1HSLA

Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
238
structure length
238
Chain Sequence
AIPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPAVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTIDINE-BINDING PROTEIN
publication title Refined 1.89-A structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport/chemosensory proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Binding protein
total genus 68
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hslA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hslA02
4Q0CA 5ISUA 5I2KB 2IA4A 4YKIA 3HV1A 3SEUA 1HSJA 3IOWA 5CI5A 3IR1A 1LAGE 3TODA 4XKQA 3C4MA 4YKPA 3RNNA 3GBBA 4P11A 2Q89A 4OERA 1B1HA 2RINA 1B32A 1EU8A 4QFKA 3H7MA 3O66A 1MXZA 3T9VA 3M8UA 3MPLA 2O1LA 1B51A 2F34A 3QUJA 4I9DA 1LCTA 4G4PA 1JW1A 3FVKA 3RUMA 3CVGA 4PE5B 1ANFA 3QYTA 4G2ZA 4U23A 1SW5A 4OMBA 1DPPA 1EZPA 2NOOA 2OBGA 3KEIA 3P7IA 5I56A 5DEXA 2PYYA 3VVEA 1IXIA 3H6WA 4OYVA 2ONKE 1QKAA 3BBRA 4KYEA 4OEVA 2W7YA 4I1DA 4THIA 3S4UA 4QHQA 3F11A 4X1BA 5I58B 3MVYA 2D5WA 3LUYA 1R6ZA 3U93A 3FV2A 1LSTA 3IB1A 4PQJA 2QS3A 3USDA 1URDA 4IY5A 2WKYA 4H65A 2BJJX 2NVUB 3MZ9A 5JTYB 3MWBA 2DXYA 1TFDA 5A5XB 3DP8A 5B7DA 3HHGA 2HAVA 2CMOA 1I6AA 4FEDA 1DPEA 4OZ9A 2Y84A 3MW0A 3K6UA 1SVXB 2PVUA 1AH5A 2H5YA 2Q2AA 4F19A 2HZKA 5ELVA 3ZSFA 1IXCA 1N3XA 3MC2A 5I2NB 1P1NA 4KCCA 1IIWA 1OLAA 3ZKLA 3O28A 1FTLA 1I69A 1M5CA 3ZKKA 2ESNA 3RTFB 4G8HA 3B6TA 3TTMA 4PFUA 4YICA 3LSLA 4ISUA 4H1XA 2XXPA 2GHBA 4M4GA 5JEIA 1SD3A 4R6HA 4EF2A 2Y7PA 3OMBA 1JEUA 3PD8A 4RY1A 4XKPA 1SYHA 2X26A 4ECFA 2DS9A 2P0SA 1MM7A 1XHYA 4H67A 1NH8A 4MH5A 3O6IA 5ITOA 5TP9A 1H3DA 4GXAA 1T0KA 2F5XA 4F29A 2QS2A 3O6HA 3V89B 1WVJA 3ODBA 2I4BA 4FE8A 1YTVA 1II5A 3KFMA 1YPNA 5TPAA 4ZEKA 4Q30B 2HFBA 4ZE9A 4TQUQ 3H6TA 1QKBA 3G7WA 4EF1A 1P1UA 4POWA 4U21A 1N76A 1UTBB 3L6GA 3K6WA 2RC8A 3R7XA 2XXWA 5HM4B 3V5AA 1A54A 3OXNA 4GD5A 4IO4A 1D3KA 3TTKA 3MPKA 3E9XA 1S50A 4F22A 4RA1A 4NF6A 4KI0E 2O6AA 2OWTA 1IZ1A 4EDPA 4OVJA 3H4ZA 2UVGA 3N26A 1O64A 4F2OA 2DWHA 4YAHX 4NTLA 3U72A 1L5TA 2PMSA 4ZEIA 4EQBA 1IUDA 3QSLA 1B3LA 4OEUA 1Q35A 4UA8A 2V93A 2QMXA 4ELQA 1GGGA 1MXYA 1M5BA 4LZ5A 4JWXA 4QSEA 1URGA 3MJNA 4QFNA 2ZYMA 4JWYA 3ILUB 5I57B 2ABHA 5KDTB 2DE2A 2I48A 2V25A 1OQGA 2GH9A 1MY4A 1TT1A 3EN3A 3U94A 1XVYA 1MY3A 3IOVA 3PV0E 3S2VA 3TQLA 3BKIB 2XX9A 2PT2A 1ZMGA 2AL4A 2DWJA 3FD3A 3L6HA 4FEBA 5J1DA 1NH7A 5CMMA 5K2YA 1LFIA 2F36A 4ZZEA 4F3PA 3IOUA 3IJOB 2QPQA 1POTA 3W9WA 4YKJA 4KCDA 4ESWA 2OZZA 3KSXA 4IGRA 3RTWB 3S9MC 1SI1A 3TDJA 2XXXA 4FECA 5EHSA 5AA2B 3D4GA 1Q1KA 1B4HA 1EH3A 3HCQA 3O2AA 3AXFA 4KPTA 5HBCA 4X9TA 3S9NC 3JV9A 1Y20A 1B7HA 3LBSA 1Y3NA 3T96B 1B0HA 2QL3A 1NKXA 2KLFA 1IITA 1MPCA 3IOTA 2REGA 4HS7A 1IEJA 4G68B 1QUIA 4FJPA 4XTCQ 1VSOA 4P0GA 2YLNA 3TTNA 4NF5A 2I0BA 3T66A 4DXBA 2Y7RA 4GXSB 4DCYA 4TOZA 2XXTA 1B3EA 1OVTA 3EQ1A 4NE4A 2NWJA 3RN8A 4IO6A 3FGSA 5DVFA 4RPOA 2PX1A 4E0XA 3RPWA 3LC8A 4O3CA 3G3IA 3KJ7A 3SERA 1SYIA 2F7CA 3GXAA 1M5FA 1O63A 4Q5TA 3MVXA 1CB6A 4R75A 4ND9A 2DSFA 2I6EA 1HSEA 3PPPA 1BKAA 2UYEA 4M1VA 5CBRA 1JQFA 2DE3A 4N6PA 2ZNTA 1DOTA 2O51A 4OTEA 1B4ZA 2HQ0A 4AQ4A 3PPRA 2DE4A 4ZE8A 2HXWA 3CFXA 3K00A 3KZGA 3MUQA 3UP9A 1NNFA 1P1OA 4YKKA 4ZEBA 4IO7A 2I58A 4EUOA 1Y1ZA 1B2HA 2DWIA 2ZNUA 3LSXA 3PMWA 1RYOA 5TU0A 1LFGA 2I3WA 2XXVA 3IAZA 1LFHA 3TEPA 2O68A 1OVBA 1R1NA 3N6UA 3O97A 5B70A 2NUVA 1VE4A 5FHNA 3ECRA 3K01A 1H76A 5DT6A 2ALUA 3CG3A 4KD5A 5H8SA 3H6UA 4AB6A 1MH4A 1PBPA 3K6VA 4HCWA 5K2XA 3TUSA 3FXRA 4RJZA 4C1TA 4BDLA 3R6UA 1Y3PA 3IX1A 3D4CA 2GFEA 1QW0A 5I56B 1Y3QA 3O29A 5DEXB 4JSOA 1IXHA 4MF3A 4NMYA 3DELB 1MXWA 4FORA 5CMKA 4YB6A 4GVOA 2V3UA 3K6XA 3UGWA 4DCXA 2P2AA 2O7IA 4N07A 4YZZA 5KCJA 4GWOA 5H8FB 3OOAA 2H99A 2H4IA 3RLFE 4X1DA 1QUKA 2AYSA 2DWAA 4LP2B 3EPEA 5A5XA 3KN3A 4MBPA 1DSNA 2A5TB 4H5GA 1Y1MA 4KYSA 1SBPA 3UIFA 1Y9UA 4XXUA 1SW1A 4NF4A 1USYH 5KZTA 2RF1A 4PP0A 1ATGA 1LBCA 1LAXA 4OFLA 4OXVA 1FCKA 3CFLA 3G3GA 5I84A 4RXLA 3OEKA 5H8QB 1KWHA 2ONSA 4U4XA 1JETA 3SEVA 4AB5A 5I2NA 1EZOA 5F7VA 3K02A 3TQWA 1ZJLA 2Y7WA 1UTHA 4U4SA 3CSGA 4ESXA 4OWDA 3IJXB 2OWSA 1JVYA 3KG2A 3T9HB 1WDNA 3MP6A 3PUYE 4R6YA 3TYHA 3V8XB 4JWOA 4TLMB 5CM6A 3QAXA 3IB0A 1N7WA 4PFTA 1B5IA 1LB9A 3RQTA 1MQJA 2Z8DA 2ANJA 2UYFA 2Q88A 1FTOA 3SEYA 4MLVA 2G93A 1LGBC 2YJPA 2UVIA 4QSCA 4ZEDA 2H98A 4OHNA 3M3FA 1N04A 4G8NA 1FQFA 3MVZA 1I6QA 4BDRA 4GQOA 4LVQA 1MPDA 3TMGA 2R71A 2Q8JA 3VXBA 2R9JA 4NF8B 4F1VA 3FUZA 1RKMA 5TP9B 4LZ8A 3VFJA 2XD2A 4G77A 2I49A 2Q2CA 4X48A 4ZECA 2X7PA 3FV1A 1R9LA 1UTBA 2UVHA 4Q8RA 1OQHA 5TPAB 4U2RA 1UIVA 3UORA 5AA4B 5DTBA 5DYHA 3PPNA 4JB7A 4PFWA 2OLBA 3FXUA 3K1PA 1US4A 1FQDA 4L17A 4WEDA 4XIGQ 4LZ7A 3C35A 1B0LA 4MLQA 1QUJA 3VV5A 3EHSA 3A3CA 3OO6A 3FVNA 5M2VA 4U1ZA 4KQPA 1POY1 3DM0A 1M5DA 2XXQA 3SESA 2HAUA 1D9VA 1PDAA 2DOJA 3K4UA 3G3KA 4PETA 4E0WA 4R9GA 5HPQA 1MY1A 3I6VA 3FJ7A 4GFRA 3CR9A 1BIYA 2THIA 4UACA 3E4RA 4WXJA 4IO2A 4OESA 3RY3A 1OIBA 3BFUA 5L9OA 3LSWA 4U1OA 1N0TA 1GTKA 3PUWE 3SEXA 4QFLA 3EF7A 1SDXA 3T22A 3H03A 2FA7A 3M3KA 1MY2A 3VVDA 2O7UA 3KOTA 3HO7A 4FAJA 2F7AA 4I8CA 4LONB 4LUBA 2H25A 1OLCA 4ELPA 3TFLA 3W9VA 1B5HA 2O84X 1B3GA 4KYDA 1FQAA 2XX8A 4GLIA 5L9SA 3KN8A 5BWJA 3PD9A 3H6VA 1FW0A 2QRYA 2ZMBA 2UVJA 4FATA 5JK4A 4RPNA 2GRVA 3RT8A 4H6DA 1MQIA 3U1OA 5H8NB 2DYXA 2O69A 2E1SA 4QSDA 4Z0IA 1A8EA 5AA2D 3GBAA 2Z8FA 1PB9A 1ZTYA 4IY6A 5IKBA 1B1XA 1A55A 3TKDA 3ZS6A 3FZVA 4JDFA 2D21A 3Q26A 3TCGA 4DXCA 3IORA 2QJEA 4O3AA 2RC7A 4LQ2A 4OENA 1FTMA 5CC2A 1XVXA 1PB7A 4ZDMA 1A99A 4BDNA 3PUXE 4GL0A 5H8HA 2QS4A 4GIZA 1NNPA 4ONYA 3HSTA 2Z8EA 1LB8A 3HPIA 4BDMA 3B6QA 3G3HA 1PC3A 2F97A 3B7DA 2B3FA 1LLSA 3TELA 3KGCA 5I59A 2QS1A 1H44A 1MQDA 1YAEA 2B3BA 2HCAA 5AA3A 1MH3A 4JXIA 4GOTA 4NF5B 5ITPA 2VP1A 2QSXA 4TLLB 3MAMA 4QFOA 4R72A 4MFIA 1PEBA 4R9FA 4GL8A 1FTJA 4ZEFA 3Q29A 4LQ5A 3DP6A 4OETA 4XKNA 4R74A 5I2KA 1LCFA 5FTHA 1RYXA 4OQOA 3MP8A 2Z23A 3SDFA 3IO4A 2REJA 3SEWA 4PFYA 1MPBA 4F31B 1P1WA 4DDDA 3FXQA 1MS7A 1QVSA 4H0WA 1AMFA 3E13X 1P99A 1M5EA 1BLFA 1B05A 4Z7EA 4EQ7A 2I0CA 3G3FA 4POXA 1B46A 2G29A 2XXHA 1B40A 4H8IA 5AA1A 3W15C 2VGQA 1F9BA 3S9EA 1MXXA 4YMAA 3PU5A 2XXRA 5AE4A 4N13A 4YMBA 3PMXA 3I5OA 1WODA 4KR5A 3C32A 3KN7A 1HSLA 1B9JA 1MDQA 2E0SA 2Q9TA 4WKMA 1DMBA 2LAOA 4OFJA 4G68C 3QIMA 4OFOA 1MRPA 3B6WA 1B7ZA 5CMBA 3CSBA 3TPAA 3TCHA 1MXVA 2Y7IA 1IXGA 1TXFA 2RKMA 3JYRA 4EXKA 3TTRA 5EHMA 1QJMA 3ONMA 3H06B 2VD3A 2VHAA 4BLAA 5I58A 1Z7NE 2F35A 2V84A 3MZ1A 2A5SA 1AIVA 3FASA 4RK9A 3MZBA 4XKRA 3FJGA 5BUUA 3IL1B 3LR1A 5H8FA 1D9YA 3G3JA 2FYIA 1XT8A 3VE1B 3VVFA 3T9XB 3MP1A 2ZYNA 4R2FA 3Q28A 3OSQA 4DZ1A 5JTYA 3OD7A 3GZGA 3A3UA 2D3IA 1N7XA 2XHDA 2A5TA 2F78A 5KCJB 1SW2A 1US5A 3CIJA 2OCUA 3QXMA 4FIMA 3CG1A 1A7LA 2XXUA 1ZU0A 2XX7A 4HCYA 4C0RA 3WAFA 1CE2A 1XS5A 3PMVA 3C33A 4BDOA 5FHOA 3OEMA 5H8QA 4YB5A 5CMCA 3QUFA 4NF4B 2H9BA 2QMWA 3C31A 3PUVE 1VFEA 3MQ9A 1YCJA 1ZIUA 1P1QA 1JW4A 3IK6B 4U22A 2B65A 1ZKBA 5FHMA 2Z22A 1UTHB 3FATA 5FTIA 3OO8A 1I6BA 2R6GE 2F6PA 1N3WA 1MXUA 4ZZAA 3DLNA 1FQCA 3UA8A 3DP4A 1EZ9A 1LBBA 4JBZA 1A40A 3SETA 1LAHE 2PBWA 2F6GA 4LA9A 1B7UA 4EXLA 1DTZA 2V3QA 4IO3A 1XOCA 3S9LC 3THIA 1QULA 2O1MA 3M3LA 2DQVA 3JZJA 1SQYA 3N6TA 4EQ9A 4NF8A 3R26A 1D4NA 4ELRA 3FVGA 3IO6A 2ZXTA 2F8DA 2YPNA 1GR2A 1FQEA 1NFTA 3A09A 2RC9A 3QK6A 1JW5A 3HHFA 3KSJA 5AA4A 4F1UA 1AL3A 4DLDA 2ZYOA 1PBQA 2AL5A 4NEDA 1URSA 1VFDA 3OELA 4LATA 1AOVA 3N5LA 4HW8A 1S7YA 4IO5A 3HN0A 3U8QA 4F39A 3CRBA 2RCBA 1NNKA 3V83A 4I62A 1MG1A 3VLVA 4NF6B 3TZAA 2ZYKA 1BTJA 4F3GA 1VR5A 2ZNSA 4F2QA 4KFQA 3CFZA 5F1QA 3ILTB 1S9TA 1Y4TA 1MDP1 5EYFA 1H45A 3O6GA 1Z7ME 3MVWA 1N84A 2AIXA 4IB2A 4RNSA 1B5JA 1MM6A 4QF9A 4DXUA 3FIRA 5IAIA 5I57A 5KDTA 4R2BA 1DTGA 1JEVA 3TCFA 1SI0A 3EHTA 2DVCA 3VLUA 3GLBA 3MBPA 5DVIA 2FNCA 1J1NA 2XXIA 3Q27A 3TAJA 4H5FA 2VOZA 5DVJA 1UQWA 2GHAA 2XD3A 2DXRA 3U92A 1MY0A 1OMPA 5CBSA 3UK4A 4BDQA 2HEUA 4YU0A 1ZLQA 1R9QA 4HTGA 1H43A 1JVXA 2DP8A 5L8DA 1UIUA 2ONRA 5H8NA 3FJMA 3RGYA 4DE8A 1ZBMA 4R6KA 3OO7A 2PT1A 1B52A 3N94A 3FVOA 2I4CA 2NXOA 2M8CA 2HZLA 1MQHA 5AA2A 4GRKA 3K1NA 1XC1A 2XXYA 2V3TA 3O9PA 3PUZE 1B3HA 4DIGA 3Q25A 3OO9A 3VLWA 4F18A 2CZLA 2X7QA 3KOSA 3TTLA 3UN6A 3SKPA 3PPQA 4O3BA 1BP5A 3K2DA 3IB2A 3K0VA 1ELJA 1IQ7A 4G68A 4NWCA 1FQBA 2IEEA 2UXAA 1GVCA 3RT6B 3PPOA 4F3BA 1A8FA 1LAFE 3VDFA 1Y4CA 4WEPA 1NMUA 5CRYA 1GV8A 3C34A 1JNFA 5L9MA 2RCAA 5H8HB 3OENA 4P0IA 4RK2A 4H8JA 1SW4A 3C36A 1USYE 2F7BA 5ICTA 3C9HA 1NL5A 3LSFB 4G8MA 3VXCA 1B3FA 3H3GA 4JSDA 3KJTA 1FTKA 3K1MA 1TFAA 4RYAA 4GF8A 2OK2A 4KHZE 4ELOA 2P1SA 3OSRA 5I59B 2OJTA 2Y7KA 1O7TA 4QRZA 4NWDA 3WAEA 3BFTA 3T9UA 4F3SA 4K3FA 5LOMA 2I3VA 1TWYA 4IGTA 1B58A 3PGFA 4F1YA 4YB7A 3T93B 1NNTA 4R73A 1B6HA 2DVZA 3CI8A 5ICQA 4QFPA 1MQGA 3KBRA 4ZS9A 3EHUA 3E3KA 1PB8A 4C1UA 3I3VA 2VD2A
