1OQHA

Crystal structure of the r124a mutant of the n-lobe human transferrin
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGASAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional consequences of binding site mutations in transferrin: crystal structures of the Asp63Glu and Arg124Ala mutants of the N-lobe of human transferrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Serotransferrin
total genus 106
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oqhA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oqhA02
4RPOA 4NF4A 3SEXA 4I1DA 1NL5A 4NWCA 4N07A 2QS2A 4LZ8A 1I69A 1ATGA 3DLNA 2NVUB 3TCGA 1B1HA 1Y3QA 3P7IA 1B3LA 1LB9A 3O28A 5DEXB 1JEVA 3MQ9A 1YTVA 1US4A 3K6VA 4H5FA 3RT6B 2ZNTA 1MH4A 1HSJA 4FECA 1B58A 4XKRA 5DEXA 1IQ7A 3OENA 4OFLA 4GWOA 4WEPA 3PPNA 1FQDA 3WAEA 1P1OA 5AA2D 1M5DA 3C35A 1XVYA 3VDFA 4F19A 1A40A 1R9QA 3B6WA 5I2KA 2H4IA 5AE4A 5B70A 3H6TA 5FHOA 5K2YA 4AB6A 3MBPA 3VVDA 3EF7A 3BFUA 3JV9A 1YCJA 3OEMA 4MFIA 1MPCA 4ZEFA 1MS7A 2D5WA 5H8NB 1AMFA 1A7LA 4U2RA 3VV5A 4I62A 1ANFA 3K1MA 1JW5A 1Y1ZA 4IO2A 5JK4A 4GXSB 4PFWA 4ZE9A 5ITPA 1BLFA 2I49A 2RC9A 5DVJA 3TZAA 2PVUA 2UXAA 3SEVA 4DLDA 4DXBA 1R1NA 4NF6A 4OMBA 4M1VA 3FGSA 1N3WA 5IKBA 1CE2A 1RYOA 5A5XB 3K6UA 1B4HA 5KZTA 3C4MA 1WODA 5ISUA 2I58A 3Q28A 1EZOA 2NWJA 1M5CA 3G3KA 1IXHA 2XXWA 3Q26A 4XIGQ 5DT6A 4H8JA 3SEUA 3TFLA 3USDA 3S9EA 2D21A 2ZYMA 2OK2A 1MY1A 2Q9TA 3MPLA 4GD5A 3E4RA 4GQOA 4ELOA 3N94A 2REGA 4NE4A 3V8XB 3C32A 4ESXA 3LSWA 4Q5TA 5H8QA 3FJ7A 2AL5A 3IORA 3FXRA 3RGYA 2DWAA 2ZMBA 1DPEA 4LVQA 4RPNA 3UP9A 2B3FA 4PFTA 3TUSA 3K6WA 1QVSA 1ZKBA 3FJGA 1RYXA 3R6UA 5TU0A 1ZBMA 5I84A 3C9HA 4R73A 2O84X 3HSTA 1ZLQA 1LBBA 4OZ9A 3TCHA 1EZ9A 3H3GA 2UVIA 1N84A 3IB0A 1VE4A 1R9LA 2IEEA 4IO3A 4JSOA 5I57A 3G3HA 3KSXA 3VLUA 3DP4A 3PMXA 3QUFA 4KQPA 1MPBA 2VD2A 2VP1A 3PD8A 3AXFA 4X9TA 2WKYA 3UORA 4AQ4A 1MXXA 1JVXA 2QS1A 3OO8A 1VR5A 4RNSA 1Q1KA 3L6HA 1PDAA 3U93A 2NUVA 3FXQA 1GVCA 5I56B 1P99A 4IB2A 1JNFA 2Y7PA 4LONB 4X1DA 1MQHA 2ALUA 4IY6A 4DCYA 1MPDA 3TTMA 3PPOA 3IJXB 1P1WA 4DE8A 4X1BA 3TELA 1POY1 1M5EA 1I6QA 1MXYA 3V5AA 2RC8A 5FHNA 1NH7A 2F78A 2RCAA 1XHYA 2H5YA 1US5A 4G8MA 3U72A 5B7DA 3K6XA 3G7WA 1IXIA 1EH3A 1SW1A 3MVXA 4OHNA 3IOVA 3DP8A 4BDQA 3KJTA 4FORA 4ECFA 4DDDA 3G3IA 3MVYA 3UIFA 3UA8A 4YB5A 3LSFB 3O9PA 1L5TA 3KEIA 3T9UA 2Y7IA 1QULA 1GGGA 4G68A 2H25A 4JB7A 4R6KA 3GBBA 3RPWA 3RN8A 2QRYA 2XXXA 3JYRA 3Q25A 5AA4B 3O97A 4Z7EA 2GHBA 3IB2A 3FZVA 3SEWA 4C1UA 5I2NB 1MY2A 3FV1A 2BJJX 1B6HA 3U8QA 3CFXA 1T0KA 4H1XA 2DP8A 4N13A 1Y1MA 3FVNA 2I4CA 2DE2A 2OCUA 4XKQA 3VVFA 1Y20A 4YKJA 1UTHB 4KYSA 4OYVA 3EPEA 4R6YA 3H6UA 1MXVA 3N5LA 3MZBA 3MP1A 1D9VA 4JWXA 3MVWA 4C0RA 2I0CA 4KYDA 3CRBA 1B9JA 2Y84A 4FE8A 4F1UA 2DYXA 1TFDA 5K2XA 1VSOA 1A8FA 4DIGA 5F7VA 1ELJA 3TQLA 3O2AA 2I48A 3CG3A 3LSXA 3PPPA 1PBQA 4F29A 4RK2A 2XX9A 1O63A 2PT2A 3A3UA 3DM0A 4LATA 2O68A 2OJTA 3QXMA 3MWBA 2I4BA 2Z22A 2O1MA 4U4SA 2F36A 2G29A 4EDPA 4EXLA 3FXUA 4FATA 3TTNA 2OWTA 1QW0A 2I6EA 1A55A 5EYFA 5L9MA 1PEBA 4RY1A 3ZKKA 3PPRA 3QK6A 2DVCA 3BBRA 4Z0IA 1PB9A 3F11A 1RKMA 5BWJA 1MXUA 5H8HA 4BDMA 3Q29A 5FTIA 5CMCA 2XXHA 2Y7WA 5AA3A 2P2AA 1IIWA 3RTFB 3SEYA 2XX8A 4P0IA 2OBGA 5AA1A 3ECRA 5L9SA 1B05A 3EHSA 3MJNA 2ZYKA 3PV0E 4ZS9A 4KYEA 1B7ZA 4F1VA 4NTLA 4LUBA 1EZPA 4TOZA 3RQTA 3I6VA 5KDTA 3EN3A 3TODA 4ZEDA 5CC2A 5KCJA 1S50A 3CR9A 3H6VA 1TFAA 4RK9A 1AL3A 3ZKLA 3H6WA 3IL1B 4HS7A 3TEPA 2FNCA 4LQ5A 4R6HA 3PUXE 5EHMA 1SD3A 2ZYNA 1JW4A 3EQ1A 4NF5B 3H03A 3OO7A 4QFKA 2UYFA 3RTWB 1FQFA 4ZECA 3K4UA 3UN6A 2Z8FA 3B6QA 3HO7A 3LR1A 4NF8B 1N7WA 2PYYA 4ND9A 1H43A 1SVXB 1MRPA 2ONKE 3H06B 3HN0A 3ILTB 1SYIA 2XXYA 1Z7NE 4O3AA 4R72A 3VVEA 3IOWA 3CFZA 2A5TA 1SI0A 4YICA 2Q89A 1D4NA 2Q8JA 1NFTA 2ZYOA 1XC1A 2XX7A 4FEBA 3TDJA 3KGCA 2OWSA 3IX1A 2E1SA 4F3GA 1H3DA 2R6GE 1H45A 2P0SA 4YB7A 5AA4A 2V93A 3HPIA 3OOAA 4ZZAA 2QS4A 1SI1A 2RINA 1O64A 3M3LA 3S2VA 2HXWA 5H8FA 4OEVA 3SETA 4OQOA 5TP9A 3T9XB 2RC7A 1ZTYA 4XKPA 3UGWA 3O6HA 4DCXA 4XKNA 3VXBA 1LFHA 1FQEA 1D9YA 1LAFE 2NOOA 5CBRA 1B3EA 1LFGA 1URGA 3D4CA 3JZJA 3PPQA 3W9WA 4GL0A 4U1OA 3T9VA 3K01A 5I57B 5DVFA 2DWHA 3PMWA 3KZGA 1OMPA 3H4ZA 5I58B 2GRVA 3OMBA 4ZDMA 1LBCA 1USYE 4MH5A 4E0XA 1IUDA 1H76A 3PD9A 3C36A 3E3KA 3SESA 5I56A 1XS5A 4PE5B 4F18A 1JVYA 2Z8EA 4POWA 1MQDA 5M2VA 3C31A 4WKMA 4FJPA 4FAJA 1FQBA 3K0VA 2Y7RA 1IITA 2FYIA 2CMOA 3QIMA 2HAVA 2D3IA 2QMXA 4GLIA 2ZNUA 2H9BA 3S4UA 4H65A 3H7MA 1Y3PA 1PB7A 3SKPA 5IAIA 2P1SA 4MLVA 5HM4B 1MDP1 4FIMA 4OETA 1B52A 2Y7KA 1A8EA 1CB6A 5FTHA 2X26A 3RUMA 3T96B 3MUQA 4YKPA 2YJPA 1P1QA 3FIRA 5TP9B 1Q35A 3RNNA 2ZXTA 3PUVE 1TXFA 3U1OA 1ZU0A 1MH3A 4GF8A 1UQWA 1AH5A 2AL4A 3PU5A 3PUZE 2F7AA 3KN7A 1LAGE 4FEDA 4HCYA 3MAMA 4KHZE 4NWDA 1FTJA 4OFOA 4QSEA 3IR1A 4KD5A 4F3BA 5I2NA 2O69A 3K1PA 3OELA 4LP2B 4YZZA 4NF6B 4ELRA 2HZLA 1B0LA 1OLCA 4DZ1A 4EF1A 4QF9A 1UIVA 1GR2A 3ONMA 4OVJA 5CMBA 5H8NA 4RJZA 1SW5A 2F35A 2PT1A 3G3JA 1OVTA 1UTHA 2HFBA 4EQBA 4ZEKA 1NNPA 4DXCA 3QYTA 1MXWA 3FATA 3O6GA 5I59B 3K02A 3IB1A 2X7QA 3C34A 4IO6A 4QFNA 3KN3A 3BFTA 1M5BA 1QUIA 2M8CA 4R9GA 3OO6A 3SDFA 1TWYA 2O7IA 4H6DA 1A99A 4IO5A 5AA2A 3OSRA 2XXUA 3HHFA 3L6GA 4I9DA 4PQJA 4R74A 3R7XA 5J1DA 1GV8A 2I3VA 1R6ZA 1IZ1A 4XTCQ 2HQ0A 1JETA 1SDXA 4GL8A 1Y4CA 3MW0A 3KFMA 1PC3A 1MQGA 4U21A 2G93A 1I6AA 1N76A 3S9NC 3M3FA 1B2HA 1OQGA 2A5SA 3KJ7A 4JXIA 3V89B 3S9LC 4G68C 3CSGA 3IJOB 4GRKA 5H8QB 3HV1A 4WXJA 3LUYA 2XXQA 2UYEA 4POXA 1FW0A 3MVZA 2VD3A 3MZ1A 4QSCA 1B3FA 1HSEA 1LB8A 1UTBB 2ABHA 2YPNA 2Z8DA 1BP5A 3IOUA 1DTZA 4G4PA 4I8CA 4JWOA 4R2FA 1WDNA 1P1NA 1USYH 2UVJA 4TLLB 4UA8A 3TQWA 4MBPA 4DXUA 2THIA 3CFLA 1FCKA 1UTBA 1XVXA 3GXAA 4GOTA 5JTYB 1NMUA 4NEDA 2HAUA 2X7PA 2PMSA 4R2BA 3T66A 1OIBA 4G2ZA 1B7HA 4F39A 5A5XA 4KCCA 4QHQA 1IXCA 1N3XA 3KSJA 4GIZA 1B40A 1AIVA 4YU0A 3FVKA 2UVHA 1POTA 3OEKA 1B1XA 2XXTA 5ELVA 3TMGA 2R71A 3OO9A 1LAXA 1SW2A 5CM6A 3KG2A 1MQJA 1MY0A 3N6UA 3TPAA 1UIUA 2XXIA 2DS9A 1FTMA 1HSLA 4KPTA 4PP0A 4UACA 1OVBA 4MF3A 2RKMA 4X48A 1B32A 1QKAA 3D4GA 4IO4A 4U23A 4EUOA 1PB8A 4ESWA 3VFJA 4EF2A 4ELPA 2V3UA 2A5TB 3PGFA 2DVZA 4OFJA 5CRYA 2VGQA 3FUZA 3EHUA 3CSBA 1SBPA 3M3KA 3E9XA 2FA7A 3MPKA 2DWIA 2O7UA 1MXZA 4H67A 4TQUQ 3S9MC 1B0HA 1QJMA 1BTJA 2F6GA 5BUUA 3G3FA 2XXPA 1URSA 1AOVA 2HEUA 2AYSA 3ZSFA 1B7UA 2B65A 3KBRA 2OLBA 3OXNA 4YMAA 1B3GA 3K00A 3HHGA 3O6IA 4YAHX 1Y3NA 1DSNA 4KCDA 3LSLA 4YKIA 4C1TA 3IK6B 1NNFA 5CMMA 3TKDA 5AA2B 3FVOA 1LAHE 4TLMB 5L8DA 2DWJA 3KOTA 2NXOA 3B6TA 2HCAA 3GLBA 4GVOA 4YMBA 1GTKA 4K3FA 4Q0CA 4NF4B 1IEJA 3MP8A 5KDTB 2DE3A 5HBCA 4LZ5A 1OQHA 1I6BA 3Q27A 2QJEA 4OWDA 1XT8A 2OZZA 1JW1A 2HZKA 1VFDA 1H44A 4KR5A 1S9TA 5CMKA 2F7CA 3VLWA 3IO6A 4LA9A 1BKAA 3W15C 4PFUA 1MG1A 1FQCA 3TTRA 2UVGA 2H99A 5ICQA 3TTLA 2AIXA 2I0BA 1WVJA 2F97A 4KFQA 4YB6A 2O51A 4IY5A 4P11A 3DELB 5ITOA 4BLAA 3EHTA 2Q2AA 2W7YA 2ESNA 3PUYE 4OESA 4YKKA 1QKBA 2QSXA 2PX1A 5TPAA 3THIA 1B5IA 4M4GA 5CI5A 1FTLA 4HCWA 3T9HB 1QUKA 1MY3A 4ZEBA 1LLSA 2VOZA 3V83A 3O29A 4G8HA 4NMYA 3CIJA 3U94A 2GH9A 3OD7A 4JBZA 4QRZA 1ZMGA 2QPQA 4E0WA 2VHAA 4G68B 4F3SA 3N6TA 4OEUA 3MZ9A 5JEIA 4H8IA 5H8HB 5KCJB 3K1NA 2V3TA 4OENA 4F31B 1FTKA 3MP6A 4BDOA 4QFLA 4N6PA 3FVGA 4MLQA 3KN8A 1A54A 2DOJA 2IA4A 2LAOA 3SERA 1QUJA 3T93B 2B3BA 1FTOA 1M5FA 2QL3A 4BDNA 2ZNSA 3LC8A 1YAEA 1BIYA 1LSTA 2Q88A 4ZE8A 4EQ7A 2QS3A 5I59A 3TAJA 1NNKA 4OERA 3VXCA 3U92A 1MM7A 3O66A 2GHAA 1XOCA 4P0GA 3N26A 4JSDA 4ONYA 5JTYA 4KI0E 4U22A 1NH8A 5F1QA 3PMVA 4ISUA 2ONSA 2F7BA 3TTKA 1B46A 2O1LA 3E13X 4BDLA 3QSLA 1VFEA 2XXVA 1ZJLA 4PFYA 2DQVA 4EQ9A 3VLVA 4HTGA 4EXKA 3C33A 2V84A 3G3GA 5LOMA 2DXRA 4LZ7A 3PUWE 1IXGA 2I3WA 3KOSA 3B7DA 2F5XA 1URDA 1II5A 1DOTA 1FQAA 5TPAB 5L9OA 3CVGA 2QMWA 2E0SA 4THIA 1O7TA 2PBWA 1JQFA 3CG1A 3TYHA 4IO7A 2DE4A 3LBSA 1Y9UA 1NKXA 2RCBA 3FV2A 1PBPA 4GXAA 3IO4A 4ZEIA 4ZZEA 4IGTA 3ZS6A 5ICTA 4O3BA 4OXVA 4RA1A 1YPNA 3IAZA 4JWYA 4RYAA 2RF1A 4LQ2A 3BKIB 4U1ZA 3QAXA 1MQIA 4NF5A 3TCFA 2DSFA 1MDQA 3FD3A 3R26A 3W9VA 4Q8RA 3MC2A 4RXLA 3T22A 4ELQA 5CBSA 4H5GA 1F9BA 3A09A 2H98A 3ODBA 4NF8A 4O3CA 2XD2A 3FJMA 3WAFA 1LCFA 3DP6A 1B51A 3GZGA 1J1NA 3A3CA 3VE1B 3FASA 1N04A 2R9JA 4GFRA 5DTBA 2F34A 2F6PA 5DVIA 1D3KA 1LCTA 1LGBC 2V25A 3ILUB 4F2QA 2XHDA 1B4ZA 3M8UA 4F3PA 4IGRA 4QFPA 1Y4TA 2CZLA 1Z7ME 1LFIA 1SQYA 2Z23A 3RY3A 4F22A 1DTGA 4U4XA 4WEDA 4G8NA 2O6AA 2XD3A 3QUJA 4Q30B 4AB5A 4BDRA 4HW8A 3RLFE 5H8FB 3RT8A 1ZIUA 4R9FA 4F1YA 2REJA 1N7XA 1MM6A 1SW4A 2F8DA 3I3VA 4R75A 5FHMA 4JDFA 1MY4A 3IOTA 1TT1A 4G77A 2YLNA 2Q2CA 4H0WA 4L17A 2ANJA 1NNTA 2ONRA 3OSQA 4PETA 4XXUA 1B3HA 1N0TA 4QFOA 5EHSA 5I2KB 1OLAA 5HPQA 1B5JA 2GFEA 3K2DA 3UK4A 1KWHA 5I58A 1B5HA 4QSDA 1JEUA 1P1UA 2DXYA 2V3QA 4F2OA 1S7YA 3I5OA 3GBAA 1DPPA 1SYHA 3CI8A 5H8SA 1EU8A 3HCQA 5DYHA 2KLFA 4OTEA 1DMBA 2XXRA
