5J1DA

X-ray crystal structure of phosphate binding protein (pbp) from stenotrophomonas maltophilia
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
373
structure length
373
Chain Sequence
ATAVTGGGASLPADLYKGSADSILPANFSYAVTGSGTGKKAFLENNSALFSTTGTVHFAGSDSVLSSTELNTYNSTYNVSGDANRYGALVQIPSVATSVTIPFNKAGSAVDLSVTQVCGIFSGKITSWSQLAGLGRTGDIQVVYRGESSGTSELLTRFLTSACQPADVSSSNLKLTNGVPAFSVQSTFANLFTTVPSNFIAAPATGGTALYNAVYAIDGRVGYVGPDAIPSLTDATKVAKVKGFSPDEVSVQATLETAAPPTGAAAENPANWVPVFGNPSAGYPIAGYTNFVFGQCYKNATVGANVRGFLTKHYGSTVVNGVEQGPNDVAIRAHKFIPLTKAWRDAVRARFATATNAGAVNNPATCSGIGRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of crystal structures of proteins of unknown identity using a marathon molecular replacement procedure: structure of Stenotrophomonas maltophilia phosphate-binding protein.
pubmed doi rcsb
molecule tags Protein binding
molecule keywords Phosphate binding protein
total genus 118
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2016-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5j1dA02
3.40.190.260 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5j1dA01
1MH4A 1B5JA 2OCUA 3R6UA 4ELOA 4U4XA 5HM4B 3MQ9A 1B2HA 2NUVA 3C33A 3K1MA 3P7IA 1XC1A 3RGYA 4F19A 1NNTA 2AYSA 3S2VA 3GBBA 3IO4A 1B1HA 1XS5A 1NKXA 3H6VA 3L6HA 4ELQA 1ANFA 1A8FA 1FQCA 1YPNA 3F11A 5I2KA 5KDTB 2I0CA 1NFTA 2DOJA 2PMSA 3KEIA 2DS9A 5AA4B 1MM6A 3TZAA 1TXFA 4RNSA 2Q2AA 1J1NA 3O97A 4DCYA 1P1WA 5ELVA 3T9HB 4NF6B 3H06B 3T66A 4ESWA 3FJMA 3H4ZA 1QULA 1Y3PA 3JV9A 4N6PA 2H99A 1QKBA 1R9LA 2NWJA 5HPQA 4LZ8A 1XHYA 1YCJA 3M3LA 5H8SA 2YLNA 5H8QA 4ZEFA 5TPAB 4ND9A 4EDPA 2E1SA 3IAZA 4OTEA 4R6HA 3UP9A 1MXVA 1PB7A 4IO4A 5CI5A 3G3GA 4HTGA 1B3LA 2R9JA 3IOVA 3RN8A 3TELA 3TTKA 3T9UA 3UN6A 2O84X 1DPPA 3IB0A 4JBZA 5AA1A 1MY0A 5TU0A 3PPQA 1XVYA 4LUBA 1RKMA 2ZYKA 4C0RA 3T93B 3IX1A 1A7LA 4XKRA 1SDXA 1MM7A 4ISUA 3PUXE 2OWSA 4NMYA 3HN0A 5DVIA 3N6TA 1FTMA 1DTGA 4O3CA 3FVOA 3KN3A 3ILTB 3QYTA 3CRBA 3OEMA 1IQ7A 4RK2A 1LFHA 1B1XA 4R9FA 4LP2B 3CFXA 3BKIB 3FXUA 4PFUA 3SKPA 3U92A 5L9OA 3KGCA 4OFLA 2DWAA 4OQOA 4KD5A 3VXCA 1B3HA 5AA2B 1MY1A 2V3UA 3PPNA 3MBPA 3IORA 4LONB 2RC9A 5I2NA 1Y9UA 4I9DA 2V3QA 3D4CA 2O6AA 3C9HA 3MVWA 3MVYA 3OSQA 3K6XA 1N76A 3FXQA 3FJGA 2G93A 4POWA 3KJ7A 4FORA 3FJ7A 3E9XA 4YKIA 1LSTA 3IJOB 1Y4CA 4DLDA 3Q29A 4IY6A 4JSDA 1IIWA 2VD3A 2WKYA 2HEUA 3H6UA 4NE4A 5A5XB 2DWHA 4MFIA 4IGTA 4GLIA 3HCQA 4XIGQ 1H76A 4ECFA 4RPOA 4BDMA 4NF8B 3KSJA 1FW0A 1B7ZA 2RCAA 4G68A 3DELB 3RLFE 3MPLA 4QSEA 2ZNSA 1HSLA 4EF1A 1LCFA 1XOCA 2ZNUA 4F3PA 4IO3A 2F34A 2RKMA 1UTHA 5CM6A 2GFEA 5CMKA 2I0BA 1LAGE 3KOTA 3KZGA 4IO2A 3RQTA 1LLSA 1D4NA 2A5SA 4IO6A 4R75A 4H67A 4BDQA 4BDRA 5IAIA 2DXYA 3FZVA 2P1SA 1QUJA 3RPWA 3C35A 4ZZEA 1A8EA 2PX1A 4POXA 1FQDA 3OD7A 2W7YA 5H8HB 5L9SA 1A40A 1R1NA 1N7XA 1MQDA 3G3FA 1M5BA 1BTJA 4P11A 3TTMA 5I56B 2XD3A 3LSXA 3RT8A 3QUJA 3C36A 1UQWA 4H0WA 4K3FA 2ZXTA 1GR2A 4IO7A 4KPTA 4NF5A 5EYFA 4GD5A 1MXUA 2F6GA 4QFLA 3RUMA 1IXCA 3ZKKA 3CSGA 3O2AA 1JW4A 3S4UA 1N0TA 1N3XA 1EZOA 2Y84A 3QK6A 4YZZA 2D21A 3PPRA 3PUYE 1B3FA 3RTWB 4OENA 2I3VA 4YMBA 1WODA 1Q35A 1R6ZA 3FUZA 1FQAA 1PC3A 3B7DA 4FE8A 1FQFA 1ATGA 4I1DA 3FVKA 4NEDA 4OEUA 4OMBA 4Z0IA 4TLMB 4ZDMA 3CVGA 3O6HA 1EZPA 4PP0A 1O7TA 1EU8A 3O6GA 4O3AA 1AL3A 1P1UA 4F2OA 1URGA 1FQEA 3LSLA 4G8NA 4R9GA 1P1NA 3QIMA 5H8NA 4DCXA 2GHAA 3Q27A 4EXKA 1VSOA 3OMBA 1B0LA 4ELRA 2DE4A 2F7AA 2XX9A 2H98A 2QS2A 1I6QA 1GV8A 3TAJA 2Y7IA 1Y4TA 4ESXA 1FTLA 1NNPA 4RYAA 3PV0E 3EHUA 4QFPA 5I59B 1UTBA 4QHQA 1B52A 4ZE8A 5F7VA 1OMPA 2OBGA 2XXIA 3W9VA 4DXUA 3RT6B 1URSA 4U1ZA 3TEPA 1VE4A 2XXWA 4RA1A 2I3WA 3CG3A 4YU0A 3MP8A 2DE3A 2H4IA 3L6GA 4X1BA 3WAEA 4C1UA 1SW2A 1AIVA 1DOTA 2O51A 3FATA 4DDDA 4F18A 1B3GA 4HS7A 4KFQA 5BUUA 2Z22A 3THIA 4EQ9A 2OJTA 1I69A 4H65A 3SEXA 3AXFA 2IA4A 4BDLA 3EPEA 1HSJA 2HCAA 3H6TA 5EHSA 4ZZAA 4OETA 3U1OA 4F39A 3G3JA 1SQYA 3HV1A 4AB5A 5H8FA 4ZE9A 1P1QA 1QUIA 4KR5A 3MVXA 2KLFA 4N13A 1MG1A 4FATA 2F8DA 2Q9TA 5H8HA 3IOWA 2XX8A 3FIRA 1M5FA 5IKBA 2Q2CA 1LAXA 1MQGA 5DYHA 3VLWA 4DXCA 5ICQA 1PEBA 2REJA 3KJTA 4PFWA 1POTA 1YAEA 5CRYA 2DWJA 1JW1A 1O64A 1MXYA 1N7WA 3I5OA 1Z7ME 4KQPA 3S9LC 3FXRA 1IZ1A 1D9VA 1MXXA 4FJPA 3G3IA 4THIA 1JEVA 4DXBA 3MW0A 1H44A 1JW5A 4OFJA 3TDJA 4PETA 3EHTA 2B65A 4MH5A 2YPNA 2OWTA 1USYH 3B6WA 3ODBA 4G68B 4RPNA 3VVDA 1WVJA 1NH8A 2A5TA 2ZNTA 3UGWA 4MBPA 1DMBA 2RINA 4TQUQ 3QAXA 1OQHA 3SEYA 1B4ZA 2P0SA 3TTLA 2XXQA 3K01A 3KFMA 4GXSB 3JZJA 4R72A 4ZEKA 3CIJA 3TQLA 1B46A 3V89B 3TCGA 3PMXA 3S9NC 4OHNA 4I8CA 4LQ5A 4F1VA 3A3CA 3V5AA 2A5TB 4EQBA 1H43A 3M3FA 4FIMA 3G7WA 1WDNA 3S9MC 1MQHA 1XT8A 4JSOA 3TTNA 2CZLA 3VFJA 3CI8A 1UTBB 4FEDA 2HXWA 5I59A 4LA9A 2RC7A 3ZSFA 1MPDA 1B7HA 1O63A 2OK2A 3EHSA 3TCHA 1KWHA 1P99A 1VFDA 2E0SA 1MPCA 4Q0CA 5AA2A 4KCCA 3A09A 1B5HA 4KCDA 1UIVA 3I3VA 4PFYA 1ZKBA 2DVCA 2DVZA 4P0GA 5H8NB 2UYEA 1M5CA 3DLNA 3FVNA 3GXAA 3HO7A 3O66A 4KYEA 2XXVA 3PU5A 4JB7A 3OO9A 3PPPA 1QJMA 3TODA 2Y7WA 4AQ4A 3WAFA 4F22A 4U1OA 3OELA 1OQGA 3OXNA 1JVYA 4XKQA 1B7UA 4PFTA 1P1OA 1UTHB 2XHDA 3CG1A 3LUYA 3PUWE 4FECA 4G8HA 4L17A 5H8FB 2PYYA 4R6YA 2RC8A 4N07A 5KZTA 3Q28A 1PDAA 4Q8RA 2REGA 5B70A 4NF8A 3C31A 5ICTA 1VR5A 3EF7A 2NVUB 1IUDA 4NF5B 3V8XB 3QXMA 1B05A 3H03A 1SYHA 1SW1A 2VGQA 3OEKA 5CMMA 3LBSA 5TPAA 5FHMA 3IOUA 3K0VA 3TFLA 1LAHE 1OLAA 4WEDA 3IK6B 1NNFA 1B40A 2HZKA 4GQOA 4TOZA 1JNFA 5DT6A 2R71A 2DQVA 4R74A 2GH9A 2H5YA 4X48A 1I6BA 4GIZA 2FA7A 5L8DA 4BDNA 2G29A 4I62A 5AA3A 4KI0E 1QKAA 1BKAA 1TFDA 4PQJA 2F6PA 2IEEA 3FGSA 2O1MA 1D3KA 3GBAA 3KN7A 4LATA 4QRZA 2I4BA 4OESA 4HCWA 4KHZE 4RY1A 3MP6A 2XXYA 1JEUA 2Q89A 3C34A 3H6WA 4R2FA 4U4SA 4EQ7A 1SW4A 4F3BA 3MPKA 3QSLA 1R9QA 1XVXA 3PUZE 2HAUA 4YKJA 1MRPA 4QFKA 2QL3A 3BFUA 1MY4A 1DPEA 1SVXB 1DTZA 1EH3A 3MZ9A 2H25A 5A5XA 2Q8JA 4LZ7A 4OXVA 1AMFA 2V3TA 2ZYNA 3FV1A 4F31B 4QF9A 4EXLA 5AA2D 2F97A 1ZIUA 4QSDA 3T22A 2QMXA 1MH3A 3GLBA 4LZ5A 2O1LA 3C32A 1MQJA 2ONKE 3LSFB 5J1DA 1LBBA 3OO6A 3MVZA 5CBSA 1UIUA 2THIA 3MWBA 4OWDA 2I4CA 5I2NB 4GF8A 3SEUA 3H7MA 1USYE 5I56A 4IGRA 3TTRA 4ZECA 3IR1A 1B32A 1SBPA 5H8QB 3SERA 2VP1A 4RJZA 3Q26A 5CMBA 3U72A 4BLAA 2B3FA 2I58A 3I6VA 4QSCA 5FTHA 1ZBMA 3IB2A 3G3KA 4YB6A 3MC2A 2Y7PA 4ONYA 4G4PA 3VLUA 1N04A 2Z8EA 3E13X 1SI1A 2PVUA 2UVGA 4G8MA 4KYDA 1POY1 1M5DA 4QFNA 1NL5A 1AH5A 5M2VA 4U22A 1L5TA 3U93A 3DM0A 3U94A 3SESA 2XXTA 2QRYA 2XXRA 4LQ2A 4OFOA 1ZU0A 3VVEA 3T96B 2I48A 4JXIA 5KDTA 4TLLB 1SYIA 2O7UA 1HSEA 4H6DA 3MZBA 4JDFA 4MLVA 5TP9A 4H8IA 3TYHA 4FAJA 2DE2A 1MDQA 4G68C 4R6KA 2NXOA 3K02A 1S9TA 3K6VA 1NNKA 3PPOA 5DEXB 4ELPA 1Y20A 2AL5A 2O68A 1MY3A 1MS7A 3KG2A 1IEJA 3FV2A 3O28A 4GFRA 1I6AA 1MY2A 4U23A 3SETA 1OLCA 3K1NA 4DIGA 3CFLA 1LGBC 4NF6A 3EN3A 1LB9A 2R6GE 1TWYA 4G77A 1DSNA 5DVFA 3N26A 4C1TA 4DZ1A 4ZEBA 4F29A 5AA4A 1A54A 4F3GA 3MAMA 1LFGA 4MLQA 5I2KB 3T9XB 3B6TA 2D3IA 3DP4A 4GRKA 4ZS9A 5ITOA 2QJEA 4FEBA 4EUOA 1EZ9A 4GWOA 3V83A 4RK9A 3IO6A 2NOOA 4Z7EA 3C4MA 3VXBA 4GOTA 1IXIA 5CBRA 1PBQA 3U8QA 3W15C 3ECRA 3PMVA 5I84A 3TUSA 2M8CA 3FASA 3SEWA 5JEIA 2I49A 2HAVA 1Z7NE 3O9PA 4WEPA 3RY3A 2QS4A 4U21A 2ESNA 2P2AA 3ILUB 1B4HA 3JYRA 1Y1ZA 3K2DA 4UACA 3OSRA 1LAFE 5KCJA 3RTFB 1N3WA 1OVTA 1FTOA 1RYOA 4Q5TA 1PBPA 2RF1A 2ZYMA 4YB5A 4R73A 3TCFA 4F1UA 1B0HA 4F3SA 1VFEA 4XXUA 3KSXA 3KN8A 1B58A 2LAOA 2V25A 3LSWA 1NMUA 2CMOA 1H3DA 5K2XA 2ZYOA 1JETA 4JWXA 4NWCA 1MXWA 3LR1A 2F7CA 3SDFA 3SEVA 3O29A 3TKDA 4E0XA 2QS1A 5CMCA 3LC8A 5JTYB 1D9YA 1M5EA 2FNCA 2Z23A 3IL1B 2F35A 2XXUA 3FD3A 3IB1A 4ZEIA 3VE1B 4ZEDA 5JK4A 1ZLQA 2DYXA 4NTLA 1LFIA 4OERA 2ONSA 2XXPA 4WXJA 2Z8DA 1Y3NA 3PD8A 1BIYA 5L9MA 3K00A 1Y3QA 5EHMA 5CC2A 1QUKA 5HBCA 4NWDA 2X7QA 1FTKA 4YAHX 3K4UA 5F1QA 1LB8A 1GVCA 5JTYA 3IJXB 2QMWA 3KBRA 1OIBA 1ZMGA 5LOMA 3BFTA 2V84A 3K6WA 2YJPA 2AL4A 2ALUA 4XKNA 2V93A 1ZTYA 4YB7A 2BJJX 4OEVA 3UA8A 1MPBA 3KOSA 4U2RA 3HPIA 4HCYA 4GXAA 4X9TA 2HQ0A 3CSBA 1T0KA 3RNNA 2F36A 4QFOA 3OOAA 3R7XA 1JQFA 1FTJA 2QS3A 3HHFA 3TMGA 5BWJA 2RCBA 3PGFA 1SD3A 3UORA 4LVQA 4F2QA 5KCJB 3IOTA 2ABHA 4OZ9A 2F78A 3QUFA 3T9VA 2PBWA 4H5FA 2UVIA 1II5A 2H9BA 1TFAA 2UYFA 4X1DA 1SW5A 1S50A 3UIFA 2VD2A 2OLBA 3K6UA 2QSXA 3B6QA 1N84A 3UK4A 1FQBA 2DP8A 4H5GA 5K2YA 2Q88A 5I58B 4UA8A 5ISUA 4H8JA 1JVXA 2HZLA 3HSTA 1IXGA 3E3KA 1QW0A 3N6UA 3N94A 3OENA 3ONMA 2FYIA 4OYVA 4WKMA 2HFBA 3PMWA 4Q30B 4NF4A 2O69A 2Z8FA 4RXLA 4MF3A 1SI0A 1US4A 2XXHA 2XX7A 4M4GA 4O3BA 2I6EA 3D4GA 1AOVA 4R2BA 4YKPA 3GZGA 1A99A 5I57A 5DTBA 1B5IA 2F7BA 4JWOA 4YMAA 2XXXA 3BBRA 4BDOA 1PB9A 3M8UA 2UXAA 3A3UA 2UVHA 3K1PA 4KYSA 4EF2A 1LCTA 4JWYA 1TT1A 1B6HA 1YTVA 1PB8A 2OZZA 3Q25A 2DWIA 2F5XA 3OO7A 1S7YA 1BP5A 1ZJLA 3G3HA 3ZS6A 2AIXA 2O7IA 2ZMBA 3M3KA 1CE2A 2ANJA 4P0IA 3R26A 4IB2A 3H3GA 1MDP1 1URDA 1OVBA 1QVSA 3DP8A 5TP9B 2GRVA 2PT1A 2PT2A 3CFZA 3MP1A 2VHAA 1IITA 5I57B 2X7PA 3DP6A 1Y1MA 2D5WA 4HW8A 2DSFA 1NH7A 1Q1KA 3E4RA 5ITPA 4E0WA 3PD9A 2Y7KA 3OO8A 4NF4B 5DVJA 4IO5A 4G2ZA 5B7DA 2VOZA 3W9WA 3VVFA 4PE5B 5FHNA 1IXHA 5FTIA 1B51A 1B9JA 3FVGA 2QPQA 3O6IA 4XKPA 1H45A 1GGGA 3MJNA 1A55A 5I58A 3MZ1A 4F1YA 3VV5A 3ZKLA 3TPAA 3MUQA 2UVJA 3S9EA 2Y7RA 1CB6A 4XTCQ 2B3BA 1ELJA 4YKKA 1B3EA 1BLFA 1GTKA 2XD2A 4OVJA 4GVOA 3TQWA 2DXRA 1MXZA 1FCKA 2ONRA 4YICA 3EQ1A 4GL0A 3VLVA 3CR9A 4GL8A 3VDFA 1MQIA 4H1XA 2GHBA 4M1VA 5AE4A 3N5LA 4IY5A 2X26A 3USDA 1US5A 3PUVE 4DE8A 5DEXA 1LBCA 1F9BA 5FHOA 1RYXA 4AB6A 3HHGA