chains in the Genus database with same CATH superfamily
2ZZVA 4Q0CA 5ISUA 5I2KB 2IA4A 4YKIA 3HV1A 3SEUA 1HSJA 3IOWA 5CI5A 3IR1A 1LAGE 3TODA 4XKQA 3C4MA 4YKPA 3RNNA 3GBBA 1NV7A 1FPFA 4P11A 4PAKA 2Q89A 4OERA 1B1HA 2RINA 1NV3A 1B32A 1EU8A 4QFKA 3H7MA 3O66A 1MXZA 1CNQA 4N91A 3T9VA 3M8UA 3MPLA 4N81A 2O1LA 1B51A 2F34A 3QUJA 4MHFA 4I9DA 3ROJA 1LCTA 4G4PA 1JW1A 3FVKA 2HXRA 4O7IA 3RUMA 3CVGA 4PE5B 1ANFA 3QYTA 4G2ZA 4U23A 1SW5A 4OMBA 1DPPA 4P47A 2XWVA 1EZPA 2NOOA 2OBGA 3KEIA 3P7IA 5I56A 1NUWA 2DDKA 5DEXA 2WYKA 2PYYA 3VVEA 1IXIA 3H6WA 4OYVA 2ONKE 1QKAA 3BBRA 4KYEA 4OEVA 2W7YA 4I1DA 4THIA 2BJIA 3S4UA 4QHQA 3F11A 4X1BA 5I58B 3MVYA 2D5WA 3LUYA 1R6ZA 3U93A 2R8TA 3FV2A 4NG7A 1FPKA 1LSTA 3IB1A 4OANA 4PQJA 3B50A 2QS3A 3USDA 1URDA 4IY5A 3U65A 1FBFA 2WKYA 4H65A 3KC0A 2BJJX 2NVUB 3MZ9A 2Q8MA 5JTYB 3MWBA 2DXYA 1TFDA 5A5XB 3DP8A 5B7DA 4I3YA 2OWZA 3D1RA 3HHGA 2HAVA 2CMOA 1I6AA 4FEDA 1DPEA 4OZ9A 2Y84A 3MW0A 4HE1A 3K6UA 1SVXB 2PVUA 1AH5A 2H5YA 2Q2AA 4F19A 2HZKA 5ELVA 4GBVA 3ZSFA 4PDHA 1IXCA 1N3XA 3MC2A 5I2NB 1P1NA 4KCCA 1IIWA 1OLAA 3ZKLA 3O28A 1FTLA 4P3LA 4KXPA 1I69A 1M5CA 3ZKKA 2ESNA 1FBCA 3RTFB 4G8HA 3B6TA 3TTMA 4PFUA 4YICA 3LSLA 2L5VA 4H1XA 4ISUA 2XXPA 2GHBA 4M4GA 5JEIA 1SD3A 4R6HA 4EF2A 2Y7PA 3OMBA 1JEUA 3PD8A 4RY1A 4XKPA 4OVQA 1SYHA 2X26A 4ECFA 2DS9A 2XWOA 2P0SA 1MM7A 1XHYA 1FJ6A 4H67A 1NH8A 4MH5A 3O6IA 5ITOA 5TP9A 1H3DA 4GXAA 1T0KA 2F5XA 4F29A 2QS2A 5LDZA 3O6HA 4MEVA 3V89B 1WVJA 3MYUA 2I4BA 3ODBA 4FE8A 1YTVA 3SZPA 1II5A 3KFMA 1YPNA 5TPAA 2JJKA 4ZEKA 4I3EA 4Q30B 2HFBA 4ZE9A 4TQUQ 3H6TA 1QKBA 3G7WA 1FPGA 4EF1A 1P1UA 4POWA 4U21A 1N76A 1UTBB 3L6GA 5IZ3A 3K6WA 4PBHA 2RC8A 4NAPA 3R7XA 2XXWA 5HM4B 3V5AA 1A54A 3OXNA 1JP4A 4GD5A 4IO4A 1D3KA 3TTKA 3MPKA 3E9XA 1S50A 2XWKA 4F22A 1RDYA 1FSAA 4RA1A 4NF6A 1FBEA 4KI0E 2O6AA 2OWTA 4MX6A 1IZ1A 4EDPA 2WEFA 4OVJA 5IM2A 3H4ZA 2UVGA 3N26A 1NUYA 1O64A 2B4MA 1EYJA 4P1EA 4F2OA 2B4LA 2DWHA 4YAHX 4NTLA 3U72A 1L5TA 2PMSA 4ZEIA 4EQBA 4NX1A 3BIGA 1IUDA 3QSLA 1B3LA 4OEUA 1Q35A 4UA8A 2FIEA 2V93A 2QMXA 4ELQA 1GGGA 1MXYA 1M5BA 4LZ5A 4JWXA 4QSEA 1URGA 3MJNA 4QFNA 2ZYMA 1LBXA 4JWYA 3ILUB 5I57B 2ABHA 5KDTB 2DE2A 2I48A 2V25A 1OQGA 2GH9A 5I5PA 1MY4A 1TT1A 3EN3A 3U94A 1XVYA 1MY3A 3IOVA 4JVCA 1NV6A 4PCDA 3PV0E 3S2VA 3TQLA 3BKIB 4O94A 2XX9A 2PT2A 1ZMGA 2AL4A 2DWJA 3FD3A 3L6HA 1NUZA 4FEBA 5J1DA 2VT5A 1NH7A 5CMMA 5K2YA 1LFIA 2F36A 1LBVA 4ZZEA 4F3PA 3IOUA 3IJOB 5ESYA 4XF5A 3E78A 2QPQA 4P56A 1POTA 3W9WA 2PFYA 4YKJA 4KCDA 4ESWA 2OZZA 3KSXA 4IGRA 3RTWB 3RPLA 3S9MC 1SI1A 3TDJA 2XXXA 4FECA 4HXVA 5EHSA 5AA2B 3D4GA 1Q1KA 1B4HA 1EH3A 3HCQA 1DK4A 3O2AA 2FVZA 4G61A 3AXFA 3T0JA 3GYYA 4KPTA 2CEXA 5HBCA 4X9TA 4PDDA 3S9NC 3JV9A 1Y20A 1B7HA 3LBSA 1Y3NA 3T96B 1B0HA 2QL3A 1NKXA 2KLFA 1IITA 1MPCA 3IOTA 4GWWA 2REGA 4HS7A 1IEJA 4G68B 1QUIA 4N17A 4FJPA 4QBAA 4XTCQ 1VSOA 4P0GA 1AWBA 2YLNA 3TTNA 4NF5A 2I0BA 3T66A 4DXBA 2Y7RA 4GXSB 4DCYA 4TOZA 2XXTA 1B3EA 5EYGA 1OVTA 3EQ1A 4NE4A 2NWJA 3RN8A 4IO6A 3FGSA 5DVFA 1RDXA 4RPOA 2PX1A 4E0XA 3RPWA 3LC8A 4O3CA 3G3IA 2FIXA 3KJ7A 5J16A 1FTAA 3SERA 1SYIA 2F7CA 3GXAA 1M5FA 1O63A 5EQ7A 4Q5TA 4H46A 3MVXA 1CB6A 5ET6A 4R75A 4ND9A 1LBZA 1LBYA 2DSFA 2I6EA 1HSEA 3PPPA 1BKAA 2UYEA 4M1VA 5CBRA 4XEQA 1JQFA 2DE3A 4N6PA 2ZNTA 1DOTA 3LV0A 4P9KA 2O51A 1LBWA 4OTEA 1B4ZA 4IR8A 2HQ0A 4AQ4A 3PPRA 2DE4A 4ZE8A 2HXWA 5A5LA 3CFXA 3K00A 3KZGA 3MUQA 3UP9A 1NNFA 1P1OA 4YKKA 4ZEBA 4IO7A 2I58A 4UABA 4EUOA 1Y1ZA 1B2HA 2DWIA 2ZNUA 3LSXA 3PMWA 1RYOA 4PFBA 5TU0A 1LFGA 5ET7A 2I3WA 2XXVA 3IAZA 1LFHA 4PC9A 3TEPA 2O68A 1OVBA 1R1NA 3N6UA 3O97A 5B70A 2NUVA 4P1LA 1VE4A 3A29A 5FHNA 3ECRA 2MKZA 3K01A 1H76A 5DT6A 2ALUA 3IFAA 1FPBA 3CG3A 4KD5A 5H8SA 3H6UA 4AB6A 1MH4A 1PBPA 1Q9DA 3K6VA 4HCWA 5K2XA 3TUSA 3FXRA 4RJZA 4C1TA 4BDLA 3R6UA 1Y3PA 3IX1A 3D4CA 2GFEA 1QW0A 5I56B 1Y3QA 3O29A 5DEXB 4JSOA 1IXHA 4MF3A 4NMYA 3DELB 1MXWA 4FORA 5CMKA 4YB6A 4GVOA 2V3UA 1NUXA 3K6XA 3UGWA 4DCXA 2P2AA 2O7IA 4N07A 4YZZA 4X04A 5KCJA 4GWOA 1FBHA 5H8FB 3OOAA 2H99A 2H4IA 3RLFE 4X1DA 2CZHA 1QUKA 2AYSA 2DWAA 4LP2B 3EPEA 1SPIA 5A5XA 3KN3A 4MBPA 1DSNA 2A5TB 2KR0A 4H5GA 1Y1MA 4KYSA 1FBGA 1SBPA 3UIFA 1Y9UA 4XXUA 1NI9A 1SW1A 4OVSA 4NF4A 1USYH 2HHMA 5KZTA 2RF1A 4PP0A 1ATGA 1LBCA 1LAXA 4OFLA 4OXVA 4NHBA 1FCKA 3CFLA 1XI6A 3G3GA 5I84A 4RXLA 3OEKA 5H8QB 1KWHA 2ONSA 4U4XA 1JETA 3SEVA 4AB5A 5I2NA 5ET8A 1EZOA 5F7VA 3K02A 3TQWA 1ZJLA 2Y7WA 1UTHA 4U4SA 3CSGA 4ESXA 4OWDA 3IJXB 2PFZA 2VPOA 3QMFA 2OWSA 1JVYA 3KG2A 3T9HB 1WDNA 3MP6A 3PUYE 4R6YA 3TYHA 3V8XB 2XXKA 3MSTA 4JWOA 1EYIA 1IMFA 4TLMB 4GWUA 2QFLA 5CM6A 3QAXA 3IB0A 4GX6A 1N7WA 4PFTA 1B5IA 4N8YA 1LB9A 3RQTA 1MQJA 2Z8DA 2ANJA 2UYFA 2Q88A 2WX9A 1FTOA 3SEYA 4MLVA 5FBPA 2G93A 1LGBC 2YJPA 2Y5LA 2UVIA 1DBZA 1FPEA 4QSCA 4ZEDA 2H98A 4OHNA 1VDWA 3M3FA 1N04A 4G8NA 1FQFA 3MVZA 1I6QA 4MJOA 4BDRA 4GQOA 4LVQA 1MPDA 3TMGA 2R71A 2Q8JA 3VXBA 2R9JA 4NF8B 4F1VA 3FUZA 1RKMA 2P3NA 4LZ8A 5TP9B 4MNCA 3VFJA 2XD2A 4G77A 2I49A 2Q2CA 4X48A 4ZECA 2X7PA 3FV1A 1R9LA 1UTBA 4GX3A 2UVHA 4Q8RA 1OQHA 5TPAB 4JVIA 4U2RA 3LUZA 4OVTA 1UIVA 3UORA 5AA4B 2OX3A 4PF8A 5DTBA 1NV5A 5DYHA 3PPNA 4JB7A 4PFWA 2OLBA 3FXUA 3K1PA 1US4A 1FQDA 4L17A 4WEDA 4XIGQ 4LZ7A 3C35A 5IZ3B 1B0LA 4MLQA 1QUJA 3VV5A 3EHSA 3A3CA 3OO6A 4N15A 3FVNA 5M2VA 4U1ZA 4KQPA 1POY1 3DM0A 1M5DA 2XXQA 3SESA 2WBDA 2HAUA 1D9VA 1PDAA 2DOJA 3K4UA 1KZ8A 3G3KA 4PETA 4E0WA 4R9GA 5HPQA 1MY1A 3I6VA 3FJ7A 4GFRA 3CR9A 1BIYA 2THIA 4UACA 3E4RA 4WXJA 4IO2A 4OESA 4HE0A 3RY3A 1OIBA 3BFUA 5L9OA 3LSWA 4U1OA 1N0TA 1GTKA 3PUWE 5I3SA 3SEXA 4QFLA 3EF7A 1SDXA 4PAIA 5F24A 3T22A 3H03A 2FA7A 3M3KA 1MY2A 3VVDA 5IZ1A 2O7UA 3KOTA 3HO7A 4FAJA 2F7AA 5EQ8A 4I8CA 4LONB 4LUBA 2H25A 1OLCA 4ELPA 3TFLA 3W9VA 1B5HA 2O84X 1B3GA 4KYDA 1FQAA 2XX8A 4GLIA 5L9SA 3KN8A 5BWJA 3PD9A 3H6VA 1FW0A 1K9ZA 2QRYA 2ZMBA 2UVJA 3B8BA 4FATA 5JK4A 4RPNA 2GRVA 3RT8A 3PTYA 4H6DA 1MQIA 3U1OA 5H8NB 2DYXA 2O69A 2E1SA 4QSDA 3E79A 4Z0IA 1A8EA 4MNIA 5AA2D 3GBAA 2Z8FA 1PB9A 1ZTYA 2XA5A 4IY6A 5IKBA 1B1XA 1A55A 3TKDA 3ZS6A 3FZVA 4JDFA 4NF0A 2D21A 3Q26A 3TCGA 4DXCA 3IORA 2QJEA 3RPLB 4O3AA 2RC7A 4LQ2A 4OENA 1FTMA 5CC2A 1NV0A 1XVXA 1PB7A 4ZDMA 1A99A 4OVRA 4BDNA 3PUXE 4GL0A 5H8HA 2QS4A 1IMCA 4GIZA 1NNPA 2FBPA 4ONYA 3HSTA 2Z8EA 1LB8A 3HPIA 4BDMA 1FBPA 3B6QA 3G3HA 1PC3A 2F97A 3B7DA 2B3FA 1LLSA 3TELA 3KGCA 5I59A 2QS1A 1H44A 1MQDA 1YAEA 2B3BA 2HCAA 5AA3A 1MH3A 4I40A 4JXIA 4GOTA 4NF5B 5ITPA 2VP1A 2QSXA 4TLLB 3MAMA 4QFOA 4R72A 4MFIA 1D9QA 1PEBA 5IZZA 4R9FA 4GL8A 2PCRA 1FTJA 4GBWA 4GWXA 4ZEFA 3Q29A 4LQ5A 3DP6A 4MNPA 4OETA 4XKNA 2ZZXA 4R74A 5EYHA 5I2KA 4MAGA 1LCFA 5FTHA 1RYXA 4OQOA 3MP8A 5EQAA 2Z23A 3SDFA 3IO4A 1FRPA 2REJA 3SEWA 3T1BA 4PFYA 1MPBA 4N4UA 4F31B 2ZZWA 1P1WA 4DDDA 3FXQA 2CZKA 1MS7A 1QVSA 4H0WA 1AMFA 3E13X 1P99A 1M5EA 1BLFA 1B05A 4Z7EA 4O8MA 4EQ7A 2I0CA 3G3FA 4POXA 1B46A 2G29A 2XXHA 1B40A 4H8IA 3IFCA 5AA1A 4PFRA 3W15C 2VGQA 1F9BA 4PTKA 3S9EA 1MXXA 4YMAA 3PU5A 2XXRA 5AE4A 4N13A 4YMBA 3PMXA 3I5OA 1WODA 5DW8A 4KR5A 1NV4A 3C32A 3KN7A 1HSLA 1B9JA 4HE2A 1MDQA 2FHYA 2E0SA 2Q9TA 2P3VA 4WKMA 1DMBA 2LAOA 4OFJA 4G68C 3QIMA 4OFOA 1MRPA 2Q74A 3B6WA 1B7ZA 5CMBA 3CSBA 3TPAA 3ISPA 3TCHA 1MXVA 2Y7IA 1IXGA 1TXFA 2XWIA 2RKMA 3JYRA 1FPJA 4EXKA 4O7MA 4PAFA 3TTRA 5EHMA 1QJMA 3ONMA 3H06B 4OA4A 2VD3A 2QVVA 2VHAA 4BLAA 2Y5KA 4AS4A 5I58A 1Z7NE 2F35A 1YYZA 2V84A 3MZ1A 2A5SA 3EKIA 1AIVA 5T3JA 3FASA 4RK9A 3MZBA 4XKRA 3FJGA 5BUUA 3IL1B 1NV1A 3LR1A 2VPNA 5H8FA 1D9YA 3G3JA 2FYIA 1XT8A 3VE1B 3VVFA 3T9XB 3MP1A 2ZYNA 4R2FA 3Q28A 3OSQA 3KC1A 4DZ1A 5JTYA 1EYKA 3GZGA 3OD7A 3A3UA 2D3IA 1N7XA 2XHDA 2A5TA 2F78A 5KCJB 1SW2A 1US5A 3CIJA 2OCUA 3QXMA 4FIMA 3CG1A 1A7LA 2XXUA 1ZU0A 2XX7A 4HCYA 4C0RA 3WAFA 1CE2A 1XS5A 2F3BA 3PMVA 1IMEA 3C33A 4BDOA 5FHOA 3OEMA 5H8QA 1FPDA 4YB5A 5CMCA 3QUFA 4NF4B 5EQ9A 2H9BA 2QMWA 3C31A 3PUVE 5LTCA 1VFEA 3MQ9A 2V4CA 4MCOA 1YCJA 1G0HA 1ZIUA 1P1QA 1JW4A 3IK6B 4U22A 2B65A 3BIHA 1ZKBA 2WBBA 1K9YA 5FHMA 2Z22A 1UTHB 3FATA 5FTIA 3OO8A 1I6BA 2R6GE 4PE3A 2F6PA 1N3WA 1MXUA 4ZZAA 3DLNA 1FQCA 3UA8A 4JVDA 