2PVUA

Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
235
structure length
235
Chain Sequence
GATKKKVVVGTDAAFAPFEYMQKGKIVGFDVDLLDAVMKAAGLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQVILVKQGSPVKNALDLKGKTIGVQNATTGQEAAEKLFGKGPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNKKLQVIEDPKNFASEYYGMIFPKNSELKAKVDEALKNVINSGKYTEIYKKWFGKEPKLDRLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ArtJ
publication title Crystal structures and mutational analysis of the arginine-, lysine-, histidine-binding protein ArtJ from Geobacillus stearothermophilus. Implications for interactions of ArtJ with its cognate ATP-binding cassette transporter, Art(MP)2
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 79
structure length 235
sequence length 235
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2pvuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2pvuA02
3VVEA 2DS9A 1P1NA 1XOCA 3IORA 1LB8A 4NF8B 4IY5A 5ITOA 3JYRA 3SESA 4KR5A 2DWAA 3O66A 2VGQA 4XKQA 4EXKA 4X48A 2DXYA 1US4A 1QJMA 3HSTA 4F29A 4OWDA 1MQHA 3RTWB 5DVIA 4U1ZA 3CG1A 1TFAA 4OFLA 3H4ZA 3A3UA 3A09A 4F1YA 3N94A 3IOTA 3MW0A 2QMWA 1MXUA 2QPQA 3IJXB 3L6HA 3UORA 3F11A 1B1XA 4RXLA 2I6EA 4YAHX 4R73A 2O1MA 1A55A 3OSQA 2BJJX 4NWDA 3T9XB 1LFIA 2E1SA 4ZE8A 4G68B 3G3HA 4WKMA 2I58A 1IQ7A 4P0IA 4LA9A 3C32A 1B32A 3EHSA 5KZTA 1MDP1 2B3FA 3MBPA 1H43A 2LAOA 1JEVA 2PMSA 2DE3A 1NKXA 3IL1B 1A8EA 4Z0IA 3DM0A 3TFLA 4OTEA 2ALUA 4I8CA 2Z22A 5KDTA 3RT8A 4ZEKA 2DQVA 1PC3A 3KOTA 1N7XA 3N26A 4EQ9A 1FQDA 4R75A 4OHNA 5I2NA 3DP8A 5I57A 4R6KA 1FQFA 1PB7A 3G3KA 2E0SA 3FV2A 3FUZA 3O2AA 3S9LC 1JVYA 3M3KA 1FTOA 3SEXA 1FCKA 3PUXE 1JQFA 4NEDA 1LFHA 4BDQA 2ESNA 2OCUA 3EF7A 2DOJA 5B7DA 3FASA 4G8NA 2DXRA 4H65A 4OEUA 5FTHA 2I0BA 1O64A 2PVUA 5I59A 5JEIA 5KDTB 3CR9A 5IKBA 2IA4A 3GBAA 1PB9A 2NUVA 2Y84A 2DE4A 3PGFA 1NH8A 4NTLA 3PPOA 4GQOA 4POXA 1N3XA 2XXRA 1B1HA 3LSLA 5I2NB 3R7XA 2ONRA 2PT1A 1BLFA 4H8IA 5I57B 2O1LA 4OVJA 3IB1A 1QVSA 4C1TA 1ZLQA 3USDA 2R71A 1LLSA 3IO6A 3IX1A 1VSOA 4F22A 1N7WA 3BFUA 5CMBA 3LC8A 4X1DA 1VFEA 3SDFA 3OO7A 2DYXA 1JEUA 4G4PA 1SI1A 3KN7A 5I59B 5DEXA 4JSOA 4N6PA 3RGYA 1LBCA 2F7CA 1LBBA 5J1DA 4P11A 1UIUA 4GD5A 3CIJA 4RPNA 2RCBA 2O7IA 4HS7A 4EF1A 1PBQA 2W7YA 1MG1A 2XXHA 4I9DA 1SW1A 4OESA 3QUFA 2O6AA 1B7ZA 3P7IA 2I4BA 4NF4A 1B3EA 3TTMA 1GR2A 1DMBA 5BWJA 1MDQA 2IEEA 3FXUA 4FEDA 1NNFA 2RC7A 1YTVA 3ZSFA 3ZS6A 1GV8A 4OYVA 4GFRA 3HCQA 3MVXA 4HW8A 1CE2A 2GHAA 4F3BA 5EHSA 2V84A 3OO8A 2GH9A 4F3GA 5ELVA 5DEXB 4GL8A 4U23A 2F35A 4PP0A 4DXUA 2F8DA 2H99A 1ZU0A 1N04A 5F7VA 1SW5A 4QSDA 3RPWA 2GFEA 2AIXA 3G3GA 4IGTA 5DVJA 2HZKA 2ZXTA 3PU5A 3PUWE 5B70A 2NOOA 1OLAA 2Z8FA 1Y4TA 3KSXA 3Q26A 5CRYA 2QL3A 3OSRA 1D3KA 1IXIA 4NF4B 3VV5A 3DELB 1S7YA 4OXVA 1B2HA 2OWTA 3MC2A 1POY1 4E0WA 1BP5A 4DXCA 2XD3A 4QSEA 4P0GA 1OQGA 1EZPA 2Z8EA 2YPNA 1P1OA 1R9QA 2B65A 4FATA 3BBRA 1OQHA 3KZGA 2M8CA 3RQTA 1IUDA 4FJPA 3OENA 1B6HA 4BDRA 3RN8A 4KCDA 2XXXA 4U1OA 3IO4A 4GOTA 1RYOA 4TQUQ 3CVGA 4RK2A 3ILUB 4AB5A 3ODBA 3CFLA 2AYSA 1VE4A 1LFGA 4C1UA 3TYHA 4IO3A 3S9MC 3K0VA 2H5YA 3FJ7A 5L9OA 4ZEFA 4QFPA 1LCTA 1I6BA 4H6DA 4M4GA 3IB0A 3CRBA 5AA2D 1ATGA 3O97A 4F18A 2YJPA 4I1DA 3BFTA 5EYFA 1N3WA 1YCJA 3Q25A 1B52A 4K3FA 3M3FA 5HBCA 2HCAA 4TOZA 1D4NA 3SEYA 3C34A 2RF1A 2F6GA 4O3CA 4RNSA 1YAEA 3ONMA 1F9BA 4IO6A 2H25A 5M2VA 3K02A 2Y7WA 3LSWA 2DP8A 1DOTA 3H6WA 3EN3A 3MVWA 4PETA 1R9LA 4G8HA 3IAZA 2Y7KA 3D4GA 4PE5B 3O6HA 2Y7RA 1FTJA 5TP9A 1QKAA 3E9XA 1FQEA 4X1BA 2O68A 4RY1A 4ELQA 4TLLB 1N84A 3M8UA 4XIGQ 2REGA 3V5AA 1I69A 1LAFE 2ABHA 3K6WA 5LOMA 5H8QA 1B0HA 3FVOA 3FZVA 3FXQA 4XKRA 1MH3A 1B40A 4KYDA 3C33A 5KCJA 1MXWA 1YPNA 4ONYA 4ELOA 3V83A 3VLVA 1M5BA 3O29A 4NWCA 1ELJA 4GL0A 2XXUA 4EXLA 3QUJA 4QRZA 4GRKA 3LUYA 1LSTA 1SYIA 5FHNA 1R6ZA 4RJZA 3HPIA 5DT6A 2XXTA 1URSA 3K4UA 3UK4A 5K2XA 1LAHE 3DP4A 5TP9B 3PPPA 4IB2A 4R72A 1JVXA 3THIA 1Y9UA 3MZBA 5I2KA 1QUKA 5H8NA 5H8QB 4EQBA 2P1SA 2DSFA 4Z7EA 1M5EA 3RNNA 3QK6A 4XXUA 4OFJA 1M5DA 4KCCA 5KCJB 3CG3A 3K1PA 4WXJA 2HFBA 3K01A 1SBPA 2DWJA 4OFOA 2REJA 3K6VA 3OXNA 2Q2CA 4YB5A 4F39A 4NF5A 1JW4A 1IIWA 1IITA 3OEKA 2OK2A 2G93A 3VLUA 1Y3NA 1B5IA 4N07A 1WDNA 3N5LA 4JWXA 3MZ9A 2V3UA 3MZ1A 4GWOA 2A5SA 1B0LA 4KQPA 2X7QA 5CBSA 1HSLA 4YKKA 4IGRA 1Y3PA 5I2KB 4JSDA 1AH5A 3M3LA 2V3QA 5H8NB 3V8XB 4LUBA 1QULA 4JWYA 3C35A 1SVXB 1TWYA 3W9VA 4E0XA 1KWHA 1A8FA 3PMWA 4YZZA 3OO6A 4NE4A 1JW1A 1IXCA 3T93B 4OMBA 3HHGA 1PEBA 3KBRA 2I3WA 3KSJA 3K6XA 3MP6A 4O3BA 4NF5B 3G7WA 5CMMA 2VD3A 1ZTYA 2QJEA 3OD7A 5CC2A 3H6VA 3GXAA 4ZEBA 3RTFB 1MXZA 2ZYNA 3A3CA 1FTKA 2HEUA 2F78A 3N6UA 3UN6A 3MVYA 1ZJLA 1H44A 4XKNA 2XXQA 4U21A 4U2RA 3VDFA 4R9FA 1LGBC 3VXBA 1GTKA 5AA1A 5I84A 3TPAA 3WAFA 1LAGE 3CFXA 5CM6A 2AL5A 3TCHA 4F3PA 3MVZA 3TEPA 1MM7A 3O28A 5DYHA 2X7PA 3CSGA 3TCFA 2FA7A 1FQCA 3KG2A 1B9JA 5A5XA 4KYSA 3T9UA 4LZ7A 2UXAA 1MS7A 2Z8DA 1JW5A 1FQBA 4R2FA 3PUZE 4MFIA 1MY0A 4GXSB 3TZAA 3LSXA 2KLFA 4ZZAA 4H5FA 5BUUA 1Z7NE 1NNTA 2A5TB 3EHUA 4R6HA 4IO5A 1VR5A 1MQIA 2ZYOA 5I56A 3TTNA 5AA3A 4PFUA 4YB6A 3T9HB 5K2YA 1RKMA 4GVOA 3TTLA 3UA8A 2VD2A 1NNKA 1DPEA 4FIMA 2ZNUA 2ANJA 2O84X 3EHTA 3FVGA 4G2ZA 1MH4A 4FEBA 3KN3A 1MY3A 1S50A 4RA1A 4U4XA 4OERA 5A5XB 4NMYA 3MUQA 3I5OA 2NWJA 4PFYA 4JBZA 3H06B 1P99A 4FECA 1I6QA 3O9PA 4GLIA 2F6PA 2F97A 4M1VA 4BDNA 1HSJA 1B5JA 3C9HA 4PFTA 1POTA 3ILTB 2OLBA 3RUMA 1S9TA 2XXPA 5H8HA 4XTCQ 1B3LA 5I56B 5DTBA 1CB6A 3KN8A 2XX9A 2OJTA 2ONKE 4N13A 4H1XA 2H98A 5CMKA 1Q35A 2XXIA 4MF3A 4ZDMA 2HAUA 1NFTA 3FJGA 3IB2A 3ECRA 1UQWA 2ZNTA 3KGCA 1AL3A 3I6VA 4G68C 2HXWA 2QSXA 3QSLA 1DTZA 3FGSA 4EQ7A 4ISUA 1L5TA 3S4UA 4OZ9A 2O7UA 2Z23A 3JV9A 1DPPA 3S2VA 2HZLA 3QIMA 4QFNA 5H8HB 5CBRA 3CSBA 1T0KA 4I62A 1A7LA 4TLMB 2PBWA 3LR1A 4ZS9A 4Q0CA 2Y7PA 3OOAA 1D9YA 1NMUA 1I6AA 4AQ4A 3G3IA 4IO7A 1SQYA 2I48A 4OETA 3U92A 1DTGA 3FV1A 4EUOA 1H3DA 3K1NA 3PUYE 4YU0A 4YB7A 1URDA 1Y20A 3K6UA 4LQ5A 1UTHA 5CMCA 5ICQA 2DVCA 1B7HA 2UYEA 3Q28A 4THIA 3C4MA 4YMAA 3DP6A 3SEVA 1XHYA 3B6TA 3HN0A 2RC9A 2D5WA 3MJNA 3VXCA 1TT1A 4ZEIA 3SKPA 3PV0E 1P1UA 3T66A 1OMPA 5AA2B 1LCFA 4JDFA 3EPEA 1MY1A 4MH5A 2AL4A 3MQ9A 3PD9A 5ISUA 2UYFA 4R2BA 2HQ0A 3TELA 2QMXA 3HHFA 1N0TA 5HM4B 1USYH 3PPQA 1OIBA 4JB7A 1B51A 2QRYA 4G77A 2YLNA 3E13X 1Y3QA 1EH3A 4QFLA 1JETA 4LONB 3U72A 1UTHB 1AMFA 2WKYA 1LB9A 3OO9A 4YICA 3W15C 4ZE9A 1Y1ZA 5JTYA 5L9SA 2F34A 3MP8A 3FATA 4LP2B 3E3KA 3S9NC 4UA8A 3TCGA 4F1VA 5IAIA 3TMGA 5HPQA 1NNPA 1PBPA 1EZOA 1P1WA 3QAXA 1WVJA 2GRVA 4WEDA 1ZKBA 4R74A 1MQGA 2ZYMA 4MLQA 3IOVA 2F7BA 2P0SA 4MLVA 1MPBA 1ZIUA 2G29A 4WEPA 1MXVA 3RLFE 5H8SA 2XHDA 4IY6A 1MXXA 1XVYA 2VP1A 1OVBA 1B3HA 1RYXA 3K00A 1TXFA 4ND9A 2V3TA 2QS3A 4JXIA 3TAJA 4NF6B 4GF8A 1URGA 4AB6A 1PB8A 1B7UA 3S9EA 3T22A 4YMBA 1MQDA 4LVQA 2FYIA 1M5CA 3MPKA 5JTYB 1FQAA 3H7MA 2NXOA 3MP1A 3KJ7A 2VHAA 4IO4A 4OEVA 1Q1KA 3R6UA 2H4IA 1WODA 5ITPA 4DXBA 3UGWA 1ANFA 3TKDA 2RKMA 5AA4A 3QXMA 3H03A 3QYTA 3L6GA 1B5HA 1OVTA 3D4CA 4LATA 2ZNSA 1HSEA 1O7TA 3W9WA 1NH7A 1Y4CA 2XXYA 1O63A 4F3SA 5FHMA 2HAVA 3C31A 1SW4A 4KD5A 3VVFA 3PPNA 2ZMBA 2V25A 1UTBA 3KEIA 4FORA 1BIYA 3PD8A 2O51A 3LBSA 3PPRA 1GVCA 4FAJA 4R9GA 4RPOA 3FD3A 1SW2A 4H67A 1B05A 4DE8A 5I58A 4GXAA 3KFMA 3I3VA 1MPDA 3B7DA 4JWOA 3BKIB 4H8JA 5AA4B 2RINA 5CI5A 3IK6B 4H5GA 3IR1A 3B6WA 4QHQA 2UVHA 5L8DA 2A5TA 4OQOA 1B4HA 3AXFA 4KHZE 4F2OA 3N6TA 1OLCA 3FIRA 3MWBA 2PYYA 2QS4A 4PFWA 2XXWA 4KI0E 5TU0A 3SETA 4Q8RA 1MRPA 4QFKA 1DSNA 5FTIA 2Q8JA 4BDLA 2QS2A 4G8MA 2H9BA 5EHMA 2ONSA 1UTBB 2F7AA 2I4CA 3U1OA 1A54A 3O6IA 1SDXA 1D9VA 4BDOA 1IZ1A 4QF9A 1SD3A 4LQ2A 3JZJA 1Y1MA 4QSCA 5I58B 4EF2A 1ZMGA 3IOWA 4KFQA 3O6GA 3SEUA 2OBGA 1R1NA 4BLAA 2XD2A 2RC8A 3TQLA 5DVFA 2I0CA 1AIVA 1B58A 2Q9TA 3FVKA 4DLDA 3VLWA 2QS1A 4RYAA 3HO7A 1NL5A 4UACA 4ZEDA 4F1UA 2VOZA 2D21A 4ZZEA 2GHBA 4R6YA 2Y7IA 1QKBA 1FW0A 3PMVA 2PT2A 1IXGA 1MM6A 4HTGA 3R26A 3VVDA 2Q2AA 5H8FA 1XT8A 2CMOA 3ZKLA 4OENA 2DWHA 1GGGA 1SYHA 3SEWA 2UVJA 4FE8A 1AOVA 4YKJA 1VFDA 3U8QA 1MXYA 3G3JA 2R9JA 1MY4A 3TUSA 2I49A 4HCYA 3UIFA 2O69A 2ZYKA 1USYE 3IJOB 1MPCA 2Q88A 3CFZA 4BDMA 1FTMA 1B3FA 2DE2A 3H3GA 3OEMA 1UIVA 2DVZA 3TODA 2PX1A 2UVIA 2I3VA 4DIGA 5H8FB 3B6QA 3RT6B 2FNCA 4ESWA 2CZLA 3OMBA 1FTLA 3ZKKA 3PUVE 3K1MA 1SI0A 3VE1B 1B3GA 2OWSA 2V93A 3FVNA 4X9TA 3FXRA 2THIA 1TFDA 2RCAA 4C0RA 4EDPA 3E4RA 4U4SA 4O3AA 4ECFA 4ELPA 1IEJA 3H6UA 3T9VA 3IOUA 3Q27A 2D3IA 4PQJA 2XX8A 4DDDA 5TPAA 1US5A 4DCXA 3MPLA 3U94A 1A40A 5AA2A 1BKAA 1EU8A 1QUJA 3G3FA 2F36A 3DLNA 1B4ZA 4F31B 4ESXA 1A99A 5L9MA 1XVXA 4HCWA 4YKPA 4KPTA 2UVGA 3MAMA 1II5A 4RK9A 4POWA 2B3BA 1JNFA 3HV1A 4F19A 4ZECA 5ICTA 1B46A 1MQJA 3TTKA 4Q5TA 1EZ9A 3KOSA 1N76A 1XC1A 1LAXA 1M5FA 2R6GE 5JK4A 4IO2A 1Z7ME 3TDJA 3H6TA 3KJTA 4QFOA 1MY2A 4KYEA 1ZBMA 1J1NA 3UP9A 4LZ8A 5TPAB 3TTRA 3U93A 3PMXA 3EQ1A 4NF8A 3Q29A 3WAEA 2OZZA 4Q30B 3OELA 2NVUB 3TQWA 4LZ5A 2XXVA 4GIZA 2XX7A 1H45A 3V89B 4DCYA 4MBPA 5FHOA 3GLBA 4U22A 2X26A 1QW0A 4H0WA 4XKPA 3T96B 1P1QA 4DZ1A 2Q89A 3FJMA 1QUIA 3GZGA 2P2AA 4L17A 4YKIA 3CI8A 3GBBA 3C36A 4NF6A 2F5XA 5F1QA 1PDAA 1XS5A 4F2QA 1H76A 3SERA 3LSFB 1BTJA 2DWIA 3VFJA 1IXHA 5AE4A 4ELRA 4G68A 3K2DA 3RY3A
