5J1DA

X-ray crystal structure of phosphate binding protein (pbp) from stenotrophomonas maltophilia
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
373
structure length
373
Chain Sequence
ATAVTGGGASLPADLYKGSADSILPANFSYAVTGSGTGKKAFLENNSALFSTTGTVHFAGSDSVLSSTELNTYNSTYNVSGDANRYGALVQIPSVATSVTIPFNKAGSAVDLSVTQVCGIFSGKITSWSQLAGLGRTGDIQVVYRGESSGTSELLTRFLTSACQPADVSSSNLKLTNGVPAFSVQSTFANLFTTVPSNFIAAPATGGTALYNAVYAIDGRVGYVGPDAIPSLTDATKVAKVKGFSPDEVSVQATLETAAPPTGAAAENPANWVPVFGNPSAGYPIAGYTNFVFGQCYKNATVGANVRGFLTKHYGSTVVNGVEQGPNDVAIRAHKFIPLTKAWRDAVRARFATATNAGAVNNPATCSGIGRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate binding protein
publication title Determination of crystal structures of proteins of unknown identity using a marathon molecular replacement procedure: structure of Stenotrophomonas maltophilia phosphate-binding protein.
pubmed doi rcsb
molecule tags Protein binding
total genus 118
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2016-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5j1dA02
3.40.190.260 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5j1dA01
2OWSA 3FIRA 4DXCA 3S9MC 3S9LC 4XKQA 2QJEA 3RQTA 3RTWB 2REJA 2OZZA 1OIBA 2Y7IA 1R6ZA 2DXRA 3TEPA 1OLCA 4EF2A 1MXYA 2XD2A 3C35A 2QS3A 1A40A 1B7ZA 5KDTB 4MH5A 3IB2A 3RLFE 1MY0A 2ZNUA 3CIJA 4P11A 2Y7PA 4KD5A 4POWA 2X7QA 3PPOA 1XHYA 4EXLA 4H5FA 4I9DA 2REGA 3U94A 3LSWA 3USDA 3BFTA 4E0XA 4RYAA 1I6BA 1JQFA 1OQHA 4ELPA 2UYEA 4H65A 4F2QA 5ISUA 1Q1KA 5CMMA 4ZZAA 2OBGA 2HQ0A 3PD9A 4ZEKA 2PYYA 4NMYA 4X1BA 4IGTA 3A3UA 4NF6A 1SYHA 2V3TA 5AA3A 3FASA 2NWJA 1I6AA 4KCDA 2DYXA 1MXVA 3GBAA 5A5XB 1B51A 2DE3A 3IR1A 3KSJA 4KYSA 4ZDMA 3K00A 5AA4A 3TODA 5I2NA 3G3FA 3QIMA 4G68B 1MY3A 4LVQA 1D4NA 4FEDA 1J1NA 3PPRA 1XC1A 1SBPA 1UTHB 4IGRA 4ZECA 1RYXA 3KZGA 1B0LA 5HM4B 4OMBA 4GLIA 3K1NA 1QKBA 4OHNA 3THIA 2XX8A 4NF8A 3TTRA 3H6WA 1Y1MA 3T9VA 2Z23A 4YKIA 3MVXA 3M3KA 1L5TA 2QS4A 3T93B 4C1UA 4GF8A 4WEDA 1US5A 5JTYB 4DXBA 2HEUA 2RCBA 2ONRA 3N6TA 3IO6A 5FHMA 3OO8A 3C4MA 3FVOA 4OYVA 5I56A 1B9JA 2FYIA 2F7AA 1H76A 3Q27A 3HO7A 2WKYA 4IY5A 4FJPA 2O1MA 1UTBB 2QRYA 4ZE8A 4R6KA 2OCUA 3MBPA 4TOZA 2YJPA 4G4PA 2LAOA 3PUYE 2PVUA 1Z7NE 4TLLB 1Y3NA 4PP0A 1TFDA 3ZKLA 3LSXA 2QS1A 1RYOA 3DP4A 3V89B 4R9GA 1O64A 3FUZA 1HSLA 2XXUA 1O7TA 2F8DA 5BUUA 4DZ1A 4FECA 1LBCA 4PETA 1JEVA 3CFZA 5FTIA 3PPNA 3H7MA 2ZNTA 5KCJB 2D3IA 2HAVA 4HCWA 1MXUA 4BDOA 1XT8A 1BLFA 3UN6A 1SQYA 1BIYA 1B7HA 1XS5A 2F6PA 2QMWA 1BKAA 1LGBC 1N84A 2A5TA 3G7WA 5TP9B 1DMBA 3K2DA 4RK9A 3FD3A 3CSBA 1LLSA 3G3JA 2O6AA 4XTCQ 5EHSA 3KOTA 4R74A 4N13A 1IEJA 3LBSA 2G93A 5L9OA 3C9HA 3OOAA 3I5OA 3T9UA 2RC9A 3FXQA 1LB8A 1IXGA 1VFEA 3C36A 4XXUA 2IA4A 4LQ2A 2RF1A 3TFLA 1PC3A 4FE8A 1UIVA 1I69A 1N0TA 2VOZA 1B5IA 4H8IA 3IO4A 4GOTA 4ECFA 1NKXA 4Q8RA 2VD2A 1N3XA 1SW4A 2ABHA 2AL5A 4KYEA 4GWOA 1PEBA 2I4BA 1AIVA 2DE2A 4F3BA 2ZYMA 3HHGA 3LSLA 2DWJA 1B3FA 3FJ7A 2OLBA 3E3KA 4EQBA 4KI0E 2Q2CA 3VXBA 2Q2AA 3K6UA 1VR5A 3VFJA 2PX1A 1B3HA 4ZEDA 4FIMA 4NEDA 3GXAA 3OO7A 4RPOA 4PFWA 5KDTA 1T0KA 1LAHE 3SETA 1M5FA 1H3DA 1SI0A 1LFIA 2B3FA 3CI8A 2ANJA 3VDFA 4OEUA 3OO9A 4MF3A 2I48A 4EQ9A 4JDFA 3M8UA 4KPTA 4C1TA 1EZOA 4U21A 3LSFB 5KZTA 1US4A 4ZEBA 3IOVA 1M5BA 2ONKE 3SESA 3ILUB 4O3AA 3RTFB 3SEXA 5A5XA 3OD7A 5CBRA 3B7DA 3U92A 3FJMA 1MXXA 1QW0A 3GBBA 2HAUA 3L6GA 3V8XB 1N04A 1B5JA 1R9LA 2HFBA 2V93A 3B6WA 4G68A 3O66A 2O69A 4FEBA 3MVZA 3KBRA 5ITPA 3LC8A 1ZJLA 4RXLA 5I2KB 2Q8JA 3IB0A 4OFJA 4JWYA 3DP8A 2I0CA 4DCXA 4IO7A 4ISUA 2PBWA 3RT6B 3T96B 1MDQA 1LCTA 3Q28A 1HSJA 5CMKA 3E4RA 4HCYA 3QK6A 2HXWA 1NFTA 2XXXA 4YZZA 4ESXA 5B7DA 4NF5A 2FNCA 1IXCA 1VSOA 5DEXB 5I58B 2DE4A 3KJ7A 3I3VA 4GL8A 3TCFA 5JK4A 2M8CA 1NH8A 1P1OA 3N26A 2X7PA 2Z8FA 1XVXA 1NNPA 2O84X 4F3PA 2QMXA 1Y20A 1IXIA 2QL3A 4WXJA 4N07A 4PQJA 2O1LA 5I57A 2Z8EA 3MUQA 1A54A 3GLBA 4BDRA 3PV0E 5K2XA 5BWJA 4QSDA 3DELB 2QS2A 1I6QA 2P2AA 3FJGA 3MP8A 2XXWA 4R72A 2H99A 3S9EA 1ANFA 4GVOA 4EDPA 4YMAA 4H0WA 4R75A 4LONB 3PUZE 3IOWA 1S9TA 4QF9A 4ZZEA 4DE8A 3SEVA 3IJOB 4R2FA 2P1SA 3O97A 4IO5A 5L8DA 3O6GA 5KCJA 2VGQA 3OSRA 3TPAA 2GRVA 4JSDA 1N7WA 2DVZA 3IK6B 4OWDA 1Q35A 2F34A 1JNFA 5CI5A 2P0SA 2Q9TA 3H6VA 3VVEA 2H9BA 3TAJA 4U1OA 5H8QB 1D3KA 3DLNA 3TTMA 4U2RA 3TTKA 4Z0IA 4F18A 3S2VA 1CB6A 3MVYA 4JSOA 5I84A 2YLNA 2X26A 1H45A 3PGFA 5AA2D 2XXYA 1R9QA 3QUJA 1MQHA 1QUKA 4G8NA 2E1SA 4OFOA 3T66A 3ODBA 2Q89A 1SW1A 1MXWA 2OJTA 4ELQA 4QHQA 3RNNA 4ZEFA 1B3LA 1II5A 2F97A 3RN8A 3B6QA 3R6UA 4YU0A 5ELVA 3CG3A 4ELOA 4AQ4A 3C31A 3K02A 2DOJA 2PMSA 1B32A 3KOSA 1SD3A 2F6GA 3O9PA 2Y7RA 4HTGA 1Y1ZA 1POTA 4JXIA 3BBRA 4BDNA 1FTMA 3M3LA 4IY6A 4MFIA 3CFXA 3SEWA 5CRYA 1M5DA 4JWOA 4EF1A 1IIWA 4E0WA 3K6VA 2NOOA 4AB5A 5AA1A 2UVJA 1LFGA 5DVJA 2DWIA 4RA1A 4NWCA 3K6WA 3TQLA 3K4UA 2Z22A 5L9MA 4ESWA 2AIXA 3CFLA 3SDFA 3KG2A 4LUBA 4OENA 2GHAA 1GGGA 4LZ8A 1EZ9A 1NNFA 1IQ7A 4PFTA 4XIGQ 1ZLQA 3CR9A 1JW1A 1JW5A 1Y9UA 4R9FA 2E0SA 3H4ZA 1QVSA 3UA8A 4QSCA 2ZMBA 4X9TA 3N5LA 3ECRA 5AE4A 1FTJA 2R6GE 1MY1A 2DP8A 3MW0A 3IL1B 1PB9A 4NF6B 3FV2A 4F31B 1MY2A 3MJNA 3CVGA 1CE2A 1N7XA 2H98A 1FQFA 1FW0A 4IO2A 3SEYA 1MQGA 3ZSFA 3O29A 1F9BA 1NMUA 5CMBA 3M3FA 3WAFA 2Y84A 5CC2A 2KLFA 3SEUA 1MM6A 2F35A 1M5CA 3MWBA 2CZLA 3C33A 4TLMB 2YPNA 3O28A 4G68C 4H1XA 3G3KA 5FTHA 4Z7EA 4GL0A 4IO6A 1B5HA 1NNKA 1GTKA 5DVIA 5AA2B 3IB1A 5ICTA 3P7IA 3PUXE 5I59B 3UORA 3PUVE 5I58A 4G2ZA 4EQ7A 1B3GA 4H67A 3MPLA 4I1DA 3VE1B 3D4GA 4GXAA 2THIA 4C0RA 2Q88A 3H06B 3QSLA 4DXUA 4X1DA 3UIFA 4ZS9A 2XX9A 2PT1A 3Q26A 4FAJA 1NL5A 4BDQA 3FV1A 2ZXTA 1JVYA 3FXRA 5I56B 4F1UA 4ZEIA 1SVXB 2H25A 2B3BA 2R9JA 1Y3QA 4TQUQ 2I0BA 3GZGA 4K3FA 1FQAA 1Y4CA 4Q0CA 5HPQA 1BTJA 1B1XA 3H03A 4QRZA 2XD3A 1QJMA 5M2VA 3CRBA 5K2YA 1LAXA 4O3CA 4BDMA 5DT6A 4YAHX 1IUDA 5CMCA 3KSXA 4NTLA 1N3WA 4WEPA 4F39A 1PBQA 3T9XB 1MS7A 4EXKA 2I58A 4YKPA 2RKMA 5F1QA 3CSGA 3WAEA 4DIGA 2NUVA 5H8QA 3UK4A 3OENA 3MPKA 2ZYKA 4G8HA 4ZE9A 3W9VA 1TT1A 4NF4B 4GD5A 4FATA 4F3SA 1B6HA 2I6EA 4F3GA 2Y7WA 1MPBA 1LAGE 4OXVA 5H8SA 3Q25A 2F36A 1URSA 4QFPA 3W15C 5JEIA 2Z8DA 3FVGA 4UACA 1UTHA 1TWYA 3MZ1A 1WODA 3F11A 1IITA 4XKRA 1GV8A 5H8NB 4U23A 3U93A 2HZLA 1PB7A 3VXCA 3EPEA 1MQDA 4BLAA 2Y7KA 1S50A 3TKDA 1QUJA 3H3GA 3MAMA 5H8HB 1ZBMA 2RCAA 4KFQA 5JTYA 4FORA 1EZPA 2DXYA 4YKKA 5H8FB 4O3BA 2AL4A 1P1WA 4F19A 4F22A 1DSNA 4RK2A 2A5SA 1B52A 2ESNA 1MH3A 1HSEA 4H5GA 2ZYOA 2QPQA 3IAZA 4F2OA 2NXOA 4JB7A 4XKPA 1USYE 1FTKA 1UTBA 5TPAB 1MQJA 4UA8A 2I49A 1WVJA 1Z7ME 5TU0A 5J1DA 3MP1A 3ZKKA 4OETA 3TTNA 2HCAA 1B05A 4YKJA 3QYTA 4MBPA 2OK2A 1MH4A 2O68A 4KR5A 1FQEA 2V3UA 4KCCA 2G29A 5EYFA 3HHFA 2D5WA 3HV1A 5IKBA 2VP1A 1LB9A 1ZKBA 3C32A 1AMFA 3S9NC 3W9WA 3AXFA 4QSEA 1VE4A 4DCYA 3OELA 2OWTA 2V25A 4R2BA 5DYHA 1P1NA 1P1QA 1MXZA 2XXQA 1MG1A 1NNTA 1IXHA 2BJJX 3FGSA 4RJZA 5TP9A 1GR2A 4P0IA 3DM0A 3FVNA 3TQWA 4HS7A 3QAXA 3H6TA 1JETA 4L17A 1MDP1 3A3CA 2ONSA 4YICA 5CM6A 4YB7A 3IOUA 4R73A 1Y3PA 1MM7A 2XXHA 4NE4A 4BDLA 1JEUA 4EUOA 4ONYA 4G77A 3PU5A 3VLWA 5HBCA 4OFLA 2UVHA 1UIUA 1VFDA 4R6HA 1SW5A 3LR1A 2O7IA 3KJTA 1O63A 2QSXA 3KEIA 2W7YA 1FCKA 1GVCA 5AA2A 2I4CA 2PT2A 4NWDA 3B6TA 3O6IA 1XVYA 5I59A 3IOTA 4JBZA 3PPQA 4F1YA 3ONMA 1ELJA 4X48A 3QXMA 4NF5B 3MZBA 1MY4A 3KN8A 1PB8A 1FTOA 2IEEA 1DPEA 3EHUA 2V84A 3VV5A 1OLAA 4QFOA 3HN0A 1YPNA 1S7YA 1URGA 3TZAA 2ALUA 3EN3A 2H4IA 3FVKA 3C34A 3SERA 3QUFA 4LZ5A 3RPWA 3MC2A 5I57B 1EU8A 4IO4A 3OMBA 4AB6A 4GFRA 3VLVA 3D4CA 1WDNA 2RINA 1XOCA 5DVFA 1M5EA 1B7UA 1LAFE 1LFHA 4XKNA 4KHZE 4PE5B 2XXTA 4LQ5A 2D21A 3G3HA 3OXNA 1ZTYA 3K01A 3FZVA 2NVUB 3MQ9A 4GQOA 4U4SA 3VVDA 3R7XA 4THIA 1D9YA 3RGYA 1AH5A 3R26A 3PMWA 4MLVA 3IX1A 3KN3A 3PMXA 1H44A 1B40A 3KFMA 2GFEA 3K6XA 4KQPA 4PFUA 1NH7A 4OTEA 4LZ7A 2AYSA 4JWXA 4GIZA 4U22A 4NF4A 3V83A 1D9VA 4OVJA 2ZYNA 5FHOA 1QUIA 1B0HA 2XXVA 4P0GA 3PUWE 1MRPA 5AA4B 3Q29A 2F7BA 3TELA 2R71A 5I2KA 5I2NB 2UYFA 1OVBA 2H5YA 3LUYA 3RUMA 3MP6A 2DSFA 2B65A 1AL3A 2VD3A 5H8NA 1OMPA 2RC7A 1SI1A 4OESA 2F78A 4GRKA 1EH3A 3K0VA 3IORA 1SYIA 4U4XA 4RY1A 2RC8A 4I62A 5H8HA 4QFLA 4DLDA 3HPIA 4NF8B 4ELRA 3O2AA 4I8CA 3EHTA 3OO6A 1H43A 1ZMGA 5DEXA 5H8FA 2I3VA 2UVIA 3FATA 3OEKA 1FTLA 1DOTA 3EF7A 4KYDA 1LCFA 3HCQA 1QULA 3MVWA 4IB2A 4OERA 1RKMA 2UVGA 5ITOA 1Y4TA 5FHNA 1OVTA 1A8FA 4YB5A 3OEMA 5EHMA 2DWHA 5TPAA 3IJXB 2I3WA 1B2HA 4RPNA 5IAIA 4N6PA 1URDA 3K1MA 1B46A 1QKAA 3RY3A 3MZ9A 2XXRA 2XXIA 3JZJA 1AOVA 4POXA 1A8EA 3TYHA 2GH9A 1MQIA 3PPPA 3TCHA 1B4HA 1R1NA 1DTZA 3V5AA 3VVFA 3JYRA 4F29A 2O51A 1YTVA 2GHBA 3UGWA 1B1HA 1LBBA 3HSTA 3DP6A 3TDJA 1TFAA 2HZKA 4Q5TA 1ZU0A 5ICQA 1N76A 3G3GA 3VLUA 3TTLA 2F5XA 3FXUA 1PDAA 1A55A 1ATGA 4DDDA 3H6UA 4MLQA 3TMGA 1DTGA 4LA9A 3ILTB 4G8MA 1A99A 1POY1 3CG1A 3O6HA 3A09A 1B3EA 2XXPA 1YAEA 1B58A 5L9SA 5DTBA 5F7VA 3OSQA 2F7CA 4YMBA 2A5TB 4OZ9A 3EQ1A 3I6VA 4F1VA 2FA7A 1DPPA 4QFNA 4R6YA 1KWHA 1MPCA 4YB6A 3ZS6A 1IZ1A 4LATA 4Q30B 2CMOA 5B70A 2V3QA 4U1ZA 4H6DA 4OQOA 1OQGA 3N6UA 1JW4A 4OEVA 1FQDA 3E13X 4ND9A 1SDXA 3EHSA 1UQWA 1A7LA 2DS9A 3N94A 2ZNSA 3U8QA 1USYH 1TXFA 3K1PA 2DQVA 1P1UA 1BP5A 3U1OA 4LP2B 2VHAA 3U72A 1FQCA 1MPDA 1YCJA 4M4GA 1SW2A 3T22A 4M1VA 3KGCA 3KN7A 1B4ZA 3BKIB 1FQBA 4HW8A 2XX7A 3PMVA 3L6HA 3UP9A 4RNSA 3JV9A 3PD8A 3E9XA 5CBSA 5LOMA 3BFUA 2UXAA 4QFKA 4IO3A 2O7UA 1LSTA 3G3IA 1ZIUA 4H8JA 3SKPA 4GXSB 1JVXA 2XHDA 3TCGA 2DWAA 3T9HB 3RT8A 3S4UA 1PBPA 4PFYA 2DVCA 1P99A 4WKMA 3TUSA