chains in the Genus database with same CATH superfamily
4I1DA 4NWCA 4N07A 2QS2A 4LZ8A 3DLNA 4MNCA 1B1HA 3MQ9A 1YTVA 3K6VA 2ZNTA 1HSJA 4FECA 4XKRA 1FBCA 4GWOA 4WEPA 3WAEA 5AA2D 1M5DA 1NV0A 1XVYA 2H4IA 5AE4A 5B70A 4O7IA 5ET6A 4PAIA 1YCJA 1A7LA 1ANFA 1Y1ZA 5ITPA 1BLFA 3SEVA 4DLDA 4PAFA 5IZ3A 5IKBA 3K6UA 5KZTA 1WODA 5ISUA 3G3KA 3USDA 3S9EA 2CZIA 2ZYMA 3MPLA 4GQOA 1EYJA 3V8XB 4Q5TA 5H8QA 3IORA 3FXRA 2DWAA 2ZMBA 1QVSA 1ZKBA 5TU0A 2VPOA 3C9HA 2XXKA 4HXVA 4PDDA 4R73A 4OZ9A 1EZ9A 2UVIA 3KSXA 4KQPA 4X9TA 3UORA 3AXFA 3BIGA 2NUVA 1MQHA 1MPDA 3TTMA 3PPOA 3V5AA 1M5EA 4IR8A 1NH7A 1XHYA 3U72A 1US5A 4G8MA 3G7WA 3KJTA 4MMPA 3LSFB 3T9UA 1FBPA 2H25A 3Q25A 4Z7EA 2GHBA 3FZVA 3CFXA 4N13A 1Y1MA 4XKQA 3FXBA 1Y20A 4KYSA 4OYVA 3EPEA 4OVSA 3H6UA 4GX4A 4JWXA 2DYXA 1VSOA 4DIGA 3TQLA 3O2AA 3CG3A 2WBDA 2PT2A 4AS5A 2I4BA 2Z22A 2O1MA 1NV6A 4U4SA 4EDPA 3FXUA 3TTNA 2OWTA 1QW0A 1A55A 5L9MA 2DVCA 5T3JA 1NV5A 1MXUA 4BDMA 5FTIA 5CMCA 1DK4A 2P2AA 4GWZA 2Y5LA 2OBGA 3PV0E 3RQTA 2V4CA 4RK9A 1AL3A 4LQ5A 5EHMA 4NF5B 3RTWB 3UN6A 5ET5A 4NF8B 1SVXB 4I3YA 4O3AA 4R72A 3VVEA 3IOWA 2ZYOA 1XC1A 4FEBA 3IX1A 4F3GA 1H3DA 1H45A 4YB7A 5AA4A 2V93A 3HPIA 2QS4A 2RINA 2HXWA 4OEVA 2RC7A 2XWKA 4XKNA 2NOOA 1URGA 1G0IA 3D4CA 4QXDA 3K01A 5DVFA 4O8MA 3OMBA 1USYE 4E0XA 1H76A 1XS5A 4PE5B 4POWA 4WKMA 4HE0A 2R8TA 2Y7RA 2QMXA 3HFUA 2ZNUA 2H9BA 3S4UA 3H7MA 3SKPA 1B52A 2Y7KA 1CB6A 3RUMA 2YJPA 3PUVE 1TXFA 1MH3A 4UABA 3IR1A 2O69A 3K1PA 4ELRA 4NF6B 3RPLA 1B0LA 4EF1A 3E78A 2F35A 1UTHA 4EQBA 2XA5A 4ZEKA 1NNPA 4H46A 5I59B 4GBWA 3IB1A 4PBHA 3C34A 3KN3A 3BFTA 1GV8A 2I3VA 2HQ0A 4GL8A 4U21A 1I6AA 4JXIA 3KJ7A 4OVRA 3IJOB 4MHFA 1FW0A 3MZ1A 4G4PA 5CRYA 2YPNA 4UA8A 3TQWA 4GOTA 2X7PA 4R2BA 2PMSA 1N3XA 5ESYA 1B1XA 5ELVA 3TMGA 3N6UA 3TPAA 1UIUA 5IZZA 1B32A 4IO4A 1PB8A 4ELPA 3PGFA 2ZZXA 2VGQA 3E9XA 1B0HA 1QJMA 1URSA 2AYSA 1NV7A 4YMAA 3K00A 4KCDA 1LAHE 2HXRA 3GLBA 4YMBA 4LZ5A 4OWDA 1JW1A 2HZKA 3MYUA 4LA9A 1MG1A 1FBGA 2UVGA 2H99A 3TTLA 4YB6A 4BLAA 2Q2AA 3PUYE 1QKBA 2QSXA 2PX1A 3THIA 4M4GA 3EKIA 4HCWA 1MY3A 2VOZA 2QVRA 3U94A 4G68B 5KCJB 4OENA 2V3TA 3MP6A 4BDOA 3FVGA 4MLQA 1A54A 1QUJA 1M5FA 1YAEA 1BK4A 1BIYA 1LSTA 4EQ7A 4OERA 1XOCA 4P0GA 4DI3D 4ONYA 1NH8A 2F7BA 3QSLA 2XXVA 4PFYA 2DQVA 4EXKA 2V84A 3PUWE 1DOTA 2E0SA 1O7TA 2PBWA 4PE3A 4IO7A 2DE4A 1Y9UA 3VXCA 5JK4A 3IAZA 4KXPA 4X8RA 5CBSA 4H5GA 3A09A 2ZZWA 4NF8A 2FVZA 3FJMA 1LCFA 3GZGA 3A3CA 3FASA 1D3KA 1FPBA 2V25A 4IGRA 4Q30B 4AB5A 4R9FA 1N7XA 1MM6A 4G77A 1IMBA 2ANJA 3OSQA 4PETA 5EHSA 4XXUA 1B3HA 1N0TA 2PCRA 1JEUA 1P1UA 1S7YA 3GBAA 1DPPA 1SYHA 1EU8A 4OTEA 1FRPA 3TCGA 1I69A 1Y3QA 5LTCA 4H5FA 3RT6B 1US4A 1IQ7A 4GWSA 3PPNA 2Q8MA 4F19A 1A40A 3B6WA 3MBPA 3BFUA 3JV9A 4ZEFA 4H45A 3VV5A 1JW5A 4GXSB 4ZE9A 3TZAA 4JVIA 1R1NA 1N3WA 1CE2A 1K9ZA 3C4MA 1EZOA 2XXWA 5DT6A 4XIGQ 4H8JA 1IMAA 2OK2A 5ET8A 2Q9TA 4ELOA 3C32A 4P8BA 2AL5A 3RGYA 5DW8A 4LVQA 2B3FA 4PFTA 3TUSA 3R6UA 3NOHA 2Y5KA 3IB0A 2IEEA 4PGPA 3DP4A 3VLUA 2VP1A 3OO8A 4AB6A 3L6HA 1PDAA 4IB2A 4LONB 2WX9A 2ALUA 4DE8A 1I6QA 5FHNA 2RCAA 3K6XA 1IXIA 4OHNA 4BDQA 4ECFA 4FORA 4DDDA 3O9PA 1L5TA 2Y7IA 1GGGA 4I3EA 3RPWA 2QRYA 3JYRA 5FBPA 4O94A 5A5LA 2PFYA 4C1UA 5I2NB 3FV1A 3FVNA 1SPIA 1UTHB 4N15A 4R6YA 1MXVA 3MZBA 1G0HA 3MVWA 2I0CA 3ROJA 4NN3A 5K2XA 5F7VA 1ELJA 2I48A 4F29A 3A3UA 3DM0A 4LATA 3MWBA 2F36A 4FATA 3ZKKA 3PPRA 1PB9A 3F11A 1RDXA 1IIWA 4NHBA 3MJNA 1B7ZA 3EN3A 4ZEDA 5KCJA 1TFAA 2FNCA 3PUXE 1KA1A 1FQFA 3K4UA 3B6QA 1N7WA 2PYYA 1H43A 1MRPA 2ONKE 1FPGA 2Q89A 1D4NA 1IMFA 4P1EA 2OWSA 3IFAA 3U65A 3OOAA 1SI1A 1O64A 3S2VA 5H8FA 4P47A 5TP9A 3T9XB 2F3BA 1ZTYA 3VXBA 1B3EA 1FPJA 4GL0A 5IM2A 5I57B 2DWHA 5I58B 4MH5A 4PGNA 3E3KA 3SESA 4F18A 5M2VA 2KR0A 3C31A 3K0VA 1NV1A 2CMOA 3QIMA 2HAVA 2D3IA 4GLIA 4H65A 1PB7A 5IAIA 1MDP1 4N81A 1NV2A 3T0JA 4YKPA 5TP9B 1P1QA 3FIRA 4MEVA 1FBDA 4FEDA 3RPLB 3KN7A 4OFOA 4QSEA 4KD5A 4YZZA 1LBYA 1OLCA 4DZ1A 4QF9A 1UIVA 1GR2A 3ONMA 5H8NA 1SW5A 3G3JA 2HFBA 3A29A 3O6GA 3K02A 2X7QA 4IO6A 1M5BA 4R9GA 2M8CA 3OO6A 2O7IA 5AA2A 3OSRA 2XXUA 3L6GA 4I9DA 4PQJA 1R6ZA 4XTCQ 1JETA 1SDXA 2MKZA 3MW0A 4NF0A 2G93A 3S9NC 3M3FA 3S9LC 3CSGA 4GRKA 5H8QB 4WXJA 3LUYA 2XXQA 4POXA 2VPNA 4QSCA 1HSEA 1LB8A 3IOUA 1DTZA 4I8CA 4FAJA 1WDNA 2UVJA 4MBPA 2THIA 4NEDA 2HAUA 3T66A 2DDKA 4G2ZA 4F39A 4KCCA 4GIZA 3FVKA 4GBVA 2R71A 4OA4A 2XXIA 4PP0A 4UACA 4KPTA 4MF3A 4P56A 1QKAA 4EUOA 4ESWA 2V3UA 1K9YA 2DVZA 3MPKA 3FUZA 3M3KA 2FA7A 4TQUQ 3S9MC 2F6GA 2XXPA 2OLBA 4PF8A 4YAHX 3HHGA 3O6IA 3IK6B 3FVOA 4TLMB 1D9QA 2NXOA 1GTKA 4K3FA 4NF4B 2DE3A 1OQHA 3Q27A 2OZZA 1VFDA 1H44A 1S9TA 3IO6A 4PFUA 5ICQA 1FQCA 3TTRA 4KFQA 4IY5A 2W7YA 2OWZA 1B5IA 3V83A 3O29A 2GH9A 1ZMGA 2QVVA 4JVDA 2VHAA 4OEUA 2DOJA 2IA4A 2LAOA 5B7DA 3SERA 4BDNA 1FBHA 4ZE8A 4O7MA 2QS3A 4KI0E 3PMVA 1RDZA 1JP4A 2XWVA 4HTGA 3G3GA 5LOMA 2DXRA 1IXGA 1EYKA 1URDA 4NQ8A 4G61A 5TPAB 3CVGA 2QMWA 1JQFA 3CG1A 4DI4B 4GXAA 4ZEIA 4O3BA 3QAXA 3MC2A 2R9JA 4GFRA 2F34A 2F6PA 4F2QA 1LGBC 2XHDA 4F3PA 1LFIA 1SQYA 2Z23A 3RY3A 4WEDA 4G8NA 3RLFE 3RT8A 2REJA 1SW4A 4R75A 3IOTA 4H0WA 1FTAA 3UK4A 1B5HA 4QSDA 4F2OA 3I5OA 1NV3A 3CI8A 3ISPA 3HCQA 3PTYA 1DMBA 4RPOA 2NVUB 1ATGA 3P7IA 4MCOA 1B3LA 1JEVA 5I5PA 1MH4A 1B58A 5DEXA 3OENA 1NUZA 4N6DA 3VDFA 5EYGA 5K2YA 2F3DA 4MFIA 1MPCA 5H8NB 4U2RA 2I49A 5DVJA 2PVUA 4DXBA 4MIJA 1YXIA 2P3NA 4OMBA 4QBAA 3FGSA 1RYOA 5A5XB 3Q28A 2NWJA 1M5CA 3Q26A 3SEUA 3TFLA 2D21A 2VT5A 4GD5A 3E4RA 3N94A 2REGA 4NE4A 3LSWA 3B50A 1FJ6A 1DPEA 3K6WA 3FJGA 1RYXA 2O84X 3HSTA 1ZLQA 1LBBA 3TCHA 4P9KA 1N84A 5I57A 1VE4A 3CHGA 4X04A 2VD2A 2WYPA 2WKYA 1JVXA 5JTYA 1GVCA 1P99A 4X1DA 1JNFA 2Y7PA 4IY6A 4P1LA 3IJXB 1P1WA 1FBFA 4OANA 1EH3A 1SW1A 1FSAA 3UIFA 4YB5A 3KEIA 4G68A 4JB7A 4R6KA 3O97A 5I7IA 1B6HA 3U8QA 4H1XA 2I4CA 2DE2A 2FHYA 3VVFA 4YKJA 3N5LA 3CRBA 1B9JA 2Y84A 4FE8A 4F1UA 1LBXA 2WYKA 3LSXA 3PPPA 1PBQA 2O68A 3QXMA 2G29A 4NAPA 2I6EA 5EYFA 2ZZVA 1PEBA 5EQ8A 3QK6A 3BBRA 4Z0IA 1RKMA 4GX3A 5H8HA 2Y7WA 3RTFB 3SEYA 5AA1A 1IMDA 3FBPA 5L9SA 1B05A 3EHSA 4ZS9A 4TOZA 2PFZA 3I6VA 5I3SA 3TODA 2BJIA 3TEPA 4HS7A 4R6HA 1SD3A 2ZYNA 1JW4A 3H03A 4QFKA 2UYFA 4ZECA 2Z8FA 3HO7A 4ND9A 3HN0A 1SYIA 1Z7NE 4AS4A 2CEYA 2A5TA 1SI0A 4YICA 1NFTA 2XX7A 3TDJA 1VDWA 2R6GE 2P0SA 4ZZAA 4N6KA 3M3LA 3UGWA 1LAFE 3PPQA 3W9WA 4U1OA 3T9VA 3H4ZA 2GRVA 4ZDMA 1LBCA 2KQZA 1IUDA 3PD9A 3C36A 5I56A 1MQDA 4FJPA 1FQBA 2FYIA 4PFBA 2P1SA 5FTHA 3T96B 1Q35A 5EQAA 2ZXTA 1AH5A 3PU5A 4C0RA 1LAGE 3MAMA 1FTJA 5I2NA 4PFRA 4LP2B 4OVJA 5CMBA 1OVTA 4DXCA 3KC0A 3FATA 1Q9DA 4XF5A 1TWYA 4H6DA 3RYDA 3HHFA 3R7XA 5J1DA 1IZ1A 5AA2B 1Y4CA 3KFMA 2XWIA 1N76A 4HE1A 4G68C 1YYZA 3HV1A 2UYEA 3MVZA 1NUYA 2ABHA 4TLLB 4JWOA 1P1NA 1FPDA 1FCKA 1UTBA 1NMUA 3LV0A 1OIBA 5A5XA 4QHQA 1IXCA 1IMEA 3KSJA 1AIVA 4YU0A 2UVHA 4N8YA 3OEKA 2XXTA 3OO9A 1LAXA 1SW2A 3KC1A 3KG2A 1MQJA 2FBPA 1FTMA 2RKMA 3D4GA 4U23A 4EF2A 4N91A 4OFJA 2WEFA 3CSBA 2GQ1A 2DWIA 4XEQA 5BUUA 3G3FA 4GWUA 2HEUA 1B7UA 3KBRA 4C1TA 5CMMA 3KOTA 3B6TA 4Q0CA 1KZ8A 5HBCA 1XT8A 4KR5A 5CMKA 2F7CA 3W15C 4NGUA 2I0BA 4GWWA 4P11A 3DELB 5ITOA 2L5VA 4OESA 5CI5A 1FTLA 4ZEBA 1NV4A 1LLSA 4G8HA 3CIJA 3OD7A 4QRZA 5F24A 2QPQA 4E0WA 3N6TA 3MZ9A 5JEIA 4H8IA 3K1NA 1FTKA 4N6PA 3T93B 2B3BA 2QL3A 3LC8A 2Q88A 3U92A 1MM7A 3O66A 2GHAA 3N26A 5F1QA 2ONSA 3TTKA 4LN5A 1VFEA 1ZJLA 3VLVA 4MNPA 4LZ7A 3SZPA 3B7DA 3GYYA 1FQAA 2JJKA 4FBPA 3TYHA 3LBSA 2RCBA 3IO4A 5ICTA 4OXVA 4RA1A 3QMFA 4JWYA 5AA3A 4U1ZA 3TCFA 3W9VA 1MQIA 4NF5A 2DSFA 1MDQA 3T22A 1F9BA 4O3CA 2H98A 3ODBA 1B51A 1J1NA 3VE1B 4PBQA 1N04A 5DVIA 3ILUB 3M8UA 2WBBA 1Y4TA 2CZLA 4F22A 4U4XA 2O6AA 4HW8A 3E79A 1ZIUA 2F8DA 2YLNA 2Q2CA 4L17A 1NNTA 2ONRA 5I2KB 1FPFA 5HPQA 4MX6A 1B5JA 2GFEA 3T1BA 3K2DA 2DXYA 5DYHA 2XXRA 4NF4A 3SEXA 1NL5A 3O28A 1LB9A 5DEXB 2XWOA 4OFLA 1FQDA 1P1OA 3C35A 1R9QA 5I2KA 3H6TA 5FHOA 3VVDA 3EF7A 3OEMA 1MS7A 2D5WA 1AMFA 4I62A 3K1MA 4IO2A 1INPA 4PFWA 2RC9A 1LBWA 2CZKA 2UXAA 1DCUA 4NF6A 4M1VA 1NI9A 1B4HA 2I58A 5IZ3B 4N17A 1IXHA 2B4LA 1MY1A 2HPGA 4ESXA 2OX3A 3FJ7A 3UP9A 4RPNA 5EQ9A 5LDZA 1ZBMA 4OVQA 5I84A 3H3GA 