chains in the Genus database with same CATH superfamily
1MH4A 2OCUA 4XF5A 3C33A 1B1HA 4ELQA 5KDTB 1ANFA 1YPNA 5I2KA 2I0CA 5AA4B 3LUZA 3O97A 1P1WA 5ELVA 4ESWA 3H06B 3T66A 1QULA 4N6PA 1QKBA 5HPQA 4N8GA 1YCJA 5EYGA 4PGPA 2OX3A 1PB7A 4IO4A 2R9JA 3IOVA 3UN6A 2O84X 1DPPA 4JBZA 5AA1A 3BIGA 1XVYA 3ISPA 3IX1A 1A7LA 4ISUA 3KN3A 1LFHA 3FXUA 5L9OA 3KGCA 4OQOA 3E79A 3PPNA 3MBPA 3IORA 4I9DA 3OSQA 3MVYA 1LBVA 5IZZA 2G93A 3IJOB 1Y4CA 5A5XB 4MFIA 4ECFA 4RPOA 3B50A 4PE3A 2RCAA 4G68A 3MPLA 1HSLA 1LCFA 2ZNUA 4IO3A 2RKMA 2FHYA 2I0BA 3KZGA 1LLSA 1D4NA 5IAIA 2P1SA 3RPWA 3C35A 1A8EA 2PX1A 1A40A 1M5BA 5I56B 2XD3A 2FIEA 3LSXA 3QUJA 4KPTA 1GR2A 5EYFA 5IGAA 4GD5A 1FBCA 4NGUA 4OANA 4YZZA 4OENA 1Q35A 4FE8A 4RJZA 3B7DA 4NEDA 3FVKA 4OEUA 4Z0IA 4ZDMA 3CVGA 4O3AA 1BK4A 1AL3A 1FQEA 1IMDA 4G8NA 1P1NA 4DCXA 4EXKA 2F7AA 2XWVA 4ESXA 3PV0E 1B52A 5F7VA 1OMPA 2OBGA 3W9VA 4DXUA 3RT6B 2H4IA 4C1UA 2KQZA 4NAPA 4KFQA 2Z22A 4PAIA 4H65A 3SEXA 4PTKA 1LBZA 4KR5A 4N17A 2F8DA 2Q9TA 4QBAA 2XX8A 1M5FA 2Q2CA 5DYHA 1POTA 1MXYA 4MIJA 5EQAA 1H44A 1JW5A 2B65A 1USYH 1WVJA 2RINA 1OQHA 2XXQA 2CZKA 3K01A 4NHBA 4ZEKA 3CIJA 4F1VA 2CEXA 4I8CA 3V5AA 1H43A 3M3FA 4FIMA 4JSOA 4FEDA 3ZSFA 1MPDA 1B7HA 3EHSA 2OK2A 4Q0CA 3I3VA 4P0GA 3O66A 2XXVA 4JB7A 3OO9A 4PFTA 1P1OA 3CG1A 4G8HA 1G0HA 2PYYA 5KZTA 2P3NA 2QVVA 2VGQA 5CMMA 5TPAA 3TFLA 3K0VA 1LAHE 1OLAA 2HZKA 2DQVA 4R74A 1I6BA 4PF6A 2G29A 1G0IA 4I62A 1QKAA 2IEEA 4TOZA 4LATA 4ELRA 4OESA 4HCWA 1R9QA 4YKJA 3MSTA 4QFKA 3BFUA 1EH3A 2H25A 3GYYA 4QF9A 1ZIUA 2QMXA 4LZ5A 4HXVA 2ONKE 4X8RA 4KXPA 5J1DA 1NV5A 1EYIA 1USYE 4IGRA 3TTRA 3IR1A 1SBPA 2VP1A 2B3FA 5FTHA 3MC2A 2WEFA 2Z8EA 3E13X 3FBPA 4U22A 1L5TA 3MZBA 2DE2A 4R6KA 2NXOA 3K02A 1S9TA 1NNKA 4ELPA 2O68A 4PAFA 1MY3A 3KG2A 1LBYA 3KBZA 5J16A 4U23A 2ZZVA 4DIGA 4F29A 5AA4A 3N26A 4ZEBA 1A54A 4F3GA 5I2KB 4GRKA 3B8BA 1RDXA 4Z7EA 3C4MA 2PFZA 3VXBA 5CBRA 1PBQA 3W15C 3PMVA 2I49A 4O8MA 4WEPA 3K2DA 4UACA 2PCRA 4PF8A 3TCFA 4OA4A 1VFEA 5K2XA 3SDFA 1MXWA 4E0XA 5CMCA 5JTYB 3VE1B 2F35A 3FD3A 2DYXA 4NTLA 4WXJA 2XXPA 3IFAA 3PD8A 1BIYA 1IMCA 4NWDA 2X7QA 3IJXB 1ZMGA 5LOMA 3UA8A 1FBFA 2HQ0A 3CSBA 5ET6A 3RNNA 2F78A 3T9VA 1TFAA 2UYFA 3UIFA 4I40A 5ISUA 3HSTA 4JVIA 3E3KA 4RXLA 1US4A 2XXHA 4O3BA 1AOVA 5I7IA 3GZGA 1A99A 4JWOA 1NV2A 4EF2A 1LCTA 1B6HA 2OZZA 3Q25A 1S7YA 1FPKA 1ZJLA 2AIXA 2O7IA 2ZMBA 3M3KA 4AS5A 1CE2A 2ANJA 3H3GA 5EQ8A 4XFEA 2PT2A 3MP1A 3DP6A 1NH7A 4NF0A 4E0WA 3PD9A 4MCOA 4G2ZA 1FPJA 5FTIA 5FHNA 1B51A 1RDYA 3FVGA 1H45A 3MJNA 1A55A 1FPFA 4GX3A 3TPAA 3MUQA 3S9EA 1CB6A 1ELJA 1B3EA 1FCKA 2ONRA 4YICA 5DW8A 1FJ9A 3CR9A 2GHBA 3N5LA 4IY5A 1US5A 5DEXA 1F9BA 5FHOA 1RYXA 4AB6A 3R6UA 1B2HA 1XC1A 1NNTA 2AYSA 4PFBA 1NKXA 3L6HA 1NFTA 2PMSA 1MM6A 1TXFA 2H99A 2NWJA 3M3LA 5H8SA 5TPAB 4ND9A 4EDPA 2E1SA 1B3LA 3PPQA 3T93B 4XKRA 3PUXE 1NV7A 5F24A 1DTGA 4O3CA 3OEMA 1IQ7A 3U92A 1MY1A 2V3UA 4MNCA 2RC9A 1Y9UA 4IR8A 2O6AA 3K6XA 3KJ7A 4FORA 4YKIA 1LSTA 5IZ3B 3Q29A 2WKYA 2HEUA 4NE4A 3HCQA 4XIGQ 1H76A 2Y5LA 4BDMA 2QFLA 3DELB 4HE2A 1KZ8A 4F3PA 1XOCA 4N6DA 5CM6A 2GFEA 3RQTA 3KOTA 4OVSA 4O7IA 2DXYA 4P1LA 1QUJA 2VPOA 1AWBA 1MQDA 1BTJA 2ZXTA 4IO7A 1MXUA 3CSGA 3S4UA 1N0TA 2D21A 3RTWB 1B3FA 4I1DA 4OMBA 1FQAA 1PC3A 4TLMB 1O7TA 3O6GA 1URGA 5H8NA 3QIMA 4I3EA 3OMBA 1B0LA 4MNPA 1FTLA 4QHQA 4ZE8A 4U1ZA 4P1EA 1VE4A 2I3WA 3MP8A 2DE3A 3L6GA 3WAEA 3FATA 4O7MA 1B3GA 4HS7A 1I69A 4G61A 1HSJA 5EHSA 4F39A 4ZZAA 1SQYA 1QUIA 2KLFA 4N13A 1MG1A 4FATA 3FIRA 1LAXA 1MQGA 1PEBA 3KJTA 4PFWA 1YAEA 1JW1A 1NV0A 1Z7ME 1IZ1A 1D9VA 1MXXA 4HE1A 4DXBA 4PETA 3VVDA 2A5TA 2ZNTA 4MBPA 1DMBA 4TQUQ 3QAXA 1FBHA 4I3YA 4XEQA 3TTLA 1B46A 3TCGA 4LQ5A 4EQBA 3D1RA 2CZLA 1UTBB 5I59A 5ESYA 3TCHA 1O63A 1KWHA 1MPCA 4KCCA 2DVCA 2DVZA 5H8NB 1M5CA 3DLNA 3FVNA 3GXAA 3HO7A 4AQ4A 3WAFA 4XKQA 1UTHB 3S2VA 4R6YA 2RC8A 4N07A 3Q28A 4GWYA 4Q8RA 2REGA 3EF7A 4NF5B 1B05A 1SYHA 3OEKA 5FHMA 3ROJA 1JNFA 2R71A 2GH9A 2FA7A 2MKZA 4BDNA 4PQJA 2O1MA 1D3KA 3GBAA 4RY1A 2XXYA 4F3BA 2Q89A 3PUZE 2HAUA 1SVXB 1AMFA 4GWXA 1INPA 2VT5A 4QSDA 1MH3A 2O1LA 1IMAA 3LSFB 1LBBA 3MVZA 2THIA 5ET7A 2I4CA 4GF8A 3H7MA 5I56A 4ZECA 1B32A 3SERA 3I6VA 4EQ7A 3IB2A 4YB6A 3VLUA 4G4PA 4KYDA 1POY1 1AH5A 3DM0A 3U94A 1FJ6A 2XXTA 2QRYA 2XXRA 3VVEA 1ZU0A 3T96B 1SYIA 1KA1A 5TP9A 4H8IA 3E78A 4FAJA 4G68C 5DEXB 1Y20A 1IEJA 3FV2A 3O28A 4GFRA 3K1NA 1LGBC 2R6GE 5DVFA 4C1TA 3T9XB 1LFGA 2D3IA 4ZS9A 5ITOA 2QJEA 2WBDA 4RK9A 2NOOA 4MX6A 1IXIA 4QXDA 5EYHA 3ECRA 5I84A 2HAVA 3RY3A 4U21A 2ESNA 3ILUB 1B4HA 3T1BA 1Y1ZA 2XWIA 1FBGA 3RTFB 1N3WA 1OVTA 1FTOA 2RF1A 2ZYMA 4R73A 1B58A 2LAOA 2V25A 2CMOA 1H3DA 2XXKA 2ZYOA 4JWXA 3SEVA 3O29A 2QS1A 5FBPA 1M5EA 2Z23A 3IL1B 3IB1A 2XXUA 1NV6A 4MEVA 2ONSA 1Y3NA 4PDDA 5CC2A 2FVZA 5HBCA 4X04A 1LB8A 1FPBA 2QMWA 3KBRA 1OIBA 3CHGA 4GWWA 3BFTA 2ALUA 2V93A 4YB7A 1MPBA 4HCYA 1T0KA 2F36A 5A5LA 1JQFA 1FTJA 2QS3A 3HHFA 5BWJA 3S9MC 3UORA 2WYKA 3IOTA 4OZ9A 3QUFA 2PBWA 4AS4A 5JK4A 1N84A 2DP8A 5K2YA 1FPLA 1JVXA 3N94A 3OENA 2FYIA 1CNQA 2HFBA 2O69A 2Z8FA 2I6EA 3KC0A 1FBEA 2XXXA 4H46A 2CZHA 2UXAA 4JWYA 3HFUA 3G3HA 1NV4A 4IB2A 1QVSA 2X7PA 2DSFA 3E4RA 1D9QA 5DVJA 2VOZA 2QPQA 1GGGA 5I58A 2Y7RA 2B3BA 4YKKA 4GVOA 3SZPA 1MXZA 3VLVA 4GL8A 4DI3D 5AE4A 3PUVE 4DE8A 4HE0A 4YU0A 1B5JA 3MQ9A 2NUVA 3K1MA 5I5PA 3GBBA 1A8FA 2OWZA 2DOJA 2DS9A 3TZAA 4RNSA 4DCYA 4PBHA 3FJMA 1R9LA 5H8QA 3IAZA 4R6HA 3UP9A 1MXVA 5CI5A 3RN8A 3G3GA 4HTGA 3TELA 3TTKA 5TU0A 4MAGA 4LUBA 2ZYKA 2QVUA 4NMYA 3NOHA 3HN0A 4NQ8A 3FVOA 3QYTA 2P3VA 3CRBA 1B1XA 4R9FA 4LP2B 4PFUA 3SKPA 2FIXA 4OFLA 4KD5A 5ET5A 4LONB 5I2NA 3D4CA 3C9HA 3FXQA 5ET8A 1NUXA 2XWKA 3FJGA 4POWA 4DLDA 2VD3A 2GQ1A 2DWHA 4IGTA 4NF8B 3KSJA 1FW0A 4GX6A 5CMKA 4IO2A 4R75A 2A5SA 4BDQA 3FZVA 1FQDA 1NUZA 4JVDA 3C36A 4K3FA 4GBWA 4PFRA 2F6GA 3RUMA 1IXCA 3O2AA 1N3XA 1EZOA 2Y84A 2HHMA 3PPRA 3PUYE 1WODA 3FUZA 3O6HA 4PP0A 3LSLA 3RPLB 3Q27A 1VSOA 2DE4A 2XX9A 2H98A 2QS2A 3TAJA 1Y4TA 1NNPA 3EHUA 4QFPA 3PTYA 4NX1A 2XXIA 1URSA 4RA1A 4X1BA 1SW2A 1AIVA 2O51A 2XWOA 3QMFA 4F18A 5BUUA 3THIA 2OJTA 3AXFA 4BDLA 2F3BA 3EPEA 2HCAA 4OETA 4AB5A 3HV1A 4ZE9A 1P1QA 1NV1A 5H8HA 5IKBA 1VDWA 3VLWA 2JJKA 5ICQA 1JP4A 5CRYA 2DWJA 3S9LC 3I5OA 1N7WA 1K9ZA 4FJPA 1JEVA 4OFJA 3TDJA 3EHTA 2YPNA 3B6WA 3UGWA 1B4ZA 2P0SA 3V89B 4GWSA 3S9NC 4OHNA 3A3CA 2A5TB 3G7WA 1XT8A 3CI8A 3EKIA 2RC7A 5IZ1A 1FPGA 2E0SA 1VFDA 3MYUA 5AA2A 3A09A 4KCDA 4PFYA 1ZKBA 3U65A 3PPPA 2Y7WA 3OELA 1OQGA 3OXNA 1B7UA 3PUWE 3LUYA 5H8FB 4NF8A 1FRPA 1VR5A 3V8XB 2NVUB 3H03A 4JVCA 1SW1A 2XA5A 3IK6B 2V4CA 1NNFA 1B40A 5DT6A 5L8DA 3FGSA 4ZZEA 3KN7A 4KHZE 4R2FA 3H6WA 4U4SA 3QSLA 1XVXA 1MRPA 2QL3A 4MHFA 5A5XA 2Q8JA 4LZ7A 4OXVA 2V3TA 2ZYNA 3FV1A 5AA2D 2F97A 2L5VA 1YXIA 3C32A 1MQJA 2CEYA 3MWBA 4OWDA 5I2NB 3SEUA 4PDHA 5H8QB 3Q26A 4BLAA 2ZZWA 2I58A 4QSCA 1ZBMA 2Y7PA 4ONYA 2PVUA 2UVGA 1M5DA 4QFNA 1NL5A 4NN3A 5M2VA 1EYJA 4OFOA 4LQ2A 5KDTA 4JXIA 1LBWA 4H6DA 4N91A 3K6VA 2BJIA 5IZ3A 1MY2A 1OLCA 3CFLA 3EN3A 2Y5KA 1LB9A 1DSNA 4DZ1A 1QGXA 3MAMA 3DP4A 2FBPA 4EUOA 4N81A 3IO6A 4GOTA 3U8QA 3TUSA 5JEIA 1Z7NE 1NUWA 1DK4A 3JYRA 5KCJA 1LAFE 4Q5TA 4YB5A 1PBPA 4F1UA 1B0HA 1YYZA 4XXUA 3KSXA 1JETA 3LR1A 2F7CA 3TKDA 3LC8A 2FNCA 4ZEIA 4ZEDA 1FPEA 1ZLQA 1LFIA 2F3DA 4OERA 2Z8DA 5LTCA 5L9MA 1Y3QA 5EHMA 1GVCA 5JTYA 3K6WA 2AL4A 4XKNA 1ZTYA 4OEVA 2B4LA 4QFOA 1IMEA 3TMGA 5KCJB 1SD3A 4F2QA 4H5FA 4GBVA 2H9BA 1SW5A 1S50A 2VD2A 4GWUA 3TEPA 2QSXA 3B6QA 4H5GA 3ONMA 4OYVA 3PMWA 4MF3A 1SI0A 2XX7A 4DI4B 4YKPA 1B5IA 2F7BA 4OVRA 3M8UA 2UVHA 4KYSA 1YTVA 4MNIA 1PB8A 2F5XA 3OO7A 3ZS6A 3R26A 1URDA 2GRVA 1IITA 1FBPA 2WYPA 5ITPA 3OO8A 4OVTA 2QVRA 4P8BA 1LBXA 3O6IA 3ZKLA 1FPIA 2UVJA 4OVJA 1GTKA 2XD2A 1NUYA 2DXRA 3EQ1A 3VDFA 4H1XA 4M1VA 3USDA 1Q9DA 5CBSA 4PBQA 4ELOA 5HM4B 4U4XA 4P56A 3P7IA 3RGYA 4F19A 3IO4A 1XS5A 3H6VA 1FQCA 3F11A 3KEIA 2Q2AA 1J1NA 3T9HB 4NF6B 3H4ZA 1Y3PA 3JV9A 2Q74A 2Q8MA 4LZ8A 1XHYA 2YLNA 4ZEFA 2CZIA 2HPGA 4OTEA 4PCDA 3T9UA 4N15A 3IB0A 1EYKA 1MY0A 1RKMA 4C0RA 1SDXA 1MM7A 2OWSA 1IMBA 5DVIA 3N6TA 1FTMA 4GX4A 3ILTB 4RK2A 3CFXA 3BKIB 2DWAA 3VXCA 1B3HA 5AA2B 2R8TA 4PC9A 4MMPA 3KC1A 2V3QA 3MVWA 1N76A 3FJ7A 3E9XA 4IY6A 3BIHA 1IMFA 1IIWA 4JSDA 3H6UA 4GLIA 1B7ZA 3RLFE 4QSEA 4EF1A 2ZNSA 5I3SA 2F34A 1UTHA 2VPNA 1LAGE 4IO6A 4H67A 4BDRA 5IM2A 2WBBA 4POXA 3OD7A 2W7YA 5H8HB 5L9SA 1R1NA 1N7XA 3G3FA 4P11A 3TTMA 3RT8A 1UQWA 4H0WA 4NF5A 4QFLA 3ZKKA 1JW4A 3QK6A 4YMBA 2I3VA 1R6ZA 2KR0A 1FQFA 1ATGA 3FXBA 4H45A 4P9KA 3HHGA 1EZPA 1EU8A 1P1UA 4F2OA 4R9GA 4OVPA 2GHAA 3RYDA 1I6QA 1GV8A 2Y7IA 2ZZXA 4RYAA 5I59B 1UTBA 1K9YA 5EQ9A 2XXWA 3CG3A 1DOTA 4DDDA 1DBZA 2IA4A 3H6TA 3U1OA 3G3JA 5H8FA 3MVXA 3IOWA 4DXCA 2REJA 4LN5A 5EQ7A 1O64A 4KQPA 4GWZA 3FXRA 4THIA 3G3IA 3MW0A 4MH5A 2OWTA 3ODBA 4G68B 4RPNA 1NH8A 3SEYA 4GXSB 3KFMA 3JZJA 4PGNA 4R72A 3TQLA 4MJOA 3PMXA 1FTAA 1WDNA 1MQHA 3TTNA 1FSAA 