chains in the Genus database with same CATH superfamily
3KC1A 2OWSA 1NV0A 3FIRA 4DXCA 3S9MC 3S9LC 4XKQA 2QJEA 3RQTA 3RTWB 2REJA 2OZZA 1NV6A 1AWBA 1OIBA 2Y7IA 1R6ZA 2DXRA 3TEPA 1OLCA 4EF2A 1MXYA 2XD2A 3C35A 1D9QA 2QS3A 4GWYA 1A40A 1B7ZA 5KDTB 4MH5A 3IB2A 3RLFE 1MY0A 2ZNUA 3CIJA 4P11A 4X8RA 2Y7PA 4KD5A 4POWA 2X7QA 3PPOA 1XHYA 5EQAA 4EXLA 4H5FA 4I9DA 2REGA 5A5LA 3U94A 3LSWA 3USDA 3BFTA 4E0XA 4RYAA 1I6BA 1JQFA 1OQHA 4ELPA 2UYEA 4H65A 4F2QA 5ISUA 1Q1KA 5CMMA 4ZZAA 3T0JA 2OBGA 2HQ0A 3PD9A 4ZEKA 2PYYA 4NMYA 4X1BA 4IGTA 3A3UA 4NF6A 1SYHA 2V3TA 4P3LA 5AA3A 3FASA 2NWJA 1I6AA 4KCDA 2DYXA 1MXVA 3GBAA 5A5XB 1B51A 2DE3A 4GWUA 3IR1A 3KSJA 4KYSA 2WX9A 4ZDMA 3K00A 4PDHA 5AA4A 3TODA 5I2NA 3G3FA 2PFYA 3QIMA 4G68B 3FXBA 3MYUA 1MY3A 4LVQA 1D4NA 2ZZXA 4FEDA 1J1NA 3PPRA 1XC1A 1SBPA 4QXDA 1UTHB 4IGRA 4ZECA 1INPA 1RYXA 3KZGA 1B0LA 5HM4B 4OMBA 4GLIA 3K1NA 1QKBA 2R8TA 4OHNA 3THIA 2XX8A 4NF8A 3TTRA 3H6WA 1Y1MA 3T9VA 2Z23A 4YKIA 3MVXA 3M3KA 1L5TA 2QS4A 3T93B 4C1UA 1EYJA 4GF8A 2CZIA 1US5A 4WEDA 5JTYB 4DXBA 2HEUA 2RCBA 2ONRA 1FBGA 3N6TA 2P3NA 3IO6A 5FHMA 3OO8A 3C4MA 3FVOA 2KR0A 4OYVA 5I56A 1LBZA 1B9JA 2FYIA 2F7AA 1H76A 1FJ9A 3Q27A 3HO7A 2WKYA 1NV3A 4IY5A 4FJPA 2O1MA 1UTBB 2QRYA 4ZE8A 4R6KA 2OCUA 4I3EA 3MBPA 4TOZA 2YJPA 4G4PA 4OANA 2LAOA 3PUYE 2PVUA 1Z7NE 4TLLB 1Y3NA 4PP0A 4OA4A 1TFDA 4MMPA 2CEYA 4MX6A 3ZKLA 3LSXA 2QS1A 1RYOA 3DP4A 3V89B 1FPKA 4R9GA 1O64A 3FUZA 1HSLA 2XXUA 1O7TA 2F8DA 3D1RA 5BUUA 4DZ1A 4FECA 1LBCA 4PETA 1JEVA 3CFZA 5FTIA 3PPNA 3CHGA 3H7MA 2ZNTA 4MNPA 5KCJB 2D3IA 2HAVA 4HCWA 1MXUA 4BDOA 1XT8A 1BLFA 3UN6A 1SQYA 1BIYA 1B7HA 1XS5A 2F6PA 2QMWA 1BKAA 1LGBC 1N84A 2A5TA 3G7WA 5TP9B 1DMBA 3K2DA 5J16A 4RK9A 3FD3A 4FBPA 4MJOA 4MNCA 3CSBA 1LLSA 3G3JA 2WBDA 4N8GA 2O6AA 5EYGA 4XTCQ 5EHSA 2QVVA 3KOTA 4R74A 4N13A 2WBBA 1IEJA 3LBSA 2G93A 5L9OA 3C9HA 3OOAA 3I5OA 3GYYA 2VPOA 3T9UA 2RC9A 3FXQA 1LB8A 1IXGA 1VFEA 3C36A 4XXUA 2IA4A 4LQ2A 2RF1A 3TFLA 1PC3A 1IMDA 4FE8A 1UIVA 1I69A 4MHFA 1N0TA 2VOZA 1B5IA 4H8IA 3IO4A 4GOTA 4ECFA 4N81A 1NKXA 4Q8RA 2VD2A 1N3XA 1SW4A 2ABHA 2AL5A 4KYEA 4GWOA 3KC0A 4N17A 1IMBA 1PEBA 2I4BA 1AIVA 2DE2A 4F3BA 2OWZA 2ZYMA 3HHGA 3LSLA 2DWJA 1B3FA 5ET7A 3FJ7A 2OLBA 3E3KA 4EQBA 4KI0E 2Q2CA 3VXBA 2Q2AA 3K6UA 2FVZA 1VR5A 3VFJA 2VT5A 2PX1A 1B3HA 4ZEDA 4FIMA 4N15A 4NEDA 3GXAA 3OO7A 4RPOA 4PFWA 3IFCA 5KDTA 1T0KA 1LAHE 3SETA 1M5FA 1H3DA 1SI0A 1LFIA 2B3FA 3CI8A 2ANJA 3VDFA 4OEUA 3OO9A 4MF3A 2I48A 4EQ9A 4O7MA 4JDFA 1NI9A 4AS4A 3M8UA 4KPTA 4C1TA 1EZOA 4U21A 3LSFB 5KZTA 4NN3A 1US4A 4P9KA 5I7IA 4ZEBA 3IOVA 1M5BA 2ONKE 3SESA 3ILUB 4O3AA 3RTFB 3SEXA 5A5XA 3OD7A 5CBRA 4N6DA 3B7DA 3U92A 3FJMA 1MXXA 3ROJA 1QW0A 3GBBA 2HAUA 3L6GA 2WYKA 5I5PA 3V8XB 1N04A 1B5JA 1R9LA 2HFBA 2V93A 3B6WA 4G68A 3O66A 2O69A 3RPLA 4FEBA 3MVZA 3KBRA 5ITPA 3LC8A 1ZJLA 4RXLA 5I2KB 1FTAA 2Q8JA 3IB0A 4OFJA 4JWYA 3DP8A 2I0CA 4DCXA 2PFZA 4IO7A 4ISUA 2PBWA 3RT6B 3T96B 1MDQA 1LCTA 3Q28A 1HSJA 5CMKA 3E4RA 4HCYA 3QK6A 2HXWA 1CNQA 1NFTA 2XXXA 4YZZA 4ESXA 5B7DA 4P1EA 4NF5A 2FNCA 5IZ3B 1FPIA 1IXCA 1FBPA 1VSOA 5DEXB 1FJ6A 5I58B 2DE4A 3KJ7A 1YYZA 3I3VA 4GL8A 4I40A 3TCFA 5JK4A 2M8CA 1NH8A 1P1OA 3N26A 2X7PA 4DI3D 2Z8FA 1XVXA 1NNPA 2O84X 4F3PA 2QMXA 3EKIA 1Y20A 1IXIA 2QL3A 4WXJA 4N07A 2XA5A 4PQJA 2O1LA 5I57A 2Z8EA 3MUQA 2MKZA 1A54A 3GLBA 4BDRA 3PV0E 5K2XA 5BWJA 1FPLA 4QSDA 3DELB 1FBEA 2QS2A 1I6QA 2P2AA 3FJGA 3MP8A 2B4MA 2XXWA 4R72A 2H99A 3S9EA 5ET5A 1ANFA 4GVOA 5LDZA 5EYHA 4EDPA 3B8BA 4YMAA 4JVIA 4H0WA 4R75A 4HXVA 4LONB 3PUZE 2CZHA 3IOWA 1S9TA 4QF9A 4P1LA 4ZZEA 4DE8A 4PAFA 3SEVA 3IJOB 4R2FA 2P1SA 4PFBA 3O97A 4IO5A 5L8DA 1LBWA 3O6GA 5KCJA 2VGQA 3OSRA 4PC9A 3TPAA 2GRVA 3BIHA 4JSDA 1N7WA 2DVZA 3IK6B 2ZZVA 4OWDA 1Q35A 2F34A 1JNFA 5CI5A 2P0SA 2Q9TA 4N6KA 3H6VA 3VVEA 2H9BA 4GX6A 3TAJA 4U1OA 5H8QB 1D3KA 3DLNA 3TTMA 4U2RA 3TTKA 4Z0IA 4F18A 3S2VA 1CB6A 4GWXA 3MVYA 4JSOA 5I84A 2YLNA 2L5VA 2X26A 1H45A 3PGFA 5AA2D 1FPEA 2XXYA 1R9QA 3QUJA 1MQHA 4H46A 1EYKA 1QUKA 4O7IA 4G8NA 2E1SA 4OFOA 4PTKA 3T66A 3ODBA 2Q89A 1SW1A 1MXWA 2OJTA 4ELQA 4QHQA 3RNNA 1YXIA 4ZEFA 1B3LA 1II5A 2F97A 3RN8A 3B6QA 3R6UA 4YU0A 5ELVA 3CG3A 4ELOA 4NAPA 4AQ4A 3C31A 3K02A 2DOJA 2PMSA 5IGAA 1B32A 3KOSA 1SD3A 1RDZA 2HHMA 1FBCA 2F6GA 3O9PA 2Y7RA 4HTGA 1Y1ZA 4NX1A 1POTA 4JXIA 4PFRA 3BBRA 4BDNA 1FTMA 3M3LA 4IY6A 5F24A 4MFIA 3CFXA 3SEWA 5CRYA 3LV0A 1M5DA 4JWOA 4EF1A 1IIWA 4E0WA 3K6VA 2NOOA 4AB5A 4P47A 5AA1A 2UVJA 1LFGA 5DVJA 1K9ZA 2DWIA 4RA1A 4NWCA 1IMAA 3K6WA 3TQLA 3PTYA 3K4UA 2Z22A 3NOHA 5L9MA 4ESWA 2AIXA 3CFLA 3SDFA 3KG2A 1LBVA 4LUBA 4OENA 3SZPA 2GHAA 1GGGA 4LZ8A 1EZ9A 1NNFA 1IQ7A 5IZ1A 4PFTA 4XIGQ 1ZLQA 3CR9A 1FPGA 1JW1A 4NQ8A 1JW5A 1Y9UA 4R9FA 4NHBA 2E0SA 3H4ZA 4HE0A 2VPNA 1QVSA 3UA8A 4QSCA 2ZMBA 4X9TA 3N5LA 3ECRA 5AE4A 1FTJA 2R6GE 1MY1A 2DP8A 3MW0A 4GX4A 3IL1B 1PB9A 4NF6B 3FV2A 4I3YA 4F31B 1MY2A 4PE3A 3MJNA 3CVGA 1CE2A 1N7XA 1FBDA 2H98A 1FQFA 1FW0A 4IO2A 3SEYA 4PCDA 1MQGA 2QVUA 3O29A 1F9BA 3ZSFA 1NMUA 5CMBA 3M3FA 3WAFA 2Y84A 5CC2A 2KLFA 3SEUA 1MM6A 4PBHA 2F35A 1M5CA 4NG7A 3MWBA 2CZLA 3C33A 4TLMB 2YPNA 3O28A 4G68C 4OVTA 4H1XA 3G3KA 5FTHA 4Z7EA 4GL0A 1BK4A 4IO6A 1B5HA 2XWOA 1NNKA 1GTKA 4OVPA 5LTCA 5DVIA 5AA2B 4XF5A 3IB1A 5ET6A 4IR8A 1NUZA 5ICTA 4MEVA 3P7IA 5IZ3A 3PUXE 5I59B 3UORA 3ISPA 3PUVE 5I58A 4G2ZA 4EQ7A 1B3GA 1FBFA 4H67A 3MPLA 2B4LA 2XWIA 1IMFA 4I1DA 3VE1B 3D4GA 4GXAA 2THIA 2F3BA 4C0RA 2Q88A 3H06B 3QSLA 4DXUA 2FBPA 4X1DA 4GX3A 4GWZA 3UIFA 4ZS9A 2XX9A 2PT1A 3Q26A 4FAJA 2P3VA 1NL5A 4BDQA 3FV1A 2ZXTA 1JVYA 3FXRA 5I56B 4F1UA 4ZEIA 1SVXB 2H25A 2B3BA 2R9JA 1Y3QA 4TQUQ 2I0BA 3GZGA 4K3FA 1FQAA 1G0HA 1Y4CA 4Q0CA 5HPQA 1BTJA 1B1XA 3E79A 4MAGA 4KXPA 1NV4A 2F3DA 3H03A 4QRZA 2XD3A 1FPFA 1QJMA 5M2VA 3CRBA 5K2YA 1LAXA 4O3CA 1KA0A 4BDMA 5DT6A 4YAHX 1IUDA 5CMCA 4N91A 3KSXA 2HPGA 4NTLA 1N3WA 4WEPA 4F39A 1PBQA 3T9XB 2Y5LA 4HE2A 1MS7A 5T3JA 4EXKA 2I58A 4YKPA 4PFIA 2RKMA 5F1QA 4O8MA 3CSGA 3WAEA 4DIGA 4NGUA 2NUVA 5H8QA 3UK4A 3OENA 3MPKA 2ZYKA 4G8HA 4ZE9A 3W9VA 1TT1A 4NF4B 4GD5A 4FATA 1B6HA 4F3SA 2I6EA 4F3GA 4PBQA 2Y7WA 1MPBA 1LAGE 4OXVA 5H8SA 3Q25A 2F36A 1URSA 4QFPA 3W15C 5JEIA 5ET8A 5FBPA 2Z8DA 3FVGA 1DBZA 4UACA 1UTHA 1TWYA 3MZ1A 1WODA 3F11A 1IITA 1FPDA 4XKRA 1GV8A 5H8NB 4OVSA 4U23A 3U93A 2XXKA 2HZLA 1PB7A 3VXCA 4PAIA 3EPEA 1XI6A 1MQDA 4BLAA 5IM2A 2Y7KA 1S50A 3TKDA 1QUJA 3H3GA 3MAMA 3KBZA 5H8HB 1ZBMA 2RCAA 4KFQA 5JTYA 4FORA 1EZPA 2DXYA 4YKKA 5H8FB 4DI4B 4O3BA 2AL4A 1P1WA 4F19A 4F22A 1DSNA 4XFEA 4RK2A 2A5SA 4XEQA 1B52A 2ESNA 1MH3A 1HSEA 4H5GA 2ZYOA 2QPQA 3IAZA 4F2OA 1NV5A 4MNIA 4OVQA 2NXOA 4JB7A 4XKPA 1USYE 1FTKA 1UTBA 5TPAB 1MQJA 4UA8A 2I49A 3MSTA 1WVJA 1Z7ME 2PCRA 5TU0A 5J1DA 1KA1A 3MP1A 3ZKKA 4OETA 3TTNA 2HCAA 1B05A 4YKJA 4UABA 3QYTA 4MBPA 2OK2A 4P8BA 1MH4A 2O68A 4KR5A 1FQEA 2V3UA 4KCCA 2G29A 5EYFA 3HHFA 1G0IA 2D5WA 3HV1A 5IKBA 2VP1A 1LB9A 1DK4A 1ZKBA 3C32A 4PGNA 1AMFA 3S9NC 3W9WA 1RDYA 3AXFA 4QSEA 2QFLA 1VE4A 4DCYA 3E78A 3OELA 4HE1A 2OWTA 2OX3A 2V25A 4QBAA 1VDWA 4R2BA 5DYHA 1P1NA 1P1QA 1MXZA 1FRPA 2XXQA 1MG1A 1NNTA 1IXHA 2BJJX 3FGSA 4RJZA 5TP9A 1IMCA 1GR2A 4P0IA 3DM0A 3FVNA 3TQWA 5EQ8A 4OVRA 4HS7A 3QAXA 3H6TA 1JETA 4L17A 1MDP1 3A3CA 2ONSA 1LBYA 3IFAA 4YICA 2CZKA 5CM6A 4YB7A 3IOUA 4R73A 1Y3PA 1MM7A 2XXHA 1LEVA 4NE4A 4BDLA 1JEUA 4EUOA 4ONYA 4G77A 2JJKA 3PU5A 2WYPA 3VLWA 5HBCA 4OFLA 2UVHA 1UIUA 1VFDA 1DCUA 4R6HA 3RPLB 1SW5A 5EQ9A 3LR1A 2O7IA 3KJTA 1O63A 2QSXA 3KEIA 2W7YA 1FCKA 1GVCA 5AA2A 2I4CA 2PT2A 4NWDA 3B6TA 3O6IA 1XVYA 5I59A 3IOTA 4JBZA 2V4CA 3PPQA 4P56A 4F1YA 3ONMA 1ELJA 1FBHA 4X48A 3QXMA 4NF5B 3MZBA 2CEXA 1MY4A 5DW8A 1NUWA 4PF6A 3KN8A 4PAKA 1PB8A 1FTOA 2IEEA 1DPEA 3EHUA 2V84A 3VV5A 3HFUA 1OLAA 4QFOA 3HN0A 1YPNA 4GWWA 1S7YA 2KQZA 1URGA 3TZAA 2ALUA 3EN3A 4PGPA 5IZZA 2H4IA 3FVKA 3C34A 3SERA 3QUFA 4LZ5A 3RPWA 3MC2A 5I57B 1EU8A 4IO4A 3LUZA 3OMBA 4AB6A 4GFRA 3VLVA 3D4CA 4PDDA 4PF8A 1WDNA 2RINA 1XOCA 5DVFA 1M5EA 1B7UA 1LAFE 1LFHA 4XKNA 4KHZE 4PE5B 2XXTA 4LQ5A 2D21A 3G3HA 3OXNA 1ZTYA 3K01A 3FZVA 2NVUB 3RYDA 1K9YA 3MQ9A 4GQOA 4U4SA 3VVDA 1NUYA 1FPJA 3R7XA 4THIA 1D9YA 3RGYA 1AH5A 3R26A 4JVDA 3PMWA 3T1BA 4MLVA 3IX1A 3KN3A 3PMXA 1H44A 1B40A 3KFMA 2GFEA 2WEFA 3K6XA 2XWKA 4KQPA 4PFUA 1NH7A 4OTEA 4LZ7A 2AYSA 4JWXA 4O94A 4GIZA 4U22A 4AS5A 4NF4A 3V83A 1D9VA 4OVJA 2ZYNA 5FHOA 1QUIA 1IMEA 1B0HA 2XXVA 4P0GA 3PUWE 1MRPA 5AA4B 3Q29A 2F7BA 4GBWA 3TELA 2R71A 5I2KA 5I2NB 2UYFA 5EQ7A 1OVBA 2H5YA 3LUYA 3RUMA 1YZ0A 3MP6A 2DSFA 4G61A 2B65A 1AL3A 2VD3A 5H8NA 1OMPA 2RC7A 1SI1A 4OESA 2ZZWA 2DDKA 1FPBA 2F78A 1JP4A 4GRKA 1EH3A 3K0VA 3IORA 4X04A 2Q8MA 1SYIA 4U4XA 4RY1A 2RC8A 5ESYA 4I62A 5H8HA 4QFLA 4DLDA 3HPIA 4NF8B 4ELRA 3O2AA 4I8CA 3EHTA 3OO6A 1H43A 1ZMGA 5DEXA 5H8FA 2I3VA 2UVIA 3FATA 3OEKA 1FTLA 1DOTA 4N4UA 3EF7A 4KYDA 1LBXA 1LCFA 3HCQA 1QULA 3MVWA 4IB2A 4OERA 1RKMA 