3DP4A 1EZ9A 4GWYA 1LBBA 4JBZA 1A40A 3SETA 1LAHE 2PBWA 2F6GA 4LA9A 1B7UA 1NV2A 4EXLA 1DTZA 2V3QA 4IO3A 1XOCA 3S9LC 3THIA 1QULA 2O1MA 3M3LA 2DQVA 3JZJA 1SQYA 3N6TA 3FBPA 4EQ9A 4NF8A 3R26A 1D4NA 1FJ9A 4ELRA 3HFUA 3FVGA 3IO6A 2ZXTA 2F8DA 4OVPA 2YPNA 1GR2A 1FQEA 1NFTA 3A09A 2RC9A 3QK6A 2GQ1A 4GWZA 1KA0A 1JW5A 3HHFA 4N6DA 3KSJA 5AA4A 4F1UA 3NOHA 1AL3A 4DLDA 2ZYOA 4P8BA 1PBQA 2AL5A 4MMPA 4NEDA 1URSA 1VFDA 4DI4B 3OELA 4LATA 4NQ8A 1AOVA 3N5LA 4HW8A 1S7YA 4IO5A 4LN5A 3HN0A 3U8QA 2QVUA 4F39A 3CRBA 2RCBA 1NNKA 3V83A 4I62A 1MG1A 3VLVA 4NF6B 3TZAA 2ZYKA 1BTJA 4F3GA 1VR5A 2ZNSA 4F2QA 4KFQA 1DCUA 3CFZA 3ILTB 4PGNA 5F1QA 1S9TA 1Y4TA 4H45A 1MDP1 5EYFA 1H45A 3O6GA 1Z7ME 3MVWA 1IMAA 3FXBA 1N84A 2AIXA 4MIJA 4IB2A 4RNSA 1B5JA 1MM6A 4QF9A 4DXUA 3FIRA 5IAIA 5I57A 5KDTA 4R2BA 1DTGA 1JEVA 4GWSA 3TCFA 1SI0A 3EHTA 2DVCA 3VLUA 3GLBA 3MBPA 5DVIA 1G0IA 2FNCA 1J1NA 2XXIA 3Q27A 3TAJA 4H5FA 2VOZA 1LEVA 5DVJA 1UQWA 2GHAA 1YXIA 2XD3A 4X8RA 2DXRA 3U92A 1MY0A 1OMPA 5CBSA 3UK4A 4BDQA 2HEUA 4YU0A 1ZLQA 1R9QA 1INPA 4NGUA 4DI3D 4HTGA 1H43A 1JVXA 2DP8A 5L8DA 1UIUA 2ONRA 1FPLA 1QGXA 5H8NA 1FPIA 3FJMA 3RGYA 4DE8A 1ZBMA 2KQZA 4R6KA 2HPGA 3OO7A 2PT1A 1B52A 3N94A 3FVOA 4PBQA 2I4CA 2NXOA 2M8CA 2HZLA 1MQHA 5AA2A 4GRKA 3K1NA 1XC1A 5I7IA 2XXYA 2V3TA 3KBZA 4N6KA 3O9PA 3PUZE 1B3HA 4DIGA 3Q25A 3OO9A 4PFIA 3VLWA 4F18A 1KA1A 1RDZA 2CZLA 2X7QA 3KOSA 3TTLA 3UN6A 3SKPA 3PPQA 4O3BA 4PF6A 1BP5A 3K2DA 4AS5A 3IB2A 3K0VA 1ELJA 1IQ7A 4G68A 4NWCA 1FQBA 2IEEA 4PGPA 2UXAA 4FBPA 1GVCA 4XFEA 3RT6B 3PPOA 4F3BA 1A8FA 1LAFE 4N8GA 3VDFA 1Y4CA 4WEPA 1NMUA 5CRYA 4GX4A 1GV8A 3C34A 1JNFA 5L9MA 1IMBA 2F3DA 2RCAA 5H8HB 1YZ0A 3OENA 4P0IA 4RK2A 4H8JA 1SW4A 3C36A 1USYE 4NN3A 2F7BA 2CEYA 5ICTA 3C9HA 1NL5A 3LSFB 4G8MA 3VXCA 1B3FA 3H3GA 4JSDA 3RYDA 3KJTA 1FTKA 2WYPA 3K1MA 1IMDA 1TFAA 4RYAA 4GF8A 2OK2A 4KHZE 4ELOA 1BK4A 2P1SA 3OSRA 5I59B 2OJTA 2Y7KA 1O7TA 4QRZA 5IGAA 4NWDA 3WAEA 4QXDA 3BFTA 3T9UA 4F3SA 3CHGA 4K3FA 5LOMA 2I3VA 1TWYA 4IGTA 2QVRA 1B58A 3PGFA 4F1YA 4YB7A 3T93B 1NNTA 4R73A 1B6HA 2DVZA 3CI8A 5ICQA 4QFPA 1MQGA 3KBRA 4ZS9A 5ET5A 3EHUA 1FBDA 3E3KA 2CZIA 1PB8A 4C1UA 3I3VA 2VD2A
chains in the Genus database with same CATH topology
4Q0CA 5ISUA 5I2KB 2IA4A 4YKIA 3HV1A 3SEUA 1HSJA 3IOWA 5CI5A 3IR1A 1LAGE 3TODA 4XKQA 3C4MA 4YKPA 3RNNA 3GBBA 4P11A 2Q89A 4OERA 1B1HA 2RINA 1B32A 1EU8A 4QFKA 3H7MA 3O66A 1MXZA 3T9VA 3M8UA 3MPLA 2O1LA 1B51A 2F34A 3QUJA 4I9DA 1LCTA 4G4PA 1JW1A 3FVKA 3RUMA 3CVGA 4PE5B 1ANFA 3QYTA 4G2ZA 4U23A 1SW5A 4OMBA 1DPPA 1EZPA 2NOOA 2OBGA 3KEIA 3P7IA 5I56A 5DEXA 2PYYA 3VVEA 1IXIA 3H6WA 4OYVA 2ONKE 1QKAA 3BBRA 4KYEA 4OEVA 2W7YA 4I1DA 4THIA 3S4UA 4QHQA 3F11A 4X1BA 5I58B 3MVYA 2D5WA 3LUYA 1R6ZA 3U93A 3FV2A 1LSTA 3IB1A 4PQJA 2QS3A 3USDA 1URDA 4IY5A 2WKYA 4H65A 2BJJX 2NVUB 3MZ9A 5JTYB 3MWBA 2DXYA 1TFDA 5A5XB 3DP8A 5B7DA 3HHGA 2HAVA 2CMOA 1I6AA 4FEDA 1DPEA 4OZ9A 2Y84A 3MW0A 3K6UA 1SVXB 2PVUA 1AH5A 2H5YA 2Q2AA 4F19A 2HZKA 5ELVA 3ZSFA 1IXCA 1N3XA 3MC2A 5I2NB 1P1NA 4KCCA 1IIWA 1OLAA 3ZKLA 3O28A 1FTLA 1I69A 1M5CA 3ZKKA 2ESNA 3RTFB 4G8HA 3B6TA 3TTMA 4PFUA 4YICA 3LSLA 4ISUA 4H1XA 2XXPA 2GHBA 4M4GA 5JEIA 1SD3A 4R6HA 4EF2A 2Y7PA 3OMBA 1JEUA 3PD8A 4RY1A 4XKPA 1SYHA 2X26A 4ECFA 2DS9A 2P0SA 1MM7A 1XHYA 4H67A 1NH8A 4MH5A 3O6IA 5ITOA 5TP9A 1H3DA 4GXAA 1T0KA 2F5XA 4F29A 2QS2A 3O6HA 3V89B 1WVJA 3ODBA 2I4BA 4FE8A 1YTVA 1II5A 3KFMA 1YPNA 5TPAA 4ZEKA 4Q30B 2HFBA 4ZE9A 4TQUQ 3H6TA 1QKBA 3G7WA 4EF1A 1P1UA 4POWA 4U21A 1N76A 1UTBB 3L6GA 3K6WA 2RC8A 3R7XA 2XXWA 5HM4B 3V5AA 1A54A 3OXNA 4GD5A 4IO4A 1D3KA 3TTKA 3MPKA 3E9XA 1S50A 4F22A 4RA1A 4NF6A 4KI0E 2O6AA 2OWTA 1IZ1A 4EDPA 4OVJA 3H4ZA 2UVGA 3N26A 1O64A 4F2OA 2DWHA 4YAHX 4NTLA 3U72A 1L5TA 2PMSA 4ZEIA 4EQBA 1IUDA 3QSLA 1B3LA 4OEUA 1Q35A 4UA8A 2V93A 2QMXA 4ELQA 1GGGA 1MXYA 1M5BA 4LZ5A 4JWXA 4QSEA 1URGA 3MJNA 4QFNA 2ZYMA 4JWYA 3ILUB 5I57B 2ABHA 5KDTB 2DE2A 2I48A 2V25A 1OQGA 2GH9A 1MY4A 1TT1A 3EN3A 3U94A 1XVYA 1MY3A 3IOVA 3PV0E 3S2VA 3TQLA 3BKIB 2XX9A 2PT2A 1ZMGA 2AL4A 2DWJA 3FD3A 3L6HA 4FEBA 5J1DA 1NH7A 5CMMA 5K2YA 1LFIA 2F36A 4ZZEA 4F3PA 3IOUA 3IJOB 2QPQA 1POTA 3W9WA 4YKJA 4KCDA 4ESWA 2OZZA 3KSXA 4IGRA 3RTWB 3S9MC 1SI1A 3TDJA 2XXXA 4FECA 5EHSA 5AA2B 3D4GA 1Q1KA 1B4HA 1EH3A 3HCQA 3O2AA 3AXFA 4KPTA 5HBCA 4X9TA 3S9NC 3JV9A 1Y20A 1B7HA 3LBSA 1Y3NA 3T96B 1B0HA 2QL3A 1NKXA 2KLFA 1IITA 1MPCA 3IOTA 2REGA 4HS7A 1IEJA 4G68B 1QUIA 4FJPA 4XTCQ 1VSOA 4P0GA 2YLNA 3TTNA 4NF5A 2I0BA 3T66A 4DXBA 2Y7RA 4GXSB 4DCYA 4TOZA 2XXTA 1B3EA 1OVTA 3EQ1A 4NE4A 2NWJA 3RN8A 4IO6A 3FGSA 5DVFA 4RPOA 2PX1A 4E0XA 3RPWA 3LC8A 4O3CA 3G3IA 3KJ7A 3SERA 1SYIA 2F7CA 3GXAA 1M5FA 1O63A 4Q5TA 3MVXA 1CB6A 4R75A 4ND9A 2DSFA 2I6EA 1HSEA 3PPPA 1BKAA 2UYEA 4M1VA 5CBRA 1JQFA 2DE3A 4N6PA 2ZNTA 1DOTA 2O51A 4OTEA 1B4ZA 2HQ0A 4AQ4A 3PPRA 2DE4A 4ZE8A 2HXWA 3CFXA 3K00A 3KZGA 3MUQA 3UP9A 1NNFA 1P1OA 4YKKA 4ZEBA 4IO7A 2I58A 4EUOA 1Y1ZA 1B2HA 2DWIA 2ZNUA 3LSXA 3PMWA 1RYOA 5TU0A 1LFGA 2I3WA 2XXVA 3IAZA 1LFHA 3TEPA 2O68A 1OVBA 1R1NA 3N6UA 3O97A 5B70A 2NUVA 1VE4A 5FHNA 3ECRA 3K01A 1H76A 5DT6A 2ALUA 3CG3A 4KD5A 5H8SA 3H6UA 4AB6A 1MH4A 1PBPA 3K6VA 4HCWA 5K2XA 3TUSA 3FXRA 4RJZA 4C1TA 4BDLA 3R6UA 1Y3PA 3IX1A 3D4CA 2GFEA 1QW0A 5I56B 1Y3QA 3O29A 5DEXB 4JSOA 1IXHA 4MF3A 4NMYA 3DELB 1MXWA 4FORA 5CMKA 4YB6A 4GVOA 2V3UA 3K6XA 3UGWA 4DCXA 2P2AA 2O7IA 4N07A 4YZZA 5KCJA 4GWOA 5H8FB 3OOAA 2H99A 2H4IA 3RLFE 4X1DA 1QUKA 2AYSA 2DWAA 4LP2B 3EPEA 5A5XA 3KN3A 4MBPA 1DSNA 2A5TB 4H5GA 1Y1MA 4KYSA 1SBPA 3UIFA 1Y9UA 4XXUA 1SW1A 4NF4A 1USYH 5KZTA 2RF1A 4PP0A 1ATGA 1LBCA 1LAXA 4OFLA 4OXVA 1FCKA 3CFLA 3G3GA 5I84A 4RXLA 3OEKA 5H8QB 1KWHA 2ONSA 4U4XA 1JETA 3SEVA 4AB5A 5I2NA 1EZOA 5F7VA 3K02A 3TQWA 1ZJLA 2Y7WA 1UTHA 4U4SA 3CSGA 4ESXA 4OWDA 3IJXB 2OWSA 1JVYA 3KG2A 3T9HB 1WDNA 3MP6A 3PUYE 4R6YA 3TYHA 3V8XB 4JWOA 4TLMB 5CM6A 3QAXA 3IB0A 1N7WA 4PFTA 1B5IA 1LB9A 3RQTA 1MQJA 2Z8DA 2ANJA 2UYFA 2Q88A 1FTOA 3SEYA 4MLVA 2G93A 1LGBC 2YJPA 2UVIA 4QSCA 4ZEDA 2H98A 4OHNA 3M3FA 1N04A 4G8NA 1FQFA 3MVZA 1I6QA 4BDRA 4GQOA 4LVQA 1MPDA 3TMGA 2R71A 2Q8JA 3VXBA 2R9JA 4NF8B 4F1VA 3FUZA 1RKMA 5TP9B 4LZ8A 3VFJA 2XD2A 4G77A 2I49A 2Q2CA 4X48A 4ZECA 2X7PA 3FV1A 1R9LA 1UTBA 2UVHA 4Q8RA 1OQHA 5TPAB 4U2RA 1UIVA 3UORA 5AA4B 5DTBA 5DYHA 3PPNA 4JB7A 4PFWA 2OLBA 3FXUA 3K1PA 1US4A 1FQDA 4L17A 4WEDA 4XIGQ 4LZ7A 3C35A 1B0LA 4MLQA 1QUJA 3VV5A 3EHSA 3A3CA 3OO6A 3FVNA 5M2VA 4U1ZA 4KQPA 1POY1 3DM0A 1M5DA 2XXQA 3SESA 2HAUA 1D9VA 1PDAA 2DOJA 3K4UA 3G3KA 4PETA 4E0WA 4R9GA 5HPQA 1MY1A 3I6VA 3FJ7A 4GFRA 3CR9A 1BIYA 2THIA 4UACA 3E4RA 4WXJA 4IO2A 4OESA 3RY3A 1OIBA 3BFUA 5L9OA 3LSWA 4U1OA 1N0TA 1GTKA 3PUWE 3SEXA 4QFLA 3EF7A 1SDXA 3T22A 3H03A 2FA7A 3M3KA 1MY2A 3VVDA 2O7UA 3KOTA 3HO7A 4FAJA 2F7AA 4I8CA 4LONB 4LUBA 2H25A 1OLCA 4ELPA 3TFLA 3W9VA 1B5HA 2O84X 1B3GA 4KYDA 1FQAA 2XX8A 4GLIA 5L9SA 3KN8A 5BWJA 3PD9A 3H6VA 1FW0A 2QRYA 2ZMBA 2UVJA 4FATA 5JK4A 4RPNA 2GRVA 3RT8A 4H6DA 1MQIA 3U1OA 5H8NB 2DYXA 2O69A 2E1SA 4QSDA 4Z0IA 1A8EA 5AA2D 3GBAA 2Z8FA 1PB9A 1ZTYA 4IY6A 5IKBA 1B1XA 1A55A 3TKDA 3ZS6A 3FZVA 4JDFA 2D21A 3Q26A 3TCGA 4DXCA 3IORA 2QJEA 4O3AA 2RC7A 4LQ2A 4OENA 1FTMA 5CC2A 1XVXA 1PB7A 4ZDMA 1A99A 4BDNA 3PUXE 4GL0A 5H8HA 2QS4A 4GIZA 1NNPA 4ONYA 3HSTA 2Z8EA 1LB8A 3HPIA 4BDMA 3B6QA 3G3HA 1PC3A 2F97A 3B7DA 2B3FA 1LLSA 3TELA 3KGCA 5I59A 2QS1A 1H44A 1MQDA 1YAEA 2B3BA 2HCAA 5AA3A 1MH3A 4JXIA 4GOTA 4NF5B 5ITPA 2VP1A 2QSXA 4TLLB 3MAMA 4QFOA 4R72A 4MFIA 1PEBA 4R9FA 4GL8A 1FTJA 4ZEFA 3Q29A 4LQ5A 3DP6A 4OETA 4XKNA 4R74A 5I2KA 1LCFA 5FTHA 1RYXA 4OQOA 3MP8A 2Z23A 3SDFA 3IO4A 2REJA 3SEWA 4PFYA 1MPBA 4F31B 1P1WA 4DDDA 3FXQA 1MS7A 1QVSA 4H0WA 1AMFA 3E13X 1P99A 1M5EA 1BLFA 1B05A 4Z7EA 4EQ7A 2I0CA 3G3FA 4POXA 1B46A 2G29A 2XXHA 1B40A 4H8IA 5AA1A 3W15C 2VGQA 1F9BA 3S9EA 1MXXA 4YMAA 3PU5A 2XXRA 5AE4A 4N13A 4YMBA 3PMXA 3I5OA 1WODA 4KR5A 3C32A 3KN7A 1HSLA 1B9JA 1MDQA 2E0SA 2Q9TA 4WKMA 1DMBA 2LAOA 4OFJA 4G68C 3QIMA 4OFOA 1MRPA 3B6WA 1B7ZA 5CMBA 3CSBA 3TPAA 3TCHA 1MXVA 2Y7IA 1IXGA 1TXFA 2RKMA 3JYRA 4EXKA 3TTRA 5EHMA 1QJMA 3ONMA 3H06B 2VD3A 2VHAA 4BLAA 5I58A 1Z7NE 2F35A 2V84A 3MZ1A 2A5SA 1AIVA 3FASA 4RK9A 3MZBA 4XKRA 3FJGA 5BUUA 3IL1B 3LR1A 5H8FA 1D9YA 3G3JA 2FYIA 1XT8A 3VE1B 3VVFA 3T9XB 3MP1A 2ZYNA 4R2FA 3Q28A 3OSQA 4DZ1A 5JTYA 3OD7A 3GZGA 3A3UA 2D3IA 1N7XA 2XHDA 2A5TA 2F78A 5KCJB 1SW2A 1US5A 3CIJA 2OCUA 3QXMA 4FIMA 3CG1A 1A7LA 2XXUA 1ZU0A 2XX7A 4HCYA 4C0RA 