1HSLA

Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
238
structure length
238
Chain Sequence
AIPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPAVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords HISTIDINE-BINDING PROTEIN
publication title Refined 1.89-A structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport/chemosensory proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hslA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hslA02
3SEUA 5TP9A 1EZ9A 2RCBA 3TDJA 4BDRA 3N5LA 1Q35A 3CRBA 4OFJA 1IUDA 4NTLA 4XTCQ 4BDMA 1Z7ME 4JSDA 3O29A 2QPQA 1ZKBA 1UTBB 5A5XB 3SEVA 4OZ9A 5HM4B 3HV1A 3IOWA 5ISUA 1MH3A 4U2RA 2RC9A 3QSLA 4QF9A 2P2AA 5F7VA 2GFEA 2ZYOA 2O7IA 1R9QA 4R2BA 1MG1A 5JTYA 4OVJA 3U8QA 5BUUA 3G3KA 5I59B 2DWHA 2DS9A 3F11A 2ALUA 1JVXA 3AXFA 4YB6A 1P99A 4F2QA 2R9JA 3R7XA 2HFBA 3TAJA 1VE4A 3T9XB 3VVEA 4XKQA 2F36A 3TELA 3FVKA 4H65A 1B3HA 4NMYA 3V5AA 3RUMA 4LP2B 4KR5A 1S7YA 4F19A 4ZE9A 3I3VA 1JEUA 3K6UA 2DVZA 5EYFA 2Q9TA 1MPDA 3CIJA 1JW4A 5H8HB 4F1VA 4DZ1A 1XS5A 1R9LA 3PD9A 4PQJA 5L8DA 5J1DA 4KPTA 4Q8RA 4LUBA 4IY6A 1SW1A 2OK2A 3QK6A 5IKBA 1LFIA 2Z23A 2XXXA 4TOZA 3ECRA 1ZTYA 2NWJA 1HSEA 4U4XA 1IXIA 2XD3A 2V93A 3MVXA 4IGTA 3PMXA 1HSJA 5KZTA 3CR9A 1IXCA 2Q2CA 2O51A 2V3UA 2VHAA 3TTNA 2ZXTA 3RN8A 1WODA 2ZNUA 4ZEBA 4NF8B 3MVZA 1B32A 3DP4A 1AH5A 4EQ7A 4E0WA 1FQCA 5I57A 2H9BA 3Q26A 1ZLQA 4C1UA 1PC3A 3CSGA 5I2NA 5TP9B 1FTJA 2F7AA 1B46A 3MPKA 3OO6A 1DMBA 3LSXA 3OMBA 5ITPA 4ELPA 4MBPA 1ZU0A 1MY3A 3MBPA 3A3UA 2XXWA 3SEWA 3PUYE 1O63A 1B1HA 3K02A 4R73A 2NOOA 5H8QA 5DYHA 1JVYA 4OESA 3K4UA 4YKJA 3O66A 4POXA 2DXYA 4OWDA 2D21A 2F35A 2DSFA 3PMVA 1B7UA 2ANJA 4DCYA 3IX1A 1N7WA 4E0XA 2XXYA 3UIFA 3OEKA 1B58A 2XD2A 4GFRA 1MQHA 3G3HA 5AA2A 5AA4A 2HQ0A 5CBRA 2XXPA 1US5A 3E13X 3RTWB 1UIUA 4U1OA 2Y7PA 2QS3A 4KI0E 2XXHA 3TUSA 3N26A 1D3KA 3LSWA 4XIGQ 1T0KA 4R9FA 1Y3PA 3KFMA 1IQ7A 3OO8A 3UA8A 4HS7A 2G29A 3MAMA 2ONSA 1QW0A 2I3VA 3FJ7A 2GH9A 1ZIUA 2VD3A 4F3BA 2QL3A 4GF8A 2ZNSA 2I4BA 1TFAA 4IO3A 4NWCA 2GRVA 1FTOA 3H6TA 2XX8A 3DP6A 4BDLA 1DOTA 2DE4A 3D4CA 4TQUQ 5L9OA 1SVXB 2V25A 1FQBA 3T9VA 4O3BA 1Y1ZA 1A99A 2RKMA 4R6HA 2X7QA 1OLAA 3H7MA 3K01A 3CVGA 1B1XA 2OBGA 1EU8A 3PPRA 4G8HA 3KJTA 1Y4CA 3FVNA 1OLCA 4OEUA 4KCCA 5I59A 3O97A 5FHNA 1GR2A 4DLDA 2GHAA 3RY3A 3LUYA 3FIRA 3KN3A 3Q29A 2HAUA 2Z8EA 1H76A 4NEDA 1LFGA 1Y4TA 2O68A 5I2KA 2AL5A 1NL5A 3SERA 4ZECA 3BKIB 1J1NA 2XHDA 4XKNA 1Y3QA 1VFEA 3O6HA 3PD8A 3O2AA 1PDAA 1DSNA 3IORA 4AQ4A 4YB7A 2FNCA 5ITOA 4PFTA 5I57B 1GVCA 3VV5A 3VVFA 1MXVA 1OQHA 3RT6B 3VLUA 4BDNA 1B3LA 3HSTA 2PYYA 4QFKA 5H8HA 3BFTA 4ZEDA 3RNNA 1B3EA 5I2NB 3UN6A 2O7UA 1N7XA 3S2VA 1SBPA 1H44A 4M1VA 1POTA 3H4ZA 2THIA 5CRYA 3TZAA 5B70A 3PPQA 2OLBA 2VGQA 3C32A 2A5TA 1MPBA 4NF5B 3FATA 3K2DA 5H8QB 4XXUA 3T22A 4DXUA 4WEPA 4H6DA 4JBZA 2PT2A 1MQDA 3KEIA 3W9WA 4GOTA 4IGRA 2I3WA 4N07A 4AB5A 1QKBA 2E0SA 1H3DA 1OIBA 1S50A 1I6BA 4JSOA 1BTJA 4IO4A 4DDDA 3U93A 4KQPA 5KCJA 4ZZAA 3CI8A 5AA2B 5AA4B 3ZKKA 4DE8A 1PEBA 2Q88A 3PPPA 4MH5A 4OERA 3C4MA 2DE3A 4PETA 4RPOA 2Q2AA 2CZLA 3MZ1A 2PMSA 2X7PA 4YB5A 4Q30B 2HXWA 2NXOA 4UACA 3C34A 3B6WA 2DVCA 4GQOA 4JWOA 3KN7A 1SI0A 1Q1KA 4P0GA 5I58B 3BBRA 1URDA 1MDP1 3PV0E 4GL8A 4YU0A 4MFIA 4GIZA 5TU0A 4RA1A 4EXLA 1B51A 4IO5A 1PBQA 3MQ9A 1B05A 3ZSFA 1VR5A 4EUOA 4KYDA 4QHQA 3B6QA 4LQ5A 1LCFA 2QSXA 1VFDA 1N04A 4FAJA 3EF7A 1FQAA 1P1QA 2HEUA 4M4GA 4PE5B 3W9VA 3GXAA 4DCXA 3OO7A 3KJ7A 3MJNA 4F31B 3FD3A 2IEEA 3FV1A 1R1NA 1LB9A 1MY0A 1EZPA 4F29A 1NMUA 3KOTA 3VXCA 1KWHA 3MP1A 5I2KB 1Y3NA 1IITA 3VLWA 3S9LC 1BLFA 3HHFA 2VP1A 1NKXA 4ND9A 3IB1A 1QVSA 3KG2A 4JDFA 5I56B 1YCJA 4DIGA 4LQ2A 5I84A 5AE4A 2ZNTA 3UP9A 4X1BA 2KLFA 1NH8A 3OELA 2V3QA 4Q0CA 1URGA 3PU5A 1A7LA 3MP6A 4ZZEA 3UGWA 3R6UA 3QUJA 3CFZA 1SW5A 1JQFA 2XXQA 2A5TB 1WVJA 2QMXA 2DXRA 3TEPA 2OCUA 1LAFE 3T9HB 4ZS9A 4OHNA 2FYIA 3ODBA 3RTFB 4H67A 2DWJA 2HCAA 1D4NA 4YKKA 1SI1A 4KCDA 3TFLA 3GZGA 3LR1A 4O3AA 4OYVA 4JXIA 4GVOA 2B3FA 5KCJB 3THIA 3JV9A 1RYOA 3S9EA 3MPLA 2RF1A 3T93B 4XKPA 1IEJA 1N76A 3PPNA 4U22A 5FHOA 2AIXA 1AOVA 4LONB 3TKDA 4NWDA 4F22A 3MUQA 3WAFA 4F1UA 4QSEA 4F1YA 5B7DA 4DXBA 3U94A 3MP8A 3C35A 1B6HA 1SYIA 3S9NC 4RY1A 3P7IA 3QXMA 1MY1A 1JEVA 4ESXA 4PFUA 1LAXA 4NF5A 2UYFA 1SD3A 3E3KA 3QAXA 1LCTA 3C33A 3H6VA 2BJJX 3MZBA 1IXGA 3WAEA 4OTEA 3R26A 1FCKA 3EHTA 1JW1A 4U4SA 2CMOA 1XVXA 3T66A 4I8CA 3E9XA 3RT8A 5JK4A 1B2HA 3MW0A 4RK2A 2V3TA 1UQWA 4JWXA 1I6QA 4POWA 4Z0IA 4DXCA 2O6AA 3LSFB 4ECFA 2P1SA 1A40A 3EN3A 1DPEA 2OJTA 4G68A 1GTKA 2YPNA 2QRYA 2OWSA 3UK4A 4YMBA 5DVFA 4LVQA 1A8EA 1QUKA 3A3CA 2F5XA 2ONKE 1B5JA 4HCWA 3TQWA 1LBBA 4FATA 3PGFA 4FEBA 3SEXA 2H5YA 1LBCA 4ELOA 5I58A 3IB2A 3PMWA 2Q89A 5AA1A 2Y7KA 3KSXA 2XXUA 4OEVA 3Q25A 3VDFA 1Y20A 2A5SA 3SDFA 3U72A 3FXUA 3FZVA 5L9MA 1ATGA 3USDA 1USYH 3H3GA 3HPIA 1S9TA 4L17A 1TXFA 3DP8A 3N94A 2REJA 1AMFA 3HHGA 3Q27A 5ELVA 2W7YA 5TPAB 3PUWE 4LZ8A 2NUVA 2Z8DA 3TCFA 2DOJA 2ESNA 1JW5A 3B6TA 1II5A 2O84X 1N0TA 3LC8A 2PBWA 5HBCA 1USYE 4EQ9A 2UVHA 1MXUA 4GD5A 3QUFA 2F97A 1FQDA 4XKRA 4BDOA 1BP5A 4RJZA 3T96B 4QRZA 3TTLA 4YAHX 1MDQA 4QFOA 3TYHA 3PUVE 4JWYA 3PPOA 2H4IA 3CFXA 2P0SA 2XX9A 2F6GA 1QUJA 3I6VA 3K1NA 3KOSA 2F6PA 4F3GA 3MWBA 1MS7A 3H6WA 3K6XA 3DLNA 1P1OA 5I56A 4KYSA 2H98A 5DTBA 3FUZA 1IZ1A 1URSA 3MC2A 4OXVA 5CC2A 2ZMBA 3OSQA 4NF4A 1B4HA 5JEIA 3G7WA 2R6GE 2D5WA 1MPCA 2O69A 1GGGA 4TLMB 3ONMA 2F34A 1CB6A 4OFOA 4FECA 4ONYA 4EF2A 3FVOA 4MLQA 4BDQA 3H6UA 4FEDA 3O6IA 4R75A 4QSCA 4PFYA 3ILUB 2I48A 2UXAA 3IAZA 3IOUA 5CMMA 1M5EA 2RC7A 4NE4A 2QS1A 1OVTA 2YLNA 1I69A 2FA7A 2UVJA 2X26A 3KN8A 4EQBA 1A55A 3G3JA 2I0CA 3VFJA 2RCAA 1AIVA 4LZ5A 2QS4A 4H8JA 3JYRA 4G68B 2DE2A 4ISUA 1LB8A 3T9UA 3FGSA 4G68C 4IY5A 1PB9A 1PBPA 4LZ7A 4R74A 3KBRA 1SW2A 4YICA 4R72A 2ONRA 2I4CA 3K6WA 2VOZA 1IXHA 4EF1A 4G8NA 1RKMA 3S9MC 2OZZA 1I6AA 2F78A 1EZOA 4ZDMA 1D9VA 1LAGE 3CG1A 4ZE8A 3TCHA 3DM0A 4X1DA 5CMBA 1MM6A 4YKIA 1B0LA 3S4UA 4GXSB 1TWYA 4IB2A 2GHBA 1B9JA 3K6VA 1OVBA 3TODA 4FE8A 2XXTA 3I5OA 4YZZA 3IJOB 5CMCA 1M5BA 2HZLA 4RNSA 5ICTA 3IR1A 1B4ZA 3U1OA 5DVIA 3KSJA 3EHUA 5DT6A 2Y84A 2Y7IA 3FASA 4R6KA 2NVUB 4AB6A 5DEXB 3H06B 1XVYA 2D3IA 5F1QA 4HW8A 4JB7A 3JZJA 2I0BA 4UA8A 1LFHA 1SW4A 3M3LA 3OD7A 3TPAA 1US4A 3IO4A 2PT1A 4THIA 4F18A 4OFLA 2RC8A 4G4PA 2REGA 4U1ZA 3K1PA 1N84A 3CSBA 3V83A 1DTGA 2QS2A 1YAEA 3G3GA 1FQEA 2DP8A 4EDPA 4R9GA 3KGCA 2UVGA 1D9YA 3PUZE 4ELQA 2V84A 3LSLA 3OXNA 5K2XA 5CBSA 1B40A 2HZKA 1MY4A 4RXLA 4Q5TA 1B0HA 3OO9A 3CG3A 2DQVA 3C36A 2LAOA 1MQIA 3TTRA 5K2YA 5KDTA 4QFPA 2UVIA 2Z22A 1GV8A 3FJMA 4H1XA 5TPAA 1LLSA 4R6YA 1JNFA 5LOMA 4NF4B 1ZBMA 5L9SA 2ZYNA 3OENA 5HPQA 3HO7A 1M5CA 3SEYA 2O1MA 3TQLA 1OQGA 1TT1A 4ZEIA 4GWOA 1P1WA 5CMKA 1Z7NE 5H8NA 2M8CA 1NNTA 2AYSA 1BKAA 1N3WA 3E4RA 3N6TA 3KZGA 2QMWA 1P1NA 1PB7A 3EQ1A 5H8SA 4HTGA 1NNKA 4KD5A 1SQYA 2DWAA 4QFLA 1MXWA 1NFTA 4X9TA 4I62A 4YMAA 3EPEA 4H0WA 1UIVA 1F9BA 2HAVA 4K3FA 4NF6A 4F3PA 2XXRA 4I1DA 3CFLA 4N13A 4O3CA 5M2VA 1B5HA 3FV2A 3IK6B 3O6GA 2XXIA 1MQJA 1VSOA 3G3IA 1CE2A 3N6UA 3L6HA 4GXAA 4F3SA 2YJPA 3MVYA 1MRPA 5FHMA 2B65A 4PFWA 3ZS6A 4BLAA 3FVGA 3RQTA 3IOVA 3V89B 3H03A 1UTHA 1SDXA 1NNPA 5EHMA 1N3XA 4QSDA 1B5IA 1ANFA 1XOCA 1SYHA 4R2FA 3TTKA 1ELJA 1MH4A 3IB0A 3K00A 4P0IA 1LSTA 1NNFA 4G8MA 1POY1 5H8FA 1BIYA 4EXKA 3W15C 2WKYA 3M3KA 5JTYB 4TLLB 4Z7EA 1PB8A 3IO6A 5CI5A 5EHSA 2H99A 1Y9UA 1FW0A 4IO7A 1MQGA 2H25A 3M3FA 3GBAA 1Y1MA 3RGYA 5FTIA 1QJMA 5IAIA 1IIWA 4C1TA 2ZYMA 4KFQA 1DPPA 3QIMA 2Q8JA 1JETA 4RYAA 1MXZA 4OENA 3VLVA 4F2OA 4MF3A 2XX7A 4GLIA 3IL1B 2I6EA 5KDTB 2F7BA 2ZYKA 1QULA 1MM7A 3TMGA 1UTBA 2Z8FA 4OQOA 1B7ZA 5A5XA 4U21A 2Y7WA 5DEXA 3TCGA 2R71A 1A54A 1HSLA 3FXQA 4IO6A 1EH3A 4G2ZA 4MLVA 2VD2A 4U23A 2AL4A 3MZ9A 3SETA 3VXBA 4QFNA 1H43A 4WKMA 3SKPA 2OWTA 5ICQA 2PVUA 4I9DA 1M5FA 3FXRA 1ZMGA 4LATA 1OMPA 5H8NB 4G77A 3VE1B 4OMBA 1A8FA 1NH7A 1B7HA 3RLFE 3OSRA 4ZEFA 4PP0A 2IA4A 3OEMA 3LBSA 5DVJA 1ZJLA 2ABHA 3MVWA 1H45A 4WXJA 3HN0A 2I58A 2XXVA 4RK9A 4RPNA 3UORA 3A09A 3IOTA 1B52A 1MXYA 4GL0A 1YPNA 3M8UA 1AL3A 4WEDA 1LGBC 4FJPA 1O7TA 3IJXB 3ILTB 2B3BA 3QYTA 2E1SA 1L5TA 4KYEA 3C9HA 4X48A 4KHZE 1MY2A 1LAHE 3B7DA 4NF6B 3TTMA 2F7CA 2F8DA 3C31A 1XC1A 4F39A 2QJEA 3K1MA 2O1LA 4HCYA 2DYXA 2DWIA 4OETA 1MXXA 1DTZA 3GBBA 3O28A 3Q28A 3HCQA 1WDNA 3SESA 1O64A 4ELRA 3EHSA 2Y7RA 3VVDA 1UTHB 3K0VA 4P11A 1M5DA 1FQFA 2UYEA 3G3FA 3FJGA 1FTLA 4FORA 4YKPA 4IO2A 1R6ZA 3OOAA 2RINA 1B3FA 4H5GA 1RYXA 1FTKA 4LA9A 5BWJA 1QKAA 2PX1A 1B3GA 3V8XB 1P1UA 4C0RA 3PUXE 2I49A 1QUIA 1XHYA 4N6PA 5H8FB 1TFDA 1YTVA 5AA3A 4NF8A 2G93A 3U92A 3GLBA 3BFUA 4H8IA 3RPWA 3L6GA 4H5FA 4GRKA 1XT8A 3DELB 5FTHA 4FIMA 3D4GA 1FTMA 3ZKLA 5AA2D 4ESWA 4ZEKA 3O9PA 5CM6A
