5J1DA

X-ray crystal structure of phosphate binding protein (pbp) from stenotrophomonas maltophilia
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
373
structure length
373
Chain Sequence
ATAVTGGGASLPADLYKGSADSILPANFSYAVTGSGTGKKAFLENNSALFSTTGTVHFAGSDSVLSSTELNTYNSTYNVSGDANRYGALVQIPSVATSVTIPFNKAGSAVDLSVTQVCGIFSGKITSWSQLAGLGRTGDIQVVYRGESSGTSELLTRFLTSACQPADVSSSNLKLTNGVPAFSVQSTFANLFTTVPSNFIAAPATGGTALYNAVYAIDGRVGYVGPDAIPSLTDATKVAKVKGFSPDEVSVQATLETAAPPTGAAAENPANWVPVFGNPSAGYPIAGYTNFVFGQCYKNATVGANVRGFLTKHYGSTVVNGVEQGPNDVAIRAHKFIPLTKAWRDAVRARFATATNAGAVNNPATCSGIGRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Phosphate binding protein
publication title Determination of crystal structures of proteins of unknown identity using a marathon molecular replacement procedure: structure of Stenotrophomonas maltophilia phosphate-binding protein.
pubmed doi rcsb
total genus 118
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2016-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5j1dA02
3.40.190.260 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5j1dA01
1P1WA 4XIGQ 4U21A 1IXHA 4PETA 3MVYA 1ZJLA 2Z8DA 1I6AA 5JTYA 4YKIA 1O7TA 2QJEA 1HSEA 1OIBA 1UTHB 3TTRA 3K02A 3MZ1A 1XOCA 1MQJA 4O3BA 2B3FA 2F36A 3KEIA 3FZVA 4THIA 4KCCA 1H45A 4OFJA 4GWOA 4NF5A 2G29A 2M8CA 4BDMA 3RN8A 4X1BA 3VE1B 3IJOB 2XXPA 4G68B 2ONKE 3S9MC 2FA7A 1QJMA 4WKMA 4U2RA 3I6VA 2F35A 4NMYA 3G3KA 4MH5A 3A3UA 5ICTA 3IAZA 1RKMA 3CR9A 1DPPA 1LGBC 2UXAA 3KN3A 3QIMA 3C32A 2HFBA 5ITOA 3QYTA 2DSFA 3QUFA 3OO9A 4LP2B 4UACA 1DSNA 1H43A 4EXKA 3OO7A 4UA8A 5H8QA 2DYXA 3B6QA 2HZLA 4ELPA 3MQ9A 1D3KA 1AOVA 2AYSA 5LOMA 4ESWA 3O9PA 2REGA 1MS7A 2OJTA 5F1QA 1N76A 4PQJA 1MPCA 4MBPA 2F7CA 4POWA 2IA4A 2REJA 1OVTA 2QS4A 1PEBA 3TQLA 3FD3A 4F29A 3O2AA 5I58B 4GRKA 4F22A 2B3BA 2XX7A 3O6HA 4G2ZA 3K4UA 3PGFA 4U1ZA 1TT1A 3ZKKA 3EHSA 4IGTA 4GFRA 3O29A 1B5JA 2XXWA 4FAJA 4XKQA 4FEBA 4BDNA 2ZYKA 4G68A 3PMXA 3G3JA 4U1OA 4R74A 3K00A 4X9TA 4TQUQ 5AA2A 1MY3A 3TUSA 4H8JA 3TDJA 3PV0E 5L9MA 3LUYA 3TCFA 2ONRA 2R9JA 1FQCA 2DS9A 3M3FA 1MPBA 3UIFA 3MAMA 2HQ0A 2UVJA 4HW8A 5H8FB 2DE3A 5I56A 4F1YA 1P1NA 2HAUA 3H7MA 4L17A 4F2OA 4MFIA 4NF6B 3FVOA 2RCAA 2H4IA 3S9LC 2CMOA 2PBWA 3MC2A 1B4HA 2UYEA 1DPEA 3S9EA 1LFGA 2Y7IA 4PFTA 2R6GE 4YKKA 1EZ9A 1IITA 1NNTA 2VD3A 4GVOA 3DP4A 1CE2A 3CFXA 5CMKA 1I69A 1OQHA 1VE4A 2ZYMA 4OESA 3CFLA 4G8HA 3I3VA 5CMBA 1B7UA 3KGCA 5CBSA 3B7DA 1UQWA 1LB9A 3EF7A 3O6IA 1S9TA 1SDXA 1DOTA 1QW0A 2DQVA 1AH5A 1Z7NE 3N6UA 2HXWA 2F34A 1A8EA 4O3CA 1SQYA 4LQ2A 1ELJA 4NF8B 2VP1A 3KZGA 3SETA 5I2NA 1EZPA 3GXAA 4PFUA 3PD9A 4FORA 1N3WA 3ILUB 1R9QA 3C9HA 4DXCA 1POTA 1MXWA 4QFNA 5TPAA 2RC8A 1JW1A 5H8FA 3VDFA 3OOAA 3SKPA 4KYSA 3VXBA 1MQGA 2GH9A 1WVJA 3KOTA 5TP9B 4F1VA 1D4NA 4IGRA 4NF6A 2Q8JA 3TYHA 4MLVA 3K1NA 4I8CA 4R6YA 5CMMA 5IKBA 4FATA 1US4A 3HPIA 4OERA 2Q89A 3IL1B 3CI8A 4ESXA 2F7BA 1SW4A 2W7YA 1Y3PA 2Z22A 2A5TA 1Z7ME 3MZ9A 4PE5B 3MPLA 5M2VA 3RPWA 1SW5A 4DE8A 1VSOA 4I9DA 4G77A 5CMCA 1II5A 4QF9A 4R2BA 4R75A 5AA4B 3KFMA 1B40A 4ZEBA 1M5DA 3CSBA 1MXYA 3O28A 4H8IA 3O97A 3QUJA 4YMBA 1B58A 1Y3QA 2V93A 3KJTA 1NNFA 5DYHA 4IY5A 2XXHA 2DP8A 1UIUA 1RYXA 4YU0A 1SI1A 3Q29A 1JVYA 2O51A 3HSTA 4XTCQ 1FQBA 4H1XA 1PBPA 4EQBA 1Y3NA 4KR5A 2FYIA 5K2XA 3V5AA 5JTYB 2QMXA 2G93A 5DVFA 1JQFA 1YAEA 2ZYOA 3H06B 2I48A 2R71A 4EF2A 3FVNA 4BDQA 5HPQA 4NF5B 4OYVA 4QFLA 1PB8A 5L9OA 2YPNA 5L9SA 4H6DA 4X48A 3EPEA 3C36A 4ELOA 4POXA 2I3WA 4QFKA 3O66A 4DLDA 3RGYA 3JYRA 4LQ5A 4M1VA 4QSDA 4JDFA 4RXLA 2WKYA 5I2KB 3W15C 2OCUA 5AA4A 1B3HA 5FHOA 2QSXA 3T93B 5FTHA 4BDRA 4H5GA 3O6GA 1M5BA 3RNNA 1T0KA 1P1QA 5FHMA 1TXFA 4GXSB 1A8FA 1BIYA 3TCHA 1BLFA 2DE4A 2XHDA 4EF1A 3HHFA 5H8QB 2UVGA 3H6VA 3PUZE 1SVXB 3VLUA 3T9UA 1S50A 4DXBA 1B0LA 3FXQA 4BLAA 4RPOA 4KHZE 2I4CA 3PPQA 4DCXA 3IR1A 4RJZA 1HSLA 3OENA 1NKXA 1N3XA 1Y20A 3IOUA 1LAXA 3C35A 4KD5A 3TQWA 2P1SA 3C31A 1PDAA 2GFEA 3PUVE 3RLFE 1A54A 3HHGA 2O7UA 5EHSA 3QXMA 3Q28A 2O69A 4F39A 2H99A 3R7XA 3K01A 4RNSA 3WAFA 2OK2A 1Y4TA 3CRBA 4WEDA 5AA2B 4GQOA 3TTLA 3JZJA 3OSRA 2B65A 2XXRA 1N04A 3RY3A 5I2KA 2XXQA 2NXOA 4R6HA 2VHAA 4Q30B 3UN6A 3RUMA 1MPDA 3SEVA 1I6QA 5EHMA 1B3EA 4C0RA 3R26A 3GZGA 5I56B 1XS5A 1S7YA 4QFOA 1MDQA 1ZLQA 1D9YA 1LCFA 3V8XB 4PFWA 3BFUA 3LSXA 3DELB 3GLBA 3UK4A 2Y7PA 3U94A 2HEUA 1IEJA 2O68A 3MP1A 5DTBA 4ZZEA 1M5FA 3HCQA 4GOTA 1MRPA 2I49A 1VR5A 2O1LA 2HZKA 1LCTA 1XHYA 1P1UA 2Q2CA 4OEVA 1MQHA 3C4MA 4F3PA 1FTKA 3G3IA 1URGA 1FTLA 2Z23A 4OEUA 2DVCA 4OETA 4BDOA 1TFAA 2OZZA 4G8MA 4RY1A 5FTIA 2CZLA 2O7IA 3OSQA 4ELRA 4ZEDA 3KOSA 2F8DA 2Y7RA 4IY6A 5I2NB 2DXRA 3ODBA 4YB5A 4FIMA 4ZZAA 1O64A 3EQ1A 5KDTA 5KZTA 1USYH 3P7IA 1NH7A 2V3UA 1IIWA 3TODA 2XXTA 3DP8A 4R9GA 2RINA 4JB7A 5TPAB 1IQ7A 3Q25A 3H3GA 2XXIA 3THIA 2I3VA 3FIRA 3TZAA 3LSWA 2QMWA 1PB7A 3VLWA 1NMUA 2I0BA 3G3GA 4F3SA 4Z7EA 5H8SA 3RTFB 4F1UA 2QL3A 1UTBB 1IXGA 4LZ8A 3K6WA 3SDFA 1H44A 4TOZA 2D3IA 2ZYNA 3H4ZA 4JWOA 4YKJA 2FNCA 4JWXA 4OTEA 4R2FA 2H98A 4Q8RA 1MH4A 4DXUA 2P0SA 5ICQA 5DVIA 3FASA 1JETA 4EUOA 3ZS6A 2A5TB 4ZDMA 2VGQA 5AE4A 3TEPA 3N94A 4YMAA 5CC2A 5AA2D 3U92A 3KG2A 4R73A 2OWSA 3EN3A 1MY2A 3TFLA 3OEKA 2XX9A 3G7WA 2H25A 1XVXA 4R72A 4Q5TA 3L6HA 2GRVA 4R9FA 5AA3A 1H76A 2O1MA 3TCGA 3T96B 3SESA 1MY1A 3UORA 1NNPA 4DIGA 3VLVA 1BKAA 2V25A 2Q88A 1JNFA 3IX1A 3R6UA 4HCWA 1QUJA 2UVHA 3Q26A 2DXYA 1B0HA 1LAHE 3VV5A 1TFDA 4KQPA 3UGWA 3SEYA 3MVZA 1EU8A 4HTGA 3TTMA 4YKPA 3EHTA 3F11A 4FE8A 4NEDA 1B3FA 4F19A 2A5SA 3H6UA 1MXVA 1MXZA 4IO5A 1QULA 1OVBA 4AB6A 1UTBA 1B1HA 3K1PA 1M5CA 4PP0A 3SEWA 1MY0A 1MDP1 3C33A 1JEVA 3IK6B 5DEXA 4E0WA 4Q0CA 3MP6A 1IZ1A 2Z8EA 1A99A 3B6WA 3VVEA 5L8DA 3IOTA 2D21A 4F2QA 2XXVA 3M8UA 3FUZA 5ITPA 3SEXA 5K2YA 3KJ7A 1SW2A 5FHNA 1VFDA 1UIVA 1R1NA 3TELA 2NVUB 4HCYA 1B5HA 2XD2A 1Y9UA 2NOOA 4AB5A 3PPPA 3FVKA 5I57B 2F97A 2UVIA 2Y84A 2F6PA 3MUQA 4RK9A 1MG1A 4H67A 2HCAA 3BBRA 5KCJA 1N84A 3VVFA 1LB8A 2GHAA 4H65A 5F7VA 3CSGA 4LUBA 4ZS9A 2ALUA 2XXXA 3IOVA 1Y1ZA 1SBPA 1FW0A 3TMGA 2XXUA 4JWYA 4HS7A 5JEIA 4ELQA 4ISUA 3FXUA 1MQIA 3SERA 4ECFA 3H6TA 3G3FA 3K0VA 1FQDA 3S2VA 3ZSFA 1BP5A 3CG3A 1OLAA 4JSOA 4XXUA 4OWDA 2PMSA 2ZNSA 3FJMA 4P11A 3PU5A 1N7XA 3CFZA 4LATA 3KN8A 3TTNA 1OMPA 1XVYA 3N5LA 5ISUA 4KYDA 3KBRA 4GIZA 4KCDA 1EH3A 5AA1A 4KFQA 4KI0E 5CRYA 4TLMB 4EQ9A 4EDPA 5A5XA 3E3KA 5BUUA 3VFJA 4C1UA 3OXNA 2VOZA 5I84A 5IAIA 4EQ7A 3OEMA 4KYEA 2V3TA 4IO4A 3KSJA 3K6VA 5I57A 3IB1A 1P1OA 3GBBA 1DMBA 1XC1A 4OQOA 5TU0A 2GHBA 2THIA 2AL4A 1R6ZA 1LFHA 1JVXA 3FJGA 1SYHA 2H5YA 4RPNA 1MQDA 2XX8A 4G68C 1LAGE 3PUWE 4C1TA 1B05A 2DWIA 1B5IA 4JSDA 4F3GA 4LVQA 3EHUA 3ONMA 3A3CA 3H03A 4LZ7A 1MXXA 4U22A 3IB0A 1GVCA 1PB9A 2XD3A 3RTWB 3QSLA 4F31B 4IB2A 2OWTA 3RQTA 5CI5A 2F5XA 5H8NB 4TLLB 4YAHX 4OHNA 4U4XA 1QUKA 4XKRA 2Q2AA 3MP8A 2RF1A 3U8QA 3L6GA 4GLIA 1MY4A 3G3HA 4X1DA 4ZEKA 5CM6A 1N7WA 1NFTA 1AMFA 2KLFA 3OD7A 4GD5A 1JEUA 3MZBA 1JW5A 4OVJA 1A40A 2RCBA 3QK6A 1B3LA 1ATGA 5BWJA 1POY1 5KDTB 1MM6A 3IJXB 5EYFA 1GV8A 1B52A 1O63A 4P0GA 4M4GA 1L5TA 2RC9A 1QKAA 2QS2A 1PC3A 3MBPA 1MH3A 2UYFA 3PUXE 4O3AA 3VXCA 1B7HA 1ANFA 2ONSA 1SYIA 2F7AA 3TTKA 4FJPA 3T9HB 1LSTA 3CIJA 4DZ1A 4I1DA 4N07A 2X7PA 3FVGA 2Z8FA 2PT1A 4XKPA 4GL0A 5H8NA 2D5WA 3MPKA 3MVWA 1AL3A 3QAXA 2Q9TA 1H3DA 3C34A 4GF8A 3MWBA 4MF3A 1UTHA 4NE4A 1GR2A 1P99A 2ZNUA 4OFLA 3DP6A 2BJJX 1FTJA 4RK2A 2OLBA 3ILTB 4ZEIA 4MLQA 4LZ5A 4FEDA 1FQEA 1D9VA 3M3LA 3IORA 2ESNA 3S9NC 3K6XA 2O6AA 3PUYE 3GBAA 1B51A 4KPTA 4JXIA 3FATA 2DOJA 4F3BA 5JK4A 3KSXA 1SW1A 4F18A 3T9VA 1KWHA 1R9LA 4LONB 3K2DA 3PPNA 1B9JA 4ONYA 3T22A 4H0WA 4IO2A 3PMWA 1YCJA 4OENA 2PT2A 1YTVA 4FECA 4GL8A 3PD8A 4I62A 2E1SA 2IEEA 3UA8A 1ZU0A 5J1DA 4H5FA 5DT6A 3IO6A 5HM4B 3PMVA 5DEXB 3WAEA 4NTLA 1ZTYA 3PPRA 3M3KA 2QPQA 2ZMBA 1OQGA 1WODA 2ZXTA 4G8NA 1OLCA 1LBCA 4G4PA 3V89B 1SI0A 3Q27A 3DM0A 4ND9A 1N0TA 3S4UA 4NF4B 1LFIA 3MW0A 4DDDA 1CB6A 2ABHA 1Y1MA 2Y7WA 1A7LA 2O84X 5I58A 3N26A 4QSEA 3IOWA 2AIXA 5ELVA 1B6HA 2YLNA 3JV9A 4Z0IA 4E0XA 4WEPA 3TAJA 3E13X 3HN0A 3E9XA 4EXLA 1VFEA 1RYOA 3SEUA 2AL5A 3U93A 1ZBMA 2I6EA 2PYYA 1URSA 1B3GA 3K1MA 3U72A 1URDA 2VD2A 5KCJB 4U4SA 5H8HB 3K6UA 2YJPA 3ZKLA 1LBBA 5B70A 1GGGA 2I58A 1USYE 5I59B 2Y7KA 3CG1A 4IO3A 3U1OA 4U23A 4ZECA 3HO7A 1YPNA 5DVJA 1FQAA 1PBQA 3RT8A 1M5EA 4IO7A 1MM7A 2I4BA 3T9XB 4ZE9A 1B4ZA 1B32A 2I0CA 1WDNA 3UP9A 4P0IA 4N13A 4YB7A 4OXVA 2H9BA 1FTOA 1SD3A 3I5OA 1I6BA 3W9VA 5CBRA 4OMBA 4NF4A 1Q35A 2QS1A 3H6WA 2HAVA 1Q1KA 4JBZA 2DWHA 1DTZA 3N6TA 3A09A 1US5A 4OZ9A 2F6GA 1ZKBA 2RKMA 5A5XB 1ZIUA 3VVDA 4WXJA 2DE2A 3D4GA 1NH8A 4ZE8A 3MJNA 1HSJA 1IXIA 2ANJA 1QUIA 4QRZA 3LSFB 1FTMA 4YZZA 3OO6A 3LBSA 4YB6A 4PFYA 3CVGA 3PPOA 4N6PA 3RT6B 5HBCA 1B7ZA 1JW4A 3AXFA 4AQ4A 5B7DA 3BFTA 4NF8A 3HV1A 1DTGA 3LC8A 1Y4CA 3USDA 1AIVA 2RC7A 5H8HA 3IB2A 4YICA 3D4CA 4GXAA 2X7QA 1FCKA 4QHQA 4RYAA 1J1NA 1B1XA 1IUDA 1IXCA 5I59A 2DVZA 3LSLA 3FGSA 1EZOA 1NNKA 2DWAA 3FJ7A 1A55A 2P2AA 3ECRA 2QRYA 2V3QA 3OMBA 3W9WA 4BDLA 4OFOA 3B6TA 1GTKA 2DWJA 5TP9A 2LAOA 4LA9A 4ZEFA 1TWYA 1B46A 4XKNA 2NWJA 2X26A 3IO4A 2OBGA 1MXUA 2PVUA 3MVXA 2ZNTA 4K3FA 4QFPA 2F78A 3TKDA 1LLSA 3FXRA 1BTJA 1F9BA 1FQFA 1LAFE 3T66A 4NWCA 3OO8A 3V83A 2QS3A 3E4RA 2NUVA 4QSCA 4R6KA 2XXYA 4NWDA 3FV1A 2V84A 2E0SA 2PX1A 1QKBA 3TPAA 1ZMGA 3LR1A 1NL5A 4DCYA 1XT8A 3KN7A 4RA1A 1QVSA 3OELA 1B2HA 3DLNA 4IO6A 3FV2A 3BKIB