2FIXA 1R9LA 4JSOA 4IO3A 3G3HA 3PMXA 4GWYA 3QUFA 1MPBA 4AQ4A 3PD8A 1MXXA 2QS1A 1VR5A 4RNSA 1Q1KA 5I56B 3U93A 3FXQA 4DCYA 4X1BA 3TELA 1POY1 1MXYA 2RC8A 2F78A 2H5YA 1CNQA 3MVXA 3IOVA 3DP8A 3G3IA 3MVYA 1IMCA 3UA8A 4PTKA 1QULA 3GBBA 3RN8A 2XXXA 5AA4B 3IB2A 2FIEA 3SEWA 1MY2A 2BJJX 4GX6A 1T0KA 2DP8A 2OCUA 3D1RA 3MP1A 1D9VA 4MJOA 1NUXA 4KYDA 1TFDA 4PAKA 1A8FA 4RK2A 2XX9A 1O63A 2OJTA 4N8GA 4EXLA 4XFEA 1FBEA 4RY1A 5BWJA 3Q29A 2XXHA 2XX8A 4P0IA 3ECRA 2ZYKA 4KYEA 4F1VA 4NTLA 4LUBA 1EZPA 5KDTA 5CC2A 1S50A 3CR9A 3H6VA 3ZKLA 3H6WA 3IL1B 1FPKA 3EQ1A 3OO7A 1FPEA 3LR1A 3ILTB 3H06B 2XXYA 3MSTA 3CFZA 2Q8JA 3KGCA 2E1SA 3SETA 4OQOA 4XKPA 4DCXA 3O6HA 1LFHA 1FQEA 1D9YA 5CBRA 3JZJA 1LFGA 3PMWA 3KZGA 1OMPA 1JVYA 2B4MA 2Z8EA 1IITA 3BIHA 1Y3PA 4MLVA 5HM4B 4FIMA 2QFLA 4OETA 5IGAA 1A8EA 2X26A 3MUQA 3RNNA 4MNIA 3U1OA 1ZU0A 4GF8A 1UQWA 2AL4A 3PUZE 4HCYA 2F7AA 4KHZE 4F3BA 3OELA 2HZLA 3LUZA 3KBZA 4RJZA 2PT1A 4NG7A 4HE2A 3QYTA 1MXWA 1XI6A 4QFNA 4P3LA 1QUIA 3SDFA 4IO5A 1A99A 4R74A 1RDYA 1PC3A 1MQGA 1DBZA 1B2HA 1OQGA 2A5SA 3V89B 2VD3A 4ELQA 1B3FA 1UTBB 2Z8DA 4NWDA 1BP5A 4R2FA 1USYH 4DXUA 3CFLA 5JTYB 3GXAA 1XVXA 5ET7A 1B7HA 1B40A 1POTA 5CM6A 4N4UA 1MY0A 2DS9A 1HSLA 1OVBA 4PC9A 1FJ9A 3VFJA 2A5TB 3EHUA 4I40A 1SBPA 1LBZA 2O7UA 4H67A 1MXZA 4OVTA 1BTJA 1AOVA 3ZSFA 2B65A 1FPLA 3OXNA 1B3GA 5EYHA 1Y3NA 1DSNA 4YKIA 3LSLA 1NNFA 3TKDA 5L8DA 2DWJA 2HCAA 4GVOA 2QVUA 1IEJA 3MP8A 5KDTB 1I6BA 2QJEA 3VLWA 1BKAA 4GWXA 2AIXA 5EQ7A 1WVJA 2F97A 2HHMA 5J16A 2O51A 3EHTA 4YKKA 2ESNA 1LEVA 5TPAA 3T9HB 1QUKA 4NMYA 4JBZA 3B8BA 4F3SA 5H8HB 1FPIA 4F31B 4PCDA 4QFLA 3KN8A 1FTOA 2ZNSA 1NUWA 2Q74A 5I59A 3TAJA 1NNKA 4JSDA 4U22A 4ISUA 1B46A 2O1LA 4MAGA 3E13X 4BDLA 4EQ9A 3C33A 1QGXA 4OVPA 2I3WA 3KOSA 2F5XA 1II5A 4NX1A 5L9OA 2P3VA 4THIA 4X48A 3FV2A 1NKXA 3ZS6A 1PBPA 4ZZEA 4IGTA 1YZ0A 1YPNA 4RYAA 4JVCA 2RF1A 4LQ2A 1KA0A 3BKIB 4Q8RA 3FD3A 3R26A 4PFIA 4RXLA 5IZ1A 2XD2A 3WAFA 3DP6A 5DTBA 1LCTA 1B4ZA 1EYIA 4QFPA 1Z7ME 1DTGA 2XD3A 3QUJA 4BDRA 5H8FB 4F1YA 1LBVA 3I3VA 5FHMA 4JDFA 1MY4A 1TT1A 3IFCA 2CEXA 4QFOA 1OLAA 1AWBA 4PF6A 5I58A 1KWHA 2V3QA 4PDHA 2CZHA 5H8SA 2KLFA
chains in the Genus database with same CATH topology
4RPOA 4NF4A 3SEXA 4I1DA 1NL5A 4NWCA 4N07A 2QS2A 4LZ8A 1I69A 1ATGA 3DLNA 2NVUB 3TCGA 1B1HA 1Y3QA 3P7IA 1B3LA 1LB9A 3O28A 5DEXB 1JEVA 3MQ9A 1YTVA 1US4A 3K6VA 4H5FA 3RT6B 2ZNTA 1MH4A 1HSJA 4FECA 1B58A 4XKRA 5DEXA 1IQ7A 3OENA 4OFLA 4GWOA 4WEPA 3PPNA 1FQDA 3WAEA 1P1OA 5AA2D 1M5DA 3C35A 1XVYA 3VDFA 4F19A 1A40A 1R9QA 3B6WA 5I2KA 2H4IA 5AE4A 5B70A 3H6TA 5FHOA 5K2YA 4AB6A 3MBPA 3VVDA 3EF7A 3BFUA 3JV9A 1YCJA 3OEMA 4MFIA 1MPCA 4ZEFA 1MS7A 2D5WA 5H8NB 1AMFA 1A7LA 4U2RA 3VV5A 4I62A 1ANFA 3K1MA 1JW5A 1Y1ZA 4IO2A 5JK4A 4GXSB 4PFWA 4ZE9A 5ITPA 1BLFA 2I49A 2RC9A 5DVJA 3TZAA 2PVUA 2UXAA 3SEVA 4DLDA 4DXBA 1R1NA 4NF6A 4OMBA 4M1VA 3FGSA 1N3WA 5IKBA 1CE2A 1RYOA 5A5XB 3K6UA 1B4HA 5KZTA 3C4MA 1WODA 5ISUA 2I58A 3Q28A 1EZOA 2NWJA 1M5CA 3G3KA 1IXHA 2XXWA 3Q26A 4XIGQ 5DT6A 4H8JA 3SEUA 3TFLA 3USDA 3S9EA 2D21A 2ZYMA 2OK2A 1MY1A 2Q9TA 3MPLA 4GD5A 3E4RA 4GQOA 4ELOA 3N94A 2REGA 4NE4A 3V8XB 3C32A 4ESXA 3LSWA 4Q5TA 5H8QA 3FJ7A 2AL5A 3IORA 3FXRA 3RGYA 2DWAA 2ZMBA 1DPEA 4LVQA 4RPNA 3UP9A 2B3FA 4PFTA 3TUSA 3K6WA 1QVSA 1ZKBA 3FJGA 1RYXA 3R6UA 5TU0A 1ZBMA 5I84A 3C9HA 4R73A 2O84X 3HSTA 1ZLQA 1LBBA 4OZ9A 3TCHA 1EZ9A 3H3GA 2UVIA 1N84A 3IB0A 1VE4A 1R9LA 2IEEA 4IO3A 4JSOA 5I57A 3G3HA 3KSXA 3VLUA 3DP4A 3PMXA 3QUFA 4KQPA 1MPBA 2VD2A 2VP1A 3PD8A 3AXFA 4X9TA 2WKYA 3UORA 4AQ4A 1MXXA 1JVXA 2QS1A 3OO8A 1VR5A 4RNSA 1Q1KA 3L6HA 1PDAA 3U93A 2NUVA 3FXQA 1GVCA 5I56B 1P99A 4IB2A 1JNFA 2Y7PA 4LONB 4X1DA 1MQHA 2ALUA 4IY6A 4DCYA 1MPDA 3TTMA 3PPOA 3IJXB 1P1WA 4DE8A 4X1BA 3TELA 1POY1 1M5EA 1I6QA 1MXYA 3V5AA 2RC8A 5FHNA 1NH7A 2F78A 2RCAA 1XHYA 2H5YA 1US5A 4G8MA 3U72A 5B7DA 3K6XA 3G7WA 1IXIA 1EH3A 1SW1A 3MVXA 4OHNA 3IOVA 3DP8A 4BDQA 3KJTA 4FORA 4ECFA 4DDDA 3G3IA 3MVYA 3UIFA 3UA8A 4YB5A 3LSFB 3O9PA 1L5TA 3KEIA 3T9UA 2Y7IA 1QULA 1GGGA 4G68A 2H25A 4JB7A 4R6KA 3GBBA 3RPWA 3RN8A 2QRYA 2XXXA 3JYRA 3Q25A 5AA4B 3O97A 4Z7EA 2GHBA 3IB2A 3FZVA 3SEWA 4C1UA 5I2NB 1MY2A 3FV1A 2BJJX 1B6HA 3U8QA 3CFXA 1T0KA 4H1XA 2DP8A 4N13A 1Y1MA 3FVNA 2I4CA 2DE2A 2OCUA 4XKQA 3VVFA 1Y20A 4YKJA 1UTHB 4KYSA 4OYVA 3EPEA 4R6YA 3H6UA 1MXVA 3N5LA 3MZBA 3MP1A 1D9VA 4JWXA 3MVWA 4C0RA 2I0CA 4KYDA 3CRBA 1B9JA 2Y84A 4FE8A 4F1UA 2DYXA 1TFDA 5K2XA 1VSOA 1A8FA 4DIGA 5F7VA 1ELJA 3TQLA 3O2AA 2I48A 3CG3A 3LSXA 3PPPA 1PBQA 4F29A 4RK2A 2XX9A 1O63A 2PT2A 3A3UA 3DM0A 4LATA 2O68A 2OJTA 3QXMA 3MWBA 2I4BA 2Z22A 2O1MA 4U4SA 2F36A 2G29A 4EDPA 4EXLA 3FXUA 4FATA 3TTNA 2OWTA 1QW0A 2I6EA 1A55A 5EYFA 5L9MA 1PEBA 4RY1A 3ZKKA 3PPRA 3QK6A 2DVCA 3BBRA 4Z0IA 1PB9A 3F11A 1RKMA 5BWJA 1MXUA 5H8HA 4BDMA 3Q29A 5FTIA 5CMCA 2XXHA 2Y7WA 5AA3A 2P2AA 1IIWA 3RTFB 3SEYA 2XX8A 4P0IA 2OBGA 5AA1A 3ECRA 5L9SA 1B05A 3EHSA 3MJNA 2ZYKA 3PV0E 4ZS9A 4KYEA 1B7ZA 4F1VA 4NTLA 4LUBA 1EZPA 4TOZA 3RQTA 3I6VA 5KDTA 3EN3A 3TODA 4ZEDA 5CC2A 5KCJA 1S50A 3CR9A 3H6VA 1TFAA 4RK9A 1AL3A 3ZKLA 3H6WA 3IL1B 4HS7A 3TEPA 2FNCA 4LQ5A 4R6HA 3PUXE 5EHMA 1SD3A 2ZYNA 1JW4A 3EQ1A 4NF5B 3H03A 3OO7A 4QFKA 2UYFA 3RTWB 1FQFA 4ZECA 3K4UA 3UN6A 2Z8FA 3B6QA 3HO7A 3LR1A 4NF8B 1N7WA 2PYYA 4ND9A 1H43A 1SVXB 1MRPA 2ONKE 3H06B 3HN0A 3ILTB 1SYIA 2XXYA 1Z7NE 4O3AA 4R72A 3VVEA 3IOWA 3CFZA 2A5TA 1SI0A 4YICA 2Q89A 1D4NA 2Q8JA 1NFTA 2ZYOA 1XC1A 2XX7A 4FEBA 3TDJA 3KGCA 2OWSA 3IX1A 2E1SA 4F3GA 1H3DA 2R6GE 1H45A 2P0SA 4YB7A 5AA4A 2V93A 3HPIA 3OOAA 4ZZAA 2QS4A 1SI1A 2RINA 1O64A 3M3LA 3S2VA 2HXWA 5H8FA 4OEVA 3SETA 4OQOA 5TP9A 3T9XB 2RC7A 1ZTYA 4XKPA 3UGWA 3O6HA 4DCXA 4XKNA 3VXBA 1LFHA 1FQEA 1D9YA 1LAFE 2NOOA 5CBRA 1B3EA 1LFGA 1URGA 3D4CA 3JZJA 3PPQA 3W9WA 4GL0A 4U1OA 3T9VA 3K01A 5I57B 5DVFA 2DWHA 3PMWA 3KZGA 1OMPA 3H4ZA 5I58B 2GRVA 3OMBA 4ZDMA 1LBCA 1USYE 4MH5A 4E0XA 1IUDA 1H76A 3PD9A 3C36A 3E3KA 3SESA 5I56A 1XS5A 4PE5B 4F18A 1JVYA 2Z8EA 4POWA 1MQDA 5M2VA 3C31A 4WKMA 4FJPA 4FAJA 1FQBA 3K0VA 2Y7RA 1IITA 2FYIA 2CMOA 3QIMA 2HAVA 2D3IA 2QMXA 4GLIA 2ZNUA 2H9BA 3S4UA 4H65A 3H7MA 1Y3PA 1PB7A 3SKPA 5IAIA 2P1SA 4MLVA 5HM4B 1MDP1 4FIMA 4OETA 1B52A 2Y7KA 1A8EA 1CB6A 5FTHA 2X26A 3RUMA 3T96B 3MUQA 4YKPA 2YJPA 1P1QA 3FIRA 5TP9B 1Q35A 3RNNA 2ZXTA 3PUVE 1TXFA 3U1OA 1ZU0A 1MH3A 4GF8A 1UQWA 1AH5A 2AL4A 3PU5A 3PUZE 2F7AA 3KN7A 1LAGE 4FEDA 4HCYA 3MAMA 4KHZE 4NWDA 1FTJA 4OFOA 4QSEA 3IR1A 4KD5A 4F3BA 5I2NA 2O69A 3K1PA 3OELA 4LP2B 4YZZA 4NF6B 4ELRA 2HZLA 1B0LA 1OLCA 4DZ1A 4EF1A 4QF9A 1UIVA 1GR2A 3ONMA 4OVJA 5CMBA 5H8NA 4RJZA 1SW5A 2F35A 2PT1A 3G3JA 1OVTA 1UTHA 2HFBA 4EQBA 4ZEKA 1NNPA 4DXCA 3QYTA 1MXWA 3FATA 3O6GA 5I59B 3K02A 3IB1A 2X7QA 3C34A 4IO6A 4QFNA 3KN3A 3BFTA 1M5BA 1QUIA 2M8CA 4R9GA 3OO6A 3SDFA 1TWYA 2O7IA 4H6DA 1A99A 4IO5A 5AA2A 3OSRA 2XXUA 3HHFA 3L6GA 4I9DA 4PQJA 4R74A 3R7XA 5J1DA 1GV8A 2I3VA 1R6ZA 1IZ1A 4XTCQ 2HQ0A 1JETA 1SDXA 4GL8A 1Y4CA 3MW0A 3KFMA 1PC3A 1MQGA 4U21A 2G93A 1I6AA 1N76A 3S9NC 3M3FA 1B2HA 1OQGA 2A5SA 3KJ7A 4JXIA 3V89B 3S9LC 4G68C 3CSGA 3IJOB 4GRKA 5H8QB 3HV1A 4WXJA 3LUYA 2XXQA 2UYEA 4POXA 1FW0A 3MVZA 2VD3A 3MZ1A 4QSCA 1B3FA 1HSEA 1LB8A 1UTBB 2ABHA 2YPNA 2Z8DA 1BP5A 3IOUA 1DTZA 4G4PA 4I8CA 4JWOA 4R2FA 1WDNA 1P1NA 1USYH 2UVJA 4TLLB 4UA8A 3TQWA 4MBPA 4DXUA 2THIA 3CFLA 1FCKA 1UTBA 1XVXA 3GXAA 4GOTA 5JTYB 1NMUA 4NEDA 2HAUA 2X7PA 2PMSA 4R2BA 3T66A 1OIBA 4G2ZA 1B7HA 4F39A 5A5XA 4KCCA 4QHQA 1IXCA 1N3XA 3KSJA 4GIZA 1B40A 1AIVA 4YU0A 3FVKA 2UVHA 1POTA 3OEKA 1B1XA 2XXTA 5ELVA 3TMGA 2R71A 3OO9A 1LAXA 1SW2A 5CM6A 3KG2A 1MQJA 1MY0A 3N6UA 3TPAA 1UIUA 2XXIA 2DS9A 1FTMA 1HSLA 4KPTA 4PP0A 4UACA 1OVBA 4MF3A 2RKMA 4X48A 1B32A 1QKAA 3D4GA 4IO4A 4U23A 4EUOA 1PB8A 4ESWA 3VFJA 4EF2A 4ELPA 2V3UA 2A5TB 3PGFA 2DVZA 4OFJA 5CRYA 2VGQA 3FUZA 3EHUA 3CSBA 1SBPA 3M3KA 3E9XA 2FA7A 3MPKA 2DWIA 2O7UA 1MXZA 4H67A 4TQUQ 3S9MC 1B0HA 1QJMA 1BTJA 2F6GA 5BUUA 3G3FA 2XXPA 1URSA 1AOVA 2HEUA 2AYSA 3ZSFA 1B7UA 2B65A 3KBRA 2OLBA 3OXNA 4YMAA 1B3GA 3K00A 3HHGA 3O6IA 4YAHX 1Y3NA 1DSNA 4KCDA 3LSLA 4YKIA 4C1TA 3IK6B 1NNFA 5CMMA 3TKDA 5AA2B 3FVOA 1LAHE 4TLMB 5L8DA 2DWJA 3KOTA 2NXOA 3B6TA 2HCAA 3GLBA 4GVOA 4YMBA 1GTKA 4K3FA 4Q0CA 4NF4B 1IEJA 3MP8A 5KDTB 2DE3A 5HBCA 4LZ5A 1OQHA 1I6BA 3Q27A 2QJEA 4OWDA 1XT8A 2OZZA 1JW1A 2HZKA 1VFDA 1H44A 4KR5A 1S9TA 5CMKA 2F7CA 3VLWA 3IO6A 4LA9A 1BKAA 3W15C 4PFUA 1MG1A 1FQCA 3TTRA 2UVGA 2H99A 5ICQA 3TTLA 2AIXA 2I0BA 