chains in the Genus database with same CATH superfamily
3SEUA 5TP9A 1EZ9A 2RCBA 3TDJA 4BDRA 1FPFA 3N5LA 1Q35A 3CRBA 4OFJA 1IUDA 4NTLA 4XTCQ 4KXPA 1FPJA 4BDMA 1Z7ME 4JSDA 1FBDA 3O29A 4NQ8A 1LBZA 2QPQA 1ZKBA 1UTBB 5A5XB 3SEVA 1DK4A 4OZ9A 5HM4B 3HV1A 3IOWA 2XWKA 2F3DA 5ISUA 1MH3A 4U2RA 5EQAA 2RC9A 3QSLA 4QF9A 2P2AA 5F7VA 2GFEA 2ZYOA 5IZ3A 2O7IA 1R9QA 4R2BA 4X8RA 1MG1A 5JTYA 4OVJA 3U8QA 4NG7A 5BUUA 5DW8A 3G3KA 5I59B 2DWHA 4AS4A 2DS9A 4PE3A 3F11A 2FHYA 2ALUA 1JVXA 3AXFA 4YB6A 1P99A 4F2QA 4P1LA 1AWBA 2R9JA 2WEFA 3R7XA 3KC0A 2HFBA 3TAJA 4NF0A 1VE4A 3T9XB 1LBWA 2VPOA 3VVEA 4XKQA 2F36A 3TELA 3FVKA 4H65A 1B3HA 4NMYA 3V5AA 3RUMA 4LP2B 4KR5A 1S7YA 4F19A 4ZE9A 3I3VA 5ET5A 1JEUA 3K6UA 1QGXA 2DVZA 5EYFA 2Q9TA 1MPDA 4MMPA 3CIJA 1JW4A 5H8HB 4F1VA 4DZ1A 1XS5A 1R9LA 3PD9A 4PQJA 5L8DA 5J1DA 4KPTA 4Q8RA 4LUBA 1INPA 4IY6A 1SW1A 2OK2A 3QK6A 5IKBA 2GQ1A 1LFIA 2Z23A 2XXXA 1IMCA 4TOZA 3ECRA 1ZTYA 2NWJA 1HSEA 4U4XA 1IXIA 2XD3A 1D9QA 2V93A 3MVXA 1RDYA 4IGTA 3PMXA 3GYYA 1HSJA 5KZTA 3CR9A 1IXCA 2Q2CA 1FPGA 2O51A 2V3UA 2VHAA 3TTNA 2ZXTA 3RN8A 1WODA 2ZNUA 5F24A 3KBZA 4ZEBA 1YZ0A 4P1EA 4NF8B 2KQZA 3MVZA 1B32A 4MX6A 3DP4A 4HE2A 1AH5A 4EQ7A 3BIGA 4E0WA 1FQCA 5I57A 2H9BA 2CZKA 3Q26A 1ZLQA 4O8MA 4PFRA 4C1UA 2OWZA 1PC3A 3CSGA 5I2NA 5TP9B 1FTJA 5ESYA 2F7AA 4UABA 5I7IA 1B46A 3MPKA 3OO6A 1DMBA 3LSXA 3OMBA 5ITPA 4ELPA 1FBGA 4MBPA 1ZU0A 1MY3A 3MBPA 3A3UA 2XXWA 3SEWA 3PUYE 3CHGA 1O63A 1B1HA 3K02A 4N91A 4R73A 2NOOA 5H8QA 5DYHA 1JVYA 4OESA 3K4UA 4YKJA 3O66A 4POXA 2DXYA 4OWDA 2D21A 2F35A 2DSFA 3PMVA 1B7UA 2ANJA 4P3LA 4DCYA 3IX1A 1N7WA 3BIHA 2XXYA 4E0XA 3UIFA 5IZ3B 3OEKA 1B58A 2XD2A 4GFRA 1MQHA 3G3HA 3NOHA 5AA2A 5AA4A 2HQ0A 5CBRA 2FBPA 2XXPA 1US5A 3E13X 3RTWB 1UIUA 4U1OA 2Y7PA 2QS3A 4KI0E 2XXHA 3TUSA 3N26A 3SZPA 1FBEA 1D3KA 3LSWA 4G61A 4XIGQ 1T0KA 4R9FA 1Y3PA 4GBWA 3KFMA 1IQ7A 3OO8A 3UA8A 4HS7A 1NUXA 2G29A 3MAMA 4GWZA 2ONSA 1QW0A 2I3VA 3FJ7A 2GH9A 1ZIUA 2VD3A 4F3BA 2QL3A 4GF8A 2ZNSA 2I4BA 1TFAA 4IO3A 4NWCA 2GRVA 1FTOA 3H6TA 2XX8A 3DP6A 4BDLA 1DOTA 5J16A 2DE4A 2WYKA 3D4CA 4TQUQ 5L9OA 1SVXB 2V25A 1FQBA 3T9VA 4O3BA 4PGNA 1Y1ZA 1LEVA 1A99A 2RKMA 1EYIA 4R6HA 2X7QA 1OLAA 3H7MA 3K01A 3CVGA 1B1XA 2OBGA 1EU8A 3PPRA 4G8HA 3KJTA 1Y4CA 3FVNA 1OLCA 2B4MA 4OEUA 4KCCA 5I59A 1NV2A 3O97A 5FHNA 1GR2A 4DLDA 2GHAA 3RY3A 3LUYA 3FIRA 1FJ6A 3KN3A 3Q29A 2HAUA 2Z8EA 1H76A 4NEDA 4JVDA 1LFGA 1Y4TA 1LBXA 2O68A 5I2KA 1YYZA 2AL5A 4AS5A 4OVQA 5ET7A 1NL5A 3D1RA 3SERA 5ET6A 4ZECA 3BKIB 1J1NA 2XHDA 1FPDA 2WBBA 4XKNA 1Y3QA 1VFEA 3O6HA 3PD8A 3O2AA 1PDAA 1RDXA 1DSNA 1KA0A 3IORA 2P3NA 4AQ4A 2Y5LA 4YB7A 2FNCA 5ITOA 4PFTA 1FPLA 5I57B 1GVCA 3VV5A 3VVFA 1MXVA 1OQHA 3RT6B 3VLUA 3B8BA 4BDNA 1B3LA 3HSTA 2PYYA 4QFKA 5H8HA 3BFTA 4ZEDA 3RNNA 1B3EA 5I2NB 3UN6A 2O7UA 4XF5A 1N7XA 2HPGA 2MKZA 3S2VA 1SBPA 1H44A 4M1VA 1POTA 2WX9A 3H4ZA 4DI3D 2THIA 5CRYA 3TZAA 5B70A 3PPQA 2OLBA 4GX4A 2VGQA 3C32A 2A5TA 1MPBA 4NF5B 2XWIA 3FATA 3K2DA 5H8QB 4XXUA 3T22A 1LBVA 4DXUA 4WEPA 2CEXA 1EYKA 4H6DA 4JBZA 2PT2A 1MQDA 3KEIA 3W9WA 2XWVA 4GOTA 4IGRA 2I3WA 4N07A 4JVCA 4AB5A 1NI9A 1QKBA 2E0SA 1H3DA 1OIBA 1S50A 1I6BA 3QMFA 4JSOA 4GWXA 1BTJA 4IO4A 4DDDA 3U93A 4KQPA 4QXDA 4N8GA 5KCJA 4ZZAA 3CI8A 5AA2B 5AA4B 1IMBA 3ZKKA 4PGPA 4DE8A 1PEBA 2Q88A 3PPPA 4MH5A 4OERA 3C4MA 3T1BA 2DE3A 4PETA 4RPOA 2Q2AA 2CZLA 1IMDA 3MZ1A 2PMSA 2X7PA 4Q30B 4YB5A 2HXWA 2NXOA 1Q9DA 4UACA 3C34A 1DCUA 3B6WA 2DVCA 4GQOA 4JWOA 3KN7A 1SI0A 1Q1KA 1FSAA 2XXKA 4P0GA 5I58B 4O7IA 3BBRA 1URDA 1MDP1 3PV0E 1FPIA 4NGUA 4GL8A 4YU0A 4MFIA 4OANA 4MAGA 4GIZA 5TU0A 4RA1A 2HXRA 1FPEA 4EXLA 1B51A 4IO5A 1PBQA 3MQ9A 1B05A 1G0HA 3ZSFA 1VR5A 2FIEA 4N15A 4EUOA 4KYDA 4QHQA 3B6QA 4LQ5A 4PFBA 1LCFA 2QSXA 1VFDA 1N04A 4P56A 4FAJA 3EF7A 1FQAA 1P1QA 2HEUA 4M4GA 4PE5B 3W9VA 3GXAA 1NUZA 4DCXA 3OO7A 3KJ7A 3MJNA 4F31B 3FD3A 2IEEA 3FV1A 1R1NA 1LB9A 1MY0A 1EZPA 4F29A 1NMUA 3KOTA 3VXCA 1KWHA 3MP1A 5I2KB 1Y3NA 4H45A 1IITA 4N6DA 3E79A 3VLWA 3S9LC 1BLFA 3ISPA 3HHFA 2VP1A 4GWUA 1NKXA 4ND9A 3IB1A 1QVSA 3KG2A 4JDFA 4LN5A 5I56B 1EYJA 1YCJA 4DIGA 4LQ2A 3ROJA 5I84A 5AE4A 3E78A 2ZNTA 3UP9A 2KLFA 1NH8A 3OELA 4X1BA 2V3QA 3RPLB 4Q0CA 1URGA 2PFYA 3PU5A 1A7LA 3MP6A 4ZZEA 3UGWA 5FBPA 4MNIA 3R6UA 3QUJA 3CFZA 4GWSA 1SW5A 1JQFA 3FBPA 2XXQA 2A5TB 1WVJA 4NN3A 2QMXA 2DXRA 4O94A 3TEPA 2OCUA 2ZZVA 1LAFE 2KR0A 3T9HB 4ZS9A 4OHNA 2FYIA 3ODBA 3RTFB 4H67A 2DWJA 2HCAA 1D4NA 4YKKA 1SI1A 4KCDA 3TFLA 3GZGA 3LR1A 4GBVA 4O3AA 2CEYA 5LDZA 4OYVA 4JXIA 4GVOA 4PF8A 2B3FA 5KCJB 3THIA 3JV9A 1RYOA 3S9EA 3MPLA 2RF1A 3T93B 4XKPA 1IEJA 1N76A 4GWWA 3PPNA 4U22A 5FHOA 4MEVA 2AIXA 1AOVA 2Q74A 4LONB 3TKDA 4NWDA 4F22A 1VDWA 3MUQA 3WAFA 4QSEA 4F1UA 2VPNA 4F1YA 5B7DA 4PTKA 2FIXA 4DXBA 5EQ7A 3U94A 3B50A 3MP8A 3C35A 1B6HA 1SYIA 3S9NC 1KZ8A 4RY1A 3P7IA 3QXMA 1MY1A 4PAIA 1JEVA 4ESXA 4PFUA 1XI6A 1LAXA 4IR8A 4NF5A 2UYFA 1K9ZA 2XA5A 1SD3A 3EKIA 1NV3A 3E3KA 3QAXA 1LCTA 3C33A 3H6VA 4XFEA 2BJJX 3MZBA 1IXGA 3WAEA 4OTEA 3R26A 1FCKA 4OVTA 2B4LA 3EHTA 1JW1A 4U4SA 2CMOA 1XVXA 3T66A 4I8CA 4MHFA 4N17A 3E9XA 3RT8A 5JK4A 1B2HA 3MW0A 4RK2A 2V3TA 1UQWA 4JWXA 1I6QA 4POWA 4Z0IA 4DXCA 2O6AA 3LSFB 4ECFA 3RYDA 1IMFA 2P1SA 1A40A 3EN3A 1DPEA 2OJTA 2CZHA 3U65A 4G68A 1GTKA 2YPNA 2QRYA 5EYGA 2OWSA 3UK4A 4YMBA 5DVFA 4LVQA 1A8EA 1QUKA 3A3CA 2F5XA 2ONKE 1B5JA 4HCWA 3TQWA 1LBBA 4FATA 3PGFA 4FEBA 3SEXA 2H5YA 1LBCA 4ELOA 5I58A 3IB2A 3PMWA 2Q89A 5AA1A 2Y7KA 3KSXA 2XXUA 4OEVA 3Q25A 3VDFA 1Y20A 2A5SA 3SDFA 3U72A 3FXUA 3FZVA 5L9MA 1ATGA 3USDA 1USYH 3H3GA 4MCOA 3HPIA 1S9TA 4L17A 1TXFA 3DP8A 3N94A 2REJA 3PTYA 1AMFA 3HHGA 3Q27A 5ELVA 2W7YA 5TPAB 3PUWE 4LZ8A 2NUVA 2Z8DA 5T3JA 3TCFA 2Q8MA 2DOJA 2ESNA 4DI4B 1JW5A 3B6TA 1II5A 4O7MA 2O84X 4GX6A 1N0TA 3LC8A 2PBWA 5HBCA 1USYE 4EQ9A 2UVHA 1MXUA 4GD5A 3QUFA 2CZIA 2F97A 4N4UA 1FQDA 4MNPA 4XKRA 4BDOA 1BP5A 4RJZA 3T96B 4QRZA 3TTLA 4YAHX 1MDQA 4QFOA 3TYHA 3PUVE 4JWYA 4NAPA 3PPOA 2H4IA 3CFXA 2P0SA 2XX9A 2F6GA 1QUJA 2WBDA 3I6VA 3K1NA 3KOSA 2F6PA 4F3GA 3MWBA 1MS7A 3H6WA 3K6XA 3DLNA 1P1OA 5I56A 4KYSA 2H98A 5DTBA 5EQ8A 3FUZA 1IZ1A 1FBCA 1NV0A 1URSA 3MC2A 4I40A 4OXVA 5CC2A 2ZMBA 3RPLA 3OSQA 4NF4A 1B4HA 4N81A 5JEIA 3G7WA 2R6GE 2D5WA 1MPCA 2O69A 1GGGA 4TLMB 3IFCA 3ONMA 2F34A 2FVZA 4HE0A 1CB6A 4OFOA 4FECA 4ONYA 4EF2A 3FVOA 4MLQA 4BDQA 4NX1A 3H6UA 2JJKA 4FEDA 2P3VA 3O6IA 4R75A 4QSCA 4X04A 4PFYA 3ILUB 2I48A 2UXAA 3IAZA 3IOUA 5CMMA 1M5EA 2RC7A 4NE4A 2QS1A 1NUWA 1OVTA 2YLNA 1I69A 2FA7A 2UVJA 5IZZA 2X26A 3KN8A 2BJIA 4EQBA 1A55A 3G3JA 1BK4A 2I0CA 4PCDA 3VFJA 2RCAA 1AIVA 4LZ5A 2QS4A 5I3SA 4H8JA 3JYRA 4G68B 2DE2A 4ISUA 1LB8A 3T9UA 3FGSA 4G68C 4IY5A 1PB9A 1PBPA 4LZ7A 4R74A 2PCRA 3KBRA 1SW2A 4YICA 4R72A 2ONRA 2I4CA 3K6WA 2VOZA 1IXHA 4EF1A 4G8NA 1RKMA 3S9MC 2OZZA 1I6AA 2F78A 1EZOA 1RDZA 1D9VA 4ZDMA 1LAGE 3CG1A 4ZE8A 3TCHA 3DM0A 1IMEA 1NV4A 4X1DA 5CMBA 1MM6A 4YKIA 1B0LA 4OVSA 3S4UA 4GXSB 4PDHA 4IB2A 1TWYA 2GHBA 1B9JA 3K6VA 4JVIA 1OVBA 3TODA 4FE8A 2XXTA 3I5OA 4YZZA 3IJOB 5CMCA 1M5BA 2HZLA 4RNSA 5ICTA 3IR1A 1B4ZA 5IM2A 3U1OA 5DVIA 2F3BA 3KSJA 3EHUA 5DT6A 2Y84A 2Y7IA 3FASA 4R6KA 2NVUB 4AB6A 5DEXB 3H06B 1XVYA 2D3IA 4PDDA 5F1QA 4HW8A 4JB7A 1G0IA 3JZJA 2QVUA 2I0BA 4UA8A 1LFHA 1SW4A 3M3LA 3OD7A 3TPAA 1US4A 3IO4A 4H46A 2PT1A 4THIA 4F18A 4OFLA 2RC8A 4PC9A 4G4PA 3A29A 2REGA 1YXIA 4U1ZA 3K1PA 1N84A 3CSBA 3V83A 1DTGA 5EQ9A 2QS2A 1YAEA 3G3GA 1FQEA 2DP8A 4EDPA 4R9GA 3KGCA 2UVGA 1D9YA 3PUZE 4ELQA 2V84A 4GWYA 3LSLA 3OXNA 5K2XA 5CBSA 1B40A 2HZKA 1MY4A 4RXLA 1SPIA 4Q5TA 1B0HA 3OO9A 1DBZA 3CG3A 3LUZA 2DQVA 3C36A 2LAOA 1MQIA 3TTRA 5K2YA 5KDTA 4QFPA 2UVIA 2Z22A 1GV8A 3FJMA 4H1XA 5TPAA 1LLSA 4P47A 1NUYA 1JNFA 4R6YA 4P9KA 5LOMA 4NF4B 1ZBMA 2QVRA 5L9SA 4PFIA 2ZYNA 3OENA 4HXVA 5HPQA 3HO7A 1M5CA 3SEYA 2O1MA 3TQLA 1KA1A 1OQGA 1TT1A 1NV5A 4ZEIA 4GWOA 4PBHA 1P1WA 5CMKA 1Z7NE 5H8NA 2M8CA 5ET8A 1NNTA 2AYSA 1LBYA 4N6KA 1BKAA 1N3WA 4MJOA 3E4RA 3N6TA 1FBPA 3KZGA 2XWOA 2QMWA 1P1NA 1PB7A 3EQ1A 5H8SA 4HTGA 1NNKA 4KD5A 1SQYA 2DWAA 1NV6A 4OA4A 4QFLA 1MXWA 1JP4A 1NFTA 4X9TA 1FPKA 4I62A 4YMAA 3EPEA 4H0WA 1UIVA 1F9BA 2HAVA 4MNCA 2ZZWA 4K3FA 4NF6A 4F3PA 2XXRA 