3WAFA 1CE2A 1XS5A 3PMVA 3C33A 4BDOA 5FHOA 3OEMA 5H8QA 4YB5A 5CMCA 3QUFA 4NF4B 2H9BA 2QMWA 3C31A 3PUVE 1VFEA 3MQ9A 1YCJA 1ZIUA 1P1QA 1JW4A 3IK6B 4U22A 2B65A 1ZKBA 5FHMA 2Z22A 1UTHB 3FATA 5FTIA 3OO8A 1I6BA 2R6GE 2F6PA 1N3WA 1MXUA 4ZZAA 3DLNA 1FQCA 3UA8A 3DP4A 1EZ9A 1LBBA 4JBZA 1A40A 3SETA 1LAHE 2PBWA 2F6GA 4LA9A 1B7UA 4EXLA 1DTZA 2V3QA 4IO3A 1XOCA 3S9LC 3THIA 1QULA 2O1MA 3M3LA 2DQVA 3JZJA 1SQYA 3N6TA 4EQ9A 4NF8A 3R26A 1D4NA 4ELRA 3FVGA 3IO6A 2ZXTA 2F8DA 2YPNA 1GR2A 1FQEA 1NFTA 3A09A 2RC9A 3QK6A 1JW5A 3HHFA 3KSJA 5AA4A 4F1UA 1AL3A 4DLDA 2ZYOA 1PBQA 2AL5A 4NEDA 1URSA 1VFDA 3OELA 4LATA 1AOVA 3N5LA 4HW8A 1S7YA 4IO5A 3HN0A 3U8QA 4F39A 3CRBA 2RCBA 1NNKA 3V83A 4I62A 1MG1A 3VLVA 4NF6B 3TZAA 2ZYKA 1BTJA 4F3GA 1VR5A 2ZNSA 4F2QA 4KFQA 3CFZA 5F1QA 3ILTB 1S9TA 1Y4TA 1MDP1 5EYFA 1H45A 3O6GA 1Z7ME 3MVWA 1N84A 2AIXA 4IB2A 4RNSA 1B5JA 1MM6A 4QF9A 4DXUA 3FIRA 5IAIA 5I57A 5KDTA 4R2BA 1DTGA 1JEVA 3TCFA 1SI0A 3EHTA 2DVCA 3VLUA 3GLBA 3MBPA 5DVIA 2FNCA 1J1NA 2XXIA 3Q27A 3TAJA 4H5FA 2VOZA 5DVJA 1UQWA 2GHAA 2XD3A 2DXRA 3U92A 1MY0A 1OMPA 5CBSA 3UK4A 4BDQA 2HEUA 4YU0A 1ZLQA 1R9QA 4HTGA 1H43A 1JVXA 2DP8A 5L8DA 1UIUA 2ONRA 5H8NA 3FJMA 3RGYA 4DE8A 1ZBMA 4R6KA 3OO7A 2PT1A 1B52A 3N94A 3FVOA 2I4CA 2NXOA 2M8CA 2HZLA 1MQHA 5AA2A 4GRKA 3K1NA 1XC1A 2XXYA 2V3TA 3O9PA 3PUZE 1B3HA 4DIGA 3Q25A 3OO9A 3VLWA 4F18A 2CZLA 2X7QA 3KOSA 3TTLA 3UN6A 3SKPA 3PPQA 4O3BA 1BP5A 3K2DA 3IB2A 3K0VA 1ELJA 1IQ7A 4G68A 4NWCA 1FQBA 2IEEA 2UXAA 1GVCA 3RT6B 3PPOA 4F3BA 1A8FA 1LAFE 3VDFA 1Y4CA 4WEPA 1NMUA 5CRYA 1GV8A 3C34A 1JNFA 5L9MA 2RCAA 5H8HB 3OENA 4P0IA 4RK2A 4H8JA 1SW4A 3C36A 1USYE 2F7BA 5ICTA 3C9HA 1NL5A 3LSFB 4G8MA 3VXCA 1B3FA 3H3GA 4JSDA 3KJTA 1FTKA 3K1MA 1TFAA 4RYAA 4GF8A 2OK2A 4KHZE 4ELOA 2P1SA 3OSRA 5I59B 2OJTA 2Y7KA 1O7TA 4QRZA 4NWDA 3WAEA 3BFTA 3T9UA 4F3SA 4K3FA 5LOMA 2I3VA 1TWYA 4IGTA 1B58A 3PGFA 4F1YA 4YB7A 3T93B 1NNTA 4R73A 1B6HA 2DVZA 3CI8A 5ICQA 4QFPA 1MQGA 3KBRA 4ZS9A 3EHUA 3E3KA 1PB8A 4C1UA 3I3VA 2VD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0C A;  5ISU A;  5I2K B;  2IA4 A;  4YKI A;  3HV1 A;  3SEU A;  1HSJ A;  3IOW A;  5CI5 A;  3IR1 A;  1LAG E;  3TOD A;  4XKQ A;  3C4M A;  4YKP A;  3RNN A;  3GBB A;  4P11 A;  2Q89 A;  4OER A;  1B1H A;  2RIN A;  1B32 A;  1EU8 A;  4QFK A;  3H7M A;  3O66 A;  1MXZ A;  3T9V A;  3M8U A;  3MPL A;  2O1L A;  1B51 A;  2F34 A;  3QUJ A;  4I9D A;  1LCT A;  4G4P A;  1JW1 A;  3FVK A;  3RUM A;  3CVG A;  4PE5 B;  1ANF A;  3QYT A;  4G2Z A;  4U23 A;  1SW5 A;  4OMB A;  1DPP A;  1EZP A;  2NOO A;  2OBG A;  3KEI A;  3P7I A;  5I56 A;  5DEX A;  2PYY A;  3VVE A;  1IXI A;  3H6W A;  4OYV A;  2ONK E;  1QKA A;  3BBR A;  4KYE A;  4OEV A;  2W7Y A;  4I1D A;  4THI A;  3S4U A;  4QHQ A;  3F11 A;  4X1B A;  5I58 B;  3MVY A;  2D5W A;  3LUY A;  1R6Z A;  3U93 A;  3FV2 A;  1LST A;  3IB1 A;  4PQJ A;  2QS3 A;  3USD A;  1URD A;  4IY5 A;  2WKY A;  4H65 A;  2BJJ X;  2NVU B;  3MZ9 A;  5JTY B;  3MWB A;  2DXY A;  1TFD A;  5A5X B;  3DP8 A;  5B7D A;  3HHG A;  2HAV A;  2CMO A;  1I6A A;  4FED A;  1DPE A;  4OZ9 A;  2Y84 A;  3MW0 A;  3K6U A;  1SVX B;  2PVU A;  1AH5 A;  2H5Y A;  2Q2A A;  4F19 A;  2HZK A;  5ELV A;  3ZSF A;  1IXC A;  1N3X A;  3MC2 A;  5I2N B;  1P1N A;  4KCC A;  1IIW A;  1OLA A;  3ZKL A;  3O28 A;  1FTL A;  1I69 A;  1M5C A;  3ZKK A;  2ESN A;  3RTF B;  4G8H A;  3B6T A;  3TTM A;  4PFU A;  4YIC A;  3LSL A;  4ISU A;  4H1X A;  2XXP A;  2GHB A;  4M4G A;  5JEI A;  1SD3 A;  4R6H A;  4EF2 A;  2Y7P A;  3OMB A;  1JEU A;  3PD8 A;  4RY1 A;  4XKP A;  1SYH A;  2X26 A;  4ECF A;  2DS9 A;  2P0S A;  1MM7 A;  1XHY A;  4H67 A;  1NH8 A;  4MH5 A;  3O6I A;  5ITO A;  5TP9 A;  1H3D A;  4GXA A;  1T0K A;  2F5X A;  4F29 A;  2QS2 A;  3O6H A;  3V89 B;  1WVJ A;  3ODB A;  2I4B A;  4FE8 A;  1YTV A;  1II5 A;  3KFM A;  1YPN A;  5TPA A;  4ZEK A;  4Q30 B;  2HFB A;  4ZE9 A;  4TQU Q;  3H6T A;  1QKB A;  3G7W A;  4EF1 A;  1P1U A;  4POW A;  4U21 A;  1N76 A;  1UTB B;  3L6G A;  3K6W A;  2RC8 A;  3R7X A;  2XXW A;  5HM4 B;  3V5A A;  1A54 A;  3OXN A;  4GD5 A;  4IO4 A;  1D3K A;  3TTK A;  3MPK A;  3E9X A;  1S50 A;  4F22 A;  4RA1 A;  4NF6 A;  4KI0 E;  2O6A A;  2OWT A;  1IZ1 A;  4EDP A;  4OVJ A;  3H4Z A;  2UVG A;  3N26 A;  1O64 A;  4F2O A;  2DWH A;  4YAH X;  4NTL A;  3U72 A;  1L5T A;  2PMS A;  4ZEI A;  4EQB A;  1IUD A;  3QSL A;  1B3L A;  4OEU A;  1Q35 A;  4UA8 A;  2V93 A;  2QMX A;  4ELQ A;  1GGG A;  1MXY A;  1M5B A;  4LZ5 A;  4JWX A;  4QSE A;  1URG A;  3MJN A;  4QFN A;  2ZYM A;  4JWY A;  3ILU B;  5I57 B;  2ABH A;  5KDT B;  2DE2 A;  2I48 A;  2V25 A;  1OQG A;  2GH9 A;  1MY4 A;  1TT1 A;  3EN3 A;  3U94 A;  1XVY A;  1MY3 A;  3IOV A;  3PV0 E;  3S2V A;  3TQL A;  3BKI B;  2XX9 A;  2PT2 A;  1ZMG A;  2AL4 A;  2DWJ A;  3FD3 A;  3L6H A;  4FEB A;  5J1D A;  1NH7 A;  5CMM A;  5K2Y A;  1LFI A;  2F36 A;  4ZZE A;  4F3P A;  3IOU A;  3IJO B;  2QPQ A;  1POT A;  3W9W A;  4YKJ A;  4KCD A;  4ESW A;  2OZZ A;  3KSX A;  4IGR A;  3RTW B;  3S9M C;  1SI1 A;  3TDJ A;  2XXX A;  4FEC A;  5EHS A;  5AA2 B;  3D4G A;  1Q1K A;  1B4H A;  1EH3 A;  3HCQ A;  3O2A A;  3AXF A;  4KPT A;  5HBC A;  4X9T A;  3S9N C;  3JV9 A;  1Y20 A;  1B7H A;  3LBS A;  1Y3N A;  3T96 B;  1B0H A;  2QL3 A;  1NKX A;  2KLF A;  1IIT A;  1MPC A;  3IOT A;  2REG A;  4HS7 A;  1IEJ A;  4G68 B;  1QUI A;  4FJP A;  4XTC Q;  1VSO A;  4P0G A;  2YLN A;  3TTN A;  4NF5 A;  2I0B A;  3T66 A;  4DXB A;  2Y7R A;  4GXS B;  4DCY A;  4TOZ A;  2XXT A;  1B3E A;  1OVT A;  3EQ1 A;  4NE4 A;  2NWJ A;  3RN8 A;  4IO6 A;  3FGS A;  5DVF A;  4RPO A;  2PX1 A;  4E0X A;  3RPW A;  3LC8 A;  4O3C A;  3G3I A;  3KJ7 A;  3SER A;  1SYI A;  2F7C A;  3GXA A;  1M5F A;  1O63 A;  4Q5T A;  3MVX A;  1CB6 A;  4R75 A;  4ND9 A;  2DSF A;  2I6E A;  1HSE A;  3PPP A;  1BKA A;  2UYE A;  4M1V A;  5CBR A;  1JQF A;  2DE3 A;  4N6P A;  2ZNT A;  1DOT A;  2O51 A;  4OTE A;  1B4Z A;  2HQ0 A;  4AQ4 A;  3PPR A;  2DE4 A;  4ZE8 A;  2HXW A;  3CFX A;  3K00 A;  3KZG A;  3MUQ A;  3UP9 A;  1NNF A;  1P1O A;  4YKK A;  4ZEB A;  4IO7 A;  2I58 A;  4EUO A;  1Y1Z A;  1B2H A;  2DWI A;  2ZNU A;  3LSX A;  3PMW A;  1RYO A;  5TU0 A;  1LFG A;  2I3W A;  2XXV A;  3IAZ A;  1LFH A;  3TEP A;  2O68 A;  1OVB A;  1R1N A;  3N6U A;  3O97 A;  5B70 A;  2NUV A;  1VE4 A;  5FHN A;  3ECR A;  3K01 A;  1H76 A;  5DT6 A;  2ALU A;  3CG3 A;  4KD5 A;  5H8S A;  3H6U A;  4AB6 A;  1MH4 A;  1PBP A;  3K6V A;  4HCW A;  5K2X A;  3TUS A;  3FXR A;  4RJZ A;  4C1T A;  4BDL A;  3R6U A;  1Y3P A;  3IX1 A;  3D4C A;  2GFE A;  1QW0 A;  5I56 B;  1Y3Q A;  3O29 A;  5DEX B;  4JSO A;  1IXH A;  4MF3 A;  4NMY A;  3DEL B;  1MXW A;  4FOR A;  5CMK A;  4YB6 A;  4GVO A;  2V3U A;  3K6X A;  3UGW A;  4DCX A;  2P2A A;  2O7I A;  4N07 A;  4YZZ A;  5KCJ A;  4GWO A;  5H8F B;  3OOA A;  2H99 A;  2H4I A;  3RLF E;  4X1D A;  1QUK A;  2AYS A;  2DWA A;  4LP2 B;  3EPE A;  5A5X A;  3KN3 A;  4MBP A;  1DSN A;  2A5T B;  4H5G A;  1Y1M A;  4KYS A;  1SBP A;  3UIF A;  1Y9U A;  4XXU A;  1SW1 A;  4NF4 A;  1USY H;  5KZT A;  2RF1 A;  4PP0 A;  1ATG A;  1LBC A;  1LAX A;  4OFL A;  4OXV A;  1FCK A;  3CFL A;  3G3G A;  5I84 A;  4RXL A;  3OEK A;  5H8Q B;  1KWH A;  2ONS A;  4U4X A;  1JET A;  3SEV A;  4AB5 A;  5I2N A;  1EZO A;  5F7V A;  3K02 A;  3TQW A;  1ZJL A;  2Y7W A;  1UTH A;  4U4S A;  3CSG A;  4ESX A;  4OWD A;  3IJX B;  2OWS A;  1JVY A;  3KG2 A;  3T9H B;  1WDN A;  3MP6 A;  3PUY E;  4R6Y A;  3TYH A;  3V8X B;  4JWO A;  4TLM B;  5CM6 A;  3QAX A;  3IB0 A;  1N7W A;  4PFT A;  1B5I A;  1LB9 A;  3RQT A;  1MQJ A;  2Z8D A;  2ANJ A;  2UYF A;  2Q88 A;  1FTO A;  3SEY A;  4MLV A;  2G93 A;  1LGB C;  2YJP A;  2UVI A;  4QSC A;  4ZED A;  2H98 A;  4OHN A;  3M3F A;  1N04 A;  4G8N A;  1FQF A;  3MVZ A;  1I6Q A;  4BDR A;  4GQO A;  4LVQ A;  1MPD A;  3TMG A;  2R71 A;  2Q8J A;  3VXB A;  2R9J A;  4NF8 B;  4F1V A;  3FUZ A;  1RKM A;  5TP9 B;  4LZ8 A;  3VFJ A;  2XD2 A;  4G77 A;  2I49 A;  2Q2C A;  4X48 A;  4ZEC A;  2X7P A;  3FV1 A;  1R9L A;  1UTB A;  2UVH A;  4Q8R A;  1OQH A;  5TPA B;  4U2R A;  1UIV A;  3UOR A;  5AA4 B;  5DTB A;  5DYH A;  3PPN A;  4JB7 A;  4PFW A;  2OLB A;  3FXU A;  3K1P A;  1US4 A;  1FQD A;  4L17 A;  4WED A;  4XIG Q;  4LZ7 A;  3C35 A;  1B0L A;  4MLQ A;  1QUJ A;  3VV5 A;  3EHS A;  3A3C A;  3OO6 A;  3FVN A;  5M2V A;  4U1Z A;  4KQP A;  1POY 1;  3DM0 A;  1M5D A;  2XXQ A;  3SES A;  2HAU A;  