1OQHA

Crystal structure of the r124a mutant of the n-lobe human transferrin
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGASAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Serotransferrin
publication title Structural and functional consequences of binding site mutations in transferrin: crystal structures of the Asp63Glu and Arg124Ala mutants of the N-lobe of human transferrin
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oqhA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oqhA02
4OXVA 2R9JA 4Q30B 4YB5A 3EF7A 1R1NA 5FTIA 1UTHB 5TP9B 5JK4A 1S50A 2P2AA 4XKQA 1IQ7A 2IA4A 1NFTA 1POTA 2QMXA 5H8QA 5DT6A 2ESNA 3G3IA 4KYEA 3OELA 3ZKLA 4OESA 5L9SA 1AMFA 4DXUA 3IK6B 5AA3A 2H4IA 2XXIA 5H8HB 4ZDMA 1SW2A 1B3EA 5ELVA 4QFNA 1JW5A 1CB6A 3G3GA 2UVGA 4HCWA 3IOTA 1SYIA 4POWA 3T66A 4ELPA 2DWIA 3B6QA 3BKIB 3OENA 3SKPA 2ALUA 5DTBA 1EZ9A 4EQBA 3B7DA 5LOMA 4P0GA 2VD3A 4U22A 4C1UA 3PUZE 4NF6A 1US5A 2NXOA 4UA8A 4ZEBA 4FIMA 2IEEA 3C4MA 1P1NA 2X7QA 1B05A 1MXWA 2WKYA 5H8NB 3IOWA 1B3FA 3SEYA 3HPIA 3PU5A 4KFQA 4IB2A 2QJEA 3CR9A 3HSTA 4IGRA 4U2RA 3FVKA 2B3FA 5H8FA 2ZYNA 4XKNA 4U1ZA 2XXQA 1N04A 1B9JA 3IOVA 4X9TA 3TZAA 2ZNUA 3UA8A 1HSJA 2PBWA 4OYVA 1JW1A 3LC8A 4LQ2A 2I6EA 3CRBA 4ONYA 2A5TB 3MJNA 4I9DA 4RNSA 4GIZA 1QJMA 3TODA 5FHNA 3U8QA 2GHBA 3KSXA 1B4HA 4RJZA 3H7MA 3O66A 1D9VA 1QVSA 1Q1KA 3RQTA 4PFUA 2XXVA 1UIUA 1UTHA 4GQOA 3MC2A 2OBGA 4DE8A 3FJGA 2F78A 3QXMA 4F3PA 3VVFA 3QIMA 1N84A 2Q8JA 2Z8FA 5EHMA 3THIA 2Y7RA 1BIYA 2XXXA 1SBPA 1OVTA 5H8HA 1MH4A 5K2YA 2AIXA 5A5XB 1H76A 4NTLA 5ICTA 4LUBA 1FTOA 1XHYA 3QK6A 4TLMB 1R6ZA 1PB9A 1Y9UA 2XX8A 4DCYA 5AA2D 1DPEA 2B65A 2DVCA 1P1OA 5I58B 4DIGA 4QFLA 3GBAA 3N94A 2RCAA 1D9YA 3M3LA 3KJ7A 3KEIA 4N6PA 5H8NA 5HM4B 1Y3QA 5B7DA 2ONKE 4Q0CA 4G8HA 4IO2A 2PMSA 4YMAA 2V93A 4F19A 5ISUA 4XKPA 2F7CA 2Z22A 4LA9A 2F6GA 1NNTA 4LQ5A 1B51A 4ELQA 3KBRA 4F1VA 5IKBA 4HCYA 1IXCA 2X7PA 1B40A 4ESXA 3FJMA 5H8SA 3E9XA 2XXHA 1SW4A 1ZTYA 1I6BA 4THIA 1N3WA 3O9PA 1JVYA 4RK9A 5I57B 3PUWE 4R6HA 3T96B 1LAXA 4YB6A 3KSJA 2UVHA 3V8XB 2RCBA 3R7XA 2Y7WA 3TQLA 2XX9A 3C32A 2DP8A 3O97A 3RNNA 3FATA 1YTVA 3AXFA 4BDLA 1A8EA 4QSCA 1FQDA 3K01A 1Y1MA 2NWJA 1PBPA 2A5SA 4KR5A 1N76A 3VV5A 1LSTA 1D4NA 1B1XA 3H6TA 3K1MA 3RPWA 2QS1A 3QUJA 4BLAA 3IR1A 3M3FA 3MP8A 3KN3A 3VLUA 5B70A 4NWDA 4K3FA 5FTHA 4LATA 3CFZA 1LAHE 3IB0A 3USDA 1Y4CA 5A5XA 5JEIA 3KOSA 1ZIUA 3G7WA 2ZYKA 3IX1A 3PUVE 2D3IA 2R6GE 3PGFA 1MXVA 3FXQA 3VXBA 2B3BA 4AQ4A 1IITA 1B3HA 3FVGA 4WEDA 4Z7EA 1FQEA 4FECA 1LCTA 5I58A 4H1XA 1PB8A 4X1BA 1QUJA 4NF5B 4YMBA 4XKRA 3FV1A 1GR2A 1SD3A 4G68B 3K1PA 4PFYA 4WKMA 1PC3A 3H6VA 3ILUB 3MWBA 3JV9A 1SW5A 1MXYA 5FHMA 3SEVA 1ZBMA 3U94A 3FVNA 3FZVA 1MQIA 3P7IA 4YAHX 1VSOA 1NNFA 3TMGA 1ZU0A 1OQHA 3A3CA 1LAGE 2O1LA 4PFWA 3ZS6A 2KLFA 5I2NB 1P1UA 4QHQA 2GFEA 3QAXA 1NL5A 1A99A 3FXRA 5BUUA 4H6DA 5I57A 2RF1A 4R6KA 3FD3A 1GTKA 4R73A 4N07A 3K6VA 3I5OA 3MVXA 2OLBA 1LFIA 4F1UA 1IUDA 2ZNSA 1RYXA 4LZ7A 2OCUA 1WODA 1Z7ME 2DYXA 4N13A 1TXFA 2M8CA 4JWOA 1IXGA 2Y84A 4YB7A 3EHUA 2F6PA 1OLAA 4R2FA 3EN3A 1SVXB 4QFOA 4H8JA 5TPAB 5CRYA 1A7LA 1SDXA 4OFJA 3KG2A 2XXYA 4FJPA 1MY4A 3K2DA 4PQJA 4R2BA 1MQJA 1MPBA 1FQFA 1PBQA 3O28A 2XXPA 3PPRA 3L6HA 5EHSA 2Z8DA 5CM6A 1XS5A 4ZEIA 5DYHA 3TTKA 3VXCA 2X26A 3OSRA 3LSWA 4U4SA 4RXLA 2I3VA 4NF5A 4U21A 1VE4A 3LR1A 5DVJA 1MY1A 4G68A 2QS3A 5JTYB 2VHAA 2QPQA 3C35A 1MXZA 1N3XA 4ZECA 3MP1A 2DXYA 3V89B 3BFTA 4FAJA 3LSXA 4M1VA 3PD9A 4GFRA 4UACA 2BJJX 4DXCA 4TQUQ 3OEMA 2H25A 2CMOA 4ZEFA 3U1OA 3MAMA 4FEBA 3QUFA 1IEJA 5FHOA 1DMBA 4EDPA 1B46A 4QFKA 3TYHA 2QMWA 4PFTA 2Y7IA 1FQAA 4JWYA 1YAEA 2OWTA 1B3LA 3O2AA 2I4BA 4XIGQ 3MW0A 4R74A 1A55A 4NF4B 3SEXA 3CFLA 2ZNTA 3N6TA 3MZBA 2D5WA 3MBPA 4PP0A 4WXJA 2XXWA 1B7UA 2HAVA 2ONSA 3KN7A 2RINA 3G3HA 2F5XA 5TPAA 4OQOA 1Y3PA 1OVBA 3RT6B 4LVQA 3G3FA 3B6WA 4GL8A 1LBBA 1Q35A 4P0IA 2O84X 1UQWA 4H67A 4C0RA 1LB8A 1MQDA 5CC2A 5I2KA 2F7BA 1FTMA 5CBRA 1II5A 3UN6A 3OMBA 2QS2A 3CG3A 4KCDA 2LAOA 3SEWA 2DS9A 1O63A 4OFOA 4MBPA 3G3JA 4Q5TA 2I0CA 3PUXE 3RGYA 1VR5A 4RY1A 5TP9A 5JTYA 1TFAA 4IO3A 1OQGA 3TDJA 3S9MC 5HPQA 3FIRA 1MRPA 4GF8A 4YICA 4ZZEA 2DQVA 3SDFA 4NWCA 2G29A 2I0BA 4GVOA 3UK4A 3M8UA 4Q8RA 3EHSA 3GXAA 2UXAA 1QUKA 4I1DA 5DVFA 3JZJA 1DOTA 4RPOA 3D4GA 4YZZA 3OXNA 3RTWB 1EZOA 5M2VA 3K4UA 4H5GA 1TWYA 4GOTA 4R72A 1S9TA 2DOJA 3TTMA 5AA1A 5AA4B 4KYSA 1FQCA 3I6VA 4ESWA 4H5FA 1OLCA 1SI0A 3SESA 1P99A 4JSOA 3GLBA 3CVGA 4JBZA 4NF4A 4O3BA 1LFHA 3KOTA 3Q29A 5I56B 4IY5A 3IOUA 3FV2A 5ITOA 2DWHA 4OERA 3IO4A 3FJ7A 4F22A 3DP4A 2NVUB 4BDQA 1LGBC 3Q25A 4GWOA 2GH9A 4LZ8A 3PPNA 2FA7A 2I4CA 4KQPA 2V3TA 1TT1A 1MPDA 3RT8A 5ITPA 2A5TA 4XXUA 3RN8A 1BTJA 4F31B 3E13X 3U93A 1MY2A 3DP8A 1H3DA 2REJA 1N0TA 1MY0A 2XHDA 2FNCA 4U4XA 5AA2B 1B3GA 1MH3A 1MY3A 3K6WA 1B52A 3T22A 2G93A 3K0VA 1YCJA 2PT1A 2Z8EA 1UTBB 3OSQA 2Q89A 4ZEKA 3H3GA 1ZLQA 3C36A 1IXIA 2PVUA 1GVCA 3K02A 2P0SA 4O3AA 3TCGA 2Q88A 4I62A 3VE1B 3CFXA 3N6UA 3TTLA 1A8FA 1NH8A 3MZ9A 1YPNA 4AB6A 4HS7A 1ZJLA 4R9GA 1B1HA 2XD2A 1DTGA 4QSEA 5CI5A 2F36A 3PPPA 1MM7A 1N7XA 2OK2A 4JWXA 1XT8A 5KDTB 2V25A 1M5BA 3MPLA 1LBCA 2Q2CA 3IJOB 3IL1B 3ONMA 2ZYOA 3HO7A 3MZ1A 3QYTA 3FASA 1EU8A 1B0LA 3MQ9A 1JETA 3W9VA 5I56A 1ZMGA 2DWJA 3RY3A 2F34A 4H0WA 1NKXA 1URGA 5L8DA 1ANFA 1LLSA 4MLQA 3PD8A 5AE4A 4EF2A 1B5JA 2I58A 3CG1A 3W15C 2D21A 5CMCA 3OO6A 1AIVA 4EQ7A 1H44A 1VFEA 2AYSA 1KWHA 1VFDA 2ZXTA 1EH3A 3FVOA 2V3QA 1BLFA 2RC7A 2RC8A 3B6TA 2Y7PA 4RYAA 3TCFA 1ATGA 2HZLA 3H03A 4OVJA 4GLIA 2REGA 1M5CA 4U1OA 3PMWA 4ND9A 3C33A 3OO8A 2PX1A 3L6GA 3MVZA 1QUIA 3TEPA 1R9QA 3TFLA 4ELOA 4BDNA 3MUQA 3TAJA 1UTBA 1Y20A 2XXTA 4DXBA 4GD5A 3Q26A 2H5YA 3ECRA 3QSLA 4ZE8A 4KPTA 2VGQA 1MXUA 3V5AA 4NMYA 2ONRA 4G68C 3H6WA 2H9BA 1H45A 2YPNA 4E0WA 4M4GA 2HEUA 1JVXA 4G8MA 2W7YA 1RYOA 3PUYE 4RA1A 2HQ0A 2DE2A 3K6XA 1NNKA 1Y1ZA 1B5HA 2VD2A 1M5EA 2Q2AA 5CMKA 4OHNA 5I84A 4IO4A 1A40A 3U72A 2O51A 5IAIA 2F7AA 3IB2A 3S2VA 2O1MA 3K00A 2XXRA 1M5DA 4H8IA 3Q28A 5KDTA 3KFMA 2GHAA 1FTLA 4O3CA 3UORA 3D4CA 4F29A 4F18A 4FORA 1H43A 2ZMBA 4F1YA 5KCJB 3N5LA 1DTZA 4HW8A 3VFJA 1QW0A 3K6UA 4GL0A 2H98A 5I2NA 3TPAA 3BFUA 2F35A 4OWDA 2Q9TA 3WAEA 3O29A 2O7UA 4WEPA 3S9EA 1ELJA 2QSXA 1XOCA 5K2XA 3H4ZA 1TFDA 1T0KA 4ZS9A 3H6UA 4ZEDA 4YU0A 1AH5A 1I6QA 1QULA 4KCCA 1FCKA 1B2HA 3TTNA 1PDAA 4LZ5A 1IXHA 1B32A 4LP2B 3HHFA 1D3KA 2HFBA 3C34A 4IY6A 3R26A 3V83A 5DVIA 3UP9A 1CE2A 3VLVA 3KZGA 3ZSFA 2PYYA 3TELA 2E1SA 4BDMA 4TOZA 4NE4A 3VVEA 3DM0A 3T9HB 1QKBA 4IO5A 2HXWA 3CIJA 2ZYMA 2UVIA 4EUOA 4IO6A 3A09A 2OWSA 3IORA 4YKPA 1URSA 3PV0E 1FTKA 1WDNA 3UGWA 1J1NA 3IB1A 4ZE9A 4P11A 3FUZA 2YLNA 5L9OA 1B7HA 4H65A 1JEUA 4E0XA 2UYFA 2R71A 4PETA 1MG1A 3Q27A 1P1QA 4JXIA 2O6AA 2ABHA 4F3BA 1M5FA 5F1QA 4PE5B 1AOVA 3O6HA 2XX7A 3GZGA 4MH5A 1MXXA 3IJXB 1MM6A 4OFLA 4ZZAA 1MDP1 1MS7A 2HAUA 1JW4A 1QKAA 3K1NA 4OEVA 5KCJA 3G3KA 4G77A 1B58A 1LAFE 3BBRA 4EF1A 1XVXA 3RUMA 3MVWA 4LONB 5CBSA 3EHTA 3OOAA 5I59B 2GRVA 2QL3A 3TUSA 2V3UA 1A54A 4EXKA 1MDQA 4EQ9A 4FATA 1B0HA 3E4RA 1AL3A 4F2QA 2P1SA 3MVYA 1R9LA 1ZKBA 5DEXB 3ODBA 3M3KA 2UYEA 3DP6A 3KJTA 2I49A 2O68A 4QSDA 2CZLA 3T9VA 2VP1A 5KZTA 1JQFA 2OJTA 5ICQA 4I8CA 1FQBA 1LCFA 4GXAA 2DXRA 5CMBA 4DZ1A 2RKMA 3TCHA 2XD3A 3OO7A 3VLWA 1B6HA 4OEUA 1USYE 1DPPA 4TLLB 1PEBA 3TTRA 2Y7KA 3TKDA 3MPKA 3EPEA 1I69A 1S7YA 2THIA 2DE4A 1L5TA 3SERA 2OZZA 1WVJA 3N26A 4U23A 3SEUA 2NUVA 4QF9A 1URDA 1B7ZA 4NF8B 3CSGA 2DWAA 2XXUA 3LUYA 3R6UA 2HCAA 2DSFA 1OMPA 2AL5A 2H99A 3RTFB 3S9NC 1JEVA 1MQGA 1SW1A 2ANJA 3C31A 3FXUA 2V84A 1BKAA 5CMMA 3C9HA 3F11A 4L17A 4OMBA 3PMVA 1Y4TA 3KN8A 5EYFA 2E0SA 4POXA 2DVZA 2PT2A 2O69A 1LFGA 3H06B 4OTEA 4BDRA 3T93B 4G2ZA 3WAFA 4F39A 2AL4A 3GBBA 3KGCA 4YKJA 4RK2A 4JB7A 1USYH 3VVDA 2I48A 3T9XB 3ILTB 4FE8A 3LSLA 3HN0A 1B4ZA 3SETA 4GRKA 3HCQA 3I3VA 4GXSB 5I59A 4OETA 4MFIA 2QS4A 4KI0E 1OIBA 3S4UA 1O64A 1F9BA 3U92A 3CSBA 4ECFA 4KYDA 4R6YA 1Y3NA 1B5IA 3O6IA 5AA4A 4MLVA 5DEXA 4QFPA 1FTJA 1MPCA 1GV8A 3A3UA 4F3GA 1P1WA 1NMUA 1UIVA 4DLDA 4YKKA 3HHGA 1PB7A 2HZKA 2YJPA 3T9UA 4NEDA 2I3WA 1SYHA 3MP6A 3PPQA 4HTGA 4JDFA 5J1DA 3LBSA 1XVYA 3ZKKA 3RLFE 2F8DA 1EZPA 5H8QB 1DSNA 3IAZA 1NH7A 3CI8A 5TU0A 2DE3A 3FGSA 4FEDA 4BDOA 4OENA 4OZ9A 1HSLA 4QRZA 3S9LC 1RKMA 5L9MA 3W9WA 4R75A 1JNFA 4EXLA 4NF8A 4ISUA 4DDDA 3PPOA 1MQHA 3OEKA 3LSFB 4MF3A 1BP5A 1SQYA 2Z23A 2UVJA 4NF6B 5HBCA 2NOOA 2VOZA 3IO6A 3O6GA 2QRYA 5AA2A 3JYRA 4X48A 4KHZE 4KD5A 4G4PA 3E3KA 2RC9A 1N7WA 3DLNA 3PMXA 1O7TA 4X1DA 1Z7NE 4F2OA 3UIFA 5F7VA 1US4A 4JSDA 5H8FB 3OD7A 4IGTA 4F3SA 1POY1 4YKIA 1XC1A 1FW0A 3EQ1A 4AB5A 5BWJA 4C1TA 4R9FA 4IO7A 3TQWA 1LB9A 3VDFA 1IIWA 1NNPA 2F97A 3OO9A 1I6AA 5I2KB 4DCXA 4ELRA 1IZ1A 2FYIA 3DELB 1SI1A 4XTCQ 4G8NA 1GGGA 2O7IA 3HV1A 4RPNA 1HSEA 4Z0IA