chains in the Genus database with same CATH superfamily
3VVEA 3BIHA 4DI3D 2DS9A 1P1NA 4N17A 1XOCA 3IORA 1LB8A 1NV4A 4NF8B 4IY5A 5ITOA 1DBZA 3JYRA 3SESA 4KR5A 2DWAA 3O66A 2VGQA 4XKQA 4EXKA 4X48A 2DXYA 1US4A 1QJMA 3HSTA 4F29A 4OWDA 1MQHA 5ET6A 3RTWB 5DVIA 4U1ZA 3CG1A 1TFAA 4OFLA 2FBPA 3H4ZA 3A3UA 3A09A 4GBVA 4F1YA 3N94A 4DI4B 5ET5A 3IOTA 3MW0A 2QMWA 1MXUA 2QPQA 3IJXB 3L6HA 3UORA 3F11A 1B1XA 4RXLA 3SZPA 2I6EA 4YAHX 4R73A 2O1MA 1A55A 3OSQA 2BJJX 1LEVA 4NWDA 3T9XB 1LFIA 4P1LA 4MNIA 2E1SA 4ZE8A 4G68B 3G3HA 4WKMA 2I58A 1IQ7A 4P0IA 4LA9A 3C32A 1B32A 3EHSA 5KZTA 1MDP1 2B3FA 3MBPA 1H43A 2LAOA 3U65A 1JEVA 2PMSA 4QXDA 2DE3A 1NKXA 3IL1B 1A8EA 4Z0IA 3DM0A 3TFLA 4OTEA 2ALUA 4I8CA 4PDDA 2Z22A 5KDTA 3RT8A 5I5PA 4ZEKA 2DQVA 4N91A 1PC3A 5IGAA 1KA0A 1N7XA 3KOTA 3N26A 4EQ9A 1FQDA 4R75A 3KC0A 4OHNA 5I2NA 3DP8A 5I57A 4R6KA 1FQFA 1PB7A 3G3KA 2CZKA 2E0SA 3FV2A 1EYKA 3FUZA 3O2AA 3S9LC 1JVYA 3M3KA 1FTOA 3SEXA 4I3EA 1FCKA 3PUXE 1JQFA 4NEDA 1LFHA 4BDQA 2ESNA 2OCUA 3EF7A 4MJOA 2DOJA 5B7DA 3FASA 4G8NA 2DXRA 4H65A 4OEUA 5FTHA 2I0BA 1O64A 2PVUA 5I59A 5JEIA 5KDTB 3CR9A 5IKBA 2IA4A 3GBAA 1PB9A 2NUVA 2Y84A 2DE4A 3PGFA 2CZHA 1NH8A 4NTLA 3PPOA 4GQOA 4POXA 1N3XA 2XXRA 1B1HA 3LSLA 5I2NB 3R7XA 2ONRA 2PT1A 1BLFA 4H8IA 1FBDA 2O1LA 5IZ3A 5I57B 4OVJA 3IB1A 1QVSA 4C1TA 1ZLQA 4N6DA 2VPNA 2XXKA 3USDA 4UABA 2R71A 1LLSA 3IO6A 3IX1A 1VSOA 2WYPA 4F22A 1N7WA 3BFUA 5CMBA 3LC8A 4JVCA 4X1DA 5LDZA 1VFEA 3SDFA 3OO7A 2DYXA 5FBPA 1JEUA 4G4PA 1SI1A 4GX6A 3KN7A 5I59B 5DEXA 4JSOA 4N6PA 3RGYA 1LBCA 2F7CA 1LBBA 5J1DA 4PDHA 4P11A 1UIUA 4GD5A 1EYJA 3CIJA 4RPNA 2RCBA 5EYGA 2O7IA 4HS7A 1FBGA 4EF1A 1PBQA 2W7YA 1MG1A 2XXHA 4I9DA 1SW1A 4OESA 4HE2A 3QUFA 2O6AA 1B7ZA 3P7IA 2I4BA 4NF4A 1B3EA 3TTMA 1GR2A 1DMBA 5BWJA 1MDQA 2IEEA 3FXUA 2QVUA 4GWZA 3QMFA 4FEDA 1NNFA 2RC7A 1YTVA 3ZSFA 3ZS6A 1GV8A 4OYVA 4GFRA 3HCQA 3MVXA 4HW8A 1CE2A 2GHAA 4F3BA 5EHSA 2V84A 3OO8A 2GH9A 4F3GA 5ELVA 5DEXB 4GL8A 4U23A 2F35A 4PP0A 5EQ8A 4DXUA 2F8DA 2H99A 1ZU0A 1N04A 5F7VA 1SW5A 4QSDA 3RPWA 2GFEA 2AIXA 3G3GA 4IGTA 5ET8A 5DVJA 4OVPA 1DCUA 1FRPA 2HZKA 2ZXTA 3PU5A 3PUWE 2Y5LA 5B70A 2NOOA 1OLAA 2Z8FA 1Y4TA 3KSXA 3Q26A 5CRYA 2QL3A 3OSRA 1D3KA 5I7IA 1IXIA 4NF4B 3VV5A 3DELB 1S7YA 4OXVA 1B2HA 2OWTA 3MC2A 1POY1 4E0WA 1BP5A 4DXCA 2XD3A 4QSEA 4P0GA 4OVQA 1OQGA 1IMFA 1EZPA 2Z8EA 5EQAA 1NV1A 2YPNA 1P1OA 1R9QA 2B65A 4FATA 3BBRA 1OQHA 3KZGA 2M8CA 5ESYA 3RQTA 2BJIA 1IUDA 4IR8A 4FJPA 3OENA 4OANA 1B6HA 4BDRA 3RN8A 3LV0A 2XXXA 4KCDA 4U1OA 3IO4A 4GOTA 1RYOA 4TQUQ 3CVGA 4RK2A 3ILUB 4AB5A 4HE0A 3ODBA 3CFLA 2AYSA 1VE4A 1LFGA 4C1UA 3TYHA 4IO3A 3S9MC 3K0VA 2H5YA 1KZ8A 4MEVA 3NOHA 3FJ7A 5L9OA 4ZEFA 4QFPA 1LCTA 1I6BA 3MSTA 4H6DA 4M4GA 3IB0A 4GWWA 3CRBA 5AA2D 1ATGA 3O97A 4F18A 2YJPA 2ZZXA 4I1DA 3BFTA 5EYFA 1N3WA 1YCJA 3Q25A 1B52A 4K3FA 3M3FA 5HBCA 2HCAA 4TOZA 1D4NA 3SEYA 3C34A 2RF1A 2F6GA 4O3CA 2B4LA 4RNSA 1YAEA 2CZIA 3ONMA 1F9BA 4IO6A 5F24A 2H25A 5M2VA 3K02A 2Y7WA 3LSWA 2DP8A 1DOTA 3H6WA 3EN3A 3MVWA 4PETA 1R9LA 4G8HA 4GBWA 3IAZA 2Y7KA 3D4GA 1G0IA 4PE5B 3O6HA 2Y7RA 1FTJA 5TP9A 1QKAA 3E9XA 4MMPA 1FQEA 4X1BA 2O68A 4RY1A 4ELQA 4TLLB 1N84A 3M8UA 4XIGQ 2REGA 3V5AA 1I69A 1LAFE 2ABHA 3K6WA 5LOMA 5H8QA 1B0HA 3FVOA 3FZVA 3FXQA 1NUWA 4XKRA 2WBDA 4O7IA 1MH3A 1B40A 4KYDA 4MNPA 3C33A 5KCJA 1MXWA 1YPNA 4ONYA 3PTYA 4ELOA 4NAPA 3V83A 4N15A 3VLVA 1INPA 1M5BA 3O29A 4NWCA 1ELJA 1KA1A 3ROJA 2PFZA 4GL0A 2XXUA 4EXLA 4O8MA 3QUJA 4PBQA 4QRZA 1LBYA 4GRKA 3LUYA 1LSTA 3B8BA 1SYIA 5FHNA 1R6ZA 4RJZA 4I3YA 4PAKA 3HPIA 5DT6A 2XXTA 1URSA 3K4UA 3UK4A 1LAHE 5K2XA 3DP4A 5TP9B 3PPPA 1NUYA 4IB2A 4R72A 1JVXA 3THIA 1Y9UA 3MZBA 5I2KA 5T3JA 2VT5A 1QUKA 1FPJA 5H8NA 2P1SA 5H8QB 4EQBA 2DSFA 2WBBA 4Z7EA 1M5EA 3RNNA 3QK6A 4XXUA 4OFJA 1FBEA 1M5DA 4KCCA 5KCJB 3CG3A 3K1PA 4WXJA 2HFBA 3K01A 1SBPA 2GQ1A 2DWJA 4OFOA 2CEYA 2L5VA 2REJA 3K6VA 3OXNA 1FPEA 2Q2CA 4YB5A 4F39A 4NF5A 1JW4A 1IIWA 1IITA 4NN3A 3OEKA 2OK2A 2G93A 3VLUA 1Y3NA 1B5IA 3GYYA 2FHYA 4N07A 1WDNA 3N5LA 4JWXA 4MNCA 3MZ9A 2V3UA 3MZ1A 4GWOA 2A5SA 1B0LA 4KQPA 2X7QA 2B4MA 5CBSA 1HSLA 4YKKA 4IGRA 4GX4A 1Y3PA 5I2KB 3A29A 1AH5A 3M3LA 4JSDA 5A5LA 2V3QA 5H8NB 3V8XB 4LUBA 1QULA 4JWYA 3C35A 1SVXB 1TWYA 3W9VA 4E0XA 1FTAA 1A8FA 1KWHA 3PMWA 1NUXA 4FBPA 4YZZA 3OO6A 4NE4A 1JW1A 1IXCA 3T93B 4OMBA 3HHGA 1PEBA 3KBRA 4I40A 2I3WA 3KSJA 3K6XA 3MP6A 4O3BA 4NF5B 3G7WA 5CMMA 2VD3A 1ZTYA 2QJEA 2FVZA 3OD7A 5CC2A 5EYHA 1SPIA 3H6VA 3GXAA 4ZEBA 3RTFB 1MXZA 2ZYNA 3A3CA 1FTKA 2HEUA 2F78A 3N6UA 3UN6A 3MVYA 2QFLA 1ZJLA 1H44A 4XKNA 2XXQA 4U21A 4U2RA 3VDFA 3T1BA 1LBVA 4R9FA 1LGBC 3VXBA 1GTKA 5AA1A 2WX9A 5I84A 3TPAA 3WAFA 1LAGE 1NV3A 4PFIA 3CFXA 4XEQA 5CM6A 2AL5A 3TCHA 4F3PA 3MVZA 3RPLA 3TEPA 1MM7A 3O28A 5DYHA 2X7PA 3CSGA 3TCFA 2FA7A 1FQCA 3KG2A 1B9JA 5A5XA 4KYSA 3T9UA 4LZ7A 2UXAA 1MS7A 2Z8DA 1JW5A 1FQBA 4PF6A 4R2FA 3PUZE 4MFIA 1IMCA 1MY0A 4GXSB 3TZAA 4KXPA 3LSXA 2KLFA 4ZZAA 4H5FA 5BUUA 1Z7NE 1NNTA 2A5TB 3EHUA 4R6HA 4IO5A 1VR5A 1MQIA 2ZYOA 5I56A 3TTNA 5AA3A 4PFUA 4YB6A 3T9HB 5K2YA 1RKMA 4GVOA 3TTLA 5LTCA 3UA8A 2VD2A 1NNKA 1DPEA 4FIMA 2ZNUA 2ANJA 2O84X 4PAIA 3EHTA 3FVGA 3RPLB 4G2ZA 1MH4A 4FEBA 3KN3A 1MY3A 1S50A 4RA1A 4U4XA 4OERA 1CNQA 5A5XB 4NMYA 1NI9A 3MUQA 3I5OA 2NWJA 4PFYA 4JBZA 3H06B 1P99A 4FECA 1I6QA 3FXBA 4GWUA 3O9PA 4GLIA 2F6PA 2F97A 4M1VA 4BDNA 3EKIA 1HSJA 1B5JA 3C9HA 4MHFA 4PFTA 1POTA 3ILTB 4QBAA 4H46A 2OLBA 3RUMA 1S9TA 2XXPA 2F3BA 5H8HA 4XTCQ 1B3LA 5I56B 5DTBA 1CB6A 3KN8A 2XX9A 2Q8MA 2OJTA 2ONKE 4N13A 4H1XA 2H98A 5CMKA 1Q35A 2XXIA 4MF3A 4ZDMA 2HAUA 1NFTA 4XF5A 3FJGA 3IB2A 4PTKA 1XI6A 3ECRA 4PF8A 1RDZA 1UQWA 2ZNTA 3KGCA 1AL3A 2FIXA 3I6VA 4G68C 2HXWA 2QSXA 4AS5A 3QSLA 1DTZA 3FGSA 4EQ7A 4ISUA 1L5TA 3S4UA 4XFEA 4GX3A 4OZ9A 1NV0A 2O7UA 2Z23A 3JV9A 1FPGA 1DPPA 3S2VA 1NV2A 2HZLA 3QIMA 4OVTA 2PCRA 4QFNA 4NHBA 5H8HB 5CBRA 4MAGA 3CSBA 1T0KA 4I62A 1A7LA 4TLMB 2PBWA 3LR1A 4JVDA 4ZS9A 4X8RA 4Q0CA 1NV6A 3MYUA 2Y7PA 3OOAA 1D9YA 1NMUA 1I6AA 1DK4A 4AQ4A 3G3IA 4PGPA 4IO7A 1SQYA 2QVRA 1VDWA 2I48A 4OETA 3U92A 1DTGA 1AWBA 3FV1A 4EUOA 1H3DA 3K1NA 3PUYE 4YU0A 4MX6A 4N4UA 4YB7A 1URDA 1Y20A 3K6UA 4HXVA 4LQ5A 1UTHA 5CMCA 5ICQA 2DVCA 1B7HA 2UYEA 1RDYA 3Q28A 4THIA 2VPOA 3C4MA 4YMAA 1FBPA 3DP6A 3SEVA 1XHYA 3B6TA 3HN0A 2RC9A 2D5WA 3MJNA 3VXCA 1TT1A 4GWYA 4ZEIA 4P56A 3SKPA 3PV0E 1P1UA 3T66A 3D1RA 1OMPA 5AA2B 1BK4A 4N6KA 1LCFA 3CHGA 2Y5KA 4JDFA 3EPEA 4NF0A 1G0HA 1MY1A 4MH5A 2AL4A 3MQ9A 3PD9A 5ISUA 2UYFA 4R2BA 2HQ0A 3TELA 2QMXA 3HHFA 1N0TA 5HM4B 1USYH 3PPQA 1OIBA 4JB7A 4NQ8A 1B51A 2QVVA 2XWVA 2QRYA 4G77A 2YLNA 3E13X 1Y3QA 4GWXA 2ZZVA 1EH3A 4QFLA 1JETA 4PAFA 4LONB 3U72A 1UTHB 4PGNA 2XA5A 1AMFA 3IFCA 4LN5A 1NUZA 4NG7A 2WKYA 1LB9A 3OO9A 4YICA 3W15C 4X04A 4ZE9A 1Y1ZA 5JTYA 5L9SA 2F34A 3MP8A 3FATA 4LP2B 3E3KA 3S9NC 1JP4A 4UA8A 3TCGA 4F1VA 5IAIA 3TMGA 4PE3A 5HPQA 1NNPA 1PBPA 1EZOA 1P1WA 3QAXA 1WVJA 2GRVA 4WEDA 1LBZA 1ZKBA 4R74A 1MQGA 2ZYMA 4MLQA 3IOVA 1K9YA 2F7BA 2P0SA 4MLVA 1MPBA 2KQZA 1ZIUA 2G29A 2FIEA 4WEPA 4O94A 2OX3A 5IZ1A 1MXVA 3RLFE 5H8SA 4NX1A 2XHDA 4IY6A 1MXXA 1XVYA 1NV5A 2VP1A 1OVBA 1B3HA 1RYXA 3K00A 1TXFA 4P3LA 4ND9A 2V3TA 1IMAA 4P1EA 2QS3A 4JXIA 3HFUA 3TAJA 4NF6B 4GF8A 1URGA 4AB6A 1PB8A 2R8TA 1B7UA 3S9EA 3T22A 4YMBA 1MQDA 4LVQA 2FYIA 1M5CA 3MPKA 5JTYB 1FQAA 3H7MA 4JVIA 2NXOA 3MP1A 3KJ7A 2VHAA 4IO4A 4OEVA 2KR0A 1Q1KA 3R6UA 2H4IA 1WODA 4P47A 5ITPA 3B50A 4OVRA 4DXBA 1FBFA 3UGWA 1ANFA 3TKDA 2RKMA 5AA4A 3QXMA 3H03A 3QYTA 3L6GA 1B5HA 1OVTA 3D4CA 4LATA 4N8GA 2ZNSA 1HSEA 4O7MA 2XWIA 1O7TA 3W9WA 5EQ9A 1NH7A 1YXIA 1Y4CA 2XXYA 1O63A 4F3SA 1IMDA 5FHMA 2HAVA 3C31A 1SW4A 4KD5A 3VVFA 1FPLA 2WYKA 3PPNA 2ZMBA 5I3SA 5DW8A 2V25A 1FPIA 2OWZA 1UTBA 2DDKA 3KEIA 4FORA 1BIYA 3PD8A 4H45A 1FBCA 2O51A 3LBSA 3PPRA 1GVCA 4FAJA 4R9GA 4RPOA 3FD3A 1SW2A 