2UVGA 5ITOA 1Y4TA 5FHNA 1OVTA 1A8FA 4YB5A 3OEMA 5EHMA 2DWHA 5TPAA 1FSAA 3IJXB 2I3WA 1B2HA 4RPNA 2FIXA 4GBVA 5IAIA 2QVRA 4N6PA 1URDA 3K1MA 1B46A 1QKAA 4H45A 3RY3A 3MZ9A 2XXRA 2XXIA 3JZJA 1AOVA 1Q9DA 1SPIA 4POXA 1A8EA 5I3SA 3TYHA 2GH9A 1MQIA 3PPPA 3TCHA 1B4HA 1R1NA 1DTZA 3V5AA 3VVFA 2XWVA 3JYRA 4F29A 2O51A 1YTVA 2GHBA 3UGWA 1B1HA 1LBBA 3HSTA 3DP6A 3TDJA 4N8YA 1TFAA 2HZKA 4Q5TA 1ZU0A 2Q74A 5ICQA 1N76A 3G3GA 3VLUA 3TTLA 2F5XA 1RDXA 1KZ8A 1PDAA 3FXUA 1A55A 1ATGA 3QMFA 4DDDA 2GQ1A 3H6UA 2Y5KA 4MLQA 3TMGA 1DTGA 4LA9A 3ILTB 4G8MA 1A99A 1POY1 3CG1A 3O6HA 3A09A 1B3EA 2XXPA 1YAEA 2BJIA 1B58A 5L9SA 5DTBA 5F7VA 3OSQA 1NUXA 2F7CA 4YMBA 2FIEA 1NV7A 2A5TB 4OZ9A 3EQ1A 3I6VA 4F1VA 2FA7A 1DPPA 4QFNA 4R6YA 1KWHA 1MPCA 4YB6A 3ZS6A 1IZ1A 4LATA 4Q30B 2CMOA 5B70A 2V3QA 4U1ZA 4GWSA 4H6DA 4OQOA 3B50A 1OQGA 3N6UA 1JW4A 4OEVA 1FQDA 3FBPA 3E13X 4ND9A 3A29A 1SDXA 3EHSA 1UQWA 1A7LA 2HXRA 2DS9A 3BIGA 3N94A 2ZNSA 4LN5A 1USYH 1TXFA 3K1PA 4MCOA 3U8QA 2DQVA 1P1UA 1NV1A 4MIJA 1BP5A 3U1OA 4LP2B 2VHAA 3U72A 1FQCA 1MPDA 1YCJA 4M4GA 1SW2A 3T22A 4M1VA 3KGCA 3KN7A 1B4ZA 3BKIB 1FQBA 4HW8A 2XX7A 3PMVA 3L6HA 3UP9A 1NV2A 4RNSA 1QGXA 3JV9A 3PD8A 4JVCA 3E9XA 5CBSA 5LOMA 3BFUA 2UXAA 4QFKA 4IO3A 2O7UA 1LSTA 3G3IA 1ZIUA 4H8JA 4GXSB 3SKPA 1JVXA 2XHDA 3TCGA 1EYIA 2DWAA 4NF0A 3T9HB 3U65A 3RT8A 3S4UA 1PBPA 4PFYA 2FHYA 2DVCA 1P99A 4WKMA 3TUSA
chains in the Genus database with same CATH topology
3KC1A 2OWSA 3FIRA 4DXCA 3S9MC 3S9LC 1NV0A 4XKQA 2QJEA 3RQTA 3RTWB 2REJA 2OZZA 1NV6A 1AWBA 1OIBA 2Y7IA 1R6ZA 2DXRA 3TEPA 1OLCA 4EF2A 1MXYA 2XD2A 3C35A 1D9QA 2QS3A 4GWYA 1A40A 1B7ZA 5KDTB 4MH5A 3IB2A 3RLFE 1MY0A 2ZNUA 3CIJA 4P11A 4X8RA 2Y7PA 4KD5A 4POWA 2X7QA 3PPOA 1XHYA 5EQAA 4EXLA 4H5FA 4I9DA 2REGA 5A5LA 3U94A 3LSWA 3USDA 3BFTA 4E0XA 4RYAA 1I6BA 1JQFA 1OQHA 4ELPA 2UYEA 4H65A 4F2QA 5ISUA 1Q1KA 5CMMA 4ZZAA 3T0JA 2OBGA 2HQ0A 3PD9A 4ZEKA 2PYYA 4NMYA 4X1BA 4IGTA 3A3UA 4NF6A 1SYHA 2V3TA 4P3LA 5AA3A 3FASA 2NWJA 1I6AA 4KCDA 2DYXA 1MXVA 3GBAA 5A5XB 1B51A 2DE3A 4GWUA 3IR1A 3KSJA 4KYSA 2WX9A 4ZDMA 3K00A 4PDHA 5AA4A 3TODA 5I2NA 3G3FA 2PFYA 3QIMA 4G68B 3FXBA 3MYUA 1MY3A 4LVQA 1D4NA 2ZZXA 4FEDA 1J1NA 3PPRA 1XC1A 1SBPA 4QXDA 1UTHB 4IGRA 4ZECA 1INPA 1RYXA 3KZGA 1B0LA 5HM4B 4OMBA 4GLIA 3K1NA 1QKBA 2R8TA 4OHNA 3THIA 2XX8A 4NF8A 3TTRA 3H6WA 1Y1MA 3T9VA 2Z23A 4YKIA 3MVXA 3M3KA 1L5TA 2QS4A 3T93B 4C1UA 1EYJA 4GF8A 4WEDA 1US5A 2CZIA 5JTYB 4DXBA 2HEUA 2RCBA 2ONRA 1FBGA 3N6TA 2P3NA 3IO6A 5FHMA 3OO8A 3C4MA 3FVOA 4OYVA 2KR0A 5I56A 1LBZA 1B9JA 2FYIA 2F7AA 1H76A 3Q27A 1FJ9A 3HO7A 2WKYA 1NV3A 4IY5A 4FJPA 2O1MA 1UTBB 2QRYA 4ZE8A 4R6KA 2OCUA 4I3EA 3MBPA 4TOZA 2YJPA 4G4PA 4OANA 2LAOA 3PUYE 2PVUA 1Z7NE 4TLLB 1Y3NA 4PP0A 4OA4A 1TFDA 4MMPA 2CEYA 4MX6A 3ZKLA 3LSXA 2QS1A 1RYOA 3DP4A 3V89B 4R9GA 1FPKA 1O64A 3FUZA 1HSLA 2XXUA 1O7TA 2F8DA 3D1RA 5BUUA 4DZ1A 4FECA 1LBCA 4PETA 1JEVA 3CFZA 5FTIA 3PPNA 3CHGA 3H7MA 2ZNTA 4MNPA 5KCJB 2D3IA 2HAVA 4HCWA 1MXUA 4BDOA 1XT8A 1BLFA 3UN6A 1SQYA 1BIYA 1B7HA 1XS5A 2F6PA 2QMWA 1BKAA 1LGBC 1N84A 2A5TA 3G7WA 5TP9B 1DMBA 3K2DA 5J16A 4RK9A 3FD3A 4FBPA 4MJOA 4MNCA 3CSBA 1LLSA 3G3JA 2WBDA 4N8GA 2O6AA 5EYGA 4XTCQ 5EHSA 2QVVA 3KOTA 4R74A 4N13A 2WBBA 1IEJA 3LBSA 2G93A 5L9OA 3C9HA 3OOAA 3I5OA 3GYYA 2VPOA 3T9UA 2RC9A 3FXQA 1LB8A 1IXGA 1VFEA 3C36A 4XXUA 2IA4A 4LQ2A 2RF1A 3TFLA 1PC3A 1IMDA 4FE8A 1UIVA 1I69A 4MHFA 1N0TA 2VOZA 1B5IA 4H8IA 3IO4A 4GOTA 4ECFA 4N81A 1NKXA 4Q8RA 2VD2A 1N3XA 1SW4A 2ABHA 2AL5A 4KYEA 4GWOA 3KC0A 4N17A 1IMBA 1PEBA 2I4BA 1AIVA 2DE2A 4F3BA 2OWZA 2ZYMA 3HHGA 3LSLA 2DWJA 1B3FA 5ET7A 3FJ7A 2OLBA 3E3KA 4EQBA 4KI0E 2Q2CA 3VXBA 2Q2AA 3K6UA 2FVZA 1VR5A 3VFJA 2VT5A 2PX1A 1B3HA 4ZEDA 4FIMA 4N15A 4NEDA 3GXAA 3OO7A 4RPOA 4PFWA 5KDTA 3IFCA 1T0KA 1LAHE 3SETA 1M5FA 1H3DA 1SI0A 1LFIA 2B3FA 3CI8A 2ANJA 3VDFA 4OEUA 3OO9A 4MF3A 2I48A 4EQ9A 4O7MA 4JDFA 1NI9A 4AS4A 3M8UA 4KPTA 4C1TA 1EZOA 4U21A 3LSFB 5KZTA 4NN3A 1US4A 4P9KA 5I7IA 4ZEBA 3IOVA 1M5BA 2ONKE 3SESA 3ILUB 4O3AA 3RTFB 3SEXA 5A5XA 3OD7A 5CBRA 4N6DA 3B7DA 3U92A 3FJMA 1MXXA 3ROJA 1QW0A 3GBBA 2HAUA 3L6GA 2WYKA 5I5PA 3V8XB 1N04A 1B5JA 1R9LA 2HFBA 2V93A 3B6WA 4G68A 3O66A 2O69A 3RPLA 4FEBA 3MVZA 3KBRA 5ITPA 3LC8A 1ZJLA 4RXLA 5I2KB 1FTAA 2Q8JA 3IB0A 4OFJA 4JWYA 3DP8A 2I0CA 4DCXA 2PFZA 4IO7A 4ISUA 2PBWA 3RT6B 3T96B 1MDQA 1LCTA 3Q28A 1HSJA 5CMKA 3E4RA 4HCYA 3QK6A 2HXWA 1NFTA 2XXXA 4YZZA 4ESXA 1CNQA 5B7DA 4P1EA 4NF5A 2FNCA 5IZ3B 1FPIA 1IXCA 1FBPA 1VSOA 5DEXB 5I58B 1FJ6A 2DE4A 3KJ7A 1YYZA 3I3VA 4GL8A 4I40A 3TCFA 5JK4A 2M8CA 1NH8A 1P1OA 3N26A 2X7PA 4DI3D 2Z8FA 1XVXA 1NNPA 2O84X 4F3PA 2QMXA 3EKIA 1Y20A 1IXIA 2QL3A 4WXJA 4N07A 2XA5A 4PQJA 2O1LA 5I57A 2Z8EA 3MUQA 2MKZA 1A54A 3GLBA 4BDRA 3PV0E 5K2XA 5BWJA 1FPLA 4QSDA 3DELB 1FBEA 2QS2A 1I6QA 2P2AA 3FJGA 3MP8A 2B4MA 2XXWA 4R72A 2H99A 3S9EA 5ET5A 1ANFA 4GVOA 5LDZA 5EYHA 4EDPA 3B8BA 4YMAA 4JVIA 4H0WA 4R75A 4HXVA 4LONB 3PUZE 2CZHA 3IOWA 1S9TA 4QF9A 4P1LA 4ZZEA 4DE8A 4PAFA 3SEVA 3IJOB 4R2FA 2P1SA 4PFBA 3O97A 4IO5A 5L8DA 3O6GA 5KCJA 1LBWA 2VGQA 3OSRA 3TPAA 4PC9A 2GRVA 3BIHA 4JSDA 1N7WA 2DVZA 3IK6B 2ZZVA 4OWDA 1Q35A 2F34A 1JNFA 5CI5A 2P0SA 2Q9TA 4N6KA 3H6VA 3VVEA 2H9BA 4GX6A 3TAJA 4U1OA 5H8QB 1D3KA 3DLNA 3TTMA 4U2RA 3TTKA 4Z0IA 4F18A 3S2VA 1CB6A 4GWXA 3MVYA 4JSOA 5I84A 2YLNA 2L5VA 2X26A 1H45A 3PGFA 5AA2D 2XXYA 1FPEA 1R9QA 3QUJA 1MQHA 4H46A 1EYKA 1QUKA 4O7IA 4G8NA 2E1SA 4OFOA 4PTKA 3T66A 3ODBA 2Q89A 1SW1A 1MXWA 2OJTA 4ELQA 4QHQA 3RNNA 1YXIA 4ZEFA 1B3LA 1II5A 2F97A 3RN8A 3B6QA 3R6UA 4YU0A 5ELVA 3CG3A 4ELOA 4NAPA 4AQ4A 3C31A 3K02A 2DOJA 2PMSA 5IGAA 1B32A 3KOSA 1SD3A 1RDZA 2HHMA 1FBCA 2F6GA 3O9PA 2Y7RA 4HTGA 1Y1ZA 4NX1A 1POTA 4JXIA 4PFRA 3BBRA 4BDNA 1FTMA 3M3LA 4IY6A 5F24A 4MFIA 3CFXA 3SEWA 5CRYA 3LV0A 1M5DA 4JWOA 4EF1A 1IIWA 4E0WA 3K6VA 2NOOA 4AB5A 4P47A 5AA1A 2UVJA 1LFGA 5DVJA 1K9ZA 2DWIA 4RA1A 4NWCA 1IMAA 3K6WA 3TQLA 3PTYA 3K4UA 2Z22A 3NOHA 5L9MA 4ESWA 2AIXA 3CFLA 3SDFA 3KG2A 1LBVA 4LUBA 4OENA 3SZPA 2GHAA 1GGGA 4LZ8A 1EZ9A 1NNFA 1IQ7A 5IZ1A 4PFTA 4XIGQ 1ZLQA 3CR9A 1FPGA 1JW1A 4NQ8A 1JW5A 1Y9UA 4R9FA 4NHBA 2E0SA 3H4ZA 4HE0A 2VPNA 1QVSA 3UA8A 4QSCA 2ZMBA 4X9TA 3N5LA 3ECRA 5AE4A 1FTJA 2R6GE 1MY1A 2DP8A 3MW0A 4GX4A 3IL1B 1PB9A 4NF6B 3FV2A 4I3YA 4F31B 1MY2A 4PE3A 3MJNA 3CVGA 1CE2A 1N7XA 1FBDA 2H98A 1FQFA 1FW0A 4IO2A 3SEYA 4PCDA 1MQGA 3ZSFA 3O29A 1F9BA 2QVUA 1NMUA 5CMBA 3M3FA 3WAFA 2Y84A 5CC2A 2KLFA 3SEUA 1MM6A 4PBHA 2F35A 1M5CA 4NG7A 3MWBA 2CZLA 3C33A 4TLMB 2YPNA 3O28A 4G68C 4OVTA 4H1XA 3G3KA 5FTHA 4Z7EA 4GL0A 1BK4A 4IO6A 1B5HA 2XWOA 1NNKA 1GTKA 4OVPA 5LTCA 5DVIA 5AA2B 4XF5A 3IB1A 5ET6A 4IR8A 1NUZA 5ICTA 4MEVA 3P7IA 5IZ3A 3PUXE 5I59B 3UORA 3ISPA 3PUVE 5I58A 4G2ZA 4EQ7A 1B3GA 1FBFA 4H67A 3MPLA 2B4LA 2XWIA 1IMFA 4I1DA 3VE1B 3D4GA 4GXAA 2THIA 4C0RA 2F3BA 2Q88A 3H06B 3QSLA 4DXUA 2FBPA 4X1DA 4GX3A 4GWZA 3UIFA 4ZS9A 2XX9A 2PT1A 3Q26A 4FAJA 2P3VA 1NL5A 4BDQA 3FV1A 2ZXTA 1JVYA 3FXRA 5I56B 4F1UA 4ZEIA 1SVXB 2H25A 2B3BA 2R9JA 1Y3QA 4TQUQ 2I0BA 3GZGA 4K3FA 1FQAA 1G0HA 1Y4CA 4Q0CA 5HPQA 1BTJA 1B1XA 3E79A 4MAGA 4KXPA 1NV4A 2F3DA 3H03A 4QRZA 2XD3A 1FPFA 1QJMA 5M2VA 3CRBA 5K2YA 1LAXA 4O3CA 1KA0A 4BDMA 5DT6A 4YAHX 1IUDA 5CMCA 4N91A 3KSXA 2HPGA 4NTLA 1N3WA 4WEPA 4F39A 1PBQA 3T9XB 2Y5LA 4HE2A 1MS7A 5T3JA 4EXKA 2I58A 4YKPA 4PFIA 2RKMA 5F1QA 4O8MA 3CSGA 3WAEA 4DIGA 4NGUA 2NUVA 5H8QA 3UK4A 3OENA 3MPKA 2ZYKA 4G8HA 4ZE9A 3W9VA 1TT1A 4NF4B 4GD5A 4FATA 4F3SA 1B6HA 2I6EA 4F3GA 4PBQA 2Y7WA 1MPBA 1LAGE 4OXVA 5H8SA 3Q25A 2F36A 1URSA 4QFPA 3W15C 5JEIA 5ET8A 5FBPA 2Z8DA 3FVGA 1DBZA 4UACA 1UTHA 1TWYA 3MZ1A 1WODA 3F11A 1IITA 1FPDA 4XKRA 1GV8A 5H8NB 4OVSA 4U23A 3U93A 2XXKA 2HZLA 1PB7A 3VXCA 4PAIA 3EPEA 1XI6A 1MQDA 4BLAA 5IM2A 2Y7KA 1S50A 3TKDA 1QUJA 3H3GA 3MAMA 5H8HB 3KBZA 1ZBMA 2RCAA 4KFQA 5JTYA 4FORA 1EZPA 2DXYA 4YKKA 5H8FB 4DI4B 4O3BA 2AL4A 1P1WA 4F19A 4F22A 1DSNA 4XFEA 4RK2A 2A5SA 4XEQA 1B52A 2ESNA 1MH3A 1HSEA 4H5GA 2ZYOA 2QPQA 3IAZA 4F2OA 1NV5A 4MNIA 4OVQA 2NXOA 4JB7A 4XKPA 1USYE 1FTKA 1UTBA 5TPAB 1MQJA 4UA8A 2I49A 3MSTA 1WVJA 1Z7ME 5TU0A 5J1DA 2PCRA 1KA1A 3MP1A 3ZKKA 4OETA 3TTNA 2HCAA 1B05A 4YKJA 4UABA 3QYTA 4MBPA 2OK2A 4P8BA 1MH4A 2O68A 4KR5A 1FQEA 2V3UA 4KCCA 2G29A 5EYFA 3HHFA 1G0IA 2D5WA 3HV1A 5IKBA 2VP1A 1LB9A 1DK4A 1ZKBA 3C32A 4PGNA 1AMFA 3S9NC 3W9WA 1RDYA 3AXFA 4QSEA 2QFLA 1VE4A 4DCYA 3E78A 3OELA 4HE1A 2OWTA 2OX3A 2V25A 4QBAA 4R2BA 1VDWA 5DYHA 1P1NA 1P1QA 1MXZA 2XXQA 1FRPA 1MG1A 1NNTA 1IXHA 2BJJX 3FGSA 4RJZA 5TP9A 1GR2A 4P0IA 1IMCA 3DM0A 3FVNA 3TQWA 5EQ8A 4OVRA 4HS7A 3QAXA 3H6TA 1JETA 4L17A 1MDP1 3A3CA 2ONSA 1LBYA 3IFAA 4YICA 2CZKA 5CM6A 4YB7A 3IOUA 4R73A 1Y3PA 1MM7A 2XXHA 1LEVA 4NE4A 4BDLA 1JEUA 4EUOA 4ONYA 4G77A 2JJKA 3PU5A 2WYPA 3VLWA 5HBCA 4OFLA 2UVHA 1UIUA 1VFDA 1DCUA 4R6HA 3RPLB 1SW5A 5EQ9A 3LR1A 2O7IA 3KJTA 1O63A 2QSXA 3KEIA 2W7YA 1FCKA 1GVCA 5AA2A 2I4CA 2PT2A 4NWDA 3B6TA 3O6IA 1XVYA 5I59A 3IOTA 4JBZA 2V4CA 3PPQA 4P56A 4F1YA 3ONMA 1ELJA 1FBHA 4X48A 3QXMA 4NF5B 3MZBA 2CEXA 1MY4A 5DW8A 1NUWA 4PF6A 3KN8A 4PAKA 1PB8A 1FTOA 2IEEA 1DPEA 3EHUA 2V84A 3VV5A 3HFUA 1OLAA 4QFOA 3HN0A 1YPNA 4GWWA 