1POTA

Spermidine/putrescine-binding protein complexed with spermidine (monomer form)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
322
structure length
322
Chain Sequence
NNTLYFYNWTEYVPPGLLEQFTKETGIKVIYSTYESNETMYAKLKTYKDGAYDLVVPSTYYVDKMRKEGMIQKIDKSKLTNFSNLDPDMLNKPFDPNNDYSIPYIWGATAIGVNGDAVDPKSVTSWADLWKPEYKGSLLLTDDAREVFQMALRKLGYSGNTTDPKEIEAAYNELKKLMPNVAAFNSDNPANPYMEGEVNLGMIWNGSAFVARQAGTPIDVVWPKEGGIFWMDSLAIPANAKNKEGALKLINFLLRPDVAKQVAETIGYPTPNLAARKLLSPEVANDKTLYPDAETIKNGEWQNDVGAASSIYEEYYQKLKAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords SPERMIDINE/PUTRESCINE-BINDING PROTEIN
publication title The 1.8-A X-ray structure of the Escherichia coli PotD protein complexed with spermidine and the mechanism of polyamine binding.
pubmed rcsb
total genus 106
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 1996-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1potA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1potA02
4GWOA 3SDFA 3EPEA 3IB2A 1XC1A 1DPPA 3O66A 2RC9A 3BFTA 2UVJA 5CBSA 2F35A 4MLVA 4XKQA 1T0KA 3RNNA 4C0RA 1MS7A 1SI0A 1WDNA 3GLBA 2AL5A 2XXHA 1PB7A 3ZSFA 4IB2A 4EDPA 2G93A 1Y1MA 1B4HA 1H76A 2Q2CA 5DVIA 3H6TA 4YKIA 3G3FA 3OXNA 2F34A 3A09A 3IR1A 3KFMA 3IO6A 3CFLA 3SEWA 4G68C 3ZS6A 5AA2D 1AH5A 4N07A 3KOSA 2VOZA 4F3SA 2O7IA 3KN3A 3EN3A 3T66A 4E0WA 2B3BA 5DVJA 1SYHA 4OHNA 1Y9UA 3VLWA 3LUYA 2Y7RA 4NF4B 5A5XB 2GFEA 3MVZA 3K4UA 4R6YA 1ZBMA 4QFPA 5ISUA 4YMBA 4MF3A 4JWYA 3GXAA 1H3DA 4KD5A 3H7MA 3FASA 3U72A 4IO4A 4DXCA 5H8SA 3CSGA 4G2ZA 1UQWA 3Q25A 3UORA 4YKPA 1TT1A 3H4ZA 4IO3A 4H65A 2XXRA 2ABHA 3MVWA 3K01A 1ZKBA 1L5TA 2H9BA 1SW2A 4FIMA 3C33A 3Q27A 4NWDA 1MH4A 3RY3A 1JEVA 4R9GA 1ANFA 1P1QA 3Q29A 2A5SA 4LP2B 4POWA 1LCTA 4DXBA 3T96B 5I2NA 5H8FB 4EQ9A 4WKMA 4NF6A 1B9JA 3HHGA 1OIBA 3KEIA 4F2QA 4F18A 4BDQA 1MY2A 3H6UA 2DE3A 3PGFA 2HCAA 3IJXB 5FTIA 3VLUA 1USYH 3TCGA 5CRYA 3U8QA 4XIGQ 3QAXA 2YJPA 4FECA 4MH5A 1DTZA 1YCJA 2IEEA 3HN0A 4OEUA 3BBRA 3UP9A 3MVYA 1UTBB 1SW1A 3G3JA 4RJZA 2KLFA 4U22A 4GRKA 4ELRA 5AA2B 2CMOA 1ZTYA 3FVOA 2NOOA 4FAJA 1MQDA 1ELJA 4U1ZA 1MQIA 3RQTA 1GV8A 3H06B 3S9MC 2HAUA 1F9BA 1DPEA 4RPNA 1B7ZA 1FTKA 3CG3A 3N5LA 2P0SA 2NXOA 1N76A 3TTNA 4K3FA 3ODBA 1SDXA 2I4CA 4BDOA 1AOVA 4XKNA 5I58B 1A40A 4F3GA 1POY1 1Y4CA 2A5TA 2RF1A 3IX1A 4Z0IA 2O1MA 3IOWA 2ONKE 4DDDA 3U94A 4BLAA 5IAIA 1HSLA 1NH7A 3DM0A 5TP9A 4M4GA 4F3PA 2RC7A 3C34A 1MQGA 1NH8A 2DE2A 4I8CA 2FA7A 4IGTA 1TXFA 5H8HA 4YB7A 1B3HA 1B51A 2FYIA 4LZ8A 1SYIA 1LAXA 2E1SA 3CIJA 4ELPA 3VE1B 1LLSA 3TQLA 3MBPA 3MUQA 2GRVA 5I57B 3A3CA 3EHSA 4EXKA 3TQWA 5H8QB 3GBBA 5CMBA 5K2XA 4R75A 3KZGA 3L6GA 1FCKA 3MP8A 3PUWE 1FTOA 5BUUA 3ZKLA 5AA4A 5K2YA 3UIFA 4RXLA 4ZEIA 3PMXA 1N0TA 3C36A 1B4ZA 1EH3A 3B6TA 1LGBC 4IY5A 4FEDA 4QFLA 1BKAA 1B0HA 2X26A 1VFDA 2DXRA 4THIA 4R2BA 3IB0A 3ILTB 5L9OA 4FATA 3VDFA 2UYFA 3TZAA 1QKBA 1JNFA 3KG2A 3SERA 4LQ5A 4R73A 3TMGA 3F11A 1VSOA 3IAZA 3AXFA 5H8NB 4DIGA 2XX9A 5EHMA 1R1NA 5KZTA 3TDJA 4F29A 2H25A 5CC2A 4DXUA 2RCBA 1A8FA 2R71A 4YICA 4G4PA 1OQHA 3TCHA 1US5A 3CFXA 3MW0A 3O6HA 1MPCA 1I6BA 3KJ7A 2XD3A 5I2KB 4ELQA 1TWYA 2DSFA 4LVQA 5FTHA 2OCUA 1LFIA 3PD9A 2VGQA 3M3FA 1YTVA 5I59B 1P1UA 2UVGA 4IY6A 1O7TA 3QUJA 2AIXA 4O3CA 4PFWA 4RK2A 2RINA 3N6TA 4JSOA 2XXYA 5KDTB 5JEIA 4G68A 4TQUQ 1CE2A 1N3WA 1B3EA 4GQOA 2NVUB 4KI0E 4DE8A 4WXJA 3HSTA 1HSJA 2ONRA 5FHOA 4LUBA 3K2DA 3UGWA 1SW5A 1OVBA 2REJA 3RT6B 3S2VA 4PE5B 1IUDA 1URGA 3OELA 4RPOA 5CMCA 3K0VA 4Q5TA 1MDP1 3I3VA 3OSRA 2HXWA 1QW0A 3FV1A 4R6HA 2O84X 3G3KA 2I3VA 1M5CA 4F1UA 1R9QA 2I4BA 3K6XA 3Q26A 5ELVA 2PMSA 4GL8A 4RY1A 1IEJA 2Q2AA 2O51A 1MY1A 5L9MA 2E0SA 3DP4A 1FTLA 3HCQA 4TOZA 2XXXA 4O3BA 4JB7A 3H6VA 1WODA 4FEBA 3G3IA 3HV1A 2THIA 2O1LA 1B3LA 4F39A 1FQDA 4FORA 3OO6A 4EUOA 4QHQA 2ZYNA 2O68A 5TPAA 3K1MA 2DOJA 3FV2A 1N04A 4OVJA 4OENA 1AIVA 1FTJA 2Y7IA 1H45A 3RGYA 3TFLA 1JQFA 3E9XA 3T9UA 3C4MA 4X1DA 5TU0A 3O9PA 3WAFA 2Z8FA 2HZLA 1A99A 4N13A 4YAHX 3W9WA 2QL3A 4LATA 1LFGA 3HPIA 1FW0A 3PMWA 4OEVA 1Y3QA 3RN8A 3SEXA 3THIA 3FJGA 3V8XB 5LOMA 1PDAA 3PPPA 1B1HA 1Z7ME 5AE4A 4KPTA 5ITOA 1N3XA 1LCFA 1QUJA 4NTLA 3PPNA 1Y1ZA 3JYRA 3USDA 3B6WA 4GVOA 1FQFA 1J1NA 4EQ7A 1MY0A 2OWSA 3SEUA 1JEUA 2UXAA 3OOAA 3UN6A 4UA8A 3VVDA 1B5HA 4KYSA 2I49A 2DWJA 3ECRA 2ZNUA 3MZBA 4U23A 2UYEA 3KN7A 3TELA 5ICQA 2I6EA 4KCCA 4IO5A 3T9VA 2M8CA 3PUYE 4X1BA 3EHUA 3D4CA 2UVHA 4H67A 1PBPA 1ATGA 5I2NB 4P0GA 5L9SA 3LSFB 3KSJA 4NF6B 2F7AA 2BJJX 3FIRA 2ESNA 3PD8A 3RTFB 4NEDA 1SQYA 1Y3PA 4ONYA 1IQ7A 3B7DA 4DLDA 2QSXA 3G3HA 4NE4A 1QUIA 4F3BA 5H8FA 3H03A 1BP5A 4ZEFA 3I5OA 4RYAA 3LSXA 1B40A 2RCAA 1ZLQA 1VFEA 1LB8A 2Z8EA 2DQVA 4H5FA 2I3WA 2LAOA 4GF8A 1B5JA 4PFUA 1D4NA 4ZZAA 1I69A 2VD2A 3FD3A 4DCYA 4QRZA 2PT1A 1D9VA 2HEUA 3TEPA 2F36A 4KHZE 4BDRA 5AA2A 3QUFA 1UIUA 3TTRA 2F97A 4G8MA 3VV5A 1OMPA 2O7UA 3QXMA 1S9TA 3P7IA 1CB6A 4JWXA 1D3KA 4WEDA 3EQ1A 1EU8A 5B7DA 3PU5A 4NF8B 2V84A 3TKDA 3FZVA 1NL5A 2A5TB 1PB9A 4X48A 2V3UA 4HW8A 1NMUA 4UACA 2QS1A 4MBPA 2QMXA 2OLBA 4DCXA 2IA4A 4POXA 3U93A 4ZE8A 4BDMA 5TP9B 3FJ7A 3T9HB 1MRPA 3O97A 3N6UA 4F31B 3LSLA 2ANJA 1IIWA 1POTA 5IKBA 2I0CA 1A55A 4U4SA 4NF5A 3O29A 3DP6A 3R6UA 5EHSA 3MAMA 3QK6A 1BTJA 5H8HB 4OESA 3RUMA 4KQPA 2QJEA 1UTHB 4N6PA 3IB1A 3G7WA 3FVKA 5JK4A 2ALUA 1PB8A 1RKMA 4KYDA 3RLFE 4Z7EA 1DOTA 3M8UA 2H98A 3MVXA 3R7XA 1BIYA 1A8EA 3CFZA 2XXUA 1OQGA 3FXQA 4GLIA 1NNTA 1LFHA 1QUKA 4YU0A 4P11A 1LAFE 3MC2A 3PPQA 1NKXA 1MXZA 3M3KA 4Q0CA 2ZMBA 4RK9A 2REGA 1B0LA 1H43A 2HQ0A 5I57A 3DLNA 3O6IA 4H8IA 2OJTA 5AA4B 3E4RA 4OFLA 3IOUA 2Q9TA 3FXUA 5CI5A 1P1OA 4GXAA 3SETA 2D21A 1MXYA 2B3FA 3K6WA 2WKYA 1P1NA 3BKIB 5DVFA 1PEBA 1I6QA 1PC3A 5F7VA 3FGSA 3U1OA 1MQJA 3I6VA 3IL1B 2XXTA 3VVFA 1RYOA 1B5IA 1BLFA 4PFYA 3TTMA 3FVNA 3OSQA 3MP6A 3OENA 4R72A 2XXVA 2QPQA 2DWHA 4PQJA 3W9VA 2XXQA 1LSTA 3VXCA 4HCYA 3LBSA 3KOTA 2B65A 2Z23A 4ZEBA 3TTLA 4U2RA 2Q88A 2VD3A 5DEXA 3IOTA 3C9HA 2I58A 2I0BA 2HFBA 3FVGA 4QSDA 3H6WA 4XTCQ 5H8NA 4ND9A 1Q35A 2CZLA 3KGCA 3KJTA 1HSEA 4PFTA 3IORA 3N26A 4X9TA 4TLMB 4O3AA 1NFTA 3HO7A 3E13X 3IO4A 2PYYA 5JTYA 1JW5A 3LC8A 2Q89A 3K6UA 1JVYA 3G3GA 1EZ9A 4HTGA 2VHAA 1N84A 5FHMA 4PETA 1B2HA 3V5AA 4G68B 3OO9A 4OERA 1MQHA 2XD2A 3FJMA 3LSWA 2PT2A 1MXVA 1OLAA 2ZYMA 1XT8A 5KDTA 3QSLA 4YB6A 2ZXTA 4IO7A 4QF9A 2F6PA 1NNFA 5KCJB 1IXGA 1B6HA 1II5A 2Y7WA 4OTEA 5I84A 1N7WA 1IITA 5I56A 3VVEA 3PUZE 4ELOA 4QFKA 3LR1A 4LA9A 5AA3A 2QRYA 4U1OA 5F1QA 4OYVA 4ZEKA 3O6GA 4JBZA 1MG1A 2Y84A 1B58A 5B70A 1O64A 5DT6A 2QMWA 3K1PA 3RTWB 4E0XA 1MH3A 4HCWA 3UK4A 3GBAA 5ICTA 5L8DA 2ZYKA 2DVZA 1IXHA 5J1DA 4U21A 5CBRA 4LZ7A 5CMMA 3M3LA 1SBPA 2DP8A 2D5WA 5TPAB 2DE4A 3C31A 2V25A 4MFIA 1JVXA 3T22A 2F78A 4IO2A 3KBRA 3OD7A 1AL3A 1Y20A 1ZU0A 1XVXA 4AQ4A 1N7XA 1I6AA 1JW1A 5AA1A 1ZIUA 4G77A 4EF1A 4QFNA 4YKJA 4YKKA 3W15C 3V89B 3B6QA 4OQOA 1ZMGA 1B05A 3ONMA 3O2AA 1EZOA 1MXWA 2QS3A 4FE8A 3FUZA 2H99A 1B1XA 3VXBA 4NF4A 4L17A 5A5XA 4XKRA 2YPNA 4G8NA 3TUSA 2V3TA 2FNCA 1FQCA 4GIZA 3S9NC 2Z22A 1MXXA 4ZECA 3C35A 2Y7KA 4NMYA 1B7UA 3MPLA 4OMBA 3VFJA 3K6VA 4BDNA 2GHBA 2XXWA 4JSDA 4F1VA 3HHFA 4C1TA 4AB5A 3PUXE 4ISUA 4R2FA 3Q28A 2NUVA 1B7HA 1URSA 3A3UA 3OEKA 1MXUA 4F1YA 3MZ9A 3KSXA 4G8HA 4GOTA 4QSEA 3SEYA 2PVUA 3DELB 4F22A 5EYFA 3FXRA 3BFUA 3K00A 4PP0A 3TYHA 4OZ9A 3MP1A 1GTKA 1Y4TA 3IOVA 4DZ1A 1UTBA 3EF7A 3WAEA 4Q8RA 1P1WA 4XXUA 3MQ9A 2H4IA 1PBQA 1FQEA 4H8JA 4MLQA 2UVIA 1KWHA 2D3IA 3S4UA 3MJNA 3QIMA 4H6DA 3FATA 1O63A 3SESA 2P2AA 2QS4A 3K02A 4JWOA 2OBGA 3PPRA 2QS2A 1MY4A 1LBCA 1M5DA 1OLCA 5CM6A 1H44A 2V3QA 2P1SA 4LZ5A 1S50A 4R6KA 3CG1A 1IZ1A 3OO7A 2OWTA 4OXVA 3MWBA 1S7YA 5DYHA 4NF8A 4ESWA 5I58A 1JETA 4KR5A 2I48A 4EF2A 4WEPA 1SW4A 3C32A 1YPNA 3IJOB 2DXYA 2ZYOA 3V83A 3EHTA 4H5GA 1VE4A 4NF5B 1AMFA 1XVYA 4H0WA 4RNSA 4NWCA 4ZZEA 3CI8A 3PUVE 4TLLB 1YAEA 5M2VA 3VLVA 1NNKA 4ESXA 2F7BA 4YMAA 1SI1A 3DP8A 1MY3A 4YZZA 3O28A 1JW4A 1RYXA 2DWAA 1UTHA 1B3GA 3MZ1A 4GFRA 4ZEDA 2X7PA 3D4GA 1QULA 2F8DA 1A54A 2OK2A 2OZZA 3PMVA 4OETA 2YLNA 2ONSA 3H3GA 3ZKKA 1MPDA 1IXIA 1M5BA 5H8QA 2HZKA 1DTGA 3E3KA 3UA8A 4OWDA 2F7CA 2Z8DA 4H1XA 3RT8A 4JDFA 1XHYA 4R9FA 3RPWA 2ZNSA 3QYTA 4ECFA 2GH9A 2R9JA 3CVGA 1Q1KA 1TFDA 4ZDMA 2DWIA 2O69A 4ZS9A 4GXSB 4HS7A 2XXIA 4Q30B 3TODA 2XX8A 3SEVA 1OVTA 1Y3NA 1QKAA 4GL0A 1VR5A 4YB5A 3CRBA 5HBCA 4I9DA 4R74A 3JZJA 1LBBA 4GD5A 3OO8A 3TAJA 2XXPA 2DS9A 4M1VA 1FQAA 3OEMA 1MDQA 5ITPA 4AB6A 1URDA 2X7QA 1SD3A 3OMBA 4ZE9A 1GGGA 3PV0E 4IO6A 4I1DA 1USYE 4EXLA 1GR2A 4F2OA 4F19A 1IXCA 3TTKA 5DEXB 4IGRA 2F6GA 4OFJA 3KN8A 3SKPA 3T9XB 4QFOA 1R6ZA 1A7LA 4KFQA 1QVSA 4RA1A 2G29A 4P0IA 5CMKA 1NNPA 5JTYB 1B3FA 1WVJA 1MM7A 2HAVA 4I62A 3L6HA 1LAGE 3ILUB 1M5FA 1B52A 2AL4A 1ZJLA 2V93A 4C1UA 1LAHE 1M5EA 3T93B 2NWJA 3TCFA 5DTBA 4KCDA 4LONB 5I2KA 3TPAA 5FHNA 2RKMA 2AYSA 2F5XA 2DVCA 1D9YA 4FJPA 5BWJA 5I59A 1DMBA 2RC8A 4LQ2A 4KYEA 2PX1A 1FQBA 1SVXB 1B46A 3GZGA 2GHAA 1FTMA 2ZNTA 2Y7PA 1XOCA 3S9LC 1Z7NE 2Q8JA 1XS5A 4EQBA 3R26A 1TFAA 3K1NA 3PPOA 1UIVA 3IK6B 3MPKA 5HM4B 2W7YA 4JXIA 1MPBA 5I56B 2XHDA 2XX7A 2O6AA 1QJMA 1R9LA 3CSBA 2DYXA 1P99A 5KCJA 4U4XA 1US4A 2H5YA 2VP1A 1EZPA 1LB9A 1DSNA 2PBWA 3CR9A 5HPQA 4QSCA 4OFOA 1GVCA 2R6GE 3U92A 4BDLA 4XKPA 3N94A 1MM6A 1B32A 3JV9A 3S9EA