3VFJA 2HXWA 4LA9A 1P99A 1B5HA 1UIVA 2UYEA 4KYEA 3PU5A 3TODA 1QJMA 4F22A 4U1OA 4FBPA 1JVYA 4FECA 4L17A 2XHDA 1RDZA 1PDAA 3IFCA 1XI6A 5B70A 2DDKA 2WX9A 3C31A 5ICTA 1IUDA 3QXMA 3LBSA 1LEVA 3IOUA 4WEDA 4GQOA 4X48A 2H5YA 4GIZA 5AA3A 4KI0E 1TFDA 1BKAA 2F6PA 4PAKA 4QRZA 4P47A 2I4BA 3MP6A 4YMAA 1JEUA 3C34A 1SW4A 3MPKA 3RPLA 1MY4A 1DPEA 1DTZA 3MZ9A 4F31B 4EXLA 3T22A 3GLBA 5LDZA 3OO6A 1UIUA 5CMBA 3U72A 1NV3A 3G3KA 4NG7A 1N04A 1SPIA 1SI1A 4G8MA 3U93A 3SESA 2I48A 4TLLB 2O7UA 1HSEA 4JDFA 4OVQA 4MLVA 3TYHA 1MDQA 3PPOA 1DCUA 2AL5A 1MS7A 1I6AA 3SETA 1FPDA 4NF6A 1TWYA 4G77A 4P3LA 4MLQA 3B6TA 4FEBA 3V83A 1EZ9A 4GWOA 2M8CA 3FASA 3SEWA 3O9PA 2QS4A 2P2AA 3A29A 3OSRA 3LV0A 1RYOA 4F3SA 3KN8A 3LSWA 1NMUA 4NWCA 1D9YA 4UABA 3K00A 1QUKA 4YAHX 1FTKA 5F1QA 3K4UA 2V84A 2YJPA 2PFYA 3T0JA 2BJJX 3KOSA 4U2RA 3HPIA 4GXAA 4X9TA 2B4MA 3OOAA 3R7XA 2RCBA 3PGFA 1YZ0A 4LVQA 2ABHA 2UVIA 1II5A 4X1DA 4PFIA 2OLBA 3K6UA 3UK4A 1FQBA 4N4UA 5I58B 2Q88A 4UA8A 2HXRA 4H8JA 2HZLA 1IXGA 3N6UA 1QW0A 4WKMA 4Q30B 4NF4A 1FBDA 4EQ9A 4M4GA 3D4GA 4R2BA 4O94A 5I57A 5DTBA 3BBRA 4BDOA 1PB9A 3A3UA 3K1PA 1NI9A 1TT1A 2DWIA 1BP5A 4P0IA 1MDP1 1OVBA 3DP8A 5TP9B 2PT1A 3CFZA 2VHAA 5I57B 4HW8A 1Y1MA 2D5WA 1Q1KA 2Y7KA 4NF4B 4IO5A 5B7DA 3W9WA 3VVFA 4PE5B 1IXHA 1B9JA 4XKPA 3MZ1A 4F1YA 3VV5A 4XTCQ 1KA0A 1BLFA 4N6KA 3TQWA 4GL0A 1MQIA 2X26A 1LBCA 5T3JA 4N8YA
chains in the Genus database with same CATH topology
1MH4A 2OCUA 4XF5A 3C33A 1B1HA 4ELQA 5KDTB 1ANFA 1YPNA 5I2KA 2I0CA 5AA4B 3LUZA 3O97A 1P1WA 5ELVA 4ESWA 3H06B 3T66A 1QULA 4N6PA 1QKBA 5HPQA 4N8GA 1YCJA 5EYGA 4PGPA 2OX3A 1PB7A 4IO4A 2R9JA 3IOVA 3UN6A 2O84X 1DPPA 4JBZA 5AA1A 3BIGA 1XVYA 3ISPA 3IX1A 1A7LA 4ISUA 3KN3A 1LFHA 3FXUA 5L9OA 3KGCA 4OQOA 3E79A 3PPNA 3MBPA 3IORA 4I9DA 3OSQA 3MVYA 1LBVA 5IZZA 2G93A 3IJOB 1Y4CA 5A5XB 4MFIA 4ECFA 4RPOA 3B50A 4PE3A 2RCAA 4G68A 3MPLA 1HSLA 1LCFA 2ZNUA 4IO3A 2RKMA 2FHYA 2I0BA 3KZGA 1LLSA 1D4NA 5IAIA 2P1SA 3RPWA 3C35A 1A8EA 2PX1A 1A40A 1M5BA 5I56B 2XD3A 3LSXA 2FIEA 3QUJA 4KPTA 1GR2A 5EYFA 5IGAA 4GD5A 1FBCA 4NGUA 4YZZA 4OANA 4OENA 1Q35A 4FE8A 4RJZA 3B7DA 4NEDA 3FVKA 4OEUA 4Z0IA 4ZDMA 3CVGA 4O3AA 1BK4A 1AL3A 1FQEA 1IMDA 4G8NA 1P1NA 4DCXA 4EXKA 2F7AA 2XWVA 4ESXA 3PV0E 1B52A 5F7VA 1OMPA 2OBGA 3W9VA 4DXUA 3RT6B 2H4IA 4C1UA 2KQZA 4NAPA 4KFQA 2Z22A 3SEXA 4H65A 4PAIA 4PTKA 1LBZA 4KR5A 4N17A 2F8DA 2Q9TA 4QBAA 2XX8A 1M5FA 2Q2CA 5DYHA 1POTA 1MXYA 4MIJA 5EQAA 1H44A 1JW5A 2B65A 1USYH 1WVJA 2RINA 1OQHA 2XXQA 3K01A 2CZKA 4NHBA 4ZEKA 3CIJA 4F1VA 4I8CA 2CEXA 3V5AA 1H43A 3M3FA 4FIMA 4JSOA 4FEDA 3ZSFA 1MPDA 1B7HA 3EHSA 2OK2A 4Q0CA 3I3VA 4P0GA 3O66A 2XXVA 4JB7A 3OO9A 4PFTA 1P1OA 3CG1A 4G8HA 1G0HA 2PYYA 5KZTA 2P3NA 2QVVA 2VGQA 5CMMA 5TPAA 3TFLA 3K0VA 1LAHE 1OLAA 2HZKA 2DQVA 4R74A 1I6BA 4PF6A 2G29A 4I62A 1G0IA 1QKAA 2IEEA 4TOZA 4ELRA 4LATA 4OESA 4HCWA 1R9QA 4YKJA 3MSTA 4QFKA 3BFUA 1EH3A 2H25A 3GYYA 4QF9A 1ZIUA 2QMXA 4LZ5A 4HXVA 2ONKE 4X8RA 5J1DA 4KXPA 1NV5A 1EYIA 1USYE 4IGRA 3TTRA 3IR1A 1SBPA 2VP1A 2B3FA 5FTHA 3MC2A 2WEFA 2Z8EA 3E13X 3FBPA 4U22A 1L5TA 3MZBA 2DE2A 4R6KA 2NXOA 3K02A 1S9TA 1NNKA 4ELPA 2O68A 4PAFA 1MY3A 3KG2A 1LBYA 3KBZA 5J16A 4U23A 2ZZVA 4DIGA 4F29A 5AA4A 3N26A 4ZEBA 1A54A 4F3GA 5I2KB 4GRKA 3B8BA 1RDXA 4Z7EA 3C4MA 3VXBA 2PFZA 5CBRA 1PBQA 3W15C 3PMVA 2I49A 4O8MA 4WEPA 3K2DA 4UACA 2PCRA 4PF8A 3TCFA 4OA4A 1VFEA 5K2XA 3SDFA 1MXWA 4E0XA 5CMCA 5JTYB 3VE1B 2F35A 3FD3A 2DYXA 4NTLA 4WXJA 2XXPA 3IFAA 3PD8A 1BIYA 1IMCA 4NWDA 2X7QA 3IJXB 1ZMGA 5LOMA 3UA8A 1FBFA 2HQ0A 3CSBA 5ET6A 3RNNA 2F78A 3T9VA 1TFAA 2UYFA 3UIFA 4I40A 5ISUA 3HSTA 4JVIA 3E3KA 4RXLA 1US4A 2XXHA 4O3BA 1AOVA 5I7IA 3GZGA 1A99A 4JWOA 1NV2A 4EF2A 1LCTA 1B6HA 2OZZA 3Q25A 1S7YA 1ZJLA 1FPKA 2AIXA 2O7IA 2ZMBA 3M3KA 4AS5A 1CE2A 2ANJA 3H3GA 5EQ8A 4XFEA 2PT2A 3MP1A 3DP6A 1NH7A 4NF0A 4E0WA 3PD9A 4MCOA 4G2ZA 1FPJA 5FTIA 5FHNA 1B51A 1RDYA 3FVGA 1H45A 3MJNA 1A55A 1FPFA 4GX3A 3TPAA 3MUQA 3S9EA 1CB6A 1ELJA 1B3EA 1FCKA 2ONRA 4YICA 5DW8A 3CR9A 1FJ9A 2GHBA 3N5LA 4IY5A 1US5A 5DEXA 1F9BA 5FHOA 1RYXA 4AB6A 3R6UA 1B2HA 1XC1A 1NNTA 2AYSA 4PFBA 1NKXA 3L6HA 1NFTA 2PMSA 1MM6A 1TXFA 2H99A 2NWJA 3M3LA 5H8SA 5TPAB 4ND9A 4EDPA 2E1SA 1B3LA 3PPQA 3T93B 4XKRA 3PUXE 1NV7A 5F24A 1DTGA 4O3CA 3OEMA 1IQ7A 3U92A 1MY1A 2V3UA 4MNCA 2RC9A 1Y9UA 4IR8A 2O6AA 3K6XA 3KJ7A 4FORA 4YKIA 1LSTA 5IZ3B 3Q29A 2WKYA 2HEUA 4NE4A 3HCQA 4XIGQ 1H76A 2Y5LA 4BDMA 2QFLA 3DELB 4HE2A 1KZ8A 4F3PA 1XOCA 4N6DA 5CM6A 2GFEA 3RQTA 3KOTA 4OVSA 4O7IA 2DXYA 4P1LA 1QUJA 2VPOA 1AWBA 1MQDA 1BTJA 2ZXTA 4IO7A 1MXUA 3CSGA 3S4UA 1N0TA 2D21A 3RTWB 1B3FA 4I1DA 4OMBA 1FQAA 1PC3A 4TLMB 1O7TA 3O6GA 1URGA 5H8NA 3QIMA 4I3EA 3OMBA 1B0LA 4MNPA 1FTLA 4QHQA 4ZE8A 4U1ZA 4P1EA 1VE4A 2I3WA 3MP8A 2DE3A 3L6GA 3WAEA 3FATA 4O7MA 1B3GA 4HS7A 1I69A 4G61A 1HSJA 5EHSA 4F39A 4ZZAA 1SQYA 1QUIA 2KLFA 4N13A 1MG1A 4FATA 3FIRA 1LAXA 1MQGA 1PEBA 3KJTA 4PFWA 1YAEA 1JW1A 1NV0A 1Z7ME 1IZ1A 1D9VA 1MXXA 4HE1A 4DXBA 4PETA 3VVDA 2A5TA 2ZNTA 4MBPA 1DMBA 4TQUQ 3QAXA 1FBHA 4I3YA 4XEQA 3TTLA 1B46A 3TCGA 4LQ5A 4EQBA 3D1RA 2CZLA 1UTBB 5I59A 5ESYA 3TCHA 1O63A 1KWHA 1MPCA 4KCCA 2DVCA 2DVZA 5H8NB 1M5CA 3DLNA 3FVNA 3GXAA 3HO7A 4AQ4A 3WAFA 4XKQA 1UTHB 3S2VA 4R6YA 2RC8A 4N07A 3Q28A 4GWYA 4Q8RA 2REGA 3EF7A 4NF5B 1B05A 1SYHA 3OEKA 5FHMA 3ROJA 1JNFA 2R71A 2GH9A 2FA7A 4BDNA 2MKZA 4PQJA 2O1MA 1D3KA 3GBAA 4RY1A 2XXYA 4F3BA 2Q89A 3PUZE 2HAUA 1SVXB 1AMFA 4GWXA 1INPA 2VT5A 4QSDA 1MH3A 2O1LA 1IMAA 3LSFB 1LBBA 3MVZA 2THIA 5ET7A 2I4CA 4GF8A 3H7MA 5I56A 4ZECA 1B32A 3SERA 4EQ7A 3I6VA 3IB2A 4YB6A 3VLUA 4G4PA 4KYDA 1POY1 1AH5A 3DM0A 3U94A 1FJ6A 2XXTA 2QRYA 2XXRA 3VVEA 1ZU0A 3T96B 1SYIA 1KA1A 5TP9A 4H8IA 4FAJA 3E78A 4G68C 5DEXB 1Y20A 1IEJA 3FV2A 3O28A 4GFRA 3K1NA 1LGBC 2R6GE 5DVFA 4C1TA 3T9XB 1LFGA 2D3IA 4ZS9A 5ITOA 2QJEA 2WBDA 4RK9A 2NOOA 4MX6A 1IXIA 4QXDA 5EYHA 3ECRA 5I84A 2HAVA 3RY3A 4U21A 2ESNA 3ILUB 1B4HA 3T1BA 1Y1ZA 2XWIA 3RTFB 1FBGA 1N3WA 1OVTA 1FTOA 2RF1A 2ZYMA 4R73A 1B58A 2LAOA 2V25A 2CMOA 1H3DA 2ZYOA 2XXKA 4JWXA 3SEVA 3O29A 2QS1A 5FBPA 1M5EA 2Z23A 3IL1B 3IB1A 2XXUA 1NV6A 4MEVA 2ONSA 1Y3NA 4PDDA 5CC2A 5HBCA 2FVZA 4X04A 1LB8A 1FPBA 2QMWA 3KBRA 1OIBA 3CHGA 4GWWA 3BFTA 2ALUA 2V93A 4YB7A 1MPBA 4HCYA 1T0KA 2F36A 5A5LA 1JQFA 1FTJA 2QS3A 3S9MC 3HHFA 5BWJA 3UORA 2WYKA 3IOTA 4OZ9A 3QUFA 2PBWA 4AS4A 5JK4A 1N84A 2DP8A 5K2YA 1FPLA 1JVXA 3N94A 3OENA 2FYIA 1CNQA 2HFBA 2O69A 2Z8FA 2I6EA 3KC0A 1FBEA 2XXXA 4H46A 2CZHA 2UXAA 4JWYA 3HFUA 3G3HA 1NV4A 4IB2A 1QVSA 2X7PA 2DSFA 3E4RA 5DVJA 1D9QA 2VOZA 2QPQA 1GGGA 5I58A 2Y7RA 2B3BA 4YKKA 4GVOA 3SZPA 1MXZA 3VLVA 4GL8A 4DI3D 5AE4A 3PUVE 4DE8A 4HE0A 4YU0A 1B5JA 3MQ9A 2NUVA 3K1MA 5I5PA 3GBBA 1A8FA 2OWZA 2DOJA 2DS9A 3TZAA 4RNSA 4DCYA 4PBHA 3FJMA 1R9LA 5H8QA 3IAZA 4R6HA 3UP9A 1MXVA 5CI5A 3RN8A 3G3GA 4HTGA 3TELA 3TTKA 5TU0A 4MAGA 4LUBA 2ZYKA 2QVUA 4NMYA 3NOHA 3HN0A 4NQ8A 3FVOA 3QYTA 2P3VA 3CRBA 1B1XA 4R9FA 4LP2B 4PFUA 3SKPA 2FIXA 4OFLA 4KD5A 5ET5A 4LONB 5I2NA 3D4CA 3C9HA 3FXQA 5ET8A 1NUXA 2XWKA 3FJGA 4POWA 4DLDA 2VD3A 2GQ1A 2DWHA 4IGTA 4NF8B 3KSJA 1FW0A 4GX6A 5CMKA 4IO2A 4R75A 2A5SA 4BDQA 3FZVA 1FQDA 1NUZA 4JVDA 3C36A 4K3FA 4GBWA 4PFRA 2F6GA 3RUMA 1IXCA 3O2AA 1N3XA 1EZOA 2Y84A 2HHMA 3PPRA 3PUYE 1WODA 3FUZA 3O6HA 4PP0A 3LSLA 3RPLB 3Q27A 1VSOA 2DE4A 2XX9A 2H98A 2QS2A 3TAJA 1Y4TA 1NNPA 3EHUA 4QFPA 3PTYA 4NX1A 2XXIA 1URSA 4RA1A 4X1BA 1SW2A 1AIVA 2O51A 4F18A 2XWOA 3QMFA 5BUUA 3THIA 2OJTA 3AXFA 4BDLA 2F3BA 3EPEA 2HCAA 4OETA 4AB5A 3HV1A 4ZE9A 1P1QA 5H8HA 1NV1A 5IKBA 1VDWA 3VLWA 2JJKA 5ICQA 1JP4A 5CRYA 2DWJA 3S9LC 3I5OA 1N7WA 1K9ZA 4FJPA 1JEVA 4OFJA 3TDJA 3EHTA 2YPNA 3B6WA 3UGWA 1B4ZA 2P0SA 3V89B 4GWSA 3S9NC 4OHNA 3A3CA 2A5TB 3G7WA 1XT8A 3CI8A 3EKIA 2RC7A 5IZ1A 1FPGA 2E0SA 1VFDA 5AA2A 3MYUA 3A09A 4KCDA 4PFYA 1ZKBA 3U65A 3PPPA 2Y7WA 3OELA 1OQGA 3OXNA 1B7UA 3PUWE 3LUYA 5H8FB 4NF8A 1FRPA 1VR5A 3V8XB 2NVUB 3H03A 4JVCA 1SW1A 2XA5A 3IK6B 2V4CA 1NNFA 1B40A 5DT6A 5L8DA 3FGSA 4ZZEA 3KN7A 4KHZE 4R2FA 3H6WA 4U4SA 3QSLA 1XVXA 1MRPA 2QL3A 4MHFA 5A5XA 2Q8JA 4LZ7A 4OXVA 2V3TA 2ZYNA 3FV1A 5AA2D 2F97A 2L5VA 1YXIA 3C32A 1MQJA 2CEYA 3MWBA 4OWDA 5I2NB 3SEUA 4PDHA 5H8QB 3Q26A 4BLAA 2ZZWA 2I58A 4QSCA 1ZBMA 2Y7PA 4ONYA 2PVUA 2UVGA 1M5DA 4QFNA 1NL5A 5M2VA 4NN3A 4OFOA 1EYJA 4LQ2A 5KDTA 4N8YA 4JXIA 1LBWA 4H6DA 4N91A 3K6VA 2BJIA 5IZ3A 1MY2A 1OLCA 3CFLA 3EN3A 2Y5KA 1LB9A 1DSNA 4DZ1A 1QGXA 3MAMA 3DP4A 2FBPA 4EUOA 4N81A 3IO6A 4GOTA 3U8QA 3TUSA 5JEIA 1Z7NE 1NUWA 1DK4A 3JYRA 5KCJA 1LAFE 4Q5TA 4YB5A 1PBPA 4F1UA 1B0HA 1YYZA 4XXUA 3KSXA 1JETA 3LR1A 2F7CA 3TKDA 3LC8A 2FNCA 4ZEIA 4ZEDA 1FPEA 1ZLQA 1LFIA 4OERA 2F3DA 2Z8DA 5LTCA 5L9MA 1Y3QA 5EHMA 1GVCA 5JTYA 3K6WA 2AL4A 4XKNA 1ZTYA 4OEVA 2B4LA 4QFOA 1IMEA 3TMGA 5KCJB 1SD3A 4F2QA 4H5FA 4GBVA 2H9BA 1SW5A 1S50A 2VD2A 4GWUA 3TEPA 2QSXA 3B6QA 4H5GA 3ONMA 4OYVA 3PMWA 4MF3A 1SI0A 2XX7A 4DI4B 4YKPA 1B5IA 2F7BA 4OVRA 3M8UA 2UVHA 4KYSA 1YTVA 4MNIA 1PB8A 2F5XA 3OO7A 3ZS6A 3R26A 1URDA 2GRVA 1IITA 1FBPA 2WYPA 5ITPA 3OO8A 4OVTA 2QVRA 4P8BA 1LBXA 3O6IA 3ZKLA 1FPIA 2UVJA 4OVJA 1GTKA 2XD2A 1NUYA 2DXRA 3EQ1A 3VDFA 4H1XA 4M1VA 3USDA 1Q9DA 