1S7YA 2KQZA 1URGA 3TZAA 2ALUA 3EN3A 4PGPA 5IZZA 2H4IA 3FVKA 3C34A 3SERA 3QUFA 4LZ5A 3RPWA 3MC2A 5I57B 1EU8A 4IO4A 3LUZA 3OMBA 4AB6A 4GFRA 3VLVA 3D4CA 4PDDA 4PF8A 1WDNA 2RINA 1XOCA 5DVFA 1M5EA 1B7UA 1LAFE 1LFHA 4XKNA 4KHZE 4PE5B 2XXTA 4LQ5A 2D21A 3G3HA 3OXNA 1ZTYA 3K01A 3FZVA 2NVUB 3RYDA 1K9YA 3MQ9A 4GQOA 4U4SA 3VVDA 1NUYA 3R7XA 1FPJA 4THIA 1D9YA 3RGYA 1AH5A 3R26A 4JVDA 3PMWA 3T1BA 4MLVA 3IX1A 3KN3A 3PMXA 1H44A 1B40A 3KFMA 2GFEA 3K6XA 2WEFA 2XWKA 4KQPA 4PFUA 1NH7A 4OTEA 4LZ7A 2AYSA 4JWXA 4O94A 4GIZA 4U22A 4AS5A 4NF4A 3V83A 1D9VA 4OVJA 2ZYNA 5FHOA 1QUIA 1B0HA 2XXVA 4P0GA 1IMEA 3PUWE 1MRPA 5AA4B 3Q29A 2F7BA 4GBWA 3TELA 2R71A 5I2KA 5I2NB 2UYFA 5EQ7A 1OVBA 2H5YA 3LUYA 3RUMA 1YZ0A 3MP6A 2DSFA 4G61A 2B65A 1AL3A 2VD3A 5H8NA 1OMPA 2RC7A 1SI1A 4OESA 2ZZWA 2DDKA 1FPBA 2F78A 4GRKA 1JP4A 1EH3A 3K0VA 3IORA 4X04A 2Q8MA 1SYIA 4U4XA 4RY1A 2RC8A 5ESYA 4I62A 5H8HA 4QFLA 4DLDA 3HPIA 4NF8B 4ELRA 3O2AA 4I8CA 3EHTA 3OO6A 1H43A 1ZMGA 5DEXA 5H8FA 2I3VA 2UVIA 3FATA 3OEKA 1FTLA 1DOTA 4N4UA 3EF7A 4KYDA 1LBXA 1LCFA 3HCQA 1QULA 3MVWA 4IB2A 4OERA 1RKMA 2UVGA 5ITOA 1Y4TA 5FHNA 1OVTA 1A8FA 4YB5A 3OEMA 5EHMA 2DWHA 5TPAA 1FSAA 3IJXB 2I3WA 1B2HA 4RPNA 2FIXA 4GBVA 5IAIA 4N6PA 2QVRA 1URDA 3K1MA 1B46A 1QKAA 4H45A 3RY3A 3MZ9A 2XXRA 2XXIA 3JZJA 1AOVA 1Q9DA 1SPIA 4POXA 1A8EA 5I3SA 3TYHA 2GH9A 1MQIA 3PPPA 3TCHA 1B4HA 1R1NA 1DTZA 3V5AA 3VVFA 2XWVA 3JYRA 4F29A 2O51A 1YTVA 2GHBA 3UGWA 1B1HA 1LBBA 3HSTA 3DP6A 3TDJA 4N8YA 1TFAA 2HZKA 4Q5TA 1ZU0A 5ICQA 2Q74A 1N76A 3G3GA 3VLUA 3TTLA 2F5XA 3FXUA 1PDAA 1KZ8A 1RDXA 1A55A 1ATGA 3QMFA 4DDDA 3H6UA 2GQ1A 2Y5KA 4MLQA 3TMGA 1DTGA 4LA9A 3ILTB 4G8MA 1A99A 1POY1 3CG1A 3O6HA 3A09A 1B3EA 2XXPA 1YAEA 2BJIA 1B58A 5L9SA 5DTBA 5F7VA 3OSQA 1NUXA 2F7CA 4YMBA 2FIEA 1NV7A 2A5TB 4OZ9A 3EQ1A 3I6VA 4F1VA 2FA7A 1DPPA 4QFNA 4R6YA 1KWHA 1MPCA 4YB6A 3ZS6A 1IZ1A 4LATA 4Q30B 2CMOA 5B70A 2V3QA 4U1ZA 4GWSA 4H6DA 4OQOA 3B50A 1OQGA 3N6UA 1JW4A 4OEVA 1FQDA 3FBPA 3E13X 4ND9A 3A29A 1SDXA 3EHSA 1UQWA 1A7LA 2HXRA 2DS9A 3BIGA 3N94A 2ZNSA 3U8QA 1USYH 1TXFA 3K1PA 4LN5A 4MCOA 2DQVA 1P1UA 1NV1A 4MIJA 1BP5A 3U1OA 4LP2B 2VHAA 3U72A 1FQCA 1MPDA 1YCJA 4M4GA 1SW2A 3T22A 4M1VA 3KGCA 3KN7A 1B4ZA 3BKIB 1FQBA 4HW8A 2XX7A 3PMVA 3L6HA 3UP9A 1NV2A 4RNSA 1QGXA 3JV9A 3PD8A 4JVCA 3E9XA 5CBSA 5LOMA 3BFUA 2UXAA 4QFKA 4IO3A 2O7UA 1LSTA 3G3IA 1ZIUA 4H8JA 3SKPA 4GXSB 1JVXA 2XHDA 3TCGA 2DWAA 1EYIA 4NF0A 3T9HB 3U65A 3RT8A 3S4UA 1PBPA 4PFYA 2FHYA 2DVCA 1P99A 4WKMA 3TUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWS A;  3FIR A;  4DXC A;  3S9M C;  3S9L C;  4XKQ A;  2QJE A;  3RQT A;  3RTW B;  2REJ A;  2OZZ A;  1OIB A;  2Y7I A;  1R6Z A;  2DXR A;  3TEP A;  1OLC A;  4EF2 A;  1MXY A;  2XD2 A;  3C35 A;  2QS3 A;  1A40 A;  1B7Z A;  5KDT B;  4MH5 A;  3IB2 A;  3RLF E;  1MY0 A;  2ZNU A;  3CIJ A;  4P11 A;  2Y7P A;  4KD5 A;  4POW A;  2X7Q A;  3PPO A;  1XHY A;  4EXL A;  4H5F A;  4I9D A;  2REG A;  3U94 A;  3LSW A;  3USD A;  3BFT A;  4E0X A;  4RYA A;  1I6B A;  1JQF A;  1OQH A;  4ELP A;  2UYE A;  4H65 A;  4F2Q A;  5ISU A;  1Q1K A;  5CMM A;  4ZZA A;  2OBG A;  2HQ0 A;  3PD9 A;  4ZEK A;  2PYY A;  4NMY A;  4X1B A;  4IGT A;  3A3U A;  4NF6 A;  1SYH A;  2V3T A;  5AA3 A;  3FAS A;  2NWJ A;  1I6A A;  4KCD A;  2DYX A;  1MXV A;  3GBA A;  5A5X B;  1B51 A;  2DE3 A;  3IR1 A;  3KSJ A;  4KYS A;  4ZDM A;  3K00 A;  5AA4 A;  3TOD A;  5I2N A;  3G3F A;  3QIM A;  4G68 B;  1MY3 A;  4LVQ A;  1D4N A;  4FED A;  1J1N A;  3PPR A;  1XC1 A;  1SBP A;  1UTH B;  4IGR A;  4ZEC A;  1RYX A;  3KZG A;  1B0L A;  5HM4 B;  4OMB A;  4GLI A;  3K1N A;  1QKB A;  4OHN A;  3THI A;  2XX8 A;  4NF8 A;  3TTR A;  3H6W A;  1Y1M A;  3T9V A;  2Z23 A;  4YKI A;  3MVX A;  3M3K A;  1L5T A;  2QS4 A;  3T93 B;  4C1U A;  4GF8 A;  4WED A;  1US5 A;  5JTY B;  4DXB A;  2HEU A;  2RCB A;  2ONR A;  3N6T A;  3IO6 A;  5FHM A;  3OO8 A;  3C4M A;  3FVO A;  4OYV A;  5I56 A;  1B9J A;  2FYI A;  2F7A A;  1H76 A;  3Q27 A;  3HO7 A;  2WKY A;  4IY5 A;  4FJP A;  2O1M A;  1UTB B;  2QRY A;  4ZE8 A;  4R6K A;  2OCU A;  3MBP A;  4TOZ A;  2YJP A;  4G4P A;  2LAO A;  3PUY E;  2PVU A;  1Z7N E;  4TLL B;  1Y3N A;  4PP0 A;  1TFD A;  3ZKL A;  3LSX A;  2QS1 A;  1RYO A;  3DP4 A;  3V89 B;  4R9G A;  1O64 A;  3FUZ A;  1HSL A;  2XXU A;  1O7T A;  2F8D A;  5BUU A;  4DZ1 A;  4FEC A;  1LBC A;  4PET A;  1JEV A;  3CFZ A;  5FTI A;  3PPN A;  3H7M A;  2ZNT A;  5KCJ B;  2D3I A;  2HAV A;  4HCW A;  1MXU A;  4BDO A;  1XT8 A;  1BLF A;  3UN6 A;  1SQY A;  1BIY A;  1B7H A;  1XS5 A;  2F6P A;  2QMW A;  1BKA A;  1LGB C;  1N84 A;  2A5T A;  3G7W A;  5TP9 B;  1DMB A;  3K2D A;  4RK9 A;  3FD3 A;  3CSB A;  1LLS A;  3G3J A;  2O6A A;  4XTC Q;  5EHS A;  3KOT A;  4R74 A;  4N13 A;  1IEJ A;  3LBS A;  2G93 A;  5L9O A;  3C9H A;  3OOA A;  3I5O A;  3T9U A;  2RC9 A;  3FXQ A;  1LB8 A;  1IXG A;  1VFE A;  3C36 A;  4XXU A;  2IA4 A;  4LQ2 A;  2RF1 A;  3TFL A;  1PC3 A;  4FE8 A;  1UIV A;  1I69 A;  1N0T A;  2VOZ A;  1B5I A;  4H8I A;  3IO4 A;  4GOT A;  4ECF A;  1NKX A;  4Q8R A;  2VD2 A;  1N3X A;  1SW4 A;  2ABH A;  2AL5 A;  4KYE A;  4GWO A;  1PEB A;  2I4B A;  1AIV A;  2DE2 A;  4F3B A;  2ZYM A;  3HHG A;  3LSL A;  2DWJ A;  1B3F A;  3FJ7 A;  2OLB A;  3E3K A;  4EQB A;  4KI0 E;  2Q2C A;  3VXB A;  2Q2A A;  3K6U A;  1VR5 A;  3VFJ A;  2PX1 A;  1B3H A;  4ZED A;  4FIM A;  4NED A;  3GXA A;  3OO7 A;  4RPO A;  4PFW A;  5KDT A;  1T0K A;  1LAH E;  3SET A;  1M5F A;  1H3D A;  1SI0 A;  1LFI A;  2B3F A;  3CI8 A;  2ANJ A;  3VDF A;  4OEU A;  3OO9 A;  4MF3 A;  2I48 A;  4EQ9 A;  4JDF A;  3M8U A;  4KPT A;  4C1T A;  1EZO A;  4U21 A;  3LSF B;  5KZT A;  1US4 A;  4ZEB A;  3IOV A;  1M5B A;  2ONK E;  3SES A;  3ILU B;  4O3A A;  3RTF B;  3SEX A;  5A5X A;  3OD7 A;  5CBR A;  3B7D A;  3U92 A;  3FJM A;  1MXX A;  1QW0 A;  3GBB A;  2HAU A;  3L6G A;  3V8X B;  1N04 A;  1B5J A;  1R9L A;  2HFB A;  2V93 A;  3B6W A;  4G68 A;  3O66 A;  2O69 A;  4FEB A;  3MVZ A;  3KBR A;  5ITP A;  3LC8 A;  1ZJL A;  4RXL A;  5I2K B;  2Q8J A;  3IB0 A;  4OFJ A;  4JWY A;  3DP8 A;  2I0C A;  4DCX A;  4IO7 A;  4ISU A;  2PBW A;  3RT6 B;  3T96 B;  1MDQ A;  1LCT A;  3Q28 A;  1HSJ A;  5CMK A;  3E4R A;  4HCY A;  3QK6 A;  2HXW A;  1NFT A;  2XXX A;  4YZZ A;  4ESX A;  5B7D A;  4NF5 A;  2FNC A;  1IXC A;  1VSO A;  5DEX B;  5I58 B;  2DE4 A;  3KJ7 A;  3I3V A;  4GL8 A;  3TCF A;  5JK4 A;  2M8C A;  1NH8 A;  1P1O A;  3N26 A;  2X7P A;  2Z8F A;  1XVX A;  1NNP A;  2O84 X;  4F3P A;  2QMX A;  1Y20 A;  1IXI A;  2QL3 A;  4WXJ A;  4N07 A;  4PQJ A;  2O1L A;  5I57 A;  2Z8E A;  3MUQ A;  1A54 A;  3GLB A;  4BDR A;  3PV0 E;  5K2X A;  5BWJ A;  4QSD A;  3DEL B;  2QS2 A;  1I6Q A;  2P2A A;  3FJG A;  3MP8 A;  2XXW A;  4R72 A;  2H99 A;  3S9E A;  1ANF A;  4GVO A;  4EDP A;  4YMA A;  4H0W A;  4R75 A;  4LON B;  3PUZ E;  3IOW A;  1S9T A;  4QF9 A;  4ZZE A;  4DE8 A;  3SEV A;  3IJO B;  4R2F A;  2P1S A;  3O97 A;  4IO5 A;  5L8D A;  3O6G A;  5KCJ A;  2VGQ A;  3OSR A;  3TPA A;  2GRV A;  4JSD A;  1N7W A;  2DVZ A;  3IK6 B;  4OWD A;  1Q35 A;  2F34 A;  1JNF A;  5CI5 A;  2P0S A;  2Q9T A;  3H6V A;  3VVE A;  2H9B A;  3TAJ A;  4U1O A;  5H8Q B;  1D3K A;  3DLN A;  3TTM A;  4U2R A;  3TTK A;  4Z0I A;  4F18 A;  3S2V A;  1CB6 A;  3MVY A;  4JSO A;  5I84 A;  2YLN A;  2X26 A;  1H45 A;  3PGF A;  5AA2 D;  2XXY A;  1R9Q A;  3QUJ A;  1MQH A;  1QUK A;  4G8N A;  2E1S A;  4OFO A;  3T66 A;  3ODB A;  2Q89 A;  1SW1 A;  1MXW A;  2OJT A;  4ELQ A;  4QHQ A;  3RNN A;  4ZEF A;  1B3L A;  1II5 A;  2F97 A;  3RN8 A;  3B6Q A;  3R6U A;  4YU0 A;  5ELV A;  3CG3 A;  4ELO A;  4AQ4 A;  3C31 A;  3K02 A;  2DOJ A;  2PMS A;  1B32 A;  3KOS A;  1SD3 A;  2F6G A;  3O9P A;  2Y7R A;  4HTG A;  1Y1Z A;  1POT A;  4JXI A;  3BBR A;  4BDN A;  1FTM A;  3M3L A;  4IY6 A;  4MFI A;  3CFX A;  3SEW A;  5CRY A;  1M5D A;  4JWO A;  4EF1 A;  1IIW A;  4E0W A;  3K6V A;  2NOO A;  4AB5 A;  5AA1 A;  2UVJ A;  1LFG A;  5DVJ A;  2DWI A;  4RA1 A;  4NWC A;  3K6W A;  3TQL A;  3K4U A;  2Z22 A;  5L9M A;  4ESW A;  2AIX A;  3CFL A;  3SDF A;  3KG2 A;  4LUB A;  4OEN A;  2GHA A;  1GGG A;  4LZ8 A;  1EZ9 A;  1NNF A;  1IQ7 A;  4PFT A;  4XIG Q;  1ZLQ A;  3CR9 A;  1JW1 A;  1JW5 A;  1Y9U A;  4R9F A;  2E0S A;  3H4Z A;  1QVS A;  3UA8 A;  4QSC A;  2ZMB A;  4X9T A;  3N5L A;  3ECR A;  5AE4 A;  1FTJ A;  2R6G E;  1MY1 A;  2DP8 A;  3MW0 A;  3IL1 B;  1PB9 A;  4NF6 B;  3FV2 A;  4F31 B;  1MY2 A;  3MJN A;  3CVG A;  1CE2 A;  1N7X A;  2H98 A;  1FQF A;  1FW0 A;  4IO2 A;  3SEY A;  1MQG A;  3ZSF A;  3O29 A;  1F9B A;  1NMU A;  5CMB A;  3M3F A;  3WAF A;  2Y84 A;  5CC2 A;  2KLF A;  3SEU A;  1MM6 A;  2F35 A;  1M5C A;  3MWB A;  2CZL A;  3C33 A;  4TLM B;  2YPN A;  3O28 A;  4G68 C;  4H1X A;  3G3K A;  5FTH A;  4Z7E A;  4GL0 A;  4IO6 A;  1B5H A;  1NNK A;  1GTK A;  5DVI A;  5AA2 B;  3IB1 A;  5ICT A;  3P7I A;  3PUX E;  5I59 B;  3UOR A;  3PUV E;  5I58 A;  4G2Z A;  4EQ7 A;  1B3G A;  4H67 A;  3MPL A;  4I1D A;  3VE1 B;  3D4G A;  4GXA A;  2THI A;  4C0R A;  2Q88 A;  3H06 B;  3QSL A;  4DXU A;  4X1D A;  3UIF A;  4ZS9 A;  2XX9 A;  