  1P1O A;  1MDQ A;  5I2K A;  1QUJ A;  2VOZ A;  1Y4T A;  3LUY A;  5ICT A;  1FCK A;  4O94 A;  2D3I A;  3K0V A;  4KPT A;  1VSO A;  3C4M A;  1IXC A;  4X48 A;  3TTN A;  3IL1 B;  4RPO A;  2O84 X;  4GFR A;  3RPW A;  5JTY B;  2I4B A;  4ELQ A;  4XF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...