chains in the Genus database with same CATH superfamily
5J16A 4GWOA 4GBWA 3SDFA 3EPEA 3IB2A 1XC1A 1DPPA 3O66A 2RC9A 3BFTA 2UVJA 5CBSA 2F35A 4MLVA 4XKQA 3MYUA 1T0KA 3RNNA 4C0RA 1MS7A 1SI0A 1WDNA 3GLBA 2AL5A 2XXHA 2XWOA 1PB7A 3ZSFA 4IB2A 4EDPA 2G93A 1Y1MA 1B4HA 1H76A 2Q2CA 4GWZA 1LBZA 5DVIA 3H6TA 4YKIA 3G3FA 3OXNA 2F34A 1KA0A 3A09A 3IR1A 3KFMA 3IO6A 3CFLA 3SEWA 4G68C 3ZS6A 5AA2D 1AH5A 4N07A 3KOSA 2VOZA 4F3SA 2MKZA 2O7IA 4HE0A 3KN3A 3EN3A 5EQAA 3T66A 2B3BA 5DVJA 4E0WA 1SYHA 4OHNA 1Y9UA 3VLWA 3LUYA 2Y7RA 4NF4B 5A5XB 2GFEA 3MVZA 3K4UA 4R6YA 1ZBMA 4QFPA 1Q9DA 5ISUA 4AS5A 4YMBA 4MF3A 4JWYA 2VT5A 3GXAA 1H3DA 4KD5A 3H7MA 3FASA 3U72A 4IO4A 4DXCA 5H8SA 3CSGA 4G2ZA 1UQWA 3Q25A 3UORA 4YKPA 1TT1A 3H4ZA 4IO3A 4H65A 1XI6A 2XXRA 4NX1A 2ABHA 3MVWA 3K01A 1ZKBA 1L5TA 2H9BA 4PAFA 1SW2A 4FIMA 4P1LA 3C33A 3Q27A 1NUZA 4NWDA 1MH4A 3RY3A 4XFEA 1JEVA 4R9GA 1ANFA 1P1QA 3Q29A 2A5SA 4LP2B 4POWA 1LCTA 4DXBA 3T96B 5I2NA 5H8FB 3QMFA 1FJ6A 4EQ9A 4WKMA 4NF6A 4X8RA 4OANA 1B9JA 3HHGA 4OVTA 1OIBA 3KEIA 4F2QA 4F18A 4BDQA 1MY2A 3H6UA 2DE3A 3PGFA 2HCAA 3IJXB 4MJOA 5FTIA 3VLUA 1USYH 4NF0A 3TCGA 5CRYA 3U8QA 4XIGQ 3QAXA 1FBEA 2YJPA 4FECA 4MH5A 1DTZA 1YCJA 2IEEA 3HN0A 4OEUA 3BBRA 1INPA 3UP9A 3MVYA 1UTBB 1SW1A 3G3JA 4RJZA 2KLFA 4PFBA 1FRPA 4U22A 3KC0A 4GRKA 4ELRA 5AA2B 2CMOA 1ZTYA 3FVOA 1YXIA 2NOOA 4FAJA 4PAIA 1MQDA 1ELJA 4U1ZA 1MQIA 3RQTA 1GV8A 3H06B 3S9MC 2HAUA 1F9BA 1DPEA 4RPNA 1B7ZA 2R8TA 1FTKA 3B8BA 3CG3A 3N5LA 2P0SA 2QVVA 2NXOA 1N76A 3TTNA 4K3FA 3ODBA 1LBWA 4PBQA 4PTKA 1SDXA 2Q8MA 2I4CA 4MMPA 4BDOA 2FBPA 1AOVA 4XKNA 5I58B 1A40A 4F3GA 1POY1 1Y4CA 2A5TA 4NAPA 2RF1A 3IX1A 4Z0IA 2O1MA 3BIGA 3IOWA 2ONKE 4DDDA 2WYKA 3U94A 4BLAA 5IAIA 2XXKA 5IGAA 1IMFA 1HSLA 1NH7A 3DM0A 4M4GA 5TP9A 4PF8A 4F3PA 4MX6A 1RDXA 4GWWA 2RC7A 4MIJA 1NUXA 3C34A 1MQGA 1NH8A 2DE2A 4I8CA 2FA7A 4IGTA 1TXFA 5H8HA 4YB7A 1B3HA 2CEYA 1B51A 2FYIA 4LZ8A 2FVZA 1SYIA 5IZ3B 1LAXA 2E1SA 3CIJA 2HHMA 4ELPA 3VE1B 1LLSA 3TQLA 3MBPA 3MUQA 3SZPA 1IMBA 3MSTA 2GRVA 5I57B 2WEFA 3A3CA 3EHSA 4N8YA 4EXKA 3TQWA 5H8QB 3GBBA 5CMBA 5K2XA 4R75A 3KZGA 3L6GA 4H46A 1FCKA 3MP8A 3PUWE 1FTOA 5BUUA 3ZKLA 3KC1A 5AA4A 5K2YA 3UIFA 4RXLA 4ZEIA 5F24A 2P3VA 3PMXA 4N6KA 1N0TA 3C36A 1B4ZA 1CNQA 1EH3A 2CZIA 3B6TA 1LGBC 4IY5A 4FEDA 4QFLA 1BKAA 1B0HA 2X26A 1VFDA 2DXRA 1JP4A 4THIA 1DCUA 4R2BA 3IB0A 3ILTB 5L9OA 4FATA 3VDFA 2UYFA 3TZAA 1QKBA 1JNFA 3KG2A 3SERA 4LQ5A 4R73A 3TMGA 3F11A 1VSOA 3IAZA 3AXFA 2FIXA 5H8NB 4DIGA 2XX9A 5EHMA 1R1NA 5KZTA 3TDJA 4F29A 2H25A 5CC2A 4DXUA 2RCBA 4P1EA 1A8FA 2R71A 4YICA 4G4PA 1OQHA 3T0JA 3TCHA 4XF5A 1US5A 3CFXA 1YZ0A 3MW0A 4JVDA 3O6HA 1MPCA 1I6BA 3KJ7A 2PFYA 2XD3A 1IMAA 5I2KB 4ELQA 1TWYA 2DSFA 4LVQA 5FTHA 2OCUA 4GWXA 1LFIA 3PD9A 2VGQA 3M3FA 1FBCA 1YTVA 5I59B 4PDDA 1P1UA 2UVGA 4IY6A 1O7TA 3QUJA 2AIXA 4O3CA 4MEVA 4PFWA 4RK2A 2RINA 3N6TA 4JSOA 2XXYA 5KDTB 5JEIA 4G68A 4TQUQ 2B4LA 1CE2A 1N3WA 1B3EA 4GQOA 2NVUB 4P47A 4KI0E 4DE8A 4NHBA 4WXJA 3HSTA 1HSJA 4OA4A 1FPGA 4X04A 2ONRA 5FHOA 4LUBA 3K2DA 3UGWA 1SW5A 1OVBA 2REJA 3RT6B 3S2VA 4PE5B 1IUDA 1URGA 3OELA 4RPOA 5CMCA 5ET5A 3K0VA 4Q5TA 1MDP1 3I3VA 1EYKA 3OSRA 4MCOA 2HXWA 1QW0A 3FV1A 4R6HA 2O84X 3G3KA 2I3VA 1M5CA 4GWSA 4MNCA 4F1UA 1R9QA 2I4BA 3K6XA 4P8BA 3Q26A 5ELVA 2PMSA 4GL8A 4RY1A 1IEJA 2Q2AA 2O51A 1MY1A 4GX6A 5L9MA 2E0SA 3DP4A 1FTLA 5DW8A 3HCQA 4TOZA 2XXXA 4O3BA 4JB7A 3H6VA 1WODA 4FEBA 3G3IA 5I5PA 3HV1A 2THIA 2O1LA 1B3LA 4F39A 1FQDA 4FORA 1DK4A 3OO6A 4EUOA 4JVIA 4QHQA 2ZYNA 4PAKA 1FBDA 2O68A 4PGNA 5TPAA 3K1MA 2DOJA 3FV2A 1FPDA 1N04A 4OVJA 4OENA 1AIVA 2FIEA 4NGUA 1FTJA 2Y7IA 1H45A 3RGYA 3TFLA 1JQFA 3E9XA 2BJIA 3T9UA 1LBXA 3C4MA 4X1DA 5TU0A 3O9PA 3WAFA 2Z8FA 2HZLA 1A99A 2KQZA 4N13A 4YAHX 2WYPA 3W9WA 2QL3A 4LATA 1LFGA 3HPIA 1FW0A 3PMWA 4OEVA 1Y3QA 3RN8A 3SEXA 3THIA 3FJGA 3V8XB 5LOMA 1PDAA 3PPPA 1B1HA 1Z7ME 4FBPA 5AE4A 2Q74A 4KPTA 5ITOA 1N3XA 1LCFA 2P3NA 1QUJA 3ROJA 4NTLA 3PPNA 1Y1ZA 3JYRA 3USDA 3B6WA 5FBPA 4GVOA 3EKIA 4N15A 1FQFA 1J1NA 4EQ7A 2CZHA 1MY0A 2OWSA 3T1BA 4I40A 5IM2A 3SEUA 1JEUA 2UXAA 1FBHA 3OOAA 3UN6A 4UA8A 3VVDA 1B5HA 4PE3A 4KYSA 2I49A 2DWJA 3ECRA 2ZNUA 3MZBA 4U23A 2UYEA 3KN7A 3TELA 4MNPA 5ICQA 2I6EA 4KCCA 4IO5A 3T9VA 2M8CA 3PUYE 4X1BA 3EHUA 3D4CA 2UVHA 4H67A 1PBPA 1ATGA 5I2NB 4P0GA 5L9SA 3LSFB 3KSJA 4NF6B 2F7AA 3D1RA 2BJJX 3FIRA 2ESNA 3PD8A 3RTFB 4NEDA 1SQYA 4PGPA 1Y3PA 4ONYA 1IQ7A 3B7DA 4DLDA 2QSXA 3G3HA 4NE4A 1QUIA 4F3BA 1LEVA 5H8FA 3H03A 1QGXA 1BP5A 4ZEFA 3I5OA 4RYAA 3LSXA 1B40A 2RCAA 2XWVA 1ZLQA 2Y5LA 3RPLA 5EQ9A 1VFEA 1LB8A 2Z8EA 2DQVA 4H5FA 2I3WA 2LAOA 4GF8A 1B5JA 4PFUA 4GWYA 1D4NA 4I3YA 2HXRA 4ZZAA 1I69A 2VD2A 3FD3A 4HXVA 1K9YA 2FHYA 4DCYA 4QRZA 4N91A 2PT1A 1D9VA 2HEUA 3TEPA 2F36A 4KHZE 4BDRA 5AA2A 2VPOA 3QUFA 1UIUA 3TTRA 4AS4A 2F97A 4G8MA 3VV5A 1OMPA 2O7UA 3QXMA 1S9TA 5ET6A 3P7IA 1CB6A 4JWXA 1D3KA 4WEDA 3EQ1A 1EU8A 5B7DA 1FPBA 3PU5A 4NF8B 2V84A 3TKDA 1SPIA 3FZVA 1NL5A 2A5TB 1PB9A 4X48A 2V3UA 4HW8A 1NMUA 4UACA 2QS1A 4MBPA 1FPJA 2QMXA 2OLBA 4DCXA 2JJKA 2IA4A 4POXA 3U93A 3LV0A 4ZE8A 4BDMA 5TP9B 3FJ7A 3T9HB 1MRPA 3O97A 3N6UA 4F31B 3LSLA 2ANJA 1IIWA 1POTA 5IKBA 2L5VA 2I0CA 4O8MA 1A55A 4NN3A 4NF5A 4U4SA 3O29A 3DP6A 3LUZA 3R6UA 5EHSA 3MAMA 3QK6A 1NV7A 1BTJA 5H8HB 4OESA 3RUMA 4KQPA 2QJEA 1UTHB 4N6PA 3IB1A 3G7WA 3FVKA 5JK4A 2ALUA 2KR0A 1PB8A 1RKMA 4KYDA 3RLFE 4Z7EA 1DOTA 3M8UA 2H98A 2XWKA 3MVXA 3R7XA 1BIYA 1A8EA 3CFZA 2XXUA 1OQGA 3FXQA 4GLIA 2F3DA 1NNTA 1LFHA 1QUKA 4YU0A 4P11A 4XEQA 1LAFE 3MC2A 3PPQA 2V4CA 1NKXA 1NV6A 5EQ7A 1MXZA 3M3KA 4Q0CA 2ZMBA 4RK9A 2DDKA 2REGA 1B0LA 1H43A 2HQ0A 5I57A 3DLNA 3O6IA 4H8IA 2OJTA 5AA4B 3E4RA 4OFLA 3IOUA 2Q9TA 3FXUA 5CI5A 1P1OA 2CEXA 4GXAA 3SETA 2D21A 1MXYA 2B3FA 2XA5A 3K6WA 4OVRA 2WKYA 1P1NA 3BKIB 5DVFA 1PEBA 1I6QA 1PC3A 5F7VA 3FGSA 3U1OA 1MQJA 1FBGA 3I6VA 3IL1B 2XXTA 3VVFA 1FSAA 1RYOA 1B5IA 1NV2A 1BLFA 4PBHA 4PFYA 1FJ9A 3TTMA 3FVNA 3OSQA 3U65A 4DI3D 3MP6A 3OENA 4R72A 2XXVA 4P56A 2QPQA 2DWHA 4PQJA 2VPNA 3W9VA 2XXQA 1LSTA 3VXCA 4HCYA 3LBSA 3KOTA 2B65A 2Z23A 4ZEBA 3TTLA 4U2RA 2Q88A 2VD3A 3FBPA 5DEXA 3IOTA 3C9HA 2I58A 2I0BA 2HFBA 3FVGA 4QSDA 3H6WA 4XTCQ 5H8NA 4ND9A 1Q35A 2CZLA 3KGCA 5EYHA 3KJTA 1HSEA 4PFTA 3IORA 3N26A 4X9TA 1BK4A 4TLMB 4O3AA 1NFTA 3HO7A 3E13X 3IO4A 3IFAA 2PYYA 1RDYA 3B50A 5JTYA 4IR8A 1JW5A 3LC8A 2GQ1A 2Q89A 3K6UA 1JVYA 3G3GA 1EZ9A 4HTGA 2VHAA 1N84A 5FHMA 4OVQA 4PETA 1B2HA 3V5AA 3CHGA 1FBFA 4G68B 3OO9A 4OERA 4O94A 1MQHA 2XD2A 1FBPA 1FTAA 3FJMA 3LSWA 2PT2A 1MXVA 1OLAA 2WBDA 2ZYMA 1FPIA 1XT8A 2QVRA 1NV1A 5KDTA 2CZKA 4N81A 3QSLA 4YB6A 2ZXTA 4IO7A 5I3SA 4QF9A 4DI4B 2F6PA 2XWIA 1NNFA 5KCJB 1IXGA 1B6HA 1II5A 1NUYA 2Y7WA 4OTEA 5I84A 1N7WA 3BIHA 2WBBA 1IITA 5I56A 5LTCA 3VVEA 3PUZE 4ELOA 2OWZA 4QFKA 3LR1A 4PDHA 4LA9A 5AA3A 2QRYA 4U1OA 5F1QA 4OYVA 4ZEKA 3O6GA 4JBZA 1MG1A 2Y84A 1B58A 1D9QA 5B70A 1O64A 5DT6A 2QMWA 3K1PA 3RTWB 4E0XA 1MH3A 4HCWA 3UK4A 3GBAA 5ICTA 5L8DA 2ZYKA 2DVZA 1IXHA 5J1DA 4U21A 5CBRA 4LZ7A 5CMMA 5LDZA 4O7IA 5ET7A 3M3LA 1SBPA 2DP8A 2D5WA 5TPAB 3ISPA 2DE4A 3C31A 2V25A 4KXPA 4MFIA 1JVXA 3T22A 2F78A 1NI9A 2B4MA 4IO2A 3KBRA 3OD7A 1AL3A 1Y20A 1ZU0A 1XVXA 4AQ4A 2ZZVA 1N7XA 1I6AA 4JVCA 1JW1A 1FPLA 5ET8A 5AA1A 4GWUA 1ZIUA 4G77A 4EF1A 4N8GA 4QFNA 4YKJA 2HPGA 4YKKA 3W15C 3V89B 1IMCA 3B6QA 4OQOA 1ZMGA 5T3JA 1B05A 3ONMA 1EYIA 4PC9A 3O2AA 4HE1A 1MXWA 1EZOA 5I7IA 2QS3A 4FE8A 3FUZA 2H99A 1B1XA 3KBZA 4GX4A 3VXBA 4NF4A 4L17A 5A5XA 4XKRA 2YPNA 4G8NA 3TUSA 2V3TA 2FNCA 5IZZA 1FQCA 4H45A 4GIZA 3S9NC 4LN5A 2Z22A 1MXXA 4ZECA 3C35A 1YYZA 2Y7KA 4P3LA 4OVSA 2ZZXA 1NUWA 4NMYA 1B7UA 3MPLA 4OMBA 4MNIA 3VFJA 3K6VA 4BDNA 2GHBA 2XXWA 4JSDA 4F1VA 3HHFA 2ZZWA 4C1TA 4AB5A 4GBVA 3PUXE 4ISUA 5EQ8A 4R2FA 3Q28A 1KA1A 2NUVA 