chains in the Genus database with same CATH superfamily
1P1WA 4XIGQ 4U21A 1IXHA 4PETA 3MVYA 2WX9A 4DI4B 1ZJLA 1INPA 2Z8DA 1I6AA 5JTYA 4YKIA 1O7TA 2QJEA 1HSEA 1OIBA 1UTHB 1FBPA 4JVIA 3TTRA 3K02A 4GWZA 3MZ1A 1XOCA 2FIXA 1MQJA 4O3BA 2B3FA 2F36A 3KEIA 3FZVA 4THIA 4GBWA 2XWVA 2FBPA 4KCCA 1H45A 4OFJA 4GWOA 4NF5A 2G29A 2M8CA 4BDMA 3RN8A 4X1BA 3VE1B 3IJOB 2XXPA 4G68B 3RPLA 4X04A 2ONKE 4XF5A 3S9MC 2FA7A 4N8YA 1QJMA 4WKMA 4U2RA 1KA0A 3I6VA 2F35A 4NMYA 2V4CA 5A5LA 3G3KA 4MH5A 3A3UA 5ICTA 3IAZA 1RKMA 3CR9A 1DPPA 5EQ8A 1LGBC 2UXAA 3KN3A 3QIMA 4HE2A 3C32A 1DK4A 2HFBA 5ITOA 1FPBA 3QYTA 4HXVA 2DSFA 3QUFA 1FBHA 3OO9A 4LP2B 4UACA 4P9KA 1DSNA 1H43A 4EXKA 3OO7A 4UA8A 5H8QA 2DYXA 3B6QA 3A29A 2HZLA 4ELPA 3MQ9A 1D3KA 1AOVA 2AYSA 5LOMA 4ESWA 3O9PA 2REGA 2R8TA 1MS7A 2OJTA 5F1QA 1N76A 4PQJA 1MPCA 4MBPA 2F7CA 4POWA 2IA4A 2REJA 4OVRA 1OVTA 2QS4A 1PEBA 3TQLA 3FD3A 1IMCA 4JVDA 1D9QA 4F29A 3O2AA 5IZ3A 5I58B 4GRKA 4PDHA 4F22A 2B3BA 2XX7A 3O6HA 4G2ZA 3B8BA 3MSTA 1FPFA 3K4UA 3PGFA 4U1ZA 5T3JA 1TT1A 3ZKKA 3EHSA 4IGTA 4GFRA 3O29A 1B5JA 2XXWA 4MAGA 4FAJA 4XKQA 4FEBA 2WBBA 4BDNA 2ZYKA 4G68A 4IR8A 5IZZA 3PMXA 3G3JA 4U1OA 4R74A 3K00A 4PF6A 4X9TA 4TQUQ 5AA2A 1MY3A 3TUSA 4H8JA 3TDJA 3PV0E 5L9MA 3LUYA 3TCFA 2ONRA 4X8RA 2R9JA 1FQCA 2DS9A 3M3FA 1MPBA 3UIFA 4PE3A 5IM2A 3MAMA 2HQ0A 2UVJA 4HW8A 5H8FB 2DE3A 5I56A 4F1YA 1P1NA 2HAUA 3H7MA 4L17A 4F2OA 4MFIA 4NF6B 4MHFA 3FVOA 2RCAA 2H4IA 3S9LC 2CMOA 2PBWA 3MC2A 1B4HA 2UYEA 1DPEA 2FVZA 3S9EA 1LFGA 2Y7IA 4PFTA 2R6GE 4YKKA 1EZ9A 2F3DA 1IITA 1NNTA 2VD3A 4GVOA 3DP4A 1CE2A 3CFXA 1IMFA 5CMKA 1I69A 2KQZA 1OQHA 4N6DA 1FPJA 1VE4A 2ZYMA 4OESA 3CFLA 4G8HA 3I3VA 5CMBA 2HHMA 4NAPA 1B7UA 3KGCA 5CBSA 3B7DA 1UQWA 1LB9A 3EF7A 3O6IA 1S9TA 1SDXA 1DOTA 2QVRA 1QW0A 2DQVA 1AH5A 2GQ1A 1Z7NE 3N6UA 2HXWA 2F34A 1A8EA 4O3CA 1SQYA 3ROJA 1FBGA 4LQ2A 1ELJA 4NF8B 2VP1A 3KZGA 3SETA 4OVPA 5I2NA 1EZPA 3GXAA 3B50A 4PFUA 5LTCA 3PD9A 4FORA 1N3WA 3ILUB 1R9QA 4PAFA 2XWIA 3FXBA 3C9HA 4DXCA 1POTA 1MXWA 4QFNA 5TPAA 1EYJA 2RC8A 1JW1A 5H8FA 3VDFA 2XWOA 3OOAA 3SKPA 4GBVA 4KYSA 3VXBA 1MQGA 2GH9A 5LDZA 1WVJA 3KOTA 5TP9B 4F1VA 1D4NA 4IGRA 4NF6A 1G0HA 2Q8JA 3TYHA 1KA1A 2JJKA 4MLVA 3K1NA 4I8CA 4R6YA 5CMMA 5IKBA 4FATA 1LBXA 1US4A 3HPIA 4OERA 2Q89A 3IL1B 3CI8A 4ESXA 2F7BA 1SW4A 2W7YA 1Y3PA 2Z22A 2A5TA 1Z7ME 3MZ9A 4PE5B 3MPLA 5M2VA 3RPWA 4PGPA 1SW5A 4DE8A 1VSOA 4I9DA 4G77A 5CMCA 1II5A 4QF9A 4R2BA 4R75A 1NI9A 4UABA 5AA4B 1NUXA 5EYGA 3KFMA 1B40A 4ZEBA 1M5DA 4I3YA 3CSBA 1MXYA 3O28A 4H8IA 3O97A 3QUJA 4YMBA 1B58A 1Y3QA 2V93A 2Y5KA 3KJTA 1NNFA 5DYHA 4IY5A 2XXHA 2DP8A 1UIUA 1RYXA 4YU0A 4GX4A 4DI3D 1SI1A 3Q29A 1JVYA 2O51A 3GYYA 4MNPA 1FRPA 3HSTA 4XTCQ 1FQBA 4GWUA 4H1XA 1PBPA 4PBQA 4EQBA 1Y3NA 2CZKA 4KR5A 2FYIA 5K2XA 3V5AA 5JTYB 2QMXA 2G93A 5DVFA 4PDDA 1JQFA 1YAEA 2ZYOA 3H06B 4AS5A 1BK4A 2I48A 2R71A 4EF2A 3FVNA 4BDQA 1RDYA 5HPQA 4NF5B 4OYVA 4QFLA 3U65A 1PB8A 5L9OA 2YPNA 5EQ9A 5L9SA 4H6DA 4X48A 3EPEA 3C36A 4ELOA 4POXA 2I3WA 4QFKA 3O66A 4DLDA 3RGYA 3JYRA 4LQ5A 2HXRA 4M1VA 4QSDA 4JDFA 4RXLA 2WKYA 5I2KB 3W15C 2OCUA 4P8BA 5AA4A 1B3HA 5FHOA 1CNQA 2QSXA 3T93B 1FBCA 5FTHA 4BDRA 4H5GA 3O6GA 1M5BA 4PAKA 1FPDA 3RNNA 4NGUA 1T0KA 1P1QA 5FHMA 1TXFA 4GXSB 1A8FA 1BIYA 3TCHA 1BLFA 2DE4A 2XHDA 4EF1A 3HHFA 5H8QB 2UVGA 3H6VA 3PUZE 1SVXB 3VLUA 3T9UA 3HFUA 1S50A 4N6KA 4DXBA 1B0LA 1FPGA 4MNCA 3FXQA 4BLAA 4RPOA 4KHZE 2I4CA 3PPQA 4DCXA 3IR1A 4RJZA 1HSLA 4I3EA 3OENA 1IMAA 1NKXA 1N3XA 1Y20A 1YXIA 1FBDA 3IOUA 5IZ3B 2QFLA 1LAXA 3C35A 1NV1A 4KD5A 3TQWA 2P1SA 3C31A 1PDAA 4N8GA 2GFEA 2HPGA 3PUVE 3RLFE 4PBHA 3T0JA 1A54A 3HHGA 4O7IA 2DDKA 2O7UA 5EHSA 3QXMA 3Q28A 2O69A 4F39A 2H99A 3R7XA 3K01A 4RNSA 2OK2A 3WAFA 1Y4TA 3CRBA 4WEDA 5AA2B 4GQOA 3TTLA 3JZJA 3OSRA 2XXKA 2B65A 2XXRA 4GWWA 4GWYA 5FBPA 1N04A 3RY3A 5I2KA 2Q8MA 2XXQA 2NXOA 4R6HA 2VHAA 4Q30B 3UN6A 3RUMA 1DCUA 1MPDA 3SEVA 1I6QA 5EHMA 1B3EA 4C0RA 3R26A 3GZGA 4O7MA 5I56B 1XS5A 1S7YA 5ESYA 4QFOA 1MDQA 1ZLQA 4PF8A 4NF0A 1D9YA 1LCFA 3V8XB 4PFWA 3BFUA 3LSXA 3DELB 3GLBA 3UK4A 2Y7PA 3U94A 2HEUA 1IEJA 2P3NA 2O68A 3MP1A 5DTBA 4ZZEA 1M5FA 3HCQA 4GOTA 1MRPA 2I49A 3KC1A 1RDZA 1VR5A 2O1LA 2HZKA 1LCTA 5IGAA 1XHYA 1P1UA 2Q2CA 4OEVA 1MQHA 3C4MA 4F3PA 1FTKA 4OVTA 3G3IA 1URGA 1FTLA 2Z23A 4NX1A 4OEUA 3E78A 2DVCA 4OETA 4BDOA 1FTAA 1TFAA 2OZZA 1FJ6A 4NQ8A 4G8MA 4RY1A 5FTIA 2CZLA 2O7IA 3OSQA 3SZPA 4ELRA 4ZEDA 3KOSA 2F8DA 2Y7RA 4IY6A 2QVUA 1IMEA 5I2NB 2QVVA 2DXRA 3ODBA 4YB5A 4FIMA 4ZZAA 1O64A 3EQ1A 4PCDA 5KDTA 5KZTA 2XA5A 1USYH 3P7IA 1NH7A 2V3UA 1IIWA 3TODA 2XXTA 3DP8A 4R9GA 2RINA 4JB7A 5TPAB 1IQ7A 3Q25A 3H3GA 2XXIA 3THIA 2I3VA 3FIRA 3TZAA 3LSWA 2QMWA 1PB7A 3VLWA 1NMUA 2I0BA 1IMBA 3G3GA 4OVQA 4F3SA 4AS4A 4Z7EA 5H8SA 4MEVA 3RTFB 4F1UA 2QL3A 1UTBB 1IXGA 4LZ8A 3K6WA 3SDFA 1H44A 4TOZA 2D3IA 2ZYNA 3H4ZA 4JWOA 4YKJA 2FNCA 4JWXA 1NV6A 4OTEA 4R2FA 2H98A 4Q8RA 4JVCA 1MH4A 4DXUA 2P0SA 5ICQA 5DVIA 3FASA 1JETA 4EUOA 3ZS6A 2A5TB 4ZDMA 2VGQA 5AE4A 3TEPA 3N94A 4YMAA 5CC2A 5AA2D 3U92A 2KR0A 3KG2A 4R73A 2OWSA 3EN3A 1MY2A 3TFLA 3OEKA 3T1BA 2XX9A 3G7WA 2H25A 1XVXA 4R72A 4Q5TA 3L6HA 2GRVA 4R9FA 2VPOA 5AA3A 1H76A 2O1MA 3BIHA 3TCGA 3T96B 3SESA 1MY1A 3UORA 1NNPA 4DIGA 3VLVA 3BIGA 1BKAA 2V25A 2Q88A 1JNFA 3IX1A 3R6UA 4HCWA 5I3SA 1QUJA 2UVHA 3Q26A 2DXYA 2XWKA 1NV5A 1B0HA 1LAHE 3VV5A 1TFDA 4KQPA 3UGWA 3SEYA 3MVZA 2CZIA 1EU8A 4HTGA 4O8MA 4P47A 3TTMA 4YKPA 3EHTA 3F11A 4FE8A 1SPIA 4NEDA 1B3FA 4F19A 2A5SA 3H6UA 1MXVA 1MXZA 3NOHA 4IO5A 1QULA 1OVBA 4AB6A 1UTBA 1B1HA 3K1PA 1M5CA 4PP0A 3SEWA 1MY0A 1MDP1 3C33A 1JEVA 3IK6B 5DEXA 5I7IA 4PTKA 4E0WA 1LBYA 5EYHA 4Q0CA 4GX6A 2CEYA 3MP6A 1IZ1A 2Z8EA 1A99A 3B6WA 3VVEA 4MJOA 5L8DA 3IOTA 2D21A 2WEFA 4F2QA 1JP4A 2XXVA 3M8UA 4OVSA 5J16A 3FUZA 5ITPA 3SEXA 5K2YA 3KJ7A 3MYUA 1SW2A 5ET5A 5FHNA 1VFDA 1UIVA 1R1NA 1VDWA 3TELA 2NVUB 4HCYA 1B5HA 2XD2A 1Y9UA 2NOOA 1AWBA 4AB5A 3PPPA 3FVKA 5I57B 1XI6A 2F97A 2UVIA 2Y84A 2F6PA 3MUQA 4RK9A 1NV7A 1MG1A 4H67A 2HCAA 3BBRA 5KCJA 1N84A 3VVFA 1LB8A 2GHAA 4H65A 5F7VA 3CSGA 4LUBA 4ZS9A 2ALUA 2XXXA 3IOVA 1Y1ZA 1SBPA 1FW0A 3TMGA 2XXUA 4GWSA 4JWYA 1YZ0A 4HS7A 5JEIA 4ELQA 2CZHA 4ISUA 3FXUA 1MQIA 3SERA 4ECFA 3H6TA 3G3FA 3K0VA 1FQDA 3PTYA 3S2VA 3ZSFA 1BP5A 3CG3A 3KC0A 1OLAA 4JSOA 4XXUA 4OANA 1NUYA 4OWDA 1EYIA 2PMSA 2ZNSA 2P3VA 3FJMA 4P11A 3PU5A 1N7XA 3CFZA 4LATA 3KN8A 3TTNA 1OMPA 1XVYA 3N5LA 1KZ8A 5ISUA 4KYDA 3KBRA 4GIZA 4KCDA 4P1LA 1EH3A 5AA1A 4KFQA 4KI0E 5CRYA 4TLMB 4EQ9A 4EDPA 5A5XA 3E3KA 5BUUA 4PFRA 1Q9DA 3VFJA 4C1UA 3OXNA 1FBEA 2VOZA 5I84A 5IAIA 4EQ7A 1K9ZA 3OEMA 4KYEA 2V3TA 4GWXA 4IO4A 3LV0A 2PFYA 3KSJA 3K6VA 5I57A 3IB1A 1P1OA 3GBBA 1DMBA 1XC1A 4OQOA 5TU0A 2GHBA 1LEVA 2THIA 2PFZA 2AL4A 4N4UA 1R6ZA 4O94A 1LFHA 1JVXA 3FJGA 1SYHA 2H5YA 4RPNA 1MQDA 2XX8A 4G68C 1LAGE 3PUWE 4C1TA 1B05A 2DWIA 1B5IA 4JSDA 4F3GA 4LVQA 3EHUA 4H45A 3ONMA 3A3CA 3H03A 4LZ7A 1MXXA 4U22A 3IB0A 1GVCA 1PB9A 2XD3A 3RTWB 3QSLA 4NHBA 4F31B 4IB2A 2OWTA 3RQTA 5CI5A 2F5XA 5H8NB 4TLLB 4YAHX 3IFCA 4OHNA 4U4XA 1QUKA 4XKRA 2Q2AA 3MP8A 2RF1A 3U8QA 3L6GA 4GLIA 3IFAA 1MY4A 3G3HA 4X1DA 4ZEKA 5CM6A 3EKIA 1N7WA 1FPLA 1NFTA 1AMFA 2KLFA 5ET8A 3OD7A 4GD5A 1JEUA 3MZBA 1JW5A 2FHYA 4KXPA 4OVJA 2Y5LA 3LUZA 3D1RA 1A40A 2RCBA 3QK6A 1B3LA 1ATGA 5BWJA 1POY1 5KDTB 1MM6A 2OWZA 1FJ9A 3IJXB 5EYFA 1GV8A 4HE0A 1B52A 1O63A 4P56A 4P0GA 4M4GA 1L5TA 4XEQA 2RC9A 1QKAA 2QS2A 1PC3A 3MBPA 1MH3A 2UYFA 4OA4A 3PUXE 4O3AA 3VXCA 1B7HA 1ANFA 4MMPA 2ONSA 1SYIA 2F7AA 3TTKA 4FJPA 3T9HB 5I5PA 1LSTA 3CIJA 4DZ1A 4I1DA 4N07A 2X7PA 3FVGA 2Z8FA 2PT1A 4XKPA 4GL0A 5H8NA 2D5WA 5DW8A 1NV4A 3MPKA 3MVWA 1AL3A 3QAXA 2Q9TA 1K9YA 2WYPA 1H3DA 2PCRA 3C34A 4GF8A 3MWBA 4MF3A 1UTHA 4NE4A 1GR2A 1P99A 2ZNUA 4OFLA 3DP6A 2BJJX 2FIEA 1FTJA 4RK2A 2OLBA 3ILTB 1LBZA 4ZEIA 4MLQA 4NN3A 4N15A 4LZ5A 4FEDA 1FQEA 3KBZA 1D9VA 3M3LA 1NUWA 3IORA 2ESNA 3S9NC 1LBWA 3K6XA 5ET6A 1NV0A 2O6AA 3PUYE 2B4MA 3GBAA 1B51A 4KPTA 4JXIA 3FATA 4N81A 2DOJA 4PC9A 4F3BA 5JK4A 3KSXA 1SW1A 5IZ1A 4F18A 3T9VA 4QBAA 1KWHA 1R9LA 4LONB 3K2DA 3PPNA 1B9JA 4ONYA 2L5VA 3T22A 4H0WA 4IO2A 1FSAA 2MKZA 3PMWA 2F3BA 1YCJA 4OENA 2PT2A 1YTVA 4FECA 4GL8A 3PD8A 4I62A 2E1SA 2IEEA 3UA8A 1ZU0A 5J1DA 4H5FA 5DT6A 3IO6A 5HM4B 3PMVA 4MX6A 5DEXB 3WAEA 4NTLA 1ZTYA 3PPRA 3M3KA 2QPQA 2ZMBA 1FPKA 1OQGA 1WODA 2ZXTA 4G8NA 4PAIA 1RDXA 1OLCA 1LBCA 4G4PA 3V89B 1SI0A 4PFBA 3Q27A 3DM0A 3E79A 4ND9A 1N0TA 3S4UA 4NF4B 1LFIA 3MW0A 4DDDA 1CB6A 1YYZA 2ABHA 4P1EA 1Y1MA 2Y7WA 1A7LA 2O84X 5I58A 3N26A 1QGXA 4QSEA 3IOWA 5EQAA 2AIXA 3FBPA 5ELVA 1B6HA 2YLNA 3JV9A 4Z0IA 4E0XA 4WEPA 1EYKA 3TAJA 3E13X 3HN0A 3E9XA 4EXLA 1VFEA 1RYOA 3SEUA 2ZZVA 2AL5A 3U93A 1ZBMA 2I6EA 2PYYA 1URSA 1B3GA 3K1MA 3U72A 1URDA 2VT5A 2VD2A 4MCOA 5KCJB 2VPNA 4U4SA 2CEXA 5H8HB 3K6UA 2ZZXA 2YJPA 3ZKLA 1LBBA 5B70A 1FPIA 4P3LA 1GGGA 2I58A 1USYE 5I59B 2Y7KA 3CG1A 4IO3A 3U1OA 4U23A 