1HSLA

Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
238
structure length
238
Chain Sequence
b'AIPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPAVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTIDINE-BINDING PROTEIN
publication title Refined 1.89-A structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport/chemosensory proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Binding protein
total genus 68
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hslA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hslA02
4OETA 1S50A 3TQWA 3UN6A 1H3DA 2FA7A 3N5LA 1L5TA 1Y20A 2F78A 5I2KA 4JWYA 1Y4CA 3R7XA 1N3XA 2H25A 4HS7A 4Z7EA 3EF7A 5JK4A 5FHNA 1B9JA 1UQWA 3PPPA 3TYHA 3FJ7A 4KPTA 3FIRA 3MVYA 1MG1A 4E0WA 3SEXA 1Y3PA 4ND9A 2RC8A 1F9BA 5JTYA 1WVJA 4F1VA 2PBWA 1DTGA 2BJJX 5L9SA 3IAZA 4POXA 2OZZA 3QK6A 4ESWA 1MXYA 3K1MA 1URSA 3MAMA 3TTKA 4I9DA 5I2NB 4GXSB 3RTFB 4ZS9A 3VVFA 2XXQA 1QW0A 1XHYA 1BIYA 1D3KA 1SD3A 3TPAA 3D4CA 2I4BA 1A54A 4JDFA 4U22A 3UORA 2QS3A 2UYEA 4EXKA 5HPQA 1MQHA 4AB6A 3PMWA 2AIXA 3OEMA 2O51A 2A5SA 1LGBC 3SEVA 5KZTA 3O6IA 4JB7A 4EQ9A 3VFJA 4L17A 4OEUA 3TEPA 3FZVA 5ELVA 4QRZA 3TCFA 3TKDA 4NF6A 3T93B 5ICTA 1EH3A 2ABHA 3HHFA 3QIMA 4M4GA 2F7BA 3ZKLA 2V3TA 1MQDA 3HCQA 3K02A 1I6AA 1JEVA 3G3IA 3N26A 1MPDA 4OMBA 4OHNA 1B5HA 4JWXA 1SBPA 3WAEA 4BDNA 2XXYA 5H8NA 1HSJA 4P11A 3RN8A 3B6QA 2AYSA 2NXOA 4ZZAA 4IO7A 4EQBA 1B3LA 1B6HA 3RT8A 4OXVA 1XC1A 1FTKA 4E0XA 3KN3A 2PX1A 1DOTA 3TTLA 3M3FA 1JVYA 3KZGA 4KR5A 2V25A 1IXGA 1IZ1A 1LBCA 4GL0A 3K0VA 2VP1A 2HFBA 5H8FA 2H9BA 2WKYA 1OIBA 3IK6B 1DSNA 3O66A 1MDQA 1SDXA 3K01A 1B7HA 4R74A 4FATA 3T9XB 2FYIA 2YPNA 1MS7A 4YAHX 4DCXA 4RYAA 3VVEA 4LQ5A 1ZIUA 4ZZEA 4F1YA 2DS9A 1GGGA 3RY3A 2P2AA 4LZ8A 3OXNA 4EQ7A 1FW0A 3FXQA 2RF1A 3CI8A 5FTIA 4G2ZA 2XXUA 4KI0E 3G3JA 4XXUA 3VVDA 1B0HA 