1B7HA 3GYYA 1URSA 3A3UA 3OEKA 1KZ8A 1MXUA 4F1YA 3MZ9A 4N4UA 4PCDA 2OX3A 3KSXA 4G8HA 4GOTA 4QSEA 4NG7A 3RPLB 3RYDA 3SEYA 2PVUA 3DELB 4F22A 5EYFA 3FXRA 3BFUA 3K00A 4PP0A 3TYHA 4OZ9A 3MP1A 4HE2A 1GTKA 4O7MA 4QXDA 1Y4TA 3IOVA 4DZ1A 1UTBA 3EF7A 3WAEA 4Q8RA 1P1WA 4XXUA 3MQ9A 2H4IA 1PBQA 5IZ1A 1FQEA 1K9ZA 3PTYA 4H8JA 4MLQA 2UVIA 1KWHA 2D3IA 3S4UA 2WX9A 1RDZA 3MJNA 3QIMA 3IFCA 4H6DA 3FATA 1O63A 1G0HA 3SESA 2P2AA 2QS4A 3K02A 4JWOA 2OBGA 1LBYA 3PPRA 2QS2A 1MY4A 1LBCA 1M5DA 1OLCA 5CM6A 2QVUA 1H44A 2V3QA 2P1SA 4LZ5A 1S50A 4R6KA 3CG1A 1IZ1A 3OO7A 2OWTA 4OXVA 3MWBA 1S7YA 1FPEA 1NV3A 4NF8A 5DYHA 4ESWA 1NV5A 5I58A 1JETA 4KR5A 2I48A 4EF2A 4WEPA 1SW4A 3C32A 1YPNA 3HFUA 3IJOB 2PFZA 2DXYA 2ZYOA 3V83A 3EHTA 4H5GA 1VE4A 4NF5B 1AMFA 4G61A 5ESYA 1XVYA 4H0WA 4RNSA 4NWCA 4ZZEA 1FPFA 1EYJA 3CI8A 4MAGA 3PUVE 4TLLB 4P9KA 1YAEA 5M2VA 3VLVA 1NNKA 4ESXA 2F7BA 4YMAA 1SI1A 3DP8A 1MY3A 4YZZA 3O28A 3FXBA 1JW4A 1RYXA 2DWAA 1UTHA 1B3GA 3MZ1A 5IZ3A 1FPKA 4GFRA 4ZEDA 2X7PA 3NOHA 3D4GA 1QULA 2F8DA 1A54A 2OK2A 2OZZA 3PMVA 4OETA 2YLNA 2ONSA 1IMEA 3H3GA 3ZKKA 1MPDA 1IXIA 1M5BA 5H8QA 2HZKA 1DTGA 3E3KA 3UA8A 4OWDA 2F7CA 2Z8DA 4H1XA 3RT8A 4JDFA 1XHYA 4R9FA 3RPWA 2ZNSA 3QYTA 4ECFA 2GH9A 3E79A 2R9JA 3CVGA 1Q1KA 1TFDA 4I3EA 4ZDMA 2DWIA 2O69A 4ZS9A 4GXSB 4HS7A 2XXIA 4Q30B 3TODA 2XX8A 3SEVA 4MHFA 4PFRA 1OVTA 1Y3NA 1QKAA 4GL0A 1VR5A 4NQ8A 4YB5A 3CRBA 5HBCA 4I9DA 4R74A 3JZJA 1LBBA 1VDWA 4GD5A 3OO8A 3TAJA 2XXPA 2DS9A 4M1VA 1FQAA 3OEMA 1MDQA 3E78A 5ITPA 4AB6A 1URDA 2X7QA 4UABA 1NV4A 1SD3A 3OMBA 4ZE9A 4N6DA 1GGGA 3PV0E 4IO6A 4I1DA 1USYE 4EXLA 4N17A 1GR2A 4F2OA 4F19A 1IXCA 3TTKA 5DEXB 4IGRA 2F6GA 4OFJA 3KN8A 3SKPA 3T9XB 2QFLA 4QFOA 1R6ZA 1A7LA 4KFQA 1QVSA 4RA1A 2G29A 4P0IA 5CMKA 1NNPA 5JTYB 2PCRA 1B3FA 1WVJA 1MM7A 2HAVA 4I62A 3L6HA 2Y5KA 1LAGE 3ILUB 1M5FA 1B52A 2AL4A 1ZJLA 2V93A 4C1UA 1LAHE 5A5LA 1M5EA 3T93B 2NWJA 3TCFA 5DTBA 4KCDA 4LONB 5I2KA 4OVPA 3TPAA 5FHNA 2RKMA 2AYSA 2F5XA 4GX3A 5EYGA 2DVCA 1D9YA 4FJPA 5BWJA 5I59A 1DMBA 2RC8A 4LQ2A 4KYEA 2PX1A 1FQBA 1SVXB 1B46A 4PFIA 2GHAA 3GZGA 1FTMA 2ZNTA 2Y7PA 1LBVA 1XOCA 3S9LC 1Z7NE 2Q8JA 1XS5A 4EQBA 1G0IA 3R26A 1TFAA 3K1NA 3PPOA 1UIVA 3IK6B 3MPKA 1NV0A 5HM4B 2W7YA 2F3BA 1IMDA 4JXIA 1MPBA 5I56B 2XHDA 4PF6A 2XX7A 4QBAA 2O6AA 1QJMA 1R9LA 3CSBA 2DYXA 1P99A 5KCJA 4U4XA 1US4A 3A29A 2H5YA 2VP1A 1EZPA 1LB9A 1DSNA 1DBZA 2PBWA 3CR9A 5HPQA 4QSCA 1AWBA 4OFOA 1GVCA 2R6GE 3U92A 4BDLA 4XKPA 3N94A 1MM6A 1B32A 3JV9A 3S9EA
chains in the Genus database with same CATH topology
4GWOA 3SDFA 3EPEA 3IB2A 1XC1A 1DPPA 3O66A 2RC9A 3BFTA 2UVJA 5CBSA 2F35A 4MLVA 4XKQA 1T0KA 3RNNA 4C0RA 1MS7A 1SI0A 1WDNA 3GLBA 2AL5A 2XXHA 1PB7A 3ZSFA 4IB2A 4EDPA 2G93A 1Y1MA 1B4HA 1H76A 2Q2CA 5DVIA 3H6TA 4YKIA 3G3FA 3OXNA 2F34A 3A09A 3IR1A 3KFMA 3IO6A 3CFLA 3SEWA 4G68C 3ZS6A 5AA2D 1AH5A 4N07A 3KOSA 2VOZA 4F3SA 2O7IA 3KN3A 3EN3A 3T66A 4E0WA 2B3BA 5DVJA 1SYHA 4OHNA 1Y9UA 3VLWA 3LUYA 2Y7RA 4NF4B 5A5XB 2GFEA 3MVZA 3K4UA 4R6YA 1ZBMA 4QFPA 5ISUA 4YMBA 4MF3A 4JWYA 3GXAA 1H3DA 4KD5A 3H7MA 3FASA 3U72A 4IO4A 4DXCA 5H8SA 3CSGA 4G2ZA 1UQWA 3Q25A 3UORA 4YKPA 1TT1A 3H4ZA 4IO3A 4H65A 2XXRA 2ABHA 3MVWA 3K01A 1ZKBA 1L5TA 2H9BA 1SW2A 4FIMA 3C33A 3Q27A 4NWDA 1MH4A 3RY3A 1JEVA 4R9GA 1ANFA 1P1QA 3Q29A 2A5SA 4LP2B 4POWA 1LCTA 4DXBA 3T96B 5I2NA 5H8FB 4EQ9A 4WKMA 4NF6A 1B9JA 3HHGA 1OIBA 3KEIA 4F2QA 4F18A 4BDQA 1MY2A 3H6UA 2DE3A 3PGFA 2HCAA 3IJXB 5FTIA 3VLUA 1USYH 3TCGA 5CRYA 3U8QA 4XIGQ 3QAXA 2YJPA 4FECA 4MH5A 1DTZA 1YCJA 2IEEA 3HN0A 4OEUA 3BBRA 3UP9A 3MVYA 1UTBB 1SW1A 3G3JA 4RJZA 2KLFA 4U22A 4GRKA 4ELRA 5AA2B 2CMOA 1ZTYA 3FVOA 2NOOA 4FAJA 1MQDA 1ELJA 4U1ZA 1MQIA 3RQTA 1GV8A 3H06B 3S9MC 2HAUA 1F9BA 1DPEA 4RPNA 1B7ZA 1FTKA 3CG3A 3N5LA 2P0SA 2NXOA 1N76A 3TTNA 4K3FA 3ODBA 1SDXA 2I4CA 4BDOA 1AOVA 4XKNA 5I58B 1A40A 4F3GA 1POY1 1Y4CA 2A5TA 2RF1A 3IX1A 4Z0IA 2O1MA 3IOWA 2ONKE 4DDDA 3U94A 4BLAA 5IAIA 1HSLA 1NH7A 3DM0A 5TP9A 4M4GA 4F3PA 2RC7A 3C34A 1MQGA 1NH8A 2DE2A 4I8CA 2FA7A 4IGTA 1TXFA 5H8HA 4YB7A 1B3HA 1B51A 2FYIA 4LZ8A 1SYIA 1LAXA 2E1SA 3CIJA 4ELPA 3VE1B 1LLSA 3TQLA 3MBPA 3MUQA 2GRVA 5I57B 3A3CA 3EHSA 4EXKA 3TQWA 5H8QB 3GBBA 5CMBA 5K2XA 4R75A 3KZGA 3L6GA 1FCKA 3MP8A 3PUWE 1FTOA 5BUUA 3ZKLA 5AA4A 5K2YA 3UIFA 4RXLA 4ZEIA 3PMXA 1N0TA 3C36A 1B4ZA 1EH3A 3B6TA 1LGBC 4IY5A 4FEDA 4QFLA 1BKAA 1B0HA 2X26A 1VFDA 2DXRA 4THIA 4R2BA 3IB0A 3ILTB 5L9OA 4FATA 3VDFA 2UYFA 3TZAA 1QKBA 1JNFA 3KG2A 3SERA 4LQ5A 4R73A 3TMGA 3F11A 1VSOA 3IAZA 3AXFA 5H8NB 4DIGA 2XX9A 5EHMA 1R1NA 5KZTA 3TDJA 4F29A 2H25A 5CC2A 4DXUA 2RCBA 1A8FA 2R71A 4YICA 4G4PA 1OQHA 3TCHA 1US5A 3CFXA 3MW0A 3O6HA 1MPCA 1I6BA 3KJ7A 2XD3A 5I2KB 4ELQA 1TWYA 2DSFA 4LVQA 5FTHA 2OCUA 1LFIA 3PD9A 2VGQA 3M3FA 1YTVA 5I59B 1P1UA 2UVGA 4IY6A 1O7TA 3QUJA 2AIXA 4O3CA 4PFWA 4RK2A 2RINA 3N6TA 4JSOA 2XXYA 5KDTB 5JEIA 4G68A 4TQUQ 1CE2A 1N3WA 1B3EA 4GQOA 2NVUB 4KI0E 4DE8A 4WXJA 3HSTA 1HSJA 2ONRA 5FHOA 4LUBA 3K2DA 3UGWA 1SW5A 1OVBA 2REJA 3RT6B 3S2VA 4PE5B 1IUDA 1URGA 3OELA 4RPOA 5CMCA 3K0VA 4Q5TA 1MDP1 3I3VA 3OSRA 2HXWA 1QW0A 3FV1A 4R6HA 2O84X 3G3KA 2I3VA 1M5CA 4F1UA 1R9QA 2I4BA 3K6XA 3Q26A 5ELVA 2PMSA 4GL8A 4RY1A 1IEJA 2Q2AA 2O51A 1MY1A 5L9MA 2E0SA 3DP4A 1FTLA 3HCQA 4TOZA 2XXXA 4O3BA 4JB7A 3H6VA 1WODA 4FEBA 3G3IA 3HV1A 2THIA 2O1LA 1B3LA 4F39A 1FQDA 4FORA 3OO6A 4EUOA 4QHQA 2ZYNA 2O68A 5TPAA 3K1MA 2DOJA 3FV2A 1N04A 4OVJA 4OENA 1AIVA 1FTJA 2Y7IA 1H45A 3RGYA 3TFLA 1JQFA 3E9XA 3T9UA 3C4MA 4X1DA 5TU0A 3O9PA 3WAFA 2Z8FA 2HZLA 1A99A 4N13A 4YAHX 3W9WA 2QL3A 4LATA 1LFGA 3HPIA 1FW0A 3PMWA 4OEVA 1Y3QA 3RN8A 3SEXA 3THIA 3FJGA 3V8XB 5LOMA 1PDAA 3PPPA 1B1HA 1Z7ME 5AE4A 4KPTA 5ITOA 1N3XA 1LCFA 1QUJA 4NTLA 3PPNA 1Y1ZA 3JYRA 3USDA 3B6WA 4GVOA 1FQFA 1J1NA 4EQ7A 1MY0A 2OWSA 3SEUA 1JEUA 2UXAA 3OOAA 3UN6A 4UA8A 3VVDA 1B5HA 4KYSA 2I49A 2DWJA 3ECRA 2ZNUA 3MZBA 4U23A 2UYEA 3KN7A 3TELA 5ICQA 2I6EA 4KCCA 4IO5A 3T9VA 2M8CA 3PUYE 4X1BA 3EHUA 3D4CA 2UVHA 4H67A 1PBPA 1ATGA 5I2NB 4P0GA 5L9SA 3LSFB 3KSJA 4NF6B 2F7AA 2BJJX 3FIRA 2ESNA 3PD8A 3RTFB 4NEDA 1SQYA 1Y3PA 4ONYA 1IQ7A 3B7DA 4DLDA 2QSXA 3G3HA 4NE4A 1QUIA 4F3BA 5H8FA 3H03A 1BP5A 4ZEFA 3I5OA 4RYAA 3LSXA 1B40A 2RCAA 1ZLQA 1VFEA 1LB8A 2Z8EA 2DQVA 4H5FA 2I3WA 2LAOA 4GF8A 1B5JA 4PFUA 1D4NA 4ZZAA 1I69A 2VD2A 3FD3A 4DCYA 4QRZA 2PT1A 1D9VA 2HEUA 3TEPA 2F36A 4KHZE 4BDRA 5AA2A 3QUFA 1UIUA 3TTRA 2F97A 4G8MA 3VV5A 1OMPA 2O7UA 3QXMA 1S9TA 3P7IA 1CB6A 4JWXA 1D3KA 4WEDA 3EQ1A 1EU8A 5B7DA 3PU5A 4NF8B 2V84A 3TKDA 3FZVA 1NL5A 2A5TB 1PB9A 4X48A 2V3UA 4HW8A 1NMUA 4UACA 2QS1A 4MBPA 2QMXA 2OLBA 4DCXA 2IA4A 4POXA 3U93A 4ZE8A 4BDMA 5TP9B 3FJ7A 3T9HB 1MRPA 3O97A 3N6UA 4F31B 3LSLA 2ANJA 1IIWA 1POTA 5IKBA 2I0CA 1A55A 4U4SA 4NF5A 3O29A 3DP6A 3R6UA 5EHSA 3MAMA 3QK6A 1BTJA 5H8HB 4OESA 3RUMA 4KQPA 2QJEA 1UTHB 4N6PA 3IB1A 3G7WA 3FVKA 5JK4A 2ALUA 1PB8A 1RKMA 4KYDA 3RLFE 4Z7EA 1DOTA 3M8UA 2H98A 3MVXA 3R7XA 1BIYA 1A8EA 3CFZA 2XXUA 1OQGA 3FXQA 4GLIA 1NNTA 1LFHA 1QUKA 4YU0A 4P11A 1LAFE 3MC2A 3PPQA 1NKXA 1MXZA 3M3KA 4Q0CA 2ZMBA 4RK9A 2REGA 1B0LA 1H43A 2HQ0A 5I57A 3DLNA 3O6IA 4H8IA 2OJTA 5AA4B 3E4RA 4OFLA 3IOUA 2Q9TA 3FXUA 5CI5A 1P1OA 4GXAA 3SETA 2D21A 1MXYA 2B3FA 3K6WA 2WKYA 1P1NA 3BKIB 5DVFA 1PEBA 1I6QA 1PC3A 5F7VA 3FGSA 3U1OA 1MQJA 3I6VA 3IL1B 2XXTA 3VVFA 1RYOA 1B5IA 1BLFA 4PFYA 3TTMA 3FVNA 3OSQA 3MP6A 3OENA 4R72A 2XXVA 2QPQA 2DWHA 4PQJA 3W9VA 2XXQA 1LSTA 3VXCA 4HCYA 3LBSA 3KOTA 2B65A 2Z23A 4ZEBA 3TTLA 4U2RA 2Q88A 2VD3A 5DEXA 3IOTA 3C9HA 2I58A 2I0BA 2HFBA 3FVGA 4QSDA 3H6WA 4XTCQ 5H8NA 4ND9A 1Q35A 2CZLA 3KGCA 3KJTA 1HSEA 4PFTA 3IORA 3N26A 4X9TA 4TLMB 4O3AA 1NFTA 3HO7A 3E13X 3IO4A 2PYYA 5JTYA 1JW5A 3LC8A 2Q89A 3K6UA 1JVYA 3G3GA 1EZ9A 4HTGA 2VHAA 1N84A 5FHMA 4PETA 1B2HA 3V5AA 4G68B 3OO9A 4OERA 1MQHA 2XD2A 3FJMA 3LSWA 2PT2A 1MXVA 1OLAA 2ZYMA 1XT8A 5KDTA 3QSLA 4YB6A 2ZXTA 4IO7A 4QF9A 2F6PA 1NNFA 5KCJB 1IXGA 1B6HA 1II5A 2Y7WA 4OTEA 5I84A 1N7WA 1IITA 5I56A 3VVEA 3PUZE 4ELOA 4QFKA 3LR1A 4LA9A 5AA3A 2QRYA 4U1OA 5F1QA 4OYVA 4ZEKA 3O6GA 4JBZA 1MG1A 2Y84A 1B58A 5B70A 1O64A 5DT6A 2QMWA 3K1PA 3RTWB 4E0XA 1MH3A 4HCWA 3UK4A 3GBAA 5ICTA 5L8DA 2ZYKA 2DVZA 1IXHA 5J1DA 4U21A 5CBRA 4LZ7A 5CMMA 3M3LA 1SBPA 2DP8A 2D5WA 5TPAB 2DE4A 3C31A 2V25A 4MFIA 1JVXA 3T22A 2F78A 4IO2A 3KBRA 3OD7A 1AL3A 1Y20A 1ZU0A 1XVXA 4AQ4A 1N7XA 1I6AA 1JW1A 5AA1A 1ZIUA 4G77A 4EF1A 4QFNA 4YKJA 4YKKA 3W15C 3V89B 3B6QA 4OQOA 1ZMGA 1B05A 3ONMA 3O2AA 1EZOA 1MXWA 2QS3A 4FE8A 3FUZA 2H99A 1B1XA 3VXBA 4NF4A 4L17A 5A5XA 