1WVJA 2F97A 4KFQA 4YB6A 2O51A 4IY5A 4P11A 3DELB 5ITOA 4BLAA 3EHTA 2Q2AA 2W7YA 2ESNA 3PUYE 4OESA 4YKKA 1QKBA 2QSXA 2PX1A 5TPAA 3THIA 1B5IA 4M4GA 5CI5A 1FTLA 4HCWA 3T9HB 1QUKA 1MY3A 4ZEBA 1LLSA 2VOZA 3V83A 3O29A 4G8HA 4NMYA 3CIJA 3U94A 2GH9A 3OD7A 4JBZA 4QRZA 1ZMGA 2QPQA 4E0WA 2VHAA 4G68B 4F3SA 3N6TA 4OEUA 3MZ9A 5JEIA 4H8IA 5H8HB 5KCJB 3K1NA 2V3TA 4OENA 4F31B 1FTKA 3MP6A 4BDOA 4QFLA 4N6PA 3FVGA 4MLQA 3KN8A 1A54A 2DOJA 2IA4A 2LAOA 3SERA 1QUJA 3T93B 2B3BA 1FTOA 1M5FA 2QL3A 4BDNA 2ZNSA 3LC8A 1YAEA 1BIYA 1LSTA 2Q88A 4ZE8A 4EQ7A 2QS3A 5I59A 3TAJA 1NNKA 4OERA 3VXCA 3U92A 1MM7A 3O66A 2GHAA 1XOCA 4P0GA 3N26A 4JSDA 4ONYA 5JTYA 4KI0E 4U22A 1NH8A 5F1QA 3PMVA 4ISUA 2ONSA 2F7BA 3TTKA 1B46A 2O1LA 3E13X 4BDLA 3QSLA 1VFEA 2XXVA 1ZJLA 4PFYA 2DQVA 4EQ9A 3VLVA 4HTGA 4EXKA 3C33A 2V84A 3G3GA 5LOMA 2DXRA 4LZ7A 3PUWE 1IXGA 2I3WA 3KOSA 3B7DA 2F5XA 1URDA 1II5A 1DOTA 1FQAA 5TPAB 5L9OA 3CVGA 2QMWA 2E0SA 4THIA 1O7TA 2PBWA 1JQFA 3CG1A 3TYHA 4IO7A 2DE4A 3LBSA 1Y9UA 1NKXA 2RCBA 3FV2A 1PBPA 4GXAA 3IO4A 4ZEIA 4ZZEA 4IGTA 3ZS6A 5ICTA 4O3BA 4OXVA 4RA1A 1YPNA 3IAZA 4JWYA 4RYAA 2RF1A 4LQ2A 3BKIB 4U1ZA 3QAXA 1MQIA 4NF5A 3TCFA 2DSFA 1MDQA 3FD3A 3R26A 3W9VA 4Q8RA 3MC2A 4RXLA 3T22A 4ELQA 5CBSA 4H5GA 1F9BA 3A09A 2H98A 3ODBA 4NF8A 4O3CA 2XD2A 3FJMA 3WAFA 1LCFA 3DP6A 1B51A 3GZGA 1J1NA 3A3CA 3VE1B 3FASA 1N04A 2R9JA 4GFRA 5DTBA 2F34A 2F6PA 5DVIA 1D3KA 1LCTA 1LGBC 2V25A 3ILUB 4F2QA 2XHDA 1B4ZA 3M8UA 4F3PA 4IGRA 4QFPA 1Y4TA 2CZLA 1Z7ME 1LFIA 1SQYA 2Z23A 3RY3A 4F22A 1DTGA 4U4XA 4WEDA 4G8NA 2O6AA 2XD3A 3QUJA 4Q30B 4AB5A 4BDRA 4HW8A 3RLFE 5H8FB 3RT8A 1ZIUA 4R9FA 4F1YA 2REJA 1N7XA 1MM6A 1SW4A 2F8DA 3I3VA 4R75A 5FHMA 4JDFA 1MY4A 3IOTA 1TT1A 4G77A 2YLNA 2Q2CA 4H0WA 4L17A 2ANJA 1NNTA 2ONRA 3OSQA 4PETA 4XXUA 1B3HA 1N0TA 4QFOA 5EHSA 5I2KB 1OLAA 5HPQA 1B5JA 2GFEA 3K2DA 3UK4A 1KWHA 5I58A 1B5HA 4QSDA 1JEUA 1P1UA 2DXYA 2V3QA 4F2OA 1S7YA 3I5OA 3GBAA 1DPPA 1SYHA 3CI8A 5H8SA 1EU8A 3HCQA 5DYHA 2KLFA 4OTEA 1DMBA 2XXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPO A;  4NF4 A;  3SEX A;  4I1D A;  1NL5 A;  4NWC A;  4N07 A;  2QS2 A;  4LZ8 A;  1I69 A;  1ATG A;  3DLN A;  2NVU B;  3TCG A;  1B1H A;  1Y3Q A;  3P7I A;  1B3L A;  1LB9 A;  3O28 A;  5DEX B;  1JEV A;  3MQ9 A;  1YTV A;  1US4 A;  3K6V A;  4H5F A;  3RT6 B;  2ZNT A;  1MH4 A;  1HSJ A;  4FEC A;  1B58 A;  4XKR A;  5DEX A;  1IQ7 A;  3OEN A;  4OFL A;  4GWO A;  4WEP A;  3PPN A;  1FQD A;  3WAE A;  1P1O A;  5AA2 D;  1M5D A;  3C35 A;  1XVY A;  3VDF A;  4F19 A;  1A40 A;  1R9Q A;  3B6W A;  5I2K A;  2H4I A;  5AE4 A;  5B70 A;  3H6T A;  5FHO A;  5K2Y A;  4AB6 A;  3MBP A;  3VVD A;  3EF7 A;  3BFU A;  3JV9 A;  1YCJ A;  3OEM A;  4MFI A;  1MPC A;  4ZEF A;  1MS7 A;  2D5W A;  5H8N B;  1AMF A;  1A7L A;  4U2R A;  3VV5 A;  4I62 A;  1ANF A;  3K1M A;  1JW5 A;  1Y1Z A;  4IO2 A;  5JK4 A;  4GXS B;  4PFW A;  4ZE9 A;  5ITP A;  1BLF A;  2I49 A;  2RC9 A;  5DVJ A;  3TZA A;  2PVU A;  2UXA A;  3SEV A;  4DLD A;  4DXB A;  1R1N A;  4NF6 A;  4OMB A;  4M1V A;  3FGS A;  1N3W A;  5IKB A;  1CE2 A;  1RYO A;  5A5X B;  3K6U A;  1B4H A;  5KZT A;  3C4M A;  1WOD A;  5ISU A;  2I58 A;  3Q28 A;  1EZO A;  2NWJ A;  1M5C A;  3G3K A;  1IXH A;  2XXW A;  3Q26 A;  4XIG Q;  5DT6 A;  4H8J A;  3SEU A;  3TFL A;  3USD A;  3S9E A;  2D21 A;  2ZYM A;  2OK2 A;  1MY1 A;  2Q9T A;  3MPL A;  4GD5 A;  3E4R A;  4GQO A;  4ELO A;  3N94 A;  2REG A;  4NE4 A;  3V8X B;  3C32 A;  4ESX A;  3LSW A;  4Q5T A;  5H8Q A;  3FJ7 A;  2AL5 A;  3IOR A;  3FXR A;  3RGY A;  2DWA A;  2ZMB A;  1DPE A;  4LVQ A;  4RPN A;  3UP9 A;  2B3F A;  4PFT A;  3TUS A;  3K6W A;  1QVS A;  1ZKB A;  3FJG A;  1RYX A;  3R6U A;  5TU0 A;  1ZBM A;  5I84 A;  3C9H A;  4R73 A;  2O84 X;  3HST A;  1ZLQ A;  1LBB A;  4OZ9 A;  3TCH A;  1EZ9 A;  3H3G A;  2UVI A;  1N84 A;  3IB0 A;  1VE4 A;  1R9L A;  2IEE A;  4IO3 A;  4JSO A;  5I57 A;  3G3H A;  3KSX A;  3VLU A;  3DP4 A;  3PMX A;  3QUF A;  4KQP A;  1MPB A;  2VD2 A;  2VP1 A;  3PD8 A;  3AXF A;  4X9T A;  2WKY A;  3UOR A;  4AQ4 A;  1MXX A;  1JVX A;  2QS1 A;  3OO8 A;  1VR5 A;  4RNS A;  1Q1K A;  3L6H A;  1PDA A;  3U93 A;  2NUV A;  3FXQ A;  1GVC A;  5I56 B;  1P99 A;  4IB2 A;  1JNF A;  2Y7P A;  4LON B;  4X1D A;  1MQH A;  2ALU A;  4IY6 A;  4DCY A;  1MPD A;  3TTM A;  3PPO A;  3IJX B;  1P1W A;  4DE8 A;  4X1B A;  3TEL A;  1POY 1;  1M5E A;  1I6Q A;  1MXY A;  3V5A A;  2RC8 A;  5FHN A;  1NH7 A;  2F78 A;  2RCA A;  1XHY A;  2H5Y A;  1US5 A;  4G8M A;  3U72 A;  5B7D A;  3K6X A;  3G7W A;  1IXI A;  1EH3 A;  1SW1 A;  3MVX A;  4OHN A;  3IOV A;  3DP8 A;  4BDQ A;  3KJT A;  4FOR A;  4ECF A;  4DDD A;  3G3I A;  3MVY A;  3UIF A;  3UA8 A;  4YB5 A;  3LSF B;  3O9P A;  1L5T A;  3KEI A;  3T9U A;  2Y7I A;  1QUL A;  1GGG A;  4G68 A;  2H25 A;  4JB7 A;  4R6K A;  3GBB A;  3RPW A;  3RN8 A;  2QRY A;  2XXX A;  3JYR A;  3Q25 A;  5AA4 B;  3O97 A;  4Z7E A;  2GHB A;  3IB2 A;  3FZV A;  3SEW A;  4C1U A;  5I2N B;  1MY2 A;  3FV1 A;  2BJJ X;  1B6H A;  3U8Q A;  3CFX A;  1T0K A;  4H1X A;  2DP8 A;  4N13 A;  1Y1M A;  3FVN A;  2I4C A;  2DE2 A;  2OCU A;  4XKQ A;  3VVF A;  1Y20 A;  4YKJ A;  1UTH B;  4KYS A;  4OYV A;  3EPE A;  4R6Y A;  3H6U A;  1MXV A;  3N5L A;  3MZB A;  3MP1 A;  1D9V A;  4JWX A;  3MVW A;  4C0R A;  2I0C A;  4KYD A;  3CRB A;  1B9J A;  2Y84 A;  4FE8 A;  4F1U A;  2DYX A;  1TFD A;  5K2X A;  1VSO A;  1A8F A;  4DIG A;  5F7V A;  1ELJ A;  3TQL A;  3O2A A;  2I48 A;  3CG3 A;  3LSX A;  3PPP A;  1PBQ A;  4F29 A;  4RK2 A;  2XX9 A;  1O63 A;  2PT2 A;  3A3U A;  3DM0 A;  4LAT A;  2O68 A;  2OJT A;  3QXM A;  3MWB A;  2I4B A;  2Z22 A;  2O1M A;  4U4S A;  2F36 A;  2G29 A;  4EDP A;  4EXL A;  3FXU A;  4FAT A;  3TTN A;  2OWT A;  1QW0 A;  2I6E A;  1A55 A;  5EYF A;  5L9M A;  1PEB A;  4RY1 A;  3ZKK A;  3PPR A;  3QK6 A;  2DVC A;  3BBR A;  4Z0I A;  1PB9 A;  3F11 A;  1RKM A;  5BWJ A;  1MXU A;  5H8H A;  4BDM A;  3Q29 A;  5FTI A;  5CMC A;  2XXH A;  2Y7W A;  5AA3 A;  2P2A A;  1IIW A;  3RTF B;  3SEY A;  2XX8 A;  4P0I A;  2OBG A;  5AA1 A;  3ECR A;  5L9S A;  1B05 A;  3EHS A;  3MJN A;  2ZYK A;  3PV0 E;  4ZS9 A;  4KYE A;  1B7Z A;  4F1V A;  4NTL A;  4LUB A;  1EZP A;  4TOZ A;  3RQT A;  3I6V A;  5KDT A;  3EN3 A;  3TOD A;  4ZED A;  5CC2 A;  5KCJ A;  1S50 A;  3CR9 A;  3H6V A;  1TFA A;  4RK9 A;  1AL3 A;  3ZKL A;  3H6W A;  3IL1 B;  4HS7 A;  3TEP A;  2FNC A;  4LQ5 A;  4R6H A;  3PUX E;  5EHM A;  1SD3 A;  2ZYN A;  1JW4 A;  3EQ1 A;  4NF5 B;  3H03 A;  3OO7 A;  4QFK A;  2UYF A;  3RTW B;  1FQF A;  4ZEC A;  3K4U A;  3UN6 A;  2Z8F A;  3B6Q A;  3HO7 A;  3LR1 A;  4NF8 B;  1N7W A;  2PYY A;  4ND9 A;  1H43 A;  1SVX B;  1MRP A;  2ONK E;  3H06 B;  3HN0 A;  3ILT B;  1SYI A;  2XXY A;  1Z7N E;  4O3A A;  4R72 A;  3VVE A;  3IOW A;  3CFZ A;  2A5T A;  1SI0 A;  4YIC A;  2Q89 A;  1D4N A;  2Q8J A;  1NFT A;  2ZYO A;  1XC1 A;  2XX7 A;  4FEB A;  3TDJ A;  3KGC A;  2OWS A;  3IX1 A;  2E1S A;  4F3G A;  1H3D A;  2R6G E;  1H45 A;  2P0S A;  4YB7 A;  5AA4 A;  2V93 A;  3HPI A;  3OOA A;  4ZZA A;  2QS4 A;  1SI1 A;  2RIN A;  1O64 A;  3M3L A;  3S2V A;  2HXW A;  5H8F A;  4OEV A;  3SET A;  4OQO A;  5TP9 A;  3T9X B;  2RC7 A;  1ZTY A;  4XKP A;  3UGW A;  3O6H A;  4DCX A;  4XKN A;  3VXB A;  1LFH A;  1FQE A;  1D9Y A;  1LAF E;  2NOO A;  5CBR A;  1B3E A;  1LFG A;  1URG A;  3D4C A;  3JZJ A;  3PPQ A;  3W9W A;  4GL0 A;  4U1O A;  3T9V A;  3K01 A;  5I57 B;  5DVF A;  2DWH A;  3PMW A;  3KZG A;  1OMP A;  3H4Z A;  5I58 B;  2GRV A;  3OMB A;  4ZDM A;  1LBC A;  1USY E;  4MH5 A;  4E0X A;  1IUD A;  1H76 A;  3PD9 A;  3C36 A;  3E3K A;  3SES A;  5I56 A;  1XS5 A;  4PE5 B;  4F18 A;  1JVY A;  2Z8E A;  4POW A;  1MQD A;  5M2V A;  3C31 A;  4WKM A;  4FJP A;  4FAJ A;  1FQB A;  3K0V A;  2Y7R A;  1IIT A;  2FYI A;  2CMO A;  3QIM A;  2HAV A;  2D3I A;  2QMX A;  4GLI A;  2ZNU A;  2H9B A;  3S4U A;  4H65 A;  3H7M A;  1Y3P A;  1PB7 A;  3SKP A;  5IAI A;  2P1S A;  4MLV A;  5HM4 B;  1MDP 1;  4FIM A;  4OET A;  1B52 A;  2Y7K A;  1A8E A;  1CB6 A;  5FTH A;  2X26 A;  3RUM A;  3T96 B;  3MUQ A;  4YKP A;  2YJP A;  1P1Q A;  3FIR A;  5TP9 B;  1Q35 A;  3RNN A;  2ZXT A;  3PUV E;  1TXF A;  3U1O A;  1ZU0 A;  1MH3 A;  4GF8 A;  1UQW A;  1AH5 A;  2AL4 A;  3PU5 A;  3PUZ E;  2F7A A;  3KN7 A;  1LAG E;  4FED A;  4HCY A;  3MAM A;  4KHZ E;  4NWD A;  1FTJ A;  4OFO A;  4QSE A;  3IR1 A;  4KD5 A;  4F3B A;  5I2N A;  2O69 A;  3K1P