4I1DA 3CFLA 4N13A 4O3CA 5M2VA 1B5HA 3FV2A 3IK6B 3O6GA 2XXIA 1MQJA 1VSOA 3G3IA 1CE2A 3N6UA 3L6HA 4GXAA 4F3SA 2YJPA 3MVYA 1MRPA 5FHMA 2B65A 4PFWA 3ZS6A 4BLAA 3FVGA 3RQTA 3IOVA 3V89B 1FJ9A 3H03A 1UTHA 1SDXA 5IZ1A 5LTCA 1NNPA 2Y5KA 5EHMA 1N3XA 2QVVA 4PF6A 4QSDA 3MYUA 1B5IA 2VT5A 1ANFA 1XOCA 1SYHA 4R2FA 3TTKA 1ELJA 1MH4A 3IB0A 3K00A 4P0IA 1LSTA 1NNFA 4G8MA 1POY1 5H8FA 1BIYA 4EXKA 3W15C 2WKYA 3M3KA 5JTYB 4TLLB 4NHBA 4Z7EA 1PB8A 3IO6A 5CI5A 5EHSA 2H99A 1Y9UA 1FW0A 4IO7A 1MQGA 4PAKA 2WYPA 2H25A 3M3FA 2PFZA 3GBAA 1Y1MA 4I3YA 3RGYA 5FTIA 1QJMA 5IAIA 1IIWA 4C1TA 2ZYMA 4KFQA 1DPPA 3QIMA 2Q8JA 1JETA 4RYAA 1MXZA 3KC1A 1FRPA 4OENA 3VLVA 1NV7A 4F2OA 4MF3A 2XX7A 4GLIA 3IL1B 2I6EA 5KDTB 2F7BA 2ZYKA 2R8TA 1QULA 1MM7A 3TMGA 1UTBA 2Z8FA 4OQOA 2L5VA 1B7ZA 5A5XA 4U21A 2Y7WA 5DEXA 3TCGA 1FBFA 2R71A 1A54A 1HSLA 1FBHA 3FXQA 4IO6A 1EH3A 4G2ZA 4MLVA 2VD2A 4U23A 2AL4A 3MZ9A 3SETA 3VXBA 4QFNA 1H43A 4PBQA 4WKMA 3SKPA 2OWTA 5ICQA 1FPBA 2PVUA 4I9DA 1M5FA 3FXRA 1ZMGA 4LATA 1OMPA 4QBAA 5H8NB 4G77A 3VE1B 4OMBA 1A8FA 1NH7A 1B7HA 3RLFE 3OSRA 4PP0A 4ZEFA 2IA4A 4GX3A 3OEMA 4MIJA 3LBSA 2ZZXA 5DVJA 1ZJLA 2ABHA 3MVWA 2HHMA 1H45A 4WXJA 3HN0A 3MSTA 2I58A 2XXVA 4RK9A 4RPNA 3A09A 3UORA 3IOTA 5I5PA 1B52A 1MXYA 4GL0A 1YPNA 3M8UA 1AL3A 4WEDA 1LGBC 2OX3A 4FJPA 4OVRA 1O7TA 3IJXB 3ILTB 4I3EA 2B3BA 3QYTA 2E1SA 1L5TA 4KYEA 3C9HA 4X48A 2V4CA 4KHZE 1MY2A 1LAHE 3B7DA 4NF6B 4N8YA 3TTMA 1K9YA 5A5LA 2F7CA 2F8DA 3HFUA 3LV0A 3C31A 1XC1A 4F39A 2QJEA 3K1MA 4FBPA 2O1LA 4HCYA 2DYXA 2DWIA 1IMAA 4OETA 2QFLA 1MXXA 1DTZA 3GBBA 3O28A 3Q28A 3HCQA 1WDNA 3FXBA 1NV1A 3SESA 3IFAA 1O64A 3T0JA 4ELRA 4XEQA 3EHSA 5IGAA 2Y7RA 1FTAA 3VVDA 1UTHB 3K0VA 4P11A 1M5DA 1FQFA 2UYEA 3G3FA 1CNQA 3FJGA 1FTLA 4FORA 4YKPA 4IO2A 1R6ZA 4OVPA 4PAFA 3OOAA 4P8BA 2RINA 1B3FA 4H5GA 1RYXA 1FTKA 4LA9A 5BWJA 1QKAA 2PX1A 1B3GA 3V8XB 1P1UA 4C0RA 3PUXE 2I49A 5EYHA 1QUIA 1XHYA 4N6PA 5H8FB 1TFDA 1YTVA 5AA3A 4NF8A 4HE1A 2G93A 2DDKA 3U92A 3GLBA 3BFUA 4H8IA 3RPWA 3L6GA 4H5FA 4GRKA 1XT8A 3DELB 5FTHA 4FIMA 3D4GA 1FTMA 3ZKLA 5AA2D 4ESWA 4ZEKA 3O9PA 5CM6A
chains in the Genus database with same CATH topology
3SEUA 5TP9A 1EZ9A 2RCBA 3TDJA 4BDRA 3N5LA 1Q35A 3CRBA 4OFJA 1IUDA 4NTLA 4XTCQ 4BDMA 1Z7ME 4JSDA 3O29A 2QPQA 1ZKBA 1UTBB 5A5XB 3SEVA 4OZ9A 5HM4B 3HV1A 3IOWA 5ISUA 1MH3A 4U2RA 2RC9A 3QSLA 4QF9A 2P2AA 5F7VA 2GFEA 2ZYOA 2O7IA 1R9QA 4R2BA 1MG1A 5JTYA 4OVJA 3U8QA 5BUUA 3G3KA 5I59B 2DWHA 2DS9A 3F11A 2ALUA 1JVXA 3AXFA 4YB6A 1P99A 4F2QA 2R9JA 3R7XA 2HFBA 3TAJA 1VE4A 3T9XB 3VVEA 4XKQA 2F36A 3TELA 3FVKA 4H65A 1B3HA 4NMYA 3V5AA 3RUMA 4LP2B 4KR5A 1S7YA 4F19A 4ZE9A 3I3VA 1JEUA 3K6UA 2DVZA 5EYFA 2Q9TA 1MPDA 3CIJA 1JW4A 5H8HB 4F1VA 4DZ1A 1XS5A 1R9LA 3PD9A 4PQJA 5L8DA 5J1DA 4KPTA 4Q8RA 4LUBA 4IY6A 1SW1A 2OK2A 3QK6A 5IKBA 1LFIA 2Z23A 2XXXA 4TOZA 3ECRA 1ZTYA 2NWJA 1HSEA 4U4XA 1IXIA 2XD3A 2V93A 3MVXA 4IGTA 3PMXA 1HSJA 5KZTA 3CR9A 1IXCA 2Q2CA 2O51A 2V3UA 2VHAA 3TTNA 2ZXTA 3RN8A 1WODA 2ZNUA 4ZEBA 4NF8B 3MVZA 1B32A 3DP4A 1AH5A 4EQ7A 4E0WA 1FQCA 5I57A 2H9BA 3Q26A 1ZLQA 4C1UA 1PC3A 3CSGA 5I2NA 5TP9B 1FTJA 2F7AA 1B46A 3MPKA 3OO6A 1DMBA 3LSXA 3OMBA 5ITPA 4ELPA 4MBPA 1ZU0A 1MY3A 3MBPA 3A3UA 2XXWA 3SEWA 3PUYE 1O63A 1B1HA 3K02A 4R73A 2NOOA 5H8QA 5DYHA 1JVYA 4OESA 3K4UA 4YKJA 3O66A 4POXA 2DXYA 4OWDA 2D21A 2F35A 2DSFA 3PMVA 1B7UA 2ANJA 4DCYA 3IX1A 1N7WA 4E0XA 2XXYA 3UIFA 3OEKA 1B58A 2XD2A 4GFRA 1MQHA 3G3HA 5AA2A 5AA4A 2HQ0A 5CBRA 2XXPA 1US5A 3E13X 3RTWB 1UIUA 4U1OA 2Y7PA 2QS3A 4KI0E 2XXHA 3TUSA 3N26A 1D3KA 3LSWA 4XIGQ 1T0KA 4R9FA 1Y3PA 3KFMA 1IQ7A 3OO8A 3UA8A 4HS7A 2G29A 3MAMA 2ONSA 1QW0A 2I3VA 3FJ7A 2GH9A 1ZIUA 2VD3A 4F3BA 2QL3A 4GF8A 2ZNSA 2I4BA 1TFAA 4IO3A 4NWCA 2GRVA 1FTOA 3H6TA 2XX8A 3DP6A 4BDLA 1DOTA 2DE4A 3D4CA 4TQUQ 5L9OA 1SVXB 2V25A 1FQBA 3T9VA 4O3BA 1Y1ZA 1A99A 2RKMA 4R6HA 2X7QA 1OLAA 3H7MA 3K01A 3CVGA 1B1XA 2OBGA 1EU8A 3PPRA 4G8HA 3KJTA 1Y4CA 3FVNA 1OLCA 4OEUA 4KCCA 5I59A 3O97A 5FHNA 1GR2A 4DLDA 2GHAA 3RY3A 3LUYA 3FIRA 3KN3A 3Q29A 2HAUA 2Z8EA 1H76A 4NEDA 1LFGA 1Y4TA 2O68A 5I2KA 2AL5A 1NL5A 3SERA 4ZECA 3BKIB 1J1NA 2XHDA 4XKNA 1Y3QA 1VFEA 3O6HA 3PD8A 3O2AA 1PDAA 1DSNA 3IORA 4AQ4A 4YB7A 2FNCA 5ITOA 4PFTA 5I57B 1GVCA 3VV5A 3VVFA 1MXVA 1OQHA 3RT6B 3VLUA 4BDNA 1B3LA 3HSTA 2PYYA 4QFKA 5H8HA 3BFTA 4ZEDA 3RNNA 1B3EA 5I2NB 3UN6A 2O7UA 1N7XA 3S2VA 1SBPA 1H44A 4M1VA 1POTA 3H4ZA 2THIA 5CRYA 3TZAA 5B70A 3PPQA 2OLBA 2VGQA 3C32A 2A5TA 1MPBA 4NF5B 3FATA 3K2DA 5H8QB 4XXUA 3T22A 4DXUA 4WEPA 4H6DA 4JBZA 2PT2A 1MQDA 3KEIA 3W9WA 4GOTA 4IGRA 2I3WA 4N07A 4AB5A 1QKBA 2E0SA 1H3DA 1OIBA 1S50A 1I6BA 4JSOA 1BTJA 4IO4A 4DDDA 3U93A 4KQPA 5KCJA 4ZZAA 3CI8A 5AA2B 5AA4B 3ZKKA 4DE8A 1PEBA 2Q88A 3PPPA 4MH5A 4OERA 3C4MA 2DE3A 4PETA 4RPOA 2Q2AA 2CZLA 3MZ1A 2PMSA 2X7PA 4YB5A 4Q30B 2HXWA 2NXOA 4UACA 3C34A 3B6WA 2DVCA 4GQOA 4JWOA 3KN7A 1SI0A 1Q1KA 4P0GA 5I58B 3BBRA 1URDA 1MDP1 3PV0E 4GL8A 4YU0A 4MFIA 4GIZA 5TU0A 4RA1A 4EXLA 1B51A 4IO5A 1PBQA 3MQ9A 1B05A 3ZSFA 1VR5A 4EUOA 4KYDA 4QHQA 3B6QA 4LQ5A 1LCFA 2QSXA 1VFDA 1N04A 4FAJA 3EF7A 1FQAA 1P1QA 2HEUA 4M4GA 4PE5B 3W9VA 3GXAA 4DCXA 3OO7A 3KJ7A 3MJNA 4F31B 3FD3A 2IEEA 3FV1A 1R1NA 1LB9A 1MY0A 1EZPA 4F29A 1NMUA 3KOTA 3VXCA 1KWHA 3MP1A 5I2KB 1Y3NA 1IITA 3VLWA 3S9LC 1BLFA 3HHFA 2VP1A 1NKXA 4ND9A 3IB1A 1QVSA 3KG2A 4JDFA 5I56B 1YCJA 4DIGA 4LQ2A 5I84A 5AE4A 2ZNTA 3UP9A 4X1BA 2KLFA 1NH8A 3OELA 2V3QA 4Q0CA 1URGA 3PU5A 1A7LA 3MP6A 4ZZEA 3UGWA 3R6UA 3QUJA 3CFZA 1SW5A 1JQFA 2XXQA 2A5TB 1WVJA 2QMXA 2DXRA 3TEPA 2OCUA 1LAFE 3T9HB 4ZS9A 4OHNA 2FYIA 3ODBA 3RTFB 4H67A 2DWJA 2HCAA 1D4NA 4YKKA 1SI1A 4KCDA 3TFLA 3GZGA 3LR1A 4O3AA 4OYVA 4JXIA 4GVOA 2B3FA 5KCJB 3THIA 3JV9A 1RYOA 3S9EA 3MPLA 2RF1A 3T93B 4XKPA 1IEJA 1N76A 3PPNA 4U22A 5FHOA 2AIXA 1AOVA 4LONB 3TKDA 4NWDA 4F22A 3MUQA 3WAFA 4F1UA 4QSEA 4F1YA 5B7DA 4DXBA 3U94A 3MP8A 3C35A 1B6HA 1SYIA 3S9NC 4RY1A 3P7IA 3QXMA 1MY1A 1JEVA 4ESXA 4PFUA 1LAXA 4NF5A 2UYFA 1SD3A 3E3KA 3QAXA 1LCTA 3C33A 3H6VA 2BJJX 3MZBA 1IXGA 3WAEA 4OTEA 3R26A 1FCKA 3EHTA 1JW1A 4U4SA 2CMOA 1XVXA 3T66A 4I8CA 3E9XA 3RT8A 5JK4A 1B2HA 3MW0A 4RK2A 2V3TA 1UQWA 4JWXA 1I6QA 4POWA 4Z0IA 4DXCA 2O6AA 3LSFB 4ECFA 2P1SA 1A40A 3EN3A 1DPEA 2OJTA 4G68A 1GTKA 2YPNA 2QRYA 2OWSA 3UK4A 4YMBA 5DVFA 4LVQA 1A8EA 1QUKA 3A3CA 2F5XA 2ONKE 1B5JA 4HCWA 3TQWA 1LBBA 4FATA 3PGFA 4FEBA 3SEXA 2H5YA 1LBCA 4ELOA 5I58A 3IB2A 3PMWA 2Q89A 5AA1A 2Y7KA 3KSXA 2XXUA 4OEVA 3Q25A 3VDFA 1Y20A 2A5SA 3SDFA 3U72A 3FXUA 3FZVA 5L9MA 1ATGA 3USDA 1USYH 3H3GA 3HPIA 1S9TA 4L17A 1TXFA 3DP8A 3N94A 2REJA 1AMFA 3HHGA 3Q27A 5ELVA 2W7YA 5TPAB 3PUWE 4LZ8A 2NUVA 2Z8DA 3TCFA 2DOJA 2ESNA 1JW5A 3B6TA 1II5A 2O84X 1N0TA 3LC8A 2PBWA 5HBCA 1USYE 4EQ9A 2UVHA 1MXUA 4GD5A 3QUFA 2F97A 1FQDA 4XKRA 4BDOA 1BP5A 4RJZA 3T96B 4QRZA 3TTLA 4YAHX 1MDQA 4QFOA 3TYHA 3PUVE 4JWYA 3PPOA 2H4IA 3CFXA 2P0SA 2XX9A 2F6GA 1QUJA 3I6VA 3K1NA 3KOSA 2F6PA 4F3GA 3MWBA 1MS7A 3H6WA 3K6XA 3DLNA 1P1OA 5I56A 4KYSA 2H98A 5DTBA 3FUZA 1IZ1A 1URSA 3MC2A 4OXVA 5CC2A 2ZMBA 3OSQA 4NF4A 1B4HA 5JEIA 3G7WA 2R6GE 2D5WA 1MPCA 2O69A 1GGGA 4TLMB 3ONMA 2F34A 1CB6A 4OFOA 4FECA 4ONYA 4EF2A 3FVOA 4MLQA 4BDQA 3H6UA 4FEDA 3O6IA 4R75A 4QSCA 4PFYA 3ILUB 2I48A 2UXAA 3IAZA 3IOUA 5CMMA 1M5EA 2RC7A 4NE4A 2QS1A 1OVTA 2YLNA 1I69A 2FA7A 2UVJA 2X26A 3KN8A 4EQBA 1A55A 3G3JA 2I0CA 3VFJA 2RCAA 1AIVA 4LZ5A 2QS4A 4H8JA 3JYRA 4G68B 2DE2A 4ISUA 1LB8A 3T9UA 3FGSA 4G68C 4IY5A 1PB9A 1PBPA 4LZ7A 4R74A 3KBRA 1SW2A 4YICA 4R72A 2ONRA 2I4CA 3K6WA 2VOZA 1IXHA 4EF1A 4G8NA 1RKMA 3S9MC 2OZZA 1I6AA 2F78A 1EZOA 4ZDMA 1D9VA 1LAGE 3CG1A 4ZE8A 3TCHA 3DM0A 4X1DA 5CMBA 1MM6A 4YKIA 1B0LA 3S4UA 4GXSB 1TWYA 4IB2A 2GHBA 1B9JA 3K6VA 1OVBA 3TODA 4FE8A 2XXTA 3I5OA 4YZZA 3IJOB 5CMCA 1M5BA 2HZLA 4RNSA 5ICTA 3IR1A 1B4ZA 3U1OA 5DVIA 3KSJA 3EHUA 5DT6A 2Y84A 2Y7IA 3FASA 4R6KA 2NVUB 4AB6A 5DEXB 3H06B 1XVYA 2D3IA 5F1QA 4HW8A 4JB7A 3JZJA 2I0BA 4UA8A 1LFHA 1SW4A 3M3LA 3OD7A 3TPAA 1US4A 3IO4A 2PT1A 4THIA 4F18A 4OFLA 2RC8A 4G4PA 2REGA 4U1ZA 3K1PA 1N84A 3CSBA 3V83A 1DTGA 2QS2A 1YAEA 3G3GA 1FQEA 2DP8A 4EDPA 4R9GA 3KGCA 2UVGA 1D9YA 3PUZE 4ELQA 2V84A 3LSLA 3OXNA 5K2XA 5CBSA 1B40A 2HZKA 1MY4A 4RXLA 4Q5TA 1B0HA 3OO9A 3CG3A 2DQVA 3C36A 2LAOA 1MQIA 3TTRA 5K2YA 5KDTA 4QFPA 2UVIA 2Z22A 1GV8A 3FJMA 4H1XA 5TPAA 1LLSA 4R6YA 1JNFA 5LOMA 4NF4B 1ZBMA 5L9SA 2ZYNA 3OENA 5HPQA 3HO7A 1M5CA 3SEYA 2O1MA 3TQLA 1OQGA 1TT1A 4ZEIA 4GWOA 1P1WA 5CMKA 1Z7NE 5H8NA 