2PT1 A;  3Q26 A;  4FAJ A;  1NL5 A;  4BDQ A;  3FV1 A;  2ZXT A;  1JVY A;  3FXR A;  5I56 B;  4F1U A;  4ZEI A;  1SVX B;  2H25 A;  2B3B A;  2R9J A;  1Y3Q A;  4TQU Q;  2I0B A;  3GZG A;  4K3F A;  1FQA A;  1Y4C A;  4Q0C A;  5HPQ A;  1BTJ A;  1B1X A;  3H03 A;  4QRZ A;  2XD3 A;  1QJM A;  5M2V A;  3CRB A;  5K2Y A;  1LAX A;  4O3C A;  4BDM A;  5DT6 A;  4YAH X;  1IUD A;  5CMC A;  3KSX A;  4NTL A;  1N3W A;  4WEP A;  4F39 A;  1PBQ A;  3T9X B;  1MS7 A;  4EXK A;  2I58 A;  4YKP A;  2RKM A;  5F1Q A;  3CSG A;  3WAE A;  4DIG A;  2NUV A;  5H8Q A;  3UK4 A;  3OEN A;  3MPK A;  2ZYK A;  4G8H A;  4ZE9 A;  3W9V A;  1TT1 A;  4NF4 B;  4GD5 A;  4FAT A;  4F3S A;  1B6H A;  2I6E A;  4F3G A;  2Y7W A;  1MPB A;  1LAG E;  4OXV A;  5H8S A;  3Q25 A;  2F36 A;  1URS A;  4QFP A;  3W15 C;  5JEI A;  2Z8D A;  3FVG A;  4UAC A;  1UTH A;  1TWY A;  3MZ1 A;  1WOD A;  3F11 A;  1IIT A;  4XKR A;  1GV8 A;  5H8N B;  4U23 A;  3U93 A;  2HZL A;  1PB7 A;  3VXC A;  3EPE A;  1MQD A;  4BLA A;  2Y7K A;  1S50 A;  3TKD A;  1QUJ A;  3H3G A;  3MAM A;  5H8H B;  1ZBM A;  2RCA A;  4KFQ A;  5JTY A;  4FOR A;  1EZP A;  2DXY A;  4YKK A;  5H8F B;  4O3B A;  2AL4 A;  1P1W A;  4F19 A;  4F22 A;  1DSN A;  4RK2 A;  2A5S A;  1B52 A;  2ESN A;  1MH3 A;  1HSE A;  4H5G A;  2ZYO A;  2QPQ A;  3IAZ A;  4F2O A;  2NXO A;  4JB7 A;  4XKP A;  1USY E;  1FTK A;  1UTB A;  5TPA B;  1MQJ A;  4UA8 A;  2I49 A;  1WVJ A;  1Z7M E;  5TU0 A;  5J1D A;  3MP1 A;  3ZKK A;  4OET A;  3TTN A;  2HCA A;  1B05 A;  4YKJ A;  3QYT A;  4MBP A;  2OK2 A;  1MH4 A;  2O68 A;  4KR5 A;  1FQE A;  2V3U A;  4KCC A;  2G29 A;  5EYF A;  3HHF A;  2D5W A;  3HV1 A;  5IKB A;  2VP1 A;  1LB9 A;  1ZKB A;  3C32 A;  1AMF A;  3S9N C;  3W9W A;  3AXF A;  4QSE A;  1VE4 A;  4DCY A;  3OEL A;  2OWT A;  2V25 A;  4R2B A;  5DYH A;  1P1N A;  1P1Q A;  1MXZ A;  2XXQ A;  1MG1 A;  1NNT A;  1IXH A;  2BJJ X;  3FGS A;  4RJZ A;  5TP9 A;  1GR2 A;  4P0I A;  3DM0 A;  3FVN A;  3TQW A;  4HS7 A;  3QAX A;  3H6T A;  1JET A;  4L17 A;  1MDP 1;  3A3C A;  2ONS A;  4YIC A;  5CM6 A;  4YB7 A;  3IOU A;  4R73 A;  1Y3P A;  1MM7 A;  2XXH A;  4NE4 A;  4BDL A;  1JEU A;  4EUO A;  4ONY A;  4G77 A;  3PU5 A;  3VLW A;  5HBC A;  4OFL A;  2UVH A;  1UIU A;  1VFD A;  4R6H A;  1SW5 A;  3LR1 A;  2O7I A;  3KJT A;  1O63 A;  2QSX A;  3KEI A;  2W7Y A;  1FCK A;  1GVC A;  5AA2 A;  2I4C A;  2PT2 A;  4NWD A;  3B6T A;  3O6I A;  1XVY A;  5I59 A;  3IOT A;  4JBZ A;  3PPQ A;  4F1Y A;  3ONM A;  1ELJ A;  4X48 A;  3QXM A;  4NF5 B;  3MZB A;  1MY4 A;  3KN8 A;  1PB8 A;  1FTO A;  2IEE A;  1DPE A;  3EHU A;  2V84 A;  3VV5 A;  1OLA A;  4QFO A;  3HN0 A;  1YPN A;  1S7Y A;  1URG A;  3TZA A;  2ALU A;  3EN3 A;  2H4I A;  3FVK A;  3C34 A;  3SER A;  3QUF A;  4LZ5 A;  3RPW A;  3MC2 A;  5I57 B;  1EU8 A;  4IO4 A;  3OMB A;  4AB6 A;  4GFR A;  3VLV A;  3D4C A;  1WDN A;  2RIN A;  1XOC A;  5DVF A;  1M5E A;  1B7U A;  1LAF E;  1LFH A;  4XKN A;  4KHZ E;  4PE5 B;  2XXT A;  4LQ5 A;  2D21 A;  3G3H A;  3OXN A;  1ZTY A;  3K01 A;  3FZV A;  2NVU B;  3MQ9 A;  4GQO A;  4U4S A;  3VVD A;  3R7X A;  4THI A;  1D9Y A;  3RGY A;  1AH5 A;  3R26 A;  3PMW A;  4MLV A;  3IX1 A;  3KN3 A;  3PMX A;  1H44 A;  1B40 A;  3KFM A;  2GFE A;  3K6X A;  4KQP A;  4PFU A;  1NH7 A;  4OTE A;  4LZ7 A;  2AYS A;  4JWX A;  4GIZ A;  4U22 A;  4NF4 A;  3V83 A;  1D9V A;  4OVJ A;  2ZYN A;  5FHO A;  1QUI A;  1B0H A;  2XXV A;  4P0G A;  3PUW E;  1MRP A;  5AA4 B;  3Q29 A;  2F7B A;  3TEL A;  2R71 A;  5I2K A;  5I2N B;  2UYF A;  1OVB A;  2H5Y A;  3LUY A;  3RUM A;  3MP6 A;  2DSF A;  2B65 A;  1AL3 A;  2VD3 A;  5H8N A;  1OMP A;  2RC7 A;  1SI1 A;  4OES A;  2F78 A;  4GRK A;  1EH3 A;  3K0V A;  3IOR A;  1SYI A;  4U4X A;  4RY1 A;  2RC8 A;  4I62 A;  5H8H A;  4QFL A;  4DLD A;  3HPI A;  4NF8 B;  4ELR A;  3O2A A;  4I8C A;  3EHT A;  3OO6 A;  1H43 A;  1ZMG A;  5DEX A;  5H8F A;  2I3V A;  2UVI A;  3FAT A;  3OEK A;  1FTL A;  1DOT A;  3EF7 A;  4KYD A;  1LCF A;  3HCQ A;  1QUL A;  3MVW A;  4IB2 A;  4OER A;  1RKM A;  2UVG A;  5ITO A;  1Y4T A;  5FHN A;  1OVT A;  1A8F A;  4YB5 A;  3OEM A;  5EHM A;  2DWH A;  5TPA A;  3IJX B;  2I3W A;  1B2H A;  4RPN A;  5IAI A;  4N6P A;  1URD A;  3K1M A;  1B46 A;  1QKA A;  3RY3 A;  3MZ9 A;  2XXR A;  2XXI A;  3JZJ A;  1AOV A;  4POX A;  1A8E A;  3TYH A;  2GH9 A;  1MQI A;  3PPP A;  3TCH A;  1B4H A;  1R1N A;  1DTZ A;  3V5A A;  3VVF A;  3JYR A;  4F29 A;  2O51 A;  1YTV A;  2GHB A;  3UGW A;  1B1H A;  1LBB A;  3HST A;  3DP6 A;  3TDJ A;  1TFA A;  2HZK A;  4Q5T A;  1ZU0 A;  5ICQ A;  1N76 A;  3G3G A;  3VLU A;  3TTL A;  2F5X A;  3FXU A;  1PDA A;  1A55 A;  1ATG A;  4DDD A;  3H6U A;  4MLQ A;  3TMG A;  1DTG A;  4LA9 A;  3ILT B;  4G8M A;  1A99 A;  1POY 1;  3CG1 A;  3O6H A;  3A09 A;  1B3E A;  2XXP A;  1YAE A;  1B58 A;  5L9S A;  5DTB A;  5F7V A;  3OSQ A;  2F7C A;  4YMB A;  2A5T B;  4OZ9 A;  3EQ1 A;  3I6V A;  4F1V A;  2FA7 A;  1DPP A;  4QFN A;  4R6Y A;  1KWH A;  1MPC A;  4YB6 A;  3ZS6 A;  1IZ1 A;  4LAT A;  4Q30 B;  2CMO A;  5B70 A;  2V3Q A;  4U1Z A;  4H6D A;  4OQO A;  1OQG A;  3N6U A;  1JW4 A;  4OEV A;  1FQD A;  3E13 X;  4ND9 A;  1SDX A;  3EHS A;  1UQW A;  1A7L A;  2DS9 A;  3N94 A;  2ZNS A;  3U8Q A;  1USY H;  1TXF A;  3K1P A;  2DQV A;  1P1U A;  1BP5 A;  3U1O A;  4LP2 B;  2VHA A;  3U72 A;  1FQC A;  1MPD A;  1YCJ A;  4M4G A;  1SW2 A;  3T22 A;  4M1V A;  3KGC A;  3KN7 A;  1B4Z A;  3BKI B;  1FQB A;  4HW8 A;  2XX7 A;  3PMV A;  3L6H A;  3UP9 A;  4RNS A;  3JV9 A;  3PD8 A;  3E9X A;  5CBS A;  5LOM A;  3BFU A;  2UXA A;  4QFK A;  4IO3 A;  2O7U A;  1LST A;  3G3I A;  1ZIU A;  4H8J A;  3SKP A;  4GXS B;  1JVX A;  2XHD A;  3TCG A;  2DWA A;  3T9H B;  3RT8 A;  3S4U A;  1PBP A;  4PFY A;  2DVC A;  1P99 A;  4WKM A;  3TUS A; 
#chains in the Genus database with same CATH topology
 3KC1 A;  2OWS A;  1NV0 A;  3FIR A;  4DXC A;  3S9M C;  3S9L C;  4XKQ A;  2QJE A;  3RQT A;  3RTW B;  2REJ A;  2OZZ A;  1NV6 A;  1AWB A;  1OIB A;  2Y7I A;  1R6Z A;  2DXR A;  3TEP A;  1OLC A;  4EF2 A;  1MXY A;  2XD2 A;  3C35 A;  1D9Q A;  2QS3 A;  4GWY A;  1A40 A;  1B7Z A;  5KDT B;  4MH5 A;  3IB2 A;  3RLF E;  1MY0 A;  2ZNU A;  3CIJ A;  4P11 A;  4X8R A;  2Y7P A;  4KD5 A;  4POW A;  2X7Q A;  3PPO A;  1XHY A;  5EQA A;  4EXL A;  4H5F A;  4I9D A;  2REG A;  5A5L A;  3U94 A;  3LSW A;  3USD A;  3BFT A;  4E0X A;  4RYA A;  1I6B A;  1JQF A;  1OQH A;  4ELP A;  2UYE A;  4H65 A;  4F2Q A;  5ISU A;  1Q1K A;  5CMM A;  4ZZA A;  3T0J A;  2OBG A;  2HQ0 A;  3PD9 A;  4ZEK A;  2PYY A;  4NMY A;  4X1B A;  4IGT A;  3A3U A;  4NF6 A;  1SYH A;  2V3T A;  4P3L A;  5AA3 A;  3FAS A;  2NWJ A;  1I6A A;  4KCD A;  2DYX A;  1MXV A;  3GBA A;  5A5X B;  1B51 A;  2DE3 A;  4GWU A;  3IR1 A;  3KSJ A;  4KYS A;  2WX9 A;  4ZDM A;  3K00 A;  4PDH A;  5AA4 A;  3TOD A;  5I2N A;  3G3F A;  2PFY A;  3QIM A;  4G68 B;  3FXB A;  3MYU A;  1MY3 A;  4LVQ A;  1D4N A;  2ZZX A;  4FED A;  1J1N A;  3PPR A;  1XC1 A;  1SBP A;  4QXD A;  1UTH B;  4IGR A;  4ZEC A;  1INP A;  1RYX A;  3KZG A;  1B0L A;  5HM4 B;  4OMB A;  4GLI A;  3K1N A;  1QKB A;  2R8T A;  4OHN A;  3THI A;  2XX8 A;  4NF8 A;  3TTR A;  3H6W A;  1Y1M A;  3T9V A;  2Z23 A;  4YKI A;  3MVX A;  3M3K A;  1L5T A;  2QS4 A;  3T93 B;  4C1U A;  1EYJ A;  4GF8 A;  2CZI A;  1US5 A;  4WED A;  5JTY B;  4DXB A;  2HEU A;  2RCB A;  2ONR A;  1FBG A;  3N6T A;  2P3N A;  3IO6 A;  5FHM A;  3OO8 A;  3C4M A;  3FVO A;  2KR0 A;  4OYV A;  5I56 A;  1LBZ A;  1B9J A;  2FYI A;  2F7A A;  1H76 A;  1FJ9 A;  3Q27 A;  3HO7 A;  2WKY A;  1NV3 A;  4IY5 A;  4FJP A;  2O1M A;  1UTB B;  2QRY A;  4ZE8 A;  4R6K A;  2OCU A;  4I3E A;  3MBP A;  4TOZ A;  2YJP A;  4G4P A;  4OAN A;  2LAO A;  3PUY E;  2PVU A;  1Z7N E;  4TLL B;  1Y3N A;  4PP0 A;  4OA4 A;  1TFD A;  4MMP A;  2CEY A;  4MX6 A;  3ZKL A;  3LSX A;  2QS1 A;  1RYO A;  3DP4 A;  3V89 B;  1FPK A;  4R9G A;  1O64 A;  3FUZ A;  1HSL A;  2XXU A;  1O7T A;  2F8D A;  3D1R A;  5BUU A;  4DZ1 A;  4FEC A;  1LBC A;  4PET A;  1JEV A;  3CFZ A;  5FTI A;  3PPN A;  3CHG A;  3H7M A;  2ZNT A;  4MNP A;  5KCJ B;  2D3I A;  2HAV A;  4HCW A;  1MXU A;  4BDO A;  1XT8 A;  1BLF A;  3UN6 A;  1SQY A;  1BIY A;  1B7H A;  1XS5 A;  2F6P A;  2QMW A;  1BKA A;  1LGB C;  1N84 A;  2A5T A;  3G7W A;  5TP9 B;  1DMB A;  3K2D A;  5J16 A;  4RK9 A;  3FD3 A;  4FBP A;  4MJO A;  4MNC A;  3CSB A;  1LLS A;  3G3J A;  2WBD A;  4N8G A;  2O6A A;  5EYG A;  4XTC Q;  5EHS A;  2QVV A;  3KOT A;  4R74 A;  4N13 A;  2WBB A;  1IEJ A;  3LBS A;  2G93 A;  5L9O A;  3C9H A;  3OOA A;  3I5O A;  3GYY A;  2VPO A;  3T9U A;  2RC9 A;  3FXQ A;  1LB8 A;  1IXG A;  1VFE A;  3C36 A;  4XXU A;  2IA4 A;  4LQ2 A;  2RF1 A;  3TFL A;  1PC3 A;  1IMD A;  4FE8 A;  1UIV A;  1I69 A;  4MHF A;  1N0T A;  2VOZ A;  1B5I A;  4H8I A;  3IO4 A;  4GOT A;  4ECF A;  4N81 A;  1NKX A;  4Q8R A;  2VD2 A;  1N3X A;  1SW4 A;  2ABH A;  2AL5 A;  4KYE A;  4GWO A;  3KC0 A;  4N17 A;  1IMB A;  1PEB A;  2I4B A;  1AIV A;  2DE2 A;  4F3B A;  2OWZ A;  2ZYM A;  3HHG A;  3LSL A;  2DWJ A;  1B3F A;  5ET7 A;  3FJ7 A;  2OLB A;  3E3K A;  4EQB A;  