chains in the Genus database with same CATH superfamily
4N8YA 3U65A 4OXVA 2R9JA 4Q30B 4YB5A 3EF7A 1R1NA 5T3JA 5FTIA 1UTHB 5TP9B 5JK4A 1S50A 2P2AA 4XKQA 1IQ7A 2IA4A 1NFTA 1FPLA 2V4CA 1POTA 1FBEA 2QMXA 5H8QA 5DT6A 2ESNA 3G3IA 4KYEA 1K9ZA 3OELA 3ZKLA 4OESA 4O7MA 5L9SA 1AMFA 4DXUA 3IK6B 1NV7A 5AA3A 2H4IA 2XXIA 5H8HB 4ZDMA 1SW2A 1B3EA 5ELVA 4QFNA 4N6KA 4PDHA 1JW5A 1CB6A 3G3GA 2UVGA 4HCWA 3IOTA 1SYIA 4POWA 3T66A 4ELPA 1FRPA 2DWIA 2OWZA 3B6QA 3BKIB 2ZZWA 3OENA 2KR0A 5F24A 3SKPA 2ALUA 5DTBA 1EZ9A 4EQBA 3B7DA 5LOMA 4P0GA 2VD3A 4U22A 4C1UA 3PUZE 4NF6A 1US5A 2NXOA 4UA8A 4ZEBA 5EQ7A 4FIMA 2IEEA 3C4MA 5ESYA 1P1NA 2WYKA 2X7QA 1B05A 1MXWA 2WKYA 5H8NB 3IOWA 1Q9DA 1B3FA 3SEYA 1JP4A 3HPIA 1FJ9A 3PU5A 4KFQA 4IB2A 2QJEA 3CR9A 3HSTA 4IGRA 4U2RA 3FVKA 2B3FA 5H8FA 2ZYNA 4XKNA 4U1ZA 2XXQA 1N04A 4PAIA 1B9JA 3IOVA 4X9TA 3TZAA 2ZNUA 1FSAA 3UA8A 1K9YA 1HSJA 2PBWA 4GWWA 4OYVA 3HFUA 1JW1A 3LC8A 4LQ2A 2I6EA 3CRBA 4ONYA 2A5TB 3MJNA 1DCUA 4I9DA 4GX3A 4RNSA 4GIZA 1QJMA 3TODA 5FHNA 3U8QA 3CHGA 2GHBA 1EYIA 3KSXA 1B4HA 4RJZA 3H7MA 4AS5A 3O66A 1D9VA 5IGAA 1QVSA 1Q1KA 3RQTA 4PDDA 4PFUA 1G0IA 3MYUA 2XXVA 1UIUA 3B8BA 1UTHA 4GQOA 3MC2A 1FBCA 2OBGA 4DE8A 3A29A 3FJGA 5IM2A 2F78A 3QXMA 4F3PA 3VVFA 3QIMA 1N84A 2Q8JA 2Z8FA 5EHMA 3THIA 5EQ8A 2Y7RA 1LBYA 2Q74A 4PF6A 1BIYA 4HE2A 2XXXA 1SBPA 1OVTA 5H8HA 1MH4A 5K2YA 2AIXA 5A5XB 1H76A 4NTLA 5ICTA 4LUBA 1FTOA 3ROJA 1XHYA 1YYZA 3QK6A 4TLMB 1G0HA 1FBDA 1R6ZA 1PB9A 1Y9UA 2XX8A 4DCYA 5AA2D 1DPEA 2B65A 2DVCA 1P1OA 5I58B 4DIGA 4QFLA 3GBAA 3N94A 2RCAA 1D9YA 1IMBA 3M3LA 4XEQA 3KJ7A 3KEIA 4N6PA 4G61A 1NI9A 5H8NA 5HM4B 1Y3QA 5B7DA 2ONKE 4Q0CA 4G8HA 4GBVA 5I7IA 4IO2A 2PMSA 4YMAA 2V93A 1FPBA 4F19A 5ISUA 4MNIA 4XKPA 2F7CA 2Z22A 3FXBA 4LA9A 2F6GA 1NNTA 4LQ5A 1B51A 4ELQA 3KBRA 4PC9A 4F1VA 3D1RA 4HCYA 1IXCA 5IKBA 2X7PA 1B40A 4ESXA 3FJMA 5H8SA 3E9XA 2XXHA 1SW4A 4N8GA 1ZTYA 1I6BA 1VDWA 4THIA 2OX3A 1IMEA 1N3WA 3O9PA 1JVYA 4RK9A 5I57B 3PUWE 2F3DA 1D9QA 4X8RA 4N15A 4R6HA 3T96B 1LAXA 4YB6A 3KSJA 2UVHA 4OANA 3V8XB 2RCBA 3R7XA 2Y7WA 3TQLA 2XX9A 3C32A 2DP8A 3O97A 3RNNA 3FATA 1YTVA 3AXFA 4BDLA 1A8EA 4DI4B 4QSCA 1FQDA 3K01A 1Y1MA 2NWJA 1PBPA 4NAPA 2A5SA 4PFIA 4KR5A 4NHBA 1N76A 3VV5A 1LSTA 1D4NA 1B1XA 3H6TA 3K1MA 4P3LA 3RPWA 2QS1A 3QUJA 4BLAA 3IR1A 2HPGA 2PFYA 3M3FA 3MP8A 3KN3A 3VLUA 5B70A 4NWDA 4K3FA 5FTHA 1IMAA 4MJOA 4LATA 2QFLA 4GBWA 3E78A 3CFZA 1LAHE 3IB0A 3USDA 1Y4CA 2CEXA 5A5XA 1FJ6A 3KOSA 5JEIA 1ZIUA 4MAGA 3G7WA 2ZYKA 3IX1A 3PUVE 2D3IA 2R6GE 3PGFA 1MXVA 3FXQA 3VXBA 5FBPA 2B3BA 4AQ4A 1IITA 1B3HA 1NUYA 3FVGA 3BIGA 4WEDA 4Z7EA 1FQEA 4FECA 1LCTA 5I58A 4H1XA 1PB8A 4X1BA 1QUJA 4NF5B 4YMBA 4XKRA 4PAFA 3FV1A 1GR2A 1SD3A 4G68B 1NV6A 3K1PA 4PFYA 4WKMA 3EKIA 1PC3A 4OVQA 3H6VA 3ILUB 3MWBA 3JV9A 1SW5A 1MXYA 5ET7A 5FHMA 3SEVA 1ZBMA 4MCOA 3U94A 3FVNA 3FZVA 1MQIA 3P7IA 2QVRA 4YAHX 1VSOA 1NNFA 3TMGA 1ZU0A 1OQHA 3A3CA 1LAGE 2O1LA 3ISPA 4PFWA 3ZS6A 4I3EA 2KLFA 5I2NB 1P1UA 4QHQA 1LBVA 2GFEA 3QAXA 1NL5A 1A99A 3FXRA 5BUUA 4H6DA 5I57A 1XI6A 2RF1A 4R6KA 4I40A 3FD3A 1GTKA 4R73A 4N07A 3RYDA 3K6VA 3I5OA 3MVXA 2OLBA 1LFIA 4F1UA 1IUDA 2ZNSA 1RYXA 2Q8MA 4LZ7A 2OCUA 4MNCA 1WODA 1Z7ME 2FVZA 2DYXA 4N13A 1TXFA 2M8CA 4JWOA 1IXGA 5IZZA 2Y84A 4YB7A 4PBQA 3EHUA 2F6PA 2P3NA 1OLAA 1NV1A 4R2FA 1AWBA 3EN3A 2VPOA 1SVXB 4QFOA 4H8JA 5TPAB 5CRYA 1A7LA 1SDXA 1QGXA 4OFJA 3KG2A 4PGNA 2XXYA 4FJPA 2WYPA 4NN3A 1MY4A 3K2DA 4PQJA 4R2BA 1MQJA 1MPBA 1FQFA 1PBQA 4N17A 3O28A 2XXPA 3PPRA 3L6HA 5EHSA 2Z8DA 5CM6A 1XS5A 4ZEIA 5DYHA 1LBZA 3TTKA 3VXCA 2X26A 3OSRA 3LSWA 4U4SA 4RXLA 2I3VA 4NF5A 4U21A 4PBHA 3RPLB 1VE4A 3LR1A 5DVJA 1MY1A 4G68A 2QS3A 5JTYB 2VHAA 2QPQA 3C35A 1MXZA 1N3XA 4ZECA 3MP1A 2DXYA 3V89B 3BFTA 4FAJA 3LSXA 4M1VA 3PD9A 4GFRA 4UACA 2BJJX 1FBFA 4NQ8A 4DXCA 4TQUQ 3OEMA 4N81A 4PE3A 4GWSA 2H25A 4XFEA 2CMOA 4ZEFA 5EYGA 3U1OA 3MAMA 4FEBA 3QUFA 1IEJA 5FHOA 2ZZVA 1DMBA 4EDPA 1B46A 4QFKA 3TYHA 2QMWA 4PFTA 2Y7IA 1FQAA 4JWYA 1YAEA 2OWTA 1B3LA 3O2AA 2I4BA 4XIGQ 3MW0A 4R74A 4N6DA 1A55A 4NF4B 2FIXA 3SEXA 3CFLA 2GQ1A 2ZNTA 3N6TA 4HXVA 3MZBA 2D5WA 3MBPA 4PP0A 4WXJA 2XXWA 1B7UA 2BJIA 2HAVA 2ONSA 3KN7A 2RINA 3G3HA 2F5XA 2MKZA 5TPAA 4OQOA 1Y3PA 1OVBA 3RT6B 4LVQA 5LDZA 3G3FA 3B6WA 4GL8A 1LBBA 1Q35A 4P0IA 2O84X 1UQWA 4H67A 4C0RA 1LB8A 1MQDA 5CC2A 5I2KA 2F7BA 1FPKA 1FTMA 5CBRA 1II5A 5IZ1A 3UN6A 3OMBA 2QS2A 4HE0A 5ET6A 3CG3A 4KCDA 2LAOA 3SEWA 2DS9A 1O63A 2PFZA 4OFOA 4MBPA 3G3JA 4Q5TA 2I0CA 3RPLA 4PAKA 3PUXE 3RGYA 1VR5A 1FBPA 1IMDA 2Y5LA 4RY1A 5TP9A 5JTYA 1TFAA 4IO3A 1OQGA 3TDJA 4P1LA 2XA5A 3S9MC 4N4UA 5HPQA 1YZ0A 3FIRA 1MRPA 4GF8A 4YICA 4ZZEA 2DQVA 4LN5A 3SDFA 4NWCA 2G29A 2L5VA 2I0BA 4GVOA 4QBAA 3UK4A 4MHFA 3M8UA 4Q8RA 3EHSA 3GXAA 4PGPA 2UXAA 1QUKA 4I1DA 4MX6A 5DVFA 1NV2A 3JZJA 1DOTA 4RPOA 3D4GA 4YZZA 3OXNA 3RTWB 1EZOA 3PTYA 5M2VA 3K4UA 4H5GA 1TWYA 4R72A 4GOTA 4MMPA 1S9TA 2DOJA 3TTMA 5AA1A 2WEFA 5AA4B 4KYSA 1FQCA 3I6VA 4P56A 1KA1A 4H46A 4ESWA 5ET8A 3E79A 4H5FA 1OLCA 1SI0A 3SESA 1P99A 4JSOA 3GLBA 3CVGA 4JBZA 4NF4A 4P8BA 4O3BA 1LFHA 3KOTA 3Q29A 5I56B 4IY5A 3IOUA 3FV2A 5ITOA 5EQAA 2DWHA 4OVTA 4OERA 3IO4A 3FJ7A 4F22A 3DP4A 2NVUB 4BDQA 1LGBC 3Q25A 1RDZA 4GWOA 2GH9A 4LZ8A 3PPNA 2FA7A 2I4CA 5EYHA 4KQPA 2V3TA 1TT1A 1LEVA 1MPDA 3RT8A 5ITPA 2A5TA 4XXUA 4O94A 3RN8A 1BTJA 4F31B 3E13X 3U93A 1MY2A 5LTCA 3DP8A 1H3DA 2WX9A 2REJA 1N0TA 4PFBA 1MY0A 2XHDA 2FNCA 4U4XA 5AA2B 1B3GA 1MH3A 1MY3A 3K6WA 1B52A 3T22A 2G93A 3K0VA 1YCJA 2PT1A 2Z8EA 1UTBB 3SZPA 3OSQA 2Q89A 1NUZA 4ZEKA 4XF5A 3H3GA 1ZLQA 3C36A 1IXIA 2PVUA 1IMFA 1GVCA 3K02A 2P0SA 4O3AA 3TCGA 2Q88A 4I62A 3VE1B 3CFXA 3N6UA 2XWVA 3TTLA 1A8FA 1NH8A 3MZ9A 1NV5A 1YPNA 4AB6A 4HS7A 1ZJLA 4NF0A 4R9GA 1B1HA 2XD2A 1DTGA 4QSEA 5CI5A 2F36A 3PPPA 1MM7A 4JVIA 1N7XA 2OK2A 4JWXA 1XT8A 5KDTB 2V25A 1M5BA 3MPLA 1LBCA 4P1EA 2Q2CA 3IJOB 3IL1B 3ONMA 2ZYOA 3HO7A 3MZ1A 3QYTA 3FASA 1NUWA 1EU8A 1B0LA 3MQ9A 1JETA 3W9VA 5I56A 1ZMGA 2DWJA 3RY3A 2F34A 4H0WA 1NKXA 1URGA 5L8DA 1ANFA 1LLSA 4MLQA 4UABA 3PD8A 5AE4A 4EF2A 1B5JA 2I58A 3CG1A 3W15C 2D21A 5CMCA 3OO6A 1AIVA 4EQ7A 1H44A 1VFEA 4OVRA 2AYSA 1KWHA 1VFDA 2ZXTA 1EH3A 3FVOA 2V3QA 2QVUA 1BLFA 2RC7A 2RC8A 3B6TA 4PFRA 4X04A 2Y7PA 4RYAA 2FIEA 1KA0A 3TCFA 1ATGA 2HZLA 4GWXA 3H03A 4OVJA 4GLIA 2REGA 3LUZA 1M5CA 4U1OA 4MIJA 3PMWA 4ND9A 3C33A 3OO8A 2PX1A 3L6GA 3MVZA 1YXIA 1QUIA 1FPDA 1R9QA 3TFLA 3TEPA 4ELOA 1NUXA 4OA4A 4BDNA 3MUQA 3TAJA 1UTBA 1Y20A 2XXTA 4H45A 4DXBA 4GD5A 3Q26A 2H5YA 3ECRA 3QSLA 4MNPA 4ZE8A 4KPTA 3KBZA 2VGQA 1MXUA 3V5AA 4NMYA 2ONRA 4G68C 3H6WA 2H9BA 1H45A 2YPNA 4E0WA 4M4GA 2XWIA 2HEUA 1JVXA 4G8MA 2W7YA 1RYOA 1FPGA 3PUYE 1FBGA 4RA1A 2HQ0A 2DE2A 3K6XA 1NNKA 1Y1ZA 1B5HA 2VD2A 1M5EA 4KXPA 1RDXA 2Q2AA 5CMKA 4OHNA 1FPEA 5I84A 4IO4A 1A40A 1DBZA 3U72A 2O51A 5IAIA 2XWOA 2F7AA 3IB2A 3S2VA 2O1MA 3K00A 2XXRA 1M5DA 4H8IA 3Q28A 5KDTA 3KFMA 2GHAA 1FTLA 1LBXA 1FBHA 1EYJA 4O3CA 3UORA 4QXDA 1BK4A 3D4CA 4GWZA 4F29A 4DI3D 4F18A 3LV0A 4FORA 1H43A 2ZMBA 4F1YA 5KCJB 3N5LA 1DTZA 4HW8A 1DK4A 3VFJA 3IFCA 1QW0A 3K6UA 4GL0A 2H98A 2CEYA 5I2NA 3TPAA 3BFUA 2F35A 1EYKA 4OWDA 2Q9TA 3WAEA 3O29A 2O7UA 2FHYA 4WEPA 3S9EA 1ELJA 2QSXA 4O8MA 1XOCA 5K2XA 3H4ZA 1TFDA 1T0KA 4ZS9A 3H6UA 4ZEDA 4YU0A 1AH5A 1I6QA 1QULA 4KCCA 1FCKA 1B2HA 3TTNA 1PDAA 4LZ5A 4NGUA 1IXHA 2XWKA 1B32A 4LP2B 3HHFA 4HE1A 1D3KA 2HFBA 2VT5A 3C34A 4IY6A 1FPJA 3R26A 3KC0A 3V83A 5DVIA 5I3SA 3UP9A 1CE2A 3VLVA 3KZGA 3ZSFA 2PYYA 3TELA 2E1SA 4BDMA 4TOZA 4NE4A 3VVEA 3DM0A 4P47A 1QKBA 4P9KA 3T9HB 4IO5A 2HXWA 3CIJA 4IR8A 2ZYMA 2UVIA 4EUOA 4IO6A 3A09A 2OWSA 3IORA 4YKPA 1URSA 3PV0E 1FTKA 1WDNA 2PCRA 3UGWA 1J1NA 2CZIA 3IB1A 4ZE9A 4P11A 3FUZA 2YLNA 5L9OA 2HHMA 1B7HA 3T0JA 5A5LA 4H65A 1JEUA 4E0XA 2UYFA 2R71A 4PETA 2XXKA 1MG1A 3Q27A 1P1QA 4JXIA 2O6AA 2ABHA 4O7IA 4F3BA 1M5FA 5F1QA 4PE5B 1AOVA 3O6HA 2XX7A 3GZGA 4MH5A 1MXXA 3IJXB 1MM6A 4OFLA 4ZZAA 1MDP1 1MS7A 2HAUA 1JW4A 1QKAA 3K1NA 4OEVA 1FTAA 5KCJA 3GYYA 3G3KA 4G77A 1B58A 1LAFE 3BBRA 4EF1A 1XVXA 3RUMA 3MVWA 4LONB 4PCDA 3EHTA 5CBSA 3OOAA 5I59B 2GRVA 1KZ8A 2QL3A 3TUSA 2V3UA 1A54A 2WBDA 1NV0A 4EXKA 