1D9V A;  1PDA A;  2DOJ A;  3K4U A;  3G3K A;  4PET A;  4E0W A;  4R9G A;  5HPQ A;  1MY1 A;  3I6V A;  3FJ7 A;  4GFR A;  3CR9 A;  1BIY A;  2THI A;  4UAC A;  3E4R A;  4WXJ A;  4IO2 A;  4OES A;  3RY3 A;  1OIB A;  3BFU A;  5L9O A;  3LSW A;  4U1O A;  1N0T A;  1GTK A;  3PUW E;  3SEX A;  4QFL A;  3EF7 A;  1SDX A;  3T22 A;  3H03 A;  2FA7 A;  3M3K A;  1MY2 A;  3VVD A;  2O7U A;  3KOT A;  3HO7 A;  4FAJ A;  2F7A A;  4I8C A;  4LON B;  4LUB A;  2H25 A;  1OLC A;  4ELP A;  3TFL A;  3W9V A;  1B5H A;  2O84 X;  1B3G A;  4KYD A;  1FQA A;  2XX8 A;  4GLI A;  5L9S A;  3KN8 A;  5BWJ A;  3PD9 A;  3H6V A;  1FW0 A;  2QRY A;  2ZMB A;  2UVJ A;  4FAT A;  5JK4 A;  4RPN A;  2GRV A;  3RT8 A;  4H6D A;  1MQI A;  3U1O A;  5H8N B;  2DYX A;  2O69 A;  2E1S A;  4QSD A;  4Z0I A;  1A8E A;  5AA2 D;  3GBA A;  2Z8F A;  1PB9 A;  1ZTY A;  4IY6 A;  5IKB A;  1B1X A;  1A55 A;  3TKD A;  3ZS6 A;  3FZV A;  4JDF A;  2D21 A;  3Q26 A;  3TCG A;  4DXC A;  3IOR A;  2QJE A;  4O3A A;  2RC7 A;  4LQ2 A;  4OEN A;  1FTM A;  5CC2 A;  1XVX A;  1PB7 A;  4ZDM A;  1A99 A;  4BDN A;  3PUX E;  4GL0 A;  5H8H A;  2QS4 A;  4GIZ A;  1NNP A;  4ONY A;  3HST A;  2Z8E A;  1LB8 A;  3HPI A;  4BDM A;  3B6Q A;  3G3H A;  1PC3 A;  2F97 A;  3B7D A;  2B3F A;  1LLS A;  3TEL A;  3KGC A;  5I59 A;  2QS1 A;  1H44 A;  1MQD A;  1YAE A;  2B3B A;  2HCA A;  5AA3 A;  1MH3 A;  4JXI A;  4GOT A;  4NF5 B;  5ITP A;  2VP1 A;  2QSX A;  4TLL B;  3MAM A;  4QFO A;  4R72 A;  4MFI A;  1PEB A;  4R9F A;  4GL8 A;  1FTJ A;  4ZEF A;  3Q29 A;  4LQ5 A;  3DP6 A;  4OET A;  4XKN A;  4R74 A;  5I2K A;  1LCF A;  5FTH A;  1RYX A;  4OQO A;  3MP8 A;  2Z23 A;  3SDF A;  3IO4 A;  2REJ A;  3SEW A;  4PFY A;  1MPB A;  4F31 B;  1P1W A;  4DDD A;  3FXQ A;  1MS7 A;  1QVS A;  4H0W A;  1AMF A;  3E13 X;  1P99 A;  1M5E A;  1BLF A;  1B05 A;  4Z7E A;  4EQ7 A;  2I0C A;  3G3F A;  4POX A;  1B46 A;  2G29 A;  2XXH A;  1B40 A;  4H8I A;  5AA1 A;  3W15 C;  2VGQ A;  1F9B A;  3S9E A;  1MXX A;  4YMA A;  3PU5 A;  2XXR A;  5AE4 A;  4N13 A;  4YMB A;  3PMX A;  3I5O A;  1WOD A;  4KR5 A;  3C32 A;  3KN7 A;  1HSL A;  1B9J A;  1MDQ A;  2E0S A;  2Q9T A;  4WKM A;  1DMB A;  2LAO A;  4OFJ A;  4G68 C;  3QIM A;  4OFO A;  1MRP A;  3B6W A;  1B7Z A;  5CMB A;  3CSB A;  3TPA A;  3TCH A;  1MXV A;  2Y7I A;  1IXG A;  1TXF A;  2RKM A;  3JYR A;  4EXK A;  3TTR A;  5EHM A;  1QJM A;  3ONM A;  3H06 B;  2VD3 A;  2VHA A;  4BLA A;  5I58 A;  1Z7N E;  2F35 A;  2V84 A;  3MZ1 A;  2A5S A;  1AIV A;  3FAS A;  4RK9 A;  3MZB A;  4XKR A;  3FJG A;  5BUU A;  3IL1 B;  3LR1 A;  5H8F A;  1D9Y A;  3G3J A;  2FYI A;  1XT8 A;  3VE1 B;  3VVF A;  3T9X B;  3MP1 A;  2ZYN A;  4R2F A;  3Q28 A;  3OSQ A;  4DZ1 A;  5JTY A;  3OD7 A;  3GZG A;  3A3U A;  2D3I A;  1N7X A;  2XHD A;  2A5T A;  2F78 A;  5KCJ B;  1SW2 A;  1US5 A;  3CIJ A;  2OCU A;  3QXM A;  4FIM A;  3CG1 A;  1A7L A;  2XXU A;  1ZU0 A;  2XX7 A;  4HCY A;  4C0R A;  3WAF A;  1CE2 A;  1XS5 A;  3PMV A;  3C33 A;  4BDO A;  5FHO A;  3OEM A;  5H8Q A;  4YB5 A;  5CMC A;  3QUF A;  4NF4 B;  2H9B A;  2QMW A;  3C31 A;  3PUV E;  1VFE A;  3MQ9 A;  1YCJ A;  1ZIU A;  1P1Q A;  1JW4 A;  3IK6 B;  4U22 A;  2B65 A;  1ZKB A;  5FHM A;  2Z22 A;  1UTH B;  3FAT A;  5FTI A;  3OO8 A;  1I6B A;  2R6G E;  2F6P A;  1N3W A;  1MXU A;  4ZZA A;  3DLN A;  1FQC A;  3UA8 A;  3DP4 A;  1EZ9 A;  1LBB A;  4JBZ A;  1A40 A;  3SET A;  1LAH E;  2PBW A;  2F6G A;  4LA9 A;  1B7U A;  4EXL A;  1DTZ A;  2V3Q A;  4IO3 A;  1XOC A;  3S9L C;  3THI A;  1QUL A;  2O1M A;  3M3L A;  2DQV A;  3JZJ A;  1SQY A;  3N6T A;  4EQ9 A;  4NF8 A;  3R26 A;  1D4N A;  4ELR A;  3FVG A;  3IO6 A;  2ZXT A;  2F8D A;  2YPN A;  1GR2 A;  1FQE A;  1NFT A;  3A09 A;  2RC9 A;  3QK6 A;  1JW5 A;  3HHF A;  3KSJ A;  5AA4 A;  4F1U A;  1AL3 A;  4DLD A;  2ZYO A;  1PBQ A;  2AL5 A;  4NED A;  1URS A;  1VFD A;  3OEL A;  4LAT A;  1AOV A;  3N5L A;  4HW8 A;  1S7Y A;  4IO5 A;  3HN0 A;  3U8Q A;  4F39 A;  3CRB A;  2RCB A;  1NNK A;  3V83 A;  4I62 A;  1MG1 A;  3VLV A;  4NF6 B;  3TZA A;  2ZYK A;  1BTJ A;  4F3G A;  1VR5 A;  2ZNS A;  4F2Q A;  4KFQ A;  3CFZ A;  5F1Q A;  3ILT B;  1S9T A;  1Y4T A;  1MDP 1;  5EYF A;  1H45 A;  3O6G A;  1Z7M E;  3MVW A;  1N84 A;  2AIX A;  4IB2 A;  4RNS A;  1B5J A;  1MM6 A;  4QF9 A;  4DXU A;  3FIR A;  5IAI A;  5I57 A;  5KDT A;  4R2B A;  1DTG A;  1JEV A;  3TCF A;  1SI0 A;  3EHT A;  2DVC A;  3VLU A;  3GLB A;  3MBP A;  5DVI A;  2FNC A;  1J1N A;  2XXI A;  3Q27 A;  3TAJ A;  4H5F A;  2VOZ A;  5DVJ A;  1UQW A;  2GHA A;  2XD3 A;  2DXR A;  3U92 A;  1MY0 A;  1OMP A;  5CBS A;  3UK4 A;  4BDQ A;  2HEU A;  4YU0 A;  1ZLQ A;  1R9Q A;  4HTG A;  1H43 A;  1JVX A;  2DP8 A;  5L8D A;  1UIU A;  2ONR A;  5H8N A;  3FJM A;  3RGY A;  4DE8 A;  1ZBM A;  4R6K A;  3OO7 A;  2PT1 A;  1B52 A;  3N94 A;  3FVO A;  2I4C A;  2NXO A;  2M8C A;  2HZL A;  1MQH A;  5AA2 A;  4GRK A;  3K1N A;  1XC1 A;  2XXY A;  2V3T A;  3O9P A;  3PUZ E;  1B3H A;  4DIG A;  3Q25 A;  3OO9 A;  3VLW A;  4F18 A;  2CZL A;  2X7Q A;  3KOS A;  3TTL A;  3UN6 A;  3SKP A;  3PPQ A;  4O3B A;  1BP5 A;  3K2D A;  3IB2 A;  3K0V A;  1ELJ A;  1IQ7 A;  4G68 A;  4NWC A;  1FQB A;  2IEE A;  2UXA A;  1GVC A;  3RT6 B;  3PPO A;  4F3B A;  1A8F A;  1LAF E;  3VDF A;  1Y4C A;  4WEP A;  1NMU A;  5CRY A;  1GV8 A;  3C34 A;  1JNF A;  5L9M A;  2RCA A;  5H8H B;  3OEN A;  4P0I A;  4RK2 A;  4H8J A;  1SW4 A;  3C36 A;  1USY E;  2F7B A;  5ICT A;  3C9H A;  1NL5 A;  3LSF B;  4G8M A;  3VXC A;  1B3F A;  3H3G A;  4JSD A;  3KJT A;  1FTK A;  3K1M A;  1TFA A;  4RYA A;  4GF8 A;  2OK2 A;  4KHZ E;  4ELO A;  2P1S A;  3OSR A;  5I59 B;  2OJT A;  2Y7K A;  1O7T A;  4QRZ A;  4NWD A;  3WAE A;  3BFT A;  3T9U A;  4F3S A;  4K3F A;  5LOM A;  2I3V A;  1TWY A;  4IGT A;  1B58 A;  3PGF A;  4F1Y A;  4YB7 A;  3T93 B;  1NNT A;  4R73 A;  1B6H A;  2DVZ A;  3CI8 A;  5ICQ A;  4QFP A;  1MQG A;  3KBR A;  4ZS9 A;  3EHU A;  3E3K A;  1PB8 A;  4C1U A;  3I3V A;  2VD2 A; 
#chains in the Genus database with same CATH topology
 2ZZV A;  4Q0C A;  5ISU A;  5I2K B;  2IA4 A;  4YKI A;  3HV1 A;  3SEU A;  1HSJ A;  3IOW A;  5CI5 A;  3IR1 A;  1LAG E;  3TOD A;  4XKQ A;  3C4M A;  4YKP A;  3RNN A;  3GBB A;  1NV7 A;  1FPF A;  4P11 A;  4PAK A;  2Q89 A;  4OER A;  1B1H A;  2RIN A;  1NV3 A;  1B32 A;  1EU8 A;  4QFK A;  3H7M A;  3O66 A;  1MXZ A;  1CNQ A;  4N91 A;  3T9V A;  3M8U A;  3MPL A;  4N81 A;  2O1L A;  1B51 A;  2F34 A;  3QUJ A;  4MHF A;  4I9D A;  3ROJ A;  1LCT A;  4G4P A;  1JW1 A;  3FVK A;  2HXR A;  4O7I A;  3RUM A;  3CVG A;  4PE5 B;  1ANF A;  3QYT A;  4G2Z A;  4U23 A;  1SW5 A;  4OMB A;  1DPP A;  4P47 A;  2XWV A;  1EZP A;  2NOO A;  2OBG A;  3KEI A;  3P7I A;  5I56 A;  1NUW A;  2DDK A;  5DEX A;  2WYK A;  2PYY A;  3VVE A;  1IXI A;  3H6W A;  4OYV A;  2ONK E;  1QKA A;  3BBR A;  4KYE A;  4OEV A;  2W7Y A;  4I1D A;  4THI A;  2BJI A;  3S4U A;  4QHQ A;  3F11 A;  4X1B A;  5I58 B;  3MVY A;  2D5W A;  3LUY A;  1R6Z A;  3U93 A;  2R8T A;  3FV2 A;  4NG7 A;  1FPK A;  1LST A;  3IB1 A;  4OAN A;  4PQJ A;  3B50 A;  2QS3 A;  3USD A;  1URD A;  4IY5 A;  3U65 A;  1FBF A;  2WKY A;  4H65 A;  3KC0 A;  2BJJ X;  2NVU B;  3MZ9 A;  2Q8M A;  5JTY B;  3MWB A;  2DXY A;  1TFD A;  5A5X B;  3DP8 A;  5B7D A;  4I3Y A;  2OWZ A;  3D1R A;  3HHG A;  2HAV A;  2CMO A;  1I6A A;  4FED A;  1DPE A;  4OZ9 A;  2Y84 A;  3MW0 A;  4HE1 A;  3K6U A;  1SVX B;  2PVU A;  1AH5 A;  2H5Y A;  2Q2A A;  4F19 A;  2HZK A;  5ELV A;  4GBV A;  3ZSF A;  4PDH A;  1IXC A;  1N3X A;  3MC2 A;  5I2N B;  1P1N A;  4KCC A;  1IIW A;  1OLA A;  3ZKL A;  3O28 A;  1FTL A;  4P3L A;  4KXP A;  1I69 A;  1M5C A;  3ZKK A;  2ESN A;  1FBC A;  3RTF B;  4G8H A;  3B6T A;  3TTM A;  4PFU A;  4YIC A;  3LSL A;  2L5V A;  4H1X A;  4ISU A;  2XXP A;  2GHB A;  4M4G A;  5JEI A;  1SD3 A;  4R6H A;  4EF2 A;  2Y7P A;  3OMB A;  1JEU A;  3PD8 A;  4RY1 A;  4XKP A;  4OVQ A;  1SYH A;  2X26 A;  4ECF A;  2DS9 A;  2XWO A;  2P0S A;  1MM7 A;  1XHY A;  1FJ6 A;  4H67 A;  1NH8 A;  4MH5 A;  3O6I A;  5ITO A;  5TP9 A;  1H3D A;  4GXA A;  1T0K A;  2F5X A;  4F29 A;  2QS2 A;  5LDZ A;  3O6H A;  4MEV A;  3V89 B;  1WVJ A;  3MYU A;  2I4B A;  3ODB A;  4FE8 A;  1YTV A;  3SZP A;  1II5 A;  3KFM A;  1YPN A;  5TPA A;  2JJK A;  4ZEK A;  4I3E A;  4Q30 B;  2HFB A;  4ZE9 A;  4TQU Q;  3H6T A;  1QKB A;  3G7W A;  1FPG A;  4EF1 A;  1P1U A;  4POW A;  4U21 A;  1N76 A;  1UTB B;  3L6G A;  5IZ3 