4H67A 1B05A 4DE8A 2Q74A 5I58A 4MCOA 1FPKA 2HPGA 4GXAA 3KFMA 3I3VA 1MPDA 3B7DA 4JWOA 3BKIB 4H8JA 1IMBA 5J16A 5AA4B 2RINA 5CI5A 3IK6B 4H5GA 3IR1A 3B6WA 1FJ9A 4QHQA 2UVHA 5L8DA 2A5TA 4OQOA 1B4HA 3AXFA 4KHZE 4F2OA 3N6TA 1OLCA 3FIRA 3MWBA 2PYYA 2QS4A 4PFWA 2XXWA 2XWKA 4G61A 4KI0E 5TU0A 3SETA 4Q8RA 3T0JA 1MRPA 4QFKA 1DSNA 5FTIA 2Q8JA 4BDLA 4AS4A 2QS2A 4G8MA 2H9BA 5EHMA 2ONSA 1UTBB 2F7AA 4PCDA 3ISPA 2I4CA 3U1OA 1A54A 3O6IA 1SDXA 5IM2A 1D9VA 4BDOA 2HXRA 1IZ1A 1FJ6A 4QF9A 1SD3A 4LQ2A 4NGUA 3JZJA 1Y1MA 4QSCA 5I58B 4EF2A 2CEXA 2MKZA 1ZMGA 3IOWA 4KFQA 1K9ZA 3O6GA 3SEUA 2OBGA 1R1NA 4BLAA 2XD2A 1D9QA 2RC8A 4N81A 3E78A 3TQLA 5DVFA 2I0CA 1AIVA 1B58A 2Q9TA 5EQ7A 3FVKA 4DLDA 3VLWA 2P3NA 2QS1A 4RYAA 3HO7A 1NL5A 4UACA 4ZEDA 4F1UA 5ET7A 2VOZA 2D21A 4ZZEA 2GHBA 4R6YA 2Y7IA 1FSAA 1LBWA 1QKBA 2WEFA 1FW0A 3PMVA 2PT2A 1IXGA 1MM6A 4HTGA 1FBHA 3R26A 3VVDA 2Q2AA 5H8FA 5IZ3B 1XT8A 2CMOA 3ZKLA 4OENA 2DWHA 1GGGA 1SYHA 4P8BA 3SEWA 2UVJA 2P3VA 4FE8A 4MIJA 1AOVA 4YKJA 4OA4A 1VFDA 3U8QA 3FBPA 1MXYA 3G3JA 2R9JA 1MY4A 3TUSA 2I49A 4HCYA 3UIFA 2O69A 2ZYKA 3BIGA 1USYE 3IJOB 4N8YA 1MPCA 2Q88A 3CFZA 4BDMA 1FTMA 1IMEA 1B3FA 2HHMA 2DE2A 3H3GA 3OEMA 4PBHA 1UIVA 2DVZA 3TODA 2PX1A 2UVIA 2I3VA 4PC9A 4DIGA 5H8FB 3B6QA 3RT6B 2FNCA 4ESWA 1NV7A 2CZLA 3OMBA 1FTLA 3ZKKA 3PUVE 4PFBA 2PFYA 3K1MA 1SI0A 3VE1B 1B3GA 2OWSA 2V93A 3FVNA 4X9TA 3FXRA 2THIA 1TFDA 2RCAA 4C0RA 4EDPA 3E4RA 4U4SA 4O3AA 4ECFA 4ELPA 1FPDA 1IEJA 3H6UA 3T9VA 3IOUA 3Q27A 1YYZA 2D3IA 4PQJA 2XX8A 4DDDA 5TPAA 1US5A 4P9KA 4DCXA 3MPLA 3U94A 1A40A 5AA2A 1BKAA 1EU8A 1QUJA 3G3FA 1Q9DA 4OVSA 2F36A 3DLNA 3LUZA 1B4ZA 4F31B 4ESXA 1A99A 5L9MA 3RYDA 4HE1A 1XVXA 4HCWA 4YKPA 4KPTA 2V4CA 2UVGA 3MAMA 1EYIA 1II5A 2JJKA 4RK9A 4POWA 2B3BA 1JNFA 1QGXA 3HV1A 4F19A 4ZECA 5ICTA 1B46A 1MQJA 3TTKA 4Q5TA 1EZ9A 3KOSA 1N76A 1XC1A 1LAXA 1M5FA 2R6GE 1FPFA 2XWOA 5JK4A 2ZZWA 4IO2A 1Z7ME 1FPBA 3TDJA 1YZ0A 3H6TA 3KJTA 4QFOA 1MY2A 4KYEA 1ZBMA 1J1NA 3UP9A 4LZ8A 5TPAB 3TTRA 1RDXA 3KBZA 3U93A 3PMXA 3EQ1A 4NF8A 3Q29A 3WAEA 2OZZA 4Q30B 3OELA 2NVUB 3TQWA 4LZ5A 2XXVA 4GIZA 2XX7A 1H45A 3V89B 4DCYA 4MBPA 5FHOA 3GLBA 4U22A 2X26A 1QW0A 4H0WA 4XKPA 3T96B 1P1QA 4DZ1A 5IZZA 2Q89A 3FJMA 1QUIA 3GZGA 4PFRA 2P2AA 4L17A 4YKIA 3CI8A 3GBBA 3E79A 3C36A 4NF6A 2F3DA 2F5XA 5F1QA 1PDAA 1XS5A 3KC1A 4F2QA 1H76A 3SERA 3IFAA 3LSFB 1BTJA 2DWIA 3VFJA 4GWSA 1IXHA 5AE4A 4ELRA 4G68A 1LBXA 3K2DA 3RY3A
chains in the Genus database with same CATH topology
3VVEA 2DS9A 1P1NA 1XOCA 3IORA 1LB8A 4NF8B 4IY5A 5ITOA 3JYRA 3SESA 4KR5A 2DWAA 3O66A 2VGQA 4XKQA 4EXKA 4X48A 2DXYA 1US4A 1QJMA 3HSTA 4F29A 4OWDA 1MQHA 3RTWB 5DVIA 4U1ZA 3CG1A 1TFAA 4OFLA 3H4ZA 3A3UA 3A09A 4F1YA 3N94A 3IOTA 3MW0A 2QMWA 1MXUA 2QPQA 3IJXB 3L6HA 3UORA 3F11A 1B1XA 4RXLA 2I6EA 4YAHX 4R73A 2O1MA 1A55A 3OSQA 2BJJX 4NWDA 3T9XB 1LFIA 2E1SA 4ZE8A 4G68B 3G3HA 4WKMA 2I58A 1IQ7A 4P0IA 4LA9A 3C32A 1B32A 3EHSA 5KZTA 1MDP1 2B3FA 3MBPA 1H43A 2LAOA 1JEVA 2PMSA 2DE3A 1NKXA 3IL1B 1A8EA 4Z0IA 3DM0A 3TFLA 4OTEA 2ALUA 4I8CA 2Z22A 5KDTA 3RT8A 4ZEKA 2DQVA 1PC3A 3KOTA 1N7XA 3N26A 4EQ9A 1FQDA 4R75A 4OHNA 5I2NA 3DP8A 5I57A 4R6KA 1FQFA 1PB7A 3G3KA 2E0SA 3FV2A 3FUZA 3O2AA 3S9LC 1JVYA 3M3KA 1FTOA 3SEXA 1FCKA 3PUXE 1JQFA 4NEDA 1LFHA 4BDQA 2ESNA 2OCUA 3EF7A 2DOJA 5B7DA 3FASA 4G8NA 2DXRA 4H65A 4OEUA 5FTHA 2I0BA 1O64A 2PVUA 5I59A 5JEIA 5KDTB 3CR9A 5IKBA 2IA4A 3GBAA 1PB9A 2NUVA 2Y84A 2DE4A 3PGFA 1NH8A 4NTLA 3PPOA 4GQOA 4POXA 1N3XA 2XXRA 1B1HA 3LSLA 5I2NB 3R7XA 2ONRA 2PT1A 1BLFA 4H8IA 5I57B 2O1LA 4OVJA 3IB1A 1QVSA 4C1TA 1ZLQA 3USDA 2R71A 1LLSA 3IO6A 3IX1A 1VSOA 4F22A 1N7WA 3BFUA 5CMBA 3LC8A 4X1DA 1VFEA 3SDFA 3OO7A 2DYXA 1JEUA 4G4PA 1SI1A 3KN7A 5I59B 5DEXA 4JSOA 4N6PA 3RGYA 1LBCA 2F7CA 1LBBA 5J1DA 4P11A 1UIUA 4GD5A 3CIJA 4RPNA 2RCBA 2O7IA 4HS7A 4EF1A 1PBQA 2W7YA 1MG1A 2XXHA 4I9DA 1SW1A 4OESA 3QUFA 2O6AA 1B7ZA 3P7IA 2I4BA 4NF4A 1B3EA 3TTMA 1GR2A 1DMBA 5BWJA 1MDQA 2IEEA 3FXUA 4FEDA 1NNFA 2RC7A 1YTVA 3ZSFA 3ZS6A 1GV8A 4OYVA 4GFRA 3HCQA 3MVXA 4HW8A 1CE2A 2GHAA 4F3BA 5EHSA 2V84A 3OO8A 2GH9A 4F3GA 5ELVA 5DEXB 4GL8A 4U23A 2F35A 4PP0A 4DXUA 2F8DA 2H99A 1ZU0A 1N04A 5F7VA 1SW5A 4QSDA 3RPWA 2GFEA 2AIXA 3G3GA 4IGTA 5DVJA 2HZKA 2ZXTA 3PU5A 3PUWE 5B70A 2NOOA 1OLAA 2Z8FA 1Y4TA 3KSXA 3Q26A 5CRYA 2QL3A 3OSRA 1D3KA 1IXIA 4NF4B 3VV5A 3DELB 1S7YA 4OXVA 1B2HA 2OWTA 3MC2A 1POY1 4E0WA 1BP5A 4DXCA 2XD3A 4QSEA 4P0GA 1OQGA 1EZPA 2Z8EA 2YPNA 1P1OA 1R9QA 2B65A 4FATA 3BBRA 1OQHA 3KZGA 2M8CA 3RQTA 1IUDA 4FJPA 3OENA 1B6HA 4BDRA 3RN8A 4KCDA 2XXXA 4U1OA 3IO4A 4GOTA 1RYOA 4TQUQ 3CVGA 4RK2A 3ILUB 4AB5A 3ODBA 3CFLA 2AYSA 1VE4A 1LFGA 4C1UA 3TYHA 4IO3A 3S9MC 3K0VA 2H5YA 3FJ7A 5L9OA 4ZEFA 4QFPA 1LCTA 1I6BA 4H6DA 4M4GA 3IB0A 3CRBA 5AA2D 1ATGA 3O97A 4F18A 2YJPA 4I1DA 3BFTA 5EYFA 1N3WA 1YCJA 3Q25A 1B52A 4K3FA 3M3FA 5HBCA 2HCAA 4TOZA 1D4NA 3SEYA 3C34A 2RF1A 2F6GA 4O3CA 4RNSA 1YAEA 3ONMA 1F9BA 4IO6A 2H25A 5M2VA 3K02A 2Y7WA 3LSWA 2DP8A 1DOTA 3H6WA 3EN3A 3MVWA 4PETA 1R9LA 4G8HA 3IAZA 2Y7KA 3D4GA 4PE5B 3O6HA 2Y7RA 1FTJA 5TP9A 1QKAA 3E9XA 1FQEA 4X1BA 2O68A 4RY1A 4ELQA 4TLLB 1N84A 3M8UA 4XIGQ 2REGA 3V5AA 1I69A 1LAFE 2ABHA 3K6WA 5LOMA 5H8QA 1B0HA 3FVOA 3FZVA 3FXQA 4XKRA 1MH3A 1B40A 4KYDA 3C33A 5KCJA 1MXWA 1YPNA 4ONYA 4ELOA 3V83A 3VLVA 1M5BA 3O29A 4NWCA 1ELJA 4GL0A 2XXUA 4EXLA 3QUJA 4QRZA 4GRKA 3LUYA 1LSTA 1SYIA 5FHNA 1R6ZA 4RJZA 3HPIA 5DT6A 2XXTA 1URSA 3K4UA 3UK4A 5K2XA 1LAHE 3DP4A 5TP9B 3PPPA 4IB2A 4R72A 1JVXA 3THIA 1Y9UA 3MZBA 5I2KA 1QUKA 5H8NA 5H8QB 4EQBA 2P1SA 2DSFA 4Z7EA 1M5EA 3RNNA 3QK6A 4XXUA 4OFJA 1M5DA 4KCCA 5KCJB 3CG3A 3K1PA 4WXJA 2HFBA 3K01A 1SBPA 2DWJA 4OFOA 2REJA 3K6VA 3OXNA 2Q2CA 4YB5A 4F39A 4NF5A 1JW4A 1IIWA 1IITA 3OEKA 2OK2A 2G93A 3VLUA 1Y3NA 1B5IA 4N07A 1WDNA 3N5LA 4JWXA 3MZ9A 2V3UA 3MZ1A 4GWOA 2A5SA 1B0LA 4KQPA 2X7QA 5CBSA 1HSLA 4YKKA 4IGRA 1Y3PA 5I2KB 4JSDA 1AH5A 3M3LA 2V3QA 5H8NB 3V8XB 4LUBA 1QULA 4JWYA 3C35A 1SVXB 1TWYA 3W9VA 4E0XA 1KWHA 1A8FA 3PMWA 4YZZA 3OO6A 4NE4A 1JW1A 1IXCA 3T93B 4OMBA 3HHGA 1PEBA 3KBRA 2I3WA 3KSJA 3K6XA 3MP6A 4O3BA 4NF5B 3G7WA 5CMMA 2VD3A 1ZTYA 2QJEA 3OD7A 5CC2A 3H6VA 3GXAA 4ZEBA 3RTFB 1MXZA 2ZYNA 3A3CA 1FTKA 2HEUA 2F78A 3N6UA 3UN6A 3MVYA 1ZJLA 1H44A 4XKNA 2XXQA 4U21A 4U2RA 3VDFA 4R9FA 1LGBC 3VXBA 1GTKA 5AA1A 5I84A 3TPAA 3WAFA 1LAGE 3CFXA 5CM6A 2AL5A 3TCHA 4F3PA 3MVZA 3TEPA 1MM7A 3O28A 5DYHA 2X7PA 3CSGA 3TCFA 2FA7A 1FQCA 3KG2A 1B9JA 5A5XA 4KYSA 3T9UA 4LZ7A 2UXAA 1MS7A 2Z8DA 1JW5A 1FQBA 4R2FA 3PUZE 4MFIA 1MY0A 4GXSB 3TZAA 3LSXA 2KLFA 4ZZAA 4H5FA 5BUUA 1Z7NE 1NNTA 2A5TB 3EHUA 4R6HA 4IO5A 1VR5A 1MQIA 2ZYOA 5I56A 3TTNA 5AA3A 4PFUA 4YB6A 3T9HB 5K2YA 1RKMA 4GVOA 3TTLA 3UA8A 2VD2A 1NNKA 1DPEA 4FIMA 2ZNUA 2ANJA 2O84X 3EHTA 3FVGA 4G2ZA 1MH4A 4FEBA 3KN3A 1MY3A 1S50A 4RA1A 4U4XA 4OERA 5A5XB 4NMYA 3MUQA 3I5OA 2NWJA 4PFYA 4JBZA 3H06B 1P99A 4FECA 1I6QA 3O9PA 4GLIA 2F6PA 2F97A 4M1VA 4BDNA 1HSJA 1B5JA 3C9HA 4PFTA 1POTA 3ILTB 2OLBA 3RUMA 1S9TA 2XXPA 5H8HA 4XTCQ 1B3LA 5I56B 5DTBA 1CB6A 3KN8A 2XX9A 2OJTA 2ONKE 4N13A 4H1XA 2H98A 5CMKA 1Q35A 2XXIA 4MF3A 4ZDMA 2HAUA 1NFTA 3FJGA 3IB2A 3ECRA 1UQWA 2ZNTA 3KGCA 1AL3A 3I6VA 4G68C 2HXWA 2QSXA 3QSLA 1DTZA 3FGSA 4EQ7A 4ISUA 1L5TA 3S4UA 4OZ9A 2O7UA 2Z23A 3JV9A 1DPPA 3S2VA 2HZLA 3QIMA 4QFNA 5H8HB 5CBRA 3CSBA 1T0KA 4I62A 1A7LA 4TLMB 2PBWA 3LR1A 4ZS9A 4Q0CA 2Y7PA 3OOAA 1D9YA 1NMUA 1I6AA 4AQ4A 3G3IA 4IO7A 1SQYA 2I48A 4OETA 3U92A 1DTGA 3FV1A 4EUOA 1H3DA 3K1NA 3PUYE 4YU0A 4YB7A 1URDA 1Y20A 3K6UA 4LQ5A 1UTHA 5CMCA 5ICQA 2DVCA 1B7HA 2UYEA 3Q28A 4THIA 3C4MA 4YMAA 3DP6A 3SEVA 1XHYA 3B6TA 3HN0A 2RC9A 2D5WA 3MJNA 3VXCA 1TT1A 4ZEIA 3SKPA 3PV0E 1P1UA 3T66A 1OMPA 5AA2B 1LCFA 4JDFA 3EPEA 1MY1A 4MH5A 2AL4A 3MQ9A 3PD9A 5ISUA 2UYFA 4R2BA 2HQ0A 3TELA 2QMXA 3HHFA 1N0TA 5HM4B 1USYH 3PPQA 1OIBA 4JB7A 1B51A 2QRYA 4G77A 2YLNA 3E13X 1Y3QA 1EH3A 4QFLA 1JETA 4LONB 3U72A 1UTHB 1AMFA 2WKYA 1LB9A 3OO9A 4YICA 3W15C 4ZE9A 1Y1ZA 5JTYA 5L9SA 2F34A 3MP8A 3FATA 4LP2B 3E3KA 3S9NC 4UA8A 3TCGA 4F1VA 5IAIA 3TMGA 5HPQA 1NNPA 1PBPA 1EZOA 1P1WA 3QAXA 1WVJA 2GRVA 4WEDA 1ZKBA 4R74A 1MQGA 2ZYMA 4MLQA 3IOVA 2F7BA 2P0SA 4MLVA 1MPBA 1ZIUA 2G29A 4WEPA 1MXVA 3RLFE 5H8SA 2XHDA 4IY6A 1MXXA 1XVYA 2VP1A 1OVBA 1B3HA 1RYXA 3K00A 1TXFA 4ND9A 2V3TA 2QS3A 4JXIA 3TAJA 4NF6B 4GF8A 1URGA 4AB6A 1PB8A 1B7UA 3S9EA 3T22A 4YMBA 1MQDA 4LVQA 2FYIA 1M5CA 3MPKA 5JTYB 1FQAA 3H7MA 2NXOA 3MP1A 3KJ7A 2VHAA 4IO4A 4OEVA 1Q1KA 3R6UA 2H4IA 1WODA 5ITPA 4DXBA 3UGWA 1ANFA 3TKDA 2RKMA 