4XKRA 2YPNA 4G8NA 3TUSA 2V3TA 2FNCA 1FQCA 4GIZA 3S9NC 2Z22A 1MXXA 4ZECA 3C35A 2Y7KA 4NMYA 1B7UA 3MPLA 4OMBA 3VFJA 3K6VA 4BDNA 2GHBA 2XXWA 4JSDA 4F1VA 3HHFA 4C1TA 4AB5A 3PUXE 4ISUA 4R2FA 3Q28A 2NUVA 1B7HA 1URSA 3A3UA 3OEKA 1MXUA 4F1YA 3MZ9A 3KSXA 4G8HA 4GOTA 4QSEA 3SEYA 2PVUA 3DELB 4F22A 5EYFA 3FXRA 3BFUA 3K00A 4PP0A 3TYHA 4OZ9A 3MP1A 1GTKA 1Y4TA 3IOVA 4DZ1A 1UTBA 3EF7A 3WAEA 4Q8RA 1P1WA 4XXUA 3MQ9A 2H4IA 1PBQA 1FQEA 4H8JA 4MLQA 2UVIA 1KWHA 2D3IA 3S4UA 3MJNA 3QIMA 4H6DA 3FATA 1O63A 3SESA 2P2AA 2QS4A 3K02A 4JWOA 2OBGA 3PPRA 2QS2A 1MY4A 1LBCA 1M5DA 1OLCA 5CM6A 1H44A 2V3QA 2P1SA 4LZ5A 1S50A 4R6KA 3CG1A 1IZ1A 3OO7A 2OWTA 4OXVA 3MWBA 1S7YA 5DYHA 4NF8A 4ESWA 5I58A 1JETA 4KR5A 2I48A 4EF2A 4WEPA 1SW4A 3C32A 1YPNA 3IJOB 2DXYA 2ZYOA 3V83A 3EHTA 4H5GA 1VE4A 4NF5B 1AMFA 1XVYA 4H0WA 4RNSA 4NWCA 4ZZEA 3CI8A 3PUVE 4TLLB 1YAEA 5M2VA 3VLVA 1NNKA 4ESXA 2F7BA 4YMAA 1SI1A 3DP8A 1MY3A 4YZZA 3O28A 1JW4A 1RYXA 2DWAA 1UTHA 1B3GA 3MZ1A 4GFRA 4ZEDA 2X7PA 3D4GA 1QULA 2F8DA 1A54A 2OK2A 2OZZA 3PMVA 4OETA 2YLNA 2ONSA 3H3GA 3ZKKA 1MPDA 1IXIA 1M5BA 5H8QA 2HZKA 1DTGA 3E3KA 3UA8A 4OWDA 2F7CA 2Z8DA 4H1XA 3RT8A 4JDFA 1XHYA 4R9FA 3RPWA 2ZNSA 3QYTA 4ECFA 2GH9A 2R9JA 3CVGA 1Q1KA 1TFDA 4ZDMA 2DWIA 2O69A 4ZS9A 4GXSB 4HS7A 2XXIA 4Q30B 3TODA 2XX8A 3SEVA 1OVTA 1Y3NA 1QKAA 4GL0A 1VR5A 4YB5A 3CRBA 5HBCA 4I9DA 4R74A 3JZJA 1LBBA 4GD5A 3OO8A 3TAJA 2XXPA 2DS9A 4M1VA 1FQAA 3OEMA 1MDQA 5ITPA 4AB6A 1URDA 2X7QA 1SD3A 3OMBA 4ZE9A 1GGGA 3PV0E 4IO6A 4I1DA 1USYE 4EXLA 1GR2A 4F2OA 4F19A 1IXCA 3TTKA 5DEXB 4IGRA 2F6GA 4OFJA 3KN8A 3SKPA 3T9XB 4QFOA 1R6ZA 1A7LA 4KFQA 1QVSA 4RA1A 2G29A 4P0IA 5CMKA 1NNPA 5JTYB 1B3FA 1WVJA 1MM7A 2HAVA 4I62A 3L6HA 1LAGE 3ILUB 1M5FA 1B52A 2AL4A 1ZJLA 2V93A 4C1UA 1LAHE 1M5EA 3T93B 2NWJA 3TCFA 5DTBA 4KCDA 4LONB 5I2KA 3TPAA 5FHNA 2RKMA 2AYSA 2F5XA 2DVCA 1D9YA 4FJPA 5BWJA 5I59A 1DMBA 2RC8A 4LQ2A 4KYEA 2PX1A 1FQBA 1SVXB 1B46A 3GZGA 2GHAA 1FTMA 2ZNTA 2Y7PA 1XOCA 3S9LC 1Z7NE 2Q8JA 1XS5A 4EQBA 3R26A 1TFAA 3K1NA 3PPOA 1UIVA 3IK6B 3MPKA 5HM4B 2W7YA 4JXIA 1MPBA 5I56B 2XHDA 2XX7A 2O6AA 1QJMA 1R9LA 3CSBA 2DYXA 1P99A 5KCJA 4U4XA 1US4A 2H5YA 2VP1A 1EZPA 1LB9A 1DSNA 2PBWA 3CR9A 5HPQA 4QSCA 4OFOA 1GVCA 2R6GE 3U92A 4BDLA 4XKPA 3N94A 1MM6A 1B32A 3JV9A 3S9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWO A;  3SDF A;  3EPE A;  3IB2 A;  1XC1 A;  1DPP A;  3O66 A;  2RC9 A;  3BFT A;  2UVJ A;  5CBS A;  2F35 A;  4MLV A;  4XKQ A;  1T0K A;  3RNN A;  4C0R A;  1MS7 A;  1SI0 A;  1WDN A;  3GLB A;  2AL5 A;  2XXH A;  1PB7 A;  3ZSF A;  4IB2 A;  4EDP A;  2G93 A;  1Y1M A;  1B4H A;  1H76 A;  2Q2C A;  5DVI A;  3H6T A;  4YKI A;  3G3F A;  3OXN A;  2F34 A;  3A09 A;  3IR1 A;  3KFM A;  3IO6 A;  3CFL A;  3SEW A;  4G68 C;  3ZS6 A;  5AA2 D;  1AH5 A;  4N07 A;  3KOS A;  2VOZ A;  4F3S A;  2O7I A;  3KN3 A;  3EN3 A;  3T66 A;  4E0W A;  2B3B A;  5DVJ A;  1SYH A;  4OHN A;  1Y9U A;  3VLW A;  3LUY A;  2Y7R A;  4NF4 B;  5A5X B;  2GFE A;  3MVZ A;  3K4U A;  4R6Y A;  1ZBM A;  4QFP A;  5ISU A;  4YMB A;  4MF3 A;  4JWY A;  3GXA A;  1H3D A;  4KD5 A;  3H7M A;  3FAS A;  3U72 A;  4IO4 A;  4DXC A;  5H8S A;  3CSG A;  4G2Z A;  1UQW A;  3Q25 A;  3UOR A;  4YKP A;  1TT1 A;  3H4Z A;  4IO3 A;  4H65 A;  2XXR A;  2ABH A;  3MVW A;  3K01 A;  1ZKB A;  1L5T A;  2H9B A;  1SW2 A;  4FIM A;  3C33 A;  3Q27 A;  4NWD A;  1MH4 A;  3RY3 A;  1JEV A;  4R9G A;  1ANF A;  1P1Q A;  3Q29 A;  2A5S A;  4LP2 B;  4POW A;  1LCT A;  4DXB A;  3T96 B;  5I2N A;  5H8F B;  4EQ9 A;  4WKM A;  4NF6 A;  1B9J A;  3HHG A;  1OIB A;  3KEI A;  4F2Q A;  4F18 A;  4BDQ A;  1MY2 A;  3H6U A;  2DE3 A;  3PGF A;  2HCA A;  3IJX B;  5FTI A;  3VLU A;  1USY H;  3TCG A;  5CRY A;  3U8Q A;  4XIG Q;  3QAX A;  2YJP A;  4FEC A;  4MH5 A;  1DTZ A;  1YCJ A;  2IEE A;  3HN0 A;  4OEU A;  3BBR A;  3UP9 A;  3MVY A;  1UTB B;  1SW1 A;  3G3J A;  4RJZ A;  2KLF A;  4U22 A;  4GRK A;  4ELR A;  5AA2 B;  2CMO A;  1ZTY A;  3FVO A;  2NOO A;  4FAJ A;  1MQD A;  1ELJ A;  4U1Z A;  1MQI A;  3RQT A;  1GV8 A;  3H06 B;  3S9M C;  2HAU A;  1F9B A;  1DPE A;  4RPN A;  1B7Z A;  1FTK A;  3CG3 A;  3N5L A;  2P0S A;  2NXO A;  1N76 A;  3TTN A;  4K3F A;  3ODB A;  1SDX A;  2I4C A;  4BDO A;  1AOV A;  4XKN A;  5I58 B;  1A40 A;  4F3G A;  1POY 1;  1Y4C A;  2A5T A;  2RF1 A;  3IX1 A;  4Z0I A;  2O1M A;  3IOW A;  2ONK E;  4DDD A;  3U94 A;  4BLA A;  5IAI A;  1HSL A;  1NH7 A;  3DM0 A;  5TP9 A;  4M4G A;  4F3P A;  2RC7 A;  3C34 A;  1MQG A;  1NH8 A;  2DE2 A;  4I8C A;  2FA7 A;  4IGT A;  1TXF A;  5H8H A;  4YB7 A;  1B3H A;  1B51 A;  2FYI A;  4LZ8 A;  1SYI A;  1LAX A;  2E1S A;  3CIJ A;  4ELP A;  3VE1 B;  1LLS A;  3TQL A;  3MBP A;  3MUQ A;  2GRV A;  5I57 B;  3A3C A;  3EHS A;  4EXK A;  3TQW A;  5H8Q B;  3GBB A;  5CMB A;  5K2X A;  4R75 A;  3KZG A;  3L6G A;  1FCK A;  3MP8 A;  3PUW E;  1FTO A;  5BUU A;  3ZKL A;  5AA4 A;  5K2Y A;  3UIF A;  4RXL A;  4ZEI A;  3PMX A;  1N0T A;  3C36 A;  1B4Z A;  1EH3 A;  3B6T A;  1LGB C;  4IY5 A;  4FED A;  4QFL A;  1BKA A;  1B0H A;  2X26 A;  1VFD A;  2DXR A;  4THI A;  4R2B A;  3IB0 A;  3ILT B;  5L9O A;  4FAT A;  3VDF A;  2UYF A;  3TZA A;  1QKB A;  1JNF A;  3KG2 A;  3SER A;  4LQ5 A;  4R73 A;  3TMG A;  3F11 A;  1VSO A;  3IAZ A;  3AXF A;  5H8N B;  4DIG A;  2XX9 A;  5EHM A;  1R1N A;  5KZT A;  3TDJ A;  4F29 A;  2H25 A;  5CC2 A;  4DXU A;  2RCB A;  1A8F A;  2R71 A;  4YIC A;  4G4P A;  1OQH A;  3TCH A;  1US5 A;  3CFX A;  3MW0 A;  3O6H A;  1MPC A;  1I6B A;  3KJ7 A;  2XD3 A;  5I2K B;  4ELQ A;  1TWY A;  2DSF A;  4LVQ A;  5FTH A;  2OCU A;  1LFI A;  3PD9 A;  2VGQ A;  3M3F A;  1YTV A;  5I59 B;  1P1U A;  2UVG A;  4IY6 A;  1O7T A;  3QUJ A;  2AIX A;  4O3C A;  4PFW A;  4RK2 A;  2RIN A;  3N6T A;  4JSO A;  2XXY A;  5KDT B;  5JEI A;  4G68 A;  4TQU Q;  1CE2 A;  1N3W A;  1B3E A;  4GQO A;  2NVU B;  4KI0 E;  4DE8 A;  4WXJ A;  3HST A;  1HSJ A;  2ONR A;  5FHO A;  4LUB A;  3K2D A;  3UGW A;  1SW5 A;  1OVB A;  2REJ A;  3RT6 B;  3S2V A;  4PE5 B;  1IUD A;  1URG A;  3OEL A;  4RPO A;  5CMC A;  3K0V A;  4Q5T A;  1MDP 1;  3I3V A;  3OSR A;  2HXW A;  1QW0 A;  3FV1 A;  4R6H A;  2O84 X;  3G3K A;  2I3V A;  1M5C A;  4F1U A;  1R9Q A;  2I4B A;  3K6X A;  3Q26 A;  5ELV A;  2PMS A;  4GL8 A;  4RY1 A;  1IEJ A;  2Q2A A;  2O51 A;  1MY1 A;  5L9M A;  2E0S A;  3DP4 A;  1FTL A;  3HCQ A;  4TOZ A;  2XXX A;  4O3B A;  4JB7 A;  3H6V A;  1WOD A;  4FEB A;  3G3I A;  3HV1 A;  2THI A;  2O1L A;  1B3L A;  4F39 A;  1FQD A;  4FOR A;  3OO6 A;  4EUO A;  4QHQ A;  2ZYN A;  2O68 A;  5TPA A;  3K1M A;  2DOJ A;  3FV2 A;  1N04 A;  4OVJ A;  4OEN A;  1AIV A;  1FTJ A;  2Y7I A;  1H45 A;  3RGY A;  3TFL A;  1JQF A;  3E9X A;  3T9U A;  3C4M A;  4X1D A;  5TU0 A;  3O9P A;  3WAF A;  2Z8F A;  2HZL A;  1A99 A;  4N13 A;  4YAH X;  3W9W A;  2QL3 A;  4LAT A;  1LFG A;  3HPI A;  1FW0 A;  3PMW A;  4OEV A;  1Y3Q A;  3RN8 A;  3SEX A;  3THI A;  3FJG A;  3V8X B;  5LOM A;  1PDA A;  3PPP A;  1B1H A;  1Z7M E;  5AE4 A;  4KPT A;  5ITO A;  1N3X A;  1LCF A;  1QUJ A;  4NTL A;  3PPN A;  1Y1Z A;  3JYR A;  3USD A;  3B6W A;  4GVO A;  1FQF A;  1J1N A;  4EQ7 A;  1MY0 A;  2OWS A;  3SEU A;  1JEU A;  2UXA A;  3OOA A;  3UN6 A;  4UA8 A;  3VVD A;  1B5H A;  4KYS A;  2I49 A;  2DWJ A;  3ECR A;  2ZNU A;  3MZB A;  4U23 A;  2UYE A;  3KN7 A;  3TEL A;  5ICQ A;  2I6E A;  4KCC A;  4IO5 A;  3T9V A;  2M8C A;  3PUY E;  4X1B A;  3EHU A;  3D4C A;  2UVH A;  4H67 A;  1PBP A;  1ATG A;  5I2N B;  4P0G A;  5L9S A;  3LSF B;  3KSJ A;  4NF6 B;  2F7A A;  2BJJ X;  3FIR A;  2ESN A;  3PD8 A;  3RTF B;  4NED A;  1SQY A;  1Y3P A;  4ONY A;  1IQ7 A;  3B7D A;  4DLD A;  2QSX A;  3G3H A;  4NE4 A;  1QUI A;  4F3B A;  5H8F A;  3H03 A;  1BP5 A;  4ZEF A;  3I5O A;  4RYA A;  3LSX A;  1B40 A;  2RCA A;  1ZLQ A;  1VFE A;  1LB8 A;  2Z8E A;  2DQV A;  4H5F A;  2I3W A;  2LAO A;  4GF8 A;  1B5J A;  4PFU A;  1D4N A;  4ZZA A;  1I69 A;  2VD2 A;  3FD3 A;  4DCY A;  4QRZ A;  2PT1 A;  1D9V A;  2HEU A;  3TEP A;  2F36 A;  4KHZ E;  4BDR A;  5AA2 A;  3QUF A;  1UIU A;  3TTR A;  2F97 A;  4G8M A;  3VV5 A;  1OMP A;  2O7U A;  3QXM A;  1S9T A;  3P7I A;  1CB6 A;  4JWX A;  1D3K A;  4WED A;  3EQ1 A;  1EU8 A;  5B7D A;  3PU5 A;  4NF8 B;  2V84 A;  3TKD A;  3FZV A;  1NL5 A;  2A5T B;  1PB9 A;  4X48 A;  2V3U A;  4HW8 A;  1NMU A;  4UAC A;  2QS1 A;  4MBP A;  2QMX A;  2OLB A;  4DCX A;  2IA4 A;  4POX A;  3U93 A;  4ZE8 A;  4BDM A;  5TP9 B;  3FJ7 A;  3T9H B;  1MRP A;  3O97 A;  3N6U A;  