4H5GA 4NMYA 2HZLA 4KD5A 3OEKA 2P0SA 1VFDA 5I56B 4N07A 2D5WA 2PVUA 2UVHA 2QS1A 1MDP1 4EDPA 1MY0A 3PMXA 3ILUB 2GFEA 1FQFA 1TFDA 3MW0A 4FE8A 4KFQA 4BLAA 5I59B 4I8CA 2OWTA 1Z7NE 4OZ9A 3K1PA 4KCDA 1DTZA 4G8HA 3H4ZA 1SW2A 1YPNA 2PT1A 3MPKA 4OEVA 4RXLA 1MH3A 3FV1A 5F1QA 4QSDA 4DE8A 5A5XB 1A55A 2NWJA 1MM7A 4TQUQ 1AOVA 4F2OA 3H03A 3KSXA 4X48A 5DT6A 1MXWA 4OQOA 4LATA 2QSXA 3ILTB 4H1XA 2I58A 2G93A 4IO6A 1MY1A 4O3AA 2VHAA 4C0RA 1GTKA 2DWHA 4QF9A 4YU0A 1P1NA 4IB2A 5L9MA 3C33A 1O64A 2UVIA 3A3UA 4QFKA 2KLFA 4R75A 4G68A 1LFGA 2B65A 4FJPA 5L8DA 3Q25A 1JVXA 4F31B 3U1OA 3V5AA 1Y1ZA 3IOUA 4NWDA 2DWIA 5CC2A 1US4A 3C32A 4NF4A 5AA4B 5HM4B 3IO6A 3UA8A 1N04A 2DE4A 5ITPA 3PMVA 3H3GA 3FVNA 4KYDA 1LAFE 2RKMA 4OENA 2O7IA 1BLFA 4P0IA 1ZU0A 1VR5A 3G3FA 4OWDA 4BDRA 2R6GE 3EQ1A 3Q28A 4G8MA 3PPNA 3GBAA 3V8XB 3HPIA 1LLSA 1QUJA 2XD3A 3H6TA 2VOZA 4QSCA 3C9HA 3PUVE 1FCKA 2I3VA 5CI5A 1AMFA 1LBBA 1Y3QA 3CIJA 1B1HA 1FTMA 3FXRA 3EHTA 4GIZA 5TU0A 1M5BA 3E13X 4ZEDA 1R9LA 4N6PA 2HCAA 1MPBA 1DPEA 1JETA 1PB8A 3KJTA 4FIMA 2YLNA 3MP6A 2XX8A 2RC9A 3K6WA 2F5XA 4NF8B 1I69A 3FVOA 4IY6A 5TPAB 1ZTYA 1B3FA 2PT2A 4ISUA 4BDMA 3O9PA 4IGTA 4ZEKA 1JQFA 2ZMBA 3MUQA 5KDTB 4LONB 1VE4A 1SVXB 3CR9A 3ZS6A 5CMCA 2O7UA 3CSGA 5AA2B 4ONYA 1AL3A 1RYXA 4XKQA 1RKMA 5ISUA 1RYOA 5DVIA 4ELPA 1OVBA 2O1MA 3N6UA 4UA8A 2XXXA 3PGFA 1GV8A 3PUYE 3RNNA 3ONMA 3SERA 5EHMA 3E3KA 3QYTA 4R73A 4U21A 3QAXA 4F19A 1NNKA 3TTNA 4GVOA 4KCCA 1WDNA 4OFLA 2OCUA 1URGA 3W15C 3B6WA 3BFUA 1VFEA 4RNSA 2HQ0A 1N76A 4QFPA 3Q27A 1UTHA 4EUOA 4YKKA 4QFLA 1OQHA 2O69A 1B3HA 2Y7IA 1DMBA 3BFTA 3SESA 2QMXA 1FQEA 5H8HA 5CBRA 1EZOA 1XT8A 2I4CA 3O6HA 1B3EA 1LAXA 2B3BA 4HW8A 2DYXA 2DE3A 2GRVA 4GWOA 2QPQA 1Q35A 3C31A 3PU5A 1A7LA 2V3QA 4PQJA 1AH5A 2F36A 1ANFA 4H8JA 5CBSA 3PUWE 1PC3A 5F7VA 4WEDA 2F7AA 4TLMB 4R2BA 4R9GA 4U4XA 1LCTA 1I6BA 3IOTA 2VD2A 