4ZECA 3HO7A 1YPNA 5DVJA 4PGNA 1FQAA 1PBQA 3RT8A 1M5EA 4IO7A 1MM7A 3CHGA 1NV2A 2I4BA 3T9XB 4HE1A 4ZE9A 1B4ZA 1B32A 2I0CA 1WDNA 4N17A 3UP9A 4FBPA 4P0IA 4N13A 4YB7A 4OXVA 2H9BA 1FTOA 1SD3A 3I5OA 1I6BA 3W9VA 5CBRA 4OMBA 4NF4A 1Q35A 2QS1A 4PFIA 3H6WA 2HAVA 1Q1KA 4JBZA 2DWHA 1DTZA 1NUZA 3N6TA 3A09A 1US5A 4OZ9A 2F6GA 1ZKBA 2RKMA 5A5XB 1ZIUA 3VVDA 4WXJA 2OX3A 2DE2A 3D4GA 1NH8A 4ZE8A 3MJNA 1HSJA 4XFEA 1IXIA 2ANJA 1QUIA 4QRZA 3LSFB 1FTMA 4YZZA 3OO6A 3LBSA 4YB6A 2WYKA 4PFYA 2ZZWA 1NV3A 3CVGA 3PPOA 4N6PA 3RT6B 5HBCA 1B7ZA 1JW4A 1IMDA 3AXFA 4AQ4A 5B7DA 3BFTA 4NF8A 3HV1A 1DTGA 3LC8A 1Y4CA 3USDA 1AIVA 2RC7A 5H8HA 3IB2A 4YICA 3D4CA 4GXAA 2X7QA 1FCKA 4QHQA 4RYAA 1J1NA 1B1XA 1IUDA 1IXCA 4NG7A 5I59A 2DVZA 3LSLA 3FGSA 1EZOA 1NNKA 2DWAA 3FJ7A 1A55A 4I40A 2B4LA 2P2AA 1LBVA 3ECRA 2QRYA 2V3QA 3OMBA 3W9WA 4BDLA 4OFOA 1G0IA 3B6TA 1GTKA 4QXDA 2DWJA 5TP9A 2LAOA 4LA9A 4ZEFA 1TWYA 4MIJA 1B46A 4GX3A 4G61A 4XKNA 2NWJA 2X26A 3IO4A 2OBGA 1MXUA 2PVUA 3MVXA 3ISPA 2ZNTA 4K3FA 4QFPA 2F78A 3TKDA 1LLSA 3FXRA 1BTJA 1DBZA 1F9BA 1FQFA 1LAFE 3T66A 4NWCA 3RPLB 3OO8A 3QMFA 3V83A 1FBFA 2QS3A 3E4RA 2NUVA 3RYDA 4QSCA 4R6KA 4H46A 2XXYA 5EQ7A 4NWDA 3FV1A 2V84A 2Q74A 2E0SA 2PX1A 1QKBA 3TPAA 1ZMGA 4LN5A 3LR1A 1NL5A 1FPEA 4DCYA 1XT8A 3KN7A 2BJIA 4RA1A 1QVSA 5F24A 3OELA 4MNIA 2WBDA 1B2HA 3DLNA 4IO6A 5ET7A 3FV2A 4N91A 3BKIB
chains in the Genus database with same CATH topology
1P1WA 4XIGQ 4U21A 1IXHA 4PETA 3MVYA 2WX9A 4DI4B 1ZJLA 1INPA 2Z8DA 1I6AA 5JTYA 4YKIA 1O7TA 2QJEA 1HSEA 1OIBA 1UTHB 1FBPA 3TTRA 4JVIA 3K02A 4GWZA 3MZ1A 1XOCA 2FIXA 1MQJA 4O3BA 2B3FA 2F36A 3KEIA 3FZVA 4THIA 4GBWA 2XWVA 2FBPA 4KCCA 1H45A 4OFJA 4GWOA 4NF5A 2G29A 2M8CA 4BDMA 3RN8A 4X1BA 3VE1B 3IJOB 2XXPA 4G68B 3RPLA 4X04A 2ONKE 4XF5A 3S9MC 2FA7A 4N8YA 1QJMA 4WKMA 4U2RA 1KA0A 3I6VA 2F35A 4NMYA 2V4CA 5A5LA 3G3KA 4MH5A 3A3UA 5ICTA 3IAZA 1RKMA 3CR9A 1DPPA 5EQ8A 1LGBC 2UXAA 3KN3A 3QIMA 4HE2A 3C32A 2HFBA 1DK4A 5ITOA 1FPBA 3QYTA 4HXVA 2DSFA 3QUFA 1FBHA 3OO9A 4LP2B 4UACA 4P9KA 1DSNA 1H43A 4EXKA 3OO7A 4UA8A 5H8QA 2DYXA 3B6QA 3A29A 2HZLA 4ELPA 3MQ9A 1D3KA 1AOVA 2AYSA 5LOMA 4ESWA 3O9PA 2REGA 2R8TA 1MS7A 2OJTA 5F1QA 1N76A 4PQJA 1MPCA 4MBPA 2F7CA 4POWA 2IA4A 2REJA 4OVRA 1OVTA 2QS4A 1PEBA 3TQLA 3FD3A 1IMCA 4JVDA 1D9QA 4F29A 3O2AA 5IZ3A 5I58B 4GRKA 4PDHA 4F22A 2B3BA 2XX7A 3O6HA 4G2ZA 3B8BA 3MSTA 1FPFA 3K4UA 3PGFA 4U1ZA 5T3JA 1TT1A 3ZKKA 3EHSA 4IGTA 4GFRA 3O29A 1B5JA 2XXWA 4FAJA 4MAGA 4XKQA 4FEBA 2WBBA 4BDNA 2ZYKA 4G68A 4IR8A 5IZZA 3PMXA 3G3JA 4U1OA 4R74A 3K00A 4PF6A 4X9TA 4TQUQ 5AA2A 1MY3A 3TUSA 4H8JA 3TDJA 3PV0E 5L9MA 3LUYA 3TCFA 2ONRA 4X8RA 2R9JA 1FQCA 2DS9A 3M3FA 1MPBA 3UIFA 4PE3A 5IM2A 3MAMA 2HQ0A 2UVJA 4HW8A 5H8FB 2DE3A 5I56A 4F1YA 1P1NA 2HAUA 3H7MA 4L17A 4F2OA 4MFIA 4NF6B 4MHFA 3FVOA 2RCAA 2H4IA 3S9LC 2CMOA 2PBWA 3MC2A 1B4HA 2UYEA 1DPEA 2FVZA 3S9EA 1LFGA 2Y7IA 4PFTA 2R6GE 4YKKA 1EZ9A 2F3DA 1IITA 1NNTA 2VD3A 4GVOA 3DP4A 1CE2A 3CFXA 1IMFA 5CMKA 1I69A 2KQZA 1OQHA 4N6DA 1FPJA 1VE4A 2ZYMA 4OESA 3CFLA 4G8HA 3I3VA 5CMBA 2HHMA 4NAPA 1B7UA 3KGCA 5CBSA 3B7DA 1UQWA 1LB9A 3EF7A 3O6IA 1S9TA 1SDXA 1DOTA 2QVRA 1QW0A 2DQVA 1AH5A 2GQ1A 1Z7NE 3N6UA 2HXWA 2F34A 1A8EA 4O3CA 1SQYA 3ROJA 1FBGA 4LQ2A 1ELJA 4NF8B 2VP1A 3KZGA 3SETA 4OVPA 5I2NA 1EZPA 3GXAA 3B50A 4PFUA 5LTCA 3PD9A 4FORA 1N3WA 3ILUB 1R9QA 4PAFA 2XWIA 3FXBA 3C9HA 4DXCA 1POTA 1MXWA 4QFNA 5TPAA 1EYJA 2RC8A 1JW1A 5H8FA 3VDFA 2XWOA 3OOAA 3SKPA 4GBVA 4KYSA 3VXBA 1MQGA 2GH9A 5LDZA 1WVJA 3KOTA 5TP9B 4F1VA 1D4NA 4IGRA 4NF6A 1G0HA 2Q8JA 3TYHA 1KA1A 2JJKA 4MLVA 3K1NA 4I8CA 4R6YA 5CMMA 5IKBA 4FATA 1LBXA 1US4A 3HPIA 4OERA 2Q89A 3IL1B 3CI8A 4ESXA 2F7BA 1SW4A 2W7YA 1Y3PA 2Z22A 2A5TA 1Z7ME 3MZ9A 4PE5B 3MPLA 5M2VA 3RPWA 4PGPA 1SW5A 4DE8A 1VSOA 4I9DA 4G77A 5CMCA 1II5A 4QF9A 4R2BA 4R75A 1NI9A 4UABA 5AA4B 1NUXA 5EYGA 3KFMA 1B40A 4ZEBA 1M5DA 4I3YA 3CSBA 1MXYA 3O28A 4H8IA 3O97A 3QUJA 4YMBA 1B58A 1Y3QA 2V93A 2Y5KA 3KJTA 1NNFA 5DYHA 4IY5A 2XXHA 2DP8A 1UIUA 1RYXA 4YU0A 4GX4A 4DI3D 1SI1A 3Q29A 1JVYA 2O51A 3GYYA 4MNPA 1FRPA 3HSTA 4XTCQ 1FQBA 4GWUA 4H1XA 1PBPA 4PBQA 4EQBA 1Y3NA 2CZKA 4KR5A 2FYIA 5K2XA 3V5AA 5JTYB 2QMXA 2G93A 5DVFA 4PDDA 1JQFA 1YAEA 2ZYOA 3H06B 4AS5A 1BK4A 2I48A 2R71A 4EF2A 3FVNA 4BDQA 1RDYA 5HPQA 4NF5B 4OYVA 4QFLA 3U65A 1PB8A 5L9OA 2YPNA 5EQ9A 5L9SA 4H6DA 4X48A 3EPEA 3C36A 4ELOA 4POXA 2I3WA 4QFKA 3O66A 4DLDA 3RGYA 3JYRA 4LQ5A 4M1VA 4QSDA 2HXRA 4JDFA 4RXLA 2WKYA 5I2KB 3W15C 2OCUA 4P8BA 5AA4A 1B3HA 5FHOA 1CNQA 2QSXA 3T93B 1FBCA 5FTHA 4BDRA 4H5GA 3O6GA 1M5BA 4PAKA 1FPDA 3RNNA 4NGUA 1T0KA 1P1QA 5FHMA 1TXFA 4GXSB 1A8FA 1BIYA 3TCHA 1BLFA 2DE4A 2XHDA 4EF1A 3HHFA 5H8QB 2UVGA 3H6VA 3PUZE 1SVXB 3VLUA 3T9UA 3HFUA 1S50A 4DXBA 4N6KA 1B0LA 1FPGA 4MNCA 3FXQA 4BLAA 4RPOA 4KHZE 2I4CA 3PPQA 4DCXA 3IR1A 4RJZA 1HSLA 4I3EA 3OENA 1IMAA 1NKXA 1N3XA 1Y20A 1YXIA 1FBDA 3IOUA 5IZ3B 2QFLA 1LAXA 3C35A 1NV1A 4KD5A 3TQWA 2P1SA 3C31A 1PDAA 4N8GA 2GFEA 2HPGA 3PUVE 3RLFE 4PBHA 3T0JA 1A54A 3HHGA 4O7IA 2DDKA 2O7UA 5EHSA 3QXMA 3Q28A 2O69A 4F39A 2H99A 3R7XA 3K01A 4RNSA 3WAFA 2OK2A 1Y4TA 3CRBA 4WEDA 5AA2B 4GQOA 3TTLA 3JZJA 3OSRA 2XXKA 2B65A 2XXRA 4GWWA 4GWYA 5FBPA 1N04A 3RY3A 5I2KA 2Q8MA 2XXQA 2NXOA 4R6HA 2VHAA 4Q30B 3UN6A 3RUMA 1DCUA 1MPDA 3SEVA 1I6QA 5EHMA 1B3EA 4C0RA 3R26A 3GZGA 5I56B 4O7MA 1XS5A 1S7YA 5ESYA 4QFOA 1MDQA 1ZLQA 4PF8A 4NF0A 1D9YA 1LCFA 3V8XB 4PFWA 3BFUA 3LSXA 3DELB 3GLBA 3UK4A 2Y7PA 3U94A 2HEUA 1IEJA 2P3NA 2O68A 3MP1A 5DTBA 4ZZEA 1M5FA 3HCQA 4GOTA 1MRPA 2I49A 3KC1A 1RDZA 1VR5A 2O1LA 2HZKA 1LCTA 5IGAA 1XHYA 1P1UA 2Q2CA 4OEVA 1MQHA 3C4MA 4F3PA 1FTKA 4OVTA 3G3IA 1URGA 1FTLA 2Z23A 4NX1A 4OEUA 3E78A 2DVCA 4OETA 4BDOA 1FTAA 1TFAA 2OZZA 1FJ6A 4NQ8A 4G8MA 4RY1A 5FTIA 2CZLA 2O7IA 3OSQA 3SZPA 4ELRA 4ZEDA 3KOSA 2F8DA 2Y7RA 4IY6A 2QVUA 1IMEA 5I2NB 2QVVA 2DXRA 3ODBA 4YB5A 4FIMA 4ZZAA 1O64A 3EQ1A 4PCDA 5KDTA 5KZTA 2XA5A 1USYH 3P7IA 1NH7A 2V3UA 1IIWA 3TODA 2XXTA 3DP8A 4R9GA 2RINA 4JB7A 5TPAB 1IQ7A 3Q25A 3H3GA 2XXIA 3THIA 2I3VA 3FIRA 3TZAA 3LSWA 2QMWA 1PB7A 3VLWA 1NMUA 2I0BA 1IMBA 3G3GA 4OVQA 4F3SA 4AS4A 4Z7EA 5H8SA 4MEVA 3RTFB 4F1UA 2QL3A 1UTBB 1IXGA 4LZ8A 3K6WA 3SDFA 1H44A 4TOZA 2D3IA 2ZYNA 3H4ZA 4JWOA 4YKJA 2FNCA 4JWXA 1NV6A 4OTEA 4R2FA 2H98A 4Q8RA 4JVCA 1MH4A 4DXUA 2P0SA 5ICQA 5DVIA 3FASA 1JETA 4EUOA 3ZS6A 2A5TB 4ZDMA 2VGQA 5AE4A 3TEPA 3N94A 4YMAA 5CC2A 5AA2D 3U92A 2KR0A 3KG2A 4R73A 2OWSA 3EN3A 1MY2A 3TFLA 3OEKA 3T1BA 2XX9A 3G7WA 2H25A 1XVXA 4R72A 4Q5TA 3L6HA 2GRVA 4R9FA 2VPOA 5AA3A 1H76A 2O1MA 3BIHA 3TCGA 3T96B 3SESA 1MY1A 3UORA 1NNPA 4DIGA 3VLVA 3BIGA 1BKAA 2V25A 2Q88A 1JNFA 3IX1A 3R6UA 4HCWA 5I3SA 1QUJA 2UVHA 3Q26A 2DXYA 2XWKA 1NV5A 1B0HA 1LAHE 3VV5A 1TFDA 4KQPA 3UGWA 3SEYA 3MVZA 2CZIA 1EU8A 4HTGA 4O8MA 4P47A 3TTMA 4YKPA 3EHTA 3F11A 4FE8A 1SPIA 4NEDA 1B3FA 4F19A 2A5SA 3H6UA 1MXVA 1MXZA 3NOHA 4IO5A 1QULA 1OVBA 4AB6A 1UTBA 1B1HA 3K1PA 1M5CA 4PP0A 3SEWA 1MY0A 1MDP1 3C33A 1JEVA 3IK6B 5DEXA 5I7IA 4PTKA 4E0WA 1LBYA 5EYHA 4Q0CA 4GX6A 2CEYA 3MP6A 1IZ1A 2Z8EA 1A99A 3B6WA 3VVEA 4MJOA 5L8DA 3IOTA 2D21A 2WEFA 4F2QA 1JP4A 2XXVA 3M8UA 4OVSA 5J16A 3FUZA 5ITPA 3SEXA 5K2YA 3KJ7A 3MYUA 1SW2A 5ET5A 5FHNA 1VFDA 1UIVA 1R1NA 3TELA 1VDWA 2NVUB 4HCYA 1B5HA 2XD2A 1Y9UA 2NOOA 4AB5A 1AWBA 3PPPA 3FVKA 5I57B 1XI6A 2F97A 2UVIA 2Y84A 2F6PA 3MUQA 4RK9A 1NV7A 1MG1A 4H67A 2HCAA 3BBRA 5KCJA 1N84A 3VVFA 1LB8A 2GHAA 4H65A 5F7VA 3CSGA 4LUBA 4ZS9A 2ALUA 2XXXA 3IOVA 1Y1ZA 1SBPA 1FW0A 3TMGA 2XXUA 4GWSA 4JWYA 1YZ0A 4HS7A 5JEIA 4ELQA 2CZHA 4ISUA 3FXUA 1MQIA 3SERA 4ECFA 3H6TA 3G3FA 3K0VA 1FQDA 3PTYA 3S2VA 3ZSFA 1BP5A 3CG3A 3KC0A 1OLAA 4JSOA 4XXUA 4OANA 1NUYA 4OWDA 1EYIA 2PMSA 2ZNSA 3FJMA 2P3VA 4P11A 3PU5A 1N7XA 3CFZA 4LATA 3KN8A 3TTNA 1OMPA 1XVYA 3N5LA 1KZ8A 5ISUA 4KYDA 3KBRA 4GIZA 4KCDA 4P1LA 1EH3A 5AA1A 4KFQA 4KI0E 5CRYA 4TLMB 4EQ9A 4EDPA 5A5XA 3E3KA 5BUUA 4PFRA 1Q9DA 3VFJA 4C1UA 3OXNA 1FBEA 2VOZA 5I84A 5IAIA 4EQ7A 3OEMA 1K9ZA 4KYEA 2V3TA 4GWXA 4IO4A 3LV0A 2PFYA 3KSJA 3K6VA 5I57A 3IB1A 1P1OA 3GBBA 1DMBA 1XC1A 4OQOA 5TU0A 2GHBA 1LEVA 2THIA 2PFZA 2AL4A 4N4UA 1R6ZA 4O94A 1LFHA 1JVXA 3FJGA 1SYHA 2H5YA 4RPNA 1MQDA 2XX8A 4G68C 1LAGE 3PUWE 4C1TA 1B05A 2DWIA 1B5IA 4JSDA 4F3GA 4LVQA 3EHUA 4H45A 3ONMA 3A3CA 3H03A 4LZ7A 1MXXA 4U22A 3IB0A 1GVCA 1PB9A 2XD3A 3RTWB 3QSLA 4NHBA 4F31B 4IB2A 2OWTA 3RQTA 5CI5A 2F5XA 5H8NB 4TLLB 4YAHX 3IFCA 4OHNA 4U4XA 1QUKA 4XKRA 2Q2AA 3MP8A 2RF1A 3U8QA 3L6GA 4GLIA 3IFAA 1MY4A 3G3HA 4X1DA 4ZEKA 5CM6A 3EKIA 1N7WA 1FPLA 1NFTA 1AMFA 2KLFA 5ET8A 3OD7A 4GD5A 1JEUA 3MZBA 1JW5A 2FHYA 4OVJA 4KXPA 2Y5LA 3LUZA 3D1RA 1A40A 2RCBA 3QK6A 1B3LA 1ATGA 5BWJA 1POY1 5KDTB 1MM6A 2OWZA 1FJ9A 3IJXB 5EYFA 1GV8A 4HE0A 1B52A 1O63A 4P56A 4P0GA 4M4GA 1L5TA 4XEQA 2RC9A 1QKAA 2QS2A 1PC3A 3MBPA 1MH3A 2UYFA 4OA4A 3PUXE 4O3AA 3VXCA 1B7HA 1ANFA 4MMPA 2ONSA 1SYIA 2F7AA 3TTKA 4FJPA 3T9HB 5I5PA 1LSTA 3CIJA 4DZ1A 4I1DA 4N07A 2X7PA 3FVGA 2Z8FA 2PT1A 4XKPA 4GL0A 5H8NA 2D5WA 5DW8A 1NV4A 3MPKA 3MVWA 1AL3A 3QAXA 2Q9TA 1K9YA 2WYPA 1H3DA 3C34A 2PCRA 4GF8A 3MWBA 4MF3A 1UTHA 4NE4A 1GR2A 1P99A 2ZNUA 4OFLA 3DP6A 2BJJX 2FIEA 1FTJA 4RK2A 