4KI0 E;  2Q2C A;  3VXB A;  2Q2A A;  3K6U A;  2FVZ A;  1VR5 A;  3VFJ A;  2VT5 A;  2PX1 A;  1B3H A;  4ZED A;  4FIM A;  4N15 A;  4NED A;  3GXA A;  3OO7 A;  4RPO A;  4PFW A;  3IFC A;  5KDT A;  1T0K A;  1LAH E;  3SET A;  1M5F A;  1H3D A;  1SI0 A;  1LFI A;  2B3F A;  3CI8 A;  2ANJ A;  3VDF A;  4OEU A;  3OO9 A;  4MF3 A;  2I48 A;  4EQ9 A;  4O7M A;  4JDF A;  1NI9 A;  4AS4 A;  3M8U A;  4KPT A;  4C1T A;  1EZO A;  4U21 A;  3LSF B;  5KZT A;  4NN3 A;  1US4 A;  4P9K A;  5I7I A;  4ZEB A;  3IOV A;  1M5B A;  2ONK E;  3SES A;  3ILU B;  4O3A A;  3RTF B;  3SEX A;  5A5X A;  3OD7 A;  5CBR A;  4N6D A;  3B7D A;  3U92 A;  3FJM A;  1MXX A;  3ROJ A;  1QW0 A;  3GBB A;  2HAU A;  3L6G A;  2WYK A;  5I5P A;  3V8X B;  1N04 A;  1B5J A;  1R9L A;  2HFB A;  2V93 A;  3B6W A;  4G68 A;  3O66 A;  2O69 A;  3RPL A;  4FEB A;  3MVZ A;  3KBR A;  5ITP A;  3LC8 A;  1ZJL A;  4RXL A;  5I2K B;  1FTA A;  2Q8J A;  3IB0 A;  4OFJ A;  4JWY A;  3DP8 A;  2I0C A;  4DCX A;  2PFZ A;  4IO7 A;  4ISU A;  2PBW A;  3RT6 B;  3T96 B;  1MDQ A;  1LCT A;  3Q28 A;  1HSJ A;  5CMK A;  3E4R A;  4HCY A;  3QK6 A;  2HXW A;  1CNQ A;  1NFT A;  2XXX A;  4YZZ A;  4ESX A;  5B7D A;  4P1E A;  4NF5 A;  2FNC A;  5IZ3 B;  1FPI A;  1IXC A;  1FBP A;  1VSO A;  5DEX B;  1FJ6 A;  5I58 B;  2DE4 A;  3KJ7 A;  1YYZ A;  3I3V A;  4GL8 A;  4I40 A;  3TCF A;  5JK4 A;  2M8C A;  1NH8 A;  1P1O A;  3N26 A;  2X7P A;  4DI3 D;  2Z8F A;  1XVX A;  1NNP A;  2O84 X;  4F3P A;  2QMX A;  3EKI A;  1Y20 A;  1IXI A;  2QL3 A;  4WXJ A;  4N07 A;  2XA5 A;  4PQJ A;  2O1L A;  5I57 A;  2Z8E A;  3MUQ A;  2MKZ A;  1A54 A;  3GLB A;  4BDR A;  3PV0 E;  5K2X A;  5BWJ A;  1FPL A;  4QSD A;  3DEL B;  1FBE A;  2QS2 A;  1I6Q A;  2P2A A;  3FJG A;  3MP8 A;  2B4M A;  2XXW A;  4R72 A;  2H99 A;  3S9E A;  5ET5 A;  1ANF A;  4GVO A;  5LDZ A;  5EYH A;  4EDP A;  3B8B A;  4YMA A;  4JVI A;  4H0W A;  4R75 A;  4HXV A;  4LON B;  3PUZ E;  2CZH A;  3IOW A;  1S9T A;  4QF9 A;  4P1L A;  4ZZE A;  4DE8 A;  4PAF A;  3SEV A;  3IJO B;  4R2F A;  2P1S A;  4PFB A;  3O97 A;  4IO5 A;  5L8D A;  1LBW A;  3O6G A;  5KCJ A;  2VGQ A;  3OSR A;  4PC9 A;  3TPA A;  2GRV A;  3BIH A;  4JSD A;  1N7W A;  2DVZ A;  3IK6 B;  2ZZV A;  4OWD A;  1Q35 A;  2F34 A;  1JNF A;  5CI5 A;  2P0S A;  2Q9T A;  4N6K A;  3H6V A;  3VVE A;  2H9B A;  4GX6 A;  3TAJ A;  4U1O A;  5H8Q B;  1D3K A;  3DLN A;  3TTM A;  4U2R A;  3TTK A;  4Z0I A;  4F18 A;  3S2V A;  1CB6 A;  4GWX A;  3MVY A;  4JSO A;  5I84 A;  2YLN A;  2L5V A;  2X26 A;  1H45 A;  3PGF A;  5AA2 D;  1FPE A;  2XXY A;  1R9Q A;  3QUJ A;  1MQH A;  4H46 A;  1EYK A;  1QUK A;  4O7I A;  4G8N A;  2E1S A;  4OFO A;  4PTK A;  3T66 A;  3ODB A;  2Q89 A;  1SW1 A;  1MXW A;  2OJT A;  4ELQ A;  4QHQ A;  3RNN A;  1YXI A;  4ZEF A;  1B3L A;  1II5 A;  2F97 A;  3RN8 A;  3B6Q A;  3R6U A;  4YU0 A;  5ELV A;  3CG3 A;  4ELO A;  4NAP A;  4AQ4 A;  3C31 A;  3K02 A;  2DOJ A;  2PMS A;  5IGA A;  1B32 A;  3KOS A;  1SD3 A;  1RDZ A;  2HHM A;  1FBC A;  2F6G A;  3O9P A;  2Y7R A;  4HTG A;  1Y1Z A;  4NX1 A;  1POT A;  4JXI A;  4PFR A;  3BBR A;  4BDN A;  1FTM A;  3M3L A;  4IY6 A;  5F24 A;  4MFI A;  3CFX A;  3SEW A;  5CRY A;  3LV0 A;  1M5D A;  4JWO A;  4EF1 A;  1IIW A;  4E0W A;  3K6V A;  2NOO A;  4AB5 A;  4P47 A;  5AA1 A;  2UVJ A;  1LFG A;  5DVJ A;  1K9Z A;  2DWI A;  4RA1 A;  4NWC A;  1IMA A;  3K6W A;  3TQL A;  3PTY A;  3K4U A;  2Z22 A;  3NOH A;  5L9M A;  4ESW A;  2AIX A;  3CFL A;  3SDF A;  3KG2 A;  1LBV A;  4LUB A;  4OEN A;  3SZP A;  2GHA A;  1GGG A;  4LZ8 A;  1EZ9 A;  1NNF A;  1IQ7 A;  5IZ1 A;  4PFT A;  4XIG Q;  1ZLQ A;  3CR9 A;  1FPG A;  1JW1 A;  4NQ8 A;  1JW5 A;  1Y9U A;  4R9F A;  4NHB A;  2E0S A;  3H4Z A;  4HE0 A;  2VPN A;  1QVS A;  3UA8 A;  4QSC A;  2ZMB A;  4X9T A;  3N5L A;  3ECR A;  5AE4 A;  1FTJ A;  2R6G E;  1MY1 A;  2DP8 A;  3MW0 A;  4GX4 A;  3IL1 B;  1PB9 A;  4NF6 B;  3FV2 A;  4I3Y A;  4F31 B;  1MY2 A;  4PE3 A;  3MJN A;  3CVG A;  1CE2 A;  1N7X A;  1FBD A;  2H98 A;  1FQF A;  1FW0 A;  4IO2 A;  3SEY A;  4PCD A;  1MQG A;  2QVU A;  3O29 A;  1F9B A;  3ZSF A;  1NMU A;  5CMB A;  3M3F A;  3WAF A;  2Y84 A;  5CC2 A;  2KLF A;  3SEU A;  1MM6 A;  4PBH A;  2F35 A;  1M5C A;  4NG7 A;  3MWB A;  2CZL A;  3C33 A;  4TLM B;  2YPN A;  3O28 A;  4G68 C;  4OVT A;  4H1X A;  3G3K A;  5FTH A;  4Z7E A;  4GL0 A;  1BK4 A;  4IO6 A;  1B5H A;  2XWO A;  1NNK A;  1GTK A;  4OVP A;  5LTC A;  5DVI A;  5AA2 B;  4XF5 A;  3IB1 A;  5ET6 A;  4IR8 A;  1NUZ A;  5ICT A;  4MEV A;  3P7I A;  5IZ3 A;  3PUX E;  5I59 B;  3UOR A;  3ISP A;  3PUV E;  5I58 A;  4G2Z A;  4EQ7 A;  1B3G A;  1FBF A;  4H67 A;  3MPL A;  2B4L A;  2XWI A;  1IMF A;  4I1D A;  3VE1 B;  3D4G A;  4GXA A;  2THI A;  2F3B A;  4C0R A;  2Q88 A;  3H06 B;  3QSL A;  4DXU A;  2FBP A;  4X1D A;  4GX3 A;  4GWZ A;  3UIF A;  4ZS9 A;  2XX9 A;  2PT1 A;  3Q26 A;  4FAJ A;  2P3V A;  1NL5 A;  4BDQ A;  3FV1 A;  2ZXT A;  1JVY A;  3FXR A;  5I56 B;  4F1U A;  4ZEI A;  1SVX B;  2H25 A;  2B3B A;  2R9J A;  1Y3Q A;  4TQU Q;  2I0B A;  3GZG A;  4K3F A;  1FQA A;  1G0H A;  1Y4C A;  4Q0C A;  5HPQ A;  1BTJ A;  1B1X A;  3E79 A;  4MAG A;  4KXP A;  1NV4 A;  2F3D A;  3H03 A;  4QRZ A;  2XD3 A;  1FPF A;  1QJM A;  5M2V A;  3CRB A;  5K2Y A;  1LAX A;  4O3C A;  1KA0 A;  4BDM A;  5DT6 A;  4YAH X;  1IUD A;  5CMC A;  4N91 A;  3KSX A;  2HPG A;  4NTL A;  1N3W A;  4WEP A;  4F39 A;  1PBQ A;  3T9X B;  2Y5L A;  4HE2 A;  1MS7 A;  5T3J A;  4EXK A;  2I58 A;  4YKP A;  4PFI A;  2RKM A;  5F1Q A;  4O8M A;  3CSG A;  3WAE A;  4DIG A;  4NGU A;  2NUV A;  5H8Q A;  3UK4 A;  3OEN A;  3MPK A;  2ZYK A;  4G8H A;  4ZE9 A;  3W9V A;  1TT1 A;  4NF4 B;  4GD5 A;  4FAT A;  1B6H A;  4F3S A;  2I6E A;  4F3G A;  4PBQ A;  2Y7W A;  1MPB A;  1LAG E;  4OXV A;  5H8S A;  3Q25 A;  2F36 A;  1URS A;  4QFP A;  3W15 C;  5JEI A;  5ET8 A;  5FBP A;  2Z8D A;  3FVG A;  1DBZ A;  4UAC A;  1UTH A;  1TWY A;  3MZ1 A;  1WOD A;  3F11 A;  1IIT A;  1FPD A;  4XKR A;  1GV8 A;  5H8N B;  4OVS A;  4U23 A;  3U93 A;  2XXK A;  2HZL A;  1PB7 A;  3VXC A;  4PAI A;  3EPE A;  1XI6 A;  1MQD A;  4BLA A;  5IM2 A;  2Y7K A;  1S50 A;  3TKD A;  1QUJ A;  3H3G A;  3MAM A;  3KBZ A;  5H8H B;  1ZBM A;  2RCA A;  4KFQ A;  5JTY A;  4FOR A;  1EZP A;  2DXY A;  4YKK A;  5H8F B;  4DI4 B;  4O3B A;  2AL4 A;  1P1W A;  4F19 A;  4F22 A;  1DSN A;  4XFE A;  4RK2 A;  2A5S A;  4XEQ A;  1B52 A;  2ESN A;  1MH3 A;  1HSE A;  4H5G A;  2ZYO A;  2QPQ A;  3IAZ A;  4F2O A;  1NV5 A;  4MNI A;  4OVQ A;  2NXO A;  4JB7 A;  4XKP A;  1USY E;  1FTK A;  1UTB A;  5TPA B;  1MQJ A;  4UA8 A;  2I49 A;  3MST A;  1WVJ A;  1Z7M E;  2PCR A;  5TU0 A;  5J1D A;  1KA1 A;  3MP1 A;  3ZKK A;  4OET A;  3TTN A;  2HCA A;  1B05 A;  4YKJ A;  4UAB A;  3QYT A;  4MBP A;  2OK2 A;  4P8B A;  1MH4 A;  2O68 A;  4KR5 A;  1FQE A;  2V3U A;  4KCC A;  2G29 A;  5EYF A;  3HHF A;  1G0I A;  2D5W A;  3HV1 A;  5IKB A;  2VP1 A;  1LB9 A;  1DK4 A;  1ZKB A;  3C32 A;  4PGN A;  1AMF A;  3S9N C;  3W9W A;  1RDY A;  3AXF A;  4QSE A;  2QFL A;  1VE4 A;  4DCY A;  3E78 A;  3OEL A;  4HE1 A;  2OWT A;  2OX3 A;  2V25 A;  4QBA A;  1VDW A;  4R2B A;  5DYH A;  1P1N A;  1P1Q A;  1MXZ A;  1FRP A;  2XXQ A;  1MG1 A;  1NNT A;  1IXH A;  2BJJ X;  3FGS A;  4RJZ A;  5TP9 A;  1IMC A;  1GR2 A;  4P0I A;  3DM0 A;  3FVN A;  3TQW A;  5EQ8 A;  4OVR A;  4HS7 A;  3QAX A;  3H6T A;  1JET A;  4L17 A;  1MDP 1;  3A3C A;  2ONS A;  1LBY A;  3IFA A;  4YIC A;  2CZK A;  5CM6 A;  4YB7 A;  3IOU A;  4R73 A;  1Y3P A;  1MM7 A;  2XXH A;  1LEV A;  4NE4 A;  4BDL A;  1JEU A;  4EUO A;  4ONY A;  4G77 A;  2JJK A;  3PU5 A;  2WYP A;  3VLW A;  5HBC A;  4OFL A;  2UVH A;  1UIU A;  1VFD A;  1DCU A;  4R6H A;  3RPL B;  1SW5 A;  5EQ9 A;  3LR1 A;  2O7I A;  3KJT A;  1O63 A;  2QSX A;  3KEI A;  2W7Y A;  1FCK A;  1GVC A;  5AA2 A;  2I4C A;  2PT2 A;  4NWD A;  3B6T A;  3O6I A;  1XVY A;  5I59 A;  3IOT A;  4JBZ A;  2V4C A;  3PPQ A;  4P56 A;  4F1Y A;  3ONM A;  1ELJ A;  1FBH A;  4X48 A;  3QXM A;  4NF5 B;  3MZB A;  2CEX A;  1MY4 A;  5DW8 A;  1NUW A;  4PF6 A;  3KN8 A;  4PAK A;  1PB8 A;  1FTO A;  2IEE A;  1DPE A;  3EHU A;  2V84 A;  3VV5 A;  3HFU A;  1OLA A;  4QFO A;  3HN0 A;  1YPN A;  4GWW A;  1S7Y A;  2KQZ A;  1URG A;  3TZA A;  2ALU A;  3EN3 A;  4PGP A;  5IZZ A;  2H4I A;  3FVK A;  3C34 A;  3SER A;  3QUF A;  4LZ5 A;  3RPW A;  3MC2 A;  5I57 B;  1EU8 A;  4IO4 A;  3LUZ A;  3OMB A;  4AB6 A;  4GFR A;  3VLV A;  3D4C A;  4PDD A;  4PF8 A;  1WDN A;  2RIN A;  1XOC A;  5DVF A;  1M5E A;  1B7U A;  1LAF E;  1LFH A;  4XKN A;  4KHZ E;  4PE5 B;  2XXT A;  4LQ5 A;  2D21 A;  3G3H A;  3OXN A;  1ZTY A;  3K01 A;  3FZV A;  2NVU B;  3RYD A;  1K9Y A;  3MQ9 A;  4GQO A;  4U4S A;  3VVD A;  1NUY A;  1FPJ A;  3R7X A;  4THI A;  1D9Y A;  3RGY A;  1AH5 A;  3R26 A;  4JVD A;  3PMW A;  3T1B A;  4MLV A;  3IX1 A;  3KN3 A;  3PMX A;  1H44 A;  1B40 A;  3KFM A;  2GFE A;  2WEF A;  3K6X A;  2XWK A;  4KQP A;  4PFU A;  1NH7 A;  4OTE A;  4LZ7 A;  2AYS A;  4JWX A;  4O94 A;  4GIZ A;  4U22 A;  4AS5 A;  4NF4 A;  3V83 A;  1D9V A;  4OVJ A;  2ZYN A;  5FHO A;  1QUI A;  1IME