2M8CA 1NNTA 2AYSA 1BKAA 1N3WA 3E4RA 3N6TA 3KZGA 2QMWA 1P1NA 1PB7A 3EQ1A 5H8SA 4HTGA 1NNKA 4KD5A 1SQYA 2DWAA 4QFLA 1MXWA 1NFTA 4X9TA 4I62A 4YMAA 3EPEA 4H0WA 1UIVA 1F9BA 2HAVA 4K3FA 4NF6A 4F3PA 2XXRA 4I1DA 3CFLA 4N13A 4O3CA 5M2VA 1B5HA 3FV2A 3IK6B 3O6GA 2XXIA 1MQJA 1VSOA 3G3IA 1CE2A 3N6UA 3L6HA 4GXAA 4F3SA 2YJPA 3MVYA 1MRPA 5FHMA 2B65A 4PFWA 3ZS6A 4BLAA 3FVGA 3RQTA 3IOVA 3V89B 3H03A 1UTHA 1SDXA 1NNPA 5EHMA 1N3XA 4QSDA 1B5IA 1ANFA 1XOCA 1SYHA 4R2FA 3TTKA 1ELJA 1MH4A 3IB0A 3K00A 4P0IA 1LSTA 1NNFA 4G8MA 1POY1 5H8FA 1BIYA 4EXKA 3W15C 2WKYA 3M3KA 5JTYB 4TLLB 4Z7EA 1PB8A 3IO6A 5CI5A 5EHSA 2H99A 1Y9UA 1FW0A 4IO7A 1MQGA 2H25A 3M3FA 3GBAA 1Y1MA 3RGYA 5FTIA 1QJMA 5IAIA 1IIWA 4C1TA 2ZYMA 4KFQA 1DPPA 3QIMA 2Q8JA 1JETA 4RYAA 1MXZA 4OENA 3VLVA 4F2OA 4MF3A 2XX7A 4GLIA 3IL1B 2I6EA 5KDTB 2F7BA 2ZYKA 1QULA 1MM7A 3TMGA 1UTBA 2Z8FA 4OQOA 1B7ZA 5A5XA 4U21A 2Y7WA 5DEXA 3TCGA 2R71A 1A54A 1HSLA 3FXQA 4IO6A 1EH3A 4G2ZA 4MLVA 2VD2A 4U23A 2AL4A 3MZ9A 3SETA 3VXBA 4QFNA 1H43A 4WKMA 3SKPA 2OWTA 5ICQA 2PVUA 4I9DA 1M5FA 3FXRA 1ZMGA 4LATA 1OMPA 5H8NB 4G77A 3VE1B 4OMBA 1A8FA 1NH7A 1B7HA 3RLFE 3OSRA 4ZEFA 4PP0A 2IA4A 3OEMA 3LBSA 5DVJA 1ZJLA 2ABHA 3MVWA 1H45A 4WXJA 3HN0A 2I58A 2XXVA 4RK9A 4RPNA 3UORA 3A09A 3IOTA 1B52A 1MXYA 4GL0A 1YPNA 3M8UA 1AL3A 4WEDA 1LGBC 4FJPA 1O7TA 3IJXB 3ILTB 2B3BA 3QYTA 2E1SA 1L5TA 4KYEA 3C9HA 4X48A 4KHZE 1MY2A 1LAHE 3B7DA 4NF6B 3TTMA 2F7CA 2F8DA 3C31A 1XC1A 4F39A 2QJEA 3K1MA 2O1LA 4HCYA 2DYXA 2DWIA 4OETA 1MXXA 1DTZA 3GBBA 3O28A 3Q28A 3HCQA 1WDNA 3SESA 1O64A 4ELRA 3EHSA 2Y7RA 3VVDA 1UTHB 3K0VA 4P11A 1M5DA 1FQFA 2UYEA 3G3FA 3FJGA 1FTLA 4FORA 4YKPA 4IO2A 1R6ZA 3OOAA 2RINA 1B3FA 4H5GA 1RYXA 1FTKA 4LA9A 5BWJA 1QKAA 2PX1A 1B3GA 3V8XB 1P1UA 4C0RA 3PUXE 2I49A 1QUIA 1XHYA 4N6PA 5H8FB 1TFDA 1YTVA 5AA3A 4NF8A 2G93A 3U92A 3GLBA 3BFUA 4H8IA 3RPWA 3L6GA 4H5FA 4GRKA 1XT8A 3DELB 5FTHA 4FIMA 3D4GA 1FTMA 3ZKLA 5AA2D 4ESWA 4ZEKA 3O9PA 5CM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEU A;  5TP9 A;  1EZ9 A;  2RCB A;  3TDJ A;  4BDR A;  3N5L A;  1Q35 A;  3CRB A;  4OFJ A;  1IUD A;  4NTL A;  4XTC Q;  4BDM A;  1Z7M E;  4JSD A;  3O29 A;  2QPQ A;  1ZKB A;  1UTB B;  5A5X B;  3SEV A;  4OZ9 A;  5HM4 B;  3HV1 A;  3IOW A;  5ISU A;  1MH3 A;  4U2R A;  2RC9 A;  3QSL A;  4QF9 A;  2P2A A;  5F7V A;  2GFE A;  2ZYO A;  2O7I A;  1R9Q A;  4R2B A;  1MG1 A;  5JTY A;  4OVJ A;  3U8Q A;  5BUU A;  3G3K A;  5I59 B;  2DWH A;  2DS9 A;  3F11 A;  2ALU A;  1JVX A;  3AXF A;  4YB6 A;  1P99 A;  4F2Q A;  2R9J A;  3R7X A;  2HFB A;  3TAJ A;  1VE4 A;  3T9X B;  3VVE A;  4XKQ A;  2F36 A;  3TEL A;  3FVK A;  4H65 A;  1B3H A;  4NMY A;  3V5A A;  3RUM A;  4LP2 B;  4KR5 A;  1S7Y A;  4F19 A;  4ZE9 A;  3I3V A;  1JEU A;  3K6U A;  2DVZ A;  5EYF A;  2Q9T A;  1MPD A;  3CIJ A;  1JW4 A;  5H8H B;  4F1V A;  4DZ1 A;  1XS5 A;  1R9L A;  3PD9 A;  4PQJ A;  5L8D A;  5J1D A;  4KPT A;  4Q8R A;  4LUB A;  4IY6 A;  1SW1 A;  2OK2 A;  3QK6 A;  5IKB A;  1LFI A;  2Z23 A;  2XXX A;  4TOZ A;  3ECR A;  1ZTY A;  2NWJ A;  1HSE A;  4U4X A;  1IXI A;  2XD3 A;  2V93 A;  3MVX A;  4IGT A;  3PMX A;  1HSJ A;  5KZT A;  3CR9 A;  1IXC A;  2Q2C A;  2O51 A;  2V3U A;  2VHA A;  3TTN A;  2ZXT A;  3RN8 A;  1WOD A;  2ZNU A;  4ZEB A;  4NF8 B;  3MVZ A;  1B32 A;  3DP4 A;  1AH5 A;  4EQ7 A;  4E0W A;  1FQC A;  5I57 A;  2H9B A;  3Q26 A;  1ZLQ A;  4C1U A;  1PC3 A;  3CSG A;  5I2N A;  5TP9 B;  1FTJ A;  2F7A A;  1B46 A;  3MPK A;  3OO6 A;  1DMB A;  3LSX A;  3OMB A;  5ITP A;  4ELP A;  4MBP A;  1ZU0 A;  1MY3 A;  3MBP A;  3A3U A;  2XXW A;  3SEW A;  3PUY E;  1O63 A;  1B1H A;  3K02 A;  4R73 A;  2NOO A;  5H8Q A;  5DYH A;  1JVY A;  4OES A;  3K4U A;  4YKJ A;  3O66 A;  4POX A;  2DXY A;  4OWD A;  2D21 A;  2F35 A;  2DSF A;  3PMV A;  1B7U A;  2ANJ A;  4DCY A;  3IX1 A;  1N7W A;  4E0X A;  2XXY A;  3UIF A;  3OEK A;  1B58 A;  2XD2 A;  4GFR A;  1MQH A;  3G3H A;  5AA2 A;  5AA4 A;  2HQ0 A;  5CBR A;  2XXP A;  1US5 A;  3E13 X;  3RTW B;  1UIU A;  4U1O A;  2Y7P A;  2QS3 A;  4KI0 E;  2XXH A;  3TUS A;  3N26 A;  1D3K A;  3LSW A;  4XIG Q;  1T0K A;  4R9F A;  1Y3P A;  3KFM A;  1IQ7 A;  3OO8 A;  3UA8 A;  4HS7 A;  2G29 A;  3MAM A;  2ONS A;  1QW0 A;  2I3V A;  3FJ7 A;  2GH9 A;  1ZIU A;  2VD3 A;  4F3B A;  2QL3 A;  4GF8 A;  2ZNS A;  2I4B A;  1TFA A;  4IO3 A;  4NWC A;  2GRV A;  1FTO A;  3H6T A;  2XX8 A;  3DP6 A;  4BDL A;  1DOT A;  2DE4 A;  3D4C A;  4TQU Q;  5L9O A;  1SVX B;  2V25 A;  1FQB A;  3T9V A;  4O3B A;  1Y1Z A;  1A99 A;  2RKM A;  4R6H A;  2X7Q A;  1OLA A;  3H7M A;  3K01 A;  3CVG A;  1B1X A;  2OBG A;  1EU8 A;  3PPR A;  4G8H A;  3KJT A;  1Y4C A;  3FVN A;  1OLC A;  4OEU A;  4KCC A;  5I59 A;  3O97 A;  5FHN A;  1GR2 A;  4DLD A;  2GHA A;  3RY3 A;  3LUY A;  3FIR A;  3KN3 A;  3Q29 A;  2HAU A;  2Z8E A;  1H76 A;  4NED A;  1LFG A;  1Y4T A;  2O68 A;  5I2K A;  2AL5 A;  1NL5 A;  3SER A;  4ZEC A;  3BKI B;  1J1N A;  2XHD A;  4XKN A;  1Y3Q A;  1VFE A;  3O6H A;  3PD8 A;  3O2A A;  1PDA A;  1DSN A;  3IOR A;  4AQ4 A;  4YB7 A;  2FNC A;  5ITO A;  4PFT A;  5I57 B;  1GVC A;  3VV5 A;  3VVF A;  1MXV A;  1OQH A;  3RT6 B;  3VLU A;  4BDN A;  1B3L A;  3HST A;  2PYY A;  4QFK A;  5H8H A;  3BFT A;  4ZED A;  3RNN A;  1B3E A;  5I2N B;  3UN6 A;  2O7U A;  1N7X A;  3S2V A;  1SBP A;  1H44 A;  4M1V A;  1POT A;  3H4Z A;  2THI A;  5CRY A;  3TZA A;  5B70 A;  3PPQ A;  2OLB A;  2VGQ A;  3C32 A;  2A5T A;  1MPB A;  4NF5 B;  3FAT A;  3K2D A;  5H8Q B;  4XXU A;  3T22 A;  4DXU A;  4WEP A;  4H6D A;  4JBZ A;  2PT2 A;  1MQD A;  3KEI A;  3W9W A;  4GOT A;  4IGR A;  2I3W A;  4N07 A;  4AB5 A;  1QKB A;  2E0S A;  1H3D A;  1OIB A;  1S50 A;  1I6B A;  4JSO A;  1BTJ A;  4IO4 A;  4DDD A;  3U93 A;  4KQP A;  5KCJ A;  4ZZA A;  3CI8 A;  5AA2 B;  5AA4 B;  3ZKK A;  4DE8 A;  1PEB A;  2Q88 A;  3PPP A;  4MH5 A;  4OER A;  3C4M A;  2DE3 A;  4PET A;  4RPO A;  2Q2A A;  2CZL A;  3MZ1 A;  2PMS A;  2X7P A;  4YB5 A;  4Q30 B;  2HXW A;  2NXO A;  4UAC A;  3C34 A;  3B6W A;  2DVC A;  4GQO A;  4JWO A;  3KN7 A;  1SI0 A;  1Q1K A;  4P0G A;  5I58 B;  3BBR A;  1URD A;  1MDP 1;  3PV0 E;  4GL8 A;  4YU0 A;  4MFI A;  4GIZ A;  5TU0 A;  4RA1 A;  4EXL A;  1B51 A;  4IO5 A;  1PBQ A;  3MQ9 A;  1B05 A;  3ZSF A;  1VR5 A;  4EUO A;  4KYD A;  4QHQ A;  3B6Q A;  4LQ5 A;  1LCF A;  2QSX A;  1VFD A;  1N04 A;  4FAJ A;  3EF7 A;  1FQA A;  1P1Q A;  2HEU A;  4M4G A;  4PE5 B;  3W9V A;  3GXA A;  4DCX A;  3OO7 A;  3KJ7 A;  3MJN A;  4F31 B;  3FD3 A;  2IEE A;  3FV1 A;  1R1N A;  1LB9 A;  1MY0 A;  1EZP A;  4F29 A;  1NMU A;  3KOT A;  3VXC A;  1KWH A;  3MP1 A;  5I2K B;  1Y3N A;  1IIT A;  3VLW A;  3S9L C;  1BLF A;  3HHF A;  2VP1 A;  1NKX A;  4ND9 A;  3IB1 A;  1QVS A;  3KG2 A;  4JDF A;  5I56 B;  1YCJ A;  4DIG A;  4LQ2 A;  5I84 A;  5AE4 A;  2ZNT A;  3UP9 A;  4X1B A;  2KLF A;  1NH8 A;  3OEL A;  2V3Q A;  4Q0C A;  1URG A;  3PU5 A;  1A7L A;  3MP6 A;  4ZZE A;  3UGW A;  3R6U A;  3QUJ A;  3CFZ A;  1SW5 A;  1JQF A;  2XXQ A;  2A5T B;  1WVJ A;  2QMX A;  2DXR A;  3TEP A;  2OCU A;  1LAF E;  3T9H B;  4ZS9 A;  4OHN A;  2FYI A;  3ODB A;  3RTF B;  4H67 A;  2DWJ A;  2HCA A;  1D4N A;  4YKK A;  1SI1 A;  4KCD A;  3TFL A;  3GZG A;  3LR1 A;  4O3A A;  4OYV A;  4JXI A;  4GVO A;  2B3F A;  5KCJ B;  3THI A;  3JV9 A;  1RYO A;  3S9E A;  3MPL A;  2RF1 A;  3T93 B;  4XKP A;  1IEJ A;  1N76 A;  3PPN A;  4U22 A;  5FHO A;  2AIX A;  1AOV A;  4LON B;  3TKD A;  4NWD A;  4F22 A;  3MUQ A;  3WAF A;  4F1U A;  4QSE A;  4F1Y A;  5B7D A;  4DXB A;  3U94 A;  3MP8 A;  3C35 A;  1B6H A;  1SYI A;  3S9N C;  4RY1 A;  3P7I A;  3QXM A;  1MY1 A;  1JEV A;  4ESX A;  4PFU A;  1LAX A;  4NF5 A;  2UYF A;  1SD3 A;  3E3K A;  3QAX A;  1LCT A;  3C33 A;  3H6V A;  2BJJ X;  3MZB A;  1IXG A;  3WAE A;  4OTE A;  3R26 A;  1FCK A;  3EHT A;  1JW1 A;  4U4S A;  2CMO A;  1XVX A;  3T66 A;  4I8C A;  3E9X A;  3RT8 A;  5JK4 A;  1B2H A;  3MW0 A;  4RK2 A;  2V3T A;  1UQW A;  4JWX A;  1I6Q A;  4POW A;  4Z0I A;  4DXC A;  2O6A A;  3LSF B;  4ECF A;  2P1S A;  1A40 A;  3EN3 A;  1DPE A;  2OJT A;  4G68 A;  1GTK A;  2YPN A;  2QRY A;  2OWS A;  3UK4 A;  4YMB A;  5DVF A;  4LVQ A;  1A8E A;  1QUK A;  3A3C A;  2F5X A;  2ONK E;  1B5J A;  4HCW A;  3TQW A;  1LBB A;  4FAT A;  3PGF A;  4FEB A;  3SEX A;  2H5Y A;  1LBC A;  4ELO A;  5I58 A;  3IB2 A;  3PMW A;  2Q89 A;  5AA1 A;  2Y7K A;  3KSX A;  2XXU A;  4OEV A;  3Q25 A;  3VDF