2OLBA 3ILTB 1LBZA 4ZEIA 4MLQA 4NN3A 4N15A 4LZ5A 4FEDA 1FQEA 3KBZA 1D9VA 3M3LA 1NUWA 3IORA 2ESNA 3S9NC 1LBWA 3K6XA 5ET6A 1NV0A 2O6AA 3PUYE 2B4MA 3GBAA 1B51A 4KPTA 4JXIA 3FATA 4N81A 2DOJA 4F3BA 4PC9A 5JK4A 3KSXA 1SW1A 5IZ1A 4F18A 3T9VA 4QBAA 1KWHA 1R9LA 4LONB 3K2DA 3PPNA 1B9JA 4ONYA 2L5VA 3T22A 4H0WA 4IO2A 1FSAA 3PMWA 2MKZA 2F3BA 1YCJA 4OENA 2PT2A 1YTVA 4FECA 4GL8A 3PD8A 4I62A 2E1SA 2IEEA 3UA8A 1ZU0A 5J1DA 4H5FA 5DT6A 3IO6A 5HM4B 3PMVA 5DEXB 3WAEA 4MX6A 4NTLA 1ZTYA 3PPRA 3M3KA 2QPQA 2ZMBA 1FPKA 1OQGA 1WODA 2ZXTA 4G8NA 4PAIA 1RDXA 1OLCA 1LBCA 4G4PA 3V89B 1SI0A 4PFBA 3Q27A 3DM0A 3E79A 4ND9A 1N0TA 3S4UA 4NF4B 1LFIA 3MW0A 4DDDA 1CB6A 1YYZA 2ABHA 4P1EA 1Y1MA 2Y7WA 1A7LA 2O84X 5I58A 3N26A 1QGXA 4QSEA 3IOWA 5EQAA 2AIXA 3FBPA 5ELVA 1B6HA 2YLNA 3JV9A 4Z0IA 4E0XA 4WEPA 1EYKA 3TAJA 3E13X 3HN0A 3E9XA 4EXLA 1VFEA 1RYOA 3SEUA 2ZZVA 2AL5A 3U93A 1ZBMA 2I6EA 2PYYA 1URSA 1B3GA 3K1MA 3U72A 1URDA 2VT5A 2VD2A 4MCOA 5KCJB 2VPNA 4U4SA 2CEXA 5H8HB 3K6UA 2ZZXA 2YJPA 3ZKLA 1LBBA 5B70A 1FPIA 4P3LA 1GGGA 2I58A 1USYE 5I59B 2Y7KA 3CG1A 4IO3A 3U1OA 4U23A 4ZECA 3HO7A 1YPNA 5DVJA 4PGNA 1FQAA 1PBQA 3RT8A 1M5EA 4IO7A 1MM7A 3CHGA 2I4BA 1NV2A 3T9XB 4HE1A 4ZE9A 1B4ZA 1B32A 2I0CA 1WDNA 4N17A 3UP9A 4FBPA 4P0IA 4N13A 4YB7A 4OXVA 2H9BA 1FTOA 1SD3A 3I5OA 1I6BA 3W9VA 5CBRA 4OMBA 4NF4A 1Q35A 2QS1A 4PFIA 3H6WA 2HAVA 1Q1KA 4JBZA 2DWHA 1DTZA 1NUZA 3N6TA 3A09A 1US5A 4OZ9A 2F6GA 1ZKBA 2RKMA 5A5XB 1ZIUA 3VVDA 4WXJA 2OX3A 2DE2A 3D4GA 1NH8A 4ZE8A 3MJNA 1HSJA 4XFEA 1IXIA 2ANJA 1QUIA 4QRZA 3LSFB 1FTMA 4YZZA 3OO6A 3LBSA 4YB6A 4PFYA 2WYKA 2ZZWA 1NV3A 3CVGA 3PPOA 4N6PA 3RT6B 5HBCA 1B7ZA 1JW4A 1IMDA 3AXFA 4AQ4A 5B7DA 3BFTA 4NF8A 3HV1A 1DTGA 3LC8A 1Y4CA 3USDA 1AIVA 2RC7A 5H8HA 3IB2A 4YICA 3D4CA 4GXAA 2X7QA 1FCKA 4QHQA 4RYAA 1J1NA 1B1XA 1IUDA 1IXCA 4NG7A 5I59A 2DVZA 3LSLA 3FGSA 1EZOA 1NNKA 2DWAA 3FJ7A 1A55A 4I40A 2B4LA 2P2AA 1LBVA 3ECRA 2QRYA 2V3QA 3OMBA 3W9WA 4BDLA 4OFOA 1G0IA 3B6TA 1GTKA 4QXDA 2DWJA 5TP9A 2LAOA 4LA9A 4ZEFA 1TWYA 4MIJA 1B46A 4GX3A 4G61A 4XKNA 2NWJA 2X26A 3IO4A 2OBGA 1MXUA 2PVUA 3MVXA 3ISPA 2ZNTA 4K3FA 4QFPA 2F78A 3TKDA 1LLSA 3FXRA 1BTJA 1DBZA 1F9BA 1FQFA 1LAFE 3T66A 4NWCA 3RPLB 3OO8A 3V83A 3QMFA 1FBFA 2QS3A 3E4RA 2NUVA 3RYDA 4QSCA 4R6KA 4H46A 2XXYA 5EQ7A 4NWDA 3FV1A 2V84A 2Q74A 2E0SA 2PX1A 1QKBA 3TPAA 1ZMGA 4LN5A 3LR1A 1NL5A 1FPEA 4DCYA 1XT8A 3KN7A 2BJIA 4RA1A 1QVSA 5F24A 3OELA 4MNIA 2WBDA 1B2HA 3DLNA 4IO6A 5ET7A 3FV2A 4N91A 3BKIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1W A;  4XIG Q;  4U21 A;  1IXH A;  4PET A;  3MVY A;  1ZJL A;  2Z8D A;  1I6A A;  5JTY A;  4YKI A;  1O7T A;  2QJE A;  1HSE A;  1OIB A;  1UTH B;  3TTR A;  3K02 A;  3MZ1 A;  1XOC A;  1MQJ A;  4O3B A;  2B3F A;  2F36 A;  3KEI A;  3FZV A;  4THI A;  4KCC A;  1H45 A;  4OFJ A;  4GWO A;  4NF5 A;  2G29 A;  2M8C A;  4BDM A;  3RN8 A;  4X1B A;  3VE1 B;  3IJO B;  2XXP A;  4G68 B;  2ONK E;  3S9M C;  2FA7 A;  1QJM A;  4WKM A;  4U2R A;  3I6V A;  2F35 A;  4NMY A;  3G3K A;  4MH5 A;  3A3U A;  5ICT A;  3IAZ A;  1RKM A;  3CR9 A;  1DPP A;  1LGB C;  2UXA A;  3KN3 A;  3QIM A;  3C32 A;  2HFB A;  5ITO A;  3QYT A;  2DSF A;  3QUF A;  3OO9 A;  4LP2 B;  4UAC A;  1DSN A;  1H43 A;  4EXK A;  3OO7 A;  4UA8 A;  5H8Q A;  2DYX A;  3B6Q A;  2HZL A;  4ELP A;  3MQ9 A;  1D3K A;  1AOV A;  2AYS A;  5LOM A;  4ESW A;  3O9P A;  2REG A;  1MS7 A;  2OJT A;  5F1Q A;  1N76 A;  4PQJ A;  1MPC A;  4MBP A;  2F7C A;  4POW A;  2IA4 A;  2REJ A;  1OVT A;  2QS4 A;  1PEB A;  3TQL A;  3FD3 A;  4F29 A;  3O2A A;  5I58 B;  4GRK A;  4F22 A;  2B3B A;  2XX7 A;  3O6H A;  4G2Z A;  3K4U A;  3PGF A;  4U1Z A;  1TT1 A;  3ZKK A;  3EHS A;  4IGT A;  4GFR A;  3O29 A;  1B5J A;  2XXW A;  4FAJ A;  4XKQ A;  4FEB A;  4BDN A;  2ZYK A;  4G68 A;  3PMX A;  3G3J A;  4U1O A;  4R74 A;  3K00 A;  4X9T A;  4TQU Q;  5AA2 A;  1MY3 A;  3TUS A;  4H8J A;  3TDJ A;  3PV0 E;  5L9M A;  3LUY A;  3TCF A;  2ONR A;  2R9J A;  1FQC A;  2DS9 A;  3M3F A;  1MPB A;  3UIF A;  3MAM A;  2HQ0 A;  2UVJ A;  4HW8 A;  5H8F B;  2DE3 A;  5I56 A;  4F1Y A;  1P1N A;  2HAU A;  3H7M A;  4L17 A;  4F2O A;  4MFI A;  4NF6 B;  3FVO A;  2RCA A;  2H4I A;  3S9L C;  2CMO A;  2PBW A;  3MC2 A;  1B4H A;  2UYE A;  1DPE A;  3S9E A;  1LFG A;  2Y7I A;  4PFT A;  2R6G E;  4YKK A;  1EZ9 A;  1IIT A;  1NNT A;  2VD3 A;  4GVO A;  3DP4 A;  1CE2 A;  3CFX A;  5CMK A;  1I69 A;  1OQH A;  1VE4 A;  2ZYM A;  4OES A;  3CFL A;  4G8H A;  3I3V A;  5CMB A;  1B7U A;  3KGC A;  5CBS A;  3B7D A;  1UQW A;  1LB9 A;  3EF7 A;  3O6I A;  1S9T A;  1SDX A;  1DOT A;  1QW0 A;  2DQV A;  1AH5 A;  1Z7N E;  3N6U A;  2HXW A;  2F34 A;  1A8E A;  4O3C A;  1SQY A;  4LQ2 A;  1ELJ A;  4NF8 B;  2VP1 A;  3KZG A;  3SET A;  5I2N A;  1EZP A;  3GXA A;  4PFU A;  3PD9 A;  4FOR A;  1N3W A;  3ILU B;  1R9Q A;  3C9H A;  4DXC A;  1POT A;  1MXW A;  4QFN A;  5TPA A;  2RC8 A;  1JW1 A;  5H8F A;  3VDF A;  3OOA A;  3SKP A;  4KYS A;  3VXB A;  1MQG A;  2GH9 A;  1WVJ A;  3KOT A;  5TP9 B;  4F1V A;  1D4N A;  4IGR A;  4NF6 A;  2Q8J A;  3TYH A;  4MLV A;  3K1N A;  4I8C A;  4R6Y A;  5CMM A;  5IKB A;  4FAT A;  1US4 A;  3HPI A;  4OER A;  2Q89 A;  3IL1 B;  3CI8 A;  4ESX A;  2F7B A;  1SW4 A;  2W7Y A;  1Y3P A;  2Z22 A;  2A5T A;  1Z7M E;  3MZ9 A;  4PE5 B;  3MPL A;  5M2V A;  3RPW A;  1SW5 A;  4DE8 A;  1VSO A;  4I9D A;  4G77 A;  5CMC A;  1II5 A;  4QF9 A;  4R2B A;  4R75 A;  5AA4 B;  3KFM A;  1B40 A;  4ZEB A;  1M5D A;  3CSB A;  1MXY A;  3O28 A;  4H8I A;  3O97 A;  3QUJ A;  4YMB A;  1B58 A;  1Y3Q A;  2V93 A;  3KJT A;  1NNF A;  5DYH A;  4IY5 A;  2XXH A;  2DP8 A;  1UIU A;  1RYX A;  4YU0 A;  1SI1 A;  3Q29 A;  1JVY A;  2O51 A;  3HST A;  4XTC Q;  1FQB A;  4H1X A;  1PBP A;  4EQB A;  1Y3N A;  4KR5 A;  2FYI A;  5K2X A;  3V5A A;  5JTY B;  2QMX A;  2G93 A;  5DVF A;  1JQF A;  1YAE A;  2ZYO A;  3H06 B;  2I48 A;  2R71 A;  4EF2 A;  3FVN A;  4BDQ A;  5HPQ A;  4NF5 B;  4OYV A;  4QFL A;  1PB8 A;  5L9O A;  2YPN A;  5L9S A;  4H6D A;  4X48 A;  3EPE A;  3C36 A;  4ELO A;  4POX A;  2I3W A;  4QFK A;  3O66 A;  4DLD A;  3RGY A;  3JYR A;  4LQ5 A;  4M1V A;  4QSD A;  4JDF A;  4RXL A;  2WKY A;  5I2K B;  3W15 C;  2OCU A;  5AA4 A;  1B3H A;  5FHO A;  2QSX A;  3T93 B;  5FTH A;  4BDR A;  4H5G A;  3O6G A;  1M5B A;  3RNN A;  1T0K A;  1P1Q A;  5FHM A;  1TXF A;  4GXS B;  1A8F A;  1BIY A;  3TCH A;  1BLF A;  2DE4 A;  2XHD A;  4EF1 A;  3HHF A;  5H8Q B;  2UVG A;  3H6V A;  3PUZ E;  1SVX B;  3VLU A;  3T9U A;  1S50 A;  4DXB A;  1B0L A;  3FXQ A;  4BLA A;  4RPO A;  4KHZ E;  2I4C A;  3PPQ A;  4DCX A;  3IR1 A;  4RJZ A;  1HSL A;  3OEN A;  1NKX A;  1N3X A;  1Y20 A;  3IOU A;  1LAX A;  3C35 A;  4KD5 A;  3TQW A;  2P1S A;  3C31 A;  1PDA A;  2GFE A;  3PUV E;  3RLF E;  1A54 A;  3HHG A;  2O7U A;  5EHS A;  3QXM A;  3Q28 A;  2O69 A;  4F39 A;  2H99 A;  3R7X A;  3K01 A;  4RNS A;  3WAF A;  2OK2 A;  1Y4T A;  3CRB A;  4WED A;  5AA2 B;  4GQO A;  3TTL A;  3JZJ A;  3OSR A;  2B65 A;  2XXR A;  1N04 A;  3RY3 A;  5I2K A;  2XXQ A;  2NXO A;  4R6H A;  2VHA A;  4Q30 B;  3UN6 A;  3RUM A;  1MPD A;  3SEV A;  1I6Q A;  5EHM A;  1B3E A;  4C0R A;  3R26 A;  3GZG A;  5I56 B;  1XS5 A;  1S7Y A;  4QFO A;  1MDQ A;  1ZLQ A;  1D9Y A;  1LCF A;  3V8X B;  4PFW A;  3BFU A;  3LSX A;  3DEL B;  3GLB A;  3UK4 A;  2Y7P A;  3U94 A;  2HEU A;  1IEJ A;  2O68 A;  3MP1 A;  5DTB A;  4ZZE A;  1M5F A;  3HCQ A;  4GOT A;  1MRP A;  2I49 A;  1VR5 A;  2O1L A;  2HZK A;  1LCT A;  1XHY A;  1P1U A;  2Q2C A;  4OEV A;  1MQH A;  3C4M A;  4F3P A;  1FTK A;  3G3I A;  1URG A;  1FTL A;  2Z23 A;  4OEU A;  2DVC A;  4OET A;  4BDO A;  1TFA A;  2OZZ A;  4G8M A;  4RY1 A;  5FTI A;  2CZL A;  2O7I A;  3OSQ A;  4ELR A;  4ZED A;  3KOS A;  2F8D A;  2Y7R A;  4IY6 A;  5I2N B;  2DXR A;  3ODB A;  4YB5 A;  4FIM A;  4ZZA A;  1O64 A;  3EQ1 A;  5KDT A;  5KZT A;  1USY H;  3P7I A;  1NH7 A;  2V3U A;  1IIW A;  3TOD A;  2XXT A;  3DP8 A;  4R9G A;  2RIN A;  4JB7 A;  5TPA B;  1IQ7 A;  3Q25 A;  3H3G A;  2XXI A;  3THI A;  2I3V A;  3FIR A;  3TZA A;  3LSW A;  2QMW A;  1PB7 A;  3VLW A;  1NMU A;  2I0B A;  3G3G A;  4F3S A;  4Z7E A;  5H8S A;  3RTF B;  4F1U A;  2QL3 A;  1UTB B;  1IXG A;  4LZ8 A;  3K6W A;  3SDF A;  1H44 A;  4TOZ A;  2D3I A;  2ZYN A;  3H4Z A;  4JWO A;  4YKJ A;  2FNC A;  4JWX A;  4OTE A;  4R2F A;  2H98 A;  4Q8R A;  1MH4 A;  4DXU A;  2P0S A;  5ICQ A;  5DVI A;  3FAS A;  1JET A;  4EUO A;  3ZS6 A;  2A5T B;  4ZDM A;  2VGQ A;  5AE4 A;  3TEP A;  3N94 A;  4YMA A;  5CC2 A;  5AA2 D;  3U92 A;  3KG2 A;  4R73 A;  2OWS A;  3EN3 A;  1MY2 A;  3TFL A;  3OEK A;  2XX9 A;  3G7W A;  2H25 A;  1XVX A;  4R72 A;  4Q5T A;  3L6H A;  2GRV A;  4R9F A;  5AA3 A;  1H76 A;  2O1M A;  3TCG A;  3T96 B;  3SES A;  1MY1 A;  3UOR A;  1NNP A;  4DIG A;  3VLV A;  1BKA A;  2V25 A;  2Q88 A;  1JNF A;  3IX1 A;  3R6U A;  4HCW A;  1QUJ A;  2UVH A;  3Q26 A;  2DXY A;  1B0H A;  1LAH E;  3VV5 A;  1TFD A;  4KQP A;  3UGW A;  3SEY A;  3MVZ A;  1EU8 A;  4HTG A;  3TTM A;  4YKP A;  3EHT A;  3F11 A;  4FE8 A;  4NED A;  1B3F A;  4F19 A;  2A5S A;  3H6U A;  1MXV