4F31 B;  3LSL A;  2ANJ A;  1IIW A;  1POT A;  5IKB A;  2I0C A;  1A55 A;  4U4S A;  4NF5 A;  3O29 A;  3DP6 A;  3R6U A;  5EHS A;  3MAM A;  3QK6 A;  1BTJ A;  5H8H B;  4OES A;  3RUM A;  4KQP A;  2QJE A;  1UTH B;  4N6P A;  3IB1 A;  3G7W A;  3FVK A;  5JK4 A;  2ALU A;  1PB8 A;  1RKM A;  4KYD A;  3RLF E;  4Z7E A;  1DOT A;  3M8U A;  2H98 A;  3MVX A;  3R7X A;  1BIY A;  1A8E A;  3CFZ A;  2XXU A;  1OQG A;  3FXQ A;  4GLI A;  1NNT A;  1LFH A;  1QUK A;  4YU0 A;  4P11 A;  1LAF E;  3MC2 A;  3PPQ A;  1NKX A;  1MXZ A;  3M3K A;  4Q0C A;  2ZMB A;  4RK9 A;  2REG A;  1B0L A;  1H43 A;  2HQ0 A;  5I57 A;  3DLN A;  3O6I A;  4H8I A;  2OJT A;  5AA4 B;  3E4R A;  4OFL A;  3IOU A;  2Q9T A;  3FXU A;  5CI5 A;  1P1O A;  4GXA A;  3SET A;  2D21 A;  1MXY A;  2B3F A;  3K6W A;  2WKY A;  1P1N A;  3BKI B;  5DVF A;  1PEB A;  1I6Q A;  1PC3 A;  5F7V A;  3FGS A;  3U1O A;  1MQJ A;  3I6V A;  3IL1 B;  2XXT A;  3VVF A;  1RYO A;  1B5I A;  1BLF A;  4PFY A;  3TTM A;  3FVN A;  3OSQ A;  3MP6 A;  3OEN A;  4R72 A;  2XXV A;  2QPQ A;  2DWH A;  4PQJ A;  3W9V A;  2XXQ A;  1LST A;  3VXC A;  4HCY A;  3LBS A;  3KOT A;  2B65 A;  2Z23 A;  4ZEB A;  3TTL A;  4U2R A;  2Q88 A;  2VD3 A;  5DEX A;  3IOT A;  3C9H A;  2I58 A;  2I0B A;  2HFB A;  3FVG A;  4QSD A;  3H6W A;  4XTC Q;  5H8N A;  4ND9 A;  1Q35 A;  2CZL A;  3KGC A;  3KJT A;  1HSE A;  4PFT A;  3IOR A;  3N26 A;  4X9T A;  4TLM B;  4O3A A;  1NFT A;  3HO7 A;  3E13 X;  3IO4 A;  2PYY A;  5JTY A;  1JW5 A;  3LC8 A;  2Q89 A;  3K6U A;  1JVY A;  3G3G A;  1EZ9 A;  4HTG A;  2VHA A;  1N84 A;  5FHM A;  4PET A;  1B2H A;  3V5A A;  4G68 B;  3OO9 A;  4OER A;  1MQH A;  2XD2 A;  3FJM A;  3LSW A;  2PT2 A;  1MXV A;  1OLA A;  2ZYM A;  1XT8 A;  5KDT A;  3QSL A;  4YB6 A;  2ZXT A;  4IO7 A;  4QF9 A;  2F6P A;  1NNF A;  5KCJ B;  1IXG A;  1B6H A;  1II5 A;  2Y7W A;  4OTE A;  5I84 A;  1N7W A;  1IIT A;  5I56 A;  3VVE A;  3PUZ E;  4ELO A;  4QFK A;  3LR1 A;  4LA9 A;  5AA3 A;  2QRY A;  4U1O A;  5F1Q A;  4OYV A;  4ZEK A;  3O6G A;  4JBZ A;  1MG1 A;  2Y84 A;  1B58 A;  5B70 A;  1O64 A;  5DT6 A;  2QMW A;  3K1P A;  3RTW B;  4E0X A;  1MH3 A;  4HCW A;  3UK4 A;  3GBA A;  5ICT A;  5L8D A;  2ZYK A;  2DVZ A;  1IXH A;  5J1D A;  4U21 A;  5CBR A;  4LZ7 A;  5CMM A;  3M3L A;  1SBP A;  2DP8 A;  2D5W A;  5TPA B;  2DE4 A;  3C31 A;  2V25 A;  4MFI A;  1JVX A;  3T22 A;  2F78 A;  4IO2 A;  3KBR A;  3OD7 A;  1AL3 A;  1Y20 A;  1ZU0 A;  1XVX A;  4AQ4 A;  1N7X A;  1I6A A;  1JW1 A;  5AA1 A;  1ZIU A;  4G77 A;  4EF1 A;  4QFN A;  4YKJ A;  4YKK A;  3W15 C;  3V89 B;  3B6Q A;  4OQO A;  1ZMG A;  1B05 A;  3ONM A;  3O2A A;  1EZO A;  1MXW A;  2QS3 A;  4FE8 A;  3FUZ A;  2H99 A;  1B1X A;  3VXB A;  4NF4 A;  4L17 A;  5A5X A;  4XKR A;  2YPN A;  4G8N A;  3TUS A;  2V3T A;  2FNC A;  1FQC A;  4GIZ A;  3S9N C;  2Z22 A;  1MXX A;  4ZEC A;  3C35 A;  2Y7K A;  4NMY A;  1B7U A;  3MPL A;  4OMB A;  3VFJ A;  3K6V A;  4BDN A;  2GHB A;  2XXW A;  4JSD A;  4F1V A;  3HHF A;  4C1T A;  4AB5 A;  3PUX E;  4ISU A;  4R2F A;  3Q28 A;  2NUV A;  1B7H A;  1URS A;  3A3U A;  3OEK A;  1MXU A;  4F1Y A;  3MZ9 A;  3KSX A;  4G8H A;  4GOT A;  4QSE A;  3SEY A;  2PVU A;  3DEL B;  4F22 A;  5EYF A;  3FXR A;  3BFU A;  3K00 A;  4PP0 A;  3TYH A;  4OZ9 A;  3MP1 A;  1GTK A;  1Y4T A;  3IOV A;  4DZ1 A;  1UTB A;  3EF7 A;  3WAE A;  4Q8R A;  1P1W A;  4XXU A;  3MQ9 A;  2H4I A;  1PBQ A;  1FQE A;  4H8J A;  4MLQ A;  2UVI A;  1KWH A;  2D3I A;  3S4U A;  3MJN A;  3QIM A;  4H6D A;  3FAT A;  1O63 A;  3SES A;  2P2A A;  2QS4 A;  3K02 A;  4JWO A;  2OBG A;  3PPR A;  2QS2 A;  1MY4 A;  1LBC A;  1M5D A;  1OLC A;  5CM6 A;  1H44 A;  2V3Q A;  2P1S A;  4LZ5 A;  1S50 A;  4R6K A;  3CG1 A;  1IZ1 A;  3OO7 A;  2OWT A;  4OXV A;  3MWB A;  1S7Y A;  5DYH A;  4NF8 A;  4ESW A;  5I58 A;  1JET A;  4KR5 A;  2I48 A;  4EF2 A;  4WEP A;  1SW4 A;  3C32 A;  1YPN A;  3IJO B;  2DXY A;  2ZYO A;  3V83 A;  3EHT A;  4H5G A;  1VE4 A;  4NF5 B;  1AMF A;  1XVY A;  4H0W A;  4RNS A;  4NWC A;  4ZZE A;  3CI8 A;  3PUV E;  4TLL B;  1YAE A;  5M2V A;  3VLV A;  1NNK A;  4ESX A;  2F7B A;  4YMA A;  1SI1 A;  3DP8 A;  1MY3 A;  4YZZ A;  3O28 A;  1JW4 A;  1RYX A;  2DWA A;  1UTH A;  1B3G A;  3MZ1 A;  4GFR A;  4ZED A;  2X7P A;  3D4G A;  1QUL A;  2F8D A;  1A54 A;  2OK2 A;  2OZZ A;  3PMV A;  4OET A;  2YLN A;  2ONS A;  3H3G A;  3ZKK A;  1MPD A;  1IXI A;  1M5B A;  5H8Q A;  2HZK A;  1DTG A;  3E3K A;  3UA8 A;  4OWD A;  2F7C A;  2Z8D A;  4H1X A;  3RT8 A;  4JDF A;  1XHY A;  4R9F A;  3RPW A;  2ZNS A;  3QYT A;  4ECF A;  2GH9 A;  2R9J A;  3CVG A;  1Q1K A;  1TFD A;  4ZDM A;  2DWI A;  2O69 A;  4ZS9 A;  4GXS B;  4HS7 A;  2XXI A;  4Q30 B;  3TOD A;  2XX8 A;  3SEV A;  1OVT A;  1Y3N A;  1QKA A;  4GL0 A;  1VR5 A;  4YB5 A;  3CRB A;  5HBC A;  4I9D A;  4R74 A;  3JZJ A;  1LBB A;  4GD5 A;  3OO8 A;  3TAJ A;  2XXP A;  2DS9 A;  4M1V A;  1FQA A;  3OEM A;  1MDQ A;  5ITP A;  4AB6 A;  1URD A;  2X7Q A;  1SD3 A;  3OMB A;  4ZE9 A;  1GGG A;  3PV0 E;  4IO6 A;  4I1D A;  1USY E;  4EXL A;  1GR2 A;  4F2O A;  4F19 A;  1IXC A;  3TTK A;  5DEX B;  4IGR A;  2F6G A;  4OFJ A;  3KN8 A;  3SKP A;  3T9X B;  4QFO A;  1R6Z A;  1A7L A;  4KFQ A;  1QVS A;  4RA1 A;  2G29 A;  4P0I A;  5CMK A;  1NNP A;  5JTY B;  1B3F A;  1WVJ A;  1MM7 A;  2HAV A;  4I62 A;  3L6H A;  1LAG E;  3ILU B;  1M5F A;  1B52 A;  2AL4 A;  1ZJL A;  2V93 A;  4C1U A;  1LAH E;  1M5E A;  3T93 B;  2NWJ A;  3TCF A;  5DTB A;  4KCD A;  4LON B;  5I2K A;  3TPA A;  5FHN A;  2RKM A;  2AYS A;  2F5X A;  2DVC A;  1D9Y A;  4FJP A;  5BWJ A;  5I59 A;  1DMB A;  2RC8 A;  4LQ2 A;  4KYE A;  2PX1 A;  1FQB A;  1SVX B;  1B46 A;  3GZG A;  2GHA A;  1FTM A;  2ZNT A;  2Y7P A;  1XOC A;  3S9L C;  1Z7N E;  2Q8J A;  1XS5 A;  4EQB A;  3R26 A;  1TFA A;  3K1N A;  3PPO A;  1UIV A;  3IK6 B;  3MPK A;  5HM4 B;  2W7Y A;  4JXI A;  1MPB A;  5I56 B;  2XHD A;  2XX7 A;  2O6A A;  1QJM A;  1R9L A;  3CSB A;  2DYX A;  1P99 A;  5KCJ A;  4U4X A;  1US4 A;  2H5Y A;  2VP1 A;  1EZP A;  1LB9 A;  1DSN A;  2PBW A;  3CR9 A;  5HPQ A;  4QSC A;  4OFO A;  1GVC A;  2R6G E;  3U92 A;  4BDL A;  4XKP A;  3N94 A;  1MM6 A;  1B32 A;  3JV9 A;  3S9E A; 
#chains in the Genus database with same CATH topology
 5J16 A;  4GWO A;  4GBW A;  3SDF A;  3EPE A;  3IB2 A;  1XC1 A;  1DPP A;  3O66 A;  2RC9 A;  3BFT A;  2UVJ A;  5CBS A;  2F35 A;  4MLV A;  4XKQ A;  3MYU A;  1T0K A;  3RNN A;  4C0R A;  1MS7 A;  1SI0 A;  1WDN A;  3GLB A;  2AL5 A;  2XXH A;  2XWO A;  1PB7 A;  3ZSF A;  4IB2 A;  4EDP A;  2G93 A;  1Y1M A;  1B4H A;  1H76 A;  2Q2C A;  4GWZ A;  1LBZ A;  5DVI A;  3H6T A;  4YKI A;  3G3F A;  3OXN A;  2F34 A;  1KA0 A;  3A09 A;  3IR1 A;  3KFM A;  3IO6 A;  3CFL A;  3SEW A;  4G68 C;  3ZS6 A;  5AA2 D;  1AH5 A;  4N07 A;  3KOS A;  2VOZ A;  4F3S A;  2MKZ A;  2O7I A;  4HE0 A;  3KN3 A;  3EN3 A;  5EQA A;  3T66 A;  2B3B A;  5DVJ A;  4E0W A;  1SYH A;  4OHN A;  1Y9U A;  3VLW A;  3LUY A;  2Y7R A;  4NF4 B;  5A5X B;  2GFE A;  3MVZ A;  3K4U A;  4R6Y A;  1ZBM A;  4QFP A;  1Q9D A;  5ISU A;  4AS5 A;  4YMB A;  4MF3 A;  4JWY A;  2VT5 A;  3GXA A;  1H3D A;  4KD5 A;  3H7M A;  3FAS A;  3U72 A;  4IO4 A;  4DXC A;  5H8S A;  3CSG A;  4G2Z A;  1UQW A;  3Q25 A;  3UOR A;  4YKP A;  1TT1 A;  3H4Z A;  4IO3 A;  4H65 A;  1XI6 A;  2XXR A;  4NX1 A;  2ABH A;  3MVW A;  3K01 A;  1ZKB A;  1L5T A;  2H9B A;  4PAF A;  1SW2 A;  4FIM A;  4P1L A;  3C33 A;  3Q27 A;  1NUZ A;  4NWD A;  1MH4 A;  3RY3 A;  4XFE A;  1JEV A;  4R9G A;  1ANF A;  1P1Q A;  3Q29 A;  2A5S A;  4LP2 B;  4POW A;  1LCT A;  4DXB A;  3T96 B;  5I2N A;  5H8F B;  3QMF A;  1FJ6 A;  4EQ9 A;  4WKM A;  4NF6 A;  4X8R A;  4OAN A;  1B9J A;  3HHG A;  4OVT A;  1OIB A;  3KEI A;  4F2Q A;  4F18 A;  4BDQ A;  1MY2 A;  3H6U A;  2DE3 A;  3PGF A;  2HCA A;  3IJX B;  4MJO A;  5FTI A;  3VLU A;  1USY H;  4NF0 A;  3TCG A;  5CRY A;  3U8Q A;  4XIG Q;  3QAX A;  1FBE A;  2YJP A;  4FEC A;  4MH5 A;  1DTZ A;  1YCJ A;  2IEE A;  3HN0 A;  4OEU A;  3BBR A;  1INP A;  3UP9 A;  3MVY A;  1UTB B;  1SW1 A;  3G3J A;  4RJZ A;  2KLF A;  4PFB A;  1FRP A;  4U22 A;  3KC0 A;  4GRK A;  4ELR A;  5AA2 B;  2CMO A;  1ZTY A;  3FVO A;  1YXI A;  2NOO A;  4FAJ A;  4PAI A;  1MQD A;  1ELJ A;  4U1Z A;  1MQI A;  3RQT A;  1GV8 A;  3H06 B;  3S9M C;  2HAU A;  1F9B A;  1DPE A;  4RPN A;  1B7Z A;  2R8T A;  1FTK A;  3B8B A;  3CG3 A;  3N5L A;  2P0S A;  2QVV A;  2NXO A;  1N76 A;  3TTN A;  4K3F A;  3ODB A;  1LBW A;  4PBQ A;  4PTK A;  