3IX1A 1QUKA 1MY4A 3VE1B 3C35A 1Y1MA 4R6HA 1YTVA 3JV9A 2ONSA 4GQOA 4FEDA 1D9VA 2XXVA 4GFRA 5AA1A 2XXHA 4ZEFA 1LFHA 4PE5B 4WXJA 1B46A 3H7MA 1FQAA 4NEDA 4RK9A 3D4GA 4RA1A 1M5DA 4QFOA 4RY1A 4Q8RA 1B0LA 1B7UA 3ZSFA 2XD2A 4F2QA 3G3GA 3K4UA 3AXFA 4X1BA 2Q2CA 4GL8A 3N6TA 3CSBA 3LC8A 2Z22A 3MBPA 4IO3A 3FVGA 1LFIA 4NF5B 3FGSA 1Z7ME 1LB8A 2I49A 3KSJA 3MZ9A 5I58A 2ZNTA 2XXRA 4ELRA 1S7YA 4POWA 2O6AA 1SYIA 3PUZE 1IITA 2RCBA 4YICA 3TCHA 1SI1A 2ZNSA 3S9NC 3O2AA 1JW1A 5H8QB 5TP9B 5KCJA 1A40A 4LZ7A 5DEXA 2Q89A 3O28A 4FECA 4XKPA 1B7ZA 1A8FA 1EU8A 2E0SA 2H98A 3CFLA 5I2KB 4ZE8A 3U93A 4IO4A 4DDDA 4YKJA 4G4PA 2Q88A 1MH4A 4R72A 3HN0A 4OFJA 1NH7A 2HAUA 3PUXE 4QHQA 5FHOA 1NMUA 3EPEA 2ONRA 2F7CA 2NVUB 4BDOA 2HAVA 3MZBA 3DP6A 5JTYB 2V93A 2UYFA 3IOWA 5HBCA 2RCAA 3FASA 3KEIA 3VXCA 1OVTA 1SW5A 3JZJA 4IO2A 2NUVA 2V3UA 4G8NA 4WEPA 3M3LA 1R1NA 5I57A 3TELA 4BDQA 1USYH 1TWYA 3O29A 4ZECA 4DXCA 5CMMA 3M3KA 3S2VA 4IO5A 1UTBA 3GLBA 3KOTA 3PPRA 5AE4A 5IAIA 4ZDMA 3QSLA 1O7TA 2H4IA 2ZYMA 4OFOA 2ZNUA 4NF6B 3I3VA 3RUMA 4DXBA 4PP0A 1YCJA 2QRYA 1B4ZA 2Y7KA 5FHMA 2OJTA 3Q26A 4M1VA 1SW4A 4OERA 1XVYA 3R26A 4JBZA 4F3PA 5H8NB 1ATGA 3FV2A 3ZKKA 5K2YA 2Q8JA 2THIA 4U1ZA 1US5A 2A5TA 2O68A 1N3WA 1IEJA 3IOVA 3MQ9A 5LOMA 2REJA 3TAJA 1IUDA 4PFUA 1A99A 3RT6B 5DTBA 2GHBA 3RGYA 1TFAA 3U72A 2ZYOA 3C34A 3CG3A 5M2VA 1SYHA 4MF3A 1LAGE 2X7QA 4HCYA 4JSOA 3LSLA 3T22A 3LSFB 3MVXA 5H8SA 2UXAA 3GBBA 1FTOA 1M5FA 1N84A 2FNCA 2QJEA 5AA2D 3CG1A 3SEUA 4F3GA 5H8FB 3MVZA 4LUBA 1LCFA 3FVKA 4EF2A 3T96B 4JWOA 4DIGA 4F22A 1NNTA 3MPLA 2REGA 4THIA 3KN7A 1NNPA 1MQGA 4IGRA 1ZLQA 3U94A 1CE2A 4FORA 1JNFA 1H44A 3K6XA 1MPCA 5CMBA 1PBQA 4R6KA 3UP9A 3KG2A 3THIA 2VD3A 1TXFA 4DZ1A 4OYVA 3U8QA 3HO7A 4G68C 4RJZA 3FXUA 4K3FA 1R6ZA 2D3IA 2YJPA 2OK2A 3C36A 3EN3A 5CMKA 2X7PA 2Z23A 1QKAA 3IJOB 1PB9A 2CMOA 3T66A 1II5A 1EZPA 5ICQA 3VLUA 