A;  1MXZ A;  4IO5 A;  1QUL A;  1OVB A;  4AB6 A;  1UTB A;  1B1H A;  3K1P A;  1M5C A;  4PP0 A;  3SEW A;  1MY0 A;  1MDP 1;  3C33 A;  1JEV A;  3IK6 B;  5DEX A;  4E0W A;  4Q0C A;  3MP6 A;  1IZ1 A;  2Z8E A;  1A99 A;  3B6W A;  3VVE A;  5L8D A;  3IOT A;  2D21 A;  4F2Q A;  2XXV A;  3M8U A;  3FUZ A;  5ITP A;  3SEX A;  5K2Y A;  3KJ7 A;  1SW2 A;  5FHN A;  1VFD A;  1UIV A;  1R1N A;  3TEL A;  2NVU B;  4HCY A;  1B5H A;  2XD2 A;  1Y9U A;  2NOO A;  4AB5 A;  3PPP A;  3FVK A;  5I57 B;  2F97 A;  2UVI A;  2Y84 A;  2F6P A;  3MUQ A;  4RK9 A;  1MG1 A;  4H67 A;  2HCA A;  3BBR A;  5KCJ A;  1N84 A;  3VVF A;  1LB8 A;  2GHA A;  4H65 A;  5F7V A;  3CSG A;  4LUB A;  4ZS9 A;  2ALU A;  2XXX A;  3IOV A;  1Y1Z A;  1SBP A;  1FW0 A;  3TMG A;  2XXU A;  4JWY A;  4HS7 A;  5JEI A;  4ELQ A;  4ISU A;  3FXU A;  1MQI A;  3SER A;  4ECF A;  3H6T A;  3G3F A;  3K0V A;  1FQD A;  3S2V A;  3ZSF A;  1BP5 A;  3CG3 A;  1OLA A;  4JSO A;  4XXU A;  4OWD A;  2PMS A;  2ZNS A;  3FJM A;  4P11 A;  3PU5 A;  1N7X A;  3CFZ A;  4LAT A;  3KN8 A;  3TTN A;  1OMP A;  1XVY A;  3N5L A;  5ISU A;  4KYD A;  3KBR A;  4GIZ A;  4KCD A;  1EH3 A;  5AA1 A;  4KFQ A;  4KI0 E;  5CRY A;  4TLM B;  4EQ9 A;  4EDP A;  5A5X A;  3E3K A;  5BUU A;  3VFJ A;  4C1U A;  3OXN A;  2VOZ A;  5I84 A;  5IAI A;  4EQ7 A;  3OEM A;  4KYE A;  2V3T A;  4IO4 A;  3KSJ A;  3K6V A;  5I57 A;  3IB1 A;  1P1O A;  3GBB A;  1DMB A;  1XC1 A;  4OQO A;  5TU0 A;  2GHB A;  2THI A;  2AL4 A;  1R6Z A;  1LFH A;  1JVX A;  3FJG A;  1SYH A;  2H5Y A;  4RPN A;  1MQD A;  2XX8 A;  4G68 C;  1LAG E;  3PUW E;  4C1T A;  1B05 A;  2DWI A;  1B5I A;  4JSD A;  4F3G A;  4LVQ A;  3EHU A;  3ONM A;  3A3C A;  3H03 A;  4LZ7 A;  1MXX A;  4U22 A;  3IB0 A;  1GVC A;  1PB9 A;  2XD3 A;  3RTW B;  3QSL A;  4F31 B;  4IB2 A;  2OWT A;  3RQT A;  5CI5 A;  2F5X A;  5H8N B;  4TLL B;  4YAH X;  4OHN A;  4U4X A;  1QUK A;  4XKR A;  2Q2A A;  3MP8 A;  2RF1 A;  3U8Q A;  3L6G A;  4GLI A;  1MY4 A;  3G3H A;  4X1D A;  4ZEK A;  5CM6 A;  1N7W A;  1NFT A;  1AMF A;  2KLF A;  3OD7 A;  4GD5 A;  1JEU A;  3MZB A;  1JW5 A;  4OVJ A;  1A40 A;  2RCB A;  3QK6 A;  1B3L A;  1ATG A;  5BWJ A;  1POY 1;  5KDT B;  1MM6 A;  3IJX B;  5EYF A;  1GV8 A;  1B52 A;  1O63 A;  4P0G A;  4M4G A;  1L5T A;  2RC9 A;  1QKA A;  2QS2 A;  1PC3 A;  3MBP A;  1MH3 A;  2UYF A;  3PUX E;  4O3A A;  3VXC A;  1B7H A;  1ANF A;  2ONS A;  1SYI A;  2F7A A;  3TTK A;  4FJP A;  3T9H B;  1LST A;  3CIJ A;  4DZ1 A;  4I1D A;  4N07 A;  2X7P A;  3FVG A;  2Z8F A;  2PT1 A;  4XKP A;  4GL0 A;  5H8N A;  2D5W A;  3MPK A;  3MVW A;  1AL3 A;  3QAX A;  2Q9T A;  1H3D A;  3C34 A;  4GF8 A;  3MWB A;  4MF3 A;  1UTH A;  4NE4 A;  1GR2 A;  1P99 A;  2ZNU A;  4OFL A;  3DP6 A;  2BJJ X;  1FTJ A;  4RK2 A;  2OLB A;  3ILT B;  4ZEI A;  4MLQ A;  4LZ5 A;  4FED A;  1FQE A;  1D9V A;  3M3L A;  3IOR A;  2ESN A;  3S9N C;  3K6X A;  2O6A A;  3PUY E;  3GBA A;  1B51 A;  4KPT A;  4JXI A;  3FAT A;  2DOJ A;  4F3B A;  5JK4 A;  3KSX A;  1SW1 A;  4F18 A;  3T9V A;  1KWH A;  1R9L A;  4LON B;  3K2D A;  3PPN A;  1B9J A;  4ONY A;  3T22 A;  4H0W A;  4IO2 A;  3PMW A;  1YCJ A;  4OEN A;  2PT2 A;  1YTV A;  4FEC A;  4GL8 A;  3PD8 A;  4I62 A;  2E1S A;  2IEE A;  3UA8 A;  1ZU0 A;  5J1D A;  4H5F A;  5DT6 A;  3IO6 A;  5HM4 B;  3PMV A;  5DEX B;  3WAE A;  4NTL A;  1ZTY A;  3PPR A;  3M3K A;  2QPQ A;  2ZMB A;  1OQG A;  1WOD A;  2ZXT A;  4G8N A;  1OLC A;  1LBC A;  4G4P A;  3V89 B;  1SI0 A;  3Q27 A;  3DM0 A;  4ND9 A;  1N0T A;  3S4U A;  4NF4 B;  1LFI A;  3MW0 A;  4DDD A;  1CB6 A;  2ABH A;  1Y1M A;  2Y7W A;  1A7L A;  2O84 X;  5I58 A;  3N26 A;  4QSE A;  3IOW A;  2AIX A;  5ELV A;  1B6H A;  2YLN A;  3JV9 A;  4Z0I A;  4E0X A;  4WEP A;  3TAJ A;  3E13 X;  3HN0 A;  3E9X A;  4EXL A;  1VFE A;  1RYO A;  3SEU A;  2AL5 A;  3U93 A;  1ZBM A;  2I6E A;  2PYY A;  1URS A;  1B3G A;  3K1M A;  3U72 A;  1URD A;  2VD2 A;  5KCJ B;  4U4S A;  5H8H B;  3K6U A;  2YJP A;  3ZKL A;  1LBB A;  5B70 A;  1GGG A;  2I58 A;  1USY E;  5I59 B;  2Y7K A;  3CG1 A;  4IO3 A;  3U1O A;  4U23 A;  4ZEC A;  3HO7 A;  1YPN A;  5DVJ A;  1FQA A;  1PBQ A;  3RT8 A;  1M5E A;  4IO7 A;  1MM7 A;  2I4B A;  3T9X B;  4ZE9 A;  1B4Z A;  1B32 A;  2I0C A;  1WDN A;  3UP9 A;  4P0I A;  4N13 A;  4YB7 A;  4OXV A;  2H9B A;  1FTO A;  1SD3 A;  3I5O A;  1I6B A;  3W9V A;  5CBR A;  4OMB A;  4NF4 A;  1Q35 A;  2QS1 A;  3H6W A;  2HAV A;  1Q1K A;  4JBZ A;  2DWH A;  1DTZ A;  3N6T A;  3A09 A;  1US5 A;  4OZ9 A;  2F6G A;  1ZKB A;  2RKM A;  5A5X B;  1ZIU A;  3VVD A;  4WXJ A;  2DE2 A;  3D4G A;  1NH8 A;  4ZE8 A;  3MJN A;  1HSJ A;  1IXI A;  2ANJ A;  1QUI A;  4QRZ A;  3LSF B;  1FTM A;  4YZZ A;  3OO6 A;  3LBS A;  4YB6 A;  4PFY A;  3CVG A;  3PPO A;  4N6P A;  3RT6 B;  5HBC A;  1B7Z A;  1JW4 A;  3AXF A;  4AQ4 A;  5B7D A;  3BFT A;  4NF8 A;  3HV1 A;  1DTG A;  3LC8 A;  1Y4C A;  3USD A;  1AIV A;  2RC7 A;  5H8H A;  3IB2 A;  4YIC A;  3D4C A;  4GXA A;  2X7Q A;  1FCK A;  4QHQ A;  4RYA A;  1J1N A;  1B1X A;  1IUD A;  1IXC A;  5I59 A;  2DVZ A;  3LSL A;  3FGS A;  1EZO A;  1NNK A;  2DWA A;  3FJ7 A;  1A55 A;  2P2A A;  3ECR A;  2QRY A;  2V3Q A;  3OMB A;  3W9W A;  4BDL A;  4OFO A;  3B6T A;  1GTK A;  2DWJ A;  5TP9 A;  2LAO A;  4LA9 A;  4ZEF A;  1TWY A;  1B46 A;  4XKN A;  2NWJ A;  2X26 A;  3IO4 A;  2OBG A;  1MXU A;  2PVU A;  3MVX A;  2ZNT A;  4K3F A;  4QFP A;  2F78 A;  3TKD A;  1LLS A;  3FXR A;  1BTJ A;  1F9B A;  1FQF A;  1LAF E;  3T66 A;  4NWC A;  3OO8 A;  3V83 A;  2QS3 A;  3E4R A;  2NUV A;  4QSC A;  4R6K A;  2XXY A;  4NWD A;  3FV1 A;  2V84 A;  2E0S A;  2PX1 A;  1QKB A;  3TPA A;  1ZMG A;  3LR1 A;  1NL5 A;  4DCY A;  1XT8 A;  3KN7 A;  4RA1 A;  1QVS A;  3OEL A;  1B2H A;  3DLN A;  4IO6 A;  3FV2 A;  3BKI B; 
#chains in the Genus database with same CATH topology
 1P1W A;  4XIG Q;  4U21 A;  1IXH A;  4PET A;  3MVY A;  2WX9 A;  4DI4 B;  1ZJL A;  1INP A;  2Z8D A;  1I6A A;  5JTY A;  4YKI A;  1O7T A;  2QJE A;  1HSE A;  1OIB A;  1UTH B;  1FBP A;  4JVI A;  3TTR A;  3K02 A;  4GWZ A;  3MZ1 A;  1XOC A;  2FIX A;  1MQJ A;  4O3B A;  2B3F A;  2F36 A;  3KEI A;  3FZV A;  4THI A;  4GBW A;  2XWV A;  2FBP A;  4KCC A;  1H45 A;  4OFJ A;  4GWO A;  4NF5 A;  2G29 A;  2M8C A;  4BDM A;  3RN8 A;  4X1B A;  3VE1 B;  3IJO B;  2XXP A;  4G68 B;  3RPL A;  4X04 A;  2ONK E;  4XF5 A;  3S9M C;  2FA7 A;  4N8Y A;  1QJM A;  4WKM A;  4U2R A;  1KA0 A;  3I6V A;  2F35 A;  4NMY A;  2V4C A;  5A5L A;  3G3K A;  4MH5 A;  3A3U A;  5ICT A;  3IAZ A;  1RKM A;  3CR9 A;  1DPP A;  5EQ8 A;  1LGB C;  2UXA A;  3KN3 A;  3QIM A;  4HE2 A;  3C32 A;  1DK4 A;  2HFB A;  5ITO A;  1FPB A;  3QYT A;  4HXV A;  2DSF A;  3QUF A;  1FBH A;  3OO9 A;  4LP2 B;  4UAC A;  4P9K A;  1DSN A;  1H43 A;  4EXK A;  3OO7 A;  4UA8 A;  5H8Q A;  2DYX A;  3B6Q A;  3A29 A;  2HZL A;  4ELP A;  3MQ9 A;  1D3K A;  1AOV A;  2AYS A;  5LOM A;  4ESW A;  3O9P A;  2REG A;  2R8T A;  1MS7 A;  2OJT A;  5F1Q A;  1N76 A;  4PQJ A;  1MPC A;  4MBP A;  2F7C A;  4POW A;  2IA4 A;  2REJ A;  4OVR A;  1OVT A;  2QS4 A;  1PEB A;  3TQL A;  3FD3 A;  1IMC A;  4JVD A;  1D9Q A;  4F29 A;  3O2A A;  5IZ3 A;  5I58 B;  4GRK A;  4PDH A;  4F22 A;  2B3B A;  2XX7 A;  3O6H A;  4G2Z A;  3B8B A;  3MST A;  1FPF A;  3K4U A;  3PGF A;  4U1Z A;  5T3J A;  1TT1 A;  3ZKK A;  3EHS A;  4IGT A;  4GFR A;  3O29 A;  1B5J A;  2XXW A;  4MAG A;  4FAJ A;  4XKQ A;  4FEB A;  2WBB A;  4BDN A;  2ZYK A;  4G68 A;  4IR8 A;  5IZZ A;  3PMX A;  3G3J A;  4U1O A;  4R74 A;  3K00 A;  4PF6 A;  4X9T A;  4TQU Q;  5AA2 A;  1MY3 A;  3TUS A;  4H8J A;  3TDJ A;  3PV0 E;  5L9M A;  3LUY A;  3TCF A;  2ONR A;  4X8R A;  2R9J A;  1FQC A;  2DS9 A;  3M3F A;  1MPB A;  3UIF A;  4PE3 A;  5IM2 A;  3MAM A;  2HQ0 A;  2UVJ A;  4HW8 A;  5H8F B;  2DE3 A;  5I56 A;  4F1Y A;  1P1N A;  2HAU A;  3H7M A;  4L17 A;  4F2O A;  4MFI A;  4NF6 B;  4MHF A;  3FVO A;  2RCA A;  2H4I A;  3S9L C;  2CMO A;  2PBW A;  3MC2 A;  1B4H A;  2UYE A;  1DPE A;  2FVZ A;  3S9E A;  1LFG A;  2Y7I A;  4PFT A;  2R6G E;  4YKK A;  1EZ9 A;  2F3D A;  1IIT A;  1NNT A;  2VD3 A;  4GVO A;  3DP4 A;  1CE2 A;  3CFX A;  1IMF A;  5CMK A;  1I69 A;  2KQZ A;  1OQH A;  4N6D A;  1FPJ A;  1VE4 A;  2ZYM A;  4OES A;  3CFL A;  4G8H A;  3I3V A;  5CMB A;  2HHM A;  4NAP A;  1B7U A;  3KGC A;  5CBS A;  3B7D A;  1UQW A;  1LB9 A;  3EF7 A;  3O6I A;  1S9T A;  1SDX A;  1DOT A;  2QVR A;  1QW0 A;  2DQV A;  1AH5 A;  2GQ1 A;  1Z7N E;  3N6U A;  2HXW A;  2F34 A;  1A8E A;  4O3C A;  1SQY A;  3ROJ A;  1FBG A;  4LQ2 A;  1ELJ A;  4NF8 B;  2VP1 A;  3KZG A;  3SET A;  4OVP A;  5I2N A;  1EZP A;  3GXA A;  3B50 A;  4PFU A;  5LTC A;  3PD9 A;  4FOR A;  1N3W A;  3ILU B;  1R9Q A;  4PAF A;  2XWI A;  3FXB A;  3C9H A;  4DXC A;  1POT A;  1MXW A;  4QFN A;  5TPA A;  1EYJ A;  2RC8 A;  1JW1 A;  5H8F A;  3VDF A;  2XWO A;  3OOA A;  3SKP A;  4GBV A;  4KYS A;  3VXB A;  1MQG A;  2GH9 A;  5LDZ A;  1WVJ A;  3KOT A;  5TP9 B;  4F1V A;  1D4N A;  4IGR A;  4NF6 A;  1G0H A;  2Q8J A;  3TYH A;  1KA1 A;  2JJK A;  4MLV A;  3K1N A;  4I8C A;  4R6Y A;  5CMM A;  5IKB A;  4FAT A;  