A;  3K6W A;  4PBH A;  2RC8 A;  4NAP A;  3R7X A;  2XXW A;  5HM4 B;  3V5A A;  1A54 A;  3OXN A;  1JP4 A;  4GD5 A;  4IO4 A;  1D3K A;  3TTK A;  3MPK A;  3E9X A;  1S50 A;  2XWK A;  4F22 A;  1RDY A;  1FSA A;  4RA1 A;  4NF6 A;  1FBE A;  4KI0 E;  2O6A A;  2OWT A;  4MX6 A;  1IZ1 A;  4EDP A;  2WEF A;  4OVJ A;  5IM2 A;  3H4Z A;  2UVG A;  3N26 A;  1NUY A;  1O64 A;  2B4M A;  1EYJ A;  4P1E A;  4F2O A;  2B4L A;  2DWH A;  4YAH X;  4NTL A;  3U72 A;  1L5T A;  2PMS A;  4ZEI A;  4EQB A;  4NX1 A;  3BIG A;  1IUD A;  3QSL A;  1B3L A;  4OEU A;  1Q35 A;  4UA8 A;  2FIE A;  2V93 A;  2QMX A;  4ELQ A;  1GGG A;  1MXY A;  1M5B A;  4LZ5 A;  4JWX A;  4QSE A;  1URG A;  3MJN A;  4QFN A;  2ZYM A;  1LBX A;  4JWY A;  3ILU B;  5I57 B;  2ABH A;  5KDT B;  2DE2 A;  2I48 A;  2V25 A;  1OQG A;  2GH9 A;  5I5P A;  1MY4 A;  1TT1 A;  3EN3 A;  3U94 A;  1XVY A;  1MY3 A;  3IOV A;  4JVC A;  1NV6 A;  4PCD A;  3PV0 E;  3S2V A;  3TQL A;  3BKI B;  4O94 A;  2XX9 A;  2PT2 A;  1ZMG A;  2AL4 A;  2DWJ A;  3FD3 A;  3L6H A;  1NUZ A;  4FEB A;  5J1D A;  2VT5 A;  1NH7 A;  5CMM A;  5K2Y A;  1LFI A;  2F36 A;  1LBV A;  4ZZE A;  4F3P A;  3IOU A;  3IJO B;  5ESY A;  4XF5 A;  3E78 A;  2QPQ A;  4P56 A;  1POT A;  3W9W A;  2PFY A;  4YKJ A;  4KCD A;  4ESW A;  2OZZ A;  3KSX A;  4IGR A;  3RTW B;  3RPL A;  3S9M C;  1SI1 A;  3TDJ A;  2XXX A;  4FEC A;  4HXV A;  5EHS A;  5AA2 B;  3D4G A;  1Q1K A;  1B4H A;  1EH3 A;  3HCQ A;  1DK4 A;  3O2A A;  2FVZ A;  4G61 A;  3AXF A;  3T0J A;  3GYY A;  4KPT A;  2CEX A;  5HBC A;  4X9T A;  4PDD A;  3S9N C;  3JV9 A;  1Y20 A;  1B7H A;  3LBS A;  1Y3N A;  3T96 B;  1B0H A;  2QL3 A;  1NKX A;  2KLF A;  1IIT A;  1MPC A;  3IOT A;  4GWW A;  2REG A;  4HS7 A;  1IEJ A;  4G68 B;  1QUI A;  4N17 A;  4FJP A;  4QBA A;  4XTC Q;  1VSO A;  4P0G A;  1AWB A;  2YLN A;  3TTN A;  4NF5 A;  2I0B A;  3T66 A;  4DXB A;  2Y7R A;  4GXS B;  4DCY A;  4TOZ A;  2XXT A;  1B3E A;  5EYG A;  1OVT A;  3EQ1 A;  4NE4 A;  2NWJ A;  3RN8 A;  4IO6 A;  3FGS A;  5DVF A;  1RDX A;  4RPO A;  2PX1 A;  4E0X A;  3RPW A;  3LC8 A;  4O3C A;  3G3I A;  2FIX A;  3KJ7 A;  5J16 A;  1FTA A;  3SER A;  1SYI A;  2F7C A;  3GXA A;  1M5F A;  1O63 A;  5EQ7 A;  4Q5T A;  4H46 A;  3MVX A;  1CB6 A;  5ET6 A;  4R75 A;  4ND9 A;  1LBZ A;  1LBY A;  2DSF A;  2I6E A;  1HSE A;  3PPP A;  1BKA A;  2UYE A;  4M1V A;  5CBR A;  4XEQ A;  1JQF A;  2DE3 A;  4N6P A;  2ZNT A;  1DOT A;  3LV0 A;  4P9K A;  2O51 A;  1LBW A;  4OTE A;  1B4Z A;  4IR8 A;  2HQ0 A;  4AQ4 A;  3PPR A;  2DE4 A;  4ZE8 A;  2HXW A;  5A5L A;  3CFX A;  3K00 A;  3KZG A;  3MUQ A;  3UP9 A;  1NNF A;  1P1O A;  4YKK A;  4ZEB A;  4IO7 A;  2I58 A;  4UAB A;  4EUO A;  1Y1Z A;  1B2H A;  2DWI A;  2ZNU A;  3LSX A;  3PMW A;  1RYO A;  4PFB A;  5TU0 A;  1LFG A;  5ET7 A;  2I3W A;  2XXV A;  3IAZ A;  1LFH A;  4PC9 A;  3TEP A;  2O68 A;  1OVB A;  1R1N A;  3N6U A;  3O97 A;  5B70 A;  2NUV A;  4P1L A;  1VE4 A;  3A29 A;  5FHN A;  3ECR A;  2MKZ A;  3K01 A;  1H76 A;  5DT6 A;  2ALU A;  3IFA A;  1FPB A;  3CG3 A;  4KD5 A;  5H8S A;  3H6U A;  4AB6 A;  1MH4 A;  1PBP A;  1Q9D A;  3K6V A;  4HCW A;  5K2X A;  3TUS A;  3FXR A;  4RJZ A;  4C1T A;  4BDL A;  3R6U A;  1Y3P A;  3IX1 A;  3D4C A;  2GFE A;  1QW0 A;  5I56 B;  1Y3Q A;  3O29 A;  5DEX B;  4JSO A;  1IXH A;  4MF3 A;  4NMY A;  3DEL B;  1MXW A;  4FOR A;  5CMK A;  4YB6 A;  4GVO A;  2V3U A;  1NUX A;  3K6X A;  3UGW A;  4DCX A;  2P2A A;  2O7I A;  4N07 A;  4YZZ A;  4X04 A;  5KCJ A;  4GWO A;  1FBH A;  5H8F B;  3OOA A;  2H99 A;  2H4I A;  3RLF E;  4X1D A;  2CZH A;  1QUK A;  2AYS A;  2DWA A;  4LP2 B;  3EPE A;  1SPI A;  5A5X A;  3KN3 A;  4MBP A;  1DSN A;  2A5T B;  2KR0 A;  4H5G A;  1Y1M A;  4KYS A;  1FBG A;  1SBP A;  3UIF A;  1Y9U A;  4XXU A;  1NI9 A;  1SW1 A;  4OVS A;  4NF4 A;  1USY H;  2HHM A;  5KZT A;  2RF1 A;  4PP0 A;  1ATG A;  1LBC A;  1LAX A;  4OFL A;  4OXV A;  4NHB A;  1FCK A;  3CFL A;  1XI6 A;  3G3G A;  5I84 A;  4RXL A;  3OEK A;  5H8Q B;  1KWH A;  2ONS A;  4U4X A;  1JET A;  3SEV A;  4AB5 A;  5I2N A;  5ET8 A;  1EZO A;  5F7V A;  3K02 A;  3TQW A;  1ZJL A;  2Y7W A;  1UTH A;  4U4S A;  3CSG A;  4ESX A;  4OWD A;  3IJX B;  2PFZ A;  2VPO A;  3QMF A;  2OWS A;  1JVY A;  3KG2 A;  3T9H B;  1WDN A;  3MP6 A;  3PUY E;  4R6Y A;  3TYH A;  3V8X B;  2XXK A;  3MST A;  4JWO A;  1EYI A;  1IMF A;  4TLM B;  4GWU A;  2QFL A;  5CM6 A;  3QAX A;  3IB0 A;  4GX6 A;  1N7W A;  4PFT A;  1B5I A;  4N8Y A;  1LB9 A;  3RQT A;  1MQJ A;  2Z8D A;  2ANJ A;  2UYF A;  2Q88 A;  2WX9 A;  1FTO A;  3SEY A;  4MLV A;  5FBP A;  2G93 A;  1LGB C;  2YJP A;  2Y5L A;  2UVI A;  1DBZ A;  1FPE A;  4QSC A;  4ZED A;  2H98 A;  4OHN A;  1VDW A;  3M3F A;  1N04 A;  4G8N A;  1FQF A;  3MVZ A;  1I6Q A;  4MJO A;  4BDR A;  4GQO A;  4LVQ A;  1MPD A;  3TMG A;  2R71 A;  2Q8J A;  3VXB A;  2R9J A;  4NF8 B;  4F1V A;  3FUZ A;  1RKM A;  2P3N A;  4LZ8 A;  5TP9 B;  4MNC A;  3VFJ A;  2XD2 A;  4G77 A;  2I49 A;  2Q2C A;  4X48 A;  4ZEC A;  2X7P A;  3FV1 A;  1R9L A;  1UTB A;  4GX3 A;  2UVH A;  4Q8R A;  1OQH A;  5TPA B;  4JVI A;  4U2R A;  3LUZ A;  4OVT A;  1UIV A;  3UOR A;  5AA4 B;  2OX3 A;  4PF8 A;  5DTB A;  1NV5 A;  5DYH A;  3PPN A;  4JB7 A;  4PFW A;  2OLB A;  3FXU A;  3K1P A;  1US4 A;  1FQD A;  4L17 A;  4WED A;  4XIG Q;  4LZ7 A;  3C35 A;  5IZ3 B;  1B0L A;  4MLQ A;  1QUJ A;  3VV5 A;  3EHS A;  3A3C A;  3OO6 A;  4N15 A;  3FVN A;  5M2V A;  4U1Z A;  4KQP A;  1POY 1;  3DM0 A;  1M5D A;  2XXQ A;  3SES A;  2WBD A;  2HAU A;  1D9V A;  1PDA A;  2DOJ A;  3K4U A;  1KZ8 A;  3G3K A;  4PET A;  4E0W A;  4R9G A;  5HPQ A;  1MY1 A;  3I6V A;  3FJ7 A;  4GFR A;  3CR9 A;  1BIY A;  2THI A;  4UAC A;  3E4R A;  4WXJ A;  4IO2 A;  4OES A;  4HE0 A;  3RY3 A;  1OIB A;  3BFU A;  5L9O A;  3LSW A;  4U1O A;  1N0T A;  1GTK A;  3PUW E;  5I3S A;  3SEX A;  4QFL A;  3EF7 A;  1SDX A;  4PAI A;  5F24 A;  3T22 A;  3H03 A;  2FA7 A;  3M3K A;  1MY2 A;  3VVD A;  5IZ1 A;  2O7U A;  3KOT A;  3HO7 A;  4FAJ A;  2F7A A;  5EQ8 A;  4I8C A;  4LON B;  4LUB A;  2H25 A;  1OLC A;  4ELP A;  3TFL A;  3W9V A;  1B5H A;  2O84 X;  1B3G A;  4KYD A;  1FQA A;  2XX8 A;  4GLI A;  5L9S A;  3KN8 A;  5BWJ A;  3PD9 A;  3H6V A;  1FW0 A;  1K9Z A;  2QRY A;  2ZMB A;  2UVJ A;  3B8B A;  4FAT A;  5JK4 A;  4RPN A;  2GRV A;  3RT8 A;  3PTY A;  4H6D A;  1MQI A;  3U1O A;  5H8N B;  2DYX A;  2O69 A;  2E1S A;  4QSD A;  3E79 A;  4Z0I A;  1A8E A;  4MNI A;  5AA2 D;  3GBA A;  2Z8F A;  1PB9 A;  1ZTY A;  2XA5 A;  4IY6 A;  5IKB A;  1B1X A;  1A55 A;  3TKD A;  3ZS6 A;  3FZV A;  4JDF A;  4NF0 A;  2D21 A;  3Q26 A;  3TCG A;  4DXC A;  3IOR A;  2QJE A;  3RPL B;  4O3A A;  2RC7 A;  4LQ2 A;  4OEN A;  1FTM A;  5CC2 A;  1NV0 A;  1XVX A;  1PB7 A;  4ZDM A;  1A99 A;  4OVR A;  4BDN A;  3PUX E;  4GL0 A;  5H8H A;  2QS4 A;  1IMC A;  4GIZ A;  1NNP A;  2FBP A;  4ONY A;  3HST A;  2Z8E A;  1LB8 A;  3HPI A;  4BDM A;  1FBP A;  3B6Q A;  3G3H A;  1PC3 A;  2F97 A;  3B7D A;  2B3F A;  1LLS A;  3TEL A;  3KGC A;  5I59 A;  2QS1 A;  1H44 A;  1MQD A;  1YAE A;  2B3B A;  2HCA A;  5AA3 A;  1MH3 A;  4I40 A;  4JXI A;  4GOT A;  4NF5 B;  5ITP A;  2VP1 A;  2QSX A;  4TLL B;  3MAM A;  4QFO A;  4R72 A;  4MFI A;  1D9Q A;  1PEB A;  5IZZ A;  4R9F A;  4GL8 A;  2PCR A;  1FTJ A;  4GBW A;  4GWX A;  4ZEF A;  3Q29 A;  4LQ5 A;  3DP6 A;  4MNP A;  4OET A;  4XKN A;  2ZZX A;  4R74 A;  5EYH A;  5I2K A;  4MAG A;  1LCF A;  5FTH A;  1RYX A;  4OQO A;  3MP8 A;  5EQA A;  2Z23 A;  3SDF A;  3IO4 A;  1FRP A;  2REJ A;  3SEW A;  3T1B A;  4PFY A;  1MPB A;  4N4U A;  4F31 B;  2ZZW A;  1P1W A;  4DDD A;  3FXQ A;  2CZK A;  1MS7 A;  1QVS A;  4H0W A;  1AMF A;  3E13 X;  1P99 A;  1M5E A;  1BLF A;  1B05 A;  4Z7E A;  4O8M A;  4EQ7 A;  2I0C A;  3G3F A;  4POX A;  1B46 A;  2G29 A;  2XXH A;  1B40 A;  4H8I A;  3IFC A;  5AA1 A;  4PFR A;  3W15 C;  2VGQ A;  1F9B A;  4PTK A;  3S9E A;  1MXX A;  4YMA A;  3PU5 A;  2XXR A;  5AE4 A;  4N13 A;  4YMB A;  3PMX A;  3I5O A;  1WOD A;  5DW8 A;  4KR5 A;  1NV4 A;  3C32 A;  3KN7 A;  1HSL A;  1B9J A;  4HE2 A;  1MDQ A;  2FHY A;  2E0S A;  2Q9T A;  2P3V A;  4WKM A;  1DMB A;  2LAO A;  4OFJ A;  4G68 C;  3QIM A;  4OFO A;  1MRP A;  2Q74 A;  3B6W A;  1B7Z A;  5CMB A;  3CSB A;  3TPA A;  3ISP A;  3TCH A;  1MXV A;  2Y7I A;  1IXG A;  1TXF A;  2XWI A;  2RKM A;  3JYR A;  1FPJ A;  4EXK A;  4O7M A;  4PAF A;  3TTR A;  5EHM A;  1QJM A;  3ONM A;  3H06 B;  4OA4 A;  