1SDX A;  2Q8M A;  2I4C A;  4MMP A;  4BDO A;  2FBP A;  1AOV A;  4XKN A;  5I58 B;  1A40 A;  4F3G A;  1POY 1;  1Y4C A;  2A5T A;  4NAP A;  2RF1 A;  3IX1 A;  4Z0I A;  2O1M A;  3BIG A;  3IOW A;  2ONK E;  4DDD A;  2WYK A;  3U94 A;  4BLA A;  5IAI A;  2XXK A;  5IGA A;  1IMF A;  1HSL A;  1NH7 A;  3DM0 A;  4M4G A;  5TP9 A;  4PF8 A;  4F3P A;  4MX6 A;  1RDX A;  4GWW A;  2RC7 A;  4MIJ A;  1NUX A;  3C34 A;  1MQG A;  1NH8 A;  2DE2 A;  4I8C A;  2FA7 A;  4IGT A;  1TXF A;  5H8H A;  4YB7 A;  1B3H A;  2CEY A;  1B51 A;  2FYI A;  4LZ8 A;  2FVZ A;  1SYI A;  5IZ3 B;  1LAX A;  2E1S A;  3CIJ A;  2HHM A;  4ELP A;  3VE1 B;  1LLS A;  3TQL A;  3MBP A;  3MUQ A;  3SZP A;  1IMB A;  3MST A;  2GRV A;  5I57 B;  2WEF A;  3A3C A;  3EHS A;  4N8Y A;  4EXK A;  3TQW A;  5H8Q B;  3GBB A;  5CMB A;  5K2X A;  4R75 A;  3KZG A;  3L6G A;  4H46 A;  1FCK A;  3MP8 A;  3PUW E;  1FTO A;  5BUU A;  3ZKL A;  3KC1 A;  5AA4 A;  5K2Y A;  3UIF A;  4RXL A;  4ZEI A;  5F24 A;  2P3V A;  3PMX A;  4N6K A;  1N0T A;  3C36 A;  1B4Z A;  1CNQ A;  1EH3 A;  2CZI A;  3B6T A;  1LGB C;  4IY5 A;  4FED A;  4QFL A;  1BKA A;  1B0H A;  2X26 A;  1VFD A;  2DXR A;  1JP4 A;  4THI A;  1DCU A;  4R2B A;  3IB0 A;  3ILT B;  5L9O A;  4FAT A;  3VDF A;  2UYF A;  3TZA A;  1QKB A;  1JNF A;  3KG2 A;  3SER A;  4LQ5 A;  4R73 A;  3TMG A;  3F11 A;  1VSO A;  3IAZ A;  3AXF A;  2FIX A;  5H8N B;  4DIG A;  2XX9 A;  5EHM A;  1R1N A;  5KZT A;  3TDJ A;  4F29 A;  2H25 A;  5CC2 A;  4DXU A;  2RCB A;  4P1E A;  1A8F A;  2R71 A;  4YIC A;  4G4P A;  1OQH A;  3T0J A;  3TCH A;  4XF5 A;  1US5 A;  3CFX A;  1YZ0 A;  3MW0 A;  4JVD A;  3O6H A;  1MPC A;  1I6B A;  3KJ7 A;  2PFY A;  2XD3 A;  1IMA A;  5I2K B;  4ELQ A;  1TWY A;  2DSF A;  4LVQ A;  5FTH A;  2OCU A;  4GWX A;  1LFI A;  3PD9 A;  2VGQ A;  3M3F A;  1FBC A;  1YTV A;  5I59 B;  4PDD A;  1P1U A;  2UVG A;  4IY6 A;  1O7T A;  3QUJ A;  2AIX A;  4O3C A;  4MEV A;  4PFW A;  4RK2 A;  2RIN A;  3N6T A;  4JSO A;  2XXY A;  5KDT B;  5JEI A;  4G68 A;  4TQU Q;  2B4L A;  1CE2 A;  1N3W A;  1B3E A;  4GQO A;  2NVU B;  4P47 A;  4KI0 E;  4DE8 A;  4NHB A;  4WXJ A;  3HST A;  1HSJ A;  4OA4 A;  1FPG A;  4X04 A;  2ONR A;  5FHO A;  4LUB A;  3K2D A;  3UGW A;  1SW5 A;  1OVB A;  2REJ A;  3RT6 B;  3S2V A;  4PE5 B;  1IUD A;  1URG A;  3OEL A;  4RPO A;  5CMC A;  5ET5 A;  3K0V A;  4Q5T A;  1MDP 1;  3I3V A;  1EYK A;  3OSR A;  4MCO A;  2HXW A;  1QW0 A;  3FV1 A;  4R6H A;  2O84 X;  3G3K A;  2I3V A;  1M5C A;  4GWS A;  4MNC A;  4F1U A;  1R9Q A;  2I4B A;  3K6X A;  4P8B A;  3Q26 A;  5ELV A;  2PMS A;  4GL8 A;  4RY1 A;  1IEJ A;  2Q2A A;  2O51 A;  1MY1 A;  4GX6 A;  5L9M A;  2E0S A;  3DP4 A;  1FTL A;  5DW8 A;  3HCQ A;  4TOZ A;  2XXX A;  4O3B A;  4JB7 A;  3H6V A;  1WOD A;  4FEB A;  3G3I A;  5I5P A;  3HV1 A;  2THI A;  2O1L A;  1B3L A;  4F39 A;  1FQD A;  4FOR A;  1DK4 A;  3OO6 A;  4EUO A;  4JVI A;  4QHQ A;  2ZYN A;  4PAK A;  1FBD A;  2O68 A;  4PGN A;  5TPA A;  3K1M A;  2DOJ A;  3FV2 A;  1FPD A;  1N04 A;  4OVJ A;  4OEN A;  1AIV A;  2FIE A;  4NGU A;  1FTJ A;  2Y7I A;  1H45 A;  3RGY A;  3TFL A;  1JQF A;  3E9X A;  2BJI A;  3T9U A;  1LBX A;  3C4M A;  4X1D A;  5TU0 A;  3O9P A;  3WAF A;  2Z8F A;  2HZL A;  1A99 A;  2KQZ A;  4N13 A;  4YAH X;  2WYP A;  3W9W A;  2QL3 A;  4LAT A;  1LFG A;  3HPI A;  1FW0 A;  3PMW A;  4OEV A;  1Y3Q A;  3RN8 A;  3SEX A;  3THI A;  3FJG A;  3V8X B;  5LOM A;  1PDA A;  3PPP A;  1B1H A;  1Z7M E;  4FBP A;  5AE4 A;  2Q74 A;  4KPT A;  5ITO A;  1N3X A;  1LCF A;  2P3N A;  1QUJ A;  3ROJ A;  4NTL A;  3PPN A;  1Y1Z A;  3JYR A;  3USD A;  3B6W A;  5FBP A;  4GVO A;  3EKI A;  4N15 A;  1FQF A;  1J1N A;  4EQ7 A;  2CZH A;  1MY0 A;  2OWS A;  3T1B A;  4I40 A;  5IM2 A;  3SEU A;  1JEU A;  2UXA A;  1FBH A;  3OOA A;  3UN6 A;  4UA8 A;  3VVD A;  1B5H A;  4PE3 A;  4KYS A;  2I49 A;  2DWJ A;  3ECR A;  2ZNU A;  3MZB A;  4U23 A;  2UYE A;  3KN7 A;  3TEL A;  4MNP A;  5ICQ A;  2I6E A;  4KCC A;  4IO5 A;  3T9V A;  2M8C A;  3PUY E;  4X1B A;  3EHU A;  3D4C A;  2UVH A;  4H67 A;  1PBP A;  1ATG A;  5I2N B;  4P0G A;  5L9S A;  3LSF B;  3KSJ A;  4NF6 B;  2F7A A;  3D1R A;  2BJJ X;  3FIR A;  2ESN A;  3PD8 A;  3RTF B;  4NED A;  1SQY A;  4PGP A;  1Y3P A;  4ONY A;  1IQ7 A;  3B7D A;  4DLD A;  2QSX A;  3G3H A;  4NE4 A;  1QUI A;  4F3B A;  1LEV A;  5H8F A;  3H03 A;  1QGX A;  1BP5 A;  4ZEF A;  3I5O A;  4RYA A;  3LSX A;  1B40 A;  2RCA A;  2XWV A;  1ZLQ A;  2Y5L A;  3RPL A;  5EQ9 A;  1VFE A;  1LB8 A;  2Z8E A;  2DQV A;  4H5F A;  2I3W A;  2LAO A;  4GF8 A;  1B5J A;  4PFU A;  4GWY A;  1D4N A;  4I3Y A;  2HXR A;  4ZZA A;  1I69 A;  2VD2 A;  3FD3 A;  4HXV A;  1K9Y A;  2FHY A;  4DCY A;  4QRZ A;  4N91 A;  2PT1 A;  1D9V A;  2HEU A;  3TEP A;  2F36 A;  4KHZ E;  4BDR A;  5AA2 A;  2VPO A;  3QUF A;  1UIU A;  3TTR A;  4AS4 A;  2F97 A;  4G8M A;  3VV5 A;  1OMP A;  2O7U A;  3QXM A;  1S9T A;  5ET6 A;  3P7I A;  1CB6 A;  4JWX A;  1D3K A;  4WED A;  3EQ1 A;  1EU8 A;  5B7D A;  1FPB A;  3PU5 A;  4NF8 B;  2V84 A;  3TKD A;  1SPI A;  3FZV A;  1NL5 A;  2A5T B;  1PB9 A;  4X48 A;  2V3U A;  4HW8 A;  1NMU A;  4UAC A;  2QS1 A;  4MBP A;  1FPJ A;  2QMX A;  2OLB A;  4DCX A;  2JJK A;  2IA4 A;  4POX A;  3U93 A;  3LV0 A;  4ZE8 A;  4BDM A;  5TP9 B;  3FJ7 A;  3T9H B;  1MRP A;  3O97 A;  3N6U A;  4F31 B;  3LSL A;  2ANJ A;  1IIW A;  1POT A;  5IKB A;  2L5V A;  2I0C A;  4O8M A;  1A55 A;  4NN3 A;  4NF5 A;  4U4S A;  3O29 A;  3DP6 A;  3LUZ A;  3R6U A;  5EHS A;  3MAM A;  3QK6 A;  1NV7 A;  1BTJ A;  5H8H B;  4OES A;  3RUM A;  4KQP A;  2QJE A;  1UTH B;  4N6P A;  3IB1 A;  3G7W A;  3FVK A;  5JK4 A;  2ALU A;  2KR0 A;  1PB8 A;  1RKM A;  4KYD A;  3RLF E;  4Z7E A;  1DOT A;  3M8U A;  2H98 A;  2XWK A;  3MVX A;  3R7X A;  1BIY A;  1A8E A;  3CFZ A;  2XXU A;  1OQG A;  3FXQ A;  4GLI A;  2F3D A;  1NNT A;  1LFH A;  1QUK A;  4YU0 A;  4P11 A;  4XEQ A;  1LAF E;  3MC2 A;  3PPQ A;  2V4C A;  1NKX A;  1NV6 A;  5EQ7 A;  1MXZ A;  3M3K A;  4Q0C A;  2ZMB A;  4RK9 A;  2DDK A;  2REG A;  1B0L A;  1H43 A;  2HQ0 A;  5I57 A;  3DLN A;  3O6I A;  4H8I A;  2OJT A;  5AA4 B;  3E4R A;  4OFL A;  3IOU A;  2Q9T A;  3FXU A;  5CI5 A;  1P1O A;  2CEX A;  4GXA A;  3SET A;  2D21 A;  1MXY A;  2B3F A;  2XA5 A;  3K6W A;  4OVR A;  2WKY A;  1P1N A;  3BKI B;  5DVF A;  1PEB A;  1I6Q A;  1PC3 A;  5F7V A;  3FGS A;  3U1O A;  1MQJ A;  1FBG A;  3I6V A;  3IL1 B;  2XXT A;  3VVF A;  1FSA A;  1RYO A;  1B5I A;  1NV2 A;  1BLF A;  4PBH A;  4PFY A;  1FJ9 A;  3TTM A;  3FVN A;  3OSQ A;  3U65 A;  4DI3 D;  3MP6 A;  3OEN A;  4R72 A;  2XXV A;  4P56 A;  2QPQ A;  2DWH A;  4PQJ A;  2VPN A;  3W9V A;  2XXQ A;  1LST A;  3VXC A;  4HCY A;  3LBS A;  3KOT A;  2B65 A;  2Z23 A;  4ZEB A;  3TTL A;  4U2R A;  2Q88 A;  2VD3 A;  3FBP A;  5DEX A;  3IOT A;  3C9H A;  2I58 A;  2I0B A;  2HFB A;  3FVG A;  4QSD A;  3H6W A;  4XTC Q;  5H8N A;  4ND9 A;  1Q35 A;  2CZL A;  3KGC A;  5EYH A;  3KJT A;  1HSE A;  4PFT A;  3IOR A;  3N26 A;  4X9T A;  1BK4 A;  4TLM B;  4O3A A;  1NFT A;  3HO7 A;  3E13 X;  3IO4 A;  3IFA A;  2PYY A;  1RDY A;  3B50 A;  5JTY A;  4IR8 A;  1JW5 A;  3LC8 A;  2GQ1 A;  2Q89 A;  3K6U A;  1JVY A;  3G3G A;  1EZ9 A;  4HTG A;  2VHA A;  1N84 A;  5FHM A;  4OVQ A;  4PET A;  1B2H A;  3V5A A;  3CHG A;  1FBF A;  4G68 B;  3OO9 A;  4OER A;  4O94 A;  1MQH A;  2XD2 A;  1FBP A;  1FTA A;  3FJM A;  3LSW A;  2PT2 A;  1MXV A;  1OLA A;  2WBD A;  2ZYM A;  1FPI A;  1XT8 A;  2QVR A;  1NV1 A;  5KDT A;  2CZK A;  4N81 A;  3QSL A;  4YB6 A;  2ZXT A;  4IO7 A;  5I3S A;  4QF9 A;  4DI4 B;  2F6P A;  2XWI A;  1NNF A;  5KCJ B;  1IXG A;  1B6H A;  1II5 A;  1NUY A;  2Y7W A;  4OTE A;  5I84 A;  1N7W A;  3BIH A;  2WBB A;  1IIT A;  5I56 A;  5LTC A;  3VVE A;  3PUZ E;  4ELO A;  2OWZ A;  4QFK A;  3LR1 A;  4PDH A;  4LA9 A;  5AA3 A;  2QRY A;  4U1O A;  5F1Q A;  4OYV A;  4ZEK A;  3O6G A;  4JBZ A;  1MG1 A;  2Y84 A;  1B58 A;  1D9Q A;  5B70 A;  1O64 A;  5DT6 A;  2QMW A;  3K1P A;  3RTW B;  4E0X A;  1MH3 A;  4HCW A;  3UK4 A;  3GBA A;  5ICT A;  5L8D A;  2ZYK A;  2DVZ A;  1IXH A;  5J1D A;  4U21 A;  5CBR A;  4LZ7 A;  5CMM A;  5LDZ A;  4O7I A;  5ET7 A;  3M3L A;  1SBP A;  2DP8 A;  2D5W A;  5TPA B;  3ISP A;  2DE4 A;  3C31 A;  2V25 A;  4KXP A;  4MFI A;  1JVX A;  3T22 A;  2F78 A;  1NI9 A;  2B4M A;  4IO2 A;  3KBR A;  3OD7 A;  1AL3 A;  1Y20 A;  1ZU0 A;  1XVX A;  4AQ4 A;  2ZZV A;  1N7X A;  1I6A A;  4JVC A;  1JW1 A;  1FPL A;  5ET8 A;  5AA1 A;  4GWU