1LBX A;  1US4 A;  3HPI A;  4OER A;  2Q89 A;  3IL1 B;  3CI8 A;  4ESX A;  2F7B A;  1SW4 A;  2W7Y A;  1Y3P A;  2Z22 A;  2A5T A;  1Z7M E;  3MZ9 A;  4PE5 B;  3MPL A;  5M2V A;  3RPW A;  4PGP A;  1SW5 A;  4DE8 A;  1VSO A;  4I9D A;  4G77 A;  5CMC A;  1II5 A;  4QF9 A;  4R2B A;  4R75 A;  1NI9 A;  4UAB A;  5AA4 B;  1NUX A;  5EYG A;  3KFM A;  1B40 A;  4ZEB A;  1M5D A;  4I3Y A;  3CSB A;  1MXY A;  3O28 A;  4H8I A;  3O97 A;  3QUJ A;  4YMB A;  1B58 A;  1Y3Q A;  2V93 A;  2Y5K A;  3KJT A;  1NNF A;  5DYH A;  4IY5 A;  2XXH A;  2DP8 A;  1UIU A;  1RYX A;  4YU0 A;  4GX4 A;  4DI3 D;  1SI1 A;  3Q29 A;  1JVY A;  2O51 A;  3GYY A;  4MNP A;  1FRP A;  3HST A;  4XTC Q;  1FQB A;  4GWU A;  4H1X A;  1PBP A;  4PBQ A;  4EQB A;  1Y3N A;  2CZK A;  4KR5 A;  2FYI A;  5K2X A;  3V5A A;  5JTY B;  2QMX A;  2G93 A;  5DVF A;  4PDD A;  1JQF A;  1YAE A;  2ZYO A;  3H06 B;  4AS5 A;  1BK4 A;  2I48 A;  2R71 A;  4EF2 A;  3FVN A;  4BDQ A;  1RDY A;  5HPQ A;  4NF5 B;  4OYV A;  4QFL A;  3U65 A;  1PB8 A;  5L9O A;  2YPN A;  5EQ9 A;  5L9S A;  4H6D A;  4X48 A;  3EPE A;  3C36 A;  4ELO A;  4POX A;  2I3W A;  4QFK A;  3O66 A;  4DLD A;  3RGY A;  3JYR A;  4LQ5 A;  2HXR A;  4M1V A;  4QSD A;  4JDF A;  4RXL A;  2WKY A;  5I2K B;  3W15 C;  2OCU A;  4P8B A;  5AA4 A;  1B3H A;  5FHO A;  1CNQ A;  2QSX A;  3T93 B;  1FBC A;  5FTH A;  4BDR A;  4H5G A;  3O6G A;  1M5B A;  4PAK A;  1FPD A;  3RNN A;  4NGU A;  1T0K A;  1P1Q A;  5FHM A;  1TXF A;  4GXS B;  1A8F A;  1BIY A;  3TCH A;  1BLF A;  2DE4 A;  2XHD A;  4EF1 A;  3HHF A;  5H8Q B;  2UVG A;  3H6V A;  3PUZ E;  1SVX B;  3VLU A;  3T9U A;  3HFU A;  1S50 A;  4N6K A;  4DXB A;  1B0L A;  1FPG A;  4MNC A;  3FXQ A;  4BLA A;  4RPO A;  4KHZ E;  2I4C A;  3PPQ A;  4DCX A;  3IR1 A;  4RJZ A;  1HSL A;  4I3E A;  3OEN A;  1IMA A;  1NKX A;  1N3X A;  1Y20 A;  1YXI A;  1FBD A;  3IOU A;  5IZ3 B;  2QFL A;  1LAX A;  3C35 A;  1NV1 A;  4KD5 A;  3TQW A;  2P1S A;  3C31 A;  1PDA A;  4N8G A;  2GFE A;  2HPG A;  3PUV E;  3RLF E;  4PBH A;  3T0J A;  1A54 A;  3HHG A;  4O7I A;  2DDK A;  2O7U A;  5EHS A;  3QXM A;  3Q28 A;  2O69 A;  4F39 A;  2H99 A;  3R7X A;  3K01 A;  4RNS A;  2OK2 A;  3WAF A;  1Y4T A;  3CRB A;  4WED A;  5AA2 B;  4GQO A;  3TTL A;  3JZJ A;  3OSR A;  2XXK A;  2B65 A;  2XXR A;  4GWW A;  4GWY A;  5FBP A;  1N04 A;  3RY3 A;  5I2K A;  2Q8M A;  2XXQ A;  2NXO A;  4R6H A;  2VHA A;  4Q30 B;  3UN6 A;  3RUM A;  1DCU A;  1MPD A;  3SEV A;  1I6Q A;  5EHM A;  1B3E A;  4C0R A;  3R26 A;  3GZG A;  4O7M A;  5I56 B;  1XS5 A;  1S7Y A;  5ESY A;  4QFO A;  1MDQ A;  1ZLQ A;  4PF8 A;  4NF0 A;  1D9Y A;  1LCF A;  3V8X B;  4PFW A;  3BFU A;  3LSX A;  3DEL B;  3GLB A;  3UK4 A;  2Y7P A;  3U94 A;  2HEU A;  1IEJ A;  2P3N A;  2O68 A;  3MP1 A;  5DTB A;  4ZZE A;  1M5F A;  3HCQ A;  4GOT A;  1MRP A;  2I49 A;  3KC1 A;  1RDZ A;  1VR5 A;  2O1L A;  2HZK A;  1LCT A;  5IGA A;  1XHY A;  1P1U A;  2Q2C A;  4OEV A;  1MQH A;  3C4M A;  4F3P A;  1FTK A;  4OVT A;  3G3I A;  1URG A;  1FTL A;  2Z23 A;  4NX1 A;  4OEU A;  3E78 A;  2DVC A;  4OET A;  4BDO A;  1FTA A;  1TFA A;  2OZZ A;  1FJ6 A;  4NQ8 A;  4G8M A;  4RY1 A;  5FTI A;  2CZL A;  2O7I A;  3OSQ A;  3SZP A;  4ELR A;  4ZED A;  3KOS A;  2F8D A;  2Y7R A;  4IY6 A;  2QVU A;  1IME A;  5I2N B;  2QVV A;  2DXR A;  3ODB A;  4YB5 A;  4FIM A;  4ZZA A;  1O64 A;  3EQ1 A;  4PCD A;  5KDT A;  5KZT A;  2XA5 A;  1USY H;  3P7I A;  1NH7 A;  2V3U A;  1IIW A;  3TOD A;  2XXT A;  3DP8 A;  4R9G A;  2RIN A;  4JB7 A;  5TPA B;  1IQ7 A;  3Q25 A;  3H3G A;  2XXI A;  3THI A;  2I3V A;  3FIR A;  3TZA A;  3LSW A;  2QMW A;  1PB7 A;  3VLW A;  1NMU A;  2I0B A;  1IMB A;  3G3G A;  4OVQ A;  4F3S A;  4AS4 A;  4Z7E A;  5H8S A;  4MEV A;  3RTF B;  4F1U A;  2QL3 A;  1UTB B;  1IXG A;  4LZ8 A;  3K6W A;  3SDF A;  1H44 A;  4TOZ A;  2D3I A;  2ZYN A;  3H4Z A;  4JWO A;  4YKJ A;  2FNC A;  4JWX A;  1NV6 A;  4OTE A;  4R2F A;  2H98 A;  4Q8R A;  4JVC A;  1MH4 A;  4DXU A;  2P0S A;  5ICQ A;  5DVI A;  3FAS A;  1JET A;  4EUO A;  3ZS6 A;  2A5T B;  4ZDM A;  2VGQ A;  5AE4 A;  3TEP A;  3N94 A;  4YMA A;  5CC2 A;  5AA2 D;  3U92 A;  2KR0 A;  3KG2 A;  4R73 A;  2OWS A;  3EN3 A;  1MY2 A;  3TFL A;  3OEK A;  3T1B A;  2XX9 A;  3G7W A;  2H25 A;  1XVX A;  4R72 A;  4Q5T A;  3L6H A;  2GRV A;  4R9F A;  2VPO A;  5AA3 A;  1H76 A;  2O1M A;  3BIH A;  3TCG A;  3T96 B;  3SES A;  1MY1 A;  3UOR A;  1NNP A;  4DIG A;  3VLV A;  3BIG A;  1BKA A;  2V25 A;  2Q88 A;  1JNF A;  3IX1 A;  3R6U A;  4HCW A;  5I3S A;  1QUJ A;  2UVH A;  3Q26 A;  2DXY A;  2XWK A;  1NV5 A;  1B0H A;  1LAH E;  3VV5 A;  1TFD A;  4KQP A;  3UGW A;  3SEY A;  3MVZ A;  2CZI A;  1EU8 A;  4HTG A;  4O8M A;  4P47 A;  3TTM A;  4YKP A;  3EHT A;  3F11 A;  4FE8 A;  1SPI A;  4NED A;  1B3F A;  4F19 A;  2A5S A;  3H6U A;  1MXV A;  1MXZ A;  3NOH A;  4IO5 A;  1QUL A;  1OVB A;  4AB6 A;  1UTB A;  1B1H A;  3K1P A;  1M5C A;  4PP0 A;  3SEW A;  1MY0 A;  1MDP 1;  3C33 A;  1JEV A;  3IK6 B;  5DEX A;  5I7I A;  4PTK A;  4E0W A;  1LBY A;  5EYH A;  4Q0C A;  4GX6 A;  2CEY A;  3MP6 A;  1IZ1 A;  2Z8E A;  1A99 A;  3B6W A;  3VVE A;  4MJO A;  5L8D A;  3IOT A;  2D21 A;  2WEF A;  4F2Q A;  1JP4 A;  2XXV A;  3M8U A;  4OVS A;  5J16 A;  3FUZ A;  5ITP A;  3SEX A;  5K2Y A;  3KJ7 A;  3MYU A;  1SW2 A;  5ET5 A;  5FHN A;  1VFD A;  1UIV A;  1R1N A;  1VDW A;  3TEL A;  2NVU B;  4HCY A;  1B5H A;  2XD2 A;  1Y9U A;  2NOO A;  1AWB A;  4AB5 A;  3PPP A;  3FVK A;  5I57 B;  1XI6 A;  2F97 A;  2UVI A;  2Y84 A;  2F6P A;  3MUQ A;  4RK9 A;  1NV7 A;  1MG1 A;  4H67 A;  2HCA A;  3BBR A;  5KCJ A;  1N84 A;  3VVF A;  1LB8 A;  2GHA A;  4H65 A;  5F7V A;  3CSG A;  4LUB A;  4ZS9 A;  2ALU A;  2XXX A;  3IOV A;  1Y1Z A;  1SBP A;  1FW0 A;  3TMG A;  2XXU A;  4GWS A;  4JWY A;  1YZ0 A;  4HS7 A;  5JEI A;  4ELQ A;  2CZH A;  4ISU A;  3FXU A;  1MQI A;  3SER A;  4ECF A;  3H6T A;  3G3F A;  3K0V A;  1FQD A;  3PTY A;  3S2V A;  3ZSF A;  1BP5 A;  3CG3 A;  3KC0 A;  1OLA A;  4JSO A;  4XXU A;  4OAN A;  1NUY A;  4OWD A;  1EYI A;  2PMS A;  2ZNS A;  2P3V A;  3FJM A;  4P11 A;  3PU5 A;  1N7X A;  3CFZ A;  4LAT A;  3KN8 A;  3TTN A;  1OMP A;  1XVY A;  3N5L A;  1KZ8 A;  5ISU A;  4KYD A;  3KBR A;  4GIZ A;  4KCD A;  4P1L A;  1EH3 A;  5AA1 A;  4KFQ A;  4KI0 E;  5CRY A;  4TLM B;  4EQ9 A;  4EDP A;  5A5X A;  3E3K A;  5BUU A;  4PFR A;  1Q9D A;  3VFJ A;  4C1U A;  3OXN A;  1FBE A;  2VOZ A;  5I84 A;  5IAI A;  4EQ7 A;  1K9Z A;  3OEM A;  4KYE A;  2V3T A;  4GWX A;  4IO4 A;  3LV0 A;  2PFY A;  3KSJ A;  3K6V A;  5I57 A;  3IB1 A;  1P1O A;  3GBB A;  1DMB A;  1XC1 A;  4OQO A;  5TU0 A;  2GHB A;  1LEV A;  2THI A;  2PFZ A;  2AL4 A;  4N4U A;  1R6Z A;  4O94 A;  1LFH A;  1JVX A;  3FJG A;  1SYH A;  2H5Y A;  4RPN A;  1MQD A;  2XX8 A;  4G68 C;  1LAG E;  3PUW E;  4C1T A;  1B05 A;  2DWI A;  1B5I A;  4JSD A;  4F3G A;  4LVQ A;  3EHU A;  4H45 A;  3ONM A;  3A3C A;  3H03 A;  4LZ7 A;  1MXX A;  4U22 A;  3IB0 A;  1GVC A;  1PB9 A;  2XD3 A;  3RTW B;  3QSL A;  4NHB A;  4F31 B;  4IB2 A;  2OWT A;  3RQT A;  5CI5 A;  2F5X A;  5H8N B;  4TLL B;  4YAH X;  3IFC A;  4OHN A;  4U4X A;  1QUK A;  4XKR A;  2Q2A A;  3MP8 A;  2RF1 A;  3U8Q A;  3L6G A;  4GLI A;  3IFA A;  1MY4 A;  3G3H A;  4X1D A;  4ZEK A;  5CM6 A;  3EKI A;  1N7W A;  1FPL A;  1NFT A;  1AMF A;  2KLF A;  5ET8 A;  3OD7 A;  4GD5 A;  1JEU A;  3MZB A;  1JW5 A;  2FHY A;  4KXP A;  4OVJ A;  2Y5L A;  3LUZ A;  3D1R A;  1A40 A;  2RCB A;  3QK6 A;  1B3L A;  1ATG A;  5BWJ A;  1POY 1;  5KDT B;  1MM6 A;  2OWZ A;  1FJ9 A;  3IJX B;  5EYF A;  1GV8 A;  4HE0 A;  1B52 A;  1O63 A;  4P56 A;  4P0G A;  4M4G A;  1L5T A;  4XEQ A;  2RC9 A;  1QKA A;  2QS2 A;  1PC3 A;  3MBP A;  1MH3 A;  2UYF A;  4OA4 A;  3PUX E;  4O3A A;  3VXC A;  1B7H A;  1ANF A;  4MMP A;  2ONS A;  1SYI A;  2F7A A;  3TTK A;  4FJP A;  3T9H B;  5I5P A;  1LST A;  3CIJ A;  4DZ1 A;  4I1D A;  4N07 A;  2X7P A;  3FVG A;  2Z8F A;  2PT1 A;  4XKP A;  4GL0 A;  5H8N A;  2D5W A;  5DW8 A;  1NV4 A;  3MPK A;  3MVW A;  1AL3 A;  3QAX A;  2Q9T A;  1K9Y A;  2WYP A;  1H3D A;  2PCR A;  3C34 A;  4GF8 A;  3MWB A;  4MF3 A;  1UTH A;  4NE4 A;  1GR2 A;  1P99 A;  2ZNU A;  4OFL A;  3DP6 A;  2BJJ X;  2FIE A;  1FTJ A;  4RK2 A;  2OLB A;  3ILT B;  1LBZ A;  4ZEI A;  4MLQ A;  4NN3 A;  4N15 A;  4LZ5 A;  4FED A;  1FQE A;  3KBZ A;  1D9V A;  3M3L A;  1NUW A;  3IOR A;  2ESN A;  3S9N C;  1LBW A;  3K6X A;  5ET6 A;  1NV0 A;  2O6A A;  3PUY E;  2B4M A;  3GBA A;  1B51 A;  4KPT A;  4JXI A;  3FAT A;  4N81 A;  2DOJ A;  4PC9 A;  4F3B A;  5JK4 A;  3KSX A;  1SW1 A;  5IZ1 A;  4F18 A;  3T9V A;  4QBA A;  1KWH A;  1R9L A;  4LON B;  3K2D A;  3PPN A;  1B9J A;  4ONY A;  2L5V A;  3T22 A;  4H0W A;  4IO2 A;  1FSA A;  2MKZ A;  3PMW A;  2F3B A;  1YCJ A;  4OEN A;  2PT2 A;  1YTV A;  4FEC A;  4GL8 A;  3PD8 A;  4I62 A;  2E1S A;  2IEE A;  3UA8 A;  1ZU0 A;  5J1D A;  4H5F A;  5DT6 A;  3IO6 A;  5HM4 B;  3PMV A;  4MX6 A;  5DEX B;  3WAE A;  4NTL A;  1ZTY A;  3PPR A;  3M3K A;  2QPQ A;  2ZMB A;  1FPK A;  1OQG A;  1WOD A;  2ZXT A;  4G8N A;  4PAI A;  1RDX A;  1OLC A;  1LBC A;  