3A09A 2V84A 4DCYA 1HSLA 2DOJA 2ALUA 4I1DA 4F1UA 3VLVA 1JEUA 4NTLA 4ELOA 1B58A 4O3CA 1PDAA 5I2NA 4TLLB 2XXPA 1QULA 3V83A 4LZ5A 2W7YA 4OTEA 5BUUA 5EYFA 3WAFA 1KWHA 3PV0E 4QSEA 3VDFA 4R2FA 5J1DA 1B52A 3OSQA 3OO9A 3G3KA 5FTHA 2DSFA 4C1UA 1UIVA 4NWCA 2XX7A 1I6QA 1Q1KA 3QXMA 3SKPA 3L6GA 4TOZA 2CZLA 3TQLA 3H6VA 4MFIA 3DP8A 1TT1A 1R9QA 3LR1A 2GHAA 1FQDA 1XOCA 4ZEIA 4DLDA 2F8DA 4OESA 3ODBA 1OLCA 3FATA 1FQCA 3EHUA 4QFNA 4ESXA 3TFLA 1Y3NA 2DXRA 1QUIA 4KQPA 2I48A 3PPQA 2LAOA 1MY2A 3SEWA 4YKIA 3OELA 2XXTA 3OO6A 3TUSA 1OMPA 4MH5A 4G68B 2O84X 5CM6A 3IR1A 3KJ7A 1N0TA 3UK4A 3GXAA 2I0BA 4H6DA 2DQVA 4NF4B 4MLQA 2IA4A 3M8UA 4R9FA 4YZZA 3USDA 1SI0A 2QL3A 1B2HA 4ZEBA 1QKBA 5K2XA 3KBRA 3B7DA 3GZGA 3VV5A 2F35A 3H6WA 4XKNA 1B5IA 1NNFA 4U23A 2Z8DA 1EZ9A 3RLFE 2R9JA 3CVGA 1BTJA 5IKBA 3H6UA 3JYRA 1N7WA 4XIGQ 5B70A 3OMBA 4IY5A 1PB7A 2DVCA 3E9XA 3OOAA 4LA9A 1JW5A 2ESNA 2OLBA 1B3GA 2O1LA 3VLWA 1MXUA 3PPOA 4ECFA 1FTJA 1H45A 3SETA 3KGCA 4F39A 4Q30B 1IQ7A 2XX9A 5JEIA 3K1NA 5BWJA 2UVJA 1BP5A 2DXYA 4O3BA 3PD9A 2R71A 2QS2A 3OD7A 1B51A 4YB6A 3MJNA 3DLNA 3QUJA 3TODA 5I56A 2XXWA 3EHSA 5ITOA 3RTWB 4G77A 2OBGA 3HV1A 4H0WA 1FTLA 1VSOA 1MXXA 4GRKA 3RPWA 1LSTA 1M5EA 2PMSA 3L6HA 5I59A 2QS4A 4GXAA 3K6VA 3PD8A 1P1WA 1N7XA 2XXIA 2I6EA 3FUZA 1SQYA 2Q9TA 3IJXB 1P1UA 4Z0IA 1P1QA 1B1XA 3SEYA 3T9UA 4RPNA 3LSXA 1Y9UA 5A5XA 2P1SA 3MP1A 1BKAA 1GVCA 1P99A 4AQ4A 1XVXA 1B5JA 2ZYKA 4FAJA 4YKPA 3S9EA 5DVJA 3ECRA 1UTHB 3DM0A 1MY3A 1MRPA 2HZKA 5L9OA 3HSTA 3N94A 3RQTA 3A3CA 4KHZE 5H8HB 1P1OA 3IL1B 4N13A 2F97A 1QVSA 3MVWA 1NL5A 5AA4A 4LP2B 2ZYNA 3TDJA 1POY1 1MQIA 3OENA 3TTRA 1AIVA 2DVZA 2PYYA 4BDLA 1YAEA 4MLVA 2DWAA 4EF1A 4FEBA 4GD5A 2QMWA 4UACA 4F3SA 4PETA 1B4HA 4F3BA 1URDA 1B40A 4X1DA 3V89B 4YB7A 4ZE9A 4WKMA 2DWJA 4YMBA 3KFMA 4HCWA 3S9MC 1D4NA 1SW1A 2UVGA 4GOTA 3S9LC 3VXBA 3TMGA 3U92A 4F29A 