A;  1Y20 A;  2A5S A;  3SDF A;  3U72 A;  3FXU A;  3FZV A;  5L9M A;  1ATG A;  3USD A;  1USY H;  3H3G A;  3HPI A;  1S9T A;  4L17 A;  1TXF A;  3DP8 A;  3N94 A;  2REJ A;  1AMF A;  3HHG A;  3Q27 A;  5ELV A;  2W7Y A;  5TPA B;  3PUW E;  4LZ8 A;  2NUV A;  2Z8D A;  3TCF A;  2DOJ A;  2ESN A;  1JW5 A;  3B6T A;  1II5 A;  2O84 X;  1N0T A;  3LC8 A;  2PBW A;  5HBC A;  1USY E;  4EQ9 A;  2UVH A;  1MXU A;  4GD5 A;  3QUF A;  2F97 A;  1FQD A;  4XKR A;  4BDO A;  1BP5 A;  4RJZ A;  3T96 B;  4QRZ A;  3TTL A;  4YAH X;  1MDQ A;  4QFO A;  3TYH A;  3PUV E;  4JWY A;  3PPO A;  2H4I A;  3CFX A;  2P0S A;  2XX9 A;  2F6G A;  1QUJ A;  3I6V A;  3K1N A;  3KOS A;  2F6P A;  4F3G A;  3MWB A;  1MS7 A;  3H6W A;  3K6X A;  3DLN A;  1P1O A;  5I56 A;  4KYS A;  2H98 A;  5DTB A;  3FUZ A;  1IZ1 A;  1URS A;  3MC2 A;  4OXV A;  5CC2 A;  2ZMB A;  3OSQ A;  4NF4 A;  1B4H A;  5JEI A;  3G7W A;  2R6G E;  2D5W A;  1MPC A;  2O69 A;  1GGG A;  4TLM B;  3ONM A;  2F34 A;  1CB6 A;  4OFO A;  4FEC A;  4ONY A;  4EF2 A;  3FVO A;  4MLQ A;  4BDQ A;  3H6U A;  4FED A;  3O6I A;  4R75 A;  4QSC A;  4PFY A;  3ILU B;  2I48 A;  2UXA A;  3IAZ A;  3IOU A;  5CMM A;  1M5E A;  2RC7 A;  4NE4 A;  2QS1 A;  1OVT A;  2YLN A;  1I69 A;  2FA7 A;  2UVJ A;  2X26 A;  3KN8 A;  4EQB A;  1A55 A;  3G3J A;  2I0C A;  3VFJ A;  2RCA A;  1AIV A;  4LZ5 A;  2QS4 A;  4H8J A;  3JYR A;  4G68 B;  2DE2 A;  4ISU A;  1LB8 A;  3T9U A;  3FGS A;  4G68 C;  4IY5 A;  1PB9 A;  1PBP A;  4LZ7 A;  4R74 A;  3KBR A;  1SW2 A;  4YIC A;  4R72 A;  2ONR A;  2I4C A;  3K6W A;  2VOZ A;  1IXH A;  4EF1 A;  4G8N A;  1RKM A;  3S9M C;  2OZZ A;  1I6A A;  2F78 A;  1EZO A;  4ZDM A;  1D9V A;  1LAG E;  3CG1 A;  4ZE8 A;  3TCH A;  3DM0 A;  4X1D A;  5CMB A;  1MM6 A;  4YKI A;  1B0L A;  3S4U A;  4GXS B;  1TWY A;  4IB2 A;  2GHB A;  1B9J A;  3K6V A;  1OVB A;  3TOD A;  4FE8 A;  2XXT A;  3I5O A;  4YZZ A;  3IJO B;  5CMC A;  1M5B A;  2HZL A;  4RNS A;  5ICT A;  3IR1 A;  1B4Z A;  3U1O A;  5DVI A;  3KSJ A;  3EHU A;  5DT6 A;  2Y84 A;  2Y7I A;  3FAS A;  4R6K A;  2NVU B;  4AB6 A;  5DEX B;  3H06 B;  1XVY A;  2D3I A;  5F1Q A;  4HW8 A;  4JB7 A;  3JZJ A;  2I0B A;  4UA8 A;  1LFH A;  1SW4 A;  3M3L A;  3OD7 A;  3TPA A;  1US4 A;  3IO4 A;  2PT1 A;  4THI A;  4F18 A;  4OFL A;  2RC8 A;  4G4P A;  2REG A;  4U1Z A;  3K1P A;  1N84 A;  3CSB A;  3V83 A;  1DTG A;  2QS2 A;  1YAE A;  3G3G A;  1FQE A;  2DP8 A;  4EDP A;  4R9G A;  3KGC A;  2UVG A;  1D9Y A;  3PUZ E;  4ELQ A;  2V84 A;  3LSL A;  3OXN A;  5K2X A;  5CBS A;  1B40 A;  2HZK A;  1MY4 A;  4RXL A;  4Q5T A;  1B0H A;  3OO9 A;  3CG3 A;  2DQV A;  3C36 A;  2LAO A;  1MQI A;  3TTR A;  5K2Y A;  5KDT A;  4QFP A;  2UVI A;  2Z22 A;  1GV8 A;  3FJM A;  4H1X A;  5TPA A;  1LLS A;  4R6Y A;  1JNF A;  5LOM A;  4NF4 B;  1ZBM A;  5L9S A;  2ZYN A;  3OEN A;  5HPQ A;  3HO7 A;  1M5C A;  3SEY A;  2O1M A;  3TQL A;  1OQG A;  1TT1 A;  4ZEI A;  4GWO A;  1P1W A;  5CMK A;  1Z7N E;  5H8N A;  2M8C A;  1NNT A;  2AYS A;  1BKA A;  1N3W A;  3E4R A;  3N6T A;  3KZG A;  2QMW A;  1P1N A;  1PB7 A;  3EQ1 A;  5H8S A;  4HTG A;  1NNK A;  4KD5 A;  1SQY A;  2DWA A;  4QFL A;  1MXW A;  1NFT A;  4X9T A;  4I62 A;  4YMA A;  3EPE A;  4H0W A;  1UIV A;  1F9B A;  2HAV A;  4K3F A;  4NF6 A;  4F3P A;  2XXR A;  4I1D A;  3CFL A;  4N13 A;  4O3C A;  5M2V A;  1B5H A;  3FV2 A;  3IK6 B;  3O6G A;  2XXI A;  1MQJ A;  1VSO A;  3G3I A;  1CE2 A;  3N6U A;  3L6H A;  4GXA A;  4F3S A;  2YJP A;  3MVY A;  1MRP A;  5FHM A;  2B65 A;  4PFW A;  3ZS6 A;  4BLA A;  3FVG A;  3RQT A;  3IOV A;  3V89 B;  3H03 A;  1UTH A;  1SDX A;  1NNP A;  5EHM A;  1N3X A;  4QSD A;  1B5I A;  1ANF A;  1XOC A;  1SYH A;  4R2F A;  3TTK A;  1ELJ A;  1MH4 A;  3IB0 A;  3K00 A;  4P0I A;  1LST A;  1NNF A;  4G8M A;  1POY 1;  5H8F A;  1BIY A;  4EXK A;  3W15 C;  2WKY A;  3M3K A;  5JTY B;  4TLL B;  4Z7E A;  1PB8 A;  3IO6 A;  5CI5 A;  5EHS A;  2H99 A;  1Y9U A;  1FW0 A;  4IO7 A;  1MQG A;  2H25 A;  3M3F A;  3GBA A;  1Y1M A;  3RGY A;  5FTI A;  1QJM A;  5IAI A;  1IIW A;  4C1T A;  2ZYM A;  4KFQ A;  1DPP A;  3QIM A;  2Q8J A;  1JET A;  4RYA A;  1MXZ A;  4OEN A;  3VLV A;  4F2O A;  4MF3 A;  2XX7 A;  4GLI A;  3IL1 B;  2I6E A;  5KDT B;  2F7B A;  2ZYK A;  1QUL A;  1MM7 A;  3TMG A;  1UTB A;  2Z8F A;  4OQO A;  1B7Z A;  5A5X A;  4U21 A;  2Y7W A;  5DEX A;  3TCG A;  2R71 A;  1A54 A;  1HSL A;  3FXQ A;  4IO6 A;  1EH3 A;  4G2Z A;  4MLV A;  2VD2 A;  4U23 A;  2AL4 A;  3MZ9 A;  3SET A;  3VXB A;  4QFN A;  1H43 A;  4WKM A;  3SKP A;  2OWT A;  5ICQ A;  2PVU A;  4I9D A;  1M5F A;  3FXR A;  1ZMG A;  4LAT A;  1OMP A;  5H8N B;  4G77 A;  3VE1 B;  4OMB A;  1A8F A;  1NH7 A;  1B7H A;  3RLF E;  3OSR A;  4ZEF A;  4PP0 A;  2IA4 A;  3OEM A;  3LBS A;  5DVJ A;  1ZJL A;  2ABH A;  3MVW A;  1H45 A;  4WXJ A;  3HN0 A;  2I58 A;  2XXV A;  4RK9 A;  4RPN A;  3UOR A;  3A09 A;  3IOT A;  1B52 A;  1MXY A;  4GL0 A;  1YPN A;  3M8U A;  1AL3 A;  4WED A;  1LGB C;  4FJP A;  1O7T A;  3IJX B;  3ILT B;  2B3B A;  3QYT A;  2E1S A;  1L5T A;  4KYE A;  3C9H A;  4X48 A;  4KHZ E;  1MY2 A;  1LAH E;  3B7D A;  4NF6 B;  3TTM A;  2F7C A;  2F8D A;  3C31 A;  1XC1 A;  4F39 A;  2QJE A;  3K1M A;  2O1L A;  4HCY A;  2DYX A;  2DWI A;  4OET A;  1MXX A;  1DTZ A;  3GBB A;  3O28 A;  3Q28 A;  3HCQ A;  1WDN A;  3SES A;  1O64 A;  4ELR A;  3EHS A;  2Y7R A;  3VVD A;  1UTH B;  3K0V A;  4P11 A;  1M5D A;  1FQF A;  2UYE A;  3G3F A;  3FJG A;  1FTL A;  4FOR A;  4YKP A;  4IO2 A;  1R6Z A;  3OOA A;  2RIN A;  1B3F A;  4H5G A;  1RYX A;  1FTK A;  4LA9 A;  5BWJ A;  1QKA A;  2PX1 A;  1B3G A;  3V8X B;  1P1U A;  4C0R A;  3PUX E;  2I49 A;  1QUI A;  1XHY A;  4N6P A;  5H8F B;  1TFD A;  1YTV A;  5AA3 A;  4NF8 A;  2G93 A;  3U92 A;  3GLB A;  3BFU A;  4H8I A;  3RPW A;  3L6G A;  4H5F A;  4GRK A;  1XT8 A;  3DEL B;  5FTH A;  4FIM A;  3D4G A;  1FTM A;  3ZKL A;  5AA2 D;  4ESW A;  4ZEK A;  3O9P A;  5CM6 A; 
#chains in the Genus database with same CATH topology
 3SEU A;  5TP9 A;  1EZ9 A;  2RCB A;  3TDJ A;  4BDR A;  1FPF A;  3N5L A;  1Q35 A;  3CRB A;  4OFJ A;  1IUD A;  4NTL A;  4XTC Q;  4KXP A;  1FPJ A;  4BDM A;  1Z7M E;  4JSD A;  1FBD A;  3O29 A;  4NQ8 A;  1LBZ A;  2QPQ A;  1ZKB A;  1UTB B;  5A5X B;  3SEV A;  1DK4 A;  4OZ9 A;  5HM4 B;  3HV1 A;  3IOW A;  2XWK A;  2F3D A;  5ISU A;  1MH3 A;  4U2R A;  5EQA A;  2RC9 A;  3QSL A;  4QF9 A;  2P2A A;  5F7V A;  2GFE A;  2ZYO A;  5IZ3 A;  2O7I A;  1R9Q A;  4R2B A;  4X8R A;  1MG1 A;  5JTY A;  4OVJ A;  3U8Q A;  4NG7 A;  5BUU A;  5DW8 A;  3G3K A;  5I59 B;  2DWH A;  4AS4 A;  2DS9 A;  4PE3 A;  3F11 A;  2FHY A;  2ALU A;  1JVX A;  3AXF A;  4YB6 A;  1P99 A;  4F2Q A;  4P1L A;  1AWB A;  2R9J A;  2WEF A;  3R7X A;  3KC0 A;  2HFB A;  3TAJ A;  4NF0 A;  1VE4 A;  3T9X B;  1LBW A;  2VPO A;  3VVE A;  4XKQ A;  2F36 A;  3TEL A;  3FVK A;  4H65 A;  1B3H A;  4NMY A;  3V5A A;  3RUM A;  4LP2 B;  4KR5 A;  1S7Y A;  4F19 A;  4ZE9 A;  3I3V A;  5ET5 A;  1JEU A;  3K6U A;  1QGX A;  2DVZ A;  5EYF A;  2Q9T A;  1MPD A;  4MMP A;  3CIJ A;  1JW4 A;  5H8H B;  4F1V A;  4DZ1 A;  1XS5 A;  1R9L A;  3PD9 A;  4PQJ A;  5L8D A;  5J1D A;  4KPT A;  4Q8R A;  4LUB A;  1INP A;  4IY6 A;  1SW1 A;  2OK2 A;  3QK6 A;  5IKB A;  2GQ1 A;  1LFI A;  2Z23 A;  2XXX A;  1IMC A;  4TOZ A;  3ECR A;  1ZTY A;  2NWJ A;  1HSE A;  4U4X A;  1IXI A;  2XD3 A;  1D9Q A;  2V93 A;  3MVX A;  1RDY A;  4IGT A;  3PMX A;  3GYY A;  1HSJ A;  5KZT A;  3CR9 A;  1IXC A;  2Q2C A;  1FPG A;  2O51 A;  2V3U A;  2VHA A;  3TTN A;  2ZXT A;  3RN8 A;  1WOD A;  2ZNU A;  5F24 A;  3KBZ A;  4ZEB A;  1YZ0 A;  4P1E A;  4NF8 B;  2KQZ A;  3MVZ A;  1B32 A;  4MX6 A;  3DP4 A;  4HE2 A;  1AH5 A;  4EQ7 A;  3BIG A;  4E0W A;  1FQC A;  5I57 A;  2H9B A;  2CZK A;  3Q26 A;  1ZLQ A;  4O8M A;  4PFR A;  4C1U A;  2OWZ A;  1PC3 A;  3CSG A;  5I2N A;  5TP9 B;  1FTJ A;  5ESY A;  2F7A A;  4UAB A;  5I7I A;  1B46 A;  3MPK A;  3OO6 A;  1DMB A;  3LSX A;  3OMB A;  5ITP A;  4ELP A;  1FBG A;  4MBP A;  1ZU0 A;  1MY3 A;  3MBP A;  3A3U A;  2XXW A;  3SEW A;  3PUY E;  3CHG A;  1O63 A;  1B1H A;  3K02 A;  4N91 A;  4R73 A;  2NOO A;  5H8Q A;  5DYH A;  1JVY A;  4OES A;  3K4U A;  4YKJ A;  3O66 A;  4POX A;  2DXY A;  4OWD A;  2D21 A;  2F35 A;  2DSF A;  3PMV A;  1B7U A;  2ANJ A;  4P3L A;  4DCY A;  3IX1 A;  1N7W A;  3BIH A;  2XXY A;  4E0X A;  3UIF A;  5IZ3 B;  3OEK A;  1B58 A;  2XD2 A;  4GFR A;  1MQH