A;  3OEL A;  4LP2 B;  4YZZ A;  4NF6 B;  4ELR A;  2HZL A;  1B0L A;  1OLC A;  4DZ1 A;  4EF1 A;  4QF9 A;  1UIV A;  1GR2 A;  3ONM A;  4OVJ A;  5CMB A;  5H8N A;  4RJZ A;  1SW5 A;  2F35 A;  2PT1 A;  3G3J A;  1OVT A;  1UTH A;  2HFB A;  4EQB A;  4ZEK A;  1NNP A;  4DXC A;  3QYT A;  1MXW A;  3FAT A;  3O6G A;  5I59 B;  3K02 A;  3IB1 A;  2X7Q A;  3C34 A;  4IO6 A;  4QFN A;  3KN3 A;  3BFT A;  1M5B A;  1QUI A;  2M8C A;  4R9G A;  3OO6 A;  3SDF A;  1TWY A;  2O7I A;  4H6D A;  1A99 A;  4IO5 A;  5AA2 A;  3OSR A;  2XXU A;  3HHF A;  3L6G A;  4I9D A;  4PQJ A;  4R74 A;  3R7X A;  5J1D A;  1GV8 A;  2I3V A;  1R6Z A;  1IZ1 A;  4XTC Q;  2HQ0 A;  1JET A;  1SDX A;  4GL8 A;  1Y4C A;  3MW0 A;  3KFM A;  1PC3 A;  1MQG A;  4U21 A;  2G93 A;  1I6A A;  1N76 A;  3S9N C;  3M3F A;  1B2H A;  1OQG A;  2A5S A;  3KJ7 A;  4JXI A;  3V89 B;  3S9L C;  4G68 C;  3CSG A;  3IJO B;  4GRK A;  5H8Q B;  3HV1 A;  4WXJ A;  3LUY A;  2XXQ A;  2UYE A;  4POX A;  1FW0 A;  3MVZ A;  2VD3 A;  3MZ1 A;  4QSC A;  1B3F A;  1HSE A;  1LB8 A;  1UTB B;  2ABH A;  2YPN A;  2Z8D A;  1BP5 A;  3IOU A;  1DTZ A;  4G4P A;  4I8C A;  4JWO A;  4R2F A;  1WDN A;  1P1N A;  1USY H;  2UVJ A;  4TLL B;  4UA8 A;  3TQW A;  4MBP A;  4DXU A;  2THI A;  3CFL A;  1FCK A;  1UTB A;  1XVX A;  3GXA A;  4GOT A;  5JTY B;  1NMU A;  4NED A;  2HAU A;  2X7P A;  2PMS A;  4R2B A;  3T66 A;  1OIB A;  4G2Z A;  1B7H A;  4F39 A;  5A5X A;  4KCC A;  4QHQ A;  1IXC A;  1N3X A;  3KSJ A;  4GIZ A;  1B40 A;  1AIV A;  4YU0 A;  3FVK A;  2UVH A;  1POT A;  3OEK A;  1B1X A;  2XXT A;  5ELV A;  3TMG A;  2R71 A;  3OO9 A;  1LAX A;  1SW2 A;  5CM6 A;  3KG2 A;  1MQJ A;  1MY0 A;  3N6U A;  3TPA A;  1UIU A;  2XXI A;  2DS9 A;  1FTM A;  1HSL A;  4KPT A;  4PP0 A;  4UAC A;  1OVB A;  4MF3 A;  2RKM A;  4X48 A;  1B32 A;  1QKA A;  3D4G A;  4IO4 A;  4U23 A;  4EUO A;  1PB8 A;  4ESW A;  3VFJ A;  4EF2 A;  4ELP A;  2V3U A;  2A5T B;  3PGF A;  2DVZ A;  4OFJ A;  5CRY A;  2VGQ A;  3FUZ A;  3EHU A;  3CSB A;  1SBP A;  3M3K A;  3E9X A;  2FA7 A;  3MPK A;  2DWI A;  2O7U A;  1MXZ A;  4H67 A;  4TQU Q;  3S9M C;  1B0H A;  1QJM A;  1BTJ A;  2F6G A;  5BUU A;  3G3F A;  2XXP A;  1URS A;  1AOV A;  2HEU A;  2AYS A;  3ZSF A;  1B7U A;  2B65 A;  3KBR A;  2OLB A;  3OXN A;  4YMA A;  1B3G A;  3K00 A;  3HHG A;  3O6I A;  4YAH X;  1Y3N A;  1DSN A;  4KCD A;  3LSL A;  4YKI A;  4C1T A;  3IK6 B;  1NNF A;  5CMM A;  3TKD A;  5AA2 B;  3FVO A;  1LAH E;  4TLM B;  5L8D A;  2DWJ A;  3KOT A;  2NXO A;  3B6T A;  2HCA A;  3GLB A;  4GVO A;  4YMB A;  1GTK A;  4K3F A;  4Q0C A;  4NF4 B;  1IEJ A;  3MP8 A;  5KDT B;  2DE3 A;  5HBC A;  4LZ5 A;  1OQH A;  1I6B A;  3Q27 A;  2QJE A;  4OWD A;  1XT8 A;  2OZZ A;  1JW1 A;  2HZK A;  1VFD A;  1H44 A;  4KR5 A;  1S9T A;  5CMK A;  2F7C A;  3VLW A;  3IO6 A;  4LA9 A;  1BKA A;  3W15 C;  4PFU A;  1MG1 A;  1FQC A;  3TTR A;  2UVG A;  2H99 A;  5ICQ A;  3TTL A;  2AIX A;  2I0B A;  1WVJ A;  2F97 A;  4KFQ A;  4YB6 A;  2O51 A;  4IY5 A;  4P11 A;  3DEL B;  5ITO A;  4BLA A;  3EHT A;  2Q2A A;  2W7Y A;  2ESN A;  3PUY E;  4OES A;  4YKK A;  1QKB A;  2QSX A;  2PX1 A;  5TPA A;  3THI A;  1B5I A;  4M4G A;  5CI5 A;  1FTL A;  4HCW A;  3T9H B;  1QUK A;  1MY3 A;  4ZEB A;  1LLS A;  2VOZ A;  3V83 A;  3O29 A;  4G8H A;  4NMY A;  3CIJ A;  3U94 A;  2GH9 A;  3OD7 A;  4JBZ A;  4QRZ A;  1ZMG A;  2QPQ A;  4E0W A;  2VHA A;  4G68 B;  4F3S A;  3N6T A;  4OEU A;  3MZ9 A;  5JEI A;  4H8I A;  5H8H B;  5KCJ B;  3K1N A;  2V3T A;  4OEN A;  4F31 B;  1FTK A;  3MP6 A;  4BDO A;  4QFL A;  4N6P A;  3FVG A;  4MLQ A;  3KN8 A;  1A54 A;  2DOJ A;  2IA4 A;  2LAO A;  3SER A;  1QUJ A;  3T93 B;  2B3B A;  1FTO A;  1M5F A;  2QL3 A;  4BDN A;  2ZNS A;  3LC8 A;  1YAE A;  1BIY A;  1LST A;  2Q88 A;  4ZE8 A;  4EQ7 A;  2QS3 A;  5I59 A;  3TAJ A;  1NNK A;  4OER A;  3VXC A;  3U92 A;  1MM7 A;  3O66 A;  2GHA A;  1XOC A;  4P0G A;  3N26 A;  4JSD A;  4ONY A;  5JTY A;  4KI0 E;  4U22 A;  1NH8 A;  5F1Q A;  3PMV A;  4ISU A;  2ONS A;  2F7B A;  3TTK A;  1B46 A;  2O1L A;  3E13 X;  4BDL A;  3QSL A;  1VFE A;  2XXV A;  1ZJL A;  4PFY A;  2DQV A;  4EQ9 A;  3VLV A;  4HTG A;  4EXK A;  3C33 A;  2V84 A;  3G3G A;  5LOM A;  2DXR A;  4LZ7 A;  3PUW E;  1IXG A;  2I3W A;  3KOS A;  3B7D A;  2F5X A;  1URD A;  1II5 A;  1DOT A;  1FQA A;  5TPA B;  5L9O A;  3CVG A;  2QMW A;  2E0S A;  4THI A;  1O7T A;  2PBW A;  1JQF A;  3CG1 A;  3TYH A;  4IO7 A;  2DE4 A;  3LBS A;  1Y9U A;  1NKX A;  2RCB A;  3FV2 A;  1PBP A;  4GXA A;  3IO4 A;  4ZEI A;  4ZZE A;  4IGT A;  3ZS6 A;  5ICT A;  4O3B A;  4OXV A;  4RA1 A;  1YPN A;  3IAZ A;  4JWY A;  4RYA A;  2RF1 A;  4LQ2 A;  3BKI B;  4U1Z A;  3QAX A;  1MQI A;  4NF5 A;  3TCF A;  2DSF A;  1MDQ A;  3FD3 A;  3R26 A;  3W9V A;  4Q8R A;  3MC2 A;  4RXL A;  3T22 A;  4ELQ A;  5CBS A;  4H5G A;  1F9B A;  3A09 A;  2H98 A;  3ODB A;  4NF8 A;  4O3C A;  2XD2 A;  3FJM A;  3WAF A;  1LCF A;  3DP6 A;  1B51 A;  3GZG A;  1J1N A;  3A3C A;  3VE1 B;  3FAS A;  1N04 A;  2R9J A;  4GFR A;  5DTB A;  2F34 A;  2F6P A;  5DVI A;  1D3K A;  1LCT A;  1LGB C;  2V25 A;  3ILU B;  4F2Q A;  2XHD A;  1B4Z A;  3M8U A;  4F3P A;  4IGR A;  4QFP A;  1Y4T A;  2CZL A;  1Z7M E;  1LFI A;  1SQY A;  2Z23 A;  3RY3 A;  4F22 A;  1DTG A;  4U4X A;  4WED A;  4G8N A;  2O6A A;  2XD3 A;  3QUJ A;  4Q30 B;  4AB5 A;  4BDR A;  4HW8 A;  3RLF E;  5H8F B;  3RT8 A;  1ZIU A;  4R9F A;  4F1Y A;  2REJ A;  1N7X A;  1MM6 A;  1SW4 A;  2F8D A;  3I3V A;  4R75 A;  5FHM A;  4JDF A;  1MY4 A;  3IOT A;  1TT1 A;  4G77 A;  2YLN A;  2Q2C A;  4H0W A;  4L17 A;  2ANJ A;  1NNT A;  2ONR A;  3OSQ A;  4PET A;  4XXU A;  1B3H A;  1N0T A;  4QFO A;  5EHS A;  5I2K B;  1OLA A;  5HPQ A;  1B5J A;  2GFE A;  3K2D A;  3UK4 A;  1KWH A;  5I58 A;  1B5H A;  4QSD A;  1JEU A;  1P1U A;  2DXY A;  2V3Q A;  4F2O A;  1S7Y A;  3I5O A;  3GBA A;  1DPP A;  1SYH A;  3CI8 A;  5H8S A;  1EU8 A;  3HCQ A;  5DYH A;  2KLF A;  4OTE A;  1DMB A;  2XXR A; 
#chains in the Genus database with same CATH topology
 4I1D A;  4NWC A;  4N07 A;  2QS2 A;  4LZ8 A;  3DLN A;  4MNC A;  1B1H A;  3MQ9 A;  1YTV A;  3K6V A;  2ZNT A;  1HSJ A;  4FEC A;  4XKR A;  1FBC A;  4GWO A;  4WEP A;  3WAE A;  5AA2 D;  1M5D A;  1NV0 A;  1XVY A;  2H4I A;  5AE4 A;  5B70 A;  4O7I A;  5ET6 A;  4PAI A;  1YCJ A;  1A7L A;  1ANF A;  1Y1Z A;  5ITP A;  1BLF A;  3SEV A;  4DLD A;  4PAF A;  5IZ3 A;  5IKB A;  3K6U A;  5KZT A;  1WOD A;  5ISU A;  3G3K A;  3USD A;  3S9E A;  2CZI A;  2ZYM A;  3MPL A;  4GQO A;  1EYJ A;  3V8X B;  4Q5T A;  5H8Q A;  3IOR A;  3FXR A;  2DWA A;  2ZMB A;  1QVS A;  1ZKB A;  5TU0 A;  2VPO A;  3C9H A;  2XXK A;  4HXV A;  4PDD A;  4R73 A;  4OZ9 A;  1EZ9 A;  2UVI A;  3KSX A;  4KQP A;  4X9T A;  3UOR A;  3AXF A;  3BIG A;  2NUV A;  1MQH A;  1MPD A;  3TTM A;  3PPO A;  3V5A A;  1M5E A;  4IR8 A;  1NH7 A;  1XHY A;  3U72 A;  1US5 A;  4G8M A;  3G7W A;  3KJT A;  4MMP A;  3LSF B;  3T9U A;  1FBP A;  2H25 A;  3Q25 A;  4Z7E A;  2GHB A;  3FZV A;  3CFX A;  4N13 A;  1Y1M A;  4XKQ A;  3FXB A;  1Y20 A;  4KYS A;  4OYV A;  3EPE A;  4OVS A;  3H6U A;  4GX4 A;  4JWX A;  2DYX A;  1VSO A;  4DIG A;  3TQL A;  3O2A A;  3CG3 A;  2WBD A;  2PT2 A;  4AS5 A;  2I4B A;  2Z22 A;  2O1M A;  1NV6 A;  4U4S A;  4EDP A;  3FXU A;  3TTN A;  2OWT A;  1QW0 A;  1A55 A;  5L9M A;  2DVC A;  5T3J A;  1NV5 A;  1MXU A;  4BDM A;  5FTI A;  5CMC A;  1DK4 A;  2P2A A;  4GWZ A;  2Y5L A;  2OBG A;  3PV0 E;  3RQT A;  2V4C A;  4RK9 A;  1AL3 A;  4LQ5 A;  5EHM A;  4NF5 B;  3RTW B;  3UN6 A;  5ET5 A;  4NF8 B;  1SVX B;  4I3Y A;  4O3A A;  4R72 A;  3VVE A;  3IOW A;  2ZYO A;  1XC1 A;  4FEB A;  3IX1 A;  4F3G A;  1H3D A;  1H45 A;  4YB7 A;  5AA4 A;  2V93 A;  3HPI A;  2QS4 A;  2RIN A;  2HXW A;  4OEV A;  2RC7 A;  2XWK A;  4XKN A;  2NOO A;  1URG A;  1G0I A;  3D4C A;  4QXD A;  3K01 A;  5DVF A;  4O8M A;  3OMB A;  1USY E;  4E0X A;  1H76 A;  1XS5 A;  4PE5 B;  4POW A;  4WKM A;  4HE0 A;  2R8T A;  2Y7R A;  2QMX A;  3HFU A;  2ZNU A;  2H9B A;  3S4U A;  3H7M A;  3SKP A;  1B52 A;  2Y7K A;  1CB6 A;  3RUM A;  2YJP A;  3PUV E;  1TXF A;  1MH3 A;  4UAB A;  3IR1 A;  2O69 A;  3K1P A;  4ELR A;  4NF6 B;  3RPL A;  1B0L A;  4EF1 A;  3E78 A;  2F35 A;  1UTH A;  4EQB A;  2XA5 A;  4ZEK A;  1NNP A;  4H46 A;  5I59 B;  4GBW A;  3IB1 A;  4PBH A;  3C34 A;  3KN3 A;  3BFT A;  1GV8 A;  2I3V A;  2HQ0 A;  4GL8 A;  4U21 A;  1I6A A;  4JXI A;  3KJ7 A;  4OVR A;  