1MDQA 4EQ9A 4FATA 1B0HA 3E4RA 1AL3A 4F2QA 2P1SA 3MVYA 1R9LA 1ZKBA 5DEXB 3ODBA 3M3KA 2CZKA 2UYEA 3DP6A 4PTKA 3KJTA 2I49A 2O68A 2Y5KA 4QSDA 2CZLA 1IMCA 2VPNA 3T9VA 2VP1A 5KZTA 1JQFA 1CNQA 2OJTA 5ICQA 4I8CA 5J16A 1FQBA 1FPFA 1FPIA 1LCFA 4GXAA 4GWYA 4N91A 2DXRA 5CMBA 4DZ1A 2RKMA 2ZZXA 3TCHA 2XD3A 3OO7A 3VLWA 1B6HA 4OEUA 1USYE 1DPPA 4TLLB 1PEBA 3TTRA 2Y7KA 3TKDA 3MPKA 3MSTA 1RDYA 4FBPA 3EPEA 1I69A 1S7YA 2THIA 2DE4A 1L5TA 3SERA 2OZZA 1WVJA 3N26A 5ET5A 3QMFA 4U23A 3SEUA 2NUVA 4QF9A 1URDA 1B7ZA 4NF8B 3CSGA 2KQZA 2DWAA 2XXUA 3LUYA 3R6UA 2HCAA 2DSFA 1OMPA 2AL5A 2H99A 3RTFB 3S9NC 1JEVA 1MQGA 1SW1A 5IZ3B 2ANJA 3C31A 3FXUA 2V84A 4GX4A 1BKAA 4JVDA 2QVVA 5CMMA 3C9HA 3F11A 2F3BA 4L17A 4OMBA 3PMVA 1Y4TA 3KN8A 5EYFA 2E0SA 2P3VA 4POXA 2DVZA 2PT2A 2O69A 1LFGA 4PF8A 3H06B 4OTEA 4BDRA 3T93B 4G2ZA 3WAFA 4GWUA 4F39A 2AL4A 4MEVA 3GBBA 3KGCA 4YKJA 4RK2A 4JB7A 1USYH 3VVDA 2I48A 3T9XB 3ILTB 4FE8A 3LSLA 3HN0A 1B4ZA 3SETA 4GRKA 3HCQA 3I3VA 2HXRA 4GXSB 5I59A 4OETA 4MFIA 2QS4A 4KI0E 3BIHA 1NV3A 2JJKA 1OIBA 3S4UA 1O64A 1F9BA 3U92A 3CSBA 4ECFA 4KYDA 4R6YA 1NV4A 1Y3NA 1B5IA 3O6IA 5AA4A 4MLVA 5DEXA 4QFPA 1FTJA 1MPCA 1GV8A 3A3UA 4F3GA 1P1WA 1NMUA 1UIVA 4DLDA 4YKKA 3HHGA 1PB7A 2HZKA 2YJPA 3T9UA 4NEDA 2I3WA 1SYHA 3MP6A 3PPQA 4HTGA 3FBPA 4JDFA 3T1BA 5J1DA 3LBSA 1XVYA 3ZKKA 3RLFE 2F8DA 2CZHA 1EZPA 5H8QB 1DSNA 3IAZA 1NH7A 3CI8A 5TU0A 2DE3A 2B4LA 3FGSA 4FEDA 2WBBA 4BDOA 4OENA 1INPA 4NG7A 3IFAA 4OZ9A 4JVCA 1HSLA 4QRZA 3S9LC 1RKMA 5L9MA 2DDKA 3W9WA 4R75A 1JNFA 5EQ9A 4OVPA 3B50A 4EXLA 4NF8A 4GX6A 4ISUA 4DDDA 3PPOA 1MQHA 3OEKA 4AS4A 3LSFB 4I3YA 4MF3A 1BP5A 1SQYA 2Z23A 2UVJA 4NF6B 5HBCA 2NOOA 5IZ3A 2VOZA 3IO6A 3KC1A 3O6GA 2QRYA 5AA2A 3JYRA 4NX1A 4X48A 4KHZE 4KD5A 4G4PA 2R8TA 3E3KA 2RC9A 1N7WA 3DLNA 3PMXA 1O7TA 4X1DA 2FBPA 1Z7NE 4F2OA 1US4A 5F7VA 3UIFA 4JSDA 5H8FB 5I5PA 3OD7A 4IGTA 4F3SA 1POY1 4YKIA 1XC1A 4OVSA 1FW0A 1LBWA 3NOHA 3EQ1A 4AB5A 5BWJA 4C1TA 4R9FA 5DW8A 4IO7A 1SPIA 3TQWA 1LB9A 3VDFA 1IIWA 1NNPA 2F97A 3OO9A 2B4MA 1I6AA 5I2KB 4DCXA 4ELRA 1IZ1A 2FYIA 3DELB 1SI1A 4XTCQ 4G8NA 1GGGA 2O7IA 3HV1A 4RPNA 1HSEA 4Z0IA
chains in the Genus database with same CATH topology
4OXVA 2R9JA 4Q30B 4YB5A 3EF7A 1R1NA 5FTIA 1UTHB 5TP9B 5JK4A 1S50A 2P2AA 4XKQA 1IQ7A 2IA4A 1NFTA 1POTA 2QMXA 5H8QA 5DT6A 2ESNA 3G3IA 4KYEA 3OELA 3ZKLA 4OESA 5L9SA 1AMFA 4DXUA 3IK6B 5AA3A 2H4IA 2XXIA 5H8HB 4ZDMA 1SW2A 1B3EA 5ELVA 4QFNA 1JW5A 1CB6A 3G3GA 2UVGA 4HCWA 3IOTA 1SYIA 4POWA 3T66A 4ELPA 2DWIA 3B6QA 3BKIB 3OENA 3SKPA 2ALUA 5DTBA 1EZ9A 4EQBA 3B7DA 5LOMA 4P0GA 2VD3A 4U22A 4C1UA 3PUZE 4NF6A 1US5A 2NXOA 4UA8A 4ZEBA 4FIMA 2IEEA 3C4MA 1P1NA 2X7QA 1B05A 1MXWA 2WKYA 5H8NB 3IOWA 1B3FA 3SEYA 3HPIA 3PU5A 4KFQA 4IB2A 2QJEA 3CR9A 3HSTA 4IGRA 4U2RA 3FVKA 2B3FA 5H8FA 2ZYNA 4XKNA 4U1ZA 2XXQA 1N04A 1B9JA 3IOVA 4X9TA 3TZAA 2ZNUA 3UA8A 1HSJA 2PBWA 4OYVA 1JW1A 3LC8A 4LQ2A 2I6EA 3CRBA 4ONYA 2A5TB 3MJNA 4I9DA 4RNSA 4GIZA 1QJMA 3TODA 5FHNA 3U8QA 2GHBA 3KSXA 1B4HA 4RJZA 3H7MA 3O66A 1D9VA 1QVSA 1Q1KA 3RQTA 4PFUA 2XXVA 1UIUA 1UTHA 4GQOA 3MC2A 2OBGA 4DE8A 3FJGA 2F78A 3QXMA 4F3PA 3VVFA 3QIMA 1N84A 2Q8JA 2Z8FA 5EHMA 3THIA 2Y7RA 1BIYA 2XXXA 1SBPA 1OVTA 5H8HA 1MH4A 5K2YA 2AIXA 5A5XB 1H76A 4NTLA 5ICTA 4LUBA 1FTOA 1XHYA 3QK6A 4TLMB 1R6ZA 1PB9A 1Y9UA 2XX8A 4DCYA 5AA2D 1DPEA 2B65A 2DVCA 1P1OA 5I58B 4DIGA 4QFLA 3GBAA 3N94A 2RCAA 1D9YA 3M3LA 3KJ7A 3KEIA 4N6PA 5H8NA 5HM4B 1Y3QA 5B7DA 2ONKE 4Q0CA 4G8HA 4IO2A 2PMSA 4YMAA 2V93A 4F19A 5ISUA 4XKPA 2F7CA 2Z22A 4LA9A 2F6GA 1NNTA 4LQ5A 1B51A 4ELQA 3KBRA 4F1VA 5IKBA 4HCYA 1IXCA 2X7PA 1B40A 4ESXA 3FJMA 5H8SA 3E9XA 2XXHA 1SW4A 1ZTYA 1I6BA 4THIA 1N3WA 3O9PA 1JVYA 4RK9A 5I57B 3PUWE 4R6HA 3T96B 1LAXA 4YB6A 3KSJA 2UVHA 3V8XB 2RCBA 3R7XA 2Y7WA 3TQLA 2XX9A 3C32A 2DP8A 3O97A 3RNNA 3FATA 1YTVA 3AXFA 4BDLA 1A8EA 4QSCA 1FQDA 3K01A 1Y1MA 2NWJA 1PBPA 2A5SA 4KR5A 1N76A 3VV5A 1LSTA 1D4NA 1B1XA 3H6TA 3K1MA 3RPWA 2QS1A 3QUJA 4BLAA 3IR1A 3M3FA 3MP8A 3KN3A 3VLUA 5B70A 4NWDA 4K3FA 5FTHA 4LATA 3CFZA 1LAHE 3IB0A 3USDA 1Y4CA 5A5XA 5JEIA 3KOSA 1ZIUA 3G7WA 2ZYKA 3IX1A 3PUVE 2D3IA 2R6GE 3PGFA 1MXVA 3FXQA 3VXBA 2B3BA 4AQ4A 1IITA 1B3HA 3FVGA 4WEDA 4Z7EA 1FQEA 4FECA 1LCTA 5I58A 4H1XA 1PB8A 4X1BA 1QUJA 4NF5B 4YMBA 4XKRA 3FV1A 1GR2A 1SD3A 4G68B 3K1PA 4PFYA 4WKMA 1PC3A 3H6VA 3ILUB 3MWBA 3JV9A 1SW5A 1MXYA 5FHMA 3SEVA 1ZBMA 3U94A 3FVNA 3FZVA 1MQIA 3P7IA 4YAHX 1VSOA 1NNFA 3TMGA 1ZU0A 1OQHA 3A3CA 1LAGE 2O1LA 4PFWA 3ZS6A 2KLFA 5I2NB 1P1UA 4QHQA 2GFEA 3QAXA 1NL5A 1A99A 3FXRA 5BUUA 4H6DA 5I57A 2RF1A 4R6KA 3FD3A 1GTKA 4R73A 4N07A 3K6VA 3I5OA 3MVXA 2OLBA 1LFIA 4F1UA 1IUDA 2ZNSA 1RYXA 4LZ7A 2OCUA 1WODA 1Z7ME 2DYXA 4N13A 1TXFA 2M8CA 4JWOA 1IXGA 2Y84A 4YB7A 3EHUA 2F6PA 1OLAA 4R2FA 3EN3A 1SVXB 4QFOA 4H8JA 5TPAB 5CRYA 1A7LA 1SDXA 4OFJA 3KG2A 2XXYA 4FJPA 1MY4A 3K2DA 4PQJA 4R2BA 1MQJA 1MPBA 1FQFA 1PBQA 3O28A 2XXPA 3PPRA 3L6HA 5EHSA 2Z8DA 5CM6A 1XS5A 4ZEIA 5DYHA 3TTKA 3VXCA 2X26A 3OSRA 3LSWA 4U4SA 4RXLA 2I3VA 4NF5A 4U21A 1VE4A 3LR1A 5DVJA 1MY1A 4G68A 2QS3A 5JTYB 2VHAA 2QPQA 3C35A 1MXZA 1N3XA 4ZECA 3MP1A 2DXYA 3V89B 3BFTA 4FAJA 3LSXA 4M1VA 3PD9A 4GFRA 4UACA 2BJJX 4DXCA 4TQUQ 3OEMA 2H25A 2CMOA 4ZEFA 3U1OA 3MAMA 4FEBA 3QUFA 1IEJA 5FHOA 1DMBA 4EDPA 1B46A 4QFKA 3TYHA 2QMWA 4PFTA 2Y7IA 1FQAA 4JWYA 1YAEA 2OWTA 1B3LA 3O2AA 2I4BA 4XIGQ 3MW0A 4R74A 1A55A 4NF4B 3SEXA 3CFLA 2ZNTA 3N6TA 3MZBA 2D5WA 3MBPA 4PP0A 4WXJA 2XXWA 1B7UA 2HAVA 2ONSA 3KN7A 2RINA 3G3HA 2F5XA 5TPAA 4OQOA 1Y3PA 1OVBA 3RT6B 4LVQA 3G3FA 3B6WA 4GL8A 1LBBA 1Q35A 4P0IA 2O84X 1UQWA 4H67A 4C0RA 1LB8A 1MQDA 5CC2A 5I2KA 2F7BA 1FTMA 5CBRA 1II5A 3UN6A 3OMBA 2QS2A 3CG3A 4KCDA 2LAOA 3SEWA 2DS9A 1O63A 4OFOA 4MBPA 3G3JA 4Q5TA 2I0CA 3PUXE 3RGYA 1VR5A 4RY1A 5TP9A 5JTYA 1TFAA 4IO3A 1OQGA 3TDJA 3S9MC 5HPQA 3FIRA 1MRPA 4GF8A 4YICA 4ZZEA 2DQVA 3SDFA 4NWCA 2G29A 2I0BA 4GVOA 3UK4A 3M8UA 4Q8RA 3EHSA 3GXAA 2UXAA 1QUKA 4I1DA 5DVFA 3JZJA 1DOTA 4RPOA 3D4GA 4YZZA 3OXNA 3RTWB 1EZOA 5M2VA 3K4UA 4H5GA 1TWYA 4GOTA 4R72A 1S9TA 2DOJA 3TTMA 5AA1A 5AA4B 4KYSA 1FQCA 3I6VA 4ESWA 4H5FA 1OLCA 1SI0A 3SESA 1P99A 4JSOA 3GLBA 3CVGA 4JBZA 4NF4A 4O3BA 1LFHA 3KOTA 3Q29A 5I56B 4IY5A 3IOUA 3FV2A 5ITOA 2DWHA 4OERA 3IO4A 3FJ7A 4F22A 3DP4A 2NVUB 4BDQA 1LGBC 3Q25A 4GWOA 2GH9A 4LZ8A 3PPNA 2FA7A 2I4CA 4KQPA 2V3TA 1TT1A 1MPDA 3RT8A 5ITPA 2A5TA 4XXUA 3RN8A 1BTJA 4F31B 3E13X 3U93A 1MY2A 3DP8A 1H3DA 2REJA 1N0TA 1MY0A 2XHDA 2FNCA 4U4XA 5AA2B 1B3GA 1MH3A 1MY3A 3K6WA 1B52A 3T22A 2G93A 3K0VA 1YCJA 2PT1A 2Z8EA 1UTBB 3OSQA 2Q89A 4ZEKA 3H3GA 1ZLQA 3C36A 1IXIA 2PVUA 1GVCA 3K02A 2P0SA 4O3AA 3TCGA 2Q88A 4I62A 3VE1B 3CFXA 3N6UA 3TTLA 1A8FA 1NH8A 3MZ9A 1YPNA 4AB6A 4HS7A 1ZJLA 4R9GA 1B1HA 2XD2A 1DTGA 4QSEA 5CI5A 2F36A 3PPPA 1MM7A 1N7XA 2OK2A 4JWXA 1XT8A 5KDTB 2V25A 1M5BA 3MPLA 1LBCA 2Q2CA 3IJOB 3IL1B 3ONMA 2ZYOA 3HO7A 3MZ1A 3QYTA 3FASA 1EU8A 1B0LA 3MQ9A 1JETA 3W9VA 5I56A 1ZMGA 2DWJA 3RY3A 2F34A 4H0WA 1NKXA 1URGA 5L8DA 1ANFA 1LLSA 4MLQA 3PD8A 5AE4A 4EF2A 1B5JA 2I58A 3CG1A 3W15C 2D21A 5CMCA 3OO6A 1AIVA 4EQ7A 1H44A 1VFEA 2AYSA 1KWHA 1VFDA 2ZXTA 1EH3A 3FVOA 2V3QA 1BLFA 2RC7A 2RC8A 3B6TA 2Y7PA 4RYAA 3TCFA 1ATGA 2HZLA 3H03A 4OVJA 4GLIA 2REGA 1M5CA 4U1OA 3PMWA 4ND9A 3C33A 3OO8A 2PX1A 3L6GA 3MVZA 1QUIA 3TEPA 1R9QA 3TFLA 4ELOA 4BDNA 3MUQA 3TAJA 1UTBA 1Y20A 2XXTA 4DXBA 4GD5A 3Q26A 2H5YA 3ECRA 3QSLA 4ZE8A 4KPTA 2VGQA 1MXUA 3V5AA 4NMYA 2ONRA 4G68C 3H6WA 2H9BA 1H45A 2YPNA 4E0WA 4M4GA 2HEUA 1JVXA 4G8MA 2W7YA 1RYOA 3PUYE 4RA1A 2HQ0A 2DE2A 3K6XA 1NNKA 1Y1ZA 1B5HA 2VD2A 1M5EA 2Q2AA 5CMKA 4OHNA 5I84A 4IO4A 1A40A 3U72A 2O51A 5IAIA 2F7AA 3IB2A 3S2VA 2O1MA 3K00A 2XXRA 1M5DA 4H8IA 3Q28A 5KDTA 3KFMA 2GHAA 1FTLA 4O3CA 3UORA 3D4CA 4F29A 4F18A 4FORA 1H43A 2ZMBA 4F1YA 5KCJB 3N5LA 1DTZA 4HW8A 3VFJA 1QW0A 3K6UA 4GL0A 2H98A 5I2NA 3TPAA 3BFUA 2F35A 4OWDA 2Q9TA 3WAEA 3O29A 2O7UA 4WEPA 3S9EA 1ELJA 2QSXA 1XOCA 5K2XA 3H4ZA 1TFDA 1T0KA 4ZS9A 3H6UA 4ZEDA 4YU0A 1AH5A 1I6QA 1QULA 4KCCA 1FCKA 1B2HA 3TTNA 1PDAA 4LZ5A 1IXHA 1B32A 4LP2B 3HHFA 1D3KA 2HFBA 3C34A 4IY6A 3R26A 3V83A 5DVIA 3UP9A 1CE2A 3VLVA 3KZGA 3ZSFA 2PYYA 3TELA 2E1SA 4BDMA 4TOZA 4NE4A 3VVEA 3DM0A 3T9HB 1QKBA 4IO5A 2HXWA 3CIJA 2ZYMA 2UVIA 4EUOA 4IO6A 3A09A 2OWSA 3IORA 4YKPA 1URSA 3PV0E 1FTKA 1WDNA 3UGWA 1J1NA 3IB1A 4ZE9A 4P11A 3FUZA 2YLNA 5L9OA 1B7HA 4H65A 1JEUA 4E0XA 2UYFA 2R71A 4PETA 1MG1A 3Q27A 1P1QA 4JXIA 2O6AA 2ABHA 4F3BA 1M5FA 5F1QA 4PE5B 1AOVA 