A;  3G3H A;  3NOH A;  5AA2 A;  5AA4 A;  2HQ0 A;  5CBR A;  2FBP A;  2XXP A;  1US5 A;  3E13 X;  3RTW B;  1UIU A;  4U1O A;  2Y7P A;  2QS3 A;  4KI0 E;  2XXH A;  3TUS A;  3N26 A;  3SZP A;  1FBE A;  1D3K A;  3LSW A;  4G61 A;  4XIG Q;  1T0K A;  4R9F A;  1Y3P A;  4GBW A;  3KFM A;  1IQ7 A;  3OO8 A;  3UA8 A;  4HS7 A;  1NUX A;  2G29 A;  3MAM A;  4GWZ A;  2ONS A;  1QW0 A;  2I3V A;  3FJ7 A;  2GH9 A;  1ZIU A;  2VD3 A;  4F3B A;  2QL3 A;  4GF8 A;  2ZNS A;  2I4B A;  1TFA A;  4IO3 A;  4NWC A;  2GRV A;  1FTO A;  3H6T A;  2XX8 A;  3DP6 A;  4BDL A;  1DOT A;  5J16 A;  2DE4 A;  2WYK A;  3D4C A;  4TQU Q;  5L9O A;  1SVX B;  2V25 A;  1FQB A;  3T9V A;  4O3B A;  4PGN A;  1Y1Z A;  1LEV A;  1A99 A;  2RKM A;  1EYI A;  4R6H A;  2X7Q A;  1OLA A;  3H7M A;  3K01 A;  3CVG A;  1B1X A;  2OBG A;  1EU8 A;  3PPR A;  4G8H A;  3KJT A;  1Y4C A;  3FVN A;  1OLC A;  2B4M A;  4OEU A;  4KCC A;  5I59 A;  1NV2 A;  3O97 A;  5FHN A;  1GR2 A;  4DLD A;  2GHA A;  3RY3 A;  3LUY A;  3FIR A;  1FJ6 A;  3KN3 A;  3Q29 A;  2HAU A;  2Z8E A;  1H76 A;  4NED A;  4JVD A;  1LFG A;  1Y4T A;  1LBX A;  2O68 A;  5I2K A;  1YYZ A;  2AL5 A;  4AS5 A;  4OVQ A;  5ET7 A;  1NL5 A;  3D1R A;  3SER A;  5ET6 A;  4ZEC A;  3BKI B;  1J1N A;  2XHD A;  1FPD A;  2WBB A;  4XKN A;  1Y3Q A;  1VFE A;  3O6H A;  3PD8 A;  3O2A A;  1PDA A;  1RDX A;  1DSN A;  1KA0 A;  3IOR A;  2P3N A;  4AQ4 A;  2Y5L A;  4YB7 A;  2FNC A;  5ITO A;  4PFT A;  1FPL A;  5I57 B;  1GVC A;  3VV5 A;  3VVF A;  1MXV A;  1OQH A;  3RT6 B;  3VLU A;  3B8B A;  4BDN A;  1B3L A;  3HST A;  2PYY A;  4QFK A;  5H8H A;  3BFT A;  4ZED A;  3RNN A;  1B3E A;  5I2N B;  3UN6 A;  2O7U A;  4XF5 A;  1N7X A;  2HPG A;  2MKZ A;  3S2V A;  1SBP A;  1H44 A;  4M1V A;  1POT A;  2WX9 A;  3H4Z A;  4DI3 D;  2THI A;  5CRY A;  3TZA A;  5B70 A;  3PPQ A;  2OLB A;  4GX4 A;  2VGQ A;  3C32 A;  2A5T A;  1MPB A;  4NF5 B;  2XWI A;  3FAT A;  3K2D A;  5H8Q B;  4XXU A;  3T22 A;  1LBV A;  4DXU A;  4WEP A;  2CEX A;  1EYK A;  4H6D A;  4JBZ A;  2PT2 A;  1MQD A;  3KEI A;  3W9W A;  2XWV A;  4GOT A;  4IGR A;  2I3W A;  4N07 A;  4JVC A;  4AB5 A;  1NI9 A;  1QKB A;  2E0S A;  1H3D A;  1OIB A;  1S50 A;  1I6B A;  3QMF A;  4JSO A;  4GWX A;  1BTJ A;  4IO4 A;  4DDD A;  3U93 A;  4KQP A;  4QXD A;  4N8G A;  5KCJ A;  4ZZA A;  3CI8 A;  5AA2 B;  5AA4 B;  1IMB A;  3ZKK A;  4PGP A;  4DE8 A;  1PEB A;  2Q88 A;  3PPP A;  4MH5 A;  4OER A;  3C4M A;  3T1B A;  2DE3 A;  4PET A;  4RPO A;  2Q2A A;  2CZL A;  1IMD A;  3MZ1 A;  2PMS A;  2X7P A;  4Q30 B;  4YB5 A;  2HXW A;  2NXO A;  1Q9D A;  4UAC A;  3C34 A;  1DCU A;  3B6W A;  2DVC A;  4GQO A;  4JWO A;  3KN7 A;  1SI0 A;  1Q1K A;  1FSA A;  2XXK A;  4P0G A;  5I58 B;  4O7I A;  3BBR A;  1URD A;  1MDP 1;  3PV0 E;  1FPI A;  4NGU A;  4GL8 A;  4YU0 A;  4MFI A;  4OAN A;  4MAG A;  4GIZ A;  5TU0 A;  4RA1 A;  2HXR A;  1FPE A;  4EXL A;  1B51 A;  4IO5 A;  1PBQ A;  3MQ9 A;  1B05 A;  1G0H A;  3ZSF A;  1VR5 A;  2FIE A;  4N15 A;  4EUO A;  4KYD A;  4QHQ A;  3B6Q A;  4LQ5 A;  4PFB A;  1LCF A;  2QSX A;  1VFD A;  1N04 A;  4P56 A;  4FAJ A;  3EF7 A;  1FQA A;  1P1Q A;  2HEU A;  4M4G A;  4PE5 B;  3W9V A;  3GXA A;  1NUZ A;  4DCX A;  3OO7 A;  3KJ7 A;  3MJN A;  4F31 B;  3FD3 A;  2IEE A;  3FV1 A;  1R1N A;  1LB9 A;  1MY0 A;  1EZP A;  4F29 A;  1NMU A;  3KOT A;  3VXC A;  1KWH A;  3MP1 A;  5I2K B;  1Y3N A;  4H45 A;  1IIT A;  4N6D A;  3E79 A;  3VLW A;  3S9L C;  1BLF A;  3ISP A;  3HHF A;  2VP1 A;  4GWU A;  1NKX A;  4ND9 A;  3IB1 A;  1QVS A;  3KG2 A;  4JDF A;  4LN5 A;  5I56 B;  1EYJ A;  1YCJ A;  4DIG A;  4LQ2 A;  3ROJ A;  5I84 A;  5AE4 A;  3E78 A;  2ZNT A;  3UP9 A;  2KLF A;  1NH8 A;  3OEL A;  4X1B A;  2V3Q A;  3RPL B;  4Q0C A;  1URG A;  2PFY A;  3PU5 A;  1A7L A;  3MP6 A;  4ZZE A;  3UGW A;  5FBP A;  4MNI A;  3R6U A;  3QUJ A;  3CFZ A;  4GWS A;  1SW5 A;  1JQF A;  3FBP A;  2XXQ A;  2A5T B;  1WVJ A;  4NN3 A;  2QMX A;  2DXR A;  4O94 A;  3TEP A;  2OCU A;  2ZZV A;  1LAF E;  2KR0 A;  3T9H B;  4ZS9 A;  4OHN A;  2FYI A;  3ODB A;  3RTF B;  4H67 A;  2DWJ A;  2HCA A;  1D4N A;  4YKK A;  1SI1 A;  4KCD A;  3TFL A;  3GZG A;  3LR1 A;  4GBV A;  4O3A A;  2CEY A;  5LDZ A;  4OYV A;  4JXI A;  4GVO A;  4PF8 A;  2B3F A;  5KCJ B;  3THI A;  3JV9 A;  1RYO A;  3S9E A;  3MPL A;  2RF1 A;  3T93 B;  4XKP A;  1IEJ A;  1N76 A;  4GWW A;  3PPN A;  4U22 A;  5FHO A;  4MEV A;  2AIX A;  1AOV A;  2Q74 A;  4LON B;  3TKD A;  4NWD A;  4F22 A;  1VDW A;  3MUQ A;  3WAF A;  4QSE A;  4F1U A;  2VPN A;  4F1Y A;  5B7D A;  4PTK A;  2FIX A;  4DXB A;  5EQ7 A;  3U94 A;  3B50 A;  3MP8 A;  3C35 A;  1B6H A;  1SYI A;  3S9N C;  1KZ8 A;  4RY1 A;  3P7I A;  3QXM A;  1MY1 A;  4PAI A;  1JEV A;  4ESX A;  4PFU A;  1XI6 A;  1LAX A;  4IR8 A;  4NF5 A;  2UYF A;  1K9Z A;  2XA5 A;  1SD3 A;  3EKI A;  1NV3 A;  3E3K A;  3QAX A;  1LCT A;  3C33 A;  3H6V A;  4XFE A;  2BJJ X;  3MZB A;  1IXG A;  3WAE A;  4OTE A;  3R26 A;  1FCK A;  4OVT A;  2B4L A;  3EHT A;  1JW1 A;  4U4S A;  2CMO A;  1XVX A;  3T66 A;  4I8C A;  4MHF A;  4N17 A;  3E9X A;  3RT8 A;  5JK4 A;  1B2H A;  3MW0 A;  4RK2 A;  2V3T A;  1UQW A;  4JWX A;  1I6Q A;  4POW A;  4Z0I A;  4DXC A;  2O6A A;  3LSF B;  4ECF A;  3RYD A;  1IMF A;  2P1S A;  1A40 A;  3EN3 A;  1DPE A;  2OJT A;  2CZH A;  3U65 A;  4G68 A;  1GTK A;  2YPN A;  2QRY A;  5EYG A;  2OWS A;  3UK4 A;  4YMB A;  5DVF A;  4LVQ A;  1A8E A;  1QUK A;  3A3C A;  2F5X A;  2ONK E;  1B5J A;  4HCW A;  3TQW A;  1LBB A;  4FAT A;  3PGF A;  4FEB A;  3SEX A;  2H5Y A;  1LBC A;  4ELO A;  5I58 A;  3IB2 A;  3PMW A;  2Q89 A;  5AA1 A;  2Y7K A;  3KSX A;  2XXU A;  4OEV A;  3Q25 A;  3VDF A;  1Y20 A;  2A5S A;  3SDF A;  3U72 A;  3FXU A;  3FZV A;  5L9M A;  1ATG A;  3USD A;  1USY H;  3H3G A;  4MCO A;  3HPI A;  1S9T A;  4L17 A;  1TXF A;  3DP8 A;  3N94 A;  2REJ A;  3PTY A;  1AMF A;  3HHG A;  3Q27 A;  5ELV A;  2W7Y A;  5TPA B;  3PUW E;  4LZ8 A;  2NUV A;  2Z8D A;  5T3J A;  3TCF A;  2Q8M A;  2DOJ A;  2ESN A;  4DI4 B;  1JW5 A;  3B6T A;  1II5 A;  4O7M A;  2O84 X;  4GX6 A;  1N0T A;  3LC8 A;  2PBW A;  5HBC A;  1USY E;  4EQ9 A;  2UVH A;  1MXU A;  4GD5 A;  3QUF A;  2CZI A;  2F97 A;  4N4U A;  1FQD A;  4MNP A;  4XKR A;  4BDO A;  1BP5 A;  4RJZ A;  3T96 B;  4QRZ A;  3TTL A;  4YAH X;  1MDQ A;  4QFO A;  3TYH A;  3PUV E;  4JWY A;  4NAP A;  3PPO A;  2H4I A;  3CFX A;  2P0S A;  2XX9 A;  2F6G A;  1QUJ A;  2WBD A;  3I6V A;  3K1N A;  3KOS A;  2F6P A;  4F3G A;  3MWB A;  1MS7 A;  3H6W A;  3K6X A;  3DLN A;  1P1O A;  5I56 A;  4KYS A;  2H98 A;  5DTB A;  5EQ8 A;  3FUZ A;  1IZ1 A;  1FBC A;  1NV0 A;  1URS A;  3MC2 A;  4I40 A;  4OXV A;  5CC2 A;  2ZMB A;  3RPL A;  3OSQ A;  4NF4 A;  1B4H A;  4N81 A;  5JEI A;  3G7W A;  2R6G E;  2D5W A;  1MPC A;  2O69 A;  1GGG A;  4TLM B;  3IFC A;  3ONM A;  2F34 A;  2FVZ A;  4HE0 A;  1CB6 A;  4OFO A;  4FEC A;  4ONY A;  4EF2 A;  3FVO A;  4MLQ A;  4BDQ A;  4NX1 A;  3H6U A;  2JJK A;  4FED A;  2P3V A;  3O6I A;  4R75 A;  4QSC A;  4X04 A;  4PFY A;  3ILU B;  2I48 A;  2UXA A;  3IAZ A;  3IOU A;  5CMM A;  1M5E A;  2RC7 A;  4NE4 A;  2QS1 A;  1NUW A;  1OVT A;  2YLN A;  1I69 A;  2FA7 A;  2UVJ A;  5IZZ A;  2X26 A;  3KN8 A;  2BJI A;  4EQB A;  1A55 A;  3G3J A;  1BK4 A;  2I0C A;  4PCD A;  3VFJ A;  2RCA A;  1AIV A;  4LZ5 A;  2QS4 A;  5I3S A;  4H8J A;  3JYR A;  4G68 B;  2DE2 A;  4ISU A;  1LB8 A;  3T9U A;  3FGS A;  4G68 C;  4IY5 A;  1PB9 A;  1PBP A;  4LZ7 A;  4R74 A;  2PCR A;  3KBR A;  1SW2 A;  4YIC A;  4R72 A;  2ONR A;  2I4C A;  3K6W A;  2VOZ A;  1IXH A;  4EF1 A;  4G8N A;  1RKM A;  3S9M C;  2OZZ A;  1I6A A;  2F78 A;  1EZO A;  1RDZ A;  1D9V A;  4ZDM A;  1LAG E;  3CG1 A;  4ZE8 A;  3TCH A;  3DM0 A;  1IME A;  1NV4 A;  4X1D A;  5CMB A;  1MM6 A;  4YKI A;  1B0L A;  4OVS A;  3S4U A;  4GXS B;  4PDH A;  4IB2 A;  1TWY A;  2GHB A;  1B9J A;  3K6V A;  4JVI A;  1OVB A;  3TOD A;  4FE8 A;  2XXT A;  3I5O A;  4YZZ A;  3IJO B;  5CMC A;  1M5B A;  2HZL A;  4RNS A;  5ICT A;  3IR1 A;  1B4Z A;  5IM2 A;  3U1O A;  5DVI A;  2F3B A;  3KSJ A;  3EHU A;  5DT6 A;  2Y84 A;  2Y7I A;  3FAS A;  4R6K A;  2NVU B;  4AB6 A;  5DEX B;  3H06 B;  1XVY A;  2D3I A;  4PDD A;  5F1Q A;  4HW8 A;  4JB7 A;  1G0I A;  3JZJ A;  2QVU A;  2I0B A;  4UA8 A;  1LFH A;  1SW4 A;  3M3L A;  3OD7 A;  3TPA A;  1US4 A;  3IO4 A;  4H46 A;  2PT1 A;  4THI A;  4F18 A;  4OFL A;  2RC8 A;  4PC9 A;  4G4P A;  3A29 A;  2REG A;  