3O6GA 1A8EA 1PBPA 4RK2A 1CB6A 3KOSA 4JXIA 2E1SA 5EHSA 1IIWA 4NF8A 1T0KA 2Q2AA 3TTMA 1GR2A 4U2RA 5TPAA 3LSWA 3E4RA 5I58B 2X26A 4H8IA 3CRBA 2D21A 1B32A 2Z8EA 1NKXA 3MC2A 2DP8A 3MZ1A 4HTGA 3UIFA 5KDTA 3FJMA 4C1TA 1POTA 3CFXA 4YMAA 4XKRA 5KCJB 3G7WA 3W9WA 3LUYA 3BBRA 1IXIA 2ZXTA 2IEEA 5AA2A 3IB1A 3HHGA 5DEXB 4P0GA 5DVFA 2F6GA 4XTCQ 2B3FA 1S9TA 3F11A 1OLAA 1MXVA 1H76A 1Y4TA 2H5YA 3I5OA 3QUFA 4U4SA 5DYHA 5AA3A 2HXWA 4LVQA 3DELB 3IB0A 5CRYA 3Q29A 1ZKBA 3FJGA 2RC7A 4LQ2A 3KN8A 5I84A 2Y7PA 4X9TA 3DP4A 3T9VA 1B05A 3LBSA 1HSEA 1XS5A 2VGQA 1M5CA 3S4UA 3P7IA 1ELJA 2NOOA 3O97A 3IORA 3OO7A 3TCGA 1J1NA 3UGWA 4EXLA 4Q5TA 4OVJA 4U1OA 3H06B 3FD3A 2ONKE 3W9VA 4GLIA 4I62A 5I57B 2I3WA 3G3HA 3K6UA 1ZMGA 3R6UA 2H99A 2RINA 4PFYA 2OWSA 4R6YA 2Y7WA 3T9HB 3TZAA 1UTBB 4GF8A 2F6PA 2F34A 3I6VA 2DE2A 1MQJA 3C4MA 3MP8A 3BKIB 1QJMA 4JSDA 1O63A 2AL5A 2Y84A 1LB9A 3B6TA 3K00A 4KYSA 2AL4A 1H43A 1OQGA 4F18A 1USYE 2G29A 4DXUA 5B7DA 1IXHA 4H5FA 2A5TB 4PFTA 4YB5A 1MXZA 2GH9A 4Q0CA 3K2DA 4AB5A 2Y7RA 4NE4A 1JW4A 3MWBA 3OSRA 1NFTA 1ZBMA 1ZJLA 1WODA 1MM6A 4NF5A 1PEBA 4ELQA 3OO8A 3IB2A 3IO4A 4RPOA 1LAHE 1IXCA 4PFWA 1DPPA 4MBPA 4H65A 2ANJA 4KYEA 5H8QA 5TP9A 2XHDA 3CFZA 2M8CA 2I0CA 3SDFA 2HEUA 1NH8A 1FQBA 1D9YA 1UIUA 4H67A 2Z8FA
chains in the Genus database with same CATH superfamily
4QBAA 4OETA 1S50A 3TQWA 3UN6A 1H3DA 2FA7A 3N5LA 1L5TA 1Y20A 2F78A 4MEVA 5I2KA 4JWYA 1Y4CA 3R7XA 1EYJA 1N3XA 2H25A 4HS7A 4Z7EA 3EF7A 5JK4A 2CZHA 5FHNA 1B9JA 1UQWA 3PPPA 3TYHA 3FJ7A 4KPTA 3FIRA 3MVYA 1MG1A 4E0WA 3SEXA 1Y3PA 1RDXA 1LBVA 4ND9A 2RC8A 1F9BA 5JTYA 1WVJA 4F1VA 2PBWA 1DTGA 3LUZA 2BJJX 5L9SA 3IAZA 4POXA 2OZZA 3QK6A 4ESWA 1MXYA 3K1MA 1URSA 3MAMA 3TTKA 4I9DA 5I2NB 4GXSB 3RTFB 4ZS9A 3VVFA 2XXQA 4P9KA 1QW0A 1XHYA 1BIYA 1D3KA 4PBQA 1SD3A 1FJ6A 3TPAA 4HXVA 3D4CA 2I4BA 1A54A 4JDFA 4HE2A 1NV2A 4U22A 