5AA4A 3QXMA 3H03A 3QYTA 3L6GA 1B5HA 1OVTA 3D4CA 4LATA 2ZNSA 1HSEA 1O7TA 3W9WA 1NH7A 1Y4CA 2XXYA 1O63A 4F3SA 5FHMA 2HAVA 3C31A 1SW4A 4KD5A 3VVFA 3PPNA 2ZMBA 2V25A 1UTBA 3KEIA 4FORA 1BIYA 3PD8A 2O51A 3LBSA 3PPRA 1GVCA 4FAJA 4R9GA 4RPOA 3FD3A 1SW2A 4H67A 1B05A 4DE8A 5I58A 4GXAA 3KFMA 3I3VA 1MPDA 3B7DA 4JWOA 3BKIB 4H8JA 5AA4B 2RINA 5CI5A 3IK6B 4H5GA 3IR1A 3B6WA 4QHQA 2UVHA 5L8DA 2A5TA 4OQOA 1B4HA 3AXFA 4KHZE 4F2OA 3N6TA 1OLCA 3FIRA 3MWBA 2PYYA 2QS4A 4PFWA 2XXWA 4KI0E 5TU0A 3SETA 4Q8RA 1MRPA 4QFKA 1DSNA 5FTIA 2Q8JA 4BDLA 2QS2A 4G8MA 2H9BA 5EHMA 2ONSA 1UTBB 2F7AA 2I4CA 3U1OA 1A54A 3O6IA 1SDXA 1D9VA 4BDOA 1IZ1A 4QF9A 1SD3A 4LQ2A 3JZJA 1Y1MA 4QSCA 5I58B 4EF2A 1ZMGA 3IOWA 4KFQA 3O6GA 3SEUA 2OBGA 1R1NA 4BLAA 2XD2A 2RC8A 3TQLA 5DVFA 2I0CA 1AIVA 1B58A 2Q9TA 3FVKA 4DLDA 3VLWA 2QS1A 4RYAA 3HO7A 1NL5A 4UACA 4ZEDA 4F1UA 2VOZA 2D21A 4ZZEA 2GHBA 4R6YA 2Y7IA 1QKBA 1FW0A 3PMVA 2PT2A 1IXGA 1MM6A 4HTGA 3R26A 3VVDA 2Q2AA 5H8FA 1XT8A 2CMOA 3ZKLA 4OENA 2DWHA 1GGGA 1SYHA 3SEWA 2UVJA 4FE8A 1AOVA 4YKJA 1VFDA 3U8QA 1MXYA 3G3JA 2R9JA 1MY4A 3TUSA 2I49A 4HCYA 3UIFA 2O69A 2ZYKA 1USYE 3IJOB 1MPCA 2Q88A 3CFZA 4BDMA 1FTMA 1B3FA 2DE2A 3H3GA 3OEMA 1UIVA 2DVZA 3TODA 2PX1A 2UVIA 2I3VA 4DIGA 5H8FB 3B6QA 3RT6B 2FNCA 4ESWA 2CZLA 3OMBA 1FTLA 3ZKKA 3PUVE 3K1MA 1SI0A 3VE1B 1B3GA 2OWSA 2V93A 3FVNA 4X9TA 3FXRA 2THIA 1TFDA 2RCAA 4C0RA 4EDPA 3E4RA 4U4SA 4O3AA 4ECFA 4ELPA 1IEJA 3H6UA 3T9VA 3IOUA 3Q27A 2D3IA 4PQJA 2XX8A 4DDDA 5TPAA 1US5A 4DCXA 3MPLA 3U94A 1A40A 5AA2A 1BKAA 1EU8A 1QUJA 3G3FA 2F36A 3DLNA 1B4ZA 4F31B 4ESXA 1A99A 5L9MA 1XVXA 4HCWA 4YKPA 4KPTA 2UVGA 3MAMA 1II5A 4RK9A 4POWA 2B3BA 1JNFA 3HV1A 4F19A 4ZECA 5ICTA 1B46A 1MQJA 3TTKA 4Q5TA 1EZ9A 3KOSA 1N76A 1XC1A 1LAXA 1M5FA 2R6GE 5JK4A 4IO2A 1Z7ME 3TDJA 3H6TA 3KJTA 4QFOA 1MY2A 4KYEA 1ZBMA 1J1NA 3UP9A 4LZ8A 5TPAB 3TTRA 3U93A 3PMXA 3EQ1A 4NF8A 3Q29A 3WAEA 2OZZA 4Q30B 3OELA 2NVUB 3TQWA 4LZ5A 2XXVA 4GIZA 2XX7A 1H45A 3V89B 4DCYA 4MBPA 5FHOA 3GLBA 4U22A 2X26A 1QW0A 4H0WA 4XKPA 3T96B 1P1QA 4DZ1A 2Q89A 3FJMA 1QUIA 3GZGA 2P2AA 4L17A 4YKIA 3CI8A 3GBBA 3C36A 4NF6A 2F5XA 5F1QA 1PDAA 1XS5A 4F2QA 1H76A 3SERA 3LSFB 1BTJA 2DWIA 3VFJA 1IXHA 5AE4A 4ELRA 4G68A 3K2DA 3RY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VVE A;  2DS9 A;  1P1N A;  1XOC A;  3IOR A;  1LB8 A;  4NF8 B;  4IY5 A;  5ITO A;  3JYR A;  3SES A;  4KR5 A;  2DWA A;  3O66 A;  2VGQ A;  4XKQ A;  4EXK A;  4X48 A;  2DXY A;  1US4 A;  1QJM A;  3HST A;  4F29 A;  4OWD A;  1MQH A;  3RTW B;  5DVI A;  4U1Z A;  3CG1 A;  1TFA A;  4OFL A;  3H4Z A;  3A3U A;  3A09 A;  4F1Y A;  3N94 A;  3IOT A;  3MW0 A;  2QMW A;  1MXU A;  2QPQ A;  3IJX B;  3L6H A;  3UOR A;  3F11 A;  1B1X A;  4RXL A;  2I6E A;  4YAH X;  4R73 A;  2O1M A;  1A55 A;  3OSQ A;  2BJJ X;  4NWD A;  3T9X B;  1LFI A;  2E1S A;  4ZE8 A;  4G68 B;  3G3H A;  4WKM A;  2I58 A;  1IQ7 A;  4P0I A;  4LA9 A;  3C32 A;  1B32 A;  3EHS A;  5KZT A;  1MDP 1;  2B3F A;  3MBP A;  1H43 A;  2LAO A;  1JEV A;  2PMS A;  2DE3 A;  1NKX A;  3IL1 B;  1A8E A;  4Z0I A;  3DM0 A;  3TFL A;  4OTE A;  2ALU A;  4I8C A;  2Z22 A;  5KDT A;  3RT8 A;  4ZEK A;  2DQV A;  1PC3 A;  3KOT A;  1N7X A;  3N26 A;  4EQ9 A;  1FQD A;  4R75 A;  4OHN A;  5I2N A;  3DP8 A;  5I57 A;  4R6K A;  1FQF A;  1PB7 A;  3G3K A;  2E0S A;  3FV2 A;  3FUZ A;  3O2A A;  3S9L C;  1JVY A;  3M3K A;  1FTO A;  3SEX A;  1FCK A;  3PUX E;  1JQF A;  4NED A;  1LFH A;  4BDQ A;  2ESN A;  2OCU A;  3EF7 A;  2DOJ A;  5B7D A;  3FAS A;  4G8N A;  2DXR A;  4H65 A;  4OEU A;  5FTH A;  2I0B A;  1O64 A;  2PVU A;  5I59 A;  5JEI A;  5KDT B;  3CR9 A;  5IKB A;  2IA4 A;  3GBA A;  1PB9 A;  2NUV A;  2Y84 A;  2DE4 A;  3PGF A;  1NH8 A;  4NTL A;  3PPO A;  4GQO A;  4POX A;  1N3X A;  2XXR A;  1B1H A;  3LSL A;  5I2N B;  3R7X A;  2ONR A;  2PT1 A;  1BLF A;  4H8I A;  5I57 B;  2O1L A;  4OVJ A;  3IB1 A;  1QVS A;  4C1T A;  1ZLQ A;  3USD A;  2R71 A;  1LLS A;  3IO6 A;  3IX1 A;  1VSO A;  4F22 A;  1N7W A;  3BFU A;  5CMB A;  3LC8 A;  4X1D A;  1VFE A;  3SDF A;  3OO7 A;  2DYX A;  1JEU A;  4G4P A;  1SI1 A;  3KN7 A;  5I59 B;  5DEX A;  4JSO A;  4N6P A;  3RGY A;  1LBC A;  2F7C A;  1LBB A;  5J1D A;  4P11 A;  1UIU A;  4GD5 A;  3CIJ A;  4RPN A;  2RCB A;  2O7I A;  4HS7 A;  4EF1 A;  1PBQ A;  2W7Y A;  1MG1 A;  2XXH A;  4I9D A;  1SW1 A;  4OES A;  3QUF A;  2O6A A;  1B7Z A;  3P7I A;  2I4B A;  4NF4 A;  1B3E A;  3TTM A;  1GR2 A;  1DMB A;  5BWJ A;  1MDQ A;  2IEE A;  3FXU A;  4FED A;  1NNF A;  2RC7 A;  1YTV A;  3ZSF A;  3ZS6 A;  1GV8 A;  4OYV A;  4GFR A;  3HCQ A;  3MVX A;  4HW8 A;  1CE2 A;  2GHA A;  4F3B A;  5EHS A;  2V84 A;  3OO8 A;  2GH9 A;  4F3G A;  5ELV A;  5DEX B;  4GL8 A;  4U23 A;  2F35 A;  4PP0 A;  4DXU A;  2F8D A;  2H99 A;  1ZU0 A;  1N04 A;  5F7V A;  1SW5 A;  4QSD A;  3RPW A;  2GFE A;  2AIX A;  3G3G A;  4IGT A;  5DVJ A;  2HZK A;  2ZXT A;  3PU5 A;  3PUW E;  5B70 A;  2NOO A;  1OLA A;  2Z8F A;  1Y4T A;  3KSX A;  3Q26 A;  5CRY A;  2QL3 A;  3OSR A;  1D3K A;  1IXI A;  4NF4 B;  3VV5 A;  3DEL B;  1S7Y A;  4OXV A;  1B2H A;  2OWT A;  3MC2 A;  1POY 1;  4E0W A;  1BP5 A;  4DXC A;  2XD3 A;  4QSE A;  4P0G A;  1OQG A;  1EZP A;  2Z8E A;  2YPN A;  1P1O A;  1R9Q A;  2B65 A;  4FAT A;  3BBR A;  1OQH A;  3KZG A;  2M8C A;  3RQT A;  1IUD A;  4FJP A;  3OEN A;  1B6H A;  4BDR A;  3RN8 A;  4KCD A;  2XXX A;  4U1O A;  3IO4 A;  4GOT A;  1RYO A;  4TQU Q;  3CVG A;  4RK2 A;  3ILU B;  4AB5 A;  3ODB A;  3CFL A;  2AYS A;  1VE4 A;  1LFG A;  4C1U A;  3TYH A;  4IO3 A;  3S9M C;  3K0V A;  2H5Y A;  3FJ7 A;  5L9O A;  4ZEF A;  4QFP A;  1LCT A;  1I6B A;  4H6D A;  4M4G A;  3IB0 A;  3CRB A;  5AA2 D;  1ATG A;  3O97 A;  4F18 A;  2YJP A;  4I1D A;  3BFT A;  5EYF A;  1N3W A;  1YCJ A;  3Q25 A;  1B52 A;  4K3F A;  3M3F A;  5HBC A;  2HCA A;  4TOZ A;  1D4N A;  3SEY A;  3C34 A;  2RF1 A;  2F6G A;  4O3C A;  4RNS A;  1YAE A;  3ONM A;  1F9B A;  4IO6 A;  2H25 A;  5M2V A;  3K02 A;  2Y7W A;  3LSW A;  2DP8 A;  1DOT A;  3H6W A;  3EN3 A;  3MVW A;  4PET A;  1R9L A;  4G8H A;  3IAZ A;  2Y7K A;  3D4G A;  4PE5 B;  3O6H A;  2Y7R A;  1FTJ A;  5TP9 A;  1QKA A;  3E9X A;  1FQE A;  4X1B A;  2O68 A;  4RY1 A;  4ELQ A;  4TLL B;  1N84 A;  3M8U A;  4XIG Q;  2REG A;  3V5A A;  1I69 A;  1LAF E;  2ABH A;  3K6W A;  5LOM A;  5H8Q A;  1B0H A;  3FVO A;  3FZV A;  3FXQ A;  4XKR A;  1MH3 A;  1B40 A;  4KYD A;  3C33 A;  5KCJ A;  1MXW A;  1YPN A;  4ONY A;  4ELO A;  3V83 A;  3VLV A;  1M5B A;  3O29 A;  4NWC A;  1ELJ A;  4GL0 A;  2XXU A;  4EXL A;  3QUJ A;  4QRZ A;  4GRK A;  3LUY A;  1LST A;  1SYI A;  5FHN A;  1R6Z A;  4RJZ A;  3HPI A;  5DT6 A;  2XXT A;  1URS A;  3K4U A;  3UK4 A;  5K2X A;  1LAH E;  3DP4 A;  5TP9 B;  3PPP A;  4IB2 A;  4R72 A;  1JVX A;  3THI A;  1Y9U A;  3MZB A;  5I2K A;  1QUK A;  5H8N A;  5H8Q B;  4EQB A;  2P1S A;  2DSF A;  4Z7E A;  1M5E A;  3RNN A;  3QK6 A;  4XXU A;  4OFJ A;  1M5D A;  4KCC A;  5KCJ B;  3CG3 A;  3K1P A;  4WXJ A;  2HFB A;  3K01 A;  1SBP A;  2DWJ A;  4OFO A;  2REJ A;  3K6V A;  3OXN A;  2Q2C A;  4YB5 A;  4F39 A;  4NF5 A;  1JW4 A;  1IIW A;  1IIT A;  3OEK A;  2OK2 A;  2G93 A;  3VLU A;  1Y3N A;  1B5I A;  4N07 A;  1WDN A;  3N5L A;  4JWX A;  3MZ9 A;  2V3U A;  3MZ1 A;  4GWO A;  2A5S A;  1B0L A;  4KQP A;  2X7Q A;  5CBS A;  1HSL A;  4YKK A;  4IGR A;  1Y3P A;  5I2K B;  4JSD A;  1AH5 A;  3M3L A;  2V3Q A;  5H8N B;  3V8X B;  4LUB A;  1QUL A;  4JWY A;  3C35 A;  1SVX B;  1TWY A;  3W9V A;  4E0X A;  1KWH A;  1A8F A;  3PMW A;  4YZZ A;  3OO6 A;  4NE4 A;  1JW1 A;  1IXC A;  3T93 B;  4OMB A;  3HHG A;  1PEB A;  3KBR A;  2I3W A;  3KSJ A;  3K6X A;  3MP6 A;  4O3B A;  4NF5 B;  3G7W A;  5CMM A;  2VD3 A;  1ZTY A;  2QJE A;  3OD7 A;  5CC2 A;  3H6V A;  3GXA A;  4ZEB A;  3RTF B;  1MXZ A;  2ZYN A;  3A3C A;  1FTK A;  2HEU A;  2F78 A;  3N6U A;  3UN6 A;  3MVY A;  1ZJL A;  1H44 A;  4XKN A;  2XXQ A;  4U21 A;  4U2R A;  3VDF A;  4R9F A;  1LGB C;  3VXB A;  1GTK A;  5AA1 A;  5I84 A;  3TPA A;  3WAF A;  1LAG E;  3CFX A;  5CM6 A;  2AL5 A;  3TCH A;  4F3P A;  3MVZ A;  3TEP A;  1MM7 A;  3O28 A;  5DYH A;  2X7P A;  3CSG A;  3TCF A;  2FA7 A;  1FQC A;  3KG2 A;  1B9J A;  5A5X A;  4KYS A;  3T9U A;  4LZ7 A;  2UXA A;  1MS7 A;  2Z8D A;  1JW5 A;  1FQB A;  4R2F A;  3PUZ E;  4MFI A;  1MY0 A;  4GXS B;  3TZA A;  3LSX A;  2KLF A;  4ZZA A;  4H5F A;  5BUU A;  1Z7N E;  1NNT A;  2A5T B;  3EHU A;  4R6H A;  4IO5 A;  1VR5 A;  1MQI A;  2ZYO A;  5I56 A;  3TTN