1YXI A;  4U1Z A;  3K1P A;  1N84 A;  3CSB A;  3V83 A;  1DTG A;  5EQ9 A;  2QS2 A;  1YAE A;  3G3G A;  1FQE A;  2DP8 A;  4EDP A;  4R9G A;  3KGC A;  2UVG A;  1D9Y A;  3PUZ E;  4ELQ A;  2V84 A;  4GWY A;  3LSL A;  3OXN A;  5K2X A;  5CBS A;  1B40 A;  2HZK A;  1MY4 A;  4RXL A;  1SPI A;  4Q5T A;  1B0H A;  3OO9 A;  1DBZ A;  3CG3 A;  3LUZ A;  2DQV A;  3C36 A;  2LAO A;  1MQI A;  3TTR A;  5K2Y A;  5KDT A;  4QFP A;  2UVI A;  2Z22 A;  1GV8 A;  3FJM A;  4H1X A;  5TPA A;  1LLS A;  4P47 A;  1NUY A;  1JNF A;  4R6Y A;  4P9K A;  5LOM A;  4NF4 B;  1ZBM A;  2QVR A;  5L9S A;  4PFI A;  2ZYN A;  3OEN A;  4HXV A;  5HPQ A;  3HO7 A;  1M5C A;  3SEY A;  2O1M A;  3TQL A;  1KA1 A;  1OQG A;  1TT1 A;  1NV5 A;  4ZEI A;  4GWO A;  4PBH A;  1P1W A;  5CMK A;  1Z7N E;  5H8N A;  2M8C A;  5ET8 A;  1NNT A;  2AYS A;  1LBY A;  4N6K A;  1BKA A;  1N3W A;  4MJO A;  3E4R A;  3N6T A;  1FBP A;  3KZG A;  2XWO A;  2QMW A;  1P1N A;  1PB7 A;  3EQ1 A;  5H8S A;  4HTG A;  1NNK A;  4KD5 A;  1SQY A;  2DWA A;  1NV6 A;  4OA4 A;  4QFL A;  1MXW A;  1JP4 A;  1NFT A;  4X9T A;  1FPK A;  4I62 A;  4YMA A;  3EPE A;  4H0W A;  1UIV A;  1F9B A;  2HAV A;  4MNC A;  2ZZW A;  4K3F A;  4NF6 A;  4F3P A;  2XXR A;  4I1D A;  3CFL A;  4N13 A;  4O3C A;  5M2V A;  1B5H A;  3FV2 A;  3IK6 B;  3O6G A;  2XXI A;  1MQJ A;  1VSO A;  3G3I A;  1CE2 A;  3N6U A;  3L6H A;  4GXA A;  4F3S A;  2YJP A;  3MVY A;  1MRP A;  5FHM A;  2B65 A;  4PFW A;  3ZS6 A;  4BLA A;  3FVG A;  3RQT A;  3IOV A;  3V89 B;  1FJ9 A;  3H03 A;  1UTH A;  1SDX A;  5IZ1 A;  5LTC A;  1NNP A;  2Y5K A;  5EHM A;  1N3X A;  2QVV A;  4PF6 A;  4QSD A;  3MYU A;  1B5I A;  2VT5 A;  1ANF A;  1XOC A;  1SYH A;  4R2F A;  3TTK A;  1ELJ A;  1MH4 A;  3IB0 A;  3K00 A;  4P0I A;  1LST A;  1NNF A;  4G8M A;  1POY 1;  5H8F A;  1BIY A;  4EXK A;  3W15 C;  2WKY A;  3M3K A;  5JTY B;  4TLL B;  4NHB A;  4Z7E A;  1PB8 A;  3IO6 A;  5CI5 A;  5EHS A;  2H99 A;  1Y9U A;  1FW0 A;  4IO7 A;  1MQG A;  4PAK A;  2WYP A;  2H25 A;  3M3F A;  2PFZ A;  3GBA A;  1Y1M A;  4I3Y A;  3RGY A;  5FTI A;  1QJM A;  5IAI A;  1IIW A;  4C1T A;  2ZYM A;  4KFQ A;  1DPP A;  3QIM A;  2Q8J A;  1JET A;  4RYA A;  1MXZ A;  3KC1 A;  1FRP A;  4OEN A;  3VLV A;  1NV7 A;  4F2O A;  4MF3 A;  2XX7 A;  4GLI A;  3IL1 B;  2I6E A;  5KDT B;  2F7B A;  2ZYK A;  2R8T A;  1QUL A;  1MM7 A;  3TMG A;  1UTB A;  2Z8F A;  4OQO A;  2L5V A;  1B7Z A;  5A5X A;  4U21 A;  2Y7W A;  5DEX A;  3TCG A;  1FBF A;  2R71 A;  1A54 A;  1HSL A;  1FBH A;  3FXQ A;  4IO6 A;  1EH3 A;  4G2Z A;  4MLV A;  2VD2 A;  4U23 A;  2AL4 A;  3MZ9 A;  3SET A;  3VXB A;  4QFN A;  1H43 A;  4PBQ A;  4WKM A;  3SKP A;  2OWT A;  5ICQ A;  1FPB A;  2PVU A;  4I9D A;  1M5F A;  3FXR A;  1ZMG A;  4LAT A;  1OMP A;  4QBA A;  5H8N B;  4G77 A;  3VE1 B;  4OMB A;  1A8F A;  1NH7 A;  1B7H A;  3RLF E;  3OSR A;  4PP0 A;  4ZEF A;  2IA4 A;  4GX3 A;  3OEM A;  4MIJ A;  3LBS A;  2ZZX A;  5DVJ A;  1ZJL A;  2ABH A;  3MVW A;  2HHM A;  1H45 A;  4WXJ A;  3HN0 A;  3MST A;  2I58 A;  2XXV A;  4RK9 A;  4RPN A;  3A09 A;  3UOR A;  3IOT A;  5I5P A;  1B52 A;  1MXY A;  4GL0 A;  1YPN A;  3M8U A;  1AL3 A;  4WED A;  1LGB C;  2OX3 A;  4FJP A;  4OVR A;  1O7T A;  3IJX B;  3ILT B;  4I3E A;  2B3B A;  3QYT A;  2E1S A;  1L5T A;  4KYE A;  3C9H A;  4X48 A;  2V4C A;  4KHZ E;  1MY2 A;  1LAH E;  3B7D A;  4NF6 B;  4N8Y A;  3TTM A;  1K9Y A;  5A5L A;  2F7C A;  2F8D A;  3HFU A;  3LV0 A;  3C31 A;  1XC1 A;  4F39 A;  2QJE A;  3K1M A;  4FBP A;  2O1L A;  4HCY A;  2DYX A;  2DWI A;  1IMA A;  4OET A;  2QFL A;  1MXX A;  1DTZ A;  3GBB A;  3O28 A;  3Q28 A;  3HCQ A;  1WDN A;  3FXB A;  1NV1 A;  3SES A;  3IFA A;  1O64 A;  3T0J A;  4ELR A;  4XEQ A;  3EHS A;  5IGA A;  2Y7R A;  1FTA A;  3VVD A;  1UTH B;  3K0V A;  4P11 A;  1M5D A;  1FQF A;  2UYE A;  3G3F A;  1CNQ A;  3FJG A;  1FTL A;  4FOR A;  4YKP A;  4IO2 A;  1R6Z A;  4OVP A;  4PAF A;  3OOA A;  4P8B A;  2RIN A;  1B3F A;  4H5G A;  1RYX A;  1FTK A;  4LA9 A;  5BWJ A;  1QKA A;  2PX1 A;  1B3G A;  3V8X B;  1P1U A;  4C0R A;  3PUX E;  2I49 A;  5EYH A;  1QUI A;  1XHY A;  4N6P A;  5H8F B;  1TFD A;  1YTV A;  5AA3 A;  4NF8 A;  4HE1 A;  2G93 A;  2DDK A;  3U92 A;  3GLB A;  3BFU A;  4H8I A;  3RPW A;  3L6G A;  4H5F A;  4GRK A;  1XT8 A;  3DEL B;  5FTH A;  4FIM A;  3D4G A;  1FTM A;  3ZKL A;  5AA2 D;  4ESW A;  4ZEK A;  3O9P A;  5CM6 A; 
#chains in the Genus database with same CATH homology
 3SEU A;  5TP9 A;  1EZ9 A;  2RCB A;  3TDJ A;  4BDR A;  3N5L A;  1Q35 A;  3CRB A;  4OFJ A;  1IUD A;  4NTL A;  4XTC Q;  4BDM A;  1Z7M E;  4JSD A;  3O29 A;  2QPQ A;  1ZKB A;  1UTB B;  5A5X B;  3SEV A;  4OZ9 A;  5HM4 B;  3HV1 A;  3IOW A;  5ISU A;  1MH3 A;  4U2R A;  2RC9 A;  3QSL A;  4QF9 A;  2P2A A;  5F7V A;  2GFE A;  2ZYO A;  2O7I A;  1R9Q A;  4R2B A;  1MG1 A;  5JTY A;  4OVJ A;  3U8Q A;  5BUU A;  3G3K A;  5I59 B;  2DWH A;  2DS9 A;  3F11 A;  2ALU A;  1JVX A;  3AXF A;  4YB6 A;  1P99 A;  4F2Q A;  2R9J A;  3R7X A;  2HFB A;  3TAJ A;  1VE4 A;  3T9X B;  3VVE A;  4XKQ A;  2F36 A;  3TEL A;  3FVK A;  4H65 A;  1B3H A;  4NMY A;  3V5A A;  3RUM A;  4LP2 B;  4KR5 A;  1S7Y A;  4F19 A;  4ZE9 A;  3I3V A;  1JEU A;  3K6U A;  2DVZ A;  5EYF A;  2Q9T A;  1MPD A;  3CIJ A;  1JW4 A;  5H8H B;  4F1V A;  4DZ1 A;  1XS5 A;  1R9L A;  3PD9 A;  4PQJ A;  5L8D A;  5J1D A;  4KPT A;  4Q8R A;  4LUB A;  4IY6 A;  1SW1 A;  2OK2 A;  3QK6 A;  5IKB A;  1LFI A;  2Z23 A;  2XXX A;  4TOZ A;  3ECR A;  1ZTY A;  2NWJ A;  1HSE A;  4U4X A;  1IXI A;  2XD3 A;  2V93 A;  3MVX A;  4IGT A;  3PMX A;  1HSJ A;  5KZT A;  3CR9 A;  1IXC A;  2Q2C A;  2O51 A;  2V3U A;  2VHA A;  3TTN A;  2ZXT A;  3RN8 A;  1WOD A;  2ZNU A;  4ZEB A;  4NF8 B;  3MVZ A;  1B32 A;  3DP4 A;  1AH5 A;  4EQ7 A;  4E0W A;  1FQC A;  5I57 A;  2H9B A;  3Q26 A;  1ZLQ A;  4C1U A;  1PC3 A;  3CSG A;  5I2N A;  5TP9 B;  1FTJ A;  2F7A A;  1B46 A;  3MPK A;  3OO6 A;  1DMB A;  3LSX A;  3OMB A;  5ITP A;  4ELP A;  4MBP A;  1ZU0 A;  1MY3 A;  3MBP A;  3A3U A;  2XXW A;  3SEW A;  3PUY E;  1O63 A;  1B1H A;  3K02 A;  4R73 A;  2NOO A;  5H8Q A;  5DYH A;  1JVY A;  4OES A;  3K4U A;  4YKJ A;  3O66 A;  4POX A;  2DXY A;  4OWD A;  2D21 A;  2F35 A;  2DSF A;  3PMV A;  1B7U A;  2ANJ A;  4DCY A;  3IX1 A;  1N7W A;  4E0X A;  2XXY A;  3UIF A;  3OEK A;  1B58 A;  2XD2 A;  4GFR A;  1MQH A;  3G3H A;  5AA2 A;  5AA4 A;  2HQ0 A;  5CBR A;  2XXP A;  1US5 A;  3E13 X;  3RTW B;  1UIU A;  4U1O A;  2Y7P A;  2QS3 A;  4KI0 E;  2XXH A;  3TUS A;  3N26 A;  1D3K A;  3LSW A;  4XIG Q;  1T0K A;  4R9F A;  1Y3P A;  3KFM A;  1IQ7 A;  3OO8 A;  3UA8 A;  4HS7 A;  2G29 A;  3MAM A;  2ONS A;  1QW0 A;  2I3V A;  3FJ7 A;  2GH9 A;  1ZIU A;  2VD3 A;  4F3B A;  2QL3 A;  4GF8 A;  2ZNS A;  2I4B A;  1TFA A;  4IO3 A;  4NWC A;  2GRV A;  1FTO A;  3H6T A;  2XX8 A;  3DP6 A;  4BDL A;  1DOT A;  2DE4 A;  3D4C A;  4TQU Q;  5L9O A;  1SVX B;  2V25 A;  1FQB A;  3T9V A;  4O3B A;  1Y1Z A;  1A99 A;  2RKM A;  4R6H A;  2X7Q A;  1OLA A;  3H7M A;  3K01 A;  3CVG A;  1B1X A;  2OBG A;  1EU8 A;  3PPR A;  4G8H A;  3KJT A;  1Y4C A;  3FVN A;  1OLC A;  4OEU A;  4KCC A;  5I59 A;  3O97 A;  5FHN A;  1GR2 A;  4DLD A;  2GHA A;  3RY3 A;  3LUY A;  3FIR A;  3KN3 A;  3Q29 A;  2HAU A;  2Z8E A;  1H76 A;  4NED A;  1LFG A;  1Y4T A;  2O68 A;  5I2K A;  2AL5 A;  1NL5 A;  3SER A;  4ZEC A;  3BKI B;  1J1N A;  2XHD A;  4XKN A;  1Y3Q A;  1VFE A;  3O6H A;  3PD8 A;  3O2A A;  1PDA A;  1DSN A;  3IOR A;  4AQ4 A;  4YB7 A;  2FNC A;  5ITO A;  4PFT A;  5I57 B;  1GVC A;  3VV5 A;  3VVF A;  1MXV A;  1OQH A;  3RT6 B;  3VLU A;  4BDN A;  1B3L A;  3HST A;  2PYY A;  4QFK A;  5H8H A;  3BFT A;  4ZED A;  3RNN A;  1B3E A;  5I2N B;  3UN6 A;  2O7U A;  1N7X A;  3S2V A;  1SBP A;  1H44 A;  4M1V A;  1POT A;  3H4Z A;  2THI A;  5CRY A;  3TZA A;  5B70 A;  3PPQ A;  2OLB A;  2VGQ A;  3C32 A;  2A5T A;  1MPB A;  4NF5 B;  3FAT A;  3K2D A;  5H8Q B;  4XXU A;  3T22 A;  4DXU A;  4WEP A;  4H6D A;  4JBZ A;  2PT2 A;  1MQD A;  3KEI A;  3W9W A;  4GOT A;  4IGR A;  2I3W A;  4N07 A;  4AB5 A;  1QKB A;  2E0S A;  1H3D A;  1OIB A;  1S50 A;  1I6B A;  4JSO A;  1BTJ A;  4IO4 A;  4DDD A;  3U93 A;  4KQP A;  5KCJ A;  4ZZA A;  3CI8 A;  5AA2 B;  5AA4 B;  3ZKK A;  4DE8 A;  1PEB A;  2Q88 A;  3PPP A;  4MH5 A;  4OER A;  3C4M A;  2DE3 A;  4PET A;  4RPO A;  2Q2A A;  2CZL A;  3MZ1 A;  2PMS A;  2X7P A;  4YB5 A;  4Q30 B;  2HXW A;  