3UORA 2QS3A 2UYEA 1FBFA 4EXKA 5HPQA 1MQHA 4AB6A 3PMWA 2AIXA 3OEMA 1NUWA 2O51A 2A5SA 1LGBC 3SEVA 5KZTA 3O6IA 4P47A 4JB7A 4EQ9A 3VFJA 4L17A 4OEUA 3NOHA 3TEPA 3FZVA 5ELVA 4NX1A 4QRZA 3TCFA 3TKDA 4NF6A 4MNPA 3T93B 5ICTA 1EH3A 2ABHA 3HHFA 4I3EA 3QIMA 4M4GA 2F7BA 3ZKLA 5IZ1A 2V3TA 1MQDA 3HCQA 3K02A 1I6AA 1JEVA 3G3IA 3N26A 1MPDA 3U65A 4PE3A 4OMBA 4OHNA 1B5HA 4JWXA 1SBPA 3WAEA 4OVQA 4BDNA 2XXYA 5H8NA 1HSJA 4P11A 4GWXA 3B6QA 3RN8A 2AYSA 1Q9DA 2NXOA 4N6KA 4ZZAA 4IO7A 4EQBA 1B3LA 1FJ9A 1B6HA 4PC9A 3RT8A 4OXVA 2ZZWA 1XC1A 2DDKA 2R8TA 1FTKA 1FBCA 4E0XA 3KN3A 5ESYA 2PX1A 1DOTA 3TTLA 3M3FA 1JVYA 3KZGA 4KR5A 2V25A 1IXGA 1IZ1A 1LBCA 4GL0A 3K0VA 3SZPA 2P3VA 2VP1A 4GWWA 2HFBA 5H8FA 2H9BA 4MHFA 2WKYA 1OIBA 1NV4A 3IK6B 1DCUA 1DSNA 3O66A 1MDQA 1SDXA 3K01A 1B7HA 4R74A 4PGPA 4FATA 3T9XB 2FYIA 2YPNA 1MS7A 4YAHX 4DCXA 4RYAA 3VVEA 4LQ5A 1ZIUA 4ZZEA 4F1YA 2DS9A 1GGGA 3RY3A 2P2AA 4LZ8A 5I5PA 3OXNA 4EQ7A 1FW0A 3FXQA 2RF1A 3CI8A 5FTIA 4G2ZA 2XXUA 4KI0E 3G3JA 4XXUA 3VVDA 1B0HA 4H5GA 4NMYA 2HZLA 4KD5A 3OEKA 2P0SA 1VFDA 5I56B 4N07A 2D5WA 2XWVA 2PVUA 2UVHA 2QS1A 1MDP1 4EDPA 1G0IA 1MY0A 3PMXA 4PDHA 3ILUB 2GFEA 1FQFA 1TFDA 3MW0A 4FE8A 4KFQA 4BLAA 5I59B 4I8CA 2OWTA 4PFIA 1VDWA 1Z7NE 4OZ9A 3K1PA 4KCDA 4OANA 1DTZA 4G8HA 3H4ZA 1SW2A 1YPNA 2PT1A 3MPKA 4OEVA 4RXLA 1MH3A 3FV1A 5F1QA 3RYDA 4QSDA 4DE8A 5A5XB 1A55A 2NWJA 1MM7A 4TQUQ 1IMCA 1AOVA 4F2OA 3H03A 4XEQA 4N4UA 3KSXA 4X48A 5DT6A 1MXWA 4OQOA 4LATA 2QSXA 4NF0A 3ILTB 4MIJA 4H1XA 2I58A 1IMEA 2G93A 4IO6A 1MY1A 1G0HA 4O3AA 2VHAA 4C0RA 1GTKA 2DWHA 5EQ7A 4PF8A 4QF9A 4YU0A 1P1NA 4IB2A 3IFCA 5L9MA 3C33A 1O64A 2UVIA 3A3UA 4QFKA 2KLFA 4R75A 4G68A 1LFGA 2B65A 4FJPA 5L8DA 3Q25A 1JVXA 4F31B 3U1OA 3V5AA 1Y1ZA 3IOUA 4NWDA 2DWIA 5CC2A 1US4A 3C32A 4NF4A 5AA4B 5HM4B 5J16A 3IO6A 3T1BA 3UA8A 1N04A 2DE4A 5ITPA 3PMVA 3H3GA 3FVNA 4KYDA 4O7MA 1LAFE 