A;  5AA3 A;  4PFU A;  4YB6 A;  3T9H B;  5K2Y A;  1RKM A;  4GVO A;  3TTL A;  3UA8 A;  2VD2 A;  1NNK A;  1DPE A;  4FIM A;  2ZNU A;  2ANJ A;  2O84 X;  3EHT A;  3FVG A;  4G2Z A;  1MH4 A;  4FEB A;  3KN3 A;  1MY3 A;  1S50 A;  4RA1 A;  4U4X A;  4OER A;  5A5X B;  4NMY A;  3MUQ A;  3I5O A;  2NWJ A;  4PFY A;  4JBZ A;  3H06 B;  1P99 A;  4FEC A;  1I6Q A;  3O9P A;  4GLI A;  2F6P A;  2F97 A;  4M1V A;  4BDN A;  1HSJ A;  1B5J A;  3C9H A;  4PFT A;  1POT A;  3ILT B;  2OLB A;  3RUM A;  1S9T A;  2XXP A;  5H8H A;  4XTC Q;  1B3L A;  5I56 B;  5DTB A;  1CB6 A;  3KN8 A;  2XX9 A;  2OJT A;  2ONK E;  4N13 A;  4H1X A;  2H98 A;  5CMK A;  1Q35 A;  2XXI A;  4MF3 A;  4ZDM A;  2HAU A;  1NFT A;  3FJG A;  3IB2 A;  3ECR A;  1UQW A;  2ZNT A;  3KGC A;  1AL3 A;  3I6V A;  4G68 C;  2HXW A;  2QSX A;  3QSL A;  1DTZ A;  3FGS A;  4EQ7 A;  4ISU A;  1L5T A;  3S4U A;  4OZ9 A;  2O7U A;  2Z23 A;  3JV9 A;  1DPP A;  3S2V A;  2HZL A;  3QIM A;  4QFN A;  5H8H B;  5CBR A;  3CSB A;  1T0K A;  4I62 A;  1A7L A;  4TLM B;  2PBW A;  3LR1 A;  4ZS9 A;  4Q0C A;  2Y7P A;  3OOA A;  1D9Y A;  1NMU A;  1I6A A;  4AQ4 A;  3G3I A;  4IO7 A;  1SQY A;  2I48 A;  4OET A;  3U92 A;  1DTG A;  3FV1 A;  4EUO A;  1H3D A;  3K1N A;  3PUY E;  4YU0 A;  4YB7 A;  1URD A;  1Y20 A;  3K6U A;  4LQ5 A;  1UTH A;  5CMC A;  5ICQ A;  2DVC A;  1B7H A;  2UYE A;  3Q28 A;  4THI A;  3C4M A;  4YMA A;  3DP6 A;  3SEV A;  1XHY A;  3B6T A;  3HN0 A;  2RC9 A;  2D5W A;  3MJN A;  3VXC A;  1TT1 A;  4ZEI A;  3SKP A;  3PV0 E;  1P1U A;  3T66 A;  1OMP A;  5AA2 B;  1LCF A;  4JDF A;  3EPE A;  1MY1 A;  4MH5 A;  2AL4 A;  3MQ9 A;  3PD9 A;  5ISU A;  2UYF A;  4R2B A;  2HQ0 A;  3TEL A;  2QMX A;  3HHF A;  1N0T A;  5HM4 B;  1USY H;  3PPQ A;  1OIB A;  4JB7 A;  1B51 A;  2QRY A;  4G77 A;  2YLN A;  3E13 X;  1Y3Q A;  1EH3 A;  4QFL A;  1JET A;  4LON B;  3U72 A;  1UTH B;  1AMF A;  2WKY A;  1LB9 A;  3OO9 A;  4YIC A;  3W15 C;  4ZE9 A;  1Y1Z A;  5JTY A;  5L9S A;  2F34 A;  3MP8 A;  3FAT A;  4LP2 B;  3E3K A;  3S9N C;  4UA8 A;  3TCG A;  4F1V A;  5IAI A;  3TMG A;  5HPQ A;  1NNP A;  1PBP A;  1EZO A;  1P1W A;  3QAX A;  1WVJ A;  2GRV A;  4WED A;  1ZKB A;  4R74 A;  1MQG A;  2ZYM A;  4MLQ A;  3IOV A;  2F7B A;  2P0S A;  4MLV A;  1MPB A;  1ZIU A;  2G29 A;  4WEP A;  1MXV A;  3RLF E;  5H8S A;  2XHD A;  4IY6 A;  1MXX A;  1XVY A;  2VP1 A;  1OVB A;  1B3H A;  1RYX A;  3K00 A;  1TXF A;  4ND9 A;  2V3T A;  2QS3 A;  4JXI A;  3TAJ A;  4NF6 B;  4GF8 A;  1URG A;  4AB6 A;  1PB8 A;  1B7U A;  3S9E A;  3T22 A;  4YMB A;  1MQD A;  4LVQ A;  2FYI A;  1M5C A;  3MPK A;  5JTY B;  1FQA A;  3H7M A;  2NXO A;  3MP1 A;  3KJ7 A;  2VHA A;  4IO4 A;  4OEV A;  1Q1K A;  3R6U A;  2H4I A;  1WOD A;  5ITP A;  4DXB A;  3UGW A;  1ANF A;  3TKD A;  2RKM A;  5AA4 A;  3QXM A;  3H03 A;  3QYT A;  3L6G A;  1B5H A;  1OVT A;  3D4C A;  4LAT A;  2ZNS A;  1HSE A;  1O7T A;  3W9W A;  1NH7 A;  1Y4C A;  2XXY A;  1O63 A;  4F3S A;  5FHM A;  2HAV A;  3C31 A;  1SW4 A;  4KD5 A;  3VVF A;  3PPN A;  2ZMB A;  2V25 A;  1UTB A;  3KEI A;  4FOR A;  1BIY A;  3PD8 A;  2O51 A;  3LBS A;  3PPR A;  1GVC A;  4FAJ A;  4R9G A;  4RPO A;  3FD3 A;  1SW2 A;  4H67 A;  1B05 A;  4DE8 A;  5I58 A;  4GXA A;  3KFM A;  3I3V A;  1MPD A;  3B7D A;  4JWO A;  3BKI B;  4H8J A;  5AA4 B;  2RIN A;  5CI5 A;  3IK6 B;  4H5G A;  3IR1 A;  3B6W A;  4QHQ A;  2UVH A;  5L8D A;  2A5T A;  4OQO A;  1B4H A;  3AXF A;  4KHZ E;  4F2O A;  3N6T A;  1OLC A;  3FIR A;  3MWB A;  2PYY A;  2QS4 A;  4PFW A;  2XXW A;  4KI0 E;  5TU0 A;  3SET A;  4Q8R A;  1MRP A;  4QFK A;  1DSN A;  5FTI A;  2Q8J A;  4BDL A;  2QS2 A;  4G8M A;  2H9B A;  5EHM A;  2ONS A;  1UTB B;  2F7A A;  2I4C A;  3U1O A;  1A54 A;  3O6I A;  1SDX A;  1D9V A;  4BDO A;  1IZ1 A;  4QF9 A;  1SD3 A;  4LQ2 A;  3JZJ A;  1Y1M A;  4QSC A;  5I58 B;  4EF2 A;  1ZMG A;  3IOW A;  4KFQ A;  3O6G A;  3SEU A;  2OBG A;  1R1N A;  4BLA A;  2XD2 A;  2RC8 A;  3TQL A;  5DVF A;  2I0C A;  1AIV A;  1B58 A;  2Q9T A;  3FVK A;  4DLD A;  3VLW A;  2QS1 A;  4RYA A;  3HO7 A;  1NL5 A;  4UAC A;  4ZED A;  4F1U A;  2VOZ A;  2D21 A;  4ZZE A;  2GHB A;  4R6Y A;  2Y7I A;  1QKB A;  1FW0 A;  3PMV A;  2PT2 A;  1IXG A;  1MM6 A;  4HTG A;  3R26 A;  3VVD A;  2Q2A A;  5H8F A;  1XT8 A;  2CMO A;  3ZKL A;  4OEN A;  2DWH A;  1GGG A;  1SYH A;  3SEW A;  2UVJ A;  4FE8 A;  1AOV A;  4YKJ A;  1VFD A;  3U8Q A;  1MXY A;  3G3J A;  2R9J A;  1MY4 A;  3TUS A;  2I49 A;  4HCY A;  3UIF A;  2O69 A;  2ZYK A;  1USY E;  3IJO B;  1MPC A;  2Q88 A;  3CFZ A;  4BDM A;  1FTM A;  1B3F A;  2DE2 A;  3H3G A;  3OEM A;  1UIV A;  2DVZ A;  3TOD A;  2PX1 A;  2UVI A;  2I3V A;  4DIG A;  5H8F B;  3B6Q A;  3RT6 B;  2FNC A;  4ESW A;  2CZL A;  3OMB A;  1FTL A;  3ZKK A;  3PUV E;  3K1M A;  1SI0 A;  3VE1 B;  1B3G A;  2OWS A;  2V93 A;  3FVN A;  4X9T A;  3FXR A;  2THI A;  1TFD A;  2RCA A;  4C0R A;  4EDP A;  3E4R A;  4U4S A;  4O3A A;  4ECF A;  4ELP A;  1IEJ A;  3H6U A;  3T9V A;  3IOU A;  3Q27 A;  2D3I A;  4PQJ A;  2XX8 A;  4DDD A;  5TPA A;  1US5 A;  4DCX A;  3MPL A;  3U94 A;  1A40 A;  5AA2 A;  1BKA A;  1EU8 A;  1QUJ A;  3G3F A;  2F36 A;  3DLN A;  1B4Z A;  4F31 B;  4ESX A;  1A99 A;  5L9M A;  1XVX A;  4HCW A;  4YKP A;  4KPT A;  2UVG A;  3MAM A;  1II5 A;  4RK9 A;  4POW A;  2B3B A;  1JNF A;  3HV1 A;  4F19 A;  4ZEC A;  5ICT A;  1B46 A;  1MQJ A;  3TTK A;  4Q5T A;  1EZ9 A;  3KOS A;  1N76 A;  1XC1 A;  1LAX A;  1M5F A;  2R6G E;  5JK4 A;  4IO2 A;  1Z7M E;  3TDJ A;  3H6T A;  3KJT A;  4QFO A;  1MY2 A;  4KYE A;  1ZBM A;  1J1N A;  3UP9 A;  4LZ8 A;  5TPA B;  3TTR A;  3U93 A;  3PMX A;  3EQ1 A;  4NF8 A;  3Q29 A;  3WAE A;  2OZZ A;  4Q30 B;  3OEL A;  2NVU B;  3TQW A;  4LZ5 A;  2XXV A;  4GIZ A;  2XX7 A;  1H45 A;  3V89 B;  4DCY A;  4MBP A;  5FHO A;  3GLB A;  4U22 A;  2X26 A;  1QW0 A;  4H0W A;  4XKP A;  3T96 B;  1P1Q A;  4DZ1 A;  2Q89 A;  3FJM A;  1QUI A;  3GZG A;  2P2A A;  4L17 A;  4YKI A;  3CI8 A;  3GBB A;  3C36 A;  4NF6 A;  2F5X A;  5F1Q A;  1PDA A;  1XS5 A;  4F2Q A;  1H76 A;  3SER A;  3LSF B;  1BTJ A;  2DWI A;  3VFJ A;  1IXH A;  5AE4 A;  4ELR A;  4G68 A;  3K2D A;  3RY3 A; 
#chains in the Genus database with same CATH topology
 3VVE A;  3BIH A;  4DI3 D;  2DS9 A;  1P1N A;  4N17 A;  1XOC A;  3IOR A;  1LB8 A;  1NV4 A;  4NF8 B;  4IY5 A;  5ITO A;  1DBZ A;  3JYR A;  3SES A;  4KR5 A;  2DWA A;  3O66 A;  2VGQ A;  4XKQ A;  4EXK A;  4X48 A;  2DXY A;  1US4 A;  1QJM A;  3HST A;  4F29 A;  4OWD A;  1MQH A;  5ET6 A;  3RTW B;  5DVI A;  4U1Z A;  3CG1 A;  1TFA A;  4OFL A;  2FBP A;  3H4Z A;  3A3U A;  3A09 A;  4GBV A;  4F1Y A;  3N94 A;  4DI4 B;  5ET5 A;  3IOT A;  3MW0 A;  2QMW A;  1MXU A;  2QPQ A;  3IJX B;  3L6H A;  3UOR A;  3F11 A;  1B1X A;  4RXL A;  3SZP A;  2I6E A;  4YAH X;  4R73 A;  2O1M A;  1A55 A;  3OSQ A;  2BJJ X;  1LEV A;  4NWD A;  3T9X B;  1LFI A;  4P1L A;  4MNI A;  2E1S A;  4ZE8 A;  4G68 B;  3G3H A;  4WKM A;  2I58 A;  1IQ7 A;  4P0I A;  4LA9 A;  3C32 A;  1B32 A;  3EHS A;  5KZT A;  1MDP 1;  2B3F A;  3MBP A;  1H43 A;  2LAO A;  3U65 A;  1JEV A;  2PMS A;  4QXD A;  2DE3 A;  1NKX A;  3IL1 B;  1A8E A;  4Z0I A;  3DM0 A;  3TFL A;  4OTE A;  2ALU A;  4I8C A;  4PDD A;  2Z22 A;  5KDT A;  3RT8 A;  5I5P A;  4ZEK A;  2DQV A;  4N91 A;  1PC3 A;  5IGA A;  1KA0 A;  1N7X A;  3KOT A;  3N26 A;  4EQ9 A;  1FQD A;  4R75 A;  3KC0 A;  4OHN A;  5I2N A;  3DP8 A;  5I57 A;  4R6K A;  1FQF A;  1PB7 A;  3G3K A;  2CZK A;  2E0S A;  3FV2 A;  1EYK A;  3FUZ A;  3O2A A;  3S9L C;  1JVY A;  3M3K A;  1FTO A;  3SEX A;  4I3E A;  1FCK A;  3PUX E;  1JQF A;  4NED A;  1LFH A;  4BDQ A;  2ESN A;  2OCU A;  3EF7 A;  4MJO A;  2DOJ A;  5B7D A;  3FAS A;  4G8N A;  2DXR A;  4H65 A;  4OEU A;  5FTH A;  2I0B A;  1O64 A;  2PVU A;  5I59 A;  5JEI A;  5KDT B;  3CR9 A;  5IKB A;  2IA4 A;  3GBA A;  1PB9 A;  2NUV A;  2Y84 A;  2DE4 A;  3PGF A;  2CZH A;  1NH8 A;  4NTL A;  3PPO A;  4GQO A;  4POX A;  1N3X A;  2XXR A;  1B1H A;  3LSL A;  5I2N B;  3R7X A;  2ONR A;  2PT1 A;  1BLF A;  4H8I A;  1FBD A;  2O1L A;  5IZ3 A;  5I57 B;  4OVJ A;  3IB1 A;  1QVS A;  4C1T A;  1ZLQ A;  4N6D A;  2VPN A;  2XXK A;  3USD A;  4UAB A;  2R71 A;  1LLS A;  3IO6 A;  3IX1 A;  1VSO A;  2WYP A;  4F22 A;  1N7W A;  3BFU A;  5CMB A;  3LC8 A;  4JVC A;  4X1D A;  5LDZ A;  1VFE A;  3SDF A;  3OO7 A;  2DYX A;  5FBP A;  1JEU A;  4G4P A;  1SI1 A;  4GX6 A;  3KN7 A;  5I59 B;  5DEX A;  4JSO A;  4N6P A;  3RGY A;  1LBC A;  2F7C A;  1LBB