A;  1B0H A;  2XXV A;  4P0G A;  3PUW E;  1MRP A;  5AA4 B;  3Q29 A;  2F7B A;  4GBW A;  3TEL A;  2R71 A;  5I2K A;  5I2N B;  2UYF A;  5EQ7 A;  1OVB A;  2H5Y A;  3LUY A;  3RUM A;  1YZ0 A;  3MP6 A;  2DSF A;  4G61 A;  2B65 A;  1AL3 A;  2VD3 A;  5H8N A;  1OMP A;  2RC7 A;  1SI1 A;  4OES A;  2ZZW A;  2DDK A;  1FPB A;  2F78 A;  1JP4 A;  4GRK A;  1EH3 A;  3K0V A;  3IOR A;  4X04 A;  2Q8M A;  1SYI A;  4U4X A;  4RY1 A;  2RC8 A;  5ESY A;  4I62 A;  5H8H A;  4QFL A;  4DLD A;  3HPI A;  4NF8 B;  4ELR A;  3O2A A;  4I8C A;  3EHT A;  3OO6 A;  1H43 A;  1ZMG A;  5DEX A;  5H8F A;  2I3V A;  2UVI A;  3FAT A;  3OEK A;  1FTL A;  1DOT A;  4N4U A;  3EF7 A;  4KYD A;  1LBX A;  1LCF A;  3HCQ A;  1QUL A;  3MVW A;  4IB2 A;  4OER A;  1RKM A;  2UVG A;  5ITO A;  1Y4T A;  5FHN A;  1OVT A;  1A8F A;  4YB5 A;  3OEM A;  5EHM A;  2DWH A;  5TPA A;  1FSA A;  3IJX B;  2I3W A;  1B2H A;  4RPN A;  2FIX A;  4GBV A;  5IAI A;  2QVR A;  4N6P A;  1URD A;  3K1M A;  1B46 A;  1QKA A;  4H45 A;  3RY3 A;  3MZ9 A;  2XXR A;  2XXI A;  3JZJ A;  1AOV A;  1Q9D A;  1SPI A;  4POX A;  1A8E A;  5I3S A;  3TYH A;  2GH9 A;  1MQI A;  3PPP A;  3TCH A;  1B4H A;  1R1N A;  1DTZ A;  3V5A A;  3VVF A;  2XWV A;  3JYR A;  4F29 A;  2O51 A;  1YTV A;  2GHB A;  3UGW A;  1B1H A;  1LBB A;  3HST A;  3DP6 A;  3TDJ A;  4N8Y A;  1TFA A;  2HZK A;  4Q5T A;  1ZU0 A;  2Q74 A;  5ICQ A;  1N76 A;  3G3G A;  3VLU A;  3TTL A;  2F5X A;  1RDX A;  1KZ8 A;  1PDA A;  3FXU A;  1A55 A;  1ATG A;  3QMF A;  4DDD A;  2GQ1 A;  3H6U A;  2Y5K A;  4MLQ A;  3TMG A;  1DTG A;  4LA9 A;  3ILT B;  4G8M A;  1A99 A;  1POY 1;  3CG1 A;  3O6H A;  3A09 A;  1B3E A;  2XXP A;  1YAE A;  2BJI A;  1B58 A;  5L9S A;  5DTB A;  5F7V A;  3OSQ A;  1NUX A;  2F7C A;  4YMB A;  2FIE A;  1NV7 A;  2A5T B;  4OZ9 A;  3EQ1 A;  3I6V A;  4F1V A;  2FA7 A;  1DPP A;  4QFN A;  4R6Y A;  1KWH A;  1MPC A;  4YB6 A;  3ZS6 A;  1IZ1 A;  4LAT A;  4Q30 B;  2CMO A;  5B70 A;  2V3Q A;  4U1Z A;  4GWS A;  4H6D A;  4OQO A;  3B50 A;  1OQG A;  3N6U A;  1JW4 A;  4OEV A;  1FQD A;  3FBP A;  3E13 X;  4ND9 A;  3A29 A;  1SDX A;  3EHS A;  1UQW A;  1A7L A;  2HXR A;  2DS9 A;  3BIG A;  3N94 A;  2ZNS A;  4LN5 A;  1USY H;  1TXF A;  3K1P A;  4MCO A;  3U8Q A;  2DQV A;  1P1U A;  1NV1 A;  4MIJ A;  1BP5 A;  3U1O A;  4LP2 B;  2VHA A;  3U72 A;  1FQC A;  1MPD A;  1YCJ A;  4M4G A;  1SW2 A;  3T22 A;  4M1V A;  3KGC A;  3KN7 A;  1B4Z A;  3BKI B;  1FQB A;  4HW8 A;  2XX7 A;  3PMV A;  3L6H A;  3UP9 A;  1NV2 A;  4RNS A;  1QGX A;  3JV9 A;  3PD8 A;  4JVC A;  3E9X A;  5CBS A;  5LOM A;  3BFU A;  2UXA A;  4QFK A;  4IO3 A;  2O7U A;  1LST A;  3G3I A;  1ZIU A;  4H8J A;  4GXS B;  3SKP A;  1JVX A;  2XHD A;  3TCG A;  1EYI A;  2DWA A;  4NF0 A;  3T9H B;  3U65 A;  3RT8 A;  3S4U A;  1PBP A;  4PFY A;  2FHY A;  2DVC A;  1P99 A;  4WKM A;  3TUS A; 
#chains in the Genus database with same CATH homology
 3KC1 A;  2OWS A;  3FIR A;  4DXC A;  3S9M C;  3S9L C;  1NV0 A;  4XKQ A;  2QJE A;  3RQT A;  3RTW B;  2REJ A;  2OZZ A;  1NV6 A;  1AWB A;  1OIB A;  2Y7I A;  1R6Z A;  2DXR A;  3TEP A;  1OLC A;  4EF2 A;  1MXY A;  2XD2 A;  3C35 A;  1D9Q A;  2QS3 A;  4GWY A;  1A40 A;  1B7Z A;  5KDT B;  4MH5 A;  3IB2 A;  3RLF E;  1MY0 A;  2ZNU A;  3CIJ A;  4P11 A;  4X8R A;  2Y7P A;  4KD5 A;  4POW A;  2X7Q A;  3PPO A;  1XHY A;  5EQA A;  4EXL A;  4H5F A;  4I9D A;  2REG A;  5A5L A;  3U94 A;  3LSW A;  3USD A;  3BFT A;  4E0X A;  4RYA A;  1I6B A;  1JQF A;  1OQH A;  4ELP A;  2UYE A;  4H65 A;  4F2Q A;  5ISU A;  1Q1K A;  5CMM A;  4ZZA A;  3T0J A;  2OBG A;  2HQ0 A;  3PD9 A;  4ZEK A;  2PYY A;  4NMY A;  4X1B A;  4IGT A;  3A3U A;  4NF6 A;  1SYH A;  2V3T A;  4P3L A;  5AA3 A;  3FAS A;  2NWJ A;  1I6A A;  4KCD A;  2DYX A;  1MXV A;  3GBA A;  5A5X B;  1B51 A;  2DE3 A;  4GWU A;  3IR1 A;  3KSJ A;  4KYS A;  2WX9 A;  4ZDM A;  3K00 A;  4PDH A;  5AA4 A;  3TOD A;  5I2N A;  3G3F A;  2PFY A;  3QIM A;  4G68 B;  3FXB A;  3MYU A;  1MY3 A;  4LVQ A;  1D4N A;  2ZZX A;  4FED A;  1J1N A;  3PPR A;  1XC1 A;  1SBP A;  4QXD A;  1UTH B;  4IGR A;  4ZEC A;  1INP A;  1RYX A;  3KZG A;  1B0L A;  5HM4 B;  4OMB A;  4GLI A;  3K1N A;  1QKB A;  2R8T A;  4OHN A;  3THI A;  2XX8 A;  4NF8 A;  3TTR A;  3H6W A;  1Y1M A;  3T9V A;  2Z23 A;  4YKI A;  3MVX A;  3M3K A;  1L5T A;  2QS4 A;  3T93 B;  4C1U A;  1EYJ A;  4GF8 A;  4WED A;  1US5 A;  2CZI A;  5JTY B;  4DXB A;  2HEU A;  2RCB A;  2ONR A;  1FBG A;  3N6T A;  2P3N A;  3IO6 A;  5FHM A;  3OO8 A;  3C4M A;  3FVO A;  4OYV A;  2KR0 A;  5I56 A;  1LBZ A;  1B9J A;  2FYI A;  2F7A A;  1H76 A;  3Q27 A;  1FJ9 A;  3HO7 A;  2WKY A;  1NV3 A;  4IY5 A;  4FJP A;  2O1M A;  1UTB B;  2QRY A;  4ZE8 A;  4R6K A;  2OCU A;  4I3E A;  3MBP A;  4TOZ A;  2YJP A;  4G4P A;  4OAN A;  2LAO A;  3PUY E;  2PVU A;  1Z7N E;  4TLL B;  1Y3N A;  4PP0 A;  4OA4 A;  1TFD A;  4MMP A;  2CEY A;  4MX6 A;  3ZKL A;  3LSX A;  2QS1 A;  1RYO A;  3DP4 A;  3V89 B;  4R9G A;  1FPK A;  1O64 A;  3FUZ A;  1HSL A;  2XXU A;  1O7T A;  2F8D A;  3D1R A;  5BUU A;  4DZ1 A;  4FEC A;  1LBC A;  4PET A;  1JEV A;  3CFZ A;  5FTI A;  3PPN A;  3CHG A;  3H7M A;  2ZNT A;  4MNP A;  5KCJ B;  2D3I A;  2HAV A;  4HCW A;  1MXU A;  4BDO A;  1XT8 A;  1BLF A;  3UN6 A;  1SQY A;  1BIY A;  1B7H A;  1XS5 A;  2F6P A;  2QMW A;  1BKA A;  1LGB C;  1N84 A;  2A5T A;  3G7W A;  5TP9 B;  1DMB A;  3K2D A;  5J16 A;  4RK9 A;  3FD3 A;  4FBP A;  4MJO A;  4MNC A;  3CSB A;  1LLS A;  3G3J A;  2WBD A;  4N8G A;  2O6A A;  5EYG A;  4XTC Q;  5EHS A;  2QVV A;  3KOT A;  4R74 A;  4N13 A;  2WBB A;  1IEJ A;  3LBS A;  2G93 A;  5L9O A;  3C9H A;  3OOA A;  3I5O A;  3GYY A;  2VPO A;  3T9U A;  2RC9 A;  3FXQ A;  1LB8 A;  1IXG A;  1VFE A;  3C36 A;  4XXU A;  2IA4 A;  4LQ2 A;  2RF1 A;  3TFL A;  1PC3 A;  1IMD A;  4FE8 A;  1UIV A;  1I69 A;  4MHF A;  1N0T A;  2VOZ A;  1B5I A;  4H8I A;  3IO4 A;  4GOT A;  4ECF A;  4N81 A;  1NKX A;  4Q8R A;  2VD2 A;  1N3X A;  1SW4 A;  2ABH A;  2AL5 A;  4KYE A;  4GWO A;  3KC0 A;  4N17 A;  1IMB A;  1PEB A;  2I4B A;  1AIV A;  2DE2 A;  4F3B A;  2OWZ A;  2ZYM A;  3HHG A;  3LSL A;  2DWJ A;  1B3F A;  5ET7 A;  3FJ7 A;  2OLB A;  3E3K A;  4EQB A;  4KI0 E;  2Q2C A;  3VXB A;  2Q2A A;  3K6U A;  2FVZ A;  1VR5 A;  3VFJ A;  2VT5 A;  2PX1 A;  1B3H A;  4ZED A;  4FIM A;  4N15 A;  4NED A;  3GXA A;  3OO7 A;  4RPO A;  4PFW A;  5KDT A;  3IFC A;  1T0K A;  1LAH E;  3SET A;  1M5F A;  1H3D A;  1SI0 A;  1LFI A;  2B3F A;  3CI8 A;  2ANJ A;  3VDF A;  4OEU A;  3OO9 A;  4MF3 A;  2I48 A;  4EQ9 A;  4O7M A;  4JDF A;  1NI9 A;  4AS4 A;  3M8U A;  4KPT A;  4C1T A;  1EZO A;  4U21 A;  3LSF B;  5KZT A;  4NN3 A;  1US4 A;  4P9K A;  5I7I A;  4ZEB A;  3IOV A;  1M5B A;  2ONK E;  3SES A;  3ILU B;  4O3A A;  3RTF B;  3SEX A;  5A5X A;  3OD7 A;  5CBR A;  4N6D A;  3B7D A;  3U92 A;  3FJM A;  1MXX A;  3ROJ A;  1QW0 A;  3GBB A;  2HAU A;  3L6G A;  2WYK A;  5I5P A;  3V8X B;  1N04 A;  1B5J A;  1R9L A;  2HFB A;  2V93 A;  3B6W A;  4G68 A;  3O66 A;  2O69 A;  3RPL A;  4FEB A;  3MVZ A;  3KBR A;  5ITP A;  3LC8 A;  1ZJL A;  4RXL A;  5I2K B;  1FTA A;  2Q8J A;  3IB0 A;  4OFJ A;  4JWY A;  3DP8 A;  2I0C A;  4DCX A;  2PFZ A;  4IO7 A;  4ISU A;  2PBW A;  3RT6 B;  3T96 B;  1MDQ A;  1LCT A;  3Q28 A;  1HSJ A;  5CMK A;  3E4R A;  4HCY A;  3QK6 A;  2HXW A;  1NFT A;  2XXX A;  4YZZ A;  4ESX A;  1CNQ A;  5B7D A;  4P1E A;  4NF5 A;  2FNC A;  5IZ3 B;  1FPI A;  1IXC A;  1FBP A;  1VSO A;  5DEX B;  5I58 B;  1FJ6 A;  2DE4 A;  3KJ7 A;  1YYZ A;  3I3V A;  4GL8 A;  4I40 A;  3TCF A;  5JK4 A;  2M8C A;  1NH8 A;  1P1O A;  3N26 A;  2X7P A;  4DI3 D;  2Z8F A;  1XVX A;  1NNP A;  2O84 X;  4F3P A;  2QMX A;  3EKI A;  1Y20 A;  1IXI A;  2QL3 A;  4WXJ A;  4N07 A;  2XA5 A;  4PQJ A;  2O1L A;  5I57 A;  2Z8E A;  3MUQ A;  2MKZ A;  1A54 A;  3GLB A;  4BDR A;  3PV0 E;  5K2X A;  5BWJ A;  1FPL A;  4QSD A;  3DEL B;  1FBE A;  2QS2 A;  1I6Q A;  2P2A A;  3FJG A;  3MP8 A;  2B4M A;  2XXW A;  4R72 A;  2H99 A;  3S9E A;  5ET5 A;  1ANF A;  4GVO A;  5LDZ A;  5EYH A;  4EDP A;  3B8B A;  4YMA A;  4JVI A;  4H0W A;  4R75 A;  4HXV A;  4LON B;  3PUZ E;  2CZH A;  3IOW A;  1S9T A;  4QF9 A;  4P1L A;  4ZZE A;  4DE8 A;  4PAF A;  3SEV A;  3IJO B;  4R2F A;  2P1S A;  4PFB A;  3O97 A;  4IO5 A;  5L8D A;  3O6G A;  5KCJ A;  1LBW A;  2VGQ A;  3OSR A;  3TPA A;  4PC9 A;  2GRV A;  3BIH A;  4JSD A;  1N7W A;  2DVZ A;  3IK6 B;  2ZZV A;  4OWD A;  1Q35 A;  2F34 A;  1JNF A;  5CI5 A;  2P0S A;  2Q9T A;  4N6K A;  3H6V A;  3VVE A;  2H9B A;  4GX6 A;  3TAJ A;  4U1O A;  5H8Q B;  1D3K A;  3DLN A;  3TTM A;  4U2R A;  3TTK A;  4Z0I A;  4F18 A;  3S2V A;  1CB6 A;  4GWX A;  3MVY A;  4JSO A;  5I84 A;  2YLN A;  2L5V A;  2X26 A;  1H45 A;  3PGF A;  5AA2 D;  2XXY A;  1FPE A;  1R9Q A;  3QUJ A;  1MQH A;  4H46 A;  1EYK A;  1QUK A;  4O7I A;  4G8N A;  2E1S A;  4OFO A;  4PTK A;  3T66 A;  3ODB A;  2Q89 A;  1SW1 A;  1MXW A;  2OJT A;  4ELQ A;  4QHQ A;  3RNN A;  1YXI A;  4ZEF A;  1B3L A;  1II5 A;  2F97 A;  3RN8 A;  3B6Q A;  3R6U A;  4YU0 A;  5ELV A;  3CG3 A;  4ELO A;  4NAP A;  4AQ4 A;  3C31 A;  3K02 