3O6HA 2XX7A 3GZGA 4MH5A 1MXXA 3IJXB 1MM6A 4OFLA 4ZZAA 1MDP1 1MS7A 2HAUA 1JW4A 1QKAA 3K1NA 4OEVA 5KCJA 3G3KA 4G77A 1B58A 1LAFE 3BBRA 4EF1A 1XVXA 3RUMA 3MVWA 4LONB 5CBSA 3EHTA 3OOAA 5I59B 2GRVA 2QL3A 3TUSA 2V3UA 1A54A 4EXKA 1MDQA 4EQ9A 4FATA 1B0HA 3E4RA 1AL3A 4F2QA 2P1SA 3MVYA 1R9LA 1ZKBA 5DEXB 3ODBA 3M3KA 2UYEA 3DP6A 3KJTA 2I49A 2O68A 4QSDA 2CZLA 3T9VA 2VP1A 5KZTA 1JQFA 2OJTA 5ICQA 4I8CA 1FQBA 1LCFA 4GXAA 2DXRA 5CMBA 4DZ1A 2RKMA 3TCHA 2XD3A 3OO7A 3VLWA 1B6HA 4OEUA 1USYE 1DPPA 4TLLB 1PEBA 3TTRA 2Y7KA 3TKDA 3MPKA 3EPEA 1I69A 1S7YA 2THIA 2DE4A 1L5TA 3SERA 2OZZA 1WVJA 3N26A 4U23A 3SEUA 2NUVA 4QF9A 1URDA 1B7ZA 4NF8B 3CSGA 2DWAA 2XXUA 3LUYA 3R6UA 2HCAA 2DSFA 1OMPA 2AL5A 2H99A 3RTFB 3S9NC 1JEVA 1MQGA 1SW1A 2ANJA 3C31A 3FXUA 2V84A 1BKAA 5CMMA 3C9HA 3F11A 4L17A 4OMBA 3PMVA 1Y4TA 3KN8A 5EYFA 2E0SA 4POXA 2DVZA 2PT2A 2O69A 1LFGA 3H06B 4OTEA 4BDRA 3T93B 4G2ZA 3WAFA 4F39A 2AL4A 3GBBA 3KGCA 4YKJA 4RK2A 4JB7A 1USYH 3VVDA 2I48A 3T9XB 3ILTB 4FE8A 3LSLA 3HN0A 1B4ZA 3SETA 4GRKA 3HCQA 3I3VA 4GXSB 5I59A 4OETA 4MFIA 2QS4A 4KI0E 1OIBA 3S4UA 1O64A 1F9BA 3U92A 3CSBA 4ECFA 4KYDA 4R6YA 1Y3NA 1B5IA 3O6IA 5AA4A 4MLVA 5DEXA 4QFPA 1FTJA 1MPCA 1GV8A 3A3UA 4F3GA 1P1WA 1NMUA 1UIVA 4DLDA 4YKKA 3HHGA 1PB7A 2HZKA 2YJPA 3T9UA 4NEDA 2I3WA 1SYHA 3MP6A 3PPQA 4HTGA 4JDFA 5J1DA 3LBSA 1XVYA 3ZKKA 3RLFE 2F8DA 1EZPA 5H8QB 1DSNA 3IAZA 1NH7A 3CI8A 5TU0A 2DE3A 3FGSA 4FEDA 4BDOA 4OENA 4OZ9A 1HSLA 4QRZA 3S9LC 1RKMA 5L9MA 3W9WA 4R75A 1JNFA 4EXLA 4NF8A 4ISUA 4DDDA 3PPOA 1MQHA 3OEKA 3LSFB 4MF3A 1BP5A 1SQYA 2Z23A 2UVJA 4NF6B 5HBCA 2NOOA 2VOZA 3IO6A 3O6GA 2QRYA 5AA2A 3JYRA 4X48A 4KHZE 4KD5A 4G4PA 3E3KA 2RC9A 1N7WA 3DLNA 3PMXA 1O7TA 4X1DA 1Z7NE 4F2OA 3UIFA 5F7VA 1US4A 4JSDA 5H8FB 3OD7A 4IGTA 4F3SA 1POY1 4YKIA 1XC1A 1FW0A 3EQ1A 4AB5A 5BWJA 4C1TA 4R9FA 4IO7A 3TQWA 1LB9A 3VDFA 1IIWA 1NNPA 2F97A 3OO9A 1I6AA 5I2KB 4DCXA 4ELRA 1IZ1A 2FYIA 3DELB 1SI1A 4XTCQ 4G8NA 1GGGA 2O7IA 3HV1A 4RPNA 1HSEA 4Z0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OXV A;  2R9J A;  4Q30 B;  4YB5 A;  3EF7 A;  1R1N A;  5FTI A;  1UTH B;  5TP9 B;  5JK4 A;  1S50 A;  2P2A A;  4XKQ A;  1IQ7 A;  2IA4 A;  1NFT A;  1POT A;  2QMX A;  5H8Q A;  5DT6 A;  2ESN A;  3G3I A;  4KYE A;  3OEL A;  3ZKL A;  4OES A;  5L9S A;  1AMF A;  4DXU A;  3IK6 B;  5AA3 A;  2H4I A;  2XXI A;  5H8H B;  4ZDM A;  1SW2 A;  1B3E A;  5ELV A;  4QFN A;  1JW5 A;  1CB6 A;  3G3G A;  2UVG A;  4HCW A;  3IOT A;  1SYI A;  4POW A;  3T66 A;  4ELP A;  2DWI A;  3B6Q A;  3BKI B;  3OEN A;  3SKP A;  2ALU A;  5DTB A;  1EZ9 A;  4EQB A;  3B7D A;  5LOM A;  4P0G A;  2VD3 A;  4U22 A;  4C1U A;  3PUZ E;  4NF6 A;  1US5 A;  2NXO A;  4UA8 A;  4ZEB A;  4FIM A;  2IEE A;  3C4M A;  1P1N A;  2X7Q A;  1B05 A;  1MXW A;  2WKY A;  5H8N B;  3IOW A;  1B3F A;  3SEY A;  3HPI A;  3PU5 A;  4KFQ A;  4IB2 A;  2QJE A;  3CR9 A;  3HST A;  4IGR A;  4U2R A;  3FVK A;  2B3F A;  5H8F A;  2ZYN A;  4XKN A;  4U1Z A;  2XXQ A;  1N04 A;  1B9J A;  3IOV A;  4X9T A;  3TZA A;  2ZNU A;  3UA8 A;  1HSJ A;  2PBW A;  4OYV A;  1JW1 A;  3LC8 A;  4LQ2 A;  2I6E A;  3CRB A;  4ONY A;  2A5T B;  3MJN A;  4I9D A;  4RNS A;  4GIZ A;  1QJM A;  3TOD A;  5FHN A;  3U8Q A;  2GHB A;  3KSX A;  1B4H A;  4RJZ A;  3H7M A;  3O66 A;  1D9V A;  1QVS A;  1Q1K A;  3RQT A;  4PFU A;  2XXV A;  1UIU A;  1UTH A;  4GQO A;  3MC2 A;  2OBG A;  4DE8 A;  3FJG A;  2F78 A;  3QXM A;  4F3P A;  3VVF A;  3QIM A;  1N84 A;  2Q8J A;  2Z8F A;  5EHM A;  3THI A;  2Y7R A;  1BIY A;  2XXX A;  1SBP A;  1OVT A;  5H8H A;  1MH4 A;  5K2Y A;  2AIX A;  5A5X B;  1H76 A;  4NTL A;  5ICT A;  4LUB A;  1FTO A;  1XHY A;  3QK6 A;  4TLM B;  1R6Z A;  1PB9 A;  1Y9U A;  2XX8 A;  4DCY A;  5AA2 D;  1DPE A;  2B65 A;  2DVC A;  1P1O A;  5I58 B;  4DIG A;  4QFL A;  3GBA A;  3N94 A;  2RCA A;  1D9Y A;  3M3L A;  3KJ7 A;  3KEI A;  4N6P A;  5H8N A;  5HM4 B;  1Y3Q A;  5B7D A;  2ONK E;  4Q0C A;  4G8H A;  4IO2 A;  2PMS A;  4YMA A;  2V93 A;  4F19 A;  5ISU A;  4XKP A;  2F7C A;  2Z22 A;  4LA9 A;  2F6G A;  1NNT A;  4LQ5 A;  1B51 A;  4ELQ A;  3KBR A;  4F1V A;  5IKB A;  4HCY A;  1IXC A;  2X7P A;  1B40 A;  4ESX A;  3FJM A;  5H8S A;  3E9X A;  2XXH A;  1SW4 A;  1ZTY A;  1I6B A;  4THI A;  1N3W A;  3O9P A;  1JVY A;  4RK9 A;  5I57 B;  3PUW E;  4R6H A;  3T96 B;  1LAX A;  4YB6 A;  3KSJ A;  2UVH A;  3V8X B;  2RCB A;  3R7X A;  2Y7W A;  3TQL A;  2XX9 A;  3C32 A;  2DP8 A;  3O97 A;  3RNN A;  3FAT A;  1YTV A;  3AXF A;  4BDL A;  1A8E A;  4QSC A;  1FQD A;  3K01 A;  1Y1M A;  2NWJ A;  1PBP A;  2A5S A;  4KR5 A;  1N76 A;  3VV5 A;  1LST A;  1D4N A;  1B1X A;  3H6T A;  3K1M A;  3RPW A;  2QS1 A;  3QUJ A;  4BLA A;  3IR1 A;  3M3F A;  3MP8 A;  3KN3 A;  3VLU A;  5B70 A;  4NWD A;  4K3F A;  5FTH A;  4LAT A;  3CFZ A;  1LAH E;  3IB0 A;  3USD A;  1Y4C A;  5A5X A;  5JEI A;  3KOS A;  1ZIU A;  3G7W A;  2ZYK A;  3IX1 A;  3PUV E;  2D3I A;  2R6G E;  3PGF A;  1MXV A;  3FXQ A;  3VXB A;  2B3B A;  4AQ4 A;  1IIT A;  1B3H A;  3FVG A;  4WED A;  4Z7E A;  1FQE A;  4FEC A;  1LCT A;  5I58 A;  4H1X A;  1PB8 A;  4X1B A;  1QUJ A;  4NF5 B;  4YMB A;  4XKR A;  3FV1 A;  1GR2 A;  1SD3 A;  4G68 B;  3K1P A;  4PFY A;  4WKM A;  1PC3 A;  3H6V A;  3ILU B;  3MWB A;  3JV9 A;  1SW5 A;  1MXY A;  5FHM A;  3SEV A;  1ZBM A;  3U94 A;  3FVN A;  3FZV A;  1MQI A;  3P7I A;  4YAH X;  1VSO A;  1NNF A;  3TMG A;  1ZU0 A;  1OQH A;  3A3C A;  1LAG E;  2O1L A;  4PFW A;  3ZS6 A;  2KLF A;  5I2N B;  1P1U A;  4QHQ A;  2GFE A;  3QAX A;  1NL5 A;  1A99 A;  3FXR A;  5BUU A;  4H6D A;  5I57 A;  2RF1 A;  4R6K A;  3FD3 A;  1GTK A;  4R73 A;  4N07 A;  3K6V A;  3I5O A;  3MVX A;  2OLB A;  1LFI A;  4F1U A;  1IUD A;  2ZNS A;  1RYX A;  4LZ7 A;  2OCU A;  1WOD A;  1Z7M E;  2DYX A;  4N13 A;  1TXF A;  2M8C A;  4JWO A;  1IXG A;  2Y84 A;  4YB7 A;  3EHU A;  2F6P A;  1OLA A;  4R2F A;  3EN3 A;  1SVX B;  4QFO A;  4H8J A;  5TPA B;  5CRY A;  1A7L A;  1SDX A;  4OFJ A;  3KG2 A;  2XXY A;  4FJP A;  1MY4 A;  3K2D A;  4PQJ A;  4R2B A;  1MQJ A;  1MPB A;  1FQF A;  1PBQ A;  3O28 A;  2XXP A;  3PPR A;  3L6H A;  5EHS A;  2Z8D A;  5CM6 A;  1XS5 A;  4ZEI A;  5DYH A;  3TTK A;  3VXC A;  2X26 A;  3OSR A;  3LSW A;  4U4S A;  4RXL A;  2I3V A;  4NF5 A;  4U21 A;  1VE4 A;  3LR1 A;  5DVJ A;  1MY1 A;  4G68 A;  2QS3 A;  5JTY B;  2VHA A;  2QPQ A;  3C35 A;  1MXZ A;  1N3X A;  4ZEC A;  3MP1 A;  2DXY A;  3V89 B;  3BFT A;  4FAJ A;  3LSX A;  4M1V A;  3PD9 A;  4GFR A;  4UAC A;  2BJJ X;  4DXC A;  4TQU Q;  3OEM A;  2H25 A;  2CMO A;  4ZEF A;  3U1O A;  3MAM A;  4FEB A;  3QUF A;  1IEJ A;  5FHO A;  1DMB A;  4EDP A;  1B46 A;  4QFK A;  3TYH A;  2QMW A;  4PFT A;  2Y7I A;  1FQA A;  4JWY A;  1YAE A;  2OWT A;  1B3L A;  3O2A A;  2I4B A;  4XIG Q;  3MW0 A;  4R74 A;  1A55 A;  4NF4 B;  3SEX A;  3CFL A;  2ZNT A;  3N6T A;  3MZB A;  2D5W A;  3MBP A;  4PP0 A;  4WXJ A;  2XXW A;  1B7U A;  2HAV A;  2ONS A;  3KN7 A;  2RIN A;  3G3H A;  2F5X A;  5TPA A;  4OQO A;  1Y3P A;  1OVB A;  3RT6 B;  4LVQ A;  3G3F A;  3B6W A;  4GL8 A;  1LBB A;  1Q35 A;  4P0I A;  2O84 X;  1UQW A;  4H67 A;  4C0R A;  1LB8 A;  1MQD A;  5CC2 A;  5I2K A;  2F7B A;  1FTM A;  5CBR A;  1II5 A;  3UN6 A;  3OMB A;  2QS2 A;  3CG3 A;  4KCD A;  2LAO A;  3SEW A;  2DS9 A;  1O63 A;  4OFO A;  4MBP A;  3G3J A;  4Q5T A;  2I0C A;  3PUX E;  3RGY A;  1VR5 A;  4RY1 A;  5TP9 A;  5JTY A;  1TFA A;  4IO3 A;  1OQG A;  3TDJ A;  3S9M C;  5HPQ A;  3FIR A;  1MRP A;  4GF8 A;  4YIC A;  4ZZE A;  2DQV A;  3SDF A;  4NWC A;  2G29 A;  2I0B A;  4GVO A;  3UK4 A;  3M8U A;  4Q8R A;  3EHS A;  3GXA A;  2UXA A;  1QUK A;  4I1D A;  5DVF A;  3JZJ A;  1DOT A;  4RPO A;  3D4G A;  4YZZ A;  3OXN A;  3RTW B;  1EZO A;  5M2V A;  3K4U A;  4H5G A;  1TWY A;  4GOT A;  4R72 A;  1S9T A;  2DOJ A;  3TTM A;  5AA1 A;  5AA4 B;  4KYS A;  1FQC A;  3I6V A;  4ESW A;  4H5F A;  1OLC A;  1SI0 A;  3SES A;  1P99 A;  4JSO A;  3GLB A;  3CVG A;  4JBZ A;  4NF4 A;  4O3B A;  1LFH A;  3KOT A;  3Q29 A;  5I56 B;  4IY5 A;  3IOU A;  3FV2 A;  5ITO A;  2DWH A;  4OER A;  3IO4 A;  3FJ7 A;  4F22 A;  3DP4 A;  2NVU B;  4BDQ A;  1LGB C;  3Q25 A;  4GWO A;  2GH9 A;  4LZ8 A;  3PPN A;  2FA7 A;  2I4C A;  4KQP A;  2V3T A;  1TT1 A;  1MPD A;  3RT8 A;  5ITP A;  2A5T A;  4XXU A;  3RN8 A;  1BTJ A;  4F31 B;  3E13 X;  3U93 A;  1MY2 A;  3DP8 A;  1H3D A;  2REJ A;  1N0T A;  1MY0 A;  2XHD A;  2FNC A;  4U4X A;  5AA2 B;  1B3G A;  