5CBSA 4PBQA 4ELOA 5HM4B 4U4XA 4P56A 3P7IA 3RGYA 4F19A 3IO4A 1XS5A 3H6VA 1FQCA 3F11A 3KEIA 2Q2AA 1J1NA 3T9HB 4NF6B 3H4ZA 1Y3PA 3JV9A 2Q74A 2Q8MA 4LZ8A 1XHYA 2YLNA 4ZEFA 2CZIA 2HPGA 4OTEA 4PCDA 3T9UA 4N15A 3IB0A 1EYKA 1MY0A 1RKMA 4C0RA 1SDXA 1MM7A 2OWSA 1IMBA 5DVIA 3N6TA 1FTMA 4GX4A 3ILTB 4RK2A 3CFXA 3BKIB 2DWAA 3VXCA 1B3HA 5AA2B 2R8TA 4PC9A 4MMPA 3KC1A 2V3QA 3MVWA 1N76A 3FJ7A 3E9XA 4IY6A 3BIHA 4JSDA 1IIWA 1IMFA 3H6UA 4GLIA 1B7ZA 3RLFE 4QSEA 4EF1A 2ZNSA 5I3SA 2F34A 1UTHA 2VPNA 1LAGE 4IO6A 4H67A 4BDRA 5IM2A 2WBBA 4POXA 3OD7A 2W7YA 5H8HB 5L9SA 1R1NA 1N7XA 3G3FA 4P11A 3TTMA 3RT8A 1UQWA 4H0WA 4NF5A 4QFLA 3ZKKA 1JW4A 3QK6A 4YMBA 2I3VA 1R6ZA 2KR0A 1FQFA 1ATGA 3FXBA 4H45A 1EZPA 4P9KA 1EU8A 1P1UA 4F2OA 4R9GA 4OVPA 2GHAA 3RYDA 1I6QA 1GV8A 2Y7IA 2ZZXA 4RYAA 5I59B 1UTBA 1K9YA 5EQ9A 2XXWA 3CG3A 1DOTA 4DDDA 1DBZA 2IA4A 3H6TA 3U1OA 3G3JA 5H8FA 3MVXA 3IOWA 4DXCA 2REJA 4LN5A 5EQ7A 1O64A 4KQPA 4GWZA 3FXRA 4THIA 3G3IA 3MW0A 4MH5A 2OWTA 3ODBA 4G68B 4RPNA 1NH8A 3SEYA 4GXSB 3KFMA 3JZJA 4R72A 4PGNA 3TQLA 4MJOA 3PMXA 1FTAA 1WDNA 1MQHA 3TTNA 1FSAA 3VFJA 2HXWA 4LA9A 1P99A 1B5HA 1UIVA 2UYEA 4KYEA 3PU5A 3TODA 1QJMA 4F22A 4U1OA 4FBPA 1JVYA 4FECA 4L17A 2XHDA 1RDZA 1PDAA 3IFCA 1XI6A 5B70A 2DDKA 3C31A 5ICTA 2WX9A 1IUDA 3QXMA 3LBSA 3IOUA 1LEVA 4WEDA 4GQOA 4X48A 2H5YA 4GIZA 5AA3A 4KI0E 1TFDA 1BKAA 2F6PA 4PAKA 4QRZA 4P47A 2I4BA 3MP6A 4YMAA 1JEUA 3C34A 1SW4A 3MPKA 3RPLA 1MY4A 1DPEA 1DTZA 3MZ9A 4F31B 4EXLA 3T22A 3GLBA 5LDZA 3OO6A 1UIUA 5CMBA 3U72A 1NV3A 3G3KA 4NG7A 1N04A 1SPIA 1SI1A 4G8MA 3U93A 3SESA 2I48A 4TLLB 2O7UA 1HSEA 4JDFA 4OVQA 4MLVA 3TYHA 1MDQA 3PPOA 1DCUA 2AL5A 1MS7A 1I6AA 3SETA 1FPDA 4NF6A 1TWYA 4G77A 4P3LA 4MLQA 3B6TA 4FEBA 3V83A 1EZ9A 4GWOA 2M8CA 3FASA 3SEWA 3O9PA 2QS4A 2P2AA 3A29A 3OSRA 3LV0A 1RYOA 4F3SA 3KN8A 3LSWA 1NMUA 4NWCA 1D9YA 4UABA 3K00A 1QUKA 4YAHX 1FTKA 5F1QA 3K4UA 2V84A 2YJPA 2PFYA 3T0JA 2BJJX 3KOSA 4U2RA 3HPIA 4GXAA 4X9TA 3OOAA 3R7XA 2B4MA 2RCBA 3PGFA 1YZ0A 4LVQA 2ABHA 2UVIA 1II5A 4X1DA 4PFIA 2OLBA 3K6UA 3UK4A 1FQBA 5I58B 4N4UA 2Q88A 4UA8A 2HXRA 4H8JA 2HZLA 1IXGA 3N6UA 1QW0A 4WKMA 4Q30B 4NF4A 1FBDA 4EQ9A 4M4GA 3D4GA 4R2BA 5I57A 4O94A 5DTBA 3BBRA 4BDOA 1PB9A 3A3UA 3K1PA 1NI9A 1TT1A 2DWIA 1BP5A 4P0IA 1MDP1 1OVBA 3DP8A 5TP9B 2PT1A 3CFZA 2VHAA 5I57B 4HW8A 1Y1MA 2D5WA 1Q1KA 2Y7KA 4NF4B 4IO5A 5B7DA 3W9WA 3VVFA 4PE5B 1IXHA 1B9JA 4XKPA 3MZ1A 4F1YA 3VV5A 4XTCQ 1KA0A 1BLFA 4N6KA 3TQWA 4GL0A 1MQIA 2X26A 1LBCA 5T3JA 3HHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MH4 A;  1B5J A;  2OCU A;  3R6U A;  4ELO A;  4U4X A;  5HM4 B;  3MQ9 A;  1B2H A;  2NUV A;  3C33 A;  3K1M A;  3P7I A;  1XC1 A;  3RGY A;  4F19 A;  1NNT A;  2AYS A;  3S2V A;  3GBB A;  3IO4 A;  1B1H A;  1XS5 A;  1NKX A;  3H6V A;  3L6H A;  4ELQ A;  1ANF A;  1A8F A;  1FQC A;  1YPN A;  3F11 A;  5I2K A;  5KDT B;  2I0C A;  1NFT A;  2DOJ A;  2PMS A;  3KEI A;  2DS9 A;  5AA4 B;  1MM6 A;  3TZA A;  1TXF A;  4RNS A;  2Q2A A;  1J1N A;  3O97 A;  4DCY A;  1P1W A;  5ELV A;  3T9H B;  4NF6 B;  3H06 B;  3T66 A;  4ESW A;  3FJM A;  3H4Z A;  1QUL A;  1Y3P A;  3JV9 A;  4N6P A;  2H99 A;  1QKB A;  1R9L A;  2NWJ A;  5HPQ A;  4LZ8 A;  1XHY A;  1YCJ A;  3M3L A;  5H8S A;  2YLN A;  5H8Q A;  4ZEF A;  5TPA B;  4ND9 A;  4EDP A;  2E1S A;  3IAZ A;  4OTE A;  4R6H A;  3UP9 A;  1MXV A;  1PB7 A;  4IO4 A;  5CI5 A;  3G3G A;  4HTG A;  1B3L A;  2R9J A;  3IOV A;  3RN8 A;  3TEL A;  3TTK A;  3T9U A;  3UN6 A;  2O84 X;  1DPP A;  3IB0 A;  4JBZ A;  5AA1 A;  1MY0 A;  5TU0 A;  3PPQ A;  1XVY A;  4LUB A;  1RKM A;  2ZYK A;  4C0R A;  3T93 B;  3IX1 A;  1A7L A;  4XKR A;  1SDX A;  1MM7 A;  4ISU A;  3PUX E;  2OWS A;  4NMY A;  3HN0 A;  5DVI A;  3N6T A;  1FTM A;  1DTG A;  4O3C A;  3FVO A;  3KN3 A;  3ILT B;  3QYT A;  3CRB A;  3OEM A;  1IQ7 A;  4RK2 A;  1LFH A;  1B1X A;  4R9F A;  4LP2 B;  3CFX A;  3BKI B;  3FXU A;  4PFU A;  3SKP A;  3U92 A;  5L9O A;  3KGC A;  4OFL A;  2DWA A;  4OQO A;  4KD5 A;  3VXC A;  1B3H A;  5AA2 B;  1MY1 A;  2V3U A;  3PPN A;  3MBP A;  3IOR A;  4LON B;  2RC9 A;  5I2N A;  1Y9U A;  4I9D A;  2V3Q A;  3D4C A;  2O6A A;  3C9H A;  3MVW A;  3MVY A;  3OSQ A;  3K6X A;  1N76 A;  3FXQ A;  3FJG A;  2G93 A;  4POW A;  3KJ7 A;  4FOR A;  3FJ7 A;  3E9X A;  4YKI A;  1LST A;  3IJO B;  1Y4C A;  4DLD A;  3Q29 A;  4IY6 A;  4JSD A;  1IIW A;  2VD3 A;  2WKY A;  2HEU A;  3H6U A;  4NE4 A;  5A5X B;  2DWH A;  4MFI A;  4IGT A;  4GLI A;  3HCQ A;  4XIG Q;  1H76 A;  4ECF A;  4RPO A;  4BDM A;  4NF8 B;  3KSJ A;  1FW0 A;  1B7Z A;  2RCA A;  4G68 A;  3DEL B;  3RLF E;  3MPL A;  4QSE A;  2ZNS A;  1HSL A;  4EF1 A;  1LCF A;  1XOC A;  2ZNU A;  4F3P A;  4IO3 A;  2F34 A;  2RKM A;  1UTH A;  5CM6 A;  2GFE A;  5CMK A;  2I0B A;  1LAG E;  3KOT A;  3KZG A;  4IO2 A;  3RQT A;  1LLS A;  1D4N A;  2A5S A;  4IO6 A;  4R75 A;  4H67 A;  4BDQ A;  4BDR A;  5IAI A;  2DXY A;  3FZV A;  2P1S A;  1QUJ A;  3RPW A;  3C35 A;  4ZZE A;  1A8E A;  2PX1 A;  4POX A;  1FQD A;  3OD7 A;  2W7Y A;  5H8H B;  5L9S A;  1A40 A;  1R1N A;  1N7X A;  1MQD A;  3G3F A;  1M5B A;  1BTJ A;  4P11 A;  3TTM A;  5I56 B;  2XD3 A;  3LSX A;  3RT8 A;  3QUJ A;  3C36 A;  1UQW A;  4H0W A;  4K3F A;  2ZXT A;  1GR2 A;  4IO7 A;  4KPT A;  4NF5 A;  5EYF A;  4GD5 A;  1MXU A;  2F6G A;  4QFL A;  3RUM A;  1IXC A;  3ZKK A;  3CSG A;  3O2A A;  1JW4 A;  3S4U A;  1N0T A;  1N3X A;  1EZO A;  2Y84 A;  3QK6 A;  4YZZ A;  2D21 A;  3PPR A;  3PUY E;  1B3F A;  3RTW B;  4OEN A;  2I3V A;  4YMB A;  1WOD A;  1Q35 A;  1R6Z A;  3FUZ A;  1FQA A;  1PC3 A;  3B7D A;  4FE8 A;  1FQF A;  1ATG A;  4I1D A;  3FVK A;  4NED A;  4OEU A;  4OMB A;  4Z0I A;  4TLM B;  4ZDM A;  3CVG A;  3O6H A;  1EZP A;  4PP0 A;  1O7T A;  1EU8 A;  3O6G A;  4O3A A;  1AL3 A;  1P1U A;  4F2O A;  1URG A;  1FQE A;  3LSL A;  4G8N A;  4R9G A;  1P1N A;  3QIM A;  5H8N A;  4DCX A;  2GHA A;  3Q27 A;  4EXK A;  1VSO A;  3OMB A;  1B0L A;  4ELR A;  2DE4 A;  2F7A A;  2XX9 A;  2H98 A;  2QS2 A;  1I6Q A;  1GV8 A;  3TAJ A;  2Y7I A;  1Y4T A;  4ESX A;  1FTL A;  1NNP A;  4RYA A;  3PV0 E;  3EHU A;  4QFP A;  5I59 B;  1UTB A;  4QHQ A;  1B52 A;  4ZE8 A;  5F7V A;  1OMP A;  2OBG A;  2XXI A;  3W9V A;  4DXU A;  3RT6 B;  1URS A;  4U1Z A;  3TEP A;  1VE4 A;  2XXW A;  4RA1 A;  2I3W A;  3CG3 A;  4YU0 A;  3MP8 A;  2DE3 A;  2H4I A;  3L6G A;  4X1B A;  3WAE A;  4C1U A;  1SW2 A;  1AIV A;  1DOT A;  2O51 A;  3FAT A;  4DDD A;  4F18 A;  1B3G A;  4HS7 A;  4KFQ A;  5BUU A;  2Z22 A;  3THI A;  4EQ9 A;  2OJT A;  1I69 A;  4H65 A;  3SEX A;  3AXF A;  2IA4 A;  4BDL A;  3EPE A;  1HSJ A;  2HCA A;  3H6T A;  5EHS A;  4ZZA A;  4OET A;  3U1O A;  4F39 A;  3G3J A;  1SQY A;  3HV1 A;  4AB5 A;  5H8F A;  4ZE9 A;  1P1Q A;  1QUI A;  4KR5 A;  3MVX A;  2KLF A;  4N13 A;  1MG1 A;  4FAT A;  2F8D A;  2Q9T A;  5H8H A;  3IOW A;  2XX8 A;  3FIR A;  1M5F A;  5IKB A;  2Q2C A;  1LAX A;  1MQG A;  5DYH A;  3VLW A;  4DXC A;  5ICQ A;  1PEB A;  2REJ A;  3KJT A;  4PFW A;  1POT A;  1YAE A;  5CRY A;  2DWJ A;  1JW1 A;  1O64 A;  1MXY A;  1N7W A;  3I5O A;  1Z7M E;  4KQP A;  3S9L C;  3FXR A;  1IZ1 A;  1D9V A;  1MXX A;  4FJP A;  3G3I A;  4THI A;  1JEV A;  4DXB A;  3MW0 A;  1H44 A;  1JW5 A;  4OFJ A;  3TDJ A;  4PET A;  3EHT A;  2B65 A;  4MH5 A;  2YPN A;  2OWT A;  1USY H;  3B6W A;  3ODB A;  4G68 B;  4RPN A;  3VVD A;  1WVJ A;  1NH8 A;  2A5T A;  2ZNT A;  3UGW A;  4MBP A;  1DMB A;  2RIN A;  4TQU Q;  3QAX A;  1OQH A;  3SEY A;  1B4Z A;  2P0S A;  3TTL A;  2XXQ A;  3K01 A;  3KFM A;  4GXS B;  3JZJ A;  4R72 A;  4ZEK A;  3CIJ A;  3TQL A;  1B46 A;  3V89 B;  3TCG A;  3PMX A;  3S9N C;  4OHN A;  4I8C A;  4LQ5 A;  4F1V A;  3A3C A;  3V5A A;  2A5T B;  4EQB A;  1H43 A;  3M3F A;  4FIM A;  3G7W A;  1WDN A;  3S9M C;  1MQH A;  1XT8 A;  4JSO A;  3TTN A;  2CZL A;  3VFJ A;  3CI8 A;  1UTB B;  4FED A;  2HXW A;  5I59 A;  4LA9 A;  2RC7 A;  3ZSF A;  1MPD A;  1B7H A;  1O63 A;  2OK2 A;  3EHS A;  3TCH A;  1KWH A;  1P99 A;  1VFD A;  2E0S A;  1MPC A;  4Q0C A;  5AA2 A;  4KCC A;  3A09 A;  1B5H A;  4KCD A;  1UIV A;  3I3V A;  4PFY A;  1ZKB A;  2DVC A;  2DVZ A;  4P0G A;  5H8N B;  2UYE A;  1M5C A;  3DLN A;  3FVN A;  3GXA A;  3HO7 A;  3O66 A;  4KYE A;  2XXV A;  3PU5 A;  4JB7 A;  3OO9 A;  3PPP A;  1QJM A;  3TOD A;  2Y7W A;  4AQ4 A;  3WAF A;  4F22 A;  4U1O A;  3OEL A;  1OQG A;  3OXN A;  1JVY A;  4XKQ A;  1B7U A;  4PFT A;  1P1O A;  1UTH B;  2XHD A;  3CG1 A;  3LUY A;  3PUW E;  4FEC A;  4G8H A;  4L17 A;  5H8F B;  2PYY A;  4R6Y A;  2RC8 A;  4N07 A;  5KZT A;  3Q28 A;  1PDA A;  4Q8R A;  2REG A;  5B70 A;  4NF8 A;  3C31 A;  5ICT A;  1VR5 A;  3EF7 A;  2NVU B;  1IUD A;  4NF5 B;  3V8X B;  3QXM A;  1B05 A;  3H03 A;  1SYH A;  1SW1 A;  2VGQ A;  3OEK A;  5CMM A;  3LBS A;  5TPA A;  5FHM A;  3IOU A;  3K0V A;  3TFL A;  1LAH E;  1OLA A;  4WED A;  3IK6 B;  1NNF A;  1B40 A;  2HZK A;  4GQO A;  4TOZ A;  1JNF A;  5DT6 A;  2R71 A;  2DQV A;  4R74 A;  2GH9 A;  2H5Y A;  4X48 A;  1I6B A;  4GIZ A;  2FA7 A;  5L8D A;  4BDN A;  2G29 A;  4I62 A;  5AA3 A;  4KI0 E;  1QKA A;  1BKA A;  1TFD A;  4PQJ A;  2F6P