3IJO B;  4MHF A;  1FW0 A;  3MZ1 A;  4G4P A;  5CRY A;  2YPN A;  4UA8 A;  3TQW A;  4GOT A;  2X7P A;  4R2B A;  2PMS A;  1N3X A;  5ESY A;  1B1X A;  5ELV A;  3TMG A;  3N6U A;  3TPA A;  1UIU A;  5IZZ A;  1B32 A;  4IO4 A;  1PB8 A;  4ELP A;  3PGF A;  2ZZX A;  2VGQ A;  3E9X A;  1B0H A;  1QJM A;  1URS A;  2AYS A;  1NV7 A;  4YMA A;  3K00 A;  4KCD A;  1LAH E;  2HXR A;  3GLB A;  4YMB A;  4LZ5 A;  4OWD A;  1JW1 A;  2HZK A;  3MYU A;  4LA9 A;  1MG1 A;  1FBG A;  2UVG A;  2H99 A;  3TTL A;  4YB6 A;  4BLA A;  2Q2A A;  3PUY E;  1QKB A;  2QSX A;  2PX1 A;  3THI A;  4M4G A;  3EKI A;  4HCW A;  1MY3 A;  2VOZ A;  2QVR A;  3U94 A;  4G68 B;  5KCJ B;  4OEN A;  2V3T A;  3MP6 A;  4BDO A;  3FVG A;  4MLQ A;  1A54 A;  1QUJ A;  1M5F A;  1YAE A;  1BK4 A;  1BIY A;  1LST A;  4EQ7 A;  4OER A;  1XOC A;  4P0G A;  4DI3 D;  4ONY A;  1NH8 A;  2F7B A;  3QSL A;  2XXV A;  4PFY A;  2DQV A;  4EXK A;  2V84 A;  3PUW E;  1DOT A;  2E0S A;  1O7T A;  2PBW A;  4PE3 A;  4IO7 A;  2DE4 A;  1Y9U A;  3VXC A;  5JK4 A;  3IAZ A;  4KXP A;  4X8R A;  5CBS A;  4H5G A;  3A09 A;  2ZZW A;  4NF8 A;  2FVZ A;  3FJM A;  1LCF A;  3GZG A;  3A3C A;  3FAS A;  1D3K A;  1FPB A;  2V25 A;  4IGR A;  4Q30 B;  4AB5 A;  4R9F A;  1N7X A;  1MM6 A;  4G77 A;  1IMB A;  2ANJ A;  3OSQ A;  4PET A;  5EHS A;  4XXU A;  1B3H A;  1N0T A;  2PCR A;  1JEU A;  1P1U A;  1S7Y A;  3GBA A;  1DPP A;  1SYH A;  1EU8 A;  4OTE A;  1FRP A;  3TCG A;  1I69 A;  1Y3Q A;  5LTC A;  4H5F A;  3RT6 B;  1US4 A;  1IQ7 A;  4GWS A;  3PPN A;  2Q8M A;  4F19 A;  1A40 A;  3B6W A;  3MBP A;  3BFU A;  3JV9 A;  4ZEF A;  4H45 A;  3VV5 A;  1JW5 A;  4GXS B;  4ZE9 A;  3TZA A;  4JVI A;  1R1N A;  1N3W A;  1CE2 A;  1K9Z A;  3C4M A;  1EZO A;  2XXW A;  5DT6 A;  4XIG Q;  4H8J A;  1IMA A;  2OK2 A;  5ET8 A;  2Q9T A;  4ELO A;  3C32 A;  4P8B A;  2AL5 A;  3RGY A;  5DW8 A;  4LVQ A;  2B3F A;  4PFT A;  3TUS A;  3R6U A;  3NOH A;  2Y5K A;  3IB0 A;  2IEE A;  4PGP A;  3DP4 A;  3VLU A;  2VP1 A;  3OO8 A;  4AB6 A;  3L6H A;  1PDA A;  4IB2 A;  4LON B;  2WX9 A;  2ALU A;  4DE8 A;  1I6Q A;  5FHN A;  2RCA A;  3K6X A;  1IXI A;  4OHN A;  4BDQ A;  4ECF A;  4FOR A;  4DDD A;  3O9P A;  1L5T A;  2Y7I A;  1GGG A;  4I3E A;  3RPW A;  2QRY A;  3JYR A;  5FBP A;  4O94 A;  5A5L A;  2PFY A;  4C1U A;  5I2N B;  3FV1 A;  3FVN A;  1SPI A;  1UTH B;  4N15 A;  4R6Y A;  1MXV A;  3MZB A;  1G0H A;  3MVW A;  2I0C A;  3ROJ A;  4NN3 A;  5K2X A;  5F7V A;  1ELJ A;  2I48 A;  4F29 A;  3A3U A;  3DM0 A;  4LAT A;  3MWB A;  2F36 A;  4FAT A;  3ZKK A;  3PPR A;  1PB9 A;  3F11 A;  1RDX A;  1IIW A;  4NHB A;  3MJN A;  1B7Z A;  3EN3 A;  4ZED A;  5KCJ A;  1TFA A;  2FNC A;  3PUX E;  1KA1 A;  1FQF A;  3K4U A;  3B6Q A;  1N7W A;  2PYY A;  1H43 A;  1MRP A;  2ONK E;  1FPG A;  2Q89 A;  1D4N A;  1IMF A;  4P1E A;  2OWS A;  3IFA A;  3U65 A;  3OOA A;  1SI1 A;  1O64 A;  3S2V A;  5H8F A;  4P47 A;  5TP9 A;  3T9X B;  2F3B A;  1ZTY A;  3VXB A;  1B3E A;  1FPJ A;  4GL0 A;  5IM2 A;  5I57 B;  2DWH A;  5I58 B;  4MH5 A;  4PGN A;  3E3K A;  3SES A;  4F18 A;  5M2V A;  2KR0 A;  3C31 A;  3K0V A;  1NV1 A;  2CMO A;  3QIM A;  2HAV A;  2D3I A;  4GLI A;  4H65 A;  1PB7 A;  5IAI A;  1MDP 1;  4N81 A;  1NV2 A;  3T0J A;  4YKP A;  5TP9 B;  1P1Q A;  3FIR A;  4MEV A;  1FBD A;  4FED A;  3RPL B;  3KN7 A;  4OFO A;  4QSE A;  4KD5 A;  4YZZ A;  1LBY A;  1OLC A;  4DZ1 A;  4QF9 A;  1UIV A;  1GR2 A;  3ONM A;  5H8N A;  1SW5 A;  3G3J A;  2HFB A;  3A29 A;  3O6G A;  3K02 A;  2X7Q A;  4IO6 A;  1M5B A;  4R9G A;  2M8C A;  3OO6 A;  2O7I A;  5AA2 A;  3OSR A;  2XXU A;  3L6G A;  4I9D A;  4PQJ A;  1R6Z A;  4XTC Q;  1JET A;  1SDX A;  2MKZ A;  3MW0 A;  4NF0 A;  2G93 A;  3S9N C;  3M3F A;  3S9L C;  3CSG A;  4GRK A;  5H8Q B;  4WXJ A;  3LUY A;  2XXQ A;  4POX A;  2VPN A;  4QSC A;  1HSE A;  1LB8 A;  3IOU A;  1DTZ A;  4I8C A;  4FAJ A;  1WDN A;  2UVJ A;  4MBP A;  2THI A;  4NED A;  2HAU A;  3T66 A;  2DDK A;  4G2Z A;  4F39 A;  4KCC A;  4GIZ A;  3FVK A;  4GBV A;  2R71 A;  4OA4 A;  2XXI A;  4PP0 A;  4UAC A;  4KPT A;  4MF3 A;  4P56 A;  1QKA A;  4EUO A;  4ESW A;  2V3U A;  1K9Y A;  2DVZ A;  3MPK A;  3FUZ A;  3M3K A;  2FA7 A;  4TQU Q;  3S9M C;  2F6G A;  2XXP A;  2OLB A;  4PF8 A;  4YAH X;  3HHG A;  3O6I A;  3IK6 B;  3FVO A;  4TLM B;  1D9Q A;  2NXO A;  1GTK A;  4K3F A;  4NF4 B;  2DE3 A;  1OQH A;  3Q27 A;  2OZZ A;  1VFD A;  1H44 A;  1S9T A;  3IO6 A;  4PFU A;  5ICQ A;  1FQC A;  3TTR A;  4KFQ A;  4IY5 A;  2W7Y A;  2OWZ A;  1B5I A;  3V83 A;  3O29 A;  2GH9 A;  1ZMG A;  2QVV A;  4JVD A;  2VHA A;  4OEU A;  2DOJ A;  2IA4 A;  2LAO A;  5B7D A;  3SER A;  4BDN A;  1FBH A;  4ZE8 A;  4O7M A;  2QS3 A;  4KI0 E;  3PMV A;  1RDZ A;  1JP4 A;  2XWV A;  4HTG A;  3G3G A;  5LOM A;  2DXR A;  1IXG A;  1EYK A;  1URD A;  4NQ8 A;  4G61 A;  5TPA B;  3CVG A;  2QMW A;  1JQF A;  3CG1 A;  4DI4 B;  4GXA A;  4ZEI A;  4O3B A;  3QAX A;  3MC2 A;  2R9J A;  4GFR A;  2F34 A;  2F6P A;  4F2Q A;  1LGB C;  2XHD A;  4F3P A;  1LFI A;  1SQY A;  2Z23 A;  3RY3 A;  4WED A;  4G8N A;  3RLF E;  3RT8 A;  2REJ A;  1SW4 A;  4R75 A;  3IOT A;  4H0W A;  1FTA A;  3UK4 A;  1B5H A;  4QSD A;  4F2O A;  3I5O A;  1NV3 A;  3CI8 A;  3ISP A;  3HCQ A;  3PTY A;  1DMB A;  4RPO A;  2NVU B;  1ATG A;  3P7I A;  4MCO A;  1B3L A;  1JEV A;  5I5P A;  1MH4 A;  1B58 A;  5DEX A;  3OEN A;  1NUZ A;  4N6D A;  3VDF A;  5EYG A;  5K2Y A;  2F3D A;  4MFI A;  1MPC A;  5H8N B;  4U2R A;  2I49 A;  5DVJ A;  2PVU A;  4DXB A;  4MIJ A;  1YXI A;  2P3N A;  4OMB A;  4QBA A;  3FGS A;  1RYO A;  5A5X B;  3Q28 A;  2NWJ A;  1M5C A;  3Q26 A;  3SEU A;  3TFL A;  2D21 A;  2VT5 A;  4GD5 A;  3E4R A;  3N94 A;  2REG A;  4NE4 A;  3LSW A;  3B50 A;  1FJ6 A;  1DPE A;  3K6W A;  3FJG A;  1RYX A;  2O84 X;  3HST A;  1ZLQ A;  1LBB A;  3TCH A;  4P9K A;  1N84 A;  5I57 A;  1VE4 A;  3CHG A;  4X04 A;  2VD2 A;  2WYP A;  2WKY A;  1JVX A;  5JTY A;  1GVC A;  1P99 A;  4X1D A;  1JNF A;  2Y7P A;  4IY6 A;  4P1L A;  3IJX B;  1P1W A;  1FBF A;  4OAN A;  1EH3 A;  1SW1 A;  1FSA A;  3UIF A;  4YB5 A;  3KEI A;  4G68 A;  4JB7 A;  4R6K A;  3O97 A;  5I7I A;  1B6H A;  3U8Q A;  4H1X A;  2I4C A;  2DE2 A;  2FHY A;  3VVF A;  4YKJ A;  3N5L A;  3CRB A;  1B9J A;  2Y84 A;  4FE8 A;  4F1U A;  1LBX A;  2WYK A;  3LSX A;  3PPP A;  1PBQ A;  2O68 A;  3QXM A;  2G29 A;  4NAP A;  2I6E A;  5EYF A;  2ZZV A;  1PEB A;  5EQ8 A;  3QK6 A;  3BBR A;  4Z0I A;  1RKM A;  4GX3 A;  5H8H A;  2Y7W A;  3RTF B;  3SEY A;  5AA1 A;  1IMD A;  3FBP A;  5L9S A;  1B05 A;  3EHS A;  4ZS9 A;  4TOZ A;  2PFZ A;  3I6V A;  5I3S A;  3TOD A;  2BJI A;  3TEP A;  4HS7 A;  4R6H A;  1SD3 A;  2ZYN A;  1JW4 A;  3H03 A;  4QFK A;  2UYF A;  4ZEC A;  2Z8F A;  3HO7 A;  4ND9 A;  3HN0 A;  1SYI A;  1Z7N E;  4AS4 A;  2CEY A;  2A5T A;  1SI0 A;  4YIC A;  1NFT A;  2XX7 A;  3TDJ A;  1VDW A;  2R6G E;  2P0S A;  4ZZA A;  4N6K A;  3M3L A;  3UGW A;  1LAF E;  3PPQ A;  3W9W A;  4U1O A;  3T9V A;  3H4Z A;  2GRV A;  4ZDM A;  1LBC A;  2KQZ A;  1IUD A;  3PD9 A;  3C36 A;  5I56 A;  1MQD A;  4FJP A;  1FQB A;  2FYI A;  4PFB A;  2P1S A;  5FTH A;  3T96 B;  1Q35 A;  5EQA A;  2ZXT A;  1AH5 A;  3PU5 A;  4C0R A;  1LAG E;  3MAM A;  1FTJ A;  5I2N A;  4PFR A;  4LP2 B;  4OVJ A;  5CMB A;  1OVT A;  4DXC A;  3KC0 A;  3FAT A;  1Q9D A;  4XF5 A;  1TWY A;  4H6D A;  3RYD A;  3HHF A;  3R7X A;  5J1D A;  1IZ1 A;  5AA2 B;  1Y4C A;  3KFM A;  2XWI A;  1N76 A;  4HE1 A;  4G68 C;  1YYZ A;  3HV1 A;  2UYE A;  3MVZ A;  1NUY A;  2ABH A;  4TLL B;  4JWO A;  1P1N A;  1FPD A;  1FCK A;  1UTB A;  1NMU A;  3LV0 A;  1OIB A;  5A5X A;  4QHQ A;  1IXC A;  1IME A;  3KSJ A;  1AIV A;  4YU0 A;  2UVH A;  4N8Y A;  3OEK A;  2XXT A;  3OO9 A;  1LAX A;  1SW2 A;  3KC1 A;  3KG2 A;  1MQJ A;  2FBP A;  1FTM A;  2RKM A;  3D4G A;  4U23 A;  4EF2 A;  4N91 A;  4OFJ A;  2WEF A;  3CSB A;  2GQ1 A;  2DWI A;  4XEQ A;  5BUU A;  3G3F A;  4GWU A;  2HEU A;  1B7U A;  3KBR A;  4C1T A;  5CMM A;  3KOT A;  3B6T A;  4Q0C A;  1KZ8 A;  5HBC A;  1XT8 A;  4KR5 A;  5CMK A;  2F7C A;  3W15 C;  4NGU A;  2I0B A;  4GWW A;  4P11 A;  3DEL B;  5ITO A;  2L5V A;  4OES A;  5CI5 A;  1FTL A;  4ZEB A;  1NV4 A;  1LLS A;  4G8H A;  3CIJ A;  3OD7 A;  4QRZ A;  5F24 A;  2QPQ A;  4E0W A;  3N6T A;  3MZ9 A;  5JEI A;  4H8I A;  3K1N A;  1FTK A;  4N6P A;  3T93 B;  2B3B A;  2QL3 A;  3LC8 A;  2Q88 A;  3U92 A;  1MM7 A;  3O66 A;  2GHA A;  3N26 A;  5F1Q A;  2ONS A;  