2VD3 A;  2QVV A;  2VHA A;  4BLA A;  2Y5K A;  4AS4 A;  5I58 A;  1Z7N E;  2F35 A;  1YYZ A;  2V84 A;  3MZ1 A;  2A5S A;  3EKI A;  1AIV A;  5T3J A;  3FAS A;  4RK9 A;  3MZB A;  4XKR A;  3FJG A;  5BUU A;  3IL1 B;  1NV1 A;  3LR1 A;  2VPN A;  5H8F A;  1D9Y A;  3G3J A;  2FYI A;  1XT8 A;  3VE1 B;  3VVF A;  3T9X B;  3MP1 A;  2ZYN A;  4R2F A;  3Q28 A;  3OSQ A;  3KC1 A;  4DZ1 A;  5JTY A;  1EYK A;  3GZG A;  3OD7 A;  3A3U A;  2D3I A;  1N7X A;  2XHD A;  2A5T A;  2F78 A;  5KCJ B;  1SW2 A;  1US5 A;  3CIJ A;  2OCU A;  3QXM A;  4FIM A;  3CG1 A;  1A7L A;  2XXU A;  1ZU0 A;  2XX7 A;  4HCY A;  4C0R A;  3WAF A;  1CE2 A;  1XS5 A;  2F3B A;  3PMV A;  1IME A;  3C33 A;  4BDO A;  5FHO A;  3OEM A;  5H8Q A;  1FPD A;  4YB5 A;  5CMC A;  3QUF A;  4NF4 B;  5EQ9 A;  2H9B A;  2QMW A;  3C31 A;  3PUV E;  5LTC A;  1VFE A;  3MQ9 A;  2V4C A;  4MCO A;  1YCJ A;  1G0H A;  1ZIU A;  1P1Q A;  1JW4 A;  3IK6 B;  4U22 A;  2B65 A;  3BIH A;  1ZKB A;  2WBB A;  1K9Y A;  5FHM A;  2Z22 A;  1UTH B;  3FAT A;  5FTI A;  3OO8 A;  1I6B A;  2R6G E;  4PE3 A;  2F6P A;  1N3W A;  1MXU A;  4ZZA A;  3DLN A;  1FQC A;  3UA8 A;  4JVD A;  3DP4 A;  1EZ9 A;  4GWY A;  1LBB A;  4JBZ A;  1A40 A;  3SET A;  1LAH E;  2PBW A;  2F6G A;  4LA9 A;  1B7U A;  1NV2 A;  4EXL A;  1DTZ A;  2V3Q A;  4IO3 A;  1XOC A;  3S9L C;  3THI A;  1QUL A;  2O1M A;  3M3L A;  2DQV A;  3JZJ A;  1SQY A;  3N6T A;  3FBP A;  4EQ9 A;  4NF8 A;  3R26 A;  1D4N A;  1FJ9 A;  4ELR A;  3HFU A;  3FVG A;  3IO6 A;  2ZXT A;  2F8D A;  4OVP A;  2YPN A;  1GR2 A;  1FQE A;  1NFT A;  3A09 A;  2RC9 A;  3QK6 A;  2GQ1 A;  4GWZ A;  1KA0 A;  1JW5 A;  3HHF A;  4N6D A;  3KSJ A;  5AA4 A;  4F1U A;  3NOH A;  1AL3 A;  4DLD A;  2ZYO A;  4P8B A;  1PBQ A;  2AL5 A;  4MMP A;  4NED A;  1URS A;  1VFD A;  4DI4 B;  3OEL A;  4LAT A;  4NQ8 A;  1AOV A;  3N5L A;  4HW8 A;  1S7Y A;  4IO5 A;  4LN5 A;  3HN0 A;  3U8Q A;  2QVU A;  4F39 A;  3CRB A;  2RCB A;  1NNK A;  3V83 A;  4I62 A;  1MG1 A;  3VLV A;  4NF6 B;  3TZA A;  2ZYK A;  1BTJ A;  4F3G A;  1VR5 A;  2ZNS A;  4F2Q A;  4KFQ A;  1DCU A;  3CFZ A;  3ILT B;  4PGN A;  5F1Q A;  1S9T A;  1Y4T A;  4H45 A;  1MDP 1;  5EYF A;  1H45 A;  3O6G A;  1Z7M E;  3MVW A;  1IMA A;  3FXB A;  1N84 A;  2AIX A;  4MIJ A;  4IB2 A;  4RNS A;  1B5J A;  1MM6 A;  4QF9 A;  4DXU A;  3FIR A;  5IAI A;  5I57 A;  5KDT A;  4R2B A;  1DTG A;  1JEV A;  4GWS A;  3TCF A;  1SI0 A;  3EHT A;  2DVC A;  3VLU A;  3GLB A;  3MBP A;  5DVI A;  1G0I A;  2FNC A;  1J1N A;  2XXI A;  3Q27 A;  3TAJ A;  4H5F A;  2VOZ A;  1LEV A;  5DVJ A;  1UQW A;  2GHA A;  1YXI A;  2XD3 A;  4X8R A;  2DXR A;  3U92 A;  1MY0 A;  1OMP A;  5CBS A;  3UK4 A;  4BDQ A;  2HEU A;  4YU0 A;  1ZLQ A;  1R9Q A;  1INP A;  4NGU A;  4DI3 D;  4HTG A;  1H43 A;  1JVX A;  2DP8 A;  5L8D A;  1UIU A;  2ONR A;  1FPL A;  1QGX A;  5H8N A;  1FPI A;  3FJM A;  3RGY A;  4DE8 A;  1ZBM A;  2KQZ A;  4R6K A;  2HPG A;  3OO7 A;  2PT1 A;  1B52 A;  3N94 A;  3FVO A;  4PBQ A;  2I4C A;  2NXO A;  2M8C A;  2HZL A;  1MQH A;  5AA2 A;  4GRK A;  3K1N A;  1XC1 A;  5I7I A;  2XXY A;  2V3T A;  3KBZ A;  4N6K A;  3O9P A;  3PUZ E;  1B3H A;  4DIG A;  3Q25 A;  3OO9 A;  4PFI A;  3VLW A;  4F18 A;  1KA1 A;  1RDZ A;  2CZL A;  2X7Q A;  3KOS A;  3TTL A;  3UN6 A;  3SKP A;  3PPQ A;  4O3B A;  4PF6 A;  1BP5 A;  3K2D A;  4AS5 A;  3IB2 A;  3K0V A;  1ELJ A;  1IQ7 A;  4G68 A;  4NWC A;  1FQB A;  2IEE A;  4PGP A;  2UXA A;  4FBP A;  1GVC A;  4XFE A;  3RT6 B;  3PPO A;  4F3B A;  1A8F A;  1LAF E;  4N8G A;  3VDF A;  1Y4C A;  4WEP A;  1NMU A;  5CRY A;  4GX4 A;  1GV8 A;  3C34 A;  1JNF A;  5L9M A;  1IMB A;  2F3D A;  2RCA A;  5H8H B;  1YZ0 A;  3OEN A;  4P0I A;  4RK2 A;  4H8J A;  1SW4 A;  3C36 A;  1USY E;  4NN3 A;  2F7B A;  2CEY A;  5ICT A;  3C9H A;  1NL5 A;  3LSF B;  4G8M A;  3VXC A;  1B3F A;  3H3G A;  4JSD A;  3RYD A;  3KJT A;  1FTK A;  2WYP A;  3K1M A;  1IMD A;  1TFA A;  4RYA A;  4GF8 A;  2OK2 A;  4KHZ E;  4ELO A;  1BK4 A;  2P1S A;  3OSR A;  5I59 B;  2OJT A;  2Y7K A;  1O7T A;  4QRZ A;  5IGA A;  4NWD A;  3WAE A;  4QXD A;  3BFT A;  3T9U A;  4F3S A;  3CHG A;  4K3F A;  5LOM A;  2I3V A;  1TWY A;  4IGT A;  2QVR A;  1B58 A;  3PGF A;  4F1Y A;  4YB7 A;  3T93 B;  1NNT A;  4R73 A;  1B6H A;  2DVZ A;  3CI8 A;  5ICQ A;  4QFP A;  1MQG A;  3KBR A;  4ZS9 A;  5ET5 A;  3EHU A;  1FBD A;  3E3K A;  2CZI A;  1PB8 A;  4C1U A;  3I3V A;  2VD2 A; 
#chains in the Genus database with same CATH homology
 4Q0C A;  5ISU A;  5I2K B;  2IA4 A;  4YKI A;  3HV1 A;  3SEU A;  1HSJ A;  3IOW A;  5CI5 A;  3IR1 A;  1LAG E;  3TOD A;  4XKQ A;  3C4M A;  4YKP A;  3RNN A;  3GBB A;  4P11 A;  2Q89 A;  4OER A;  1B1H A;  2RIN A;  1B32 A;  1EU8 A;  4QFK A;  3H7M A;  3O66 A;  1MXZ A;  3T9V A;  3M8U A;  3MPL A;  2O1L A;  1B51 A;  2F34 A;  3QUJ A;  4I9D A;  1LCT A;  4G4P A;  1JW1 A;  3FVK A;  3RUM A;  3CVG A;  4PE5 B;  1ANF A;  3QYT A;  4G2Z A;  4U23 A;  1SW5 A;  4OMB A;  1DPP A;  1EZP A;  2NOO A;  2OBG A;  3KEI A;  3P7I A;  5I56 A;  5DEX A;  2PYY A;  3VVE A;  1IXI A;  3H6W A;  4OYV A;  2ONK E;  1QKA A;  3BBR A;  4KYE A;  4OEV A;  2W7Y A;  4I1D A;  4THI A;  3S4U A;  4QHQ A;  3F11 A;  4X1B A;  5I58 B;  3MVY A;  2D5W A;  3LUY A;  1R6Z A;  3U93 A;  3FV2 A;  1LST A;  3IB1 A;  4PQJ A;  2QS3 A;  3USD A;  1URD A;  4IY5 A;  2WKY A;  4H65 A;  2BJJ X;  2NVU B;  3MZ9 A;  5JTY B;  3MWB A;  2DXY A;  1TFD A;  5A5X B;  3DP8 A;  5B7D A;  3HHG A;  2HAV A;  2CMO A;  1I6A A;  4FED A;  1DPE A;  4OZ9 A;  2Y84 A;  3MW0 A;  3K6U A;  1SVX B;  2PVU A;  1AH5 A;  2H5Y A;  2Q2A A;  4F19 A;  2HZK A;  5ELV A;  3ZSF A;  1IXC A;  1N3X A;  3MC2 A;  5I2N B;  1P1N A;  4KCC A;  1IIW A;  1OLA A;  3ZKL A;  3O28 A;  1FTL A;  1I69 A;  1M5C A;  3ZKK A;  2ESN A;  3RTF B;  4G8H A;  3B6T A;  3TTM A;  4PFU A;  4YIC A;  3LSL A;  4ISU A;  4H1X A;  2XXP A;  2GHB A;  4M4G A;  5JEI A;  1SD3 A;  4R6H A;  4EF2 A;  2Y7P A;  3OMB A;  1JEU A;  3PD8 A;  4RY1 A;  4XKP A;  1SYH A;  2X26 A;  4ECF A;  2DS9 A;  2P0S A;  1MM7 A;  1XHY A;  4H67 A;  1NH8 A;  4MH5 A;  3O6I A;  5ITO A;  5TP9 A;  1H3D A;  4GXA A;  1T0K A;  2F5X A;  4F29 A;  2QS2 A;  3O6H A;  3V89 B;  1WVJ A;  3ODB A;  2I4B A;  4FE8 A;  1YTV A;  1II5 A;  3KFM A;  1YPN A;  5TPA A;  4ZEK A;  4Q30 B;  2HFB A;  4ZE9 A;  4TQU Q;  3H6T A;  1QKB A;  3G7W A;  4EF1 A;  1P1U A;  4POW A;  4U21 A;  1N76 A;  1UTB B;  3L6G A;  3K6W A;  2RC8 A;  3R7X A;  2XXW A;  5HM4 B;  3V5A A;  1A54 A;  3OXN A;  4GD5 A;  4IO4 A;  1D3K A;  3TTK A;  3MPK A;  3E9X A;  1S50 A;  4F22 A;  4RA1 A;  4NF6 A;  4KI0 E;  2O6A A;  2OWT A;  1IZ1 A;  4EDP A;  4OVJ A;  3H4Z A;  2UVG A;  3N26 A;  1O64 A;  4F2O A;  2DWH A;  4YAH X;  4NTL A;  3U72 A;  1L5T A;  2PMS A;  4ZEI A;  4EQB A;  1IUD A;  3QSL A;  1B3L A;  4OEU A;  1Q35 A;  4UA8 A;  2V93 A;  2QMX A;  4ELQ A;  1GGG A;  1MXY A;  1M5B A;  4LZ5 A;  4JWX A;  4QSE A;  1URG A;  3MJN A;  4QFN A;  2ZYM A;  4JWY A;  3ILU B;  5I57 B;  2ABH A;  5KDT B;  2DE2 A;  2I48 A;  2V25 A;  1OQG A;  2GH9 A;  1MY4 A;  1TT1 A;  3EN3 A;  3U94 A;  1XVY A;  1MY3 A;  3IOV A;  3PV0 E;  3S2V A;  3TQL A;  3BKI B;  2XX9 A;  2PT2 A;  1ZMG A;  2AL4 A;  2DWJ A;  3FD3 A;  3L6H A;  4FEB A;  5J1D A;  1NH7 A;  5CMM A;  5K2Y A;  1LFI A;  2F36 A;  4ZZE A;  4F3P A;  3IOU A;  3IJO B;  2QPQ A;  1POT A;  3W9W A;  4YKJ A;  4KCD A;  4ESW A;  2OZZ A;  3KSX A;  4IGR A;  3RTW B;  3S9M C;  1SI1 A;  3TDJ A;  2XXX A;  4FEC A;  5EHS A;  5AA2 B;  3D4G A;  1Q1K A;  1B4H A;  1EH3 A;  3HCQ A;  3O2A A;  3AXF A;  4KPT A;  5HBC A;  4X9T A;  3S9N C;  3JV9 A;  1Y20 A;  1B7H A;  3LBS A;  1Y3N A;  3T96 B;  1B0H A;  2QL3 A;  1NKX A;  2KLF A;  1IIT A;  1MPC A;  3IOT A;  2REG A;  4HS7 A;  1IEJ A;  4G68 B;  1QUI A;  4FJP A;  4XTC Q;  1VSO A;  4P0G A;  2YLN A;  3TTN A;  4NF5 A;  2I0B A;  3T66 A;  4DXB A;  2Y7R A;  4GXS B;  4DCY A;  4TOZ A;  2XXT A;  1B3E A;  1OVT A;  3EQ1 A;  4NE4 A;  2NWJ A;  3RN8 A;  4IO6 A;  3FGS A;  5DVF A;  4RPO A;  2PX1 A;  4E0X A;  3RPW A;  3LC8 A;  4O3C A;  3G3I A;  3KJ7 A;  3SER A;  1SYI A;  2F7C A;  3GXA A;  1M5F A;  1O63 A;  4Q5T A;  3MVX A;  1CB6 A;  4R75 A;  4ND9 A;  2DSF A;  2I6E A;  1HSE A;  3PPP A;  1BKA A;  2UYE A;  4M1V A;  5CBR A;  1JQF A;  2DE3 A;  4N6P A;  2ZNT A;  1DOT A;  2O51 A;  4OTE A;  1B4Z A;  2HQ0 A;  4AQ4 A;  3PPR A;  2DE4 A;  4ZE8 A;  2HXW A;  3CFX A;  3K00 A;  3KZG A;  