1MH3 A;  1MY3 A;  3K6W A;  1B52 A;  3T22 A;  2G93 A;  3K0V A;  1YCJ A;  2PT1 A;  2Z8E A;  1UTB B;  3OSQ A;  2Q89 A;  4ZEK A;  3H3G A;  1ZLQ A;  3C36 A;  1IXI A;  2PVU A;  1GVC A;  3K02 A;  2P0S A;  4O3A A;  3TCG A;  2Q88 A;  4I62 A;  3VE1 B;  3CFX A;  3N6U A;  3TTL A;  1A8F A;  1NH8 A;  3MZ9 A;  1YPN A;  4AB6 A;  4HS7 A;  1ZJL A;  4R9G A;  1B1H A;  2XD2 A;  1DTG A;  4QSE A;  5CI5 A;  2F36 A;  3PPP A;  1MM7 A;  1N7X A;  2OK2 A;  4JWX A;  1XT8 A;  5KDT B;  2V25 A;  1M5B A;  3MPL A;  1LBC A;  2Q2C A;  3IJO B;  3IL1 B;  3ONM A;  2ZYO A;  3HO7 A;  3MZ1 A;  3QYT A;  3FAS A;  1EU8 A;  1B0L A;  3MQ9 A;  1JET A;  3W9V A;  5I56 A;  1ZMG A;  2DWJ A;  3RY3 A;  2F34 A;  4H0W A;  1NKX A;  1URG A;  5L8D A;  1ANF A;  1LLS A;  4MLQ A;  3PD8 A;  5AE4 A;  4EF2 A;  1B5J A;  2I58 A;  3CG1 A;  3W15 C;  2D21 A;  5CMC A;  3OO6 A;  1AIV A;  4EQ7 A;  1H44 A;  1VFE A;  2AYS A;  1KWH A;  1VFD A;  2ZXT A;  1EH3 A;  3FVO A;  2V3Q A;  1BLF A;  2RC7 A;  2RC8 A;  3B6T A;  2Y7P A;  4RYA A;  3TCF A;  1ATG A;  2HZL A;  3H03 A;  4OVJ A;  4GLI A;  2REG A;  1M5C A;  4U1O A;  3PMW A;  4ND9 A;  3C33 A;  3OO8 A;  2PX1 A;  3L6G A;  3MVZ A;  1QUI A;  3TEP A;  1R9Q A;  3TFL A;  4ELO A;  4BDN A;  3MUQ A;  3TAJ A;  1UTB A;  1Y20 A;  2XXT A;  4DXB A;  4GD5 A;  3Q26 A;  2H5Y A;  3ECR A;  3QSL A;  4ZE8 A;  4KPT A;  2VGQ A;  1MXU A;  3V5A A;  4NMY A;  2ONR A;  4G68 C;  3H6W A;  2H9B A;  1H45 A;  2YPN A;  4E0W A;  4M4G A;  2HEU A;  1JVX A;  4G8M A;  2W7Y A;  1RYO A;  3PUY E;  4RA1 A;  2HQ0 A;  2DE2 A;  3K6X A;  1NNK A;  1Y1Z A;  1B5H A;  2VD2 A;  1M5E A;  2Q2A A;  5CMK A;  4OHN A;  5I84 A;  4IO4 A;  1A40 A;  3U72 A;  2O51 A;  5IAI A;  2F7A A;  3IB2 A;  3S2V A;  2O1M A;  3K00 A;  2XXR A;  1M5D A;  4H8I A;  3Q28 A;  5KDT A;  3KFM A;  2GHA A;  1FTL A;  4O3C A;  3UOR A;  3D4C A;  4F29 A;  4F18 A;  4FOR A;  1H43 A;  2ZMB A;  4F1Y A;  5KCJ B;  3N5L A;  1DTZ A;  4HW8 A;  3VFJ A;  1QW0 A;  3K6U A;  4GL0 A;  2H98 A;  5I2N A;  3TPA A;  3BFU A;  2F35 A;  4OWD A;  2Q9T A;  3WAE A;  3O29 A;  2O7U A;  4WEP A;  3S9E A;  1ELJ A;  2QSX A;  1XOC A;  5K2X A;  3H4Z A;  1TFD A;  1T0K A;  4ZS9 A;  3H6U A;  4ZED A;  4YU0 A;  1AH5 A;  1I6Q A;  1QUL A;  4KCC A;  1FCK A;  1B2H A;  3TTN A;  1PDA A;  4LZ5 A;  1IXH A;  1B32 A;  4LP2 B;  3HHF A;  1D3K A;  2HFB A;  3C34 A;  4IY6 A;  3R26 A;  3V83 A;  5DVI A;  3UP9 A;  1CE2 A;  3VLV A;  3KZG A;  3ZSF A;  2PYY A;  3TEL A;  2E1S A;  4BDM A;  4TOZ A;  4NE4 A;  3VVE A;  3DM0 A;  3T9H B;  1QKB A;  4IO5 A;  2HXW A;  3CIJ A;  2ZYM A;  2UVI A;  4EUO A;  4IO6 A;  3A09 A;  2OWS A;  3IOR A;  4YKP A;  1URS A;  3PV0 E;  1FTK A;  1WDN A;  3UGW A;  1J1N A;  3IB1 A;  4ZE9 A;  4P11 A;  3FUZ A;  2YLN A;  5L9O A;  1B7H A;  4H65 A;  1JEU A;  4E0X A;  2UYF A;  2R71 A;  4PET A;  1MG1 A;  3Q27 A;  1P1Q A;  4JXI A;  2O6A A;  2ABH A;  4F3B A;  1M5F A;  5F1Q A;  4PE5 B;  1AOV A;  3O6H A;  2XX7 A;  3GZG A;  4MH5 A;  1MXX A;  3IJX B;  1MM6 A;  4OFL A;  4ZZA A;  1MDP 1;  1MS7 A;  2HAU A;  1JW4 A;  1QKA A;  3K1N A;  4OEV A;  5KCJ A;  3G3K A;  4G77 A;  1B58 A;  1LAF E;  3BBR A;  4EF1 A;  1XVX A;  3RUM A;  3MVW A;  4LON B;  5CBS A;  3EHT A;  3OOA A;  5I59 B;  2GRV A;  2QL3 A;  3TUS A;  2V3U A;  1A54 A;  4EXK A;  1MDQ A;  4EQ9 A;  4FAT A;  1B0H A;  3E4R A;  1AL3 A;  4F2Q A;  2P1S A;  3MVY A;  1R9L A;  1ZKB A;  5DEX B;  3ODB A;  3M3K A;  2UYE A;  3DP6 A;  3KJT A;  2I49 A;  2O68 A;  4QSD A;  2CZL A;  3T9V A;  2VP1 A;  5KZT A;  1JQF A;  2OJT A;  5ICQ A;  4I8C A;  1FQB A;  1LCF A;  4GXA A;  2DXR A;  5CMB A;  4DZ1 A;  2RKM A;  3TCH A;  2XD3 A;  3OO7 A;  3VLW A;  1B6H A;  4OEU A;  1USY E;  1DPP A;  4TLL B;  1PEB A;  3TTR A;  2Y7K A;  3TKD A;  3MPK A;  3EPE A;  1I69 A;  1S7Y A;  2THI A;  2DE4 A;  1L5T A;  3SER A;  2OZZ A;  1WVJ A;  3N26 A;  4U23 A;  3SEU A;  2NUV A;  4QF9 A;  1URD A;  1B7Z A;  4NF8 B;  3CSG A;  2DWA A;  2XXU A;  3LUY A;  3R6U A;  2HCA A;  2DSF A;  1OMP A;  2AL5 A;  2H99 A;  3RTF B;  3S9N C;  1JEV A;  1MQG A;  1SW1 A;  2ANJ A;  3C31 A;  3FXU A;  2V84 A;  1BKA A;  5CMM A;  3C9H A;  3F11 A;  4L17 A;  4OMB A;  3PMV A;  1Y4T A;  3KN8 A;  5EYF A;  2E0S A;  4POX A;  2DVZ A;  2PT2 A;  2O69 A;  1LFG A;  3H06 B;  4OTE A;  4BDR A;  3T93 B;  4G2Z A;  3WAF A;  4F39 A;  2AL4 A;  3GBB A;  3KGC A;  4YKJ A;  4RK2 A;  4JB7 A;  1USY H;  3VVD A;  2I48 A;  3T9X B;  3ILT B;  4FE8 A;  3LSL A;  3HN0 A;  1B4Z A;  3SET A;  4GRK A;  3HCQ A;  3I3V A;  4GXS B;  5I59 A;  4OET A;  4MFI A;  2QS4 A;  4KI0 E;  1OIB A;  3S4U A;  1O64 A;  1F9B A;  3U92 A;  3CSB A;  4ECF A;  4KYD A;  4R6Y A;  1Y3N A;  1B5I A;  3O6I A;  5AA4 A;  4MLV A;  5DEX A;  4QFP A;  1FTJ A;  1MPC A;  1GV8 A;  3A3U A;  4F3G A;  1P1W A;  1NMU A;  1UIV A;  4DLD A;  4YKK A;  3HHG A;  1PB7 A;  2HZK A;  2YJP A;  3T9U A;  4NED A;  2I3W A;  1SYH A;  3MP6 A;  3PPQ A;  4HTG A;  4JDF A;  5J1D A;  3LBS A;  1XVY A;  3ZKK A;  3RLF E;  2F8D A;  1EZP A;  5H8Q B;  1DSN A;  3IAZ A;  1NH7 A;  3CI8 A;  5TU0 A;  2DE3 A;  3FGS A;  4FED A;  4BDO A;  4OEN A;  4OZ9 A;  1HSL A;  4QRZ A;  3S9L C;  1RKM A;  5L9M A;  3W9W A;  4R75 A;  1JNF A;  4EXL A;  4NF8 A;  4ISU A;  4DDD A;  3PPO A;  1MQH A;  3OEK A;  3LSF B;  4MF3 A;  1BP5 A;  1SQY A;  2Z23 A;  2UVJ A;  4NF6 B;  5HBC A;  2NOO A;  2VOZ A;  3IO6 A;  3O6G A;  2QRY A;  5AA2 A;  3JYR A;  4X48 A;  4KHZ E;  4KD5 A;  4G4P A;  3E3K A;  2RC9 A;  1N7W A;  3DLN A;  3PMX A;  1O7T A;  4X1D A;  1Z7N E;  4F2O A;  3UIF A;  5F7V A;  1US4 A;  4JSD A;  5H8F B;  3OD7 A;  4IGT A;  4F3S A;  1POY 1;  4YKI A;  1XC1 A;  1FW0 A;  3EQ1 A;  4AB5 A;  5BWJ A;  4C1T A;  4R9F A;  4IO7 A;  3TQW A;  1LB9 A;  3VDF A;  1IIW A;  1NNP A;  2F97 A;  3OO9 A;  1I6A A;  5I2K B;  4DCX A;  4ELR A;  1IZ1 A;  2FYI A;  3DEL B;  1SI1 A;  4XTC Q;  4G8N A;  1GGG A;  2O7I A;  3HV1 A;  4RPN A;  1HSE A;  4Z0I A; 
#chains in the Genus database with same CATH topology
 4N8Y A;  3U65 A;  4OXV A;  2R9J A;  4Q30 B;  4YB5 A;  3EF7 A;  1R1N A;  5T3J A;  5FTI A;  1UTH B;  5TP9 B;  5JK4 A;  1S50 A;  2P2A A;  4XKQ A;  1IQ7 A;  2IA4 A;  1NFT A;  1FPL A;  2V4C A;  1POT A;  1FBE A;  2QMX A;  5H8Q A;  5DT6 A;  2ESN A;  3G3I A;  4KYE A;  1K9Z A;  3OEL A;  3ZKL A;  4OES A;  4O7M A;  5L9S A;  1AMF A;  4DXU A;  3IK6 B;  1NV7 A;  5AA3 A;  2H4I A;  2XXI A;  5H8H B;  4ZDM A;  1SW2 A;  1B3E A;  5ELV A;  4QFN A;  4N6K A;  4PDH A;  1JW5 A;  1CB6 A;  3G3G A;  2UVG A;  4HCW A;  3IOT A;  1SYI A;  4POW A;  3T66 A;  4ELP A;  1FRP A;  2DWI A;  2OWZ A;  3B6Q A;  3BKI B;  2ZZW A;  3OEN A;  2KR0 A;  5F24 A;  3SKP A;  2ALU A;  5DTB A;  1EZ9 A;  4EQB A;  3B7D A;  5LOM A;  4P0G A;  2VD3 A;  4U22 A;  4C1U A;  3PUZ E;  4NF6 A;  1US5 A;  2NXO A;  4UA8 A;  4ZEB A;  5EQ7 A;  4FIM A;  2IEE A;  3C4M A;  5ESY A;  1P1N A;  2WYK A;  2X7Q A;  1B05 A;  1MXW A;  2WKY A;  5H8N B;  3IOW A;  1Q9D A;  1B3F A;  3SEY A;  1JP4 A;  3HPI A;  1FJ9 A;  3PU5 A;  4KFQ A;  4IB2 A;  2QJE A;  3CR9 A;  3HST A;  4IGR A;  4U2R A;  3FVK A;  2B3F A;  5H8F A;  2ZYN A;  4XKN A;  4U1Z A;  2XXQ A;  1N04 A;  4PAI A;  1B9J A;  3IOV A;  4X9T A;  3TZA A;  2ZNU A;  1FSA A;  3UA8 A;  1K9Y A;  1HSJ A;  2PBW A;  4GWW A;  4OYV A;  3HFU A;  1JW1 A;  3LC8 A;  4LQ2 A;  2I6E A;  3CRB A;  4ONY A;  2A5T B;  3MJN A;  1DCU A;  4I9D A;  4GX3 A;  4RNS A;  4GIZ A;  1QJM A;  3TOD A;  5FHN A;  3U8Q A;  3CHG A;  2GHB A;  1EYI A;  3KSX A;  1B4H A;  4RJZ A;  3H7M A;  4AS5 A;  3O66 A;  1D9V A;  5IGA A;  1QVS A;  1Q1K A;  3RQT A;  4PDD A;  4PFU A;  1G0I A;  3MYU A;  2XXV A;  1UIU A;  3B8B A;  1UTH A;  4GQO A;  3MC2 A;  1FBC A;  2OBG A;  4DE8 A;  3A29 A;  3FJG A;  5IM2 A;  2F78 A;  3QXM A;  4F3P A;  3VVF A;  3QIM A;  1N84 A;  2Q8J A;  2Z8F A;  5EHM A;  3THI A;  5EQ8 A;  2Y7R A;  1LBY A;  2Q74 A;  4PF6 A;  1BIY A;  4HE2 A;  2XXX A;  1SBP A;  1OVT A;  5H8H A;  1MH4 A;  5K2Y A;  2AIX A;  5A5X B;  1H76 A;  4NTL A;  5ICT A;  4LUB A;  1FTO A;  3ROJ A;  1XHY A;  1YYZ A;  3QK6 A;  4TLM B;  1G0H A;  1FBD A;  1R6Z A;  1PB9 A;  1Y9U A;  2XX8 A;  4DCY A;  5AA2 D;  1DPE A;  2B65 A;  2DVC A;  1P1O A;  5I58 B;  4DIG A;  4QFL A;  3GBA A;  3N94 A;  2RCA A;  1D9Y A;  1IMB A;  3M3L A;  4XEQ A;  3KJ7 A;  3KEI A;  4N6P A;  4G61 A;  1NI9 A;  5H8N A;  5HM4 B;  1Y3Q A;  5B7D A;  2ONK E;  4Q0C A;  4G8H A;  