2RKMA 4OENA 2O7IA 1BLFA 4P0IA 2KR0A 1ZU0A 1VR5A 3G3FA 4OWDA 4BDRA 2R6GE 3RPLA 3EQ1A 3Q28A 4G8MA 4PAIA 3PPNA 3GBAA 4PTKA 4N17A 3V8XB 3HPIA 1LLSA 1QUJA 2XD3A 3H6TA 2Y5KA 2VOZA 4QSCA 3C9HA 3PUVE 1FCKA 2I3VA 5CI5A 1AMFA 1LBBA 1Y3QA 3CIJA 2HHMA 1B1HA 1FTMA 1NV1A 3FXRA 3EHTA 4GIZA 3ISPA 5TU0A 4GWYA 1M5BA 3E13X 4ZEDA 2CZKA 1K9YA 1R9LA 4N6PA 2HCAA 1MPBA 4G61A 1DPEA 1JETA 1PB8A 3KJTA 4FIMA 2YLNA 3MP6A 2XX8A 2RC9A 3K6WA 2F5XA 5EYGA 1NV6A 3FXBA 4NF8B 1I69A 2Q8MA 3FVOA 4IY6A 5TPAB 1ZTYA 1B3FA 2PFYA 2PT2A 4ISUA 4BDMA 3O9PA 4IGTA 4ZEKA 1JQFA 2ZMBA 3MUQA 5KDTB 4LONB 1FBDA 1VE4A 2XWIA 1SVXB 3CR9A 3ZS6A 5CMCA 2O7UA 4MNIA 3CSGA 5AA2B 4ONYA 5ET5A 1AL3A 1RYXA 4XKQA 1RKMA 5ISUA 1RYOA 5DVIA 4ELPA 1OVBA 2O1MA 3N6UA 4UA8A 2XXXA 3PGFA 1GV8A 3PUYE 3RNNA 3ONMA 3SERA 5EHMA 3E3KA 3QYTA 4R73A 4U21A 3QAXA 4F19A 1NNKA 3TTNA 4GVOA 4KCCA 1WDNA 4OFLA 2OCUA 1URGA 3W15C 3B6WA 3BFUA 5IZZA 1VFEA 4RNSA 2HQ0A 1N76A 4QFPA 3Q27A 1UTHA 4EUOA 1RDYA 4YKKA 4QFLA 1OQHA 2O69A 1B3HA 2Y7IA 1DMBA 2WBBA 3BFTA 3SESA 2QMXA 1FQEA 5H8HA 5CBRA 1EZOA 1XT8A 4N91A 2I4CA 3O6HA 1B3EA 1LAXA 2WYKA 2B3BA 4HW8A 2DYXA 2DE3A 4NG7A 2GRVA 4GWOA 2QPQA 1Q35A 3C31A 3PU5A 1A7LA 2V3QA 4PQJA 1AH5A 2F36A 1ANFA 4H8JA 2JJKA 5CBSA 3PUWE 1PC3A 4WEDA 5F7VA 1JP4A 2F7AA 4TLMB 4R2BA 4R9GA 4U4XA 1LCTA 1NV7A 5I7IA 1I6BA 3IOTA 2VD2A 4NGUA 3IX1A 1QUKA 1MY4A 3VE1B 3C35A 4GWZA 1Y1MA 4R6HA 1YTVA 3JV9A 2ONSA 4GQOA 4FEDA 2QVVA 1D9VA 2XXVA 4GFRA 5AA1A 2ZZXA 1IMBA 2XXHA 2WBDA 4ZEFA 1LFHA 4PE5B 4WXJA 1B46A 3H7MA 5IZ3B 1FQAA 4NEDA 4RK9A 3D4GA 4N8YA 4RA1A 1IMFA 1M5DA 4QFOA 4RY1A 4Q8RA 2XWKA 1B0LA 1B7UA 3E78A 3ZSFA 2XA5A 2XD2A 2V4CA 3A29A 5EQAA 4F2QA 3G3GA 3K4UA 2Q74A 3AXFA 1KZ8A 4X1BA 2Q2CA 1YZ0A 4GL8A 3N6TA 3CSBA 3LC8A 2Z22A 3MBPA 4IO3A 3FVGA 1LFIA 4HE1A 4NF5B 1FBHA 3FGSA 1Z7ME 1LB8A 2I49A 3KSJA 3MZ9A 5I58A 4KXPA 2ZNTA 2XXRA 