4G4P A;  3V89 B;  1SI0 A;  4PFB A;  3Q27 A;  3DM0 A;  3E79 A;  4ND9 A;  1N0T A;  3S4U A;  4NF4 B;  1LFI A;  3MW0 A;  4DDD A;  1CB6 A;  1YYZ A;  2ABH A;  4P1E A;  1Y1M A;  2Y7W A;  1A7L A;  2O84 X;  5I58 A;  3N26 A;  1QGX A;  4QSE A;  3IOW A;  5EQA A;  2AIX A;  3FBP A;  5ELV A;  1B6H A;  2YLN A;  3JV9 A;  4Z0I A;  4E0X A;  4WEP A;  1EYK A;  3TAJ A;  3E13 X;  3HN0 A;  3E9X A;  4EXL A;  1VFE A;  1RYO A;  3SEU A;  2ZZV A;  2AL5 A;  3U93 A;  1ZBM A;  2I6E A;  2PYY A;  1URS A;  1B3G A;  3K1M A;  3U72 A;  1URD A;  2VT5 A;  2VD2 A;  4MCO A;  5KCJ B;  2VPN A;  4U4S A;  2CEX A;  5H8H B;  3K6U A;  2ZZX A;  2YJP A;  3ZKL A;  1LBB A;  5B70 A;  1FPI A;  4P3L A;  1GGG A;  2I58 A;  1USY E;  5I59 B;  2Y7K A;  3CG1 A;  4IO3 A;  3U1O A;  4U23 A;  4ZEC A;  3HO7 A;  1YPN A;  5DVJ A;  4PGN A;  1FQA A;  1PBQ A;  3RT8 A;  1M5E A;  4IO7 A;  1MM7 A;  3CHG A;  1NV2 A;  2I4B A;  3T9X B;  4HE1 A;  4ZE9 A;  1B4Z A;  1B32 A;  2I0C A;  1WDN A;  4N17 A;  3UP9 A;  4FBP A;  4P0I A;  4N13 A;  4YB7 A;  4OXV A;  2H9B A;  1FTO A;  1SD3 A;  3I5O A;  1I6B A;  3W9V A;  5CBR A;  4OMB A;  4NF4 A;  1Q35 A;  2QS1 A;  4PFI A;  3H6W A;  2HAV A;  1Q1K A;  4JBZ A;  2DWH A;  1DTZ A;  1NUZ A;  3N6T A;  3A09 A;  1US5 A;  4OZ9 A;  2F6G A;  1ZKB A;  2RKM A;  5A5X B;  1ZIU A;  3VVD A;  4WXJ A;  2OX3 A;  2DE2 A;  3D4G A;  1NH8 A;  4ZE8 A;  3MJN A;  1HSJ A;  4XFE A;  1IXI A;  2ANJ A;  1QUI A;  4QRZ A;  3LSF B;  1FTM A;  4YZZ A;  3OO6 A;  3LBS A;  4YB6 A;  2WYK A;  4PFY A;  2ZZW A;  1NV3 A;  3CVG A;  3PPO A;  4N6P A;  3RT6 B;  5HBC A;  1B7Z A;  1JW4 A;  1IMD A;  3AXF A;  4AQ4 A;  5B7D A;  3BFT A;  4NF8 A;  3HV1 A;  1DTG A;  3LC8 A;  1Y4C A;  3USD A;  1AIV A;  2RC7 A;  5H8H A;  3IB2 A;  4YIC A;  3D4C A;  4GXA A;  2X7Q A;  1FCK A;  4QHQ A;  4RYA A;  1J1N A;  1B1X A;  1IUD A;  1IXC A;  4NG7 A;  5I59 A;  2DVZ A;  3LSL A;  3FGS A;  1EZO A;  1NNK A;  2DWA A;  3FJ7 A;  1A55 A;  4I40 A;  2B4L A;  2P2A A;  1LBV A;  3ECR A;  2QRY A;  2V3Q A;  3OMB A;  3W9W A;  4BDL A;  4OFO A;  1G0I A;  3B6T A;  1GTK A;  4QXD A;  2DWJ A;  5TP9 A;  2LAO A;  4LA9 A;  4ZEF A;  1TWY A;  4MIJ A;  1B46 A;  4GX3 A;  4G61 A;  4XKN A;  2NWJ A;  2X26 A;  3IO4 A;  2OBG A;  1MXU A;  2PVU A;  3MVX A;  3ISP A;  2ZNT A;  4K3F A;  4QFP A;  2F78 A;  3TKD A;  1LLS A;  3FXR A;  1BTJ A;  1DBZ A;  1F9B A;  1FQF A;  1LAF E;  3T66 A;  4NWC A;  3RPL B;  3OO8 A;  3QMF A;  3V83 A;  1FBF A;  2QS3 A;  3E4R A;  2NUV A;  3RYD A;  4QSC A;  4R6K A;  4H46 A;  2XXY A;  5EQ7 A;  4NWD A;  3FV1 A;  2V84 A;  2Q74 A;  2E0S A;  2PX1 A;  1QKB A;  3TPA A;  1ZMG A;  4LN5 A;  3LR1 A;  1NL5 A;  1FPE A;  4DCY A;  1XT8 A;  3KN7 A;  2BJI A;  4RA1 A;  1QVS A;  5F24 A;  3OEL A;  4MNI A;  2WBD A;  1B2H A;  3DLN A;  4IO6 A;  5ET7 A;  3FV2 A;  4N91 A;  3BKI B; 
#chains in the Genus database with same CATH homology
 1P1W A;  4XIG Q;  4U21 A;  1IXH A;  4PET A;  3MVY A;  2WX9 A;  4DI4 B;  1ZJL A;  1INP A;  2Z8D A;  1I6A A;  5JTY A;  4YKI A;  1O7T A;  2QJE A;  1HSE A;  1OIB A;  1UTH B;  1FBP A;  3TTR A;  4JVI A;  3K02 A;  4GWZ A;  3MZ1 A;  1XOC A;  2FIX A;  1MQJ A;  4O3B A;  2B3F A;  2F36 A;  3KEI A;  3FZV A;  4THI A;  4GBW A;  2XWV A;  2FBP A;  4KCC A;  1H45 A;  4OFJ A;  4GWO A;  4NF5 A;  2G29 A;  2M8C A;  4BDM A;  3RN8 A;  4X1B A;  3VE1 B;  3IJO B;  2XXP A;  4G68 B;  3RPL A;  4X04 A;  2ONK E;  4XF5 A;  3S9M C;  2FA7 A;  4N8Y A;  1QJM A;  4WKM A;  4U2R A;  1KA0 A;  3I6V A;  2F35 A;  4NMY A;  2V4C A;  5A5L A;  3G3K A;  4MH5 A;  3A3U A;  5ICT A;  3IAZ A;  1RKM A;  3CR9 A;  1DPP A;  5EQ8 A;  1LGB C;  2UXA A;  3KN3 A;  3QIM A;  4HE2 A;  3C32 A;  2HFB A;  1DK4 A;  5ITO A;  1FPB A;  3QYT A;  4HXV A;  2DSF A;  3QUF A;  1FBH A;  3OO9 A;  4LP2 B;  4UAC A;  4P9K A;  1DSN A;  1H43 A;  4EXK A;  3OO7 A;  4UA8 A;  5H8Q A;  2DYX A;  3B6Q A;  3A29 A;  2HZL A;  4ELP A;  3MQ9 A;  1D3K A;  1AOV A;  2AYS A;  5LOM A;  4ESW A;  3O9P A;  2REG A;  2R8T A;  1MS7 A;  2OJT A;  5F1Q A;  1N76 A;  4PQJ A;  1MPC A;  4MBP A;  2F7C A;  4POW A;  2IA4 A;  2REJ A;  4OVR A;  1OVT A;  2QS4 A;  1PEB A;  3TQL A;  3FD3 A;  1IMC A;  4JVD A;  1D9Q A;  4F29 A;  3O2A A;  5IZ3 A;  5I58 B;  4GRK A;  4PDH A;  4F22 A;  2B3B A;  2XX7 A;  3O6H A;  4G2Z A;  3B8B A;  3MST A;  1FPF A;  3K4U A;  3PGF A;  4U1Z A;  5T3J A;  1TT1 A;  3ZKK A;  3EHS A;  4IGT A;  4GFR A;  3O29 A;  1B5J A;  2XXW A;  4FAJ A;  4MAG A;  4XKQ A;  4FEB A;  2WBB A;  4BDN A;  2ZYK A;  4G68 A;  4IR8 A;  5IZZ A;  3PMX A;  3G3J A;  4U1O A;  4R74 A;  3K00 A;  4PF6 A;  4X9T A;  4TQU Q;  5AA2 A;  1MY3 A;  3TUS A;  4H8J A;  3TDJ A;  3PV0 E;  5L9M A;  3LUY A;  3TCF A;  2ONR A;  4X8R A;  2R9J A;  1FQC A;  2DS9 A;  3M3F A;  1MPB A;  3UIF A;  4PE3 A;  5IM2 A;  3MAM A;  2HQ0 A;  2UVJ A;  4HW8 A;  5H8F B;  2DE3 A;  5I56 A;  4F1Y A;  1P1N A;  2HAU A;  3H7M A;  4L17 A;  4F2O A;  4MFI A;  4NF6 B;  4MHF A;  3FVO A;  2RCA A;  2H4I A;  3S9L C;  2CMO A;  2PBW A;  3MC2 A;  1B4H A;  2UYE A;  1DPE A;  2FVZ A;  3S9E A;  1LFG A;  2Y7I A;  4PFT A;  2R6G E;  4YKK A;  1EZ9 A;  2F3D A;  1IIT A;  1NNT A;  2VD3 A;  4GVO A;  3DP4 A;  1CE2 A;  3CFX A;  1IMF A;  5CMK A;  1I69 A;  2KQZ A;  1OQH A;  4N6D A;  1FPJ A;  1VE4 A;  2ZYM A;  4OES A;  3CFL A;  4G8H A;  3I3V A;  5CMB A;  2HHM A;  4NAP A;  1B7U A;  3KGC A;  5CBS A;  3B7D A;  1UQW A;  1LB9 A;  3EF7 A;  3O6I A;  1S9T A;  1SDX A;  1DOT A;  2QVR A;  1QW0 A;  2DQV A;  1AH5 A;  2GQ1 A;  1Z7N E;  3N6U A;  2HXW A;  2F34 A;  1A8E A;  4O3C A;  1SQY A;  3ROJ A;  1FBG A;  4LQ2 A;  1ELJ A;  4NF8 B;  2VP1 A;  3KZG A;  3SET A;  4OVP A;  5I2N A;  1EZP A;  3GXA A;  3B50 A;  4PFU A;  5LTC A;  3PD9 A;  4FOR A;  1N3W A;  3ILU B;  1R9Q A;  4PAF A;  2XWI A;  3FXB A;  3C9H A;  4DXC A;  1POT A;  1MXW A;  4QFN A;  5TPA A;  1EYJ A;  2RC8 A;  1JW1 A;  5H8F A;  3VDF A;  2XWO A;  3OOA A;  3SKP A;  4GBV A;  4KYS A;  3VXB A;  1MQG A;  2GH9 A;  5LDZ A;  1WVJ A;  3KOT A;  5TP9 B;  4F1V A;  1D4N A;  4IGR A;  4NF6 A;  1G0H A;  2Q8J A;  3TYH A;  1KA1 A;  2JJK A;  4MLV A;  3K1N A;  4I8C A;  4R6Y A;  5CMM A;  5IKB A;  4FAT A;  1LBX A;  1US4 A;  3HPI A;  4OER A;  2Q89 A;  3IL1 B;  3CI8 A;  4ESX A;  2F7B A;  1SW4 A;  2W7Y A;  1Y3P A;  2Z22 A;  2A5T A;  1Z7M E;  3MZ9 A;  4PE5 B;  3MPL A;  5M2V A;  3RPW A;  4PGP A;  1SW5 A;  4DE8 A;  1VSO A;  4I9D A;  4G77 A;  5CMC A;  1II5 A;  4QF9 A;  4R2B A;  4R75 A;  1NI9 A;  4UAB A;  5AA4 B;  1NUX A;  5EYG A;  3KFM A;  1B40 A;  4ZEB A;  1M5D A;  4I3Y A;  3CSB A;  1MXY A;  3O28 A;  4H8I A;  3O97 A;  3QUJ A;  4YMB A;  1B58 A;  1Y3Q A;  2V93 A;  2Y5K A;  3KJT A;  1NNF A;  5DYH A;  4IY5 A;  2XXH A;  2DP8 A;  1UIU A;  1RYX A;  4YU0 A;  4GX4 A;  4DI3 D;  1SI1 A;  3Q29 A;  1JVY A;  2O51 A;  3GYY A;  4MNP A;  1FRP A;  3HST A;  4XTC Q;  1FQB A;  4GWU A;  4H1X A;  1PBP A;  4PBQ A;  4EQB A;  1Y3N A;  2CZK A;  4KR5 A;  2FYI A;  5K2X A;  3V5A A;  5JTY B;  2QMX A;  2G93 A;  5DVF A;  4PDD A;  1JQF A;  1YAE A;  2ZYO A;  3H06 B;  4AS5 A;  1BK4 A;  2I48 A;  2R71 A;  4EF2 A;  3FVN A;  4BDQ A;  1RDY A;  5HPQ A;  4NF5 B;  4OYV A;  4QFL A;  3U65 A;  1PB8 A;  5L9O A;  2YPN A;  5EQ9 A;  5L9S A;  4H6D A;  4X48 A;  3EPE A;  3C36 A;  4ELO A;  4POX A;  2I3W A;  4QFK A;  3O66 A;  4DLD A;  3RGY A;  3JYR A;  4LQ5 A;  4M1V A;  4QSD A;  2HXR A;  4JDF A;  4RXL A;  2WKY A;  5I2K B;  3W15 C;  2OCU A;  4P8B A;  5AA4 A;  1B3H A;  5FHO A;  1CNQ A;  2QSX A;  3T93 B;  1FBC A;  5FTH A;  4BDR A;  4H5G A;  3O6G A;  1M5B A;  4PAK A;  1FPD A;  3RNN A;  4NGU A;  1T0K A;  1P1Q A;  5FHM A;  1TXF A;  4GXS B;  1A8F A;  1BIY A;  3TCH A;  1BLF A;  2DE4 A;  2XHD A;  4EF1 A;  3HHF A;  5H8Q B;  2UVG A;  3H6V A;  3PUZ E;  1SVX B;  3VLU A;  3T9U A;  3HFU A;  1S50 A;  4DXB A;  4N6K A;  1B0L A;  1FPG A;  4MNC A;  3FXQ A;  4BLA A;  4RPO A;  4KHZ E;  2I4C A;  3PPQ A;  4DCX A;  3IR1 A;  4RJZ A;  1HSL A;  4I3E A;  3OEN A;  1IMA A;  1NKX A;  1N3X A;  1Y20 A;  1YXI A;  1FBD A;  3IOU A;  5IZ3 B;  2QFL A;  1LAX A;  3C35 A;  1NV1 A;  4KD5 A;  3TQW A;  2P1S A;  3C31 A;  1PDA A;  4N8G A;  2GFE A;  2HPG A;  3PUV E;  3RLF E;  4PBH A;  3T0J A;  1A54 A;  3HHG A;  4O7I A;  2DDK A;  2O7U A;  5EHS A;  3QXM A;  3Q28 A;  2O69 A;  4F39 A;  2H99 A;  3R7X A;  3K01 A;  4RNS A;  3WAF A;  2OK2 A;  1Y4T A;  3CRB A;  4WED A;  5AA2 B;  4GQO A;  3TTL A;  3JZJ A;  3OSR A;  2XXK A;  2B65 A;  2XXR A;  4GWW A;  4GWY A;  5FBP A;  1N04 A;  3RY3 A;  5I2K A;  2Q8M A;  2XXQ A;  2NXO A;  4R6H A;  2VHA A;  4Q30 B;  3UN6 A;  3RUM A;  1DCU A;  1MPD A;  3SEV A;  1I6Q A;  5EHM A;  1B3E A;  4C0R A;  3R26 A;  3GZG A;  5I56 B;  4O7M A;  1XS5 A;  1S7Y A;  5ESY A;  4QFO A;  1MDQ A;  1ZLQ A;  4PF8 A;  4NF0 A;  1D9Y A;  1LCF A;  3V8X B;  4PFW A;  3BFU A;  3LSX A;  3DEL B;  3GLB A;  3UK4 A;  2Y7P A;  3U94 A;  2HEU A;  1IEJ A;  2P3N A;  2O68 A;  3MP1 A;  5DTB A;  4ZZE A;  1M5F A;  3HCQ A;  4GOT A;  1MRP A;  2I49 A;  3KC1 A;  1RDZ A;  1VR5 A;  2O1L A;  2HZK A;  1LCT A;  5IGA A;  