A;  2DOJ A;  2PMS A;  5IGA A;  1B32 A;  3KOS A;  1SD3 A;  1RDZ A;  2HHM A;  1FBC A;  2F6G A;  3O9P A;  2Y7R A;  4HTG A;  1Y1Z A;  4NX1 A;  1POT A;  4JXI A;  4PFR A;  3BBR A;  4BDN A;  1FTM A;  3M3L A;  4IY6 A;  5F24 A;  4MFI A;  3CFX A;  3SEW A;  5CRY A;  3LV0 A;  1M5D A;  4JWO A;  4EF1 A;  1IIW A;  4E0W A;  3K6V A;  2NOO A;  4AB5 A;  4P47 A;  5AA1 A;  2UVJ A;  1LFG A;  5DVJ A;  1K9Z A;  2DWI A;  4RA1 A;  4NWC A;  1IMA A;  3K6W A;  3TQL A;  3PTY A;  3K4U A;  2Z22 A;  3NOH A;  5L9M A;  4ESW A;  2AIX A;  3CFL A;  3SDF A;  3KG2 A;  1LBV A;  4LUB A;  4OEN A;  3SZP A;  2GHA A;  1GGG A;  4LZ8 A;  1EZ9 A;  1NNF A;  1IQ7 A;  5IZ1 A;  4PFT A;  4XIG Q;  1ZLQ A;  3CR9 A;  1FPG A;  1JW1 A;  4NQ8 A;  1JW5 A;  1Y9U A;  4R9F A;  4NHB A;  2E0S A;  3H4Z A;  4HE0 A;  2VPN A;  1QVS A;  3UA8 A;  4QSC A;  2ZMB A;  4X9T A;  3N5L A;  3ECR A;  5AE4 A;  1FTJ A;  2R6G E;  1MY1 A;  2DP8 A;  3MW0 A;  4GX4 A;  3IL1 B;  1PB9 A;  4NF6 B;  3FV2 A;  4I3Y A;  4F31 B;  1MY2 A;  4PE3 A;  3MJN A;  3CVG A;  1CE2 A;  1N7X A;  1FBD A;  2H98 A;  1FQF A;  1FW0 A;  4IO2 A;  3SEY A;  4PCD A;  1MQG A;  3ZSF A;  3O29 A;  1F9B A;  2QVU A;  1NMU A;  5CMB A;  3M3F A;  3WAF A;  2Y84 A;  5CC2 A;  2KLF A;  3SEU A;  1MM6 A;  4PBH A;  2F35 A;  1M5C A;  4NG7 A;  3MWB A;  2CZL A;  3C33 A;  4TLM B;  2YPN A;  3O28 A;  4G68 C;  4OVT A;  4H1X A;  3G3K A;  5FTH A;  4Z7E A;  4GL0 A;  1BK4 A;  4IO6 A;  1B5H A;  2XWO A;  1NNK A;  1GTK A;  4OVP A;  5LTC A;  5DVI A;  5AA2 B;  4XF5 A;  3IB1 A;  5ET6 A;  4IR8 A;  1NUZ A;  5ICT A;  4MEV A;  3P7I A;  5IZ3 A;  3PUX E;  5I59 B;  3UOR A;  3ISP A;  3PUV E;  5I58 A;  4G2Z A;  4EQ7 A;  1B3G A;  1FBF A;  4H67 A;  3MPL A;  2B4L A;  2XWI A;  1IMF A;  4I1D A;  3VE1 B;  3D4G A;  4GXA A;  2THI A;  4C0R A;  2F3B A;  2Q88 A;  3H06 B;  3QSL A;  4DXU A;  2FBP A;  4X1D A;  4GX3 A;  4GWZ A;  3UIF A;  4ZS9 A;  2XX9 A;  2PT1 A;  3Q26 A;  4FAJ A;  2P3V A;  1NL5 A;  4BDQ A;  3FV1 A;  2ZXT A;  1JVY A;  3FXR A;  5I56 B;  4F1U A;  4ZEI A;  1SVX B;  2H25 A;  2B3B A;  2R9J A;  1Y3Q A;  4TQU Q;  2I0B A;  3GZG A;  4K3F A;  1FQA A;  1G0H A;  1Y4C A;  4Q0C A;  5HPQ A;  1BTJ A;  1B1X A;  3E79 A;  4MAG A;  4KXP A;  1NV4 A;  2F3D A;  3H03 A;  4QRZ A;  2XD3 A;  1FPF A;  1QJM A;  5M2V A;  3CRB A;  5K2Y A;  1LAX A;  4O3C A;  1KA0 A;  4BDM A;  5DT6 A;  4YAH X;  1IUD A;  5CMC A;  4N91 A;  3KSX A;  2HPG A;  4NTL A;  1N3W A;  4WEP A;  4F39 A;  1PBQ A;  3T9X B;  2Y5L A;  4HE2 A;  1MS7 A;  5T3J A;  4EXK A;  2I58 A;  4YKP A;  4PFI A;  2RKM A;  5F1Q A;  4O8M A;  3CSG A;  3WAE A;  4DIG A;  4NGU A;  2NUV A;  5H8Q A;  3UK4 A;  3OEN A;  3MPK A;  2ZYK A;  4G8H A;  4ZE9 A;  3W9V A;  1TT1 A;  4NF4 B;  4GD5 A;  4FAT A;  4F3S A;  1B6H A;  2I6E A;  4F3G A;  4PBQ A;  2Y7W A;  1MPB A;  1LAG E;  4OXV A;  5H8S A;  3Q25 A;  2F36 A;  1URS A;  4QFP A;  3W15 C;  5JEI A;  5ET8 A;  5FBP A;  2Z8D A;  3FVG A;  1DBZ A;  4UAC A;  1UTH A;  1TWY A;  3MZ1 A;  1WOD A;  3F11 A;  1IIT A;  1FPD A;  4XKR A;  1GV8 A;  5H8N B;  4OVS A;  4U23 A;  3U93 A;  2XXK A;  2HZL A;  1PB7 A;  3VXC A;  4PAI A;  3EPE A;  1XI6 A;  1MQD A;  4BLA A;  5IM2 A;  2Y7K A;  1S50 A;  3TKD A;  1QUJ A;  3H3G A;  3MAM A;  5H8H B;  3KBZ A;  1ZBM A;  2RCA A;  4KFQ A;  5JTY A;  4FOR A;  1EZP A;  2DXY A;  4YKK A;  5H8F B;  4DI4 B;  4O3B A;  2AL4 A;  1P1W A;  4F19 A;  4F22 A;  1DSN A;  4XFE A;  4RK2 A;  2A5S A;  4XEQ A;  1B52 A;  2ESN A;  1MH3 A;  1HSE A;  4H5G A;  2ZYO A;  2QPQ A;  3IAZ A;  4F2O A;  1NV5 A;  4MNI A;  4OVQ A;  2NXO A;  4JB7 A;  4XKP A;  1USY E;  1FTK A;  1UTB A;  5TPA B;  1MQJ A;  4UA8 A;  2I49 A;  3MST A;  1WVJ A;  1Z7M E;  5TU0 A;  5J1D A;  2PCR A;  1KA1 A;  3MP1 A;  3ZKK A;  4OET A;  3TTN A;  2HCA A;  1B05 A;  4YKJ A;  4UAB A;  3QYT A;  4MBP A;  2OK2 A;  4P8B A;  1MH4 A;  2O68 A;  4KR5 A;  1FQE A;  2V3U A;  4KCC A;  2G29 A;  5EYF A;  3HHF A;  1G0I A;  2D5W A;  3HV1 A;  5IKB A;  2VP1 A;  1LB9 A;  1DK4 A;  1ZKB A;  3C32 A;  4PGN A;  1AMF A;  3S9N C;  3W9W A;  1RDY A;  3AXF A;  4QSE A;  2QFL A;  1VE4 A;  4DCY A;  3E78 A;  3OEL A;  4HE1 A;  2OWT A;  2OX3 A;  2V25 A;  4QBA A;  4R2B A;  1VDW A;  5DYH A;  1P1N A;  1P1Q A;  1MXZ A;  2XXQ A;  1FRP A;  1MG1 A;  1NNT A;  1IXH A;  2BJJ X;  3FGS A;  4RJZ A;  5TP9 A;  1GR2 A;  4P0I A;  1IMC A;  3DM0 A;  3FVN A;  3TQW A;  5EQ8 A;  4OVR A;  4HS7 A;  3QAX A;  3H6T A;  1JET A;  4L17 A;  1MDP 1;  3A3C A;  2ONS A;  1LBY A;  3IFA A;  4YIC A;  2CZK A;  5CM6 A;  4YB7 A;  3IOU A;  4R73 A;  1Y3P A;  1MM7 A;  2XXH A;  1LEV A;  4NE4 A;  4BDL A;  1JEU A;  4EUO A;  4ONY A;  4G77 A;  2JJK A;  3PU5 A;  2WYP A;  3VLW A;  5HBC A;  4OFL A;  2UVH A;  1UIU A;  1VFD A;  1DCU A;  4R6H A;  3RPL B;  1SW5 A;  5EQ9 A;  3LR1 A;  2O7I A;  3KJT A;  1O63 A;  2QSX A;  3KEI A;  2W7Y A;  1FCK A;  1GVC A;  5AA2 A;  2I4C A;  2PT2 A;  4NWD A;  3B6T A;  3O6I A;  1XVY A;  5I59 A;  3IOT A;  4JBZ A;  2V4C A;  3PPQ A;  4P56 A;  4F1Y A;  3ONM A;  1ELJ A;  1FBH A;  4X48 A;  3QXM A;  4NF5 B;  3MZB A;  2CEX A;  1MY4 A;  5DW8 A;  1NUW A;  4PF6 A;  3KN8 A;  4PAK A;  1PB8 A;  1FTO A;  2IEE A;  1DPE A;  3EHU A;  2V84 A;  3VV5 A;  3HFU A;  1OLA A;  4QFO A;  3HN0 A;  1YPN A;  4GWW A;  1S7Y A;  2KQZ A;  1URG A;  3TZA A;  2ALU A;  3EN3 A;  4PGP A;  5IZZ A;  2H4I A;  3FVK A;  3C34 A;  3SER A;  3QUF A;  4LZ5 A;  3RPW A;  3MC2 A;  5I57 B;  1EU8 A;  4IO4 A;  3LUZ A;  3OMB A;  4AB6 A;  4GFR A;  3VLV A;  3D4C A;  4PDD A;  4PF8 A;  1WDN A;  2RIN A;  1XOC A;  5DVF A;  1M5E A;  1B7U A;  1LAF E;  1LFH A;  4XKN A;  4KHZ E;  4PE5 B;  2XXT A;  4LQ5 A;  2D21 A;  3G3H A;  3OXN A;  1ZTY A;  3K01 A;  3FZV A;  2NVU B;  3RYD A;  1K9Y A;  3MQ9 A;  4GQO A;  4U4S A;  3VVD A;  1NUY A;  3R7X A;  1FPJ A;  4THI A;  1D9Y A;  3RGY A;  1AH5 A;  3R26 A;  4JVD A;  3PMW A;  3T1B A;  4MLV A;  3IX1 A;  3KN3 A;  3PMX A;  1H44 A;  1B40 A;  3KFM A;  2GFE A;  3K6X A;  2WEF A;  2XWK A;  4KQP A;  4PFU A;  1NH7 A;  4OTE A;  4LZ7 A;  2AYS A;  4JWX A;  4O94 A;  4GIZ A;  4U22 A;  4AS5 A;  4NF4 A;  3V83 A;  1D9V A;  4OVJ A;  2ZYN A;  5FHO A;  1QUI A;  1B0H A;  2XXV A;  4P0G A;  1IME A;  3PUW E;  1MRP A;  5AA4 B;  3Q29 A;  2F7B A;  4GBW A;  3TEL A;  2R71 A;  5I2K A;  5I2N B;  2UYF A;  5EQ7 A;  1OVB A;  2H5Y A;  3LUY A;  3RUM A;  1YZ0 A;  3MP6 A;  2DSF A;  4G61 A;  2B65 A;  1AL3 A;  2VD3 A;  5H8N A;  1OMP A;  2RC7 A;  1SI1 A;  4OES A;  2ZZW A;  2DDK A;  1FPB A;  2F78 A;  4GRK A;  1JP4 A;  1EH3 A;  3K0V A;  3IOR A;  4X04 A;  2Q8M A;  1SYI A;  4U4X A;  4RY1 A;  2RC8 A;  5ESY A;  4I62 A;  5H8H A;  4QFL A;  4DLD A;  3HPI A;  4NF8 B;  4ELR A;  3O2A A;  4I8C A;  3EHT A;  3OO6 A;  1H43 A;  1ZMG A;  5DEX A;  5H8F A;  2I3V A;  2UVI A;  3FAT A;  3OEK A;  1FTL A;  1DOT A;  4N4U A;  3EF7 A;  4KYD A;  1LBX A;  1LCF A;  3HCQ A;  1QUL A;  3MVW A;  4IB2 A;  4OER A;  1RKM A;  2UVG A;  5ITO A;  1Y4T A;  5FHN A;  1OVT A;  1A8F A;  4YB5 A;  3OEM A;  5EHM A;  2DWH A;  5TPA A;  1FSA A;  3IJX B;  2I3W A;  1B2H A;  4RPN A;  2FIX A;  4GBV A;  5IAI A;  4N6P A;  2QVR A;  1URD A;  3K1M A;  1B46 A;  1QKA A;  4H45 A;  3RY3 A;  3MZ9 A;  2XXR A;  2XXI A;  3JZJ A;  1AOV A;  1Q9D A;  1SPI A;  4POX A;  1A8E A;  5I3S A;  3TYH A;  2GH9 A;  1MQI A;  3PPP A;  3TCH A;  1B4H A;  1R1N A;  1DTZ A;  3V5A A;  3VVF A;  2XWV A;  3JYR A;  4F29 A;  2O51 A;  1YTV A;  2GHB A;  3UGW A;  1B1H A;  1LBB A;  3HST A;  3DP6 A;  3TDJ A;  4N8Y A;  1TFA A;  2HZK A;  4Q5T A;  1ZU0 A;  5ICQ A;  2Q74 A;  1N76 A;  3G3G A;  3VLU A;  3TTL A;  2F5X A;  3FXU A;  1PDA A;  1KZ8 A;  1RDX A;  1A55 A;  1ATG A;  3QMF A;  4DDD A;  3H6U A;  2GQ1 A;  2Y5K A;  4MLQ A;  3TMG A;  1DTG A;  4LA9 A;  3ILT B;  4G8M A;  1A99 A;  1POY 1;  3CG1 A;  3O6H A;  3A09 A;  1B3E A;  2XXP A;  1YAE A;  2BJI A;  1B58 A;  5L9S A;  5DTB A;  5F7V A;  3OSQ A;  1NUX A;  2F7C A;  4YMB A;  2FIE A;  1NV7 A;  2A5T B;  4OZ9 A;  3EQ1 A;  3I6V A;  4F1V A;  2FA7 A;  1DPP A;  4QFN A;  4R6Y A;  1KWH A;  1MPC A;  4YB6 A;  3ZS6 A;  1IZ1 A;  4LAT A;  4Q30 B;  2CMO A;  5B70 A;  2V3Q A;  4U1Z A;  4GWS A;  4H6D A;  4OQO A;  3B50 A;  1OQG A;  3N6U A;  1JW4 A;  4OEV A;  1FQD A;  3FBP A;  3E13 X;  4ND9 A;  3A29 A;  1SDX A;  3EHS A;  1UQW A;  1A7L A;  2HXR A;  2DS9 A;  3BIG A;  3N94 A;  2ZNS A;  3U8Q A;  1USY H;  1TXF A;  3K1P A;  4LN5 A;  4MCO A;  2DQV A;  1P1U A;  1NV1 A;  4MIJ A;  1BP5 A;  3U1O A;  4LP2 B;  2VHA A;  3U72 A;  1FQC A;  1MPD A;  1YCJ A;  4M4G A;  1SW2 A;  3T22 A;  4M1V A;  3KGC A;  3KN7 A;  1B4Z A;  3BKI B;  1FQB A;  4HW8 A;  2XX7 A;  3PMV A;  3L6H A;  3UP9 A;  1NV2 A;  4RNS A;  1QGX A;  3JV9 A;  3PD8 A;  4JVC A;  3E9X A;  5CBS A;  5LOM A;  3BFU A;  2UXA A;  4QFK A;  4IO3 A;  2O7U A;  1LST A;  3G3I A;  1ZIU A;  4H8J A;  3SKP A;  4GXS B;  1JVX A;  2XHD A;  3TCG A;  2DWA A;  1EYI A;  4NF0 A;  3T9H B;  3U65 A;  3RT8 A;  3S4U A;  1PBP A;  4PFY A;  2FHY A;  2DVC A;  1P99 A;  4WKM A;  3TUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...