A;  1ZIU A;  4G77 A;  4EF1 A;  4N8G A;  4QFN A;  4YKJ A;  2HPG A;  4YKK A;  3W15 C;  3V89 B;  1IMC A;  3B6Q A;  4OQO A;  1ZMG A;  5T3J A;  1B05 A;  3ONM A;  1EYI A;  4PC9 A;  3O2A A;  4HE1 A;  1MXW A;  1EZO A;  5I7I A;  2QS3 A;  4FE8 A;  3FUZ A;  2H99 A;  1B1X A;  3KBZ A;  4GX4 A;  3VXB A;  4NF4 A;  4L17 A;  5A5X A;  4XKR A;  2YPN A;  4G8N A;  3TUS A;  2V3T A;  2FNC A;  5IZZ A;  1FQC A;  4H45 A;  4GIZ A;  3S9N C;  4LN5 A;  2Z22 A;  1MXX A;  4ZEC A;  3C35 A;  1YYZ A;  2Y7K A;  4P3L A;  4OVS A;  2ZZX A;  1NUW A;  4NMY A;  1B7U A;  3MPL A;  4OMB A;  4MNI A;  3VFJ A;  3K6V A;  4BDN A;  2GHB A;  2XXW A;  4JSD A;  4F1V A;  3HHF A;  2ZZW A;  4C1T A;  4AB5 A;  4GBV A;  3PUX E;  4ISU A;  5EQ8 A;  4R2F A;  3Q28 A;  1KA1 A;  2NUV A;  1B7H A;  3GYY A;  1URS A;  3A3U A;  3OEK A;  1KZ8 A;  1MXU A;  4F1Y A;  3MZ9 A;  4N4U A;  4PCD A;  2OX3 A;  3KSX A;  4G8H A;  4GOT A;  4QSE A;  4NG7 A;  3RPL B;  3RYD A;  3SEY A;  2PVU A;  3DEL B;  4F22 A;  5EYF A;  3FXR A;  3BFU A;  3K00 A;  4PP0 A;  3TYH A;  4OZ9 A;  3MP1 A;  4HE2 A;  1GTK A;  4O7M A;  4QXD A;  1Y4T A;  3IOV A;  4DZ1 A;  1UTB A;  3EF7 A;  3WAE A;  4Q8R A;  1P1W A;  4XXU A;  3MQ9 A;  2H4I A;  1PBQ A;  5IZ1 A;  1FQE A;  1K9Z A;  3PTY A;  4H8J A;  4MLQ A;  2UVI A;  1KWH A;  2D3I A;  3S4U A;  2WX9 A;  1RDZ A;  3MJN A;  3QIM A;  3IFC A;  4H6D A;  3FAT A;  1O63 A;  1G0H A;  3SES A;  2P2A A;  2QS4 A;  3K02 A;  4JWO A;  2OBG A;  1LBY A;  3PPR A;  2QS2 A;  1MY4 A;  1LBC A;  1M5D A;  1OLC A;  5CM6 A;  2QVU A;  1H44 A;  2V3Q A;  2P1S A;  4LZ5 A;  1S50 A;  4R6K A;  3CG1 A;  1IZ1 A;  3OO7 A;  2OWT A;  4OXV A;  3MWB A;  1S7Y A;  1FPE A;  1NV3 A;  4NF8 A;  5DYH A;  4ESW A;  1NV5 A;  5I58 A;  1JET A;  4KR5 A;  2I48 A;  4EF2 A;  4WEP A;  1SW4 A;  3C32 A;  1YPN A;  3HFU A;  3IJO B;  2PFZ A;  2DXY A;  2ZYO A;  3V83 A;  3EHT A;  4H5G A;  1VE4 A;  4NF5 B;  1AMF A;  4G61 A;  5ESY A;  1XVY A;  4H0W A;  4RNS A;  4NWC A;  4ZZE A;  1FPF A;  1EYJ A;  3CI8 A;  4MAG A;  3PUV E;  4TLL B;  4P9K A;  1YAE A;  5M2V A;  3VLV A;  1NNK A;  4ESX A;  2F7B A;  4YMA A;  1SI1 A;  3DP8 A;  1MY3 A;  4YZZ A;  3O28 A;  3FXB A;  1JW4 A;  1RYX A;  2DWA A;  1UTH A;  1B3G A;  3MZ1 A;  5IZ3 A;  1FPK A;  4GFR A;  4ZED A;  2X7P A;  3NOH A;  3D4G A;  1QUL A;  2F8D A;  1A54 A;  2OK2 A;  2OZZ A;  3PMV A;  4OET A;  2YLN A;  2ONS A;  1IME A;  3H3G A;  3ZKK A;  1MPD A;  1IXI A;  1M5B A;  5H8Q A;  2HZK A;  1DTG A;  3E3K A;  3UA8 A;  4OWD A;  2F7C A;  2Z8D A;  4H1X A;  3RT8 A;  4JDF A;  1XHY A;  4R9F A;  3RPW A;  2ZNS A;  3QYT A;  4ECF A;  2GH9 A;  3E79 A;  2R9J A;  3CVG A;  1Q1K A;  1TFD A;  4I3E A;  4ZDM A;  2DWI A;  2O69 A;  4ZS9 A;  4GXS B;  4HS7 A;  2XXI A;  4Q30 B;  3TOD A;  2XX8 A;  3SEV A;  4MHF A;  4PFR A;  1OVT A;  1Y3N A;  1QKA A;  4GL0 A;  1VR5 A;  4NQ8 A;  4YB5 A;  3CRB A;  5HBC A;  4I9D A;  4R74 A;  3JZJ A;  1LBB A;  1VDW A;  4GD5 A;  3OO8 A;  3TAJ A;  2XXP A;  2DS9 A;  4M1V A;  1FQA A;  3OEM A;  1MDQ A;  3E78 A;  5ITP A;  4AB6 A;  1URD A;  2X7Q A;  4UAB A;  1NV4 A;  1SD3 A;  3OMB A;  4ZE9 A;  4N6D A;  1GGG A;  3PV0 E;  4IO6 A;  4I1D A;  1USY E;  4EXL A;  4N17 A;  1GR2 A;  4F2O A;  4F19 A;  1IXC A;  3TTK A;  5DEX B;  4IGR A;  2F6G A;  4OFJ A;  3KN8 A;  3SKP A;  3T9X B;  2QFL A;  4QFO A;  1R6Z A;  1A7L A;  4KFQ A;  1QVS A;  4RA1 A;  2G29 A;  4P0I A;  5CMK A;  1NNP A;  5JTY B;  2PCR A;  1B3F A;  1WVJ A;  1MM7 A;  2HAV A;  4I62 A;  3L6H A;  2Y5K A;  1LAG E;  3ILU B;  1M5F A;  1B52 A;  2AL4 A;  1ZJL A;  2V93 A;  4C1U A;  1LAH E;  5A5L A;  1M5E A;  3T93 B;  2NWJ A;  3TCF A;  5DTB A;  4KCD A;  4LON B;  5I2K A;  4OVP A;  3TPA A;  5FHN A;  2RKM A;  2AYS A;  2F5X A;  4GX3 A;  5EYG A;  2DVC A;  1D9Y A;  4FJP A;  5BWJ A;  5I59 A;  1DMB A;  2RC8 A;  4LQ2 A;  4KYE A;  2PX1 A;  1FQB A;  1SVX B;  1B46 A;  4PFI A;  2GHA A;  3GZG A;  1FTM A;  2ZNT A;  2Y7P A;  1LBV A;  1XOC A;  3S9L C;  1Z7N E;  2Q8J A;  1XS5 A;  4EQB A;  1G0I A;  3R26 A;  1TFA A;  3K1N A;  3PPO A;  1UIV A;  3IK6 B;  3MPK A;  1NV0 A;  5HM4 B;  2W7Y A;  2F3B A;  1IMD A;  4JXI A;  1MPB A;  5I56 B;  2XHD A;  4PF6 A;  2XX7 A;  4QBA A;  2O6A A;  1QJM A;  1R9L A;  3CSB A;  2DYX A;  1P99 A;  5KCJ A;  4U4X A;  1US4 A;  3A29 A;  2H5Y A;  2VP1 A;  1EZP A;  1LB9 A;  1DSN A;  1DBZ A;  2PBW A;  3CR9 A;  5HPQ A;  4QSC A;  1AWB A;  4OFO A;  1GVC A;  2R6G E;  3U92 A;  4BDL A;  4XKP A;  3N94 A;  1MM6 A;  1B32 A;  3JV9 A;  3S9E A; 
#chains in the Genus database with same CATH homology
 4GWO A;  3SDF A;  3EPE A;  3IB2 A;  1XC1 A;  1DPP A;  3O66 A;  2RC9 A;  3BFT A;  2UVJ A;  5CBS A;  2F35 A;  4MLV A;  4XKQ A;  1T0K A;  3RNN A;  4C0R A;  1MS7 A;  1SI0 A;  1WDN A;  3GLB A;  2AL5 A;  2XXH A;  1PB7 A;  3ZSF A;  4IB2 A;  4EDP A;  2G93 A;  1Y1M A;  1B4H A;  1H76 A;  2Q2C A;  5DVI A;  3H6T A;  4YKI A;  3G3F A;  3OXN A;  2F34 A;  3A09 A;  3IR1 A;  3KFM A;  3IO6 A;  3CFL A;  3SEW A;  4G68 C;  3ZS6 A;  5AA2 D;  1AH5 A;  4N07 A;  3KOS A;  2VOZ A;  4F3S A;  2O7I A;  3KN3 A;  3EN3 A;  3T66 A;  4E0W A;  2B3B A;  5DVJ A;  1SYH A;  4OHN A;  1Y9U A;  3VLW A;  3LUY A;  2Y7R A;  4NF4 B;  5A5X B;  2GFE A;  3MVZ A;  3K4U A;  4R6Y A;  1ZBM A;  4QFP A;  5ISU A;  4YMB A;  4MF3 A;  4JWY A;  3GXA A;  1H3D A;  4KD5 A;  3H7M A;  3FAS A;  3U72 A;  4IO4 A;  4DXC A;  5H8S A;  3CSG A;  4G2Z A;  1UQW A;  3Q25 A;  3UOR A;  4YKP A;  1TT1 A;  3H4Z A;  4IO3 A;  4H65 A;  2XXR A;  2ABH A;  3MVW A;  3K01 A;  1ZKB A;  1L5T A;  2H9B A;  1SW2 A;  4FIM A;  3C33 A;  3Q27 A;  4NWD A;  1MH4 A;  3RY3 A;  1JEV A;  4R9G A;  1ANF A;  1P1Q A;  3Q29 A;  2A5S A;  4LP2 B;  4POW A;  1LCT A;  4DXB A;  3T96 B;  5I2N A;  5H8F B;  4EQ9 A;  4WKM A;  4NF6 A;  1B9J A;  3HHG A;  1OIB A;  3KEI A;  4F2Q A;  4F18 A;  4BDQ A;  1MY2 A;  3H6U A;  2DE3 A;  3PGF A;  2HCA A;  3IJX B;  5FTI A;  3VLU A;  1USY H;  3TCG A;  5CRY A;  3U8Q A;  4XIG Q;  3QAX A;  2YJP A;  4FEC A;  4MH5 A;  1DTZ A;  1YCJ A;  2IEE A;  3HN0 A;  4OEU A;  3BBR A;  3UP9 A;  3MVY A;  1UTB B;  1SW1 A;  3G3J A;  4RJZ A;  2KLF A;  4U22 A;  4GRK A;  4ELR A;  5AA2 B;  2CMO A;  1ZTY A;  3FVO A;  2NOO A;  4FAJ A;  1MQD A;  1ELJ A;  4U1Z A;  1MQI A;  3RQT A;  1GV8 A;  3H06 B;  3S9M C;  2HAU A;  1F9B A;  1DPE A;  4RPN A;  1B7Z A;  1FTK A;  3CG3 A;  3N5L A;  2P0S A;  2NXO A;  1N76 A;  3TTN A;  4K3F A;  3ODB A;  1SDX A;  2I4C A;  4BDO A;  1AOV A;  4XKN A;  5I58 B;  1A40 A;  4F3G A;  1POY 1;  1Y4C A;  2A5T A;  2RF1 A;  3IX1 A;  4Z0I A;  2O1M A;  3IOW A;  2ONK E;  4DDD A;  3U94 A;  4BLA A;  5IAI A;  1HSL A;  1NH7 A;  3DM0 A;  5TP9 A;  4M4G A;  4F3P A;  2RC7 A;  3C34 A;  1MQG A;  1NH8 A;  2DE2 A;  4I8C A;  2FA7 A;  4IGT A;  1TXF A;  5H8H A;  4YB7 A;  1B3H A;  1B51 A;  2FYI A;  4LZ8 A;  1SYI A;  1LAX A;  2E1S A;  3CIJ A;  4ELP A;  3VE1 B;  1LLS A;  3TQL A;  3MBP A;  3MUQ A;  2GRV A;  5I57 B;  3A3C A;  3EHS A;  4EXK A;  3TQW A;  5H8Q B;  3GBB A;  5CMB A;  5K2X A;  4R75 A;  3KZG A;  3L6G A;  1FCK A;  3MP8 A;  3PUW E;  1FTO A;  5BUU A;  3ZKL A;  5AA4 A;  5K2Y A;  3UIF A;  4RXL A;  4ZEI A;  3PMX A;  1N0T A;  3C36 A;  1B4Z A;  1EH3 A;  3B6T A;  1LGB C;  4IY5 A;  4FED A;  4QFL A;  1BKA A;  1B0H A;  2X26 A;  1VFD A;  2DXR A;  4THI A;  4R2B A;  3IB0 A;  3ILT B;  5L9O A;  4FAT A;  3VDF A;  2UYF A;  3TZA A;  1QKB A;  1JNF A;  3KG2 A;  3SER A;  4LQ5 A;  4R73 A;  3TMG A;  3F11 A;  1VSO A;  3IAZ A;  3AXF A;  5H8N B;  4DIG A;  2XX9 A;  5EHM A;  1R1N A;  5KZT A;  3TDJ A;  4F29 A;  2H25 A;  5CC2 A;  4DXU A;  2RCB A;  1A8F A;  2R71 A;  4YIC A;  4G4P A;  1OQH A;  3TCH A;  1US5 A;  3CFX A;  3MW0 A;  3O6H A;  1MPC A;  1I6B A;  3KJ7 A;  2XD3 A;  5I2K B;  4ELQ A;  1TWY A;  2DSF A;  4LVQ A;  5FTH A;  2OCU A;  1LFI A;  3PD9 A;  2VGQ A;  3M3F A;  1YTV A;  5I59 B;  1P1U A;  2UVG A;  4IY6 A;  1O7T A;  3QUJ A;  2AIX A;  4O3C A;  4PFW A;  4RK2 A;  2RIN A;  3N6T A;  4JSO A;  2XXY A;  5KDT B;  5JEI A;  4G68 A;  4TQU Q;  1CE2 A;  1N3W A;  1B3E A;  4GQO A;  2NVU B;  4KI0 E;  4DE8 A;  4WXJ A;  3HST A;  1HSJ A;  2ONR A;  5FHO A;  4LUB A;  3K2D A;  3UGW A;  1SW5 A;  1OVB A;  2REJ A;  3RT6 B;  3S2V A;  4PE5 B;  1IUD A;  1URG A;  3OEL A;  4RPO A;  5CMC A;  3K0V A;  4Q5T A;  1MDP 1;  3I3V A;  3OSR A;  2HXW A;  1QW0 A;  3FV1 A;  4R6H A;  2O84 X;  3G3K A;  2I3V A;  1M5C A;  4F1U A;  1R9Q A;  2I4B A;  3K6X A;  3Q26 A;  5ELV