4GBV A;  5I7I A;  4IO2 A;  2PMS A;  4YMA A;  2V93 A;  1FPB A;  4F19 A;  5ISU A;  4MNI A;  4XKP A;  2F7C A;  2Z22 A;  3FXB A;  4LA9 A;  2F6G A;  1NNT A;  4LQ5 A;  1B51 A;  4ELQ A;  3KBR A;  4PC9 A;  4F1V A;  3D1R A;  4HCY A;  1IXC A;  5IKB A;  2X7P A;  1B40 A;  4ESX A;  3FJM A;  5H8S A;  3E9X A;  2XXH A;  1SW4 A;  4N8G A;  1ZTY A;  1I6B A;  1VDW A;  4THI A;  2OX3 A;  1IME A;  1N3W A;  3O9P A;  1JVY A;  4RK9 A;  5I57 B;  3PUW E;  2F3D A;  1D9Q A;  4X8R A;  4N15 A;  4R6H A;  3T96 B;  1LAX A;  4YB6 A;  3KSJ A;  2UVH A;  4OAN A;  3V8X B;  2RCB A;  3R7X A;  2Y7W A;  3TQL A;  2XX9 A;  3C32 A;  2DP8 A;  3O97 A;  3RNN A;  3FAT A;  1YTV A;  3AXF A;  4BDL A;  1A8E A;  4DI4 B;  4QSC A;  1FQD A;  3K01 A;  1Y1M A;  2NWJ A;  1PBP A;  4NAP A;  2A5S A;  4PFI A;  4KR5 A;  4NHB A;  1N76 A;  3VV5 A;  1LST A;  1D4N A;  1B1X A;  3H6T A;  3K1M A;  4P3L A;  3RPW A;  2QS1 A;  3QUJ A;  4BLA A;  3IR1 A;  2HPG A;  2PFY A;  3M3F A;  3MP8 A;  3KN3 A;  3VLU A;  5B70 A;  4NWD A;  4K3F A;  5FTH A;  1IMA A;  4MJO A;  4LAT A;  2QFL A;  4GBW A;  3E78 A;  3CFZ A;  1LAH E;  3IB0 A;  3USD A;  1Y4C A;  2CEX A;  5A5X A;  1FJ6 A;  3KOS A;  5JEI A;  1ZIU A;  4MAG A;  3G7W A;  2ZYK A;  3IX1 A;  3PUV E;  2D3I A;  2R6G E;  3PGF A;  1MXV A;  3FXQ A;  3VXB A;  5FBP A;  2B3B A;  4AQ4 A;  1IIT A;  1B3H A;  1NUY A;  3FVG A;  3BIG A;  4WED A;  4Z7E A;  1FQE A;  4FEC A;  1LCT A;  5I58 A;  4H1X A;  1PB8 A;  4X1B A;  1QUJ A;  4NF5 B;  4YMB A;  4XKR A;  4PAF A;  3FV1 A;  1GR2 A;  1SD3 A;  4G68 B;  1NV6 A;  3K1P A;  4PFY A;  4WKM A;  3EKI A;  1PC3 A;  4OVQ A;  3H6V A;  3ILU B;  3MWB A;  3JV9 A;  1SW5 A;  1MXY A;  5ET7 A;  5FHM A;  3SEV A;  1ZBM A;  4MCO A;  3U94 A;  3FVN A;  3FZV A;  1MQI A;  3P7I A;  2QVR A;  4YAH X;  1VSO A;  1NNF A;  3TMG A;  1ZU0 A;  1OQH A;  3A3C A;  1LAG E;  2O1L A;  3ISP A;  4PFW A;  3ZS6 A;  4I3E A;  2KLF A;  5I2N B;  1P1U A;  4QHQ A;  1LBV A;  2GFE A;  3QAX A;  1NL5 A;  1A99 A;  3FXR A;  5BUU A;  4H6D A;  5I57 A;  1XI6 A;  2RF1 A;  4R6K A;  4I40 A;  3FD3 A;  1GTK A;  4R73 A;  4N07 A;  3RYD A;  3K6V A;  3I5O A;  3MVX A;  2OLB A;  1LFI A;  4F1U A;  1IUD A;  2ZNS A;  1RYX A;  2Q8M A;  4LZ7 A;  2OCU A;  4MNC A;  1WOD A;  1Z7M E;  2FVZ A;  2DYX A;  4N13 A;  1TXF A;  2M8C A;  4JWO A;  1IXG A;  5IZZ A;  2Y84 A;  4YB7 A;  4PBQ A;  3EHU A;  2F6P A;  2P3N A;  1OLA A;  1NV1 A;  4R2F A;  1AWB A;  3EN3 A;  2VPO A;  1SVX B;  4QFO A;  4H8J A;  5TPA B;  5CRY A;  1A7L A;  1SDX A;  1QGX A;  4OFJ A;  3KG2 A;  4PGN A;  2XXY A;  4FJP A;  2WYP A;  4NN3 A;  1MY4 A;  3K2D A;  4PQJ A;  4R2B A;  1MQJ A;  1MPB A;  1FQF A;  1PBQ A;  4N17 A;  3O28 A;  2XXP A;  3PPR A;  3L6H A;  5EHS A;  2Z8D A;  5CM6 A;  1XS5 A;  4ZEI A;  5DYH A;  1LBZ A;  3TTK A;  3VXC A;  2X26 A;  3OSR A;  3LSW A;  4U4S A;  4RXL A;  2I3V A;  4NF5 A;  4U21 A;  4PBH A;  3RPL B;  1VE4 A;  3LR1 A;  5DVJ A;  1MY1 A;  4G68 A;  2QS3 A;  5JTY B;  2VHA A;  2QPQ A;  3C35 A;  1MXZ A;  1N3X A;  4ZEC A;  3MP1 A;  2DXY A;  3V89 B;  3BFT A;  4FAJ A;  3LSX A;  4M1V A;  3PD9 A;  4GFR A;  4UAC A;  2BJJ X;  1FBF A;  4NQ8 A;  4DXC A;  4TQU Q;  3OEM A;  4N81 A;  4PE3 A;  4GWS A;  2H25 A;  4XFE A;  2CMO A;  4ZEF A;  5EYG A;  3U1O A;  3MAM A;  4FEB A;  3QUF A;  1IEJ A;  5FHO A;  2ZZV A;  1DMB A;  4EDP A;  1B46 A;  4QFK A;  3TYH A;  2QMW A;  4PFT A;  2Y7I A;  1FQA A;  4JWY A;  1YAE A;  2OWT A;  1B3L A;  3O2A A;  2I4B A;  4XIG Q;  3MW0 A;  4R74 A;  4N6D A;  1A55 A;  4NF4 B;  2FIX A;  3SEX A;  3CFL A;  2GQ1 A;  2ZNT A;  3N6T A;  4HXV A;  3MZB A;  2D5W A;  3MBP A;  4PP0 A;  4WXJ A;  2XXW A;  1B7U A;  2BJI A;  2HAV A;  2ONS A;  3KN7 A;  2RIN A;  3G3H A;  2F5X A;  2MKZ A;  5TPA A;  4OQO A;  1Y3P A;  1OVB A;  3RT6 B;  4LVQ A;  5LDZ A;  3G3F A;  3B6W A;  4GL8 A;  1LBB A;  1Q35 A;  4P0I A;  2O84 X;  1UQW A;  4H67 A;  4C0R A;  1LB8 A;  1MQD A;  5CC2 A;  5I2K A;  2F7B A;  1FPK A;  1FTM A;  5CBR A;  1II5 A;  5IZ1 A;  3UN6 A;  3OMB A;  2QS2 A;  4HE0 A;  5ET6 A;  3CG3 A;  4KCD A;  2LAO A;  3SEW A;  2DS9 A;  1O63 A;  2PFZ A;  4OFO A;  4MBP A;  3G3J A;  4Q5T A;  2I0C A;  3RPL A;  4PAK A;  3PUX E;  3RGY A;  1VR5 A;  1FBP A;  1IMD A;  2Y5L A;  4RY1 A;  5TP9 A;  5JTY A;  1TFA A;  4IO3 A;  1OQG A;  3TDJ A;  4P1L A;  2XA5 A;  3S9M C;  4N4U A;  5HPQ A;  1YZ0 A;  3FIR A;  1MRP A;  4GF8 A;  4YIC A;  4ZZE A;  2DQV A;  4LN5 A;  3SDF A;  4NWC A;  2G29 A;  2L5V A;  2I0B A;  4GVO A;  4QBA A;  3UK4 A;  4MHF A;  3M8U A;  4Q8R A;  3EHS A;  3GXA A;  4PGP A;  2UXA A;  1QUK A;  4I1D A;  4MX6 A;  5DVF A;  1NV2 A;  3JZJ A;  1DOT A;  4RPO A;  3D4G A;  4YZZ A;  3OXN A;  3RTW B;  1EZO A;  3PTY A;  5M2V A;  3K4U A;  4H5G A;  1TWY A;  4R72 A;  4GOT A;  4MMP A;  1S9T A;  2DOJ A;  3TTM A;  5AA1 A;  2WEF A;  5AA4 B;  4KYS A;  1FQC A;  3I6V A;  4P56 A;  1KA1 A;  4H46 A;  4ESW A;  5ET8 A;  3E79 A;  4H5F A;  1OLC A;  1SI0 A;  3SES A;  1P99 A;  4JSO A;  3GLB A;  3CVG A;  4JBZ A;  4NF4 A;  4P8B A;  4O3B A;  1LFH A;  3KOT A;  3Q29 A;  5I56 B;  4IY5 A;  3IOU A;  3FV2 A;  5ITO A;  5EQA A;  2DWH A;  4OVT A;  4OER A;  3IO4 A;  3FJ7 A;  4F22 A;  3DP4 A;  2NVU B;  4BDQ A;  1LGB C;  3Q25 A;  1RDZ A;  4GWO A;  2GH9 A;  4LZ8 A;  3PPN A;  2FA7 A;  2I4C A;  5EYH A;  4KQP A;  2V3T A;  1TT1 A;  1LEV A;  1MPD A;  3RT8 A;  5ITP A;  2A5T A;  4XXU A;  4O94 A;  3RN8 A;  1BTJ A;  4F31 B;  3E13 X;  3U93 A;  1MY2 A;  5LTC A;  3DP8 A;  1H3D A;  2WX9 A;  2REJ A;  1N0T A;  4PFB A;  1MY0 A;  2XHD A;  2FNC A;  4U4X A;  5AA2 B;  1B3G A;  1MH3 A;  1MY3 A;  3K6W A;  1B52 A;  3T22 A;  2G93 A;  3K0V A;  1YCJ A;  2PT1 A;  2Z8E A;  1UTB B;  3SZP A;  3OSQ A;  2Q89 A;  1NUZ A;  4ZEK A;  4XF5 A;  3H3G A;  1ZLQ A;  3C36 A;  1IXI A;  2PVU A;  1IMF A;  1GVC A;  3K02 A;  2P0S A;  4O3A A;  3TCG A;  2Q88 A;  4I62 A;  3VE1 B;  3CFX A;  3N6U A;  2XWV A;  3TTL A;  1A8F A;  1NH8 A;  3MZ9 A;  1NV5 A;  1YPN A;  4AB6 A;  4HS7 A;  1ZJL A;  4NF0 A;  4R9G A;  1B1H A;  2XD2 A;  1DTG A;  4QSE A;  5CI5 A;  2F36 A;  3PPP A;  1MM7 A;  4JVI A;  1N7X A;  2OK2 A;  4JWX A;  1XT8 A;  5KDT B;  2V25 A;  1M5B A;  3MPL A;  1LBC A;  4P1E A;  2Q2C A;  3IJO B;  3IL1 B;  3ONM A;  2ZYO A;  3HO7 A;  3MZ1 A;  3QYT A;  3FAS A;  1NUW A;  1EU8 A;  1B0L A;  3MQ9 A;  1JET A;  3W9V A;  5I56 A;  1ZMG A;  2DWJ A;  3RY3 A;  2F34 A;  4H0W A;  1NKX A;  1URG A;  5L8D A;  1ANF A;  1LLS A;  4MLQ A;  4UAB A;  3PD8 A;  5AE4 A;  4EF2 A;  1B5J A;  2I58 A;  3CG1 A;  3W15 C;  2D21 A;  5CMC A;  3OO6 A;  1AIV A;  4EQ7 A;  1H44 A;  1VFE A;  4OVR A;  2AYS A;  1KWH A;  1VFD A;  2ZXT A;  1EH3 A;  3FVO A;  2V3Q A;  2QVU A;  1BLF A;  2RC7 A;  2RC8 A;  3B6T A;  4PFR A;  4X04 A;  2Y7P A;  4RYA A;  2FIE A;  1KA0 A;  3TCF A;  1ATG A;  2HZL A;  4GWX A;  3H03 A;  4OVJ A;  4GLI A;  2REG A;  3LUZ A;  1M5C A;  4U1O A;  4MIJ A;  3PMW A;  4ND9 A;  3C33 A;  3OO8 A;  2PX1 A;  3L6G A;  3MVZ A;  1YXI A;  1QUI A;  1FPD A;  1R9Q A;  3TFL A;  3TEP A;  4ELO A;  1NUX A;  4OA4 A;  4BDN A;  3MUQ A;  3TAJ A;  1UTB A;  1Y20 A;  2XXT A;  4H45 A;  4DXB A;  4GD5 A;  3Q26 A;  2H5Y A;  3ECR A;  3QSL A;  4MNP A;  4ZE8 A;  4KPT A;  3KBZ A;  2VGQ A;  1MXU A;  3V5A A;  4NMY A;  2ONR A;  4G68 C;  3H6W A;  2H9B A;  1H45 A;  2YPN A;  4E0W A;  4M4G A;  2XWI A;  2HEU A;  1JVX A;  4G8M A;  2W7Y A;  1RYO A;  1FPG A;  3PUY E;  1FBG A;  4RA1 A;  2HQ0 A;  2DE2 A;  3K6X A;  1NNK A;  1Y1Z A;  1B5H A;  2VD2 A;  1M5E A;  4KXP A;  1RDX A;  2Q2A A;  5CMK A;  4OHN A;  1FPE A;  5I84 A;  4IO4 A;  1A40 A;  1DBZ A;  3U72 A;  2O51 A;  5IAI A;  2XWO A;  2F7A A;  3IB2 A;  3S2V A;  2O1M A;  3K00 A;  2XXR A;  1M5D A;  4H8I A;  3Q28 A;  5KDT A;  3KFM A;  2GHA A;  1FTL A;  1LBX A;  1FBH A;  1EYJ A;  4O3C A;  3UOR A;  4QXD A;  1BK4 A;  3D4C A;  4GWZ A;  4F29 A;  4DI3 D;  4F18 A;  3LV0 A;  4FOR A;  1H43 A;  2ZMB A;  4F1Y A;  5KCJ B;  3N5L A;  1DTZ A;  4HW8 A;  1DK4 A;  3VFJ A;  3IFC A;  1QW0 A;  3K6U A;  4GL0 A;  2H98 A;  2CEY A;  5I2N A;  3TPA A;  3BFU A;  2F35 A;  1EYK A;  4OWD A;  2Q9T A;  3WAE A;  3O29 A;  2O7U A;  2FHY A;  4WEP A;  3S9E A;  1ELJ A;  2QSX A;  4O8M A;  1XOC A;  5K2X A;  3H4Z A;  1TFD A;  1T0K A;  4ZS9 A;  3H6U A;  4ZED A;  4YU0 A;  1AH5 A;  1I6Q A;  1QUL A;  4KCC A;  1FCK A;  1B2H A;  3TTN A;  1PDA A;  4LZ5 A;  4NGU A;  1IXH A;  2XWK A;  