A;  5J1D A;  4PDH A;  4P11 A;  1UIU A;  4GD5 A;  1EYJ A;  3CIJ A;  4RPN A;  2RCB A;  5EYG A;  2O7I A;  4HS7 A;  1FBG A;  4EF1 A;  1PBQ A;  2W7Y A;  1MG1 A;  2XXH A;  4I9D A;  1SW1 A;  4OES A;  4HE2 A;  3QUF A;  2O6A A;  1B7Z A;  3P7I A;  2I4B A;  4NF4 A;  1B3E A;  3TTM A;  1GR2 A;  1DMB A;  5BWJ A;  1MDQ A;  2IEE A;  3FXU A;  2QVU A;  4GWZ A;  3QMF A;  4FED A;  1NNF A;  2RC7 A;  1YTV A;  3ZSF A;  3ZS6 A;  1GV8 A;  4OYV A;  4GFR A;  3HCQ A;  3MVX A;  4HW8 A;  1CE2 A;  2GHA A;  4F3B A;  5EHS A;  2V84 A;  3OO8 A;  2GH9 A;  4F3G A;  5ELV A;  5DEX B;  4GL8 A;  4U23 A;  2F35 A;  4PP0 A;  5EQ8 A;  4DXU A;  2F8D A;  2H99 A;  1ZU0 A;  1N04 A;  5F7V A;  1SW5 A;  4QSD A;  3RPW A;  2GFE A;  2AIX A;  3G3G A;  4IGT A;  5ET8 A;  5DVJ A;  4OVP A;  1DCU A;  1FRP A;  2HZK A;  2ZXT A;  3PU5 A;  3PUW E;  2Y5L A;  5B70 A;  2NOO A;  1OLA A;  2Z8F A;  1Y4T A;  3KSX A;  3Q26 A;  5CRY A;  2QL3 A;  3OSR A;  1D3K A;  5I7I A;  1IXI A;  4NF4 B;  3VV5 A;  3DEL B;  1S7Y A;  4OXV A;  1B2H A;  2OWT A;  3MC2 A;  1POY 1;  4E0W A;  1BP5 A;  4DXC A;  2XD3 A;  4QSE A;  4P0G A;  4OVQ A;  1OQG A;  1IMF A;  1EZP A;  2Z8E A;  5EQA A;  1NV1 A;  2YPN A;  1P1O A;  1R9Q A;  2B65 A;  4FAT A;  3BBR A;  1OQH A;  3KZG A;  2M8C A;  5ESY A;  3RQT A;  2BJI A;  1IUD A;  4IR8 A;  4FJP A;  3OEN A;  4OAN A;  1B6H A;  4BDR A;  3RN8 A;  3LV0 A;  2XXX A;  4KCD A;  4U1O A;  3IO4 A;  4GOT A;  1RYO A;  4TQU Q;  3CVG A;  4RK2 A;  3ILU B;  4AB5 A;  4HE0 A;  3ODB A;  3CFL A;  2AYS A;  1VE4 A;  1LFG A;  4C1U A;  3TYH A;  4IO3 A;  3S9M C;  3K0V A;  2H5Y A;  1KZ8 A;  4MEV A;  3NOH A;  3FJ7 A;  5L9O A;  4ZEF A;  4QFP A;  1LCT A;  1I6B A;  3MST A;  4H6D A;  4M4G A;  3IB0 A;  4GWW A;  3CRB A;  5AA2 D;  1ATG A;  3O97 A;  4F18 A;  2YJP A;  2ZZX A;  4I1D A;  3BFT A;  5EYF A;  1N3W A;  1YCJ A;  3Q25 A;  1B52 A;  4K3F A;  3M3F A;  5HBC A;  2HCA A;  4TOZ A;  1D4N A;  3SEY A;  3C34 A;  2RF1 A;  2F6G A;  4O3C A;  2B4L A;  4RNS A;  1YAE A;  2CZI A;  3ONM A;  1F9B A;  4IO6 A;  5F24 A;  2H25 A;  5M2V A;  3K02 A;  2Y7W A;  3LSW A;  2DP8 A;  1DOT A;  3H6W A;  3EN3 A;  3MVW A;  4PET A;  1R9L A;  4G8H A;  4GBW A;  3IAZ A;  2Y7K A;  3D4G A;  1G0I A;  4PE5 B;  3O6H A;  2Y7R A;  1FTJ A;  5TP9 A;  1QKA A;  3E9X A;  4MMP A;  1FQE A;  4X1B A;  2O68 A;  4RY1 A;  4ELQ A;  4TLL B;  1N84 A;  3M8U A;  4XIG Q;  2REG A;  3V5A A;  1I69 A;  1LAF E;  2ABH A;  3K6W A;  5LOM A;  5H8Q A;  1B0H A;  3FVO A;  3FZV A;  3FXQ A;  1NUW A;  4XKR A;  2WBD A;  4O7I A;  1MH3 A;  1B40 A;  4KYD A;  4MNP A;  3C33 A;  5KCJ A;  1MXW A;  1YPN A;  4ONY A;  3PTY A;  4ELO A;  4NAP A;  3V83 A;  4N15 A;  3VLV A;  1INP A;  1M5B A;  3O29 A;  4NWC A;  1ELJ A;  1KA1 A;  3ROJ A;  2PFZ A;  4GL0 A;  2XXU A;  4EXL A;  4O8M A;  3QUJ A;  4PBQ A;  4QRZ A;  1LBY A;  4GRK A;  3LUY A;  1LST A;  3B8B A;  1SYI A;  5FHN A;  1R6Z A;  4RJZ A;  4I3Y A;  4PAK A;  3HPI A;  5DT6 A;  2XXT A;  1URS A;  3K4U A;  3UK4 A;  1LAH E;  5K2X A;  3DP4 A;  5TP9 B;  3PPP A;  1NUY A;  4IB2 A;  4R72 A;  1JVX A;  3THI A;  1Y9U A;  3MZB A;  5I2K A;  5T3J A;  2VT5 A;  1QUK A;  1FPJ A;  5H8N A;  2P1S A;  5H8Q B;  4EQB A;  2DSF A;  2WBB A;  4Z7E A;  1M5E A;  3RNN A;  3QK6 A;  4XXU A;  4OFJ A;  1FBE A;  1M5D A;  4KCC A;  5KCJ B;  3CG3 A;  3K1P A;  4WXJ A;  2HFB A;  3K01 A;  1SBP A;  2GQ1 A;  2DWJ A;  4OFO A;  2CEY A;  2L5V A;  2REJ A;  3K6V A;  3OXN A;  1FPE A;  2Q2C A;  4YB5 A;  4F39 A;  4NF5 A;  1JW4 A;  1IIW A;  1IIT A;  4NN3 A;  3OEK A;  2OK2 A;  2G93 A;  3VLU A;  1Y3N A;  1B5I A;  3GYY A;  2FHY A;  4N07 A;  1WDN A;  3N5L A;  4JWX A;  4MNC A;  3MZ9 A;  2V3U A;  3MZ1 A;  4GWO A;  2A5S A;  1B0L A;  4KQP A;  2X7Q A;  2B4M A;  5CBS A;  1HSL A;  4YKK A;  4IGR A;  4GX4 A;  1Y3P A;  5I2K B;  3A29 A;  1AH5 A;  3M3L A;  4JSD A;  5A5L A;  2V3Q A;  5H8N B;  3V8X B;  4LUB A;  1QUL A;  4JWY A;  3C35 A;  1SVX B;  1TWY A;  3W9V A;  4E0X A;  1FTA A;  1A8F A;  1KWH A;  3PMW A;  1NUX A;  4FBP A;  4YZZ A;  3OO6 A;  4NE4 A;  1JW1 A;  1IXC A;  3T93 B;  4OMB A;  3HHG A;  1PEB A;  3KBR A;  4I40 A;  2I3W A;  3KSJ A;  3K6X A;  3MP6 A;  4O3B A;  4NF5 B;  3G7W A;  5CMM A;  2VD3 A;  1ZTY A;  2QJE A;  2FVZ A;  3OD7 A;  5CC2 A;  5EYH A;  1SPI A;  3H6V A;  3GXA A;  4ZEB A;  3RTF B;  1MXZ A;  2ZYN A;  3A3C A;  1FTK A;  2HEU A;  2F78 A;  3N6U A;  3UN6 A;  3MVY A;  2QFL A;  1ZJL A;  1H44 A;  4XKN A;  2XXQ A;  4U21 A;  4U2R A;  3VDF A;  3T1B A;  1LBV A;  4R9F A;  1LGB C;  3VXB A;  1GTK A;  5AA1 A;  2WX9 A;  5I84 A;  3TPA A;  3WAF A;  1LAG E;  1NV3 A;  4PFI A;  3CFX A;  4XEQ A;  5CM6 A;  2AL5 A;  3TCH A;  4F3P A;  3MVZ A;  3RPL A;  3TEP A;  1MM7 A;  3O28 A;  5DYH A;  2X7P A;  3CSG A;  3TCF A;  2FA7 A;  1FQC A;  3KG2 A;  1B9J A;  5A5X A;  4KYS A;  3T9U A;  4LZ7 A;  2UXA A;  1MS7 A;  2Z8D A;  1JW5 A;  1FQB A;  4PF6 A;  4R2F A;  3PUZ E;  4MFI A;  1IMC A;  1MY0 A;  4GXS B;  3TZA A;  4KXP A;  3LSX A;  2KLF A;  4ZZA A;  4H5F A;  5BUU A;  1Z7N E;  1NNT A;  2A5T B;  3EHU A;  4R6H A;  4IO5 A;  1VR5 A;  1MQI A;  2ZYO A;  5I56 A;  3TTN A;  5AA3 A;  4PFU A;  4YB6 A;  3T9H B;  5K2Y A;  1RKM A;  4GVO A;  3TTL A;  5LTC A;  3UA8 A;  2VD2 A;  1NNK A;  1DPE A;  4FIM A;  2ZNU A;  2ANJ A;  2O84 X;  4PAI A;  3EHT A;  3FVG A;  3RPL B;  4G2Z A;  1MH4 A;  4FEB A;  3KN3 A;  1MY3 A;  1S50 A;  4RA1 A;  4U4X A;  4OER A;  1CNQ A;  5A5X B;  4NMY A;  1NI9 A;  3MUQ A;  3I5O A;  2NWJ A;  4PFY A;  4JBZ A;  3H06 B;  1P99 A;  4FEC A;  1I6Q A;  3FXB A;  4GWU A;  3O9P A;  4GLI A;  2F6P A;  2F97 A;  4M1V A;  4BDN A;  3EKI A;  1HSJ A;  1B5J A;  3C9H A;  4MHF A;  4PFT A;  1POT A;  3ILT B;  4QBA A;  4H46 A;  2OLB A;  3RUM A;  1S9T A;  2XXP A;  2F3B A;  5H8H A;  4XTC Q;  1B3L A;  5I56 B;  5DTB A;  1CB6 A;  3KN8 A;  2XX9 A;  2Q8M A;  2OJT A;  2ONK E;  4N13 A;  4H1X A;  2H98 A;  5CMK A;  1Q35 A;  2XXI A;  4MF3 A;  4ZDM A;  2HAU A;  1NFT A;  4XF5 A;  3FJG A;  3IB2 A;  4PTK A;  1XI6 A;  3ECR A;  4PF8 A;  1RDZ A;  1UQW A;  2ZNT A;  3KGC A;  1AL3 A;  2FIX A;  3I6V A;  4G68 C;  2HXW A;  2QSX A;  4AS5 A;  3QSL A;  1DTZ A;  3FGS A;  4EQ7 A;  4ISU A;  1L5T A;  3S4U A;  4XFE A;  4GX3 A;  4OZ9 A;  1NV0 A;  2O7U A;  2Z23 A;  3JV9 A;  1FPG A;  1DPP A;  3S2V A;  1NV2 A;  2HZL A;  3QIM A;  4OVT A;  2PCR A;  4QFN A;  4NHB A;  5H8H B;  5CBR A;  4MAG A;  3CSB A;  1T0K A;  4I62 A;  1A7L A;  4TLM B;  2PBW A;  3LR1 A;  4JVD A;  4ZS9 A;  4X8R A;  4Q0C A;  1NV6 A;  3MYU A;  2Y7P A;  3OOA A;  1D9Y A;  1NMU A;  1I6A A;  1DK4 A;  4AQ4 A;  3G3I A;  4PGP A;  4IO7 A;  1SQY A;  2QVR A;  1VDW A;  2I48 A;  4OET A;  3U92 A;  1DTG A;  1AWB A;  3FV1 A;  4EUO A;  1H3D A;  3K1N A;  3PUY E;  4YU0 A;  4MX6 A;  4N4U A;  4YB7 A;  1URD A;  1Y20 A;  3K6U A;  4HXV A;  4LQ5 A;  1UTH A;  5CMC A;  5ICQ A;  2DVC A;  1B7H A;  2UYE A;  1RDY A;  3Q28 A;  4THI A;  2VPO A;  3C4M A;  4YMA A;  1FBP A;  3DP6 A;  3SEV A;  1XHY A;  3B6T A;  3HN0 A;  2RC9 A;  2D5W A;  3MJN A;  3VXC A;  1TT1 A;  4GWY A;  4ZEI A;  4P56 A;  3SKP A;  3PV0 E;  1P1U A;  3T66 A;  3D1R A;  1OMP A;  5AA2 B;  1BK4 A;  4N6K A;  1LCF A;  3CHG A;  2Y5K A;  4JDF A;  3EPE A;  4NF0 A;  1G0H A;  1MY1 A;  4MH5 A;  2AL4 A;  3MQ9 A;  3PD9 A;  5ISU A;  2UYF A;  4R2B A;  2HQ0 A;  3TEL A;  2QMX A;  3HHF A;  1N0T A;  5HM4 B;  1USY H;  3PPQ A;  1OIB A;  4JB7 A;  4NQ8 A;  1B51 A;  2QVV A;  2XWV A;  2QRY A;  4G77 A;  2YLN A;  3E13 X;  1Y3Q A;  4GWX A;  2ZZV A;  1EH3 A;  4QFL A;  1JET A;  4PAF A;  4LON B;  3U72 A;  1UTH B;  4PGN A;  2XA5 A;  1AMF A;  3IFC A;  4LN5 A;  1NUZ A;  4NG7 A;  2WKY A;  1LB9 A;  3OO9 A;  4YIC A;  3W15 C;  4X04 A;  4ZE9 A;  1Y1Z A;  5JTY A;  5L9S A;  2F34 A;  3MP8 A;  3FAT A;  4LP2 B;  3E3K A;  3S9N C;  1JP4 A;  4UA8 A;  3TCG A;  4F1V A;  5IAI A;  3TMG A;  4PE3 A;  5HPQ A;  1NNP A;  1PBP A;  1EZO A;  1P1W A;  3QAX A;  1WVJ A;  2GRV A;  4WED A;  1LBZ A;  1ZKB A;  4R74 A;  1MQG A;  2ZYM A;  4MLQ A;  3IOV A;  1K9Y A;  2F7B A;  2P0S A;  4MLV A;  1MPB A;  2KQZ A;  1ZIU A;  2G29 A;  2FIE A;  4WEP A;  4O94 A;  2OX3 A;  5IZ1 A;  1MXV A;  3RLF E;  5H8S A;  4NX1 A;  2XHD A;  4IY6 A;  1MXX A;  1XVY A;  1NV5 A;  2VP1 A;  1OVB A;  1B3H A;  1RYX A;  3K00 A;  1TXF A;  4P3L A;  4ND9 A;  2V3T A;  1IMA A;  4P1E A;  2QS3 A;  4JXI A;  3HFU A;  3TAJ A;  4NF6 B;  4GF8 A;  1URG A;  4AB6 A;  1PB8 A;  2R8T A;  1B7U A;  3S9E