4ELRA 1S7YA 4POWA 2O6AA 1SYIA 3PUZE 1IITA 2RCBA 1YYZA 4YICA 1XI6A 3EKIA 3TCHA 1SI1A 2ZNSA 3S9NC 3O2AA 1JW1A 5H8QB 4MX6A 5TP9B 5KCJA 3KBZA 1A40A 1EYIA 4LZ7A 5DEXA 2Q89A 5F24A 3O28A 4FECA 4XKPA 1B7ZA 1A8FA 1EU8A 2E0SA 2H98A 3CFLA 5I2KB 4ZE8A 3U93A 4IO4A 4DDDA 4YKJA 4G4PA 2Q88A 1MH4A 4R72A 3HN0A 4OFJA 1NH7A 4IR8A 2HAUA 3PUXE 4QHQA 5FHOA 1NMUA 3EPEA 2ONRA 2F7CA 2NVUB 3IFAA 4BDOA 2HAVA 3MZBA 3DP6A 5JTYB 2V93A 2UYFA 1FPEA 3IOWA 5HBCA 2RCAA 3FASA 3KEIA 3VXCA 1LBXA 1OVTA 2XWOA 1FPFA 1SW5A 3JZJA 2HPGA 4IO2A 2NUVA 2V3UA 4G8NA 4WEPA 3M3LA 4I3YA 4MNCA 1R1NA 5I57A 3TELA 4BDQA 4NAPA 1USYH 1CNQA 1KA1A 1TWYA 5LTCA 3O29A 4ZECA 4DXCA 5CMMA 3ROJA 3M3KA 3S2VA 4IO5A 1UTBA 3GLBA 4GWUA 3KOTA 3PPRA 5AE4A 5IAIA 4ZDMA 3QSLA 1O7TA 2H4IA 2XXKA 2ZYMA 2ZNUA 4NF6B 4OFOA 3I3VA 3MYUA 3B8BA 3RUMA 4DXBA 4PP0A 2Y5LA 4PFBA 1YCJA 2QRYA 2FIXA 4P3LA 1B4ZA 1IMAA 2Y7KA 5FHMA 2OJTA 3Q26A 5EQ8A 4M1VA 1SW4A 4OERA 1LBWA 1XVYA 4H46A 3R26A 4JBZA 4F3PA 5H8NB 1ATGA 3FV2A 3ZKKA 5K2YA 2Q8JA 2THIA 4U1ZA 1US5A 2A5TA 2O68A 1N3WA 1IEJA 3IOVA 3MQ9A 4P1EA 5LOMA 2REJA 3TAJA 1IUDA 4PFUA 1A99A 3RT6B 5DTBA 2GHBA 3RGYA 4N15A 1TFAA 3U72A 2ZYOA 3C34A 3CG3A 5M2VA 5I3SA 1SYHA 4MF3A 1LAGE 2X7QA 4HCYA 4JSOA 3LSLA 2QFLA 5ET7A 3T22A 3LSFB 4O7IA 3MVXA 5H8SA 2UXAA 3GBBA 1FTOA 1M5FA 1KA0A 1N84A 2FNCA 4MJOA 2QJEA 5AA2D 4MMPA 3CG1A 3SEUA 4F3GA 5H8FB 1LBZA 3MVZA 4JVCA 4LUBA 4UABA 1LCFA 3FVKA 4EF2A 3T96B 4JWOA 4DIGA 4F22A 1NNTA 3MPLA 2REGA 4THIA 3KN7A 1NNPA 1MQGA 4IGRA 1ZLQA 3U94A 1CE2A 4FORA 4GWSA 4JVIA 1JNFA 1H44A 3CHGA 3K6XA 4GX6A 1MPCA 5CMBA 1PBQA 4R6KA 3UP9A 3KG2A 3THIA 2VD3A 1DBZA 4OVSA 2PFZA 4XFEA 1TXFA 4DZ1A 4OYVA 4N81A 3U8QA 3HO7A 4G68C 3BIGA 4RJZA 1EYKA 3FXUA 4K3FA 1R6ZA 2D3IA 2YJPA 2OK2A 2MKZA 3C36A 3EN3A 5CMKA 2X7PA 2Z23A 1QKAA 3FBPA 3IJOB 1PB9A 2CMOA 3T66A 1II5A 1EZPA 5ICQA 3VLUA 3A09A 2V84A 4DCYA