1XHY A;  1P1U A;  2Q2C A;  4OEV A;  1MQH A;  3C4M A;  4F3P A;  1FTK A;  4OVT A;  3G3I A;  1URG A;  1FTL A;  2Z23 A;  4NX1 A;  4OEU A;  3E78 A;  2DVC A;  4OET A;  4BDO A;  1FTA A;  1TFA A;  2OZZ A;  1FJ6 A;  4NQ8 A;  4G8M A;  4RY1 A;  5FTI A;  2CZL A;  2O7I A;  3OSQ A;  3SZP A;  4ELR A;  4ZED A;  3KOS A;  2F8D A;  2Y7R A;  4IY6 A;  2QVU A;  1IME A;  5I2N B;  2QVV A;  2DXR A;  3ODB A;  4YB5 A;  4FIM A;  4ZZA A;  1O64 A;  3EQ1 A;  4PCD A;  5KDT A;  5KZT A;  2XA5 A;  1USY H;  3P7I A;  1NH7 A;  2V3U A;  1IIW A;  3TOD A;  2XXT A;  3DP8 A;  4R9G A;  2RIN A;  4JB7 A;  5TPA B;  1IQ7 A;  3Q25 A;  3H3G A;  2XXI A;  3THI A;  2I3V A;  3FIR A;  3TZA A;  3LSW A;  2QMW A;  1PB7 A;  3VLW A;  1NMU A;  2I0B A;  1IMB A;  3G3G A;  4OVQ A;  4F3S A;  4AS4 A;  4Z7E A;  5H8S A;  4MEV A;  3RTF B;  4F1U A;  2QL3 A;  1UTB B;  1IXG A;  4LZ8 A;  3K6W A;  3SDF A;  1H44 A;  4TOZ A;  2D3I A;  2ZYN A;  3H4Z A;  4JWO A;  4YKJ A;  2FNC A;  4JWX A;  1NV6 A;  4OTE A;  4R2F A;  2H98 A;  4Q8R A;  4JVC A;  1MH4 A;  4DXU A;  2P0S A;  5ICQ A;  5DVI A;  3FAS A;  1JET A;  4EUO A;  3ZS6 A;  2A5T B;  4ZDM A;  2VGQ A;  5AE4 A;  3TEP A;  3N94 A;  4YMA A;  5CC2 A;  5AA2 D;  3U92 A;  2KR0 A;  3KG2 A;  4R73 A;  2OWS A;  3EN3 A;  1MY2 A;  3TFL A;  3OEK A;  3T1B A;  2XX9 A;  3G7W A;  2H25 A;  1XVX A;  4R72 A;  4Q5T A;  3L6H A;  2GRV A;  4R9F A;  2VPO A;  5AA3 A;  1H76 A;  2O1M A;  3BIH A;  3TCG A;  3T96 B;  3SES A;  1MY1 A;  3UOR A;  1NNP A;  4DIG A;  3VLV A;  3BIG A;  1BKA A;  2V25 A;  2Q88 A;  1JNF A;  3IX1 A;  3R6U A;  4HCW A;  5I3S A;  1QUJ A;  2UVH A;  3Q26 A;  2DXY A;  2XWK A;  1NV5 A;  1B0H A;  1LAH E;  3VV5 A;  1TFD A;  4KQP A;  3UGW A;  3SEY A;  3MVZ A;  2CZI A;  1EU8 A;  4HTG A;  4O8M A;  4P47 A;  3TTM A;  4YKP A;  3EHT A;  3F11 A;  4FE8 A;  1SPI A;  4NED A;  1B3F A;  4F19 A;  2A5S A;  3H6U A;  1MXV A;  1MXZ A;  3NOH A;  4IO5 A;  1QUL A;  1OVB A;  4AB6 A;  1UTB A;  1B1H A;  3K1P A;  1M5C A;  4PP0 A;  3SEW A;  1MY0 A;  1MDP 1;  3C33 A;  1JEV A;  3IK6 B;  5DEX A;  5I7I A;  4PTK A;  4E0W A;  1LBY A;  5EYH A;  4Q0C A;  4GX6 A;  2CEY A;  3MP6 A;  1IZ1 A;  2Z8E A;  1A99 A;  3B6W A;  3VVE A;  4MJO A;  5L8D A;  3IOT A;  2D21 A;  2WEF A;  4F2Q A;  1JP4 A;  2XXV A;  3M8U A;  4OVS A;  5J16 A;  3FUZ A;  5ITP A;  3SEX A;  5K2Y A;  3KJ7 A;  3MYU A;  1SW2 A;  5ET5 A;  5FHN A;  1VFD A;  1UIV A;  1R1N A;  3TEL A;  1VDW A;  2NVU B;  4HCY A;  1B5H A;  2XD2 A;  1Y9U A;  2NOO A;  4AB5 A;  1AWB A;  3PPP A;  3FVK A;  5I57 B;  1XI6 A;  2F97 A;  2UVI A;  2Y84 A;  2F6P A;  3MUQ A;  4RK9 A;  1NV7 A;  1MG1 A;  4H67 A;  2HCA A;  3BBR A;  5KCJ A;  1N84 A;  3VVF A;  1LB8 A;  2GHA A;  4H65 A;  5F7V A;  3CSG A;  4LUB A;  4ZS9 A;  2ALU A;  2XXX A;  3IOV A;  1Y1Z A;  1SBP A;  1FW0 A;  3TMG A;  2XXU A;  4GWS A;  4JWY A;  1YZ0 A;  4HS7 A;  5JEI A;  4ELQ A;  2CZH A;  4ISU A;  3FXU A;  1MQI A;  3SER A;  4ECF A;  3H6T A;  3G3F A;  3K0V A;  1FQD A;  3PTY A;  3S2V A;  3ZSF A;  1BP5 A;  3CG3 A;  3KC0 A;  1OLA A;  4JSO A;  4XXU A;  4OAN A;  1NUY A;  4OWD A;  1EYI A;  2PMS A;  2ZNS A;  3FJM A;  2P3V A;  4P11 A;  3PU5 A;  1N7X A;  3CFZ A;  4LAT A;  3KN8 A;  3TTN A;  1OMP A;  1XVY A;  3N5L A;  1KZ8 A;  5ISU A;  4KYD A;  3KBR A;  4GIZ A;  4KCD A;  4P1L A;  1EH3 A;  5AA1 A;  4KFQ A;  4KI0 E;  5CRY A;  4TLM B;  4EQ9 A;  4EDP A;  5A5X A;  3E3K A;  5BUU A;  4PFR A;  1Q9D A;  3VFJ A;  4C1U A;  3OXN A;  1FBE A;  2VOZ A;  5I84 A;  5IAI A;  4EQ7 A;  3OEM A;  1K9Z A;  4KYE A;  2V3T A;  4GWX A;  4IO4 A;  3LV0 A;  2PFY A;  3KSJ A;  3K6V A;  5I57 A;  3IB1 A;  1P1O A;  3GBB A;  1DMB A;  1XC1 A;  4OQO A;  5TU0 A;  2GHB A;  1LEV A;  2THI A;  2PFZ A;  2AL4 A;  4N4U A;  1R6Z A;  4O94 A;  1LFH A;  1JVX A;  3FJG A;  1SYH A;  2H5Y A;  4RPN A;  1MQD A;  2XX8 A;  4G68 C;  1LAG E;  3PUW E;  4C1T A;  1B05 A;  2DWI A;  1B5I A;  4JSD A;  4F3G A;  4LVQ A;  3EHU A;  4H45 A;  3ONM A;  3A3C A;  3H03 A;  4LZ7 A;  1MXX A;  4U22 A;  3IB0 A;  1GVC A;  1PB9 A;  2XD3 A;  3RTW B;  3QSL A;  4NHB A;  4F31 B;  4IB2 A;  2OWT A;  3RQT A;  5CI5 A;  2F5X A;  5H8N B;  4TLL B;  4YAH X;  3IFC A;  4OHN A;  4U4X A;  1QUK A;  4XKR A;  2Q2A A;  3MP8 A;  2RF1 A;  3U8Q A;  3L6G A;  4GLI A;  3IFA A;  1MY4 A;  3G3H A;  4X1D A;  4ZEK A;  5CM6 A;  3EKI A;  1N7W A;  1FPL A;  1NFT A;  1AMF A;  2KLF A;  5ET8 A;  3OD7 A;  4GD5 A;  1JEU A;  3MZB A;  1JW5 A;  2FHY A;  4OVJ A;  4KXP A;  2Y5L A;  3LUZ A;  3D1R A;  1A40 A;  2RCB A;  3QK6 A;  1B3L A;  1ATG A;  5BWJ A;  1POY 1;  5KDT B;  1MM6 A;  2OWZ A;  1FJ9 A;  3IJX B;  5EYF A;  1GV8 A;  4HE0 A;  1B52 A;  1O63 A;  4P56 A;  4P0G A;  4M4G A;  1L5T A;  4XEQ A;  2RC9 A;  1QKA A;  2QS2 A;  1PC3 A;  3MBP A;  1MH3 A;  2UYF A;  4OA4 A;  3PUX E;  4O3A A;  3VXC A;  1B7H A;  1ANF A;  4MMP A;  2ONS A;  1SYI A;  2F7A A;  3TTK A;  4FJP A;  3T9H B;  5I5P A;  1LST A;  3CIJ A;  4DZ1 A;  4I1D A;  4N07 A;  2X7P A;  3FVG A;  2Z8F A;  2PT1 A;  4XKP A;  4GL0 A;  5H8N A;  2D5W A;  5DW8 A;  1NV4 A;  3MPK A;  3MVW A;  1AL3 A;  3QAX A;  2Q9T A;  1K9Y A;  2WYP A;  1H3D A;  3C34 A;  2PCR A;  4GF8 A;  3MWB A;  4MF3 A;  1UTH A;  4NE4 A;  1GR2 A;  1P99 A;  2ZNU A;  4OFL A;  3DP6 A;  2BJJ X;  2FIE A;  1FTJ A;  4RK2 A;  2OLB A;  3ILT B;  1LBZ A;  4ZEI A;  4MLQ A;  4NN3 A;  4N15 A;  4LZ5 A;  4FED A;  1FQE A;  3KBZ A;  1D9V A;  3M3L A;  1NUW A;  3IOR A;  2ESN A;  3S9N C;  1LBW A;  3K6X A;  5ET6 A;  1NV0 A;  2O6A A;  3PUY E;  2B4M A;  3GBA A;  1B51 A;  4KPT A;  4JXI A;  3FAT A;  4N81 A;  2DOJ A;  4F3B A;  4PC9 A;  5JK4 A;  3KSX A;  1SW1 A;  5IZ1 A;  4F18 A;  3T9V A;  4QBA A;  1KWH A;  1R9L A;  4LON B;  3K2D A;  3PPN A;  1B9J A;  4ONY A;  2L5V A;  3T22 A;  4H0W A;  4IO2 A;  1FSA A;  3PMW A;  2MKZ A;  2F3B A;  1YCJ A;  4OEN A;  2PT2 A;  1YTV A;  4FEC A;  4GL8 A;  3PD8 A;  4I62 A;  2E1S A;  2IEE A;  3UA8 A;  1ZU0 A;  5J1D A;  4H5F A;  5DT6 A;  3IO6 A;  5HM4 B;  3PMV A;  5DEX B;  3WAE A;  4MX6 A;  4NTL A;  1ZTY A;  3PPR A;  3M3K A;  2QPQ A;  2ZMB A;  1FPK A;  1OQG A;  1WOD A;  2ZXT A;  4G8N A;  4PAI A;  1RDX A;  1OLC A;  1LBC A;  4G4P A;  3V89 B;  1SI0 A;  4PFB A;  3Q27 A;  3DM0 A;  3E79 A;  4ND9 A;  1N0T A;  3S4U A;  4NF4 B;  1LFI A;  3MW0 A;  4DDD A;  1CB6 A;  1YYZ A;  2ABH A;  4P1E A;  1Y1M A;  2Y7W A;  1A7L A;  2O84 X;  5I58 A;  3N26 A;  1QGX A;  4QSE A;  3IOW A;  5EQA A;  2AIX A;  3FBP A;  5ELV A;  1B6H A;  2YLN A;  3JV9 A;  4Z0I A;  4E0X A;  4WEP A;  1EYK A;  3TAJ A;  3E13 X;  3HN0 A;  3E9X A;  4EXL A;  1VFE A;  1RYO A;  3SEU A;  2ZZV A;  2AL5 A;  3U93 A;  1ZBM A;  2I6E A;  2PYY A;  1URS A;  1B3G A;  3K1M A;  3U72 A;  1URD A;  2VT5 A;  2VD2 A;  4MCO A;  5KCJ B;  2VPN A;  4U4S A;  2CEX A;  5H8H B;  3K6U A;  2ZZX A;  2YJP A;  3ZKL A;  1LBB A;  5B70 A;  1FPI A;  4P3L A;  1GGG A;  2I58 A;  1USY E;  5I59 B;  2Y7K A;  3CG1 A;  4IO3 A;  3U1O A;  4U23 A;  4ZEC A;  3HO7 A;  1YPN A;  5DVJ A;  4PGN A;  1FQA A;  1PBQ A;  3RT8 A;  1M5E A;  4IO7 A;  1MM7 A;  3CHG A;  2I4B A;  1NV2 A;  3T9X B;  4HE1 A;  4ZE9 A;  1B4Z A;  1B32 A;  2I0C A;  1WDN A;  4N17 A;  3UP9 A;  4FBP A;  4P0I A;  4N13 A;  4YB7 A;  4OXV A;  2H9B A;  1FTO A;  1SD3 A;  3I5O A;  1I6B A;  3W9V A;  5CBR A;  4OMB A;  4NF4 A;  1Q35 A;  2QS1 A;  4PFI A;  3H6W A;  2HAV A;  1Q1K A;  4JBZ A;  2DWH A;  1DTZ A;  1NUZ A;  3N6T A;  3A09 A;  1US5 A;  4OZ9 A;  2F6G A;  1ZKB A;  2RKM A;  5A5X B;  1ZIU A;  3VVD A;  4WXJ A;  2OX3 A;  2DE2 A;  3D4G A;  1NH8 A;  4ZE8 A;  3MJN A;  1HSJ A;  4XFE A;  1IXI A;  2ANJ A;  1QUI A;  4QRZ A;  3LSF B;  1FTM A;  4YZZ A;  3OO6 A;  3LBS A;  4YB6 A;  4PFY A;  2WYK A;  2ZZW A;  1NV3 A;  3CVG A;  3PPO A;  4N6P A;  3RT6 B;  5HBC A;  1B7Z A;  1JW4 A;  1IMD A;  3AXF A;  4AQ4 A;  5B7D A;  3BFT A;  4NF8 A;  3HV1 A;  1DTG A;  3LC8 A;  1Y4C A;  3USD A;  1AIV A;  2RC7 A;  5H8H A;  3IB2 A;  4YIC A;  3D4C A;  4GXA A;  2X7Q A;  1FCK A;  4QHQ A;  4RYA A;  1J1N A;  1B1X A;  1IUD A;  1IXC A;  4NG7 A;  5I59 A;  2DVZ A;  3LSL A;  3FGS A;  1EZO A;  1NNK A;  2DWA A;  3FJ7 A;  1A55 A;  4I40 A;  2B4L A;  2P2A A;  1LBV A;  3ECR A;  2QRY A;  2V3Q A;  3OMB A;  3W9W A;  4BDL A;  4OFO A;  1G0I A;  3B6T A;  1GTK A;  4QXD A;  2DWJ A;  5TP9 A;  2LAO A;  4LA9 A;  4ZEF A;  1TWY A;  4MIJ A;  1B46 A;  4GX3 A;  4G61 A;  4XKN A;  2NWJ A;  2X26 A;  3IO4 A;  2OBG A;  1MXU A;  2PVU A;  3MVX A;  3ISP A;  2ZNT A;  4K3F A;  4QFP A;  2F78 A;  3TKD A;  1LLS A;  3FXR A;  1BTJ A;  1DBZ A;  1F9B A;  1FQF A;  1LAF E;  3T66 A;  4NWC A;  3RPL B;  3OO8 A;  3V83 A;  3QMF A;  1FBF A;  2QS3 A;  3E4R A;  2NUV A;  3RYD A;  4QSC A;  4R6K A;  4H46 A;  2XXY A;  5EQ7 A;  4NWD A;  3FV1 A;  2V84 A;  2Q74 A;  2E0S A;  2PX1 A;  1QKB A;  3TPA A;  1ZMG A;  4LN5 A;  3LR1 A;  1NL5 A;  1FPE A;  4DCY A;  1XT8 A;  3KN7 A;  2BJI A;  4RA1 A;  1QVS A;  5F24 A;  3OEL A;  4MNI A;  2WBD A;  1B2H A;  3DLN A;  4IO6 A;  5ET7 A;  3FV2 A;  4N91 A;  3BKI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...