A;  2IEE A;  3FGS A;  2O1M A;  1D3K A;  3GBA A;  3KN7 A;  4LAT A;  4QRZ A;  2I4B A;  4OES A;  4HCW A;  4KHZ E;  4RY1 A;  3MP6 A;  2XXY A;  1JEU A;  2Q89 A;  3C34 A;  3H6W A;  4R2F A;  4U4S A;  4EQ7 A;  1SW4 A;  4F3B A;  3MPK A;  3QSL A;  1R9Q A;  1XVX A;  3PUZ E;  2HAU A;  4YKJ A;  1MRP A;  4QFK A;  2QL3 A;  3BFU A;  1MY4 A;  1DPE A;  1SVX B;  1DTZ A;  1EH3 A;  3MZ9 A;  2H25 A;  5A5X A;  2Q8J A;  4LZ7 A;  4OXV A;  1AMF A;  2V3T A;  2ZYN A;  3FV1 A;  4F31 B;  4QF9 A;  4EXL A;  5AA2 D;  2F97 A;  1ZIU A;  4QSD A;  3T22 A;  2QMX A;  1MH3 A;  3GLB A;  4LZ5 A;  2O1L A;  3C32 A;  1MQJ A;  2ONK E;  3LSF B;  5J1D A;  1LBB A;  3OO6 A;  3MVZ A;  5CBS A;  1UIU A;  2THI A;  3MWB A;  4OWD A;  2I4C A;  5I2N B;  4GF8 A;  3SEU A;  3H7M A;  1USY E;  5I56 A;  4IGR A;  3TTR A;  4ZEC A;  3IR1 A;  1B32 A;  1SBP A;  5H8Q B;  3SER A;  2VP1 A;  4RJZ A;  3Q26 A;  5CMB A;  3U72 A;  4BLA A;  2B3F A;  2I58 A;  3I6V A;  4QSC A;  5FTH A;  1ZBM A;  3IB2 A;  3G3K A;  4YB6 A;  3MC2 A;  2Y7P A;  4ONY A;  4G4P A;  3VLU A;  1N04 A;  2Z8E A;  3E13 X;  1SI1 A;  2PVU A;  2UVG A;  4G8M A;  4KYD A;  1POY 1;  1M5D A;  4QFN A;  1NL5 A;  1AH5 A;  5M2V A;  4U22 A;  1L5T A;  3U93 A;  3DM0 A;  3U94 A;  3SES A;  2XXT A;  2QRY A;  2XXR A;  4LQ2 A;  4OFO A;  1ZU0 A;  3VVE A;  3T96 B;  2I48 A;  4JXI A;  5KDT A;  4TLL B;  1SYI A;  2O7U A;  1HSE A;  4H6D A;  3MZB A;  4JDF A;  4MLV A;  5TP9 A;  4H8I A;  3TYH A;  4FAJ A;  2DE2 A;  1MDQ A;  4G68 C;  4R6K A;  2NXO A;  3K02 A;  1S9T A;  3K6V A;  1NNK A;  3PPO A;  5DEX B;  4ELP A;  1Y20 A;  2AL5 A;  2O68 A;  1MY3 A;  1MS7 A;  3KG2 A;  1IEJ A;  3FV2 A;  3O28 A;  4GFR A;  1I6A A;  1MY2 A;  4U23 A;  3SET A;  1OLC A;  3K1N A;  4DIG A;  3CFL A;  1LGB C;  4NF6 A;  3EN3 A;  1LB9 A;  2R6G E;  1TWY A;  4G77 A;  1DSN A;  5DVF A;  3N26 A;  4C1T A;  4DZ1 A;  4ZEB A;  4F29 A;  5AA4 A;  1A54 A;  4F3G A;  3MAM A;  1LFG A;  4MLQ A;  5I2K B;  3T9X B;  3B6T A;  2D3I A;  3DP4 A;  4GRK A;  4ZS9 A;  5ITO A;  2QJE A;  4FEB A;  4EUO A;  1EZ9 A;  4GWO A;  3V83 A;  4RK9 A;  3IO6 A;  2NOO A;  4Z7E A;  3C4M A;  3VXB A;  4GOT A;  1IXI A;  5CBR A;  1PBQ A;  3U8Q A;  3W15 C;  3ECR A;  3PMV A;  5I84 A;  3TUS A;  2M8C A;  3FAS A;  3SEW A;  5JEI A;  2I49 A;  2HAV A;  1Z7N E;  3O9P A;  4WEP A;  3RY3 A;  2QS4 A;  4U21 A;  2ESN A;  2P2A A;  3ILU B;  1B4H A;  3JYR A;  1Y1Z A;  3K2D A;  4UAC A;  3OSR A;  1LAF E;  5KCJ A;  3RTF B;  1N3W A;  1OVT A;  1FTO A;  1RYO A;  4Q5T A;  1PBP A;  2RF1 A;  2ZYM A;  4YB5 A;  4R73 A;  3TCF A;  4F1U A;  1B0H A;  4F3S A;  1VFE A;  4XXU A;  3KSX A;  3KN8 A;  1B58 A;  2LAO A;  2V25 A;  3LSW A;  1NMU A;  2CMO A;  1H3D A;  5K2X A;  2ZYO A;  1JET A;  4JWX A;  4NWC A;  1MXW A;  3LR1 A;  2F7C A;  3SDF A;  3SEV A;  3O29 A;  3TKD A;  4E0X A;  2QS1 A;  5CMC A;  3LC8 A;  5JTY B;  1D9Y A;  1M5E A;  2FNC A;  2Z23 A;  3IL1 B;  2F35 A;  2XXU A;  3FD3 A;  3IB1 A;  4ZEI A;  3VE1 B;  4ZED A;  5JK4 A;  1ZLQ A;  2DYX A;  4NTL A;  1LFI A;  4OER A;  2ONS A;  2XXP A;  4WXJ A;  2Z8D A;  1Y3N A;  3PD8 A;  1BIY A;  5L9M A;  3K00 A;  1Y3Q A;  5EHM A;  5CC2 A;  1QUK A;  5HBC A;  4NWD A;  2X7Q A;  1FTK A;  4YAH X;  3K4U A;  5F1Q A;  1LB8 A;  1GVC A;  5JTY A;  3IJX B;  2QMW A;  3KBR A;  1OIB A;  1ZMG A;  5LOM A;  3BFT A;  2V84 A;  3K6W A;  2YJP A;  2AL4 A;  2ALU A;  4XKN A;  2V93 A;  1ZTY A;  4YB7 A;  2BJJ X;  4OEV A;  3UA8 A;  1MPB A;  3KOS A;  4U2R A;  3HPI A;  4HCY A;  4GXA A;  4X9T A;  2HQ0 A;  3CSB A;  1T0K A;  3RNN A;  2F36 A;  4QFO A;  3OOA A;  3R7X A;  1JQF A;  1FTJ A;  2QS3 A;  3HHF A;  3TMG A;  5BWJ A;  2RCB A;  3PGF A;  1SD3 A;  3UOR A;  4LVQ A;  4F2Q A;  5KCJ B;  3IOT A;  2ABH A;  4OZ9 A;  2F78 A;  3QUF A;  3T9V A;  2PBW A;  4H5F A;  2UVI A;  1II5 A;  2H9B A;  1TFA A;  2UYF A;  4X1D A;  1SW5 A;  1S50 A;  3UIF A;  2VD2 A;  2OLB A;  3K6U A;  2QSX A;  3B6Q A;  1N84 A;  3UK4 A;  1FQB A;  2DP8 A;  4H5G A;  5K2Y A;  2Q88 A;  5I58 B;  4UA8 A;  5ISU A;  4H8J A;  1JVX A;  2HZL A;  3HST A;  1IXG A;  3E3K A;  1QW0 A;  3N6U A;  3N94 A;  3OEN A;  3ONM A;  2FYI A;  4OYV A;  4WKM A;  2HFB A;  3PMW A;  4Q30 B;  4NF4 A;  2O69 A;  2Z8F A;  4RXL A;  4MF3 A;  1SI0 A;  1US4 A;  2XXH A;  2XX7 A;  4M4G A;  4O3B A;  2I6E A;  3D4G A;  1AOV A;  4R2B A;  4YKP A;  3GZG A;  1A99 A;  5I57 A;  5DTB A;  1B5I A;  2F7B A;  4JWO A;  4YMA A;  2XXX A;  3BBR A;  4BDO A;  1PB9 A;  3M8U A;  2UXA A;  3A3U A;  2UVH A;  3K1P A;  4KYS A;  4EF2 A;  1LCT A;  4JWY A;  1TT1 A;  1B6H A;  1YTV A;  1PB8 A;  2OZZ A;  3Q25 A;  2DWI A;  2F5X A;  3OO7 A;  1S7Y A;  1BP5 A;  1ZJL A;  3G3H A;  3ZS6 A;  2AIX A;  2O7I A;  2ZMB A;  3M3K A;  1CE2 A;  2ANJ A;  4P0I A;  3R26 A;  4IB2 A;  3H3G A;  1MDP 1;  1URD A;  1OVB A;  1QVS A;  3DP8 A;  5TP9 B;  2GRV A;  2PT1 A;  2PT2 A;  3CFZ A;  3MP1 A;  2VHA A;  1IIT A;  5I57 B;  2X7P A;  3DP6 A;  1Y1M A;  2D5W A;  4HW8 A;  2DSF A;  1NH7 A;  1Q1K A;  3E4R A;  5ITP A;  4E0W A;  3PD9 A;  2Y7K A;  3OO8 A;  4NF4 B;  5DVJ A;  4IO5 A;  4G2Z A;  5B7D A;  2VOZ A;  3W9W A;  3VVF A;  4PE5 B;  5FHN A;  1IXH A;  5FTI A;  1B51 A;  1B9J A;  3FVG A;  2QPQ A;  3O6I A;  4XKP A;  1H45 A;  1GGG A;  3MJN A;  1A55 A;  5I58 A;  3MZ1 A;  4F1Y A;  3VV5 A;  3ZKL A;  3TPA A;  3MUQ A;  2UVJ A;  3S9E A;  2Y7R A;  1CB6 A;  4XTC Q;  2B3B A;  1ELJ A;  4YKK A;  1B3E A;  1BLF A;  1GTK A;  2XD2 A;  4OVJ A;  4GVO A;  3TQW A;  2DXR A;  1MXZ A;  1FCK A;  2ONR A;  4YIC A;  3EQ1 A;  4GL0 A;  3VLV A;  3CR9 A;  4GL8 A;  3VDF A;  1MQI A;  4H1X A;  2GHB A;  4M1V A;  5AE4 A;  3N5L A;  4IY5 A;  2X26 A;  3USD A;  1US5 A;  3PUV E;  4DE8 A;  5DEX A;  1LBC A;  1F9B A;  5FHO A;  1RYX A;  4AB6 A;  3HHG A; 
#chains in the Genus database with same CATH topology
 1MH4 A;  2OCU A;  4XF5 A;  3C33 A;  1B1H A;  4ELQ A;  5KDT B;  1ANF A;  1YPN A;  5I2K A;  2I0C A;  5AA4 B;  3LUZ A;  3O97 A;  1P1W A;  5ELV A;  4ESW A;  3H06 B;  3T66 A;  1QUL A;  4N6P A;  1QKB A;  5HPQ A;  4N8G A;  1YCJ A;  5EYG A;  4PGP A;  2OX3 A;  1PB7 A;  4IO4 A;  2R9J A;  3IOV A;  3UN6 A;  2O84 X;  1DPP A;  4JBZ A;  5AA1 A;  3BIG A;  1XVY A;  3ISP A;  3IX1 A;  1A7L A;  4ISU A;  3KN3 A;  1LFH A;  3FXU A;  5L9O A;  3KGC A;  4OQO A;  3E79 A;  3PPN A;  3MBP A;  3IOR A;  4I9D A;  3OSQ A;  3MVY A;  1LBV A;  5IZZ A;  2G93 A;  3IJO B;  1Y4C A;  5A5X B;  4MFI A;  4ECF A;  4RPO A;  3B50 A;  4PE3 A;  2RCA A;  4G68 A;  3MPL A;  1HSL A;  1LCF A;  2ZNU A;  4IO3 A;  2RKM A;  2FHY A;  2I0B A;  3KZG A;  1LLS A;  1D4N A;  5IAI A;  2P1S A;  3RPW A;  3C35 A;  1A8E A;  2PX1 A;  1A40 A;  1M5B A;  5I56 B;  2XD3 A;  2FIE A;  3LSX A;  3QUJ A;  4KPT A;  1GR2 A;  5EYF A;  5IGA A;  4GD5 A;  1FBC A;  4NGU A;  4OAN A;  4YZZ A;  4OEN A;  1Q35 A;  4FE8 A;  4RJZ A;  3B7D A;  4NED A;  3FVK A;  4OEU A;  4Z0I A;  4ZDM A;  3CVG A;  4O3A A;  1BK4 A;  1AL3 A;  1FQE A;  1IMD A;  4G8N A;  1P1N A;  4DCX A;  4EXK A;  2F7A A;  2XWV A;  4ESX A;  3PV0 E;  1B52 A;  5F7V A;  1OMP A;  2OBG A;  3W9V A;  4DXU A;  3RT6 B;  2H4I A;  4C1U A;  2KQZ A;  4NAP A;  4KFQ A;  2Z22 A;  4PAI A;  4H65 A;  3SEX A;  4PTK A;  1LBZ A;  4KR5 A;  4N17 A;  2F8D A;  2Q9T A;  4QBA A;  2XX8 A;  1M5F A;  2Q2C A;  5DYH A;  1POT A;  1MXY A;  4MIJ A;  5EQA A;  1H44 A;  1JW5 A;  2B65 A;  1USY H;  1WVJ A;  2RIN A;  1OQH A;  2XXQ A;  2CZK A;  3K01 A;  4NHB A;  4ZEK A;  3CIJ A;  4F1V A;  2CEX A;  4I8C A;  3V5A A;  1H43 A;  3M3F A;  4FIM A;  4JSO A;  4FED A;  3ZSF A;  1MPD A;  1B7H A;  3EHS A;  2OK2 A;  4Q0C A;  3I3V A;  4P0G A;  3O66 A;  2XXV A;  4JB7 A;  3OO9 A;  4PFT A;  1P1O A;  3CG1 A;  4G8H A;  1G0H A;  2PYY A;  5KZT A;  2P3N A;  2QVV A;  2VGQ A;  5CMM A;  5TPA A;  3TFL A;  3K0V A;  1LAH E;  1OLA A;  2HZK A;  2DQV A;  4R74 A;  1I6B A;  4PF6 A;  2G29 A;  1G0I A;  4I62 A;  1QKA A;  2IEE A;  4TOZ A;  4LAT A;  4ELR A;  4OES A;  4HCW A;  1R9Q A;  4YKJ A;  3MST A;  4QFK A;  3BFU A;  1EH3 A;  2H25 A;  3GYY A;  4QF9 A;  1ZIU A;  2QMX A;  4LZ5 A;  4HXV A;  2ONK E;  4X8R A;  4KXP A;  5J1D A;  1NV5 A;  1EYI A;  1USY E;  4IGR A;  3TTR A;  3IR1 A;  1SBP A;  2VP1 A;  2B3F A;  5FTH A;  3MC2 A;  2WEF A;  2Z8E A;  3E13 X;  3FBP A;  4U22 A;  1L5T A;  3MZB A;  2DE2 A;  4R6K A;  2NXO A;  3K02 A;  1S9T A;  1NNK A;  4ELP A;  2O68 A;  4PAF A;  1MY3 A;  3KG2 A;  1LBY A;  3KBZ A;  5J16 A;  4U23 A;  2ZZV A;  4DIG A;  4F29 A;  5AA4 A;  3N26 A;  4ZEB A;  1A54 A;  4F3G A;  5I2K B;  4GRK A;  3B8B A;  1RDX A;  4Z7E A;  3C4M A;  2PFZ A;  3VXB A;  5CBR A;  1PBQ A;  3W15 C;  3PMV A;  2I49 A;  4O8M A;  4WEP A;  3K2D A;  4UAC A;  2PCR A;  4PF8 A;  3TCF A;  4OA4 A;  1VFE A;  5K2X A;  3SDF A;  1MXW A;  4E0X A;  5CMC A;  5JTY B;  3VE1 B;  2F35 A;  3FD3 A;  2DYX A;  4NTL A;  4WXJ A;  2XXP A;  3IFA A;  3PD8 A;  1BIY A;  1IMC A;  4NWD A;  2X7Q A;  3IJX B;  1ZMG A;  5LOM A;  3UA8 A;  1FBF A;  2HQ0 A;  3CSB A;  5ET6 A;  3RNN A;  2F78 A;  3T9V A;  1TFA A;  2UYF A;  3UIF A;  4I40 A;  5ISU A;  3HST A;  4JVI A;  3E3K A;  4RXL