A;  2PMS A;  4GL8 A;  4RY1 A;  1IEJ A;  2Q2A A;  2O51 A;  1MY1 A;  5L9M A;  2E0S A;  3DP4 A;  1FTL A;  3HCQ A;  4TOZ A;  2XXX A;  4O3B A;  4JB7 A;  3H6V A;  1WOD A;  4FEB A;  3G3I A;  3HV1 A;  2THI A;  2O1L A;  1B3L A;  4F39 A;  1FQD A;  4FOR A;  3OO6 A;  4EUO A;  4QHQ A;  2ZYN A;  2O68 A;  5TPA A;  3K1M A;  2DOJ A;  3FV2 A;  1N04 A;  4OVJ A;  4OEN A;  1AIV A;  1FTJ A;  2Y7I A;  1H45 A;  3RGY A;  3TFL A;  1JQF A;  3E9X A;  3T9U A;  3C4M A;  4X1D A;  5TU0 A;  3O9P A;  3WAF A;  2Z8F A;  2HZL A;  1A99 A;  4N13 A;  4YAH X;  3W9W A;  2QL3 A;  4LAT A;  1LFG A;  3HPI A;  1FW0 A;  3PMW A;  4OEV A;  1Y3Q A;  3RN8 A;  3SEX A;  3THI A;  3FJG A;  3V8X B;  5LOM A;  1PDA A;  3PPP A;  1B1H A;  1Z7M E;  5AE4 A;  4KPT A;  5ITO A;  1N3X A;  1LCF A;  1QUJ A;  4NTL A;  3PPN A;  1Y1Z A;  3JYR A;  3USD A;  3B6W A;  4GVO A;  1FQF A;  1J1N A;  4EQ7 A;  1MY0 A;  2OWS A;  3SEU A;  1JEU A;  2UXA A;  3OOA A;  3UN6 A;  4UA8 A;  3VVD A;  1B5H A;  4KYS A;  2I49 A;  2DWJ A;  3ECR A;  2ZNU A;  3MZB A;  4U23 A;  2UYE A;  3KN7 A;  3TEL A;  5ICQ A;  2I6E A;  4KCC A;  4IO5 A;  3T9V A;  2M8C A;  3PUY E;  4X1B A;  3EHU A;  3D4C A;  2UVH A;  4H67 A;  1PBP A;  1ATG A;  5I2N B;  4P0G A;  5L9S A;  3LSF B;  3KSJ A;  4NF6 B;  2F7A A;  2BJJ X;  3FIR A;  2ESN A;  3PD8 A;  3RTF B;  4NED A;  1SQY A;  1Y3P A;  4ONY A;  1IQ7 A;  3B7D A;  4DLD A;  2QSX A;  3G3H A;  4NE4 A;  1QUI A;  4F3B A;  5H8F A;  3H03 A;  1BP5 A;  4ZEF A;  3I5O A;  4RYA A;  3LSX A;  1B40 A;  2RCA A;  1ZLQ A;  1VFE A;  1LB8 A;  2Z8E A;  2DQV A;  4H5F A;  2I3W A;  2LAO A;  4GF8 A;  1B5J A;  4PFU A;  1D4N A;  4ZZA A;  1I69 A;  2VD2 A;  3FD3 A;  4DCY A;  4QRZ A;  2PT1 A;  1D9V A;  2HEU A;  3TEP A;  2F36 A;  4KHZ E;  4BDR A;  5AA2 A;  3QUF A;  1UIU A;  3TTR A;  2F97 A;  4G8M A;  3VV5 A;  1OMP A;  2O7U A;  3QXM A;  1S9T A;  3P7I A;  1CB6 A;  4JWX A;  1D3K A;  4WED A;  3EQ1 A;  1EU8 A;  5B7D A;  3PU5 A;  4NF8 B;  2V84 A;  3TKD A;  3FZV A;  1NL5 A;  2A5T B;  1PB9 A;  4X48 A;  2V3U A;  4HW8 A;  1NMU A;  4UAC A;  2QS1 A;  4MBP A;  2QMX A;  2OLB A;  4DCX A;  2IA4 A;  4POX A;  3U93 A;  4ZE8 A;  4BDM A;  5TP9 B;  3FJ7 A;  3T9H B;  1MRP A;  3O97 A;  3N6U A;  4F31 B;  3LSL A;  2ANJ A;  1IIW A;  1POT A;  5IKB A;  2I0C A;  1A55 A;  4U4S A;  4NF5 A;  3O29 A;  3DP6 A;  3R6U A;  5EHS A;  3MAM A;  3QK6 A;  1BTJ A;  5H8H B;  4OES A;  3RUM A;  4KQP A;  2QJE A;  1UTH B;  4N6P A;  3IB1 A;  3G7W A;  3FVK A;  5JK4 A;  2ALU A;  1PB8 A;  1RKM A;  4KYD A;  3RLF E;  4Z7E A;  1DOT A;  3M8U A;  2H98 A;  3MVX A;  3R7X A;  1BIY A;  1A8E A;  3CFZ A;  2XXU A;  1OQG A;  3FXQ A;  4GLI A;  1NNT A;  1LFH A;  1QUK A;  4YU0 A;  4P11 A;  1LAF E;  3MC2 A;  3PPQ A;  1NKX A;  1MXZ A;  3M3K A;  4Q0C A;  2ZMB A;  4RK9 A;  2REG A;  1B0L A;  1H43 A;  2HQ0 A;  5I57 A;  3DLN A;  3O6I A;  4H8I A;  2OJT A;  5AA4 B;  3E4R A;  4OFL A;  3IOU A;  2Q9T A;  3FXU A;  5CI5 A;  1P1O A;  4GXA A;  3SET A;  2D21 A;  1MXY A;  2B3F A;  3K6W A;  2WKY A;  1P1N A;  3BKI B;  5DVF A;  1PEB A;  1I6Q A;  1PC3 A;  5F7V A;  3FGS A;  3U1O A;  1MQJ A;  3I6V A;  3IL1 B;  2XXT A;  3VVF A;  1RYO A;  1B5I A;  1BLF A;  4PFY A;  3TTM A;  3FVN A;  3OSQ A;  3MP6 A;  3OEN A;  4R72 A;  2XXV A;  2QPQ A;  2DWH A;  4PQJ A;  3W9V A;  2XXQ A;  1LST A;  3VXC A;  4HCY A;  3LBS A;  3KOT A;  2B65 A;  2Z23 A;  4ZEB A;  3TTL A;  4U2R A;  2Q88 A;  2VD3 A;  5DEX A;  3IOT A;  3C9H A;  2I58 A;  2I0B A;  2HFB A;  3FVG A;  4QSD A;  3H6W A;  4XTC Q;  5H8N A;  4ND9 A;  1Q35 A;  2CZL A;  3KGC A;  3KJT A;  1HSE A;  4PFT A;  3IOR A;  3N26 A;  4X9T A;  4TLM B;  4O3A A;  1NFT A;  3HO7 A;  3E13 X;  3IO4 A;  2PYY A;  5JTY A;  1JW5 A;  3LC8 A;  2Q89 A;  3K6U A;  1JVY A;  3G3G A;  1EZ9 A;  4HTG A;  2VHA A;  1N84 A;  5FHM A;  4PET A;  1B2H A;  3V5A A;  4G68 B;  3OO9 A;  4OER A;  1MQH A;  2XD2 A;  3FJM A;  3LSW A;  2PT2 A;  1MXV A;  1OLA A;  2ZYM A;  1XT8 A;  5KDT A;  3QSL A;  4YB6 A;  2ZXT A;  4IO7 A;  4QF9 A;  2F6P A;  1NNF A;  5KCJ B;  1IXG A;  1B6H A;  1II5 A;  2Y7W A;  4OTE A;  5I84 A;  1N7W A;  1IIT A;  5I56 A;  3VVE A;  3PUZ E;  4ELO A;  4QFK A;  3LR1 A;  4LA9 A;  5AA3 A;  2QRY A;  4U1O A;  5F1Q A;  4OYV A;  4ZEK A;  3O6G A;  4JBZ A;  1MG1 A;  2Y84 A;  1B58 A;  5B70 A;  1O64 A;  5DT6 A;  2QMW A;  3K1P A;  3RTW B;  4E0X A;  1MH3 A;  4HCW A;  3UK4 A;  3GBA A;  5ICT A;  5L8D A;  2ZYK A;  2DVZ A;  1IXH A;  5J1D A;  4U21 A;  5CBR A;  4LZ7 A;  5CMM A;  3M3L A;  1SBP A;  2DP8 A;  2D5W A;  5TPA B;  2DE4 A;  3C31 A;  2V25 A;  4MFI A;  1JVX A;  3T22 A;  2F78 A;  4IO2 A;  3KBR A;  3OD7 A;  1AL3 A;  1Y20 A;  1ZU0 A;  1XVX A;  4AQ4 A;  1N7X A;  1I6A A;  1JW1 A;  5AA1 A;  1ZIU A;  4G77 A;  4EF1 A;  4QFN A;  4YKJ A;  4YKK A;  3W15 C;  3V89 B;  3B6Q A;  4OQO A;  1ZMG A;  1B05 A;  3ONM A;  3O2A A;  1EZO A;  1MXW A;  2QS3 A;  4FE8 A;  3FUZ A;  2H99 A;  1B1X A;  3VXB A;  4NF4 A;  4L17 A;  5A5X A;  4XKR A;  2YPN A;  4G8N A;  3TUS A;  2V3T A;  2FNC A;  1FQC A;  4GIZ A;  3S9N C;  2Z22 A;  1MXX A;  4ZEC A;  3C35 A;  2Y7K A;  4NMY A;  1B7U A;  3MPL A;  4OMB A;  3VFJ A;  3K6V A;  4BDN A;  2GHB A;  2XXW A;  4JSD A;  4F1V A;  3HHF A;  4C1T A;  4AB5 A;  3PUX E;  4ISU A;  4R2F A;  3Q28 A;  2NUV A;  1B7H A;  1URS A;  3A3U A;  3OEK A;  1MXU A;  4F1Y A;  3MZ9 A;  3KSX A;  4G8H A;  4GOT A;  4QSE A;  3SEY A;  2PVU A;  3DEL B;  4F22 A;  5EYF A;  3FXR A;  3BFU A;  3K00 A;  4PP0 A;  3TYH A;  4OZ9 A;  3MP1 A;  1GTK A;  1Y4T A;  3IOV A;  4DZ1 A;  1UTB A;  3EF7 A;  3WAE A;  4Q8R A;  1P1W A;  4XXU A;  3MQ9 A;  2H4I A;  1PBQ A;  1FQE A;  4H8J A;  4MLQ A;  2UVI A;  1KWH A;  2D3I A;  3S4U A;  3MJN A;  3QIM A;  4H6D A;  3FAT A;  1O63 A;  3SES A;  2P2A A;  2QS4 A;  3K02 A;  4JWO A;  2OBG A;  3PPR A;  2QS2 A;  1MY4 A;  1LBC A;  1M5D A;  1OLC A;  5CM6 A;  1H44 A;  2V3Q A;  2P1S A;  4LZ5 A;  1S50 A;  4R6K A;  3CG1 A;  1IZ1 A;  3OO7 A;  2OWT A;  4OXV A;  3MWB A;  1S7Y A;  5DYH A;  4NF8 A;  4ESW A;  5I58 A;  1JET A;  4KR5 A;  2I48 A;  4EF2 A;  4WEP A;  1SW4 A;  3C32 A;  1YPN A;  3IJO B;  2DXY A;  2ZYO A;  3V83 A;  3EHT A;  4H5G A;  1VE4 A;  4NF5 B;  1AMF A;  1XVY A;  4H0W A;  4RNS A;  4NWC A;  4ZZE A;  3CI8 A;  3PUV E;  4TLL B;  1YAE A;  5M2V A;  3VLV A;  1NNK A;  4ESX A;  2F7B A;  4YMA A;  1SI1 A;  3DP8 A;  1MY3 A;  4YZZ A;  3O28 A;  1JW4 A;  1RYX A;  2DWA A;  1UTH A;  1B3G A;  3MZ1 A;  4GFR A;  4ZED A;  2X7P A;  3D4G A;  1QUL A;  2F8D A;  1A54 A;  2OK2 A;  2OZZ A;  3PMV A;  4OET A;  2YLN A;  2ONS A;  3H3G A;  3ZKK A;  1MPD A;  1IXI A;  1M5B A;  5H8Q A;  2HZK A;  1DTG A;  3E3K A;  3UA8 A;  4OWD A;  2F7C A;  2Z8D A;  4H1X A;  3RT8 A;  4JDF A;  1XHY A;  4R9F A;  3RPW A;  2ZNS A;  3QYT A;  4ECF A;  2GH9 A;  2R9J A;  3CVG A;  1Q1K A;  1TFD A;  4ZDM A;  2DWI A;  2O69 A;  4ZS9 A;  4GXS B;  4HS7 A;  2XXI A;  4Q30 B;  3TOD A;  2XX8 A;  3SEV A;  1OVT A;  1Y3N A;  1QKA A;  4GL0 A;  1VR5 A;  4YB5 A;  3CRB A;  5HBC A;  4I9D A;  4R74 A;  3JZJ A;  1LBB A;  4GD5 A;  3OO8 A;  3TAJ A;  2XXP A;  2DS9 A;  4M1V A;  1FQA A;  3OEM A;  1MDQ A;  5ITP A;  4AB6 A;  1URD A;  2X7Q A;  1SD3 A;  3OMB A;  4ZE9 A;  1GGG A;  3PV0 E;  4IO6 A;  4I1D A;  1USY E;  4EXL A;  1GR2 A;  4F2O A;  4F19 A;  1IXC A;  3TTK A;  5DEX B;  4IGR A;  2F6G A;  4OFJ A;  3KN8 A;  3SKP A;  3T9X B;  4QFO A;  1R6Z A;  1A7L A;  4KFQ A;  1QVS A;  4RA1 A;  2G29 A;  4P0I A;  5CMK A;  1NNP A;  5JTY B;  1B3F A;  1WVJ A;  1MM7 A;  2HAV A;  4I62 A;  3L6H A;  1LAG E;  3ILU B;  1M5F A;  1B52 A;  2AL4 A;  1ZJL A;  2V93 A;  4C1U A;  1LAH E;  1M5E A;  3T93 B;  2NWJ A;  3TCF A;  5DTB A;  4KCD A;  4LON B;  5I2K A;  3TPA A;  5FHN A;  2RKM A;  2AYS A;  2F5X A;  2DVC A;  1D9Y A;  4FJP A;  5BWJ A;  5I59 A;  1DMB A;  2RC8 A;  4LQ2 A;  4KYE A;  2PX1 A;  1FQB A;  1SVX B;  1B46 A;  3GZG A;  2GHA A;  1FTM A;  2ZNT A;  2Y7P A;  1XOC A;  3S9L C;  1Z7N E;  2Q8J A;  1XS5 A;  4EQB A;  3R26 A;  1TFA A;  3K1N A;  3PPO A;  1UIV A;  3IK6 B;  3MPK A;  5HM4 B;  2W7Y A;  4JXI A;  1MPB A;  5I56 B;  2XHD A;  2XX7 A;  2O6A A;  1QJM A;  1R9L A;  3CSB A;  2DYX A;  1P99 A;  5KCJ A;  4U4X A;  1US4 A;  2H5Y A;  2VP1 A;  1EZP A;  1LB9 A;  1DSN A;  2PBW A;  3CR9 A;  5HPQ A;  4QSC A;  4OFO A;  1GVC A;  2R6G E;  3U92 A;  4BDL A;  4XKP A;  3N94 A;  1MM6 A;  1B32 A;  3JV9 A;  3S9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...