A;  3T22 A;  4YMB A;  1MQD A;  4LVQ A;  2FYI A;  1M5C A;  3MPK A;  5JTY B;  1FQA A;  3H7M A;  4JVI A;  2NXO A;  3MP1 A;  3KJ7 A;  2VHA A;  4IO4 A;  4OEV A;  2KR0 A;  1Q1K A;  3R6U A;  2H4I A;  1WOD A;  4P47 A;  5ITP A;  3B50 A;  4OVR A;  4DXB A;  1FBF A;  3UGW A;  1ANF A;  3TKD A;  2RKM A;  5AA4 A;  3QXM A;  3H03 A;  3QYT A;  3L6G A;  1B5H A;  1OVT A;  3D4C A;  4LAT A;  4N8G A;  2ZNS A;  1HSE A;  4O7M A;  2XWI A;  1O7T A;  3W9W A;  5EQ9 A;  1NH7 A;  1YXI A;  1Y4C A;  2XXY A;  1O63 A;  4F3S A;  1IMD A;  5FHM A;  2HAV A;  3C31 A;  1SW4 A;  4KD5 A;  3VVF A;  1FPL A;  2WYK A;  3PPN A;  2ZMB A;  5I3S A;  5DW8 A;  2V25 A;  1FPI A;  2OWZ A;  1UTB A;  2DDK A;  3KEI A;  4FOR A;  1BIY A;  3PD8 A;  4H45 A;  1FBC A;  2O51 A;  3LBS A;  3PPR A;  1GVC A;  4FAJ A;  4R9G A;  4RPO A;  3FD3 A;  1SW2 A;  4H67 A;  1B05 A;  4DE8 A;  2Q74 A;  5I58 A;  4MCO A;  1FPK A;  2HPG A;  4GXA A;  3KFM A;  3I3V A;  1MPD A;  3B7D A;  4JWO A;  3BKI B;  4H8J A;  1IMB A;  5J16 A;  5AA4 B;  2RIN A;  5CI5 A;  3IK6 B;  4H5G A;  3IR1 A;  3B6W A;  1FJ9 A;  4QHQ A;  2UVH A;  5L8D A;  2A5T A;  4OQO A;  1B4H A;  3AXF A;  4KHZ E;  4F2O A;  3N6T A;  1OLC A;  3FIR A;  3MWB A;  2PYY A;  2QS4 A;  4PFW A;  2XXW A;  2XWK A;  4G61 A;  4KI0 E;  5TU0 A;  3SET A;  4Q8R A;  3T0J A;  1MRP A;  4QFK A;  1DSN A;  5FTI A;  2Q8J A;  4BDL A;  4AS4 A;  2QS2 A;  4G8M A;  2H9B A;  5EHM A;  2ONS A;  1UTB B;  2F7A A;  4PCD A;  3ISP A;  2I4C A;  3U1O A;  1A54 A;  3O6I A;  1SDX A;  5IM2 A;  1D9V A;  4BDO A;  2HXR A;  1IZ1 A;  1FJ6 A;  4QF9 A;  1SD3 A;  4LQ2 A;  4NGU A;  3JZJ A;  1Y1M A;  4QSC A;  5I58 B;  4EF2 A;  2CEX A;  2MKZ A;  1ZMG A;  3IOW A;  4KFQ A;  1K9Z A;  3O6G A;  3SEU A;  2OBG A;  1R1N A;  4BLA A;  2XD2 A;  1D9Q A;  2RC8 A;  4N81 A;  3E78 A;  3TQL A;  5DVF A;  2I0C A;  1AIV A;  1B58 A;  2Q9T A;  5EQ7 A;  3FVK A;  4DLD A;  3VLW A;  2P3N A;  2QS1 A;  4RYA A;  3HO7 A;  1NL5 A;  4UAC A;  4ZED A;  4F1U A;  5ET7 A;  2VOZ A;  2D21 A;  4ZZE A;  2GHB A;  4R6Y A;  2Y7I A;  1FSA A;  1LBW A;  1QKB A;  2WEF A;  1FW0 A;  3PMV A;  2PT2 A;  1IXG A;  1MM6 A;  4HTG A;  1FBH A;  3R26 A;  3VVD A;  2Q2A A;  5H8F A;  5IZ3 B;  1XT8 A;  2CMO A;  3ZKL A;  4OEN A;  2DWH A;  1GGG A;  1SYH A;  4P8B A;  3SEW A;  2UVJ A;  2P3V A;  4FE8 A;  4MIJ A;  1AOV A;  4YKJ A;  4OA4 A;  1VFD A;  3U8Q A;  3FBP A;  1MXY A;  3G3J A;  2R9J A;  1MY4 A;  3TUS A;  2I49 A;  4HCY A;  3UIF A;  2O69 A;  2ZYK A;  3BIG A;  1USY E;  3IJO B;  4N8Y A;  1MPC A;  2Q88 A;  3CFZ A;  4BDM A;  1FTM A;  1IME A;  1B3F A;  2HHM A;  2DE2 A;  3H3G A;  3OEM A;  4PBH A;  1UIV A;  2DVZ A;  3TOD A;  2PX1 A;  2UVI A;  2I3V A;  4PC9 A;  4DIG A;  5H8F B;  3B6Q A;  3RT6 B;  2FNC A;  4ESW A;  1NV7 A;  2CZL A;  3OMB A;  1FTL A;  3ZKK A;  3PUV E;  4PFB A;  2PFY A;  3K1M A;  1SI0 A;  3VE1 B;  1B3G A;  2OWS A;  2V93 A;  3FVN A;  4X9T A;  3FXR A;  2THI A;  1TFD A;  2RCA A;  4C0R A;  4EDP A;  3E4R A;  4U4S A;  4O3A A;  4ECF A;  4ELP A;  1FPD A;  1IEJ A;  3H6U A;  3T9V A;  3IOU A;  3Q27 A;  1YYZ A;  2D3I A;  4PQJ A;  2XX8 A;  4DDD A;  5TPA A;  1US5 A;  4P9K A;  4DCX A;  3MPL A;  3U94 A;  1A40 A;  5AA2 A;  1BKA A;  1EU8 A;  1QUJ A;  3G3F A;  1Q9D A;  4OVS A;  2F36 A;  3DLN A;  3LUZ A;  1B4Z A;  4F31 B;  4ESX A;  1A99 A;  5L9M A;  3RYD A;  4HE1 A;  1XVX A;  4HCW A;  4YKP A;  4KPT A;  2V4C A;  2UVG A;  3MAM A;  1EYI A;  1II5 A;  2JJK A;  4RK9 A;  4POW A;  2B3B A;  1JNF A;  1QGX A;  3HV1 A;  4F19 A;  4ZEC A;  5ICT A;  1B46 A;  1MQJ A;  3TTK A;  4Q5T A;  1EZ9 A;  3KOS A;  1N76 A;  1XC1 A;  1LAX A;  1M5F A;  2R6G E;  1FPF A;  2XWO A;  5JK4 A;  2ZZW A;  4IO2 A;  1Z7M E;  1FPB A;  3TDJ A;  1YZ0 A;  3H6T A;  3KJT A;  4QFO A;  1MY2 A;  4KYE A;  1ZBM A;  1J1N A;  3UP9 A;  4LZ8 A;  5TPA B;  3TTR A;  1RDX A;  3KBZ A;  3U93 A;  3PMX A;  3EQ1 A;  4NF8 A;  3Q29 A;  3WAE A;  2OZZ A;  4Q30 B;  3OEL A;  2NVU B;  3TQW A;  4LZ5 A;  2XXV A;  4GIZ A;  2XX7 A;  1H45 A;  3V89 B;  4DCY A;  4MBP A;  5FHO A;  3GLB A;  4U22 A;  2X26 A;  1QW0 A;  4H0W A;  4XKP A;  3T96 B;  1P1Q A;  4DZ1 A;  5IZZ A;  2Q89 A;  3FJM A;  1QUI A;  3GZG A;  4PFR A;  2P2A A;  4L17 A;  4YKI A;  3CI8 A;  3GBB A;  3E79 A;  3C36 A;  4NF6 A;  2F3D A;  2F5X A;  5F1Q A;  1PDA A;  1XS5 A;  3KC1 A;  4F2Q A;  1H76 A;  3SER A;  3IFA A;  3LSF B;  1BTJ A;  2DWI A;  3VFJ A;  4GWS A;  1IXH A;  5AE4 A;  4ELR A;  4G68 A;  1LBX A;  3K2D A;  3RY3 A; 
#chains in the Genus database with same CATH homology
 3VVE A;  2DS9 A;  1P1N A;  1XOC A;  3IOR A;  1LB8 A;  4NF8 B;  4IY5 A;  5ITO A;  3JYR A;  3SES A;  4KR5 A;  2DWA A;  3O66 A;  2VGQ A;  4XKQ A;  4EXK A;  4X48 A;  2DXY A;  1US4 A;  1QJM A;  3HST A;  4F29 A;  4OWD A;  1MQH A;  3RTW B;  5DVI A;  4U1Z A;  3CG1 A;  1TFA A;  4OFL A;  3H4Z A;  3A3U A;  3A09 A;  4F1Y A;  3N94 A;  3IOT A;  3MW0 A;  2QMW A;  1MXU A;  2QPQ A;  3IJX B;  3L6H A;  3UOR A;  3F11 A;  1B1X A;  4RXL A;  2I6E A;  4YAH X;  4R73 A;  2O1M A;  1A55 A;  3OSQ A;  2BJJ X;  4NWD A;  3T9X B;  1LFI A;  2E1S A;  4ZE8 A;  4G68 B;  3G3H A;  4WKM A;  2I58 A;  1IQ7 A;  4P0I A;  4LA9 A;  3C32 A;  1B32 A;  3EHS A;  5KZT A;  1MDP 1;  2B3F A;  3MBP A;  1H43 A;  2LAO A;  1JEV A;  2PMS A;  2DE3 A;  1NKX A;  3IL1 B;  1A8E A;  4Z0I A;  3DM0 A;  3TFL A;  4OTE A;  2ALU A;  4I8C A;  2Z22 A;  5KDT A;  3RT8 A;  4ZEK A;  2DQV A;  1PC3 A;  3KOT A;  1N7X A;  3N26 A;  4EQ9 A;  1FQD A;  4R75 A;  4OHN A;  5I2N A;  3DP8 A;  5I57 A;  4R6K A;  1FQF A;  1PB7 A;  3G3K A;  2E0S A;  3FV2 A;  3FUZ A;  3O2A A;  3S9L C;  1JVY A;  3M3K A;  1FTO A;  3SEX A;  1FCK A;  3PUX E;  1JQF A;  4NED A;  1LFH A;  4BDQ A;  2ESN A;  2OCU A;  3EF7 A;  2DOJ A;  5B7D A;  3FAS A;  4G8N A;  2DXR A;  4H65 A;  4OEU A;  5FTH A;  2I0B A;  1O64 A;  2PVU A;  5I59 A;  5JEI A;  5KDT B;  3CR9 A;  5IKB A;  2IA4 A;  3GBA A;  1PB9 A;  2NUV A;  2Y84 A;  2DE4 A;  3PGF A;  1NH8 A;  4NTL A;  3PPO A;  4GQO A;  4POX A;  1N3X A;  2XXR A;  1B1H A;  3LSL A;  5I2N B;  3R7X A;  2ONR A;  2PT1 A;  1BLF A;  4H8I A;  5I57 B;  2O1L A;  4OVJ A;  3IB1 A;  1QVS A;  4C1T A;  1ZLQ A;  3USD A;  2R71 A;  1LLS A;  3IO6 A;  3IX1 A;  1VSO A;  4F22 A;  1N7W A;  3BFU A;  5CMB A;  3LC8 A;  4X1D A;  1VFE A;  3SDF A;  3OO7 A;  2DYX A;  1JEU A;  4G4P A;  1SI1 A;  3KN7 A;  5I59 B;  5DEX A;  4JSO A;  4N6P A;  3RGY A;  1LBC A;  2F7C A;  1LBB A;  5J1D A;  4P11 A;  1UIU A;  4GD5 A;  3CIJ A;  4RPN A;  2RCB A;  2O7I A;  4HS7 A;  4EF1 A;  1PBQ A;  2W7Y A;  1MG1 A;  2XXH A;  4I9D A;  1SW1 A;  4OES A;  3QUF A;  2O6A A;  1B7Z A;  3P7I A;  2I4B A;  4NF4 A;  1B3E A;  3TTM A;  1GR2 A;  1DMB A;  5BWJ A;  1MDQ A;  2IEE A;  3FXU A;  4FED A;  1NNF A;  2RC7 A;  1YTV A;  3ZSF A;  3ZS6 A;  1GV8 A;  4OYV A;  4GFR A;  3HCQ A;  3MVX A;  4HW8 A;  1CE2 A;  2GHA A;  4F3B A;  5EHS A;  2V84 A;  3OO8 A;  2GH9 A;  4F3G A;  5ELV A;  5DEX B;  4GL8 A;  4U23 A;  2F35 A;  4PP0 A;  4DXU A;  2F8D A;  2H99 A;  1ZU0 A;  1N04 A;  5F7V A;  1SW5 A;  4QSD A;  3RPW A;  2GFE A;  2AIX A;  3G3G A;  4IGT A;  5DVJ A;  2HZK A;  2ZXT A;  3PU5 A;  3PUW E;  5B70 A;  2NOO A;  1OLA A;  2Z8F A;  1Y4T A;  3KSX A;  3Q26 A;  5CRY A;  2QL3 A;  3OSR A;  1D3K A;  1IXI A;  4NF4 B;  3VV5 A;  3DEL B;  1S7Y A;  4OXV A;  1B2H A;  2OWT A;  3MC2 A;  1POY 1;  4E0W A;  1BP5 A;  4DXC A;  2XD3 A;  4QSE A;  4P0G A;  1OQG A;  1EZP A;  2Z8E A;  2YPN A;  1P1O A;  1R9Q A;  2B65 A;  4FAT A;  3BBR A;  1OQH A;  3KZG A;  2M8C A;  3RQT A;  1IUD A;  4FJP A;  3OEN A;  1B6H A;  4BDR A;  3RN8 A;  4KCD A;  2XXX A;  4U1O A;  3IO4 A;  4GOT A;  1RYO A;  4TQU Q;  3CVG A;  4RK2 A;  3ILU B;  4AB5 A;  3ODB A;  3CFL A;  2AYS A;  1VE4 A;  1LFG A;  4C1U A;  3TYH A;  4IO3 A;  3S9M C;  3K0V A;  2H5Y A;  3FJ7 A;  5L9O A;  4ZEF A;  4QFP A;  1LCT A;  1I6B A;  4H6D A;  4M4G A;  3IB0 A;  3CRB A;  5AA2 D;  1ATG A;  3O97 A;  4F18 A;  2YJP A;  4I1D A;  3BFT A;  5EYF A;  1N3W A;  1YCJ A;  3Q25 A;  1B52 A;  4K3F A;  3M3F A;  5HBC A;  2HCA A;  4TOZ A;  1D4N A;  3SEY A;  3C34 A;  2RF1 A;  2F6G A;  4O3C A;  4RNS A;  1YAE A;  3ONM A;  1F9B A;  4IO6 A;  2H25 A;  5M2V A;  3K02 A;  2Y7W A;  3LSW A;  2DP8 A;  1DOT A;  3H6W A;  3EN3 A;  3MVW A;  4PET A;  1R9L A;  4G8H A;  3IAZ A;  2Y7K A;  3D4G A;  4PE5 B;  3O6H A;  2Y7R A;  1FTJ A;  5TP9 A;  1QKA A;  3E9X A;  1FQE A;  4X1B A;  2O68 A;  4RY1 A;  4ELQ A;  4TLL B;  1N84 A;  3M8U A;  4XIG Q;  2REG A;  3V5A A;  1I69 A;  1LAF E;  2ABH A;  3K6W A;  5LOM A;  5H8Q A;  1B0H A;  3FVO A;  3FZV A;  3FXQ A;  4XKR A;  1MH3 A;  1B40 A;  4KYD A;  3C33 A;  5KCJ A;  1MXW A;  1YPN A;  4ONY A;  4ELO A;  3V83 A;  3VLV A;  1M5B A;  3O29 A;  4NWC A;  1ELJ A;  4GL0 A;  2XXU A;  4EXL A;  3QUJ A;  4QRZ A;  4GRK A;  3LUY A;  1LST A;  1SYI A;  5FHN A;  1R6Z A;  4RJZ A;  3HPI A;  5DT6 A;  2XXT A;  1URS A;  3K4U A;  3UK4 A;  5K2X A;  1LAH E;  3DP4 A;  5TP9 B;  3PPP A;  4IB2 A;  4R72 A;  1JVX A;  3THI A;  1Y9U A;  3MZB A;  5I2K A;  1QUK A;  5H8N A;  5H8Q B;  4EQB A;  2P1S A;  2DSF A;  4Z7E A;  1M5E A;  3RNN A;  3QK6 A;  4XXU A;  4OFJ A;  1M5D A;  4KCC A;  5KCJ B;  3CG3 A;  3K1P A;  4WXJ A;  2HFB A;  3K01 A;  1SBP A;  2DWJ A;  4OFO A;  2REJ A;  3K6V A;  3OXN A;  2Q2C A;  4YB5 A;  4F39 A;  4NF5 A;  1JW4 A;  1IIW A;  1IIT A;  3OEK A;  2OK2 A;  2G93 A;  3VLU A;  1Y3N A;  1B5I A;  4N07 A;  1WDN A;  3N5L A;  4JWX A;  3MZ9 A;  2V3U A;  3MZ1 A;  4GWO A;  2A5S A;  1B0L A;  4KQP A;  2X7Q A;  5CBS A;  1HSL A;  4YKK A;  4IGR A;  1Y3P A;  5I2K B;  4JSD A;  1AH5 A;  3M3L A;  2V3Q A;  5H8N B;  3V8X B;  4LUB A;  1QUL A;  4JWY A;  3C35 A;  1SVX B;  1TWY A;  3W9V A;  4E0X A;  1KWH A;  1A8F A;  3PMW A;  4YZZ A;  3OO6 A;  4NE4 A;  1JW1 A;  1IXC A;  3T93 B;  4OMB A;  3HHG A;  1PEB A;  3KBR A;  2I3W A;  3KSJ A;  3K6X A;  3MP6 A;  4O3B A;  4NF5 B;  3G7W A;  5CMM A;  2VD3 A;  1ZTY A;  2QJE A;  3OD7 A;  5CC2 A;  3H6V A;  3GXA A;  4ZEB A;  3RTF B;  1MXZ A;  2ZYN A;  3A3C A;  1FTK A;  2HEU A;  2F78 A;  3N6U A;  3UN6 A;  3MVY A;  1ZJL A;  1H44 A;  4XKN A;  2XXQ A;  4U21 A;  4U2R A;  3VDF A;  4R9F A;  1LGB C;  3VXB A;  1GTK A;  5AA1 A;  5I84 A;  3TPA A;  3WAF A;  1LAG E;  3CFX A;  5CM6 A;  2AL5 A;  3TCH A;  4F3P A;  3MVZ A;  3TEP A;  1MM7 A;  3O28 A;  5DYH A;  2X7P A;  3CSG A;  3TCF A;  2FA7 A;  1FQC A;  3KG2 A;  1B9J A;  5A5X A;  4KYS A;  3T9U A;  4LZ7 A;  2UXA A;  1MS7 A;  2Z8D A;  1JW5 A;  1FQB A;  4R2F A;  3PUZ E;  4MFI A;  1MY0 A;  4GXS B;  3TZA A;  3LSX A;  2KLF A;  4ZZA A;  4H5F A;  5BUU A;  1Z7N E;  1NNT A;  2A5T B;  3EHU A;  4R6H A;  4IO5 A;  1VR5 A;  1MQI A;  2ZYO A;  5I56 A;  3TTN A;  5AA3 A;  4PFU A;  4YB6 A;  3T9H B;  5K2Y A;  1RKM A;  4GVO A;  3TTL A;  3UA8 A;  2VD2 A;  1NNK A;  1DPE A;  4FIM A;  2ZNU A;  2ANJ A;  2O84 X;  3EHT A;  3FVG A;  4G2Z A;  1MH4 A;  4FEB A;  3KN3 A;  1MY3 A;  1S50 A;  4RA1 A;  4U4X A;  4OER A;  5A5X B;  4NMY A;  3MUQ A;  3I5O A;  2NWJ A;  4PFY A;  4JBZ A;  3H06 B;  1P99 A;  4FEC A;  1I6Q A;  3O9P A;  4GLI A;  2F6P A;  2F97 A;  4M1V A;  4BDN A;  1HSJ A;  1B5J A;  3C9H A;  4PFT A;  1POT A;  3ILT B;  2OLB A;  3RUM A;  1S9T A;  2XXP A;  5H8H A;  4XTC Q;  1B3L A;  5I56 B;  5DTB A;  1CB6 A;  3KN8 A;  2XX9 A;  2OJT A;  2ONK E;  4N13 A;  4H1X A;  2H98 A;  5CMK A;  1Q35 A;  2XXI A;  4MF3 A;  4ZDM A;  2HAU A;  1NFT A;  3FJG A;  3IB2 A;  3ECR A;  1UQW A;  2ZNT A;  3KGC A;  1AL3 A;  3I6V A;  4G68 C;  2HXW A;  2QSX A;  3QSL A;  1DTZ A;  3FGS A;  4EQ7 A;  4ISU A;  1L5T A;  3S4U A;  4OZ9 A;  2O7U A;  2Z23 A;  3JV9 A;  1DPP A;  3S2V A;  2HZL A;  3QIM A;  4QFN A;  5H8H B;  5CBR A;  3CSB A;  1T0K A;  4I62 A;  1A7L A;  4TLM B;  2PBW A;  3LR1 A;  4ZS9 A;  4Q0C A;  2Y7P A;  3OOA A;  1D9Y A;  1NMU A;  1I6A A;  4AQ4 A;  3G3I A;  4IO7 A;  1SQY A;  2I48 A;  4OET A;  3U92 A;  1DTG A;  3FV1 A;  4EUO A;  1H3D A;  3K1N A;  3PUY E;  4YU0 A;  4YB7 A;  1URD A;  1Y20 A;  3K6U A;  4LQ5 A;  1UTH A;  5CMC A;  5ICQ A;  2DVC A;  1B7H A;  2UYE A;  3Q28 A;  4THI A;  3C4M A;  4YMA A;  3DP6 A;  3SEV A;  1XHY A;  3B6T A;  3HN0 A;  2RC9 A;  2D5W A;  3MJN A;  3VXC A;  1TT1 A;  4ZEI A;  3SKP A;  3PV0 E;  1P1U A;  3T66 A;  1OMP A;  5AA2 B;  1LCF A;  4JDF A;  3EPE A;  1MY1 A;  4MH5 A;  2AL4 A;  3MQ9 A;  3PD9 A;  5ISU A;  2UYF A;  4R2B A;  2HQ0 A;  3TEL A;  2QMX A;  3HHF A;  1N0T A;  5HM4 B;  1USY H;  3PPQ A;  1OIB A;  4JB7 A;  1B51 A;  2QRY A;  4G77 A;  2YLN A;  3E13 X;  1Y3Q A;  1EH3 A;  4QFL A;  1JET A;  4LON B;  3U72 A;  1UTH B;  1AMF A;  2WKY A;  1LB9 A;  3OO9 A;  4YIC A;  3W15 C;  4ZE9 A;  1Y1Z A;  5JTY A;  5L9S A;  2F34 A;  3MP8 A;  3FAT A;  4LP2 B;  3E3K A;  3S9N C;  4UA8 A;  3TCG A;  4F1V A;  5IAI A;  3TMG A;  5HPQ A;  1NNP A;  1PBP A;  1EZO A;  1P1W A;  3QAX A;  1WVJ A;  2GRV A;  4WED A;  1ZKB A;  4R74 A;  1MQG A;  2ZYM A;  4MLQ A;  3IOV A;  2F7B A;  2P0S A;  4MLV A;  1MPB A;  1ZIU A;  2G29 A;  4WEP A;  1MXV A;  3RLF E;  5H8S A;  2XHD A;  4IY6 A;  1MXX A;  1XVY A;  2VP1 A;  1OVB A;  1B3H A;  1RYX A;  3K00 A;  1TXF A;  4ND9 A;  2V3T A;  2QS3 A;  4JXI A;  3TAJ A;  4NF6 B;  4GF8 A;  1URG A;  4AB6 A;  1PB8 A;  1B7U A;  3S9E A;  3T22 A;  4YMB A;  1MQD A;  4LVQ A;  2FYI A;  1M5C A;  3MPK A;  5JTY B;  1FQA A;  3H7M A;  2NXO A;  3MP1 A;  3KJ7 A;  2VHA A;  4IO4 A;  4OEV A;  1Q1K A;  3R6U A;  2H4I A;  1WOD A;  5ITP A;  4DXB A;  3UGW A;  1ANF A;  3TKD A;  2RKM A;  5AA4 A;  3QXM A;  3H03 A;  3QYT A;  3L6G A;  1B5H A;  1OVT A;  3D4C A;  4LAT A;  2ZNS A;  1HSE A;  1O7T A;  3W9W A;  1NH7 A;  1Y4C A;  2XXY A;  1O63 A;  4F3S A;  5FHM A;  2HAV A;  3C31 A;  1SW4 A;  4KD5 A;  3VVF A;  3PPN A;  2ZMB A;  2V25 A;  1UTB A;  3KEI A;  4FOR A;  1BIY A;  3PD8 A;  2O51 A;  3LBS A;  3PPR A;  1GVC A;  4FAJ A;  4R9G A;  4RPO A;  3FD3 A;  1SW2 A;  4H67 A;  1B05 A;  4DE8 A;  5I58 A;  4GXA A;  3KFM A;  3I3V A;  1MPD A;  3B7D A;  4JWO A;  3BKI B;  4H8J A;  5AA4 B;  2RIN A;  5CI5 A;  3IK6 B;  4H5G A;  3IR1 A;  3B6W A;  4QHQ A;  2UVH A;  5L8D A;  2A5T A;  4OQO A;  1B4H A;  3AXF A;  4KHZ E;  4F2O A;  3N6T A;  1OLC A;  3FIR A;  3MWB A;  2PYY A;  2QS4 A;  4PFW A;  2XXW A;  4KI0 E;  5TU0 A;  3SET A;  4Q8R A;  1MRP A;  4QFK A;  1DSN A;  5FTI A;  2Q8J A;  4BDL A;  2QS2 A;  4G8M A;  2H9B A;  5EHM A;  2ONS A;  1UTB B;  2F7A A;  2I4C A;  3U1O A;  1A54 A;  3O6I A;  1SDX A;  1D9V A;  4BDO A;  1IZ1 A;  4QF9 A;  1SD3 A;  4LQ2 A;  3JZJ A;  1Y1M A;  4QSC A;  5I58 B;  4EF2 A;  1ZMG A;  3IOW A;  4KFQ A;  3O6G A;  3SEU A;  2OBG A;  1R1N A;  4BLA A;  2XD2 A;  2RC8 A;  3TQL A;  5DVF A;  2I0C A;  1AIV A;  1B58 A;  2Q9T A;  3FVK A;  4DLD A;  3VLW A;  2QS1 A;  4RYA A;  3HO7 A;  1NL5 A;  4UAC A;  4ZED A;  4F1U A;  2VOZ A;  2D21 A;  4ZZE A;  2GHB A;  4R6Y A;  2Y7I A;  1QKB A;  1FW0 A;  3PMV A;  2PT2 A;  1IXG A;  1MM6 A;  4HTG A;  3R26 A;  3VVD A;  2Q2A A;  5H8F A;  1XT8 A;  2CMO A;  3ZKL A;  4OEN A;  2DWH A;  1GGG A;  1SYH A;  3SEW A;  2UVJ A;  4FE8 A;  1AOV A;  4YKJ A;  1VFD A;  3U8Q A;  1MXY A;  3G3J A;  2R9J A;  1MY4 A;  3TUS A;  2I49 A;  4HCY A;  3UIF A;  2O69 A;  2ZYK A;  1USY E;  3IJO B;  1MPC A;  2Q88 A;  3CFZ A;  4BDM A;  1FTM A;  1B3F A;  2DE2 A;  3H3G A;  3OEM A;  1UIV A;  2DVZ A;  3TOD A;  2PX1 A;  2UVI A;  2I3V A;  4DIG A;  5H8F B;  3B6Q A;  3RT6 B;  2FNC A;  4ESW A;  2CZL A;  3OMB A;  1FTL A;  3ZKK A;  3PUV E;  3K1M A;  1SI0 A;  3VE1 B;  1B3G A;  2OWS A;  2V93 A;  3FVN A;  4X9T A;  3FXR A;  2THI A;  1TFD A;  2RCA A;  4C0R A;  4EDP A;  3E4R A;  4U4S A;  4O3A A;  4ECF A;  4ELP A;  1IEJ A;  3H6U A;  3T9V A;  3IOU A;  3Q27 A;  2D3I A;  4PQJ A;  2XX8 A;  4DDD A;  5TPA A;  1US5 A;  4DCX A;  3MPL A;  3U94 A;  1A40 A;  5AA2 A;  1BKA A;  1EU8 A;  1QUJ A;  3G3F A;  2F36 A;  3DLN A;  1B4Z A;  4F31 B;  4ESX A;  1A99 A;  5L9M A;  1XVX A;  4HCW A;  4YKP A;  4KPT A;  2UVG A;  3MAM A;  1II5 A;  4RK9 A;  4POW A;  2B3B A;  1JNF A;  3HV1 A;  4F19 A;  4ZEC A;  5ICT A;  1B46 A;  1MQJ A;  3TTK A;  4Q5T A;  1EZ9 A;  3KOS A;  1N76 A;  1XC1 A;  1LAX A;  1M5F A;  2R6G E;  5JK4 A;  4IO2 A;  1Z7M E;  3TDJ A;  3H6T A;  3KJT A;  4QFO A;  1MY2 A;  4KYE A;  1ZBM A;  1J1N A;  3UP9 A;  4LZ8 A;  5TPA B;  3TTR A;  3U93 A;  3PMX A;  3EQ1 A;  4NF8 A;  3Q29 A;  3WAE A;  2OZZ A;  4Q30 B;  3OEL A;  2NVU B;  3TQW A;  4LZ5 A;  2XXV A;  4GIZ A;  2XX7 A;  1H45 A;  3V89 B;  4DCY A;  4MBP A;  5FHO A;  3GLB A;  4U22 A;  2X26 A;  1QW0 A;  4H0W A;  4XKP A;  3T96 B;  1P1Q A;  4DZ1 A;  2Q89 A;  3FJM A;  1QUI A;  3GZG A;  2P2A A;  4L17 A;  4YKI A;  3CI8 A;  3GBB A;  3C36 A;  4NF6 A;  2F5X A;  5F1Q A;  1PDA A;  1XS5 A;  4F2Q A;  1H76 A;  3SER A;  3LSF B;  1BTJ A;  2DWI A;  3VFJ A;  1IXH A;  5AE4 A;  4ELR A;  4G68 A;  3K2D A;  3RY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...