A;  1US4 A;  2XXH A;  4O3B A;  1AOV A;  5I7I A;  3GZG A;  1A99 A;  4JWO A;  1NV2 A;  4EF2 A;  1LCT A;  1B6H A;  2OZZ A;  3Q25 A;  1S7Y A;  1FPK A;  1ZJL A;  2AIX A;  2O7I A;  2ZMB A;  3M3K A;  4AS5 A;  1CE2 A;  2ANJ A;  3H3G A;  5EQ8 A;  4XFE A;  2PT2 A;  3MP1 A;  3DP6 A;  1NH7 A;  4NF0 A;  4E0W A;  3PD9 A;  4MCO A;  4G2Z A;  1FPJ A;  5FTI A;  5FHN A;  1B51 A;  1RDY A;  3FVG A;  1H45 A;  3MJN A;  1A55 A;  1FPF A;  4GX3 A;  3TPA A;  3MUQ A;  3S9E A;  1CB6 A;  1ELJ A;  1B3E A;  1FCK A;  2ONR A;  4YIC A;  5DW8 A;  1FJ9 A;  3CR9 A;  2GHB A;  3N5L A;  4IY5 A;  1US5 A;  5DEX A;  1F9B A;  5FHO A;  1RYX A;  4AB6 A;  3R6U A;  1B2H A;  1XC1 A;  1NNT A;  2AYS A;  4PFB A;  1NKX A;  3L6H A;  1NFT A;  2PMS A;  1MM6 A;  1TXF A;  2H99 A;  2NWJ A;  3M3L A;  5H8S A;  5TPA B;  4ND9 A;  4EDP A;  2E1S A;  1B3L A;  3PPQ A;  3T93 B;  4XKR A;  3PUX E;  1NV7 A;  5F24 A;  1DTG A;  4O3C A;  3OEM A;  1IQ7 A;  3U92 A;  1MY1 A;  2V3U A;  4MNC A;  2RC9 A;  1Y9U A;  4IR8 A;  2O6A A;  3K6X A;  3KJ7 A;  4FOR A;  4YKI A;  1LST A;  5IZ3 B;  3Q29 A;  2WKY A;  2HEU A;  4NE4 A;  3HCQ A;  4XIG Q;  1H76 A;  2Y5L A;  4BDM A;  2QFL A;  3DEL B;  4HE2 A;  1KZ8 A;  4F3P A;  1XOC A;  4N6D A;  5CM6 A;  2GFE A;  3RQT A;  3KOT A;  4OVS A;  4O7I A;  2DXY A;  4P1L A;  1QUJ A;  2VPO A;  1AWB A;  1MQD A;  1BTJ A;  2ZXT A;  4IO7 A;  1MXU A;  3CSG A;  3S4U A;  1N0T A;  2D21 A;  3RTW B;  1B3F A;  4I1D A;  4OMB A;  1FQA A;  1PC3 A;  4TLM B;  1O7T A;  3O6G A;  1URG A;  5H8N A;  3QIM A;  4I3E A;  3OMB A;  1B0L A;  4MNP A;  1FTL A;  4QHQ A;  4ZE8 A;  4U1Z A;  4P1E A;  1VE4 A;  2I3W A;  3MP8 A;  2DE3 A;  3L6G A;  3WAE A;  3FAT A;  4O7M A;  1B3G A;  4HS7 A;  1I69 A;  4G61 A;  1HSJ A;  5EHS A;  4F39 A;  4ZZA A;  1SQY A;  1QUI A;  2KLF A;  4N13 A;  1MG1 A;  4FAT A;  3FIR A;  1LAX A;  1MQG A;  1PEB A;  3KJT A;  4PFW A;  1YAE A;  1JW1 A;  1NV0 A;  1Z7M E;  1IZ1 A;  1D9V A;  1MXX A;  4HE1 A;  4DXB A;  4PET A;  3VVD A;  2A5T A;  2ZNT A;  4MBP A;  1DMB A;  4TQU Q;  3QAX A;  1FBH A;  4I3Y A;  4XEQ A;  3TTL A;  1B46 A;  3TCG A;  4LQ5 A;  4EQB A;  3D1R A;  2CZL A;  1UTB B;  5I59 A;  5ESY A;  3TCH A;  1O63 A;  1KWH A;  1MPC A;  4KCC A;  2DVC A;  2DVZ A;  5H8N B;  1M5C A;  3DLN A;  3FVN A;  3GXA A;  3HO7 A;  4AQ4 A;  3WAF A;  4XKQ A;  1UTH B;  3S2V A;  4R6Y A;  2RC8 A;  4N07 A;  3Q28 A;  4GWY A;  4Q8R A;  2REG A;  3EF7 A;  4NF5 B;  1B05 A;  1SYH A;  3OEK A;  5FHM A;  3ROJ A;  1JNF A;  2R71 A;  2GH9 A;  2FA7 A;  2MKZ A;  4BDN A;  4PQJ A;  2O1M A;  1D3K A;  3GBA A;  4RY1 A;  2XXY A;  4F3B A;  2Q89 A;  3PUZ E;  2HAU A;  1SVX B;  1AMF A;  4GWX A;  1INP A;  2VT5 A;  4QSD A;  1MH3 A;  2O1L A;  1IMA A;  3LSF B;  1LBB A;  3MVZ A;  2THI A;  5ET7 A;  2I4C A;  4GF8 A;  3H7M A;  5I56 A;  4ZEC A;  1B32 A;  3SER A;  3I6V A;  4EQ7 A;  3IB2 A;  4YB6 A;  3VLU A;  4G4P A;  4KYD A;  1POY 1;  1AH5 A;  3DM0 A;  3U94 A;  1FJ6 A;  2XXT A;  2QRY A;  2XXR A;  3VVE A;  1ZU0 A;  3T96 B;  1SYI A;  1KA1 A;  5TP9 A;  4H8I A;  3E78 A;  4FAJ A;  4G68 C;  5DEX B;  1Y20 A;  1IEJ A;  3FV2 A;  3O28 A;  4GFR A;  3K1N A;  1LGB C;  2R6G E;  5DVF A;  4C1T A;  3T9X B;  1LFG A;  2D3I A;  4ZS9 A;  5ITO A;  2QJE A;  2WBD A;  4RK9 A;  2NOO A;  4MX6 A;  1IXI A;  4QXD A;  5EYH A;  3ECR A;  5I84 A;  2HAV A;  3RY3 A;  4U21 A;  2ESN A;  3ILU B;  1B4H A;  3T1B A;  1Y1Z A;  2XWI A;  1FBG A;  3RTF B;  1N3W A;  1OVT A;  1FTO A;  2RF1 A;  2ZYM A;  4R73 A;  1B58 A;  2LAO A;  2V25 A;  2CMO A;  1H3D A;  2XXK A;  2ZYO A;  4JWX A;  3SEV A;  3O29 A;  2QS1 A;  5FBP A;  1M5E A;  2Z23 A;  3IL1 B;  3IB1 A;  2XXU A;  1NV6 A;  4MEV A;  2ONS A;  1Y3N A;  4PDD A;  5CC2 A;  2FVZ A;  5HBC A;  4X04 A;  1LB8 A;  1FPB A;  2QMW A;  3KBR A;  1OIB A;  3CHG A;  4GWW A;  3BFT A;  2ALU A;  2V93 A;  4YB7 A;  1MPB A;  4HCY A;  1T0K A;  2F36 A;  5A5L A;  1JQF A;  1FTJ A;  2QS3 A;  3HHF A;  5BWJ A;  3S9M C;  3UOR A;  2WYK A;  3IOT A;  4OZ9 A;  3QUF A;  2PBW A;  4AS4 A;  5JK4 A;  1N84 A;  2DP8 A;  5K2Y A;  1FPL A;  1JVX A;  3N94 A;  3OEN A;  2FYI A;  1CNQ A;  2HFB A;  2O69 A;  2Z8F A;  2I6E A;  3KC0 A;  1FBE A;  2XXX A;  4H46 A;  2CZH A;  2UXA A;  4JWY A;  3HFU A;  3G3H A;  1NV4 A;  4IB2 A;  1QVS A;  2X7P A;  2DSF A;  3E4R A;  1D9Q A;  5DVJ A;  2VOZ A;  2QPQ A;  1GGG A;  5I58 A;  2Y7R A;  2B3B A;  4YKK A;  4GVO A;  3SZP A;  1MXZ A;  3VLV A;  4GL8 A;  4DI3 D;  5AE4 A;  3PUV E;  4DE8 A;  4HE0 A;  4YU0 A;  1B5J A;  3MQ9 A;  2NUV A;  3K1M A;  5I5P A;  3GBB A;  1A8F A;  2OWZ A;  2DOJ A;  2DS9 A;  3TZA A;  4RNS A;  4DCY A;  4PBH A;  3FJM A;  1R9L A;  5H8Q A;  3IAZ A;  4R6H A;  3UP9 A;  1MXV A;  5CI5 A;  3RN8 A;  3G3G A;  4HTG A;  3TEL A;  3TTK A;  5TU0 A;  4MAG A;  4LUB A;  2ZYK A;  2QVU A;  4NMY A;  3NOH A;  3HN0 A;  4NQ8 A;  3FVO A;  3QYT A;  2P3V A;  3CRB A;  1B1X A;  4R9F A;  4LP2 B;  4PFU A;  3SKP A;  2FIX A;  4OFL A;  4KD5 A;  5ET5 A;  4LON B;  5I2N A;  3D4C A;  3C9H A;  3FXQ A;  5ET8 A;  1NUX A;  2XWK A;  3FJG A;  4POW A;  4DLD A;  2VD3 A;  2GQ1 A;  2DWH A;  4IGT A;  4NF8 B;  3KSJ A;  1FW0 A;  4GX6 A;  5CMK A;  4IO2 A;  4R75 A;  2A5S A;  4BDQ A;  3FZV A;  1FQD A;  1NUZ A;  4JVD A;  3C36 A;  4K3F A;  4GBW A;  4PFR A;  2F6G A;  3RUM A;  1IXC A;  3O2A A;  1N3X A;  1EZO A;  2Y84 A;  2HHM A;  3PPR A;  3PUY E;  1WOD A;  3FUZ A;  3O6H A;  4PP0 A;  3LSL A;  3RPL B;  3Q27 A;  1VSO A;  2DE4 A;  2XX9 A;  2H98 A;  2QS2 A;  3TAJ A;  1Y4T A;  1NNP A;  3EHU A;  4QFP A;  3PTY A;  4NX1 A;  2XXI A;  1URS A;  4RA1 A;  4X1B A;  1SW2 A;  1AIV A;  2O51 A;  2XWO A;  3QMF A;  4F18 A;  5BUU A;  3THI A;  2OJT A;  3AXF A;  4BDL A;  2F3B A;  3EPE A;  2HCA A;  4OET A;  4AB5 A;  3HV1 A;  4ZE9 A;  1P1Q A;  1NV1 A;  5H8H A;  5IKB A;  1VDW A;  3VLW A;  2JJK A;  5ICQ A;  1JP4 A;  5CRY A;  2DWJ A;  3S9L C;  3I5O A;  1N7W A;  1K9Z A;  4FJP A;  1JEV A;  4OFJ A;  3TDJ A;  3EHT A;  2YPN A;  3B6W A;  3UGW A;  1B4Z A;  2P0S A;  3V89 B;  4GWS A;  3S9N C;  4OHN A;  3A3C A;  2A5T B;  3G7W A;  1XT8 A;  3CI8 A;  3EKI A;  2RC7 A;  5IZ1 A;  1FPG A;  2E0S A;  1VFD A;  3MYU A;  5AA2 A;  3A09 A;  4KCD A;  4PFY A;  1ZKB A;  3U65 A;  3PPP A;  2Y7W A;  3OEL A;  1OQG A;  3OXN A;  1B7U A;  3PUW E;  3LUY A;  5H8F B;  4NF8 A;  1FRP A;  1VR5 A;  3V8X B;  2NVU B;  3H03 A;  4JVC A;  1SW1 A;  2XA5 A;  3IK6 B;  2V4C A;  1NNF A;  1B40 A;  5DT6 A;  5L8D A;  3FGS A;  4ZZE A;  3KN7 A;  4KHZ E;  4R2F A;  3H6W A;  4U4S A;  3QSL A;  1XVX A;  1MRP A;  2QL3 A;  4MHF A;  5A5X A;  2Q8J A;  4LZ7 A;  4OXV A;  2V3T A;  2ZYN A;  3FV1 A;  5AA2 D;  2F97 A;  2L5V A;  1YXI A;  3C32 A;  1MQJ A;  2CEY A;  3MWB A;  4OWD A;  5I2N B;  3SEU A;  4PDH A;  5H8Q B;  3Q26 A;  4BLA A;  2ZZW A;  2I58 A;  4QSC A;  1ZBM A;  2Y7P A;  4ONY A;  2PVU A;  2UVG A;  1M5D A;  4QFN A;  1NL5 A;  4NN3 A;  5M2V A;  1EYJ A;  4OFO A;  4LQ2 A;  5KDT A;  4JXI A;  1LBW A;  4H6D A;  4N91 A;  3K6V A;  2BJI A;  5IZ3 A;  1MY2 A;  1OLC A;  3CFL A;  3EN3 A;  2Y5K A;  1LB9 A;  1DSN A;  4DZ1 A;  1QGX A;  3MAM A;  3DP4 A;  2FBP A;  4EUO A;  4N81 A;  3IO6 A;  4GOT A;  3U8Q A;  3TUS A;  5JEI A;  1Z7N E;  1NUW A;  1DK4 A;  3JYR A;  5KCJ A;  1LAF E;  4Q5T A;  4YB5 A;  1PBP A;  4F1U A;  1B0H A;  1YYZ A;  4XXU A;  3KSX A;  1JET A;  3LR1 A;  2F7C A;  3TKD A;  3LC8 A;  2FNC A;  4ZEI A;  4ZED A;  1FPE A;  1ZLQ A;  1LFI A;  2F3D A;  4OER A;  2Z8D A;  5LTC A;  5L9M A;  1Y3Q A;  5EHM A;  1GVC A;  5JTY A;  3K6W A;  2AL4 A;  4XKN A;  1ZTY A;  4OEV A;  2B4L A;  4QFO A;  1IME A;  3TMG A;  5KCJ B;  1SD3 A;  4F2Q A;  4H5F A;  4GBV A;  2H9B A;  1SW5 A;  1S50 A;  2VD2 A;  4GWU A;  3TEP A;  2QSX A;  3B6Q A;  4H5G A;  3ONM A;  4OYV A;  3PMW A;  4MF3 A;  1SI0 A;  2XX7 A;  4DI4 B;  4YKP A;  1B5I A;  2F7B A;  4OVR A;  3M8U A;  2UVH A;  4KYS A;  1YTV A;  4MNI A;  1PB8 A;  2F5X A;  3OO7 A;  3ZS6 A;  3R26 A;  1URD A;  2GRV A;  1IIT A;  1FBP A;  2WYP A;  5ITP A;  3OO8 A;  4OVT A;  2QVR A;  4P8B A;  1LBX A;  3O6I A;  3ZKL A;  1FPI A;  2UVJ A;  4OVJ A;  1GTK A;  2XD2 A;  1NUY A;  2DXR A;  3EQ1 A;  3VDF A;  4H1X A;  4M1V A;  3USD A;  1Q9D A;  5CBS A;  4PBQ A;  4ELO A;  5HM4 B;  4U4X A;  4P56 A;  3P7I A;  3RGY A;  4F19 A;  3IO4 A;  1XS5 A;  3H6V A;  1FQC A;  3F11 A;  3KEI A;  2Q2A A;  1J1N A;  3T9H B;  4NF6 B;  3H4Z A;  1Y3P A;  3JV9 A;  2Q74 A;  2Q8M A;  4LZ8 A;  1XHY A;  2YLN A;  4ZEF A;  2CZI A;  2HPG A;  4OTE A;  4PCD A;  3T9U A;  4N15 A;  3IB0 A;  1EYK A;  1MY0 A;  1RKM A;  4C0R A;  1SDX A;  1MM7 A;  2OWS A;  1IMB A;  5DVI A;  3N6T A;  1FTM A;  4GX4 A;  3ILT B;  4RK2 A;  3CFX A;  3BKI B;  2DWA A;  3VXC A;  1B3H A;  5AA2 B;  2R8T A;  4PC9 A;  4MMP A;  3KC1 A;  2V3Q A;  3MVW A;  1N76 A;  3FJ7 A;  3E9X A;  4IY6 A;  3BIH A;  1IMF A;  1IIW A;  4JSD A;  3H6U A;  4GLI A;  1B7Z A;  3RLF E;  4QSE A;  4EF1 A;  2ZNS A;  5I3S A;  2F34 A;  1UTH A;  2VPN A;  1LAG E;  4IO6 A;  4H67 A;  4BDR A;  5IM2 A;  2WBB A;  4POX A;  3OD7 A;  2W7Y A;  5H8H B;  5L9S A;  1R1N A;  1N7X A;  3G3F A;  4P11 A;  3TTM A;  3RT8 A;  1UQW A;  4H0W A;  4NF5 A;  4QFL A;  3ZKK A;  1JW4 A;  3QK6 A;  4YMB A;  2I3V A;  1R6Z A;  2KR0 A;  1FQF A;  1ATG A;  3FXB A;  4H45 A;  4P9K A;  3HHG A;  1EZP A;  1EU8 A;  1P1U A;  4F2O A;  4R9G A;  4OVP A;  2GHA A;  3RYD A;  1I6Q A;  1GV8 A;  2Y7I A;  2ZZX A;  4RYA A;  5I59 B;  1UTB A;  1K9Y A;  5EQ9 A;  2XXW A;  3CG3 A;  1DOT A;  4DDD A;  1DBZ A;  2IA4 A;  3H6T A;  3U1O A;  3G3J A;  5H8F A;  3MVX A;  3IOW A;  4DXC A;  2REJ A;  4LN5 A;  5EQ7 A;  1O64 A;  4KQP A;  4GWZ A;  3FXR A;  4THI A;  3G3I A;  3MW0 A;  4MH5 A;  2OWT A;  3ODB A;  4G68 B;  4RPN A;  1NH8 A;  3SEY A;  4GXS B;  3KFM A;  3JZJ A;  4PGN A;  4R72 A;  3TQL A;  4MJO A;  3PMX A;  1FTA A;  1WDN A;  1MQH A;  3TTN A;  1FSA A;  3VFJ A;  2HXW A;  4LA9 A;  1P99 A;  1B5H A;  1UIV A;  2UYE A;  4KYE A;  3PU5 A;  3TOD A;  1QJM A;  4F22 A;  4U1O A;  4FBP A;  1JVY A;  4FEC A;  4L17 A;  2XHD A;  1RDZ A;  1PDA A;  3IFC A;  1XI6 A;  5B70 A;  2DDK A;  2WX9 A;  3C31 A;  5ICT A;  1IUD A;  3QXM A;  3LBS A;  1LEV A;  3IOU A;  4WED A;  4GQO A;  4X48 A;  2H5Y A;  4GIZ A;  5AA3 A;  4KI0 E;  1TFD A;  1BKA A;  2F6P A;  4PAK A;  4QRZ A;  4P47 A;  2I4B A;  3MP6 A;  4YMA A;  1JEU A;  3C34 A;  1SW4 A;  3MPK A;  3RPL A;  1MY4 A;  1DPE A;  1DTZ A;  3MZ9 A;  4F31 B;  4EXL A;  3T22 A;  3GLB A;  5LDZ A;  3OO6 A;  1UIU A;  5CMB A;  3U72 A;  1NV3 A;  3G3K A;  4NG7 A;  1N04 A;  1SPI A;  1SI1 A;  4G8M A;  3U93 A;  3SES A;  2I48 A;  4TLL B;  2O7U A;  1HSE A;  4JDF A;  4OVQ A;  4MLV A;  3TYH A;  1MDQ A;  3PPO A;  1DCU A;  2AL5 A;  1MS7 A;  1I6A A;  3SET A;  1FPD A;  4NF6 A;  1TWY A;  4G77 A;  4P3L A;  4MLQ A;  3B6T A;  4FEB A;  3V83 A;  1EZ9 A;  4GWO A;  2M8C A;  3FAS A;  3SEW A;  3O9P A;  2QS4 A;  2P2A A;  3A29 A;  3OSR A;  3LV0 A;  1RYO A;  4F3S A;  3KN8 A;  3LSW A;  1NMU A;  4NWC A;  1D9Y A;  4UAB A;  3K00 A;  1QUK A;  4YAH X;  1FTK A;  5F1Q A;  3K4U A;  2V84 A;  2YJP A;  2PFY A;  3T0J A;  2BJJ X;  3KOS A;  4U2R A;  3HPI A;  4GXA A;  4X9T A;  2B4M A;  3OOA A;  3R7X A;  2RCB A;  3PGF A;  1YZ0 A;  4LVQ A;  2ABH A;  2UVI A;  1II5 A;  4X1D A;  4PFI A;  2OLB A;  3K6U A;  3UK4 A;  1FQB A;  4N4U A;  5I58 B;  2Q88 A;  4UA8 A;  2HXR A;  4H8J A;  2HZL A;  1IXG A;  3N6U A;  1QW0 A;  4WKM A;  4Q30 B;  4NF4 A;  1FBD A;  4EQ9 A;  4M4G A;  3D4G A;  4R2B A;  4O94 A;  5I57 A;  5DTB A;  3BBR A;  4BDO A;  1PB9 A;  3A3U A;  3K1P A;  1NI9 A;  1TT1 A;  2DWI A;  1BP5 A;  4P0I A;  1MDP 1;  1OVB A;  3DP8 A;  5TP9 B;  2PT1 A;  3CFZ A;  2VHA A;  5I57 B;  4HW8 A;  1Y1M A;  2D5W A;  1Q1K A;  2Y7K A;  4NF4 B;  4IO5 A;  5B7D A;  3W9W A;  3VVF A;  4PE5 B;  1IXH A;  1B9J A;  4XKP A;  3MZ1 A;  4F1Y A;  3VV5 A;  4XTC Q;  1KA0 A;  1BLF A;  4N6K A;  3TQW A;  4GL0 A;  1MQI A;  2X26 A;  1LBC A;  5T3J A;  4N8Y A; 
#chains in the Genus database with same CATH homology
 1MH4 A;  2OCU A;  4XF5 A;  3C33 A;  1B1H A;  4ELQ A;  5KDT B;  1ANF A;  1YPN A;  5I2K A;  2I0C A;  5AA4 B;  3LUZ A;  3O97 A;  1P1W A;  5ELV A;  4ESW A;  3H06 B;  3T66 A;  1QUL A;  4N6P A;  1QKB A;  5HPQ A;  4N8G A;  1YCJ A;  5EYG A;  4PGP A;  2OX3 A;  1PB7 A;  4IO4 A;  2R9J A;  3IOV A;  3UN6 A;  2O84 X;  1DPP A;  4JBZ A;  5AA1 A;  3BIG A;  1XVY A;  3ISP A;  3IX1 A;  1A7L A;  4ISU A;  3KN3 A;  1LFH A;  3FXU A;  5L9O A;  3KGC A;  4OQO A;  3E79 A;  3PPN A;  3MBP A;  3IOR A;  4I9D A;  3OSQ A;  3MVY A;  1LBV A;  5IZZ A;  2G93 A;  3IJO B;  1Y4C A;  5A5X B;  4MFI A;  4ECF A;  4RPO A;  3B50 A;  4PE3 A;  2RCA A;  4G68 A;  3MPL A;  1HSL A;  1LCF A;  2ZNU A;  4IO3 A;  2RKM A;  2FHY A;  2I0B A;  3KZG A;  1LLS A;  1D4N A;  5IAI A;  2P1S A;  3RPW A;  3C35 A;  1A8E A;  2PX1 A;  1A40 A;  1M5B A;  5I56 B;  2XD3 A;  3LSX A;  2FIE A;  3QUJ A;  4KPT A;  1GR2 A;  5EYF A;  5IGA A;  4GD5 A;  1FBC A;  4NGU A;  4YZZ A;  4OAN A;  4OEN A;  1Q35 A;  4FE8 A;  4RJZ A;  3B7D A;  4NED A;  3FVK A;  4OEU A;  4Z0I A;  4ZDM A;  3CVG A;  4O3A A;  1BK4 A;  1AL3 A;  1FQE A;  1IMD A;  4G8N A;  1P1N A;  4DCX A;  4EXK A;  2F7A A;  2XWV A;  4ESX A;  3PV0 E;  1B52 A;  5F7V A;  1OMP A;  2OBG A;  3W9V A;  4DXU A;  3RT6 B;  2H4I A;  4C1U A;  2KQZ A;  4NAP A;  4KFQ A;  2Z22 A;  3SEX A;  4H65 A;  4PAI A;  4PTK A;  1LBZ A;  4KR5 A;  4N17 A;  2F8D A;  2Q9T A;  4QBA A;  2XX8 A;  1M5F A;  2Q2C A;  5DYH A;  1POT A;  1MXY A;  4MIJ A;  5EQA A;  1H44 A;  1JW5 A;  2B65 A;  1USY H;  1WVJ A;  2RIN A;  1OQH A;  2XXQ A;  3K01 A;  2CZK A;  4NHB A;  4ZEK A;  3CIJ A;  4F1V A;  4I8C A;  2CEX A;  3V5A A;  1H43 A;  3M3F A;  4FIM A;  4JSO A;  4FED A;  3ZSF A;  1MPD A;  1B7H A;  3EHS A;  2OK2 A;  4Q0C A;  3I3V A;  4P0G A;  3O66 A;  2XXV A;  4JB7 A;  3OO9 A;  4PFT A;  1P1O A;  3CG1 A;  4G8H A;  1G0H A;  2PYY A;  5KZT A;  2P3N A;  2QVV A;  2VGQ A;  5CMM A;  5TPA A;  3TFL A;  3K0V A;  1LAH E;  1OLA A;  2HZK A;  2DQV A;  4R74 A;  1I6B A;  4PF6 A;  2G29 A;  4I62 A;  1G0I A;  1QKA A;  2IEE A;  4TOZ A;  4ELR A;  4LAT A;  4OES A;  4HCW A;  1R9Q A;  4YKJ A;  3MST A;  4QFK A;  3BFU A;  1EH3 A;  2H25 A;  3GYY A;  4QF9 A;  1ZIU A;  2QMX A;  4LZ5 A;  4HXV A;  2ONK E;  4X8R A;  5J1D A;  4KXP A;  1NV5 A;  1EYI A;  1USY E;  4IGR A;  3TTR A;  3IR1 A;  1SBP A;  2VP1 A;  2B3F A;  5FTH A;  3MC2 A;  2WEF A;  2Z8E A;  3E13 X;  3FBP A;  4U22 A;  1L5T A;  3MZB A;  2DE2 A;  4R6K A;  2NXO A;  3K02 A;  1S9T A;  1NNK A;  4ELP A;  2O68 A;  4PAF A;  1MY3 A;  3KG2 A;  1LBY A;  3KBZ A;  5J16 A;  4U23 A;  2ZZV A;  4DIG A;  4F29 A;  5AA4 A;  3N26 A;  4ZEB A;  1A54 A;  4F3G A;  5I2K B;  4GRK A;  3B8B A;  1RDX A;  4Z7E A;  3C4M A;  3VXB A;  2PFZ A;  5CBR A;  1PBQ A;  3W15 C;  3PMV A;  2I49 A;  4O8M A;  4WEP A;  3K2D A;  4UAC A;  2PCR A;  4PF8 A;  3TCF A;  4OA4 A;  1VFE A;  5K2X A;  3SDF A;  1MXW A;  4E0X A;  5CMC A;  5JTY B;  3VE1 B;  2F35 A;  3FD3 A;  2DYX A;  4NTL A;  4WXJ A;  2XXP A;  3IFA A;  3PD8 A;  1BIY A;  1IMC A;  4NWD A;  2X7Q A;  3IJX B;  1ZMG A;  5LOM A;  3UA8 A;  1FBF A;  2HQ0 A;  3CSB A;  5ET6 A;  3RNN A;  2F78 A;  3T9V A;  1TFA A;  2UYF A;  3UIF A;  4I40 A;  5ISU A;  3HST A;  4JVI A;  3E3K A;  4RXL A;  1US4 A;  2XXH A;  4O3B A;  1AOV A;  5I7I A;  3GZG A;  1A99 A;  4JWO A;  1NV2 A;  4EF2 A;  1LCT A;  1B6H A;  2OZZ A;  3Q25 A;  1S7Y A;  1ZJL A;  1FPK A;  2AIX A;  2O7I A;  2ZMB A;  3M3K A;  4AS5 A;  1CE2 A;  2ANJ A;  3H3G A;  5EQ8 A;  4XFE A;  2PT2 A;  3MP1 A;  3DP6 A;  1NH7 A;  4NF0 A;  4E0W A;  3PD9 A;  4MCO A;  4G2Z A;  1FPJ A;  5FTI A;  5FHN A;  1B51 A;  1RDY A;  3FVG A;  1H45 A;  3MJN A;  1A55 A;  1FPF A;  4GX3 A;  3TPA A;  3MUQ A;  3S9E A;  1CB6 A;  1ELJ A;  1B3E A;  1FCK A;  2ONR A;  4YIC A;  5DW8 A;  3CR9 A;  1FJ9 A;  2GHB A;  3N5L A;  4IY5 A;  1US5 A;  5DEX A;  1F9B A;  5FHO A;  1RYX A;  4AB6 A;  3R6U A;  1B2H A;  1XC1 A;  1NNT A;  2AYS A;  4PFB A;  1NKX A;  3L6H A;  1NFT A;  2PMS A;  1MM6 A;  1TXF A;  2H99 A;  2NWJ A;  3M3L A;  5H8S A;  5TPA B;  4ND9 A;  4EDP A;  2E1S A;  1B3L A;  3PPQ A;  3T93 B;  4XKR A;  3PUX E;  1NV7 A;  5F24 A;  1DTG A;  4O3C A;  3OEM A;  1IQ7 A;  3U92 A;  1MY1 A;  2V3U A;  4MNC A;  2RC9 A;  1Y9U A;  4IR8 A;  2O6A A;  3K6X A;  3KJ7 A;  4FOR A;  4YKI A;  1LST A;  5IZ3 B;  3Q29 A;  2WKY A;  2HEU A;  4NE4 A;  3HCQ A;  4XIG Q;  1H76 A;  2Y5L A;  4BDM A;  2QFL A;  3DEL B;  4HE2 A;  1KZ8 A;  4F3P A;  1XOC A;  4N6D A;  5CM6 A;  2GFE A;  3RQT A;  3KOT A;  4OVS A;  4O7I A;  2DXY A;  4P1L A;  1QUJ A;  2VPO A;  1AWB A;  1MQD A;  1BTJ A;  2ZXT A;  4IO7 A;  1MXU A;  3CSG A;  3S4U A;  1N0T A;  2D21 A;  3RTW B;  1B3F A;  4I1D A;  4OMB A;  1FQA A;  1PC3 A;  4TLM B;  1O7T A;  3O6G A;  1URG A;  5H8N A;  3QIM A;  4I3E A;  3OMB A;  1B0L A;  4MNP A;  1FTL A;  4QHQ A;  4ZE8 A;  4U1Z A;  4P1E A;  1VE4 A;  2I3W A;  3MP8 A;  2DE3 A;  3L6G A;  3WAE A;  3FAT A;  4O7M A;  1B3G A;  4HS7 A;  1I69 A;  4G61 A;  1HSJ A;  5EHS A;  4F39 A;  4ZZA A;  1SQY A;  1QUI A;  2KLF A;  4N13 A;  1MG1 A;  4FAT A;  3FIR A;  1LAX A;  1MQG A;  1PEB A;  3KJT A;  4PFW A;  1YAE A;  1JW1 A;  1NV0 A;  1Z7M E;  1IZ1 A;  1D9V A;  1MXX A;  4HE1 A;  4DXB A;  4PET A;  3VVD A;  2A5T A;  2ZNT A;  4MBP A;  1DMB A;  4TQU Q;  3QAX A;  1FBH A;  4I3Y A;  4XEQ A;  3TTL A;  1B46 A;  3TCG A;  4LQ5 A;  4EQB A;  3D1R A;  2CZL A;  1UTB B;  5I59 A;  5ESY A;  3TCH A;  1O63 A;  1KWH A;  1MPC A;  4KCC A;  2DVC A;  2DVZ A;  5H8N B;  1M5C A;  3DLN A;  3FVN A;  3GXA A;  3HO7 A;  4AQ4 A;  3WAF A;  4XKQ A;  1UTH B;  3S2V A;  4R6Y A;  2RC8 A;  4N07 A;  3Q28 A;  4GWY A;  4Q8R A;  2REG A;  3EF7 A;  4NF5 B;  1B05 A;  1SYH A;  3OEK A;  5FHM A;  3ROJ A;  1JNF A;  2R71 A;  2GH9 A;  2FA7 A;  4BDN A;  2MKZ A;  4PQJ A;  2O1M A;  1D3K A;  3GBA A;  4RY1 A;  2XXY A;  4F3B A;  2Q89 A;  3PUZ E;  2HAU A;  1SVX B;  1AMF A;  4GWX A;  1INP A;  2VT5 A;  4QSD A;  1MH3 A;  2O1L A;  1IMA A;  3LSF B;  1LBB A;  3MVZ A;  2THI A;  5ET7 A;  2I4C A;  4GF8 A;  3H7M A;  5I56 A;  4ZEC A;  1B32 A;  3SER A;  4EQ7 A;  3I6V A;  3IB2 A;  4YB6 A;  3VLU A;  4G4P