1B32 A;  4LP2 B;  3HHF A;  4HE1 A;  1D3K A;  2HFB A;  2VT5 A;  3C34 A;  4IY6 A;  1FPJ A;  3R26 A;  3KC0 A;  3V83 A;  5DVI A;  5I3S A;  3UP9 A;  1CE2 A;  3VLV A;  3KZG A;  3ZSF A;  2PYY A;  3TEL A;  2E1S A;  4BDM A;  4TOZ A;  4NE4 A;  3VVE A;  3DM0 A;  4P47 A;  1QKB A;  4P9K A;  3T9H B;  4IO5 A;  2HXW A;  3CIJ A;  4IR8 A;  2ZYM A;  2UVI A;  4EUO A;  4IO6 A;  3A09 A;  2OWS A;  3IOR A;  4YKP A;  1URS A;  3PV0 E;  1FTK A;  1WDN A;  2PCR A;  3UGW A;  1J1N A;  2CZI A;  3IB1 A;  4ZE9 A;  4P11 A;  3FUZ A;  2YLN A;  5L9O A;  2HHM A;  1B7H A;  3T0J A;  5A5L A;  4H65 A;  1JEU A;  4E0X A;  2UYF A;  2R71 A;  4PET A;  2XXK A;  1MG1 A;  3Q27 A;  1P1Q A;  4JXI A;  2O6A A;  2ABH A;  4O7I A;  4F3B A;  1M5F A;  5F1Q A;  4PE5 B;  1AOV A;  3O6H A;  2XX7 A;  3GZG A;  4MH5 A;  1MXX A;  3IJX B;  1MM6 A;  4OFL A;  4ZZA A;  1MDP 1;  1MS7 A;  2HAU A;  1JW4 A;  1QKA A;  3K1N A;  4OEV A;  1FTA A;  5KCJ A;  3GYY A;  3G3K A;  4G77 A;  1B58 A;  1LAF E;  3BBR A;  4EF1 A;  1XVX A;  3RUM A;  3MVW A;  4LON B;  4PCD A;  3EHT A;  5CBS A;  3OOA A;  5I59 B;  2GRV A;  1KZ8 A;  2QL3 A;  3TUS A;  2V3U A;  1A54 A;  2WBD A;  1NV0 A;  4EXK A;  1MDQ A;  4EQ9 A;  4FAT A;  1B0H A;  3E4R A;  1AL3 A;  4F2Q A;  2P1S A;  3MVY A;  1R9L A;  1ZKB A;  5DEX B;  3ODB A;  3M3K A;  2CZK A;  2UYE A;  3DP6 A;  4PTK A;  3KJT A;  2I49 A;  2O68 A;  2Y5K A;  4QSD A;  2CZL A;  1IMC A;  2VPN A;  3T9V A;  2VP1 A;  5KZT A;  1JQF A;  1CNQ A;  2OJT A;  5ICQ A;  4I8C A;  5J16 A;  1FQB A;  1FPF A;  1FPI A;  1LCF A;  4GXA A;  4GWY A;  4N91 A;  2DXR A;  5CMB A;  4DZ1 A;  2RKM A;  2ZZX A;  3TCH A;  2XD3 A;  3OO7 A;  3VLW A;  1B6H A;  4OEU A;  1USY E;  1DPP A;  4TLL B;  1PEB A;  3TTR A;  2Y7K A;  3TKD A;  3MPK A;  3MST A;  1RDY A;  4FBP A;  3EPE A;  1I69 A;  1S7Y A;  2THI A;  2DE4 A;  1L5T A;  3SER A;  2OZZ A;  1WVJ A;  3N26 A;  5ET5 A;  3QMF A;  4U23 A;  3SEU A;  2NUV A;  4QF9 A;  1URD A;  1B7Z A;  4NF8 B;  3CSG A;  2KQZ A;  2DWA A;  2XXU A;  3LUY A;  3R6U A;  2HCA A;  2DSF A;  1OMP A;  2AL5 A;  2H99 A;  3RTF B;  3S9N C;  1JEV A;  1MQG A;  1SW1 A;  5IZ3 B;  2ANJ A;  3C31 A;  3FXU A;  2V84 A;  4GX4 A;  1BKA A;  4JVD A;  2QVV A;  5CMM A;  3C9H A;  3F11 A;  2F3B A;  4L17 A;  4OMB A;  3PMV A;  1Y4T A;  3KN8 A;  5EYF A;  2E0S A;  2P3V A;  4POX A;  2DVZ A;  2PT2 A;  2O69 A;  1LFG A;  4PF8 A;  3H06 B;  4OTE A;  4BDR A;  3T93 B;  4G2Z A;  3WAF A;  4GWU A;  4F39 A;  2AL4 A;  4MEV A;  3GBB A;  3KGC A;  4YKJ A;  4RK2 A;  4JB7 A;  1USY H;  3VVD A;  2I48 A;  3T9X B;  3ILT B;  4FE8 A;  3LSL A;  3HN0 A;  1B4Z A;  3SET A;  4GRK A;  3HCQ A;  3I3V A;  2HXR A;  4GXS B;  5I59 A;  4OET A;  4MFI A;  2QS4 A;  4KI0 E;  3BIH A;  1NV3 A;  2JJK A;  1OIB A;  3S4U A;  1O64 A;  1F9B A;  3U92 A;  3CSB A;  4ECF A;  4KYD A;  4R6Y A;  1NV4 A;  1Y3N A;  1B5I A;  3O6I A;  5AA4 A;  4MLV A;  5DEX A;  4QFP A;  1FTJ A;  1MPC A;  1GV8 A;  3A3U A;  4F3G A;  1P1W A;  1NMU A;  1UIV A;  4DLD A;  4YKK A;  3HHG A;  1PB7 A;  2HZK A;  2YJP A;  3T9U A;  4NED A;  2I3W A;  1SYH A;  3MP6 A;  3PPQ A;  4HTG A;  3FBP A;  4JDF A;  3T1B A;  5J1D A;  3LBS A;  1XVY A;  3ZKK A;  3RLF E;  2F8D A;  2CZH A;  1EZP A;  5H8Q B;  1DSN A;  3IAZ A;  1NH7 A;  3CI8 A;  5TU0 A;  2DE3 A;  2B4L A;  3FGS A;  4FED A;  2WBB A;  4BDO A;  4OEN A;  1INP A;  4NG7 A;  3IFA A;  4OZ9 A;  4JVC A;  1HSL A;  4QRZ A;  3S9L C;  1RKM A;  5L9M A;  2DDK A;  3W9W A;  4R75 A;  1JNF A;  5EQ9 A;  4OVP A;  3B50 A;  4EXL A;  4NF8 A;  4GX6 A;  4ISU A;  4DDD A;  3PPO A;  1MQH A;  3OEK A;  4AS4 A;  3LSF B;  4I3Y A;  4MF3 A;  1BP5 A;  1SQY A;  2Z23 A;  2UVJ A;  4NF6 B;  5HBC A;  2NOO A;  5IZ3 A;  2VOZ A;  3IO6 A;  3KC1 A;  3O6G A;  2QRY A;  5AA2 A;  3JYR A;  4NX1 A;  4X48 A;  4KHZ E;  4KD5 A;  4G4P A;  2R8T A;  3E3K A;  2RC9 A;  1N7W A;  3DLN A;  3PMX A;  1O7T A;  4X1D A;  2FBP A;  1Z7N E;  4F2O A;  1US4 A;  5F7V A;  3UIF A;  4JSD A;  5H8F B;  5I5P A;  3OD7 A;  4IGT A;  4F3S A;  1POY 1;  4YKI A;  1XC1 A;  4OVS A;  1FW0 A;  1LBW A;  3NOH A;  3EQ1 A;  4AB5 A;  5BWJ A;  4C1T A;  4R9F A;  5DW8 A;  4IO7 A;  1SPI A;  3TQW A;  1LB9 A;  3VDF A;  1IIW A;  1NNP A;  2F97 A;  3OO9 A;  2B4M A;  1I6A A;  5I2K B;  4DCX A;  4ELR A;  1IZ1 A;  2FYI A;  3DEL B;  1SI1 A;  4XTC Q;  4G8N A;  1GGG A;  2O7I A;  3HV1 A;  4RPN A;  1HSE A;  4Z0I A; 
#chains in the Genus database with same CATH homology
 4OXV A;  2R9J A;  4Q30 B;  4YB5 A;  3EF7 A;  1R1N A;  5FTI A;  1UTH B;  5TP9 B;  5JK4 A;  1S50 A;  2P2A A;  4XKQ A;  1IQ7 A;  2IA4 A;  1NFT A;  1POT A;  2QMX A;  5H8Q A;  5DT6 A;  2ESN A;  3G3I A;  4KYE A;  3OEL A;  3ZKL A;  4OES A;  5L9S A;  1AMF A;  4DXU A;  3IK6 B;  5AA3 A;  2H4I A;  2XXI A;  5H8H B;  4ZDM A;  1SW2 A;  1B3E A;  5ELV A;  4QFN A;  1JW5 A;  1CB6 A;  3G3G A;  2UVG A;  4HCW A;  3IOT A;  1SYI A;  4POW A;  3T66 A;  4ELP A;  2DWI A;  3B6Q A;  3BKI B;  3OEN A;  3SKP A;  2ALU A;  5DTB A;  1EZ9 A;  4EQB A;  3B7D A;  5LOM A;  4P0G A;  2VD3 A;  4U22 A;  4C1U A;  3PUZ E;  4NF6 A;  1US5 A;  2NXO A;  4UA8 A;  4ZEB A;  4FIM A;  2IEE A;  3C4M A;  1P1N A;  2X7Q A;  1B05 A;  1MXW A;  2WKY A;  5H8N B;  3IOW A;  1B3F A;  3SEY A;  3HPI A;  3PU5 A;  4KFQ A;  4IB2 A;  2QJE A;  3CR9 A;  3HST A;  4IGR A;  4U2R A;  3FVK A;  2B3F A;  5H8F A;  2ZYN A;  4XKN A;  4U1Z A;  2XXQ A;  1N04 A;  1B9J A;  3IOV A;  4X9T A;  3TZA A;  2ZNU A;  3UA8 A;  1HSJ A;  2PBW A;  4OYV A;  1JW1 A;  3LC8 A;  4LQ2 A;  2I6E A;  3CRB A;  4ONY A;  2A5T B;  3MJN A;  4I9D A;  4RNS A;  4GIZ A;  1QJM A;  3TOD A;  5FHN A;  3U8Q A;  2GHB A;  3KSX A;  1B4H A;  4RJZ A;  3H7M A;  3O66 A;  1D9V A;  1QVS A;  1Q1K A;  3RQT A;  4PFU A;  2XXV A;  1UIU A;  1UTH A;  4GQO A;  3MC2 A;  2OBG A;  4DE8 A;  3FJG A;  2F78 A;  3QXM A;  4F3P A;  3VVF A;  3QIM A;  1N84 A;  2Q8J A;  2Z8F A;  5EHM A;  3THI A;  2Y7R A;  1BIY A;  2XXX A;  1SBP A;  1OVT A;  5H8H A;  1MH4 A;  5K2Y A;  2AIX A;  5A5X B;  1H76 A;  4NTL A;  5ICT A;  4LUB A;  1FTO A;  1XHY A;  3QK6 A;  4TLM B;  1R6Z A;  1PB9 A;  1Y9U A;  2XX8 A;  4DCY A;  5AA2 D;  1DPE A;  2B65 A;  2DVC A;  1P1O A;  5I58 B;  4DIG A;  4QFL A;  3GBA A;  3N94 A;  2RCA A;  1D9Y A;  3M3L A;  3KJ7 A;  3KEI A;  4N6P A;  5H8N A;  5HM4 B;  1Y3Q A;  5B7D A;  2ONK E;  4Q0C A;  4G8H A;  4IO2 A;  2PMS A;  4YMA A;  2V93 A;  4F19 A;  5ISU A;  4XKP A;  2F7C A;  2Z22 A;  4LA9 A;  2F6G A;  1NNT A;  4LQ5 A;  1B51 A;  4ELQ A;  3KBR A;  4F1V A;  5IKB A;  4HCY A;  1IXC A;  2X7P A;  1B40 A;  4ESX A;  3FJM A;  5H8S A;  3E9X A;  2XXH A;  1SW4 A;  1ZTY A;  1I6B A;  4THI A;  1N3W A;  3O9P A;  1JVY A;  4RK9 A;  5I57 B;  3PUW E;  4R6H A;  3T96 B;  1LAX A;  4YB6 A;  3KSJ A;  2UVH A;  3V8X B;  2RCB A;  3R7X A;  2Y7W A;  3TQL A;  2XX9 A;  3C32 A;  2DP8 A;  3O97 A;  3RNN A;  3FAT A;  1YTV A;  3AXF A;  4BDL A;  1A8E A;  4QSC A;  1FQD A;  3K01 A;  1Y1M A;  2NWJ A;  1PBP A;  2A5S A;  4KR5 A;  1N76 A;  3VV5 A;  1LST A;  1D4N A;  1B1X A;  3H6T A;  3K1M A;  3RPW A;  2QS1 A;  3QUJ A;  4BLA A;  3IR1 A;  3M3F A;  3MP8 A;  3KN3 A;  3VLU A;  5B70 A;  4NWD A;  4K3F A;  5FTH A;  4LAT A;  3CFZ A;  1LAH E;  3IB0 A;  3USD A;  1Y4C A;  5A5X A;  5JEI A;  3KOS A;  1ZIU A;  3G7W A;  2ZYK A;  3IX1 A;  3PUV E;  2D3I A;  2R6G E;  3PGF A;  1MXV A;  3FXQ A;  3VXB A;  2B3B A;  4AQ4 A;  1IIT A;  1B3H A;  3FVG A;  4WED A;  4Z7E A;  1FQE A;  4FEC A;  1LCT A;  5I58 A;  4H1X A;  1PB8 A;  4X1B A;  1QUJ A;  4NF5 B;  4YMB A;  4XKR A;  3FV1 A;  1GR2 A;  1SD3 A;  4G68 B;  3K1P A;  4PFY A;  4WKM A;  1PC3 A;  3H6V A;  3ILU B;  3MWB A;  3JV9 A;  1SW5 A;  1MXY A;  5FHM A;  3SEV A;  1ZBM A;  3U94 A;  3FVN A;  3FZV A;  1MQI A;  3P7I A;  4YAH X;  1VSO A;  1NNF A;  3TMG A;  1ZU0 A;  1OQH A;  3A3C A;  1LAG E;  2O1L A;  4PFW A;  3ZS6 A;  2KLF A;  5I2N B;  1P1U A;  4QHQ A;  2GFE A;  3QAX A;  1NL5 A;  1A99 A;  3FXR A;  5BUU A;  4H6D A;  5I57 A;  2RF1 A;  4R6K A;  3FD3 A;  1GTK A;  4R73 A;  4N07 A;  3K6V A;  3I5O A;  3MVX A;  2OLB A;  1LFI A;  4F1U A;  1IUD A;  2ZNS A;  1RYX A;  4LZ7 A;  2OCU A;  1WOD A;  1Z7M E;  2DYX A;  4N13 A;  1TXF A;  2M8C A;  4JWO A;  1IXG A;  2Y84 A;  4YB7 A;  3EHU A;  2F6P A;  1OLA A;  4R2F A;  3EN3 A;  1SVX B;  4QFO A;  4H8J A;  5TPA B;  5CRY A;  1A7L A;  1SDX A;  4OFJ A;  3KG2 A;  2XXY A;  4FJP A;  1MY4 A;  3K2D