3TTK A;  4LN5 A;  1VFE A;  1ZJL A;  3VLV A;  4MNP A;  4LZ7 A;  3SZP A;  3B7D A;  3GYY A;  1FQA A;  2JJK A;  4FBP A;  3TYH A;  3LBS A;  2RCB A;  3IO4 A;  5ICT A;  4OXV A;  4RA1 A;  3QMF A;  4JWY A;  5AA3 A;  4U1Z A;  3TCF A;  3W9V A;  1MQI A;  4NF5 A;  2DSF A;  1MDQ A;  3T22 A;  1F9B A;  4O3C A;  2H98 A;  3ODB A;  1B51 A;  1J1N A;  3VE1 B;  4PBQ A;  1N04 A;  5DVI A;  3ILU B;  3M8U A;  2WBB A;  1Y4T A;  2CZL A;  4F22 A;  4U4X A;  2O6A A;  4HW8 A;  3E79 A;  1ZIU A;  2F8D A;  2YLN A;  2Q2C A;  4L17 A;  1NNT A;  2ONR A;  5I2K B;  1FPF A;  5HPQ A;  4MX6 A;  1B5J A;  2GFE A;  3T1B A;  3K2D A;  2DXY A;  5DYH A;  2XXR A;  4NF4 A;  3SEX A;  1NL5 A;  3O28 A;  1LB9 A;  5DEX B;  2XWO A;  4OFL A;  1FQD A;  1P1O A;  3C35 A;  1R9Q A;  5I2K A;  3H6T A;  5FHO A;  3VVD A;  3EF7 A;  3OEM A;  1MS7 A;  2D5W A;  1AMF A;  4I62 A;  3K1M A;  4IO2 A;  1INP A;  4PFW A;  2RC9 A;  1LBW A;  2CZK A;  2UXA A;  1DCU A;  4NF6 A;  4M1V A;  1NI9 A;  1B4H A;  2I58 A;  5IZ3 B;  4N17 A;  1IXH A;  2B4L A;  1MY1 A;  2HPG A;  4ESX A;  2OX3 A;  3FJ7 A;  3UP9 A;  4RPN A;  5EQ9 A;  5LDZ A;  1ZBM A;  4OVQ A;  5I84 A;  3H3G A;  2FIX A;  1R9L A;  4JSO A;  4IO3 A;  3G3H A;  3PMX A;  4GWY A;  3QUF A;  1MPB A;  4AQ4 A;  3PD8 A;  1MXX A;  2QS1 A;  1VR5 A;  4RNS A;  1Q1K A;  5I56 B;  3U93 A;  3FXQ A;  4DCY A;  4X1B A;  3TEL A;  1POY 1;  1MXY A;  2RC8 A;  2F78 A;  2H5Y A;  1CNQ A;  3MVX A;  3IOV A;  3DP8 A;  3G3I A;  3MVY A;  1IMC A;  3UA8 A;  4PTK A;  1QUL A;  3GBB A;  3RN8 A;  2XXX A;  5AA4 B;  3IB2 A;  2FIE A;  3SEW A;  1MY2 A;  2BJJ X;  4GX6 A;  1T0K A;  2DP8 A;  2OCU A;  3D1R A;  3MP1 A;  1D9V A;  4MJO A;  1NUX A;  4KYD A;  1TFD A;  4PAK A;  1A8F A;  4RK2 A;  2XX9 A;  1O63 A;  2OJT A;  4N8G A;  4EXL A;  4XFE A;  1FBE A;  4RY1 A;  5BWJ A;  3Q29 A;  2XXH A;  2XX8 A;  4P0I A;  3ECR A;  2ZYK A;  4KYE A;  4F1V A;  4NTL A;  4LUB A;  1EZP A;  5KDT A;  5CC2 A;  1S50 A;  3CR9 A;  3H6V A;  3ZKL A;  3H6W A;  3IL1 B;  1FPK A;  3EQ1 A;  3OO7 A;  1FPE A;  3LR1 A;  3ILT B;  3H06 B;  2XXY A;  3MST A;  3CFZ A;  2Q8J A;  3KGC A;  2E1S A;  3SET A;  4OQO A;  4XKP A;  4DCX A;  3O6H A;  1LFH A;  1FQE A;  1D9Y A;  5CBR A;  3JZJ A;  1LFG A;  3PMW A;  3KZG A;  1OMP A;  1JVY A;  2B4M A;  2Z8E A;  1IIT A;  3BIH A;  1Y3P A;  4MLV A;  5HM4 B;  4FIM A;  2QFL A;  4OET A;  5IGA A;  1A8E A;  2X26 A;  3MUQ A;  3RNN A;  4MNI A;  3U1O A;  1ZU0 A;  4GF8 A;  1UQW A;  2AL4 A;  3PUZ E;  4HCY A;  2F7A A;  4KHZ E;  4F3B A;  3OEL A;  2HZL A;  3LUZ A;  3KBZ A;  4RJZ A;  2PT1 A;  4NG7 A;  4HE2 A;  3QYT A;  1MXW A;  1XI6 A;  4QFN A;  4P3L A;  1QUI A;  3SDF A;  4IO5 A;  1A99 A;  4R74 A;  1RDY A;  1PC3 A;  1MQG A;  1DBZ A;  1B2H A;  1OQG A;  2A5S A;  3V89 B;  2VD3 A;  4ELQ A;  1B3F A;  1UTB B;  2Z8D A;  4NWD A;  1BP5 A;  4R2F A;  1USY H;  4DXU A;  3CFL A;  5JTY B;  3GXA A;  1XVX A;  5ET7 A;  1B7H A;  1B40 A;  1POT A;  5CM6 A;  4N4U A;  1MY0 A;  2DS9 A;  1HSL A;  1OVB A;  4PC9 A;  1FJ9 A;  3VFJ A;  2A5T B;  3EHU A;  4I40 A;  1SBP A;  1LBZ A;  2O7U A;  4H67 A;  1MXZ A;  4OVT A;  1BTJ A;  1AOV A;  3ZSF A;  2B65 A;  1FPL A;  3OXN A;  1B3G A;  5EYH A;  1Y3N A;  1DSN A;  4YKI A;  3LSL A;  1NNF A;  3TKD A;  5L8D A;  2DWJ A;  2HCA A;  4GVO A;  2QVU A;  1IEJ A;  3MP8 A;  5KDT B;  1I6B A;  2QJE A;  3VLW A;  1BKA A;  4GWX A;  2AIX A;  5EQ7 A;  1WVJ A;  2F97 A;  2HHM A;  5J16 A;  2O51 A;  3EHT A;  4YKK A;  2ESN A;  1LEV A;  5TPA A;  3T9H B;  1QUK A;  4NMY A;  4JBZ A;  3B8B A;  4F3S A;  5H8H B;  1FPI A;  4F31 B;  4PCD A;  4QFL A;  3KN8 A;  1FTO A;  2ZNS A;  1NUW A;  2Q74 A;  5I59 A;  3TAJ A;  1NNK A;  4JSD A;  4U22 A;  4ISU A;  1B46 A;  2O1L A;  4MAG A;  3E13 X;  4BDL A;  4EQ9 A;  3C33 A;  1QGX A;  4OVP A;  2I3W A;  3KOS A;  2F5X A;  1II5 A;  4NX1 A;  5L9O A;  2P3V A;  4THI A;  4X48 A;  3FV2 A;  1NKX A;  3ZS6 A;  1PBP A;  4ZZE A;  4IGT A;  1YZ0 A;  1YPN A;  4RYA A;  4JVC A;  2RF1 A;  4LQ2 A;  1KA0 A;  3BKI B;  4Q8R A;  3FD3 A;  3R26 A;  4PFI A;  4RXL A;  5IZ1 A;  2XD2 A;  3WAF A;  3DP6 A;  5DTB A;  1LCT A;  1B4Z A;  1EYI A;  4QFP A;  1Z7M E;  1DTG A;  2XD3 A;  3QUJ A;  4BDR A;  5H8F B;  4F1Y A;  1LBV A;  3I3V A;  5FHM A;  4JDF A;  1MY4 A;  1TT1 A;  3IFC A;  2CEX A;  4QFO A;  1OLA A;  1AWB A;  4PF6 A;  5I58 A;  1KWH A;  2V3Q A;  4PDH A;  2CZH A;  5H8S A;  2KLF A; 
#chains in the Genus database with same CATH homology
 4RPO A;  4NF4 A;  3SEX A;  4I1D A;  1NL5 A;  4NWC A;  4N07 A;  2QS2 A;  4LZ8 A;  1I69 A;  1ATG A;  3DLN A;  2NVU B;  3TCG A;  1B1H A;  1Y3Q A;  3P7I A;  1B3L A;  1LB9 A;  3O28 A;  5DEX B;  1JEV A;  3MQ9 A;  1YTV A;  1US4 A;  3K6V A;  4H5F A;  3RT6 B;  2ZNT A;  1MH4 A;  1HSJ A;  4FEC A;  1B58 A;  4XKR A;  5DEX A;  1IQ7 A;  3OEN A;  4OFL A;  4GWO A;  4WEP A;  3PPN A;  1FQD A;  3WAE A;  1P1O A;  5AA2 D;  1M5D A;  3C35 A;  1XVY A;  3VDF A;  4F19 A;  1A40 A;  1R9Q A;  3B6W A;  5I2K A;  2H4I A;  5AE4 A;  5B70 A;  3H6T A;  5FHO A;  5K2Y A;  4AB6 A;  3MBP A;  3VVD A;  3EF7 A;  3BFU A;  3JV9 A;  1YCJ A;  3OEM A;  4MFI A;  1MPC A;  4ZEF A;  1MS7 A;  2D5W A;  5H8N B;  1AMF A;  1A7L A;  4U2R A;  3VV5 A;  4I62 A;  1ANF A;  3K1M A;  1JW5 A;  1Y1Z A;  4IO2 A;  5JK4 A;  4GXS B;  4PFW A;  4ZE9 A;  5ITP A;  1BLF A;  2I49 A;  2RC9 A;  5DVJ A;  3TZA A;  2PVU A;  2UXA A;  3SEV A;  4DLD A;  4DXB A;  1R1N A;  4NF6 A;  4OMB A;  4M1V A;  3FGS A;  1N3W A;  5IKB A;  1CE2 A;  1RYO A;  5A5X B;  3K6U A;  1B4H A;  5KZT A;  3C4M A;  1WOD A;  5ISU A;  2I58 A;  3Q28 A;  1EZO A;  2NWJ A;  1M5C A;  3G3K A;  1IXH A;  2XXW A;  3Q26 A;  4XIG Q;  5DT6 A;  4H8J A;  3SEU A;  3TFL A;  3USD A;  3S9E A;  2D21 A;  2ZYM A;  2OK2 A;  1MY1 A;  2Q9T A;  3MPL A;  4GD5 A;  3E4R A;  4GQO A;  4ELO A;  3N94 A;  2REG A;  4NE4 A;  3V8X B;  3C32 A;  4ESX A;  3LSW A;  4Q5T A;  5H8Q A;  3FJ7 A;  2AL5 A;  3IOR A;  3FXR A;  3RGY A;  2DWA A;  2ZMB A;  1DPE A;  4LVQ A;  4RPN A;  3UP9 A;  2B3F A;  4PFT A;  3TUS A;  3K6W A;  1QVS A;  1ZKB A;  3FJG A;  1RYX A;  3R6U A;  5TU0 A;  1ZBM A;  5I84 A;  3C9H A;  4R73 A;  2O84 X;  3HST A;  1ZLQ A;  1LBB A;  4OZ9 A;  3TCH A;  1EZ9 A;  3H3G A;  2UVI A;  1N84 A;  3IB0 A;  1VE4 A;  1R9L A;  2IEE A;  4IO3 A;  4JSO A;  5I57 A;  3G3H A;  3KSX A;  3VLU A;  3DP4 A;  3PMX A;  3QUF A;  4KQP A;  1MPB A;  2VD2 A;  2VP1 A;  3PD8 A;  3AXF A;  4X9T A;  2WKY A;  3UOR A;  4AQ4 A;  1MXX A;  1JVX A;  2QS1 A;  3OO8 A;  1VR5 A;  4RNS A;  1Q1K A;  3L6H A;  1PDA A;  3U93 A;  2NUV A;  3FXQ A;  1GVC A;  5I56 B;  1P99 A;  4IB2 A;  1JNF A;  2Y7P A;  4LON B;  4X1D A;  1MQH A;  2ALU A;  4IY6 A;  4DCY A;  1MPD A;  3TTM A;  3PPO A;  3IJX B;  1P1W A;  4DE8 A;  4X1B A;  3TEL A;  1POY 1;  1M5E A;  1I6Q A;  1MXY A;  3V5A A;  2RC8 A;  5FHN A;  1NH7 A;  2F78 A;  2RCA A;  1XHY A;  2H5Y A;  1US5 A;  4G8M A;  3U72 A;  5B7D A;  3K6X A;  3G7W A;  1IXI A;  1EH3 A;  1SW1 A;  3MVX A;  4OHN A;  3IOV A;  3DP8 A;  4BDQ A;  3KJT A;  4FOR A;  4ECF A;  4DDD A;  3G3I A;  3MVY A;  3UIF A;  3UA8 A;  4YB5 A;  3LSF B;  3O9P A;  1L5T A;  3KEI A;  3T9U A;  2Y7I A;  1QUL A;  1GGG A;  4G68 A;  2H25 A;  4JB7 A;  4R6K A;  3GBB A;  3RPW A;  3RN8 A;  2QRY A;  2XXX A;  3JYR A;  3Q25 A;  5AA4 B;  3O97 A;  4Z7E A;  2GHB A;  3IB2 A;  3FZV A;  3SEW A;  4C1U A;  5I2N B;  1MY2 A;  3FV1 A;  2BJJ X;  1B6H A;  3U8Q A;  3CFX A;  1T0K A;  4H1X A;  2DP8 A;  4N13 A;  1Y1M A;  3FVN A;  2I4C A;  2DE2 A;  2OCU A;  4XKQ A;  3VVF A;  1Y20 A;  4YKJ A;  1UTH B;  4KYS A;  4OYV A;  3EPE A;  4R6Y A;  3H6U A;  1MXV A;  3N5L A;  3MZB A;  3MP1 A;  1D9V A;  4JWX A;  3MVW A;  4C0R A;  2I0C A;  4KYD A;  3CRB A;  1B9J A;  2Y84 A;  4FE8 A;  4F1U A;  2DYX A;  1TFD A;  5K2X A;  1VSO A;  1A8F A;  4DIG A;  5F7V A;  1ELJ A;  3TQL A;  3O2A A;  2I48 A;  3CG3 A;  3LSX A;  3PPP A;  1PBQ A;  4F29 A;  4RK2 A;  2XX9 A;  1O63 A;  2PT2 A;  3A3U A;  3DM0 A;  4LAT A;  2O68 A;  2OJT A;  3QXM A;  3MWB A;  2I4B A;  2Z22 A;  2O1M A;  4U4S A;  2F36 A;  2G29 A;  4EDP A;  4EXL A;  3FXU A;  4FAT A;  3TTN A;  2OWT A;  1QW0 A;  2I6E A;  1A55 A;  5EYF A;  5L9M A;  1PEB A;  4RY1 A;  3ZKK A;  3PPR A;  3QK6 A;  2DVC A;  3BBR A;  4Z0I A;  1PB9 A;  3F11 A;  1RKM A;  5BWJ A;  1MXU A;  5H8H A;  4BDM A;  3Q29 A;  5FTI A;  5CMC A;  2XXH A;  2Y7W A;  5AA3 A;  2P2A A;  1IIW A;  3RTF B;  3SEY