A;  4KYD A;  1POY 1;  1AH5 A;  3DM0 A;  3U94 A;  1FJ6 A;  2XXT A;  2QRY A;  2XXR A;  3VVE A;  1ZU0 A;  3T96 B;  1SYI A;  1KA1 A;  5TP9 A;  4H8I A;  4FAJ A;  3E78 A;  4G68 C;  5DEX B;  1Y20 A;  1IEJ A;  3FV2 A;  3O28 A;  4GFR A;  3K1N A;  1LGB C;  2R6G E;  5DVF A;  4C1T A;  3T9X B;  1LFG A;  2D3I A;  4ZS9 A;  5ITO A;  2QJE A;  2WBD A;  4RK9 A;  2NOO A;  4MX6 A;  1IXI A;  4QXD A;  5EYH A;  3ECR A;  5I84 A;  2HAV A;  3RY3 A;  4U21 A;  2ESN A;  3ILU B;  1B4H A;  3T1B A;  1Y1Z A;  2XWI A;  3RTF B;  1FBG A;  1N3W A;  1OVT A;  1FTO A;  2RF1 A;  2ZYM A;  4R73 A;  1B58 A;  2LAO A;  2V25 A;  2CMO A;  1H3D A;  2ZYO A;  2XXK A;  4JWX A;  3SEV A;  3O29 A;  2QS1 A;  5FBP A;  1M5E A;  2Z23 A;  3IL1 B;  3IB1 A;  2XXU A;  1NV6 A;  4MEV A;  2ONS A;  1Y3N A;  4PDD A;  5CC2 A;  5HBC A;  2FVZ A;  4X04 A;  1LB8 A;  1FPB A;  2QMW A;  3KBR A;  1OIB A;  3CHG A;  4GWW A;  3BFT A;  2ALU A;  2V93 A;  4YB7 A;  1MPB A;  4HCY A;  1T0K A;  2F36 A;  5A5L A;  1JQF A;  1FTJ A;  2QS3 A;  3S9M C;  3HHF A;  5BWJ A;  3UOR A;  2WYK A;  3IOT A;  4OZ9 A;  3QUF A;  2PBW A;  4AS4 A;  5JK4 A;  1N84 A;  2DP8 A;  5K2Y A;  1FPL A;  1JVX A;  3N94 A;  3OEN A;  2FYI A;  1CNQ A;  2HFB A;  2O69 A;  2Z8F A;  2I6E A;  3KC0 A;  1FBE A;  2XXX A;  4H46 A;  2CZH A;  2UXA A;  4JWY A;  3HFU A;  3G3H A;  1NV4 A;  4IB2 A;  1QVS A;  2X7P A;  2DSF A;  3E4R A;  5DVJ A;  1D9Q A;  2VOZ A;  2QPQ A;  1GGG A;  5I58 A;  2Y7R A;  2B3B A;  4YKK A;  4GVO A;  3SZP A;  1MXZ A;  3VLV A;  4GL8 A;  4DI3 D;  5AE4 A;  3PUV E;  4DE8 A;  4HE0 A;  4YU0 A;  1B5J A;  3MQ9 A;  2NUV A;  3K1M A;  5I5P A;  3GBB A;  1A8F A;  2OWZ A;  2DOJ A;  2DS9 A;  3TZA A;  4RNS A;  4DCY A;  4PBH A;  3FJM A;  1R9L A;  5H8Q A;  3IAZ A;  4R6H A;  3UP9 A;  1MXV A;  5CI5 A;  3RN8 A;  3G3G A;  4HTG A;  3TEL A;  3TTK A;  5TU0 A;  4MAG A;  4LUB A;  2ZYK A;  2QVU A;  4NMY A;  3NOH A;  3HN0 A;  4NQ8 A;  3FVO A;  3QYT A;  2P3V A;  3CRB A;  1B1X A;  4R9F A;  4LP2 B;  4PFU A;  3SKP A;  2FIX A;  4OFL A;  4KD5 A;  5ET5 A;  4LON B;  5I2N A;  3D4C A;  3C9H A;  3FXQ A;  5ET8 A;  1NUX A;  2XWK A;  3FJG A;  4POW A;  4DLD A;  2VD3 A;  2GQ1 A;  2DWH A;  4IGT A;  4NF8 B;  3KSJ A;  1FW0 A;  4GX6 A;  5CMK A;  4IO2 A;  4R75 A;  2A5S A;  4BDQ A;  3FZV A;  1FQD A;  1NUZ A;  4JVD A;  3C36 A;  4K3F A;  4GBW A;  4PFR A;  2F6G A;  3RUM A;  1IXC A;  3O2A A;  1N3X A;  1EZO A;  2Y84 A;  2HHM A;  3PPR A;  3PUY E;  1WOD A;  3FUZ A;  3O6H A;  4PP0 A;  3LSL A;  3RPL B;  3Q27 A;  1VSO A;  2DE4 A;  2XX9 A;  2H98 A;  2QS2 A;  3TAJ A;  1Y4T A;  1NNP A;  3EHU A;  4QFP A;  3PTY A;  4NX1 A;  2XXI A;  1URS A;  4RA1 A;  4X1B A;  1SW2 A;  1AIV A;  2O51 A;  4F18 A;  2XWO A;  3QMF A;  5BUU A;  3THI A;  2OJT A;  3AXF A;  4BDL A;  2F3B A;  3EPE A;  2HCA A;  4OET A;  4AB5 A;  3HV1 A;  4ZE9 A;  1P1Q A;  5H8H A;  1NV1 A;  5IKB A;  1VDW A;  3VLW A;  2JJK A;  5ICQ A;  1JP4 A;  5CRY A;  2DWJ A;  3S9L C;  3I5O A;  1N7W A;  1K9Z A;  4FJP A;  1JEV A;  4OFJ A;  3TDJ A;  3EHT A;  2YPN A;  3B6W A;  3UGW A;  1B4Z A;  2P0S A;  3V89 B;  4GWS A;  3S9N C;  4OHN A;  3A3C A;  2A5T B;  3G7W A;  1XT8 A;  3CI8 A;  3EKI A;  2RC7 A;  5IZ1 A;  1FPG A;  2E0S A;  1VFD A;  5AA2 A;  3MYU A;  3A09 A;  4KCD A;  4PFY A;  1ZKB A;  3U65 A;  3PPP A;  2Y7W A;  3OEL A;  1OQG A;  3OXN A;  1B7U A;  3PUW E;  3LUY A;  5H8F B;  4NF8 A;  1FRP A;  1VR5 A;  3V8X B;  2NVU B;  3H03 A;  4JVC A;  1SW1 A;  2XA5 A;  3IK6 B;  2V4C A;  1NNF A;  1B40 A;  5DT6 A;  5L8D A;  3FGS A;  4ZZE A;  3KN7 A;  4KHZ E;  4R2F A;  3H6W A;  4U4S A;  3QSL A;  1XVX A;  1MRP A;  2QL3 A;  4MHF A;  5A5X A;  2Q8J A;  4LZ7 A;  4OXV A;  2V3T A;  2ZYN A;  3FV1 A;  5AA2 D;  2F97 A;  2L5V A;  1YXI A;  3C32 A;  1MQJ A;  2CEY A;  3MWB A;  4OWD A;  5I2N B;  3SEU A;  4PDH A;  5H8Q B;  3Q26 A;  4BLA A;  2ZZW A;  2I58 A;  4QSC A;  1ZBM A;  2Y7P A;  4ONY A;  2PVU A;  2UVG A;  1M5D A;  4QFN A;  1NL5 A;  5M2V A;  4NN3 A;  4OFO A;  1EYJ A;  4LQ2 A;  5KDT A;  4N8Y A;  4JXI A;  1LBW A;  4H6D A;  4N91 A;  3K6V A;  2BJI A;  5IZ3 A;  1MY2 A;  1OLC A;  3CFL A;  3EN3 A;  2Y5K A;  1LB9 A;  1DSN A;  4DZ1 A;  1QGX A;  3MAM A;  3DP4 A;  2FBP A;  4EUO A;  4N81 A;  3IO6 A;  4GOT A;  3U8Q A;  3TUS A;  5JEI A;  1Z7N E;  1NUW A;  1DK4 A;  3JYR A;  5KCJ A;  1LAF E;  4Q5T A;  4YB5 A;  1PBP A;  4F1U A;  1B0H A;  1YYZ A;  4XXU A;  3KSX A;  1JET A;  3LR1 A;  2F7C A;  3TKD A;  3LC8 A;  2FNC A;  4ZEI A;  4ZED A;  1FPE A;  1ZLQ A;  1LFI A;  4OER A;  2F3D A;  2Z8D A;  5LTC A;  5L9M A;  1Y3Q A;  5EHM A;  1GVC A;  5JTY A;  3K6W A;  2AL4 A;  4XKN A;  1ZTY A;  4OEV A;  2B4L A;  4QFO A;  1IME A;  3TMG A;  5KCJ B;  1SD3 A;  4F2Q A;  4H5F A;  4GBV A;  2H9B A;  1SW5 A;  1S50 A;  2VD2 A;  4GWU A;  3TEP A;  2QSX A;  3B6Q A;  4H5G A;  3ONM A;  4OYV A;  3PMW A;  4MF3 A;  1SI0 A;  2XX7 A;  4DI4 B;  4YKP A;  1B5I A;  2F7B A;  4OVR A;  3M8U A;  2UVH A;  4KYS A;  1YTV A;  4MNI A;  1PB8 A;  2F5X A;  3OO7 A;  3ZS6 A;  3R26 A;  1URD A;  2GRV A;  1IIT A;  1FBP A;  2WYP A;  5ITP A;  3OO8 A;  4OVT A;  2QVR A;  4P8B A;  1LBX A;  3O6I A;  3ZKL A;  1FPI A;  2UVJ A;  4OVJ A;  1GTK A;  2XD2 A;  1NUY A;  2DXR A;  3EQ1 A;  3VDF A;  4H1X A;  4M1V A;  3USD A;  1Q9D A;  5CBS A;  4PBQ A;  4ELO A;  5HM4 B;  4U4X A;  4P56 A;  3P7I A;  3RGY A;  4F19 A;  3IO4 A;  1XS5 A;  3H6V A;  1FQC A;  3F11 A;  3KEI A;  2Q2A A;  1J1N A;  3T9H B;  4NF6 B;  3H4Z A;  1Y3P A;  3JV9 A;  2Q74 A;  2Q8M A;  4LZ8 A;  1XHY A;  2YLN A;  4ZEF A;  2CZI A;  2HPG A;  4OTE A;  4PCD A;  3T9U A;  4N15 A;  3IB0 A;  1EYK A;  1MY0 A;  1RKM A;  4C0R A;  1SDX A;  1MM7 A;  2OWS A;  1IMB A;  5DVI A;  3N6T A;  1FTM A;  4GX4 A;  3ILT B;  4RK2 A;  3CFX A;  3BKI B;  2DWA A;  3VXC A;  1B3H A;  5AA2 B;  2R8T A;  4PC9 A;  4MMP A;  3KC1 A;  2V3Q A;  3MVW A;  1N76 A;  3FJ7 A;  3E9X A;  4IY6 A;  3BIH A;  4JSD A;  1IIW A;  1IMF A;  3H6U A;  4GLI A;  1B7Z A;  3RLF E;  4QSE A;  4EF1 A;  2ZNS A;  5I3S A;  2F34 A;  1UTH A;  2VPN A;  1LAG E;  4IO6 A;  4H67 A;  4BDR A;  5IM2 A;  2WBB A;  4POX A;  3OD7 A;  2W7Y A;  5H8H B;  5L9S A;  1R1N A;  1N7X A;  3G3F A;  4P11 A;  3TTM A;  3RT8 A;  1UQW A;  4H0W A;  4NF5 A;  4QFL A;  3ZKK A;  1JW4 A;  3QK6 A;  4YMB A;  2I3V A;  1R6Z A;  2KR0 A;  1FQF A;  1ATG A;  3FXB A;  4H45 A;  1EZP A;  4P9K A;  1EU8 A;  1P1U A;  4F2O A;  4R9G A;  4OVP A;  2GHA A;  3RYD A;  1I6Q A;  1GV8 A;  2Y7I A;  2ZZX A;  4RYA A;  5I59 B;  1UTB A;  1K9Y A;  5EQ9 A;  2XXW A;  3CG3 A;  1DOT A;  4DDD A;  1DBZ A;  2IA4 A;  3H6T A;  3U1O A;  3G3J A;  5H8F A;  3MVX A;  3IOW A;  4DXC A;  2REJ A;  4LN5 A;  5EQ7 A;  1O64 A;  4KQP A;  4GWZ A;  3FXR A;  4THI A;  3G3I A;  3MW0 A;  4MH5 A;  2OWT A;  3ODB A;  4G68 B;  4RPN A;  1NH8 A;  3SEY A;  4GXS B;  3KFM A;  3JZJ A;  4R72 A;  4PGN A;  3TQL A;  4MJO A;  3PMX A;  1FTA A;  1WDN A;  1MQH A;  3TTN A;  1FSA A;  3VFJ A;  2HXW A;  4LA9 A;  1P99 A;  1B5H A;  1UIV A;  2UYE A;  4KYE A;  3PU5 A;  3TOD A;  1QJM A;  4F22 A;  4U1O A;  4FBP A;  1JVY A;  4FEC A;  4L17 A;  2XHD A;  1RDZ A;  1PDA A;  3IFC A;  1XI6 A;  5B70 A;  2DDK A;  3C31 A;  5ICT A;  2WX9 A;  1IUD A;  3QXM A;  3LBS A;  3IOU A;  1LEV A;  4WED A;  4GQO A;  4X48 A;  2H5Y A;  4GIZ A;  5AA3 A;  4KI0 E;  1TFD A;  1BKA A;  2F6P A;  4PAK A;  4QRZ A;  4P47 A;  2I4B A;  3MP6 A;  4YMA A;  1JEU A;  3C34 A;  1SW4 A;  3MPK A;  3RPL A;  1MY4 A;  1DPE A;  1DTZ A;  3MZ9 A;  4F31 B;  4EXL A;  3T22 A;  3GLB A;  5LDZ A;  3OO6 A;  1UIU A;  5CMB A;  3U72 A;  1NV3 A;  3G3K A;  4NG7 A;  1N04 A;  1SPI A;  1SI1 A;  4G8M A;  3U93 A;  3SES A;  2I48 A;  4TLL B;  2O7U A;  1HSE A;  4JDF A;  4OVQ A;  4MLV A;  3TYH A;  1MDQ A;  3PPO A;  1DCU A;  2AL5 A;  1MS7 A;  1I6A A;  3SET A;  1FPD A;  4NF6 A;  1TWY A;  4G77 A;  4P3L A;  4MLQ A;  3B6T A;  4FEB A;  3V83 A;  1EZ9 A;  4GWO A;  2M8C A;  3FAS A;  3SEW A;  3O9P A;  2QS4 A;  2P2A A;  3A29 A;  3OSR A;  3LV0 A;  1RYO A;  4F3S A;  3KN8 A;  3LSW A;  1NMU A;  4NWC A;  1D9Y A;  4UAB A;  3K00 A;  1QUK A;  4YAH X;  1FTK A;  5F1Q A;  3K4U A;  2V84 A;  2YJP A;  2PFY A;  3T0J A;  2BJJ X;  3KOS A;  4U2R A;  3HPI A;  4GXA A;  4X9T A;  3OOA A;  3R7X A;  2B4M A;  2RCB A;  3PGF A;  1YZ0 A;  4LVQ A;  2ABH A;  2UVI A;  1II5 A;  4X1D A;  4PFI A;  2OLB A;  3K6U A;  3UK4 A;  1FQB A;  5I58 B;  4N4U A;  2Q88 A;  4UA8 A;  2HXR A;  4H8J A;  2HZL A;  1IXG A;  3N6U A;  1QW0 A;  4WKM A;  4Q30 B;  4NF4 A;  1FBD A;  4EQ9 A;  4M4G A;  3D4G A;  4R2B A;  5I57 A;  4O94 A;  5DTB A;  3BBR A;  4BDO A;  1PB9 A;  3A3U A;  3K1P A;  1NI9 A;  1TT1 A;  2DWI A;  1BP5 A;  4P0I A;  1MDP 1;  1OVB A;  3DP8 A;  5TP9 B;  2PT1 A;  3CFZ A;  2VHA A;  5I57 B;  4HW8 A;  1Y1M A;  2D5W A;  1Q1K A;  2Y7K A;  4NF4 B;  4IO5 A;  5B7D A;  3W9W A;  3VVF A;  4PE5 B;  1IXH A;  1B9J A;  4XKP A;  3MZ1 A;  4F1Y A;  3VV5 A;  4XTC Q;  1KA0 A;  1BLF A;  4N6K A;  3TQW A;  4GL0 A;  1MQI A;  2X26 A;  1LBC A;  5T3J A;  3HHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...