A;  4PQJ A;  4R2B A;  1MQJ A;  1MPB A;  1FQF A;  1PBQ A;  3O28 A;  2XXP A;  3PPR A;  3L6H A;  5EHS A;  2Z8D A;  5CM6 A;  1XS5 A;  4ZEI A;  5DYH A;  3TTK A;  3VXC A;  2X26 A;  3OSR A;  3LSW A;  4U4S A;  4RXL A;  2I3V A;  4NF5 A;  4U21 A;  1VE4 A;  3LR1 A;  5DVJ A;  1MY1 A;  4G68 A;  2QS3 A;  5JTY B;  2VHA A;  2QPQ A;  3C35 A;  1MXZ A;  1N3X A;  4ZEC A;  3MP1 A;  2DXY A;  3V89 B;  3BFT A;  4FAJ A;  3LSX A;  4M1V A;  3PD9 A;  4GFR A;  4UAC A;  2BJJ X;  4DXC A;  4TQU Q;  3OEM A;  2H25 A;  2CMO A;  4ZEF A;  3U1O A;  3MAM A;  4FEB A;  3QUF A;  1IEJ A;  5FHO A;  1DMB A;  4EDP A;  1B46 A;  4QFK A;  3TYH A;  2QMW A;  4PFT A;  2Y7I A;  1FQA A;  4JWY A;  1YAE A;  2OWT A;  1B3L A;  3O2A A;  2I4B A;  4XIG Q;  3MW0 A;  4R74 A;  1A55 A;  4NF4 B;  3SEX A;  3CFL A;  2ZNT A;  3N6T A;  3MZB A;  2D5W A;  3MBP A;  4PP0 A;  4WXJ A;  2XXW A;  1B7U A;  2HAV A;  2ONS A;  3KN7 A;  2RIN A;  3G3H A;  2F5X A;  5TPA A;  4OQO A;  1Y3P A;  1OVB A;  3RT6 B;  4LVQ A;  3G3F A;  3B6W A;  4GL8 A;  1LBB A;  1Q35 A;  4P0I A;  2O84 X;  1UQW A;  4H67 A;  4C0R A;  1LB8 A;  1MQD A;  5CC2 A;  5I2K A;  2F7B A;  1FTM A;  5CBR A;  1II5 A;  3UN6 A;  3OMB A;  2QS2 A;  3CG3 A;  4KCD A;  2LAO A;  3SEW A;  2DS9 A;  1O63 A;  4OFO A;  4MBP A;  3G3J A;  4Q5T A;  2I0C A;  3PUX E;  3RGY A;  1VR5 A;  4RY1 A;  5TP9 A;  5JTY A;  1TFA A;  4IO3 A;  1OQG A;  3TDJ A;  3S9M C;  5HPQ A;  3FIR A;  1MRP A;  4GF8 A;  4YIC A;  4ZZE A;  2DQV A;  3SDF A;  4NWC A;  2G29 A;  2I0B A;  4GVO A;  3UK4 A;  3M8U A;  4Q8R A;  3EHS A;  3GXA A;  2UXA A;  1QUK A;  4I1D A;  5DVF A;  3JZJ A;  1DOT A;  4RPO A;  3D4G A;  4YZZ A;  3OXN A;  3RTW B;  1EZO A;  5M2V A;  3K4U A;  4H5G A;  1TWY A;  4GOT A;  4R72 A;  1S9T A;  2DOJ A;  3TTM A;  5AA1 A;  5AA4 B;  4KYS A;  1FQC A;  3I6V A;  4ESW A;  4H5F A;  1OLC A;  1SI0 A;  3SES A;  1P99 A;  4JSO A;  3GLB A;  3CVG A;  4JBZ A;  4NF4 A;  4O3B A;  1LFH A;  3KOT A;  3Q29 A;  5I56 B;  4IY5 A;  3IOU A;  3FV2 A;  5ITO A;  2DWH A;  4OER A;  3IO4 A;  3FJ7 A;  4F22 A;  3DP4 A;  2NVU B;  4BDQ A;  1LGB C;  3Q25 A;  4GWO A;  2GH9 A;  4LZ8 A;  3PPN A;  2FA7 A;  2I4C A;  4KQP A;  2V3T A;  1TT1 A;  1MPD A;  3RT8 A;  5ITP A;  2A5T A;  4XXU A;  3RN8 A;  1BTJ A;  4F31 B;  3E13 X;  3U93 A;  1MY2 A;  3DP8 A;  1H3D A;  2REJ A;  1N0T A;  1MY0 A;  2XHD A;  2FNC A;  4U4X A;  5AA2 B;  1B3G A;  1MH3 A;  1MY3 A;  3K6W A;  1B52 A;  3T22 A;  2G93 A;  3K0V A;  1YCJ A;  2PT1 A;  2Z8E A;  1UTB B;  3OSQ A;  2Q89 A;  4ZEK A;  3H3G A;  1ZLQ A;  3C36 A;  1IXI A;  2PVU A;  1GVC A;  3K02 A;  2P0S A;  4O3A A;  3TCG A;  2Q88 A;  4I62 A;  3VE1 B;  3CFX A;  3N6U A;  3TTL A;  1A8F A;  1NH8 A;  3MZ9 A;  1YPN A;  4AB6 A;  4HS7 A;  1ZJL A;  4R9G A;  1B1H A;  2XD2 A;  1DTG A;  4QSE A;  5CI5 A;  2F36 A;  3PPP A;  1MM7 A;  1N7X A;  2OK2 A;  4JWX A;  1XT8 A;  5KDT B;  2V25 A;  1M5B A;  3MPL A;  1LBC A;  2Q2C A;  3IJO B;  3IL1 B;  3ONM A;  2ZYO A;  3HO7 A;  3MZ1 A;  3QYT A;  3FAS A;  1EU8 A;  1B0L A;  3MQ9 A;  1JET A;  3W9V A;  5I56 A;  1ZMG A;  2DWJ A;  3RY3 A;  2F34 A;  4H0W A;  1NKX A;  1URG A;  5L8D A;  1ANF A;  1LLS A;  4MLQ A;  3PD8 A;  5AE4 A;  4EF2 A;  1B5J A;  2I58 A;  3CG1 A;  3W15 C;  2D21 A;  5CMC A;  3OO6 A;  1AIV A;  4EQ7 A;  1H44 A;  1VFE A;  2AYS A;  1KWH A;  1VFD A;  2ZXT A;  1EH3 A;  3FVO A;  2V3Q A;  1BLF A;  2RC7 A;  2RC8 A;  3B6T A;  2Y7P A;  4RYA A;  3TCF A;  1ATG A;  2HZL A;  3H03 A;  4OVJ A;  4GLI A;  2REG A;  1M5C A;  4U1O A;  3PMW A;  4ND9 A;  3C33 A;  3OO8 A;  2PX1 A;  3L6G A;  3MVZ A;  1QUI A;  3TEP A;  1R9Q A;  3TFL A;  4ELO A;  4BDN A;  3MUQ A;  3TAJ A;  1UTB A;  1Y20 A;  2XXT A;  4DXB A;  4GD5 A;  3Q26 A;  2H5Y A;  3ECR A;  3QSL A;  4ZE8 A;  4KPT A;  2VGQ A;  1MXU A;  3V5A A;  4NMY A;  2ONR A;  4G68 C;  3H6W A;  2H9B A;  1H45 A;  2YPN A;  4E0W A;  4M4G A;  2HEU A;  1JVX A;  4G8M A;  2W7Y A;  1RYO A;  3PUY E;  4RA1 A;  2HQ0 A;  2DE2 A;  3K6X A;  1NNK A;  1Y1Z A;  1B5H A;  2VD2 A;  1M5E A;  2Q2A A;  5CMK A;  4OHN A;  5I84 A;  4IO4 A;  1A40 A;  3U72 A;  2O51 A;  5IAI A;  2F7A A;  3IB2 A;  3S2V A;  2O1M A;  3K00 A;  2XXR A;  1M5D A;  4H8I A;  3Q28 A;  5KDT A;  3KFM A;  2GHA A;  1FTL A;  4O3C A;  3UOR A;  3D4C A;  4F29 A;  4F18 A;  4FOR A;  1H43 A;  2ZMB A;  4F1Y A;  5KCJ B;  3N5L A;  1DTZ A;  4HW8 A;  3VFJ A;  1QW0 A;  3K6U A;  4GL0 A;  2H98 A;  5I2N A;  3TPA A;  3BFU A;  2F35 A;  4OWD A;  2Q9T A;  3WAE A;  3O29 A;  2O7U A;  4WEP A;  3S9E A;  1ELJ A;  2QSX A;  1XOC A;  5K2X A;  3H4Z A;  1TFD A;  1T0K A;  4ZS9 A;  3H6U A;  4ZED A;  4YU0 A;  1AH5 A;  1I6Q A;  1QUL A;  4KCC A;  1FCK A;  1B2H A;  3TTN A;  1PDA A;  4LZ5 A;  1IXH A;  1B32 A;  4LP2 B;  3HHF A;  1D3K A;  2HFB A;  3C34 A;  4IY6 A;  3R26 A;  3V83 A;  5DVI A;  3UP9 A;  1CE2 A;  3VLV A;  3KZG A;  3ZSF A;  2PYY A;  3TEL A;  2E1S A;  4BDM A;  4TOZ A;  4NE4 A;  3VVE A;  3DM0 A;  3T9H B;  1QKB A;  4IO5 A;  2HXW A;  3CIJ A;  2ZYM A;  2UVI A;  4EUO A;  4IO6 A;  3A09 A;  2OWS A;  3IOR A;  4YKP A;  1URS A;  3PV0 E;  1FTK A;  1WDN A;  3UGW A;  1J1N A;  3IB1 A;  4ZE9 A;  4P11 A;  3FUZ A;  2YLN A;  5L9O A;  1B7H A;  4H65 A;  1JEU A;  4E0X A;  2UYF A;  2R71 A;  4PET A;  1MG1 A;  3Q27 A;  1P1Q A;  4JXI A;  2O6A A;  2ABH A;  4F3B A;  1M5F A;  5F1Q A;  4PE5 B;  1AOV A;  3O6H A;  2XX7 A;  3GZG A;  4MH5 A;  1MXX A;  3IJX B;  1MM6 A;  4OFL A;  4ZZA A;  1MDP 1;  1MS7 A;  2HAU A;  1JW4 A;  1QKA A;  3K1N A;  4OEV A;  5KCJ A;  3G3K A;  4G77 A;  1B58 A;  1LAF E;  3BBR A;  4EF1 A;  1XVX A;  3RUM A;  3MVW A;  4LON B;  5CBS A;  3EHT A;  3OOA A;  5I59 B;  2GRV A;  2QL3 A;  3TUS A;  2V3U A;  1A54 A;  4EXK A;  1MDQ A;  4EQ9 A;  4FAT A;  1B0H A;  3E4R A;  1AL3 A;  4F2Q A;  2P1S A;  3MVY A;  1R9L A;  1ZKB A;  5DEX B;  3ODB A;  3M3K A;  2UYE A;  3DP6 A;  3KJT A;  2I49 A;  2O68 A;  4QSD A;  2CZL A;  3T9V A;  2VP1 A;  5KZT A;  1JQF A;  2OJT A;  5ICQ A;  4I8C A;  1FQB A;  1LCF A;  4GXA A;  2DXR A;  5CMB A;  4DZ1 A;  2RKM A;  3TCH A;  2XD3 A;  3OO7 A;  3VLW A;  1B6H A;  4OEU A;  1USY E;  1DPP A;  4TLL B;  1PEB A;  3TTR A;  2Y7K A;  3TKD A;  3MPK A;  3EPE A;  1I69 A;  1S7Y A;  2THI A;  2DE4 A;  1L5T A;  3SER A;  2OZZ A;  1WVJ A;  3N26 A;  4U23 A;  3SEU A;  2NUV A;  4QF9 A;  1URD A;  1B7Z A;  4NF8 B;  3CSG A;  2DWA A;  2XXU A;  3LUY A;  3R6U A;  2HCA A;  2DSF A;  1OMP A;  2AL5 A;  2H99 A;  3RTF B;  3S9N C;  1JEV A;  1MQG A;  1SW1 A;  2ANJ A;  3C31 A;  3FXU A;  2V84 A;  1BKA A;  5CMM A;  3C9H A;  3F11 A;  4L17 A;  4OMB A;  3PMV A;  1Y4T A;  3KN8 A;  5EYF A;  2E0S A;  4POX A;  2DVZ A;  2PT2 A;  2O69 A;  1LFG A;  3H06 B;  4OTE A;  4BDR A;  3T93 B;  4G2Z A;  3WAF A;  4F39 A;  2AL4 A;  3GBB A;  3KGC A;  4YKJ A;  4RK2 A;  4JB7 A;  1USY H;  3VVD A;  2I48 A;  3T9X B;  3ILT B;  4FE8 A;  3LSL A;  3HN0 A;  1B4Z A;  3SET A;  4GRK A;  3HCQ A;  3I3V A;  4GXS B;  5I59 A;  4OET A;  4MFI A;  2QS4 A;  4KI0 E;  1OIB A;  3S4U A;  1O64 A;  1F9B A;  3U92 A;  3CSB A;  4ECF A;  4KYD A;  4R6Y A;  1Y3N A;  1B5I A;  3O6I A;  5AA4 A;  4MLV A;  5DEX A;  4QFP A;  1FTJ A;  1MPC A;  1GV8 A;  3A3U A;  4F3G A;  1P1W A;  1NMU A;  1UIV A;  4DLD A;  4YKK A;  3HHG A;  1PB7 A;  2HZK A;  2YJP A;  3T9U A;  4NED A;  2I3W A;  1SYH A;  3MP6 A;  3PPQ A;  4HTG A;  4JDF A;  5J1D A;  3LBS A;  1XVY A;  3ZKK A;  3RLF E;  2F8D A;  1EZP A;  5H8Q B;  1DSN A;  3IAZ A;  1NH7 A;  3CI8 A;  5TU0 A;  2DE3 A;  3FGS A;  4FED A;  4BDO A;  4OEN A;  4OZ9 A;  1HSL A;  4QRZ A;  3S9L C;  1RKM A;  5L9M A;  3W9W A;  4R75 A;  1JNF A;  4EXL A;  4NF8 A;  4ISU A;  4DDD A;  3PPO A;  1MQH A;  3OEK A;  3LSF B;  4MF3 A;  1BP5 A;  1SQY A;  2Z23 A;  2UVJ A;  4NF6 B;  5HBC A;  2NOO A;  2VOZ A;  3IO6 A;  3O6G A;  2QRY A;  5AA2 A;  3JYR A;  4X48 A;  4KHZ E;  4KD5 A;  4G4P A;  3E3K A;  2RC9 A;  1N7W A;  3DLN A;  3PMX A;  1O7T A;  4X1D A;  1Z7N E;  4F2O A;  3UIF A;  5F7V A;  1US4 A;  4JSD A;  5H8F B;  3OD7 A;  4IGT A;  4F3S A;  1POY 1;  4YKI A;  1XC1 A;  1FW0 A;  3EQ1 A;  4AB5 A;  5BWJ A;  4C1T A;  4R9F A;  4IO7 A;  3TQW A;  1LB9 A;  3VDF A;  1IIW A;  1NNP A;  2F97 A;  3OO9 A;  1I6A A;  5I2K B;  4DCX A;  4ELR A;  1IZ1 A;  2FYI A;  3DEL B;  1SI1 A;  4XTC Q;  4G8N A;  1GGG A;  2O7I A;  3HV1 A;  4RPN A;  1HSE A;  4Z0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...