3MUQ A;  3UP9 A;  1NNF A;  1P1O A;  4YKK A;  4ZEB A;  4IO7 A;  2I58 A;  4EUO A;  1Y1Z A;  1B2H A;  2DWI A;  2ZNU A;  3LSX A;  3PMW A;  1RYO A;  5TU0 A;  1LFG A;  2I3W A;  2XXV A;  3IAZ A;  1LFH A;  3TEP A;  2O68 A;  1OVB A;  1R1N A;  3N6U A;  3O97 A;  5B70 A;  2NUV A;  1VE4 A;  5FHN A;  3ECR A;  3K01 A;  1H76 A;  5DT6 A;  2ALU A;  3CG3 A;  4KD5 A;  5H8S A;  3H6U A;  4AB6 A;  1MH4 A;  1PBP A;  3K6V A;  4HCW A;  5K2X A;  3TUS A;  3FXR A;  4RJZ A;  4C1T A;  4BDL A;  3R6U A;  1Y3P A;  3IX1 A;  3D4C A;  2GFE A;  1QW0 A;  5I56 B;  1Y3Q A;  3O29 A;  5DEX B;  4JSO A;  1IXH A;  4MF3 A;  4NMY A;  3DEL B;  1MXW A;  4FOR A;  5CMK A;  4YB6 A;  4GVO A;  2V3U A;  3K6X A;  3UGW A;  4DCX A;  2P2A A;  2O7I A;  4N07 A;  4YZZ A;  5KCJ A;  4GWO A;  5H8F B;  3OOA A;  2H99 A;  2H4I A;  3RLF E;  4X1D A;  1QUK A;  2AYS A;  2DWA A;  4LP2 B;  3EPE A;  5A5X A;  3KN3 A;  4MBP A;  1DSN A;  2A5T B;  4H5G A;  1Y1M A;  4KYS A;  1SBP A;  3UIF A;  1Y9U A;  4XXU A;  1SW1 A;  4NF4 A;  1USY H;  5KZT A;  2RF1 A;  4PP0 A;  1ATG A;  1LBC A;  1LAX A;  4OFL A;  4OXV A;  1FCK A;  3CFL A;  3G3G A;  5I84 A;  4RXL A;  3OEK A;  5H8Q B;  1KWH A;  2ONS A;  4U4X A;  1JET A;  3SEV A;  4AB5 A;  5I2N A;  1EZO A;  5F7V A;  3K02 A;  3TQW A;  1ZJL A;  2Y7W A;  1UTH A;  4U4S A;  3CSG A;  4ESX A;  4OWD A;  3IJX B;  2OWS A;  1JVY A;  3KG2 A;  3T9H B;  1WDN A;  3MP6 A;  3PUY E;  4R6Y A;  3TYH A;  3V8X B;  4JWO A;  4TLM B;  5CM6 A;  3QAX A;  3IB0 A;  1N7W A;  4PFT A;  1B5I A;  1LB9 A;  3RQT A;  1MQJ A;  2Z8D A;  2ANJ A;  2UYF A;  2Q88 A;  1FTO A;  3SEY A;  4MLV A;  2G93 A;  1LGB C;  2YJP A;  2UVI A;  4QSC A;  4ZED A;  2H98 A;  4OHN A;  3M3F A;  1N04 A;  4G8N A;  1FQF A;  3MVZ A;  1I6Q A;  4BDR A;  4GQO A;  4LVQ A;  1MPD A;  3TMG A;  2R71 A;  2Q8J A;  3VXB A;  2R9J A;  4NF8 B;  4F1V A;  3FUZ A;  1RKM A;  5TP9 B;  4LZ8 A;  3VFJ A;  2XD2 A;  4G77 A;  2I49 A;  2Q2C A;  4X48 A;  4ZEC A;  2X7P A;  3FV1 A;  1R9L A;  1UTB A;  2UVH A;  4Q8R A;  1OQH A;  5TPA B;  4U2R A;  1UIV A;  3UOR A;  5AA4 B;  5DTB A;  5DYH A;  3PPN A;  4JB7 A;  4PFW A;  2OLB A;  3FXU A;  3K1P A;  1US4 A;  1FQD A;  4L17 A;  4WED A;  4XIG Q;  4LZ7 A;  3C35 A;  1B0L A;  4MLQ A;  1QUJ A;  3VV5 A;  3EHS A;  3A3C A;  3OO6 A;  3FVN A;  5M2V A;  4U1Z A;  4KQP A;  1POY 1;  3DM0 A;  1M5D A;  2XXQ A;  3SES A;  2HAU A;  1D9V A;  1PDA A;  2DOJ A;  3K4U A;  3G3K A;  4PET A;  4E0W A;  4R9G A;  5HPQ A;  1MY1 A;  3I6V A;  3FJ7 A;  4GFR A;  3CR9 A;  1BIY A;  2THI A;  4UAC A;  3E4R A;  4WXJ A;  4IO2 A;  4OES A;  3RY3 A;  1OIB A;  3BFU A;  5L9O A;  3LSW A;  4U1O A;  1N0T A;  1GTK A;  3PUW E;  3SEX A;  4QFL A;  3EF7 A;  1SDX A;  3T22 A;  3H03 A;  2FA7 A;  3M3K A;  1MY2 A;  3VVD A;  2O7U A;  3KOT A;  3HO7 A;  4FAJ A;  2F7A A;  4I8C A;  4LON B;  4LUB A;  2H25 A;  1OLC A;  4ELP A;  3TFL A;  3W9V A;  1B5H A;  2O84 X;  1B3G A;  4KYD A;  1FQA A;  2XX8 A;  4GLI A;  5L9S A;  3KN8 A;  5BWJ A;  3PD9 A;  3H6V A;  1FW0 A;  2QRY A;  2ZMB A;  2UVJ A;  4FAT A;  5JK4 A;  4RPN A;  2GRV A;  3RT8 A;  4H6D A;  1MQI A;  3U1O A;  5H8N B;  2DYX A;  2O69 A;  2E1S A;  4QSD A;  4Z0I A;  1A8E A;  5AA2 D;  3GBA A;  2Z8F A;  1PB9 A;  1ZTY A;  4IY6 A;  5IKB A;  1B1X A;  1A55 A;  3TKD A;  3ZS6 A;  3FZV A;  4JDF A;  2D21 A;  3Q26 A;  3TCG A;  4DXC A;  3IOR A;  2QJE A;  4O3A A;  2RC7 A;  4LQ2 A;  4OEN A;  1FTM A;  5CC2 A;  1XVX A;  1PB7 A;  4ZDM A;  1A99 A;  4BDN A;  3PUX E;  4GL0 A;  5H8H A;  2QS4 A;  4GIZ A;  1NNP A;  4ONY A;  3HST A;  2Z8E A;  1LB8 A;  3HPI A;  4BDM A;  3B6Q A;  3G3H A;  1PC3 A;  2F97 A;  3B7D A;  2B3F A;  1LLS A;  3TEL A;  3KGC A;  5I59 A;  2QS1 A;  1H44 A;  1MQD A;  1YAE A;  2B3B A;  2HCA A;  5AA3 A;  1MH3 A;  4JXI A;  4GOT A;  4NF5 B;  5ITP A;  2VP1 A;  2QSX A;  4TLL B;  3MAM A;  4QFO A;  4R72 A;  4MFI A;  1PEB A;  4R9F A;  4GL8 A;  1FTJ A;  4ZEF A;  3Q29 A;  4LQ5 A;  3DP6 A;  4OET A;  4XKN A;  4R74 A;  5I2K A;  1LCF A;  5FTH A;  1RYX A;  4OQO A;  3MP8 A;  2Z23 A;  3SDF A;  3IO4 A;  2REJ A;  3SEW A;  4PFY A;  1MPB A;  4F31 B;  1P1W A;  4DDD A;  3FXQ A;  1MS7 A;  1QVS A;  4H0W A;  1AMF A;  3E13 X;  1P99 A;  1M5E A;  1BLF A;  1B05 A;  4Z7E A;  4EQ7 A;  2I0C A;  3G3F A;  4POX A;  1B46 A;  2G29 A;  2XXH A;  1B40 A;  4H8I A;  5AA1 A;  3W15 C;  2VGQ A;  1F9B A;  3S9E A;  1MXX A;  4YMA A;  3PU5 A;  2XXR A;  5AE4 A;  4N13 A;  4YMB A;  3PMX A;  3I5O A;  1WOD A;  4KR5 A;  3C32 A;  3KN7 A;  1HSL A;  1B9J A;  1MDQ A;  2E0S A;  2Q9T A;  4WKM A;  1DMB A;  2LAO A;  4OFJ A;  4G68 C;  3QIM A;  4OFO A;  1MRP A;  3B6W A;  1B7Z A;  5CMB A;  3CSB A;  3TPA A;  3TCH A;  1MXV A;  2Y7I A;  1IXG A;  1TXF A;  2RKM A;  3JYR A;  4EXK A;  3TTR A;  5EHM A;  1QJM A;  3ONM A;  3H06 B;  2VD3 A;  2VHA A;  4BLA A;  5I58 A;  1Z7N E;  2F35 A;  2V84 A;  3MZ1 A;  2A5S A;  1AIV A;  3FAS A;  4RK9 A;  3MZB A;  4XKR A;  3FJG A;  5BUU A;  3IL1 B;  3LR1 A;  5H8F A;  1D9Y A;  3G3J A;  2FYI A;  1XT8 A;  3VE1 B;  3VVF A;  3T9X B;  3MP1 A;  2ZYN A;  4R2F A;  3Q28 A;  3OSQ A;  4DZ1 A;  5JTY A;  3OD7 A;  3GZG A;  3A3U A;  2D3I A;  1N7X A;  2XHD A;  2A5T A;  2F78 A;  5KCJ B;  1SW2 A;  1US5 A;  3CIJ A;  2OCU A;  3QXM A;  4FIM A;  3CG1 A;  1A7L A;  2XXU A;  1ZU0 A;  2XX7 A;  4HCY A;  4C0R A;  3WAF A;  1CE2 A;  1XS5 A;  3PMV A;  3C33 A;  4BDO A;  5FHO A;  3OEM A;  5H8Q A;  4YB5 A;  5CMC A;  3QUF A;  4NF4 B;  2H9B A;  2QMW A;  3C31 A;  3PUV E;  1VFE A;  3MQ9 A;  1YCJ A;  1ZIU A;  1P1Q A;  1JW4 A;  3IK6 B;  4U22 A;  2B65 A;  1ZKB A;  5FHM A;  2Z22 A;  1UTH B;  3FAT A;  5FTI A;  3OO8 A;  1I6B A;  2R6G E;  2F6P A;  1N3W A;  1MXU A;  4ZZA A;  3DLN A;  1FQC A;  3UA8 A;  3DP4 A;  1EZ9 A;  1LBB A;  4JBZ A;  1A40 A;  3SET A;  1LAH E;  2PBW A;  2F6G A;  4LA9 A;  1B7U A;  4EXL A;  1DTZ A;  2V3Q A;  4IO3 A;  1XOC A;  3S9L C;  3THI A;  1QUL A;  2O1M A;  3M3L A;  2DQV A;  3JZJ A;  1SQY A;  3N6T A;  4EQ9 A;  4NF8 A;  3R26 A;  1D4N A;  4ELR A;  3FVG A;  3IO6 A;  2ZXT A;  2F8D A;  2YPN A;  1GR2 A;  1FQE A;  1NFT A;  3A09 A;  2RC9 A;  3QK6 A;  1JW5 A;  3HHF A;  3KSJ A;  5AA4 A;  4F1U A;  1AL3 A;  4DLD A;  2ZYO A;  1PBQ A;  2AL5 A;  4NED A;  1URS A;  1VFD A;  3OEL A;  4LAT A;  1AOV A;  3N5L A;  4HW8 A;  1S7Y A;  4IO5 A;  3HN0 A;  3U8Q A;  4F39 A;  3CRB A;  2RCB A;  1NNK A;  3V83 A;  4I62 A;  1MG1 A;  3VLV A;  4NF6 B;  3TZA A;  2ZYK A;  1BTJ A;  4F3G A;  1VR5 A;  2ZNS A;  4F2Q A;  4KFQ A;  3CFZ A;  5F1Q A;  3ILT B;  1S9T A;  1Y4T A;  1MDP 1;  5EYF A;  1H45 A;  3O6G A;  1Z7M E;  3MVW A;  1N84 A;  2AIX A;  4IB2 A;  4RNS A;  1B5J A;  1MM6 A;  4QF9 A;  4DXU A;  3FIR A;  5IAI A;  5I57 A;  5KDT A;  4R2B A;  1DTG A;  1JEV A;  3TCF A;  1SI0 A;  3EHT A;  2DVC A;  3VLU A;  3GLB A;  3MBP A;  5DVI A;  2FNC A;  1J1N A;  2XXI A;  3Q27 A;  3TAJ A;  4H5F A;  2VOZ A;  5DVJ A;  1UQW A;  2GHA A;  2XD3 A;  2DXR A;  3U92 A;  1MY0 A;  1OMP A;  5CBS A;  3UK4 A;  4BDQ A;  2HEU A;  4YU0 A;  1ZLQ A;  1R9Q A;  4HTG A;  1H43 A;  1JVX A;  2DP8 A;  5L8D A;  1UIU A;  2ONR A;  5H8N A;  3FJM A;  3RGY A;  4DE8 A;  1ZBM A;  4R6K A;  3OO7 A;  2PT1 A;  1B52 A;  3N94 A;  3FVO A;  2I4C A;  2NXO A;  2M8C A;  2HZL A;  1MQH A;  5AA2 A;  4GRK A;  3K1N A;  1XC1 A;  2XXY A;  2V3T A;  3O9P A;  3PUZ E;  1B3H A;  4DIG A;  3Q25 A;  3OO9 A;  3VLW A;  4F18 A;  2CZL A;  2X7Q A;  3KOS A;  3TTL A;  3UN6 A;  3SKP A;  3PPQ A;  4O3B A;  1BP5 A;  3K2D A;  3IB2 A;  3K0V A;  1ELJ A;  1IQ7 A;  4G68 A;  4NWC A;  1FQB A;  2IEE A;  2UXA A;  1GVC A;  3RT6 B;  3PPO A;  4F3B A;  1A8F A;  1LAF E;  3VDF A;  1Y4C A;  4WEP A;  1NMU A;  5CRY A;  1GV8 A;  3C34 A;  1JNF A;  5L9M A;  2RCA A;  5H8H B;  3OEN A;  4P0I A;  4RK2 A;  4H8J A;  1SW4 A;  3C36 A;  1USY E;  2F7B A;  5ICT A;  3C9H A;  1NL5 A;  3LSF B;  4G8M A;  3VXC A;  1B3F A;  3H3G A;  4JSD A;  3KJT A;  1FTK A;  3K1M A;  1TFA A;  4RYA A;  4GF8 A;  2OK2 A;  4KHZ E;  4ELO A;  2P1S A;  3OSR A;  5I59 B;  2OJT A;  2Y7K A;  1O7T A;  4QRZ A;  4NWD A;  3WAE A;  3BFT A;  3T9U A;  4F3S A;  4K3F A;  5LOM A;  2I3V A;  1TWY A;  4IGT A;  1B58 A;  3PGF A;  4F1Y A;  4YB7 A;  3T93 B;  1NNT A;  4R73 A;  1B6H A;  2DVZ A;  3CI8 A;  5ICQ A;  4QFP A;  1MQG A;  3KBR A;  4ZS9 A;  3EHU A;  3E3K A;  1PB8 A;  4C1U A;  3I3V A;  2VD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...