A;  2XX8 A;  4P0I A;  2OBG A;  5AA1 A;  3ECR A;  5L9S A;  1B05 A;  3EHS A;  3MJN A;  2ZYK A;  3PV0 E;  4ZS9 A;  4KYE A;  1B7Z A;  4F1V A;  4NTL A;  4LUB A;  1EZP A;  4TOZ A;  3RQT A;  3I6V A;  5KDT A;  3EN3 A;  3TOD A;  4ZED A;  5CC2 A;  5KCJ A;  1S50 A;  3CR9 A;  3H6V A;  1TFA A;  4RK9 A;  1AL3 A;  3ZKL A;  3H6W A;  3IL1 B;  4HS7 A;  3TEP A;  2FNC A;  4LQ5 A;  4R6H A;  3PUX E;  5EHM A;  1SD3 A;  2ZYN A;  1JW4 A;  3EQ1 A;  4NF5 B;  3H03 A;  3OO7 A;  4QFK A;  2UYF A;  3RTW B;  1FQF A;  4ZEC A;  3K4U A;  3UN6 A;  2Z8F A;  3B6Q A;  3HO7 A;  3LR1 A;  4NF8 B;  1N7W A;  2PYY A;  4ND9 A;  1H43 A;  1SVX B;  1MRP A;  2ONK E;  3H06 B;  3HN0 A;  3ILT B;  1SYI A;  2XXY A;  1Z7N E;  4O3A A;  4R72 A;  3VVE A;  3IOW A;  3CFZ A;  2A5T A;  1SI0 A;  4YIC A;  2Q89 A;  1D4N A;  2Q8J A;  1NFT A;  2ZYO A;  1XC1 A;  2XX7 A;  4FEB A;  3TDJ A;  3KGC A;  2OWS A;  3IX1 A;  2E1S A;  4F3G A;  1H3D A;  2R6G E;  1H45 A;  2P0S A;  4YB7 A;  5AA4 A;  2V93 A;  3HPI A;  3OOA A;  4ZZA A;  2QS4 A;  1SI1 A;  2RIN A;  1O64 A;  3M3L A;  3S2V A;  2HXW A;  5H8F A;  4OEV A;  3SET A;  4OQO A;  5TP9 A;  3T9X B;  2RC7 A;  1ZTY A;  4XKP A;  3UGW A;  3O6H A;  4DCX A;  4XKN A;  3VXB A;  1LFH A;  1FQE A;  1D9Y A;  1LAF E;  2NOO A;  5CBR A;  1B3E A;  1LFG A;  1URG A;  3D4C A;  3JZJ A;  3PPQ A;  3W9W A;  4GL0 A;  4U1O A;  3T9V A;  3K01 A;  5I57 B;  5DVF A;  2DWH A;  3PMW A;  3KZG A;  1OMP A;  3H4Z A;  5I58 B;  2GRV A;  3OMB A;  4ZDM A;  1LBC A;  1USY E;  4MH5 A;  4E0X A;  1IUD A;  1H76 A;  3PD9 A;  3C36 A;  3E3K A;  3SES A;  5I56 A;  1XS5 A;  4PE5 B;  4F18 A;  1JVY A;  2Z8E A;  4POW A;  1MQD A;  5M2V A;  3C31 A;  4WKM A;  4FJP A;  4FAJ A;  1FQB A;  3K0V A;  2Y7R A;  1IIT A;  2FYI A;  2CMO A;  3QIM A;  2HAV A;  2D3I A;  2QMX A;  4GLI A;  2ZNU A;  2H9B A;  3S4U A;  4H65 A;  3H7M A;  1Y3P A;  1PB7 A;  3SKP A;  5IAI A;  2P1S A;  4MLV A;  5HM4 B;  1MDP 1;  4FIM A;  4OET A;  1B52 A;  2Y7K A;  1A8E A;  1CB6 A;  5FTH A;  2X26 A;  3RUM A;  3T96 B;  3MUQ A;  4YKP A;  2YJP A;  1P1Q A;  3FIR A;  5TP9 B;  1Q35 A;  3RNN A;  2ZXT A;  3PUV E;  1TXF A;  3U1O A;  1ZU0 A;  1MH3 A;  4GF8 A;  1UQW A;  1AH5 A;  2AL4 A;  3PU5 A;  3PUZ E;  2F7A A;  3KN7 A;  1LAG E;  4FED A;  4HCY A;  3MAM A;  4KHZ E;  4NWD A;  1FTJ A;  4OFO A;  4QSE A;  3IR1 A;  4KD5 A;  4F3B A;  5I2N A;  2O69 A;  3K1P A;  3OEL A;  4LP2 B;  4YZZ A;  4NF6 B;  4ELR A;  2HZL A;  1B0L A;  1OLC A;  4DZ1 A;  4EF1 A;  4QF9 A;  1UIV A;  1GR2 A;  3ONM A;  4OVJ A;  5CMB A;  5H8N A;  4RJZ A;  1SW5 A;  2F35 A;  2PT1 A;  3G3J A;  1OVT A;  1UTH A;  2HFB A;  4EQB A;  4ZEK A;  1NNP A;  4DXC A;  3QYT A;  1MXW A;  3FAT A;  3O6G A;  5I59 B;  3K02 A;  3IB1 A;  2X7Q A;  3C34 A;  4IO6 A;  4QFN A;  3KN3 A;  3BFT A;  1M5B A;  1QUI A;  2M8C A;  4R9G A;  3OO6 A;  3SDF A;  1TWY A;  2O7I A;  4H6D A;  1A99 A;  4IO5 A;  5AA2 A;  3OSR A;  2XXU A;  3HHF A;  3L6G A;  4I9D A;  4PQJ A;  4R74 A;  3R7X A;  5J1D A;  1GV8 A;  2I3V A;  1R6Z A;  1IZ1 A;  4XTC Q;  2HQ0 A;  1JET A;  1SDX A;  4GL8 A;  1Y4C A;  3MW0 A;  3KFM A;  1PC3 A;  1MQG A;  4U21 A;  2G93 A;  1I6A A;  1N76 A;  3S9N C;  3M3F A;  1B2H A;  1OQG A;  2A5S A;  3KJ7 A;  4JXI A;  3V89 B;  3S9L C;  4G68 C;  3CSG A;  3IJO B;  4GRK A;  5H8Q B;  3HV1 A;  4WXJ A;  3LUY A;  2XXQ A;  2UYE A;  4POX A;  1FW0 A;  3MVZ A;  2VD3 A;  3MZ1 A;  4QSC A;  1B3F A;  1HSE A;  1LB8 A;  1UTB B;  2ABH A;  2YPN A;  2Z8D A;  1BP5 A;  3IOU A;  1DTZ A;  4G4P A;  4I8C A;  4JWO A;  4R2F A;  1WDN A;  1P1N A;  1USY H;  2UVJ A;  4TLL B;  4UA8 A;  3TQW A;  4MBP A;  4DXU A;  2THI A;  3CFL A;  1FCK A;  1UTB A;  1XVX A;  3GXA A;  4GOT A;  5JTY B;  1NMU A;  4NED A;  2HAU A;  2X7P A;  2PMS A;  4R2B A;  3T66 A;  1OIB A;  4G2Z A;  1B7H A;  4F39 A;  5A5X A;  4KCC A;  4QHQ A;  1IXC A;  1N3X A;  3KSJ A;  4GIZ A;  1B40 A;  1AIV A;  4YU0 A;  3FVK A;  2UVH A;  1POT A;  3OEK A;  1B1X A;  2XXT A;  5ELV A;  3TMG A;  2R71 A;  3OO9 A;  1LAX A;  1SW2 A;  5CM6 A;  3KG2 A;  1MQJ A;  1MY0 A;  3N6U A;  3TPA A;  1UIU A;  2XXI A;  2DS9 A;  1FTM A;  1HSL A;  4KPT A;  4PP0 A;  4UAC A;  1OVB A;  4MF3 A;  2RKM A;  4X48 A;  1B32 A;  1QKA A;  3D4G A;  4IO4 A;  4U23 A;  4EUO A;  1PB8 A;  4ESW A;  3VFJ A;  4EF2 A;  4ELP A;  2V3U A;  2A5T B;  3PGF A;  2DVZ A;  4OFJ A;  5CRY A;  2VGQ A;  3FUZ A;  3EHU A;  3CSB A;  1SBP A;  3M3K A;  3E9X A;  2FA7 A;  3MPK A;  2DWI A;  2O7U A;  1MXZ A;  4H67 A;  4TQU Q;  3S9M C;  1B0H A;  1QJM A;  1BTJ A;  2F6G A;  5BUU A;  3G3F A;  2XXP A;  1URS A;  1AOV A;  2HEU A;  2AYS A;  3ZSF A;  1B7U A;  2B65 A;  3KBR A;  2OLB A;  3OXN A;  4YMA A;  1B3G A;  3K00 A;  3HHG A;  3O6I A;  4YAH X;  1Y3N A;  1DSN A;  4KCD A;  3LSL A;  4YKI A;  4C1T A;  3IK6 B;  1NNF A;  5CMM A;  3TKD A;  5AA2 B;  3FVO A;  1LAH E;  4TLM B;  5L8D A;  2DWJ A;  3KOT A;  2NXO A;  3B6T A;  2HCA A;  3GLB A;  4GVO A;  4YMB A;  1GTK A;  4K3F A;  4Q0C A;  4NF4 B;  1IEJ A;  3MP8 A;  5KDT B;  2DE3 A;  5HBC A;  4LZ5 A;  1OQH A;  1I6B A;  3Q27 A;  2QJE A;  4OWD A;  1XT8 A;  2OZZ A;  1JW1 A;  2HZK A;  1VFD A;  1H44 A;  4KR5 A;  1S9T A;  5CMK A;  2F7C A;  3VLW A;  3IO6 A;  4LA9 A;  1BKA A;  3W15 C;  4PFU A;  1MG1 A;  1FQC A;  3TTR A;  2UVG A;  2H99 A;  5ICQ A;  3TTL A;  2AIX A;  2I0B A;  1WVJ A;  2F97 A;  4KFQ A;  4YB6 A;  2O51 A;  4IY5 A;  4P11 A;  3DEL B;  5ITO A;  4BLA A;  3EHT A;  2Q2A A;  2W7Y A;  2ESN A;  3PUY E;  4OES A;  4YKK A;  1QKB A;  2QSX A;  2PX1 A;  5TPA A;  3THI A;  1B5I A;  4M4G A;  5CI5 A;  1FTL A;  4HCW A;  3T9H B;  1QUK A;  1MY3 A;  4ZEB A;  1LLS A;  2VOZ A;  3V83 A;  3O29 A;  4G8H A;  4NMY A;  3CIJ A;  3U94 A;  2GH9 A;  3OD7 A;  4JBZ A;  4QRZ A;  1ZMG A;  2QPQ A;  4E0W A;  2VHA A;  4G68 B;  4F3S A;  3N6T A;  4OEU A;  3MZ9 A;  5JEI A;  4H8I A;  5H8H B;  5KCJ B;  3K1N A;  2V3T A;  4OEN A;  4F31 B;  1FTK A;  3MP6 A;  4BDO A;  4QFL A;  4N6P A;  3FVG A;  4MLQ A;  3KN8 A;  1A54 A;  2DOJ A;  2IA4 A;  2LAO A;  3SER A;  1QUJ A;  3T93 B;  2B3B A;  1FTO A;  1M5F A;  2QL3 A;  4BDN A;  2ZNS A;  3LC8 A;  1YAE A;  1BIY A;  1LST A;  2Q88 A;  4ZE8 A;  4EQ7 A;  2QS3 A;  5I59 A;  3TAJ A;  1NNK A;  4OER A;  3VXC A;  3U92 A;  1MM7 A;  3O66 A;  2GHA A;  1XOC A;  4P0G A;  3N26 A;  4JSD A;  4ONY A;  5JTY A;  4KI0 E;  4U22 A;  1NH8 A;  5F1Q A;  3PMV A;  4ISU A;  2ONS A;  2F7B A;  3TTK A;  1B46 A;  2O1L A;  3E13 X;  4BDL A;  3QSL A;  1VFE A;  2XXV A;  1ZJL A;  4PFY A;  2DQV A;  4EQ9 A;  3VLV A;  4HTG A;  4EXK A;  3C33 A;  2V84 A;  3G3G A;  5LOM A;  2DXR A;  4LZ7 A;  3PUW E;  1IXG A;  2I3W A;  3KOS A;  3B7D A;  2F5X A;  1URD A;  1II5 A;  1DOT A;  1FQA A;  5TPA B;  5L9O A;  3CVG A;  2QMW A;  2E0S A;  4THI A;  1O7T A;  2PBW A;  1JQF A;  3CG1 A;  3TYH A;  4IO7 A;  2DE4 A;  3LBS A;  1Y9U A;  1NKX A;  2RCB A;  3FV2 A;  1PBP A;  4GXA A;  3IO4 A;  4ZEI A;  4ZZE A;  4IGT A;  3ZS6 A;  5ICT A;  4O3B A;  4OXV A;  4RA1 A;  1YPN A;  3IAZ A;  4JWY A;  4RYA A;  2RF1 A;  4LQ2 A;  3BKI B;  4U1Z A;  3QAX A;  1MQI A;  4NF5 A;  3TCF A;  2DSF A;  1MDQ A;  3FD3 A;  3R26 A;  3W9V A;  4Q8R A;  3MC2 A;  4RXL A;  3T22 A;  4ELQ A;  5CBS A;  4H5G A;  1F9B A;  3A09 A;  2H98 A;  3ODB A;  4NF8 A;  4O3C A;  2XD2 A;  3FJM A;  3WAF A;  1LCF A;  3DP6 A;  1B51 A;  3GZG A;  1J1N A;  3A3C A;  3VE1 B;  3FAS A;  1N04 A;  2R9J A;  4GFR A;  5DTB A;  2F34 A;  2F6P A;  5DVI A;  1D3K A;  1LCT A;  1LGB C;  2V25 A;  3ILU B;  4F2Q A;  2XHD A;  1B4Z A;  3M8U A;  4F3P A;  4IGR A;  4QFP A;  1Y4T A;  2CZL A;  1Z7M E;  1LFI A;  1SQY A;  2Z23 A;  3RY3 A;  4F22 A;  1DTG A;  4U4X A;  4WED A;  4G8N A;  2O6A A;  2XD3 A;  3QUJ A;  4Q30 B;  4AB5 A;  4BDR A;  4HW8 A;  3RLF E;  5H8F B;  3RT8 A;  1ZIU A;  4R9F A;  4F1Y A;  2REJ A;  1N7X A;  1MM6 A;  1SW4 A;  2F8D A;  3I3V A;  4R75 A;  5FHM A;  4JDF A;  1MY4 A;  3IOT A;  1TT1 A;  4G77 A;  2YLN A;  2Q2C A;  4H0W A;  4L17 A;  2ANJ A;  1NNT A;  2ONR A;  3OSQ A;  4PET A;  4XXU A;  1B3H A;  1N0T A;  4QFO A;  5EHS A;  5I2K B;  1OLA A;  5HPQ A;  1B5J A;  2GFE A;  3K2D A;  3UK4 A;  1KWH A;  5I58 A;  1B5H A;  4QSD A;  1JEU A;  1P1U A;  2DXY A;  2V3Q A;  4F2O A;  1S7Y A;  3I5O A;  3GBA A;  1DPP A;  1SYH A;  3CI8 A;  5H8S A;  1EU8 A;  3HCQ A;  5DYH A;  2KLF A;  4OTE A;  1DMB A;  2XXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...