2NXO A;  4UAC A;  3C34 A;  3B6W A;  2DVC A;  4GQO A;  4JWO A;  3KN7 A;  1SI0 A;  1Q1K A;  4P0G A;  5I58 B;  3BBR A;  1URD A;  1MDP 1;  3PV0 E;  4GL8 A;  4YU0 A;  4MFI A;  4GIZ A;  5TU0 A;  4RA1 A;  4EXL A;  1B51 A;  4IO5 A;  1PBQ A;  3MQ9 A;  1B05 A;  3ZSF A;  1VR5 A;  4EUO A;  4KYD A;  4QHQ A;  3B6Q A;  4LQ5 A;  1LCF A;  2QSX A;  1VFD A;  1N04 A;  4FAJ A;  3EF7 A;  1FQA A;  1P1Q A;  2HEU A;  4M4G A;  4PE5 B;  3W9V A;  3GXA A;  4DCX A;  3OO7 A;  3KJ7 A;  3MJN A;  4F31 B;  3FD3 A;  2IEE A;  3FV1 A;  1R1N A;  1LB9 A;  1MY0 A;  1EZP A;  4F29 A;  1NMU A;  3KOT A;  3VXC A;  1KWH A;  3MP1 A;  5I2K B;  1Y3N A;  1IIT A;  3VLW A;  3S9L C;  1BLF A;  3HHF A;  2VP1 A;  1NKX A;  4ND9 A;  3IB1 A;  1QVS A;  3KG2 A;  4JDF A;  5I56 B;  1YCJ A;  4DIG A;  4LQ2 A;  5I84 A;  5AE4 A;  2ZNT A;  3UP9 A;  4X1B A;  2KLF A;  1NH8 A;  3OEL A;  2V3Q A;  4Q0C A;  1URG A;  3PU5 A;  1A7L A;  3MP6 A;  4ZZE A;  3UGW A;  3R6U A;  3QUJ A;  3CFZ A;  1SW5 A;  1JQF A;  2XXQ A;  2A5T B;  1WVJ A;  2QMX A;  2DXR A;  3TEP A;  2OCU A;  1LAF E;  3T9H B;  4ZS9 A;  4OHN A;  2FYI A;  3ODB A;  3RTF B;  4H67 A;  2DWJ A;  2HCA A;  1D4N A;  4YKK A;  1SI1 A;  4KCD A;  3TFL A;  3GZG A;  3LR1 A;  4O3A A;  4OYV A;  4JXI A;  4GVO A;  2B3F A;  5KCJ B;  3THI A;  3JV9 A;  1RYO A;  3S9E A;  3MPL A;  2RF1 A;  3T93 B;  4XKP A;  1IEJ A;  1N76 A;  3PPN A;  4U22 A;  5FHO A;  2AIX A;  1AOV A;  4LON B;  3TKD A;  4NWD A;  4F22 A;  3MUQ A;  3WAF A;  4F1U A;  4QSE A;  4F1Y A;  5B7D A;  4DXB A;  3U94 A;  3MP8 A;  3C35 A;  1B6H A;  1SYI A;  3S9N C;  4RY1 A;  3P7I A;  3QXM A;  1MY1 A;  1JEV A;  4ESX A;  4PFU A;  1LAX A;  4NF5 A;  2UYF A;  1SD3 A;  3E3K A;  3QAX A;  1LCT A;  3C33 A;  3H6V A;  2BJJ X;  3MZB A;  1IXG A;  3WAE A;  4OTE A;  3R26 A;  1FCK A;  3EHT A;  1JW1 A;  4U4S A;  2CMO A;  1XVX A;  3T66 A;  4I8C A;  3E9X A;  3RT8 A;  5JK4 A;  1B2H A;  3MW0 A;  4RK2 A;  2V3T A;  1UQW A;  4JWX A;  1I6Q A;  4POW A;  4Z0I A;  4DXC A;  2O6A A;  3LSF B;  4ECF A;  2P1S A;  1A40 A;  3EN3 A;  1DPE A;  2OJT A;  4G68 A;  1GTK A;  2YPN A;  2QRY A;  2OWS A;  3UK4 A;  4YMB A;  5DVF A;  4LVQ A;  1A8E A;  1QUK A;  3A3C A;  2F5X A;  2ONK E;  1B5J A;  4HCW A;  3TQW A;  1LBB A;  4FAT A;  3PGF A;  4FEB A;  3SEX A;  2H5Y A;  1LBC A;  4ELO A;  5I58 A;  3IB2 A;  3PMW A;  2Q89 A;  5AA1 A;  2Y7K A;  3KSX A;  2XXU A;  4OEV A;  3Q25 A;  3VDF A;  1Y20 A;  2A5S A;  3SDF A;  3U72 A;  3FXU A;  3FZV A;  5L9M A;  1ATG A;  3USD A;  1USY H;  3H3G A;  3HPI A;  1S9T A;  4L17 A;  1TXF A;  3DP8 A;  3N94 A;  2REJ A;  1AMF A;  3HHG A;  3Q27 A;  5ELV A;  2W7Y A;  5TPA B;  3PUW E;  4LZ8 A;  2NUV A;  2Z8D A;  3TCF A;  2DOJ A;  2ESN A;  1JW5 A;  3B6T A;  1II5 A;  2O84 X;  1N0T A;  3LC8 A;  2PBW A;  5HBC A;  1USY E;  4EQ9 A;  2UVH A;  1MXU A;  4GD5 A;  3QUF A;  2F97 A;  1FQD A;  4XKR A;  4BDO A;  1BP5 A;  4RJZ A;  3T96 B;  4QRZ A;  3TTL A;  4YAH X;  1MDQ A;  4QFO A;  3TYH A;  3PUV E;  4JWY A;  3PPO A;  2H4I A;  3CFX A;  2P0S A;  2XX9 A;  2F6G A;  1QUJ A;  3I6V A;  3K1N A;  3KOS A;  2F6P A;  4F3G A;  3MWB A;  1MS7 A;  3H6W A;  3K6X A;  3DLN A;  1P1O A;  5I56 A;  4KYS A;  2H98 A;  5DTB A;  3FUZ A;  1IZ1 A;  1URS A;  3MC2 A;  4OXV A;  5CC2 A;  2ZMB A;  3OSQ A;  4NF4 A;  1B4H A;  5JEI A;  3G7W A;  2R6G E;  2D5W A;  1MPC A;  2O69 A;  1GGG A;  4TLM B;  3ONM A;  2F34 A;  1CB6 A;  4OFO A;  4FEC A;  4ONY A;  4EF2 A;  3FVO A;  4MLQ A;  4BDQ A;  3H6U A;  4FED A;  3O6I A;  4R75 A;  4QSC A;  4PFY A;  3ILU B;  2I48 A;  2UXA A;  3IAZ A;  3IOU A;  5CMM A;  1M5E A;  2RC7 A;  4NE4 A;  2QS1 A;  1OVT A;  2YLN A;  1I69 A;  2FA7 A;  2UVJ A;  2X26 A;  3KN8 A;  4EQB A;  1A55 A;  3G3J A;  2I0C A;  3VFJ A;  2RCA A;  1AIV A;  4LZ5 A;  2QS4 A;  4H8J A;  3JYR A;  4G68 B;  2DE2 A;  4ISU A;  1LB8 A;  3T9U A;  3FGS A;  4G68 C;  4IY5 A;  1PB9 A;  1PBP A;  4LZ7 A;  4R74 A;  3KBR A;  1SW2 A;  4YIC A;  4R72 A;  2ONR A;  2I4C A;  3K6W A;  2VOZ A;  1IXH A;  4EF1 A;  4G8N A;  1RKM A;  3S9M C;  2OZZ A;  1I6A A;  2F78 A;  1EZO A;  4ZDM A;  1D9V A;  1LAG E;  3CG1 A;  4ZE8 A;  3TCH A;  3DM0 A;  4X1D A;  5CMB A;  1MM6 A;  4YKI A;  1B0L A;  3S4U A;  4GXS B;  1TWY A;  4IB2 A;  2GHB A;  1B9J A;  3K6V A;  1OVB A;  3TOD A;  4FE8 A;  2XXT A;  3I5O A;  4YZZ A;  3IJO B;  5CMC A;  1M5B A;  2HZL A;  4RNS A;  5ICT A;  3IR1 A;  1B4Z A;  3U1O A;  5DVI A;  3KSJ A;  3EHU A;  5DT6 A;  2Y84 A;  2Y7I A;  3FAS A;  4R6K A;  2NVU B;  4AB6 A;  5DEX B;  3H06 B;  1XVY A;  2D3I A;  5F1Q A;  4HW8 A;  4JB7 A;  3JZJ A;  2I0B A;  4UA8 A;  1LFH A;  1SW4 A;  3M3L A;  3OD7 A;  3TPA A;  1US4 A;  3IO4 A;  2PT1 A;  4THI A;  4F18 A;  4OFL A;  2RC8 A;  4G4P A;  2REG A;  4U1Z A;  3K1P A;  1N84 A;  3CSB A;  3V83 A;  1DTG A;  2QS2 A;  1YAE A;  3G3G A;  1FQE A;  2DP8 A;  4EDP A;  4R9G A;  3KGC A;  2UVG A;  1D9Y A;  3PUZ E;  4ELQ A;  2V84 A;  3LSL A;  3OXN A;  5K2X A;  5CBS A;  1B40 A;  2HZK A;  1MY4 A;  4RXL A;  4Q5T A;  1B0H A;  3OO9 A;  3CG3 A;  2DQV A;  3C36 A;  2LAO A;  1MQI A;  3TTR A;  5K2Y A;  5KDT A;  4QFP A;  2UVI A;  2Z22 A;  1GV8 A;  3FJM A;  4H1X A;  5TPA A;  1LLS A;  4R6Y A;  1JNF A;  5LOM A;  4NF4 B;  1ZBM A;  5L9S A;  2ZYN A;  3OEN A;  5HPQ A;  3HO7 A;  1M5C A;  3SEY A;  2O1M A;  3TQL A;  1OQG A;  1TT1 A;  4ZEI A;  4GWO A;  1P1W A;  5CMK A;  1Z7N E;  5H8N A;  2M8C A;  1NNT A;  2AYS A;  1BKA A;  1N3W A;  3E4R A;  3N6T A;  3KZG A;  2QMW A;  1P1N A;  1PB7 A;  3EQ1 A;  5H8S A;  4HTG A;  1NNK A;  4KD5 A;  1SQY A;  2DWA A;  4QFL A;  1MXW A;  1NFT A;  4X9T A;  4I62 A;  4YMA A;  3EPE A;  4H0W A;  1UIV A;  1F9B A;  2HAV A;  4K3F A;  4NF6 A;  4F3P A;  2XXR A;  4I1D A;  3CFL A;  4N13 A;  4O3C A;  5M2V A;  1B5H A;  3FV2 A;  3IK6 B;  3O6G A;  2XXI A;  1MQJ A;  1VSO A;  3G3I A;  1CE2 A;  3N6U A;  3L6H A;  4GXA A;  4F3S A;  2YJP A;  3MVY A;  1MRP A;  5FHM A;  2B65 A;  4PFW A;  3ZS6 A;  4BLA A;  3FVG A;  3RQT A;  3IOV A;  3V89 B;  3H03 A;  1UTH A;  1SDX A;  1NNP A;  5EHM A;  1N3X A;  4QSD A;  1B5I A;  1ANF A;  1XOC A;  1SYH A;  4R2F A;  3TTK A;  1ELJ A;  1MH4 A;  3IB0 A;  3K00 A;  4P0I A;  1LST A;  1NNF A;  4G8M A;  1POY 1;  5H8F A;  1BIY A;  4EXK A;  3W15 C;  2WKY A;  3M3K A;  5JTY B;  4TLL B;  4Z7E A;  1PB8 A;  3IO6 A;  5CI5 A;  5EHS A;  2H99 A;  1Y9U A;  1FW0 A;  4IO7 A;  1MQG A;  2H25 A;  3M3F A;  3GBA A;  1Y1M A;  3RGY A;  5FTI A;  1QJM A;  5IAI A;  1IIW A;  4C1T A;  2ZYM A;  4KFQ A;  1DPP A;  3QIM A;  2Q8J A;  1JET A;  4RYA A;  1MXZ A;  4OEN A;  3VLV A;  4F2O A;  4MF3 A;  2XX7 A;  4GLI A;  3IL1 B;  2I6E A;  5KDT B;  2F7B A;  2ZYK A;  1QUL A;  1MM7 A;  3TMG A;  1UTB A;  2Z8F A;  4OQO A;  1B7Z A;  5A5X A;  4U21 A;  2Y7W A;  5DEX A;  3TCG A;  2R71 A;  1A54 A;  1HSL A;  3FXQ A;  4IO6 A;  1EH3 A;  4G2Z A;  4MLV A;  2VD2 A;  4U23 A;  2AL4 A;  3MZ9 A;  3SET A;  3VXB A;  4QFN A;  1H43 A;  4WKM A;  3SKP A;  2OWT A;  5ICQ A;  2PVU A;  4I9D A;  1M5F A;  3FXR A;  1ZMG A;  4LAT A;  1OMP A;  5H8N B;  4G77 A;  3VE1 B;  4OMB A;  1A8F A;  1NH7 A;  1B7H A;  3RLF E;  3OSR A;  4ZEF A;  4PP0 A;  2IA4 A;  3OEM A;  3LBS A;  5DVJ A;  1ZJL A;  2ABH A;  3MVW A;  1H45 A;  4WXJ A;  3HN0 A;  2I58 A;  2XXV A;  4RK9 A;  4RPN A;  3UOR A;  3A09 A;  3IOT A;  1B52 A;  1MXY A;  4GL0 A;  1YPN A;  3M8U A;  1AL3 A;  4WED A;  1LGB C;  4FJP A;  1O7T A;  3IJX B;  3ILT B;  2B3B A;  3QYT A;  2E1S A;  1L5T A;  4KYE A;  3C9H A;  4X48 A;  4KHZ E;  1MY2 A;  1LAH E;  3B7D A;  4NF6 B;  3TTM A;  2F7C A;  2F8D A;  3C31 A;  1XC1 A;  4F39 A;  2QJE A;  3K1M A;  2O1L A;  4HCY A;  2DYX A;  2DWI A;  4OET A;  1MXX A;  1DTZ A;  3GBB A;  3O28 A;  3Q28 A;  3HCQ A;  1WDN A;  3SES A;  1O64 A;  4ELR A;  3EHS A;  2Y7R A;  3VVD A;  1UTH B;  3K0V A;  4P11 A;  1M5D A;  1FQF A;  2UYE A;  3G3F A;  3FJG A;  1FTL A;  4FOR A;  4YKP A;  4IO2 A;  1R6Z A;  3OOA A;  2RIN A;  1B3F A;  4H5G A;  1RYX A;  1FTK A;  4LA9 A;  5BWJ A;  1QKA A;  2PX1 A;  1B3G A;  3V8X B;  1P1U A;  4C0R A;  3PUX E;  2I49 A;  1QUI A;  1XHY A;  4N6P A;  5H8F B;  1TFD A;  1YTV A;  5AA3 A;  4NF8 A;  2G93 A;  3U92 A;  3GLB A;  3BFU A;  4H8I A;  3RPW A;  3L6G A;  4H5F A;  4GRK A;  1XT8 A;  3DEL B;  5FTH A;  4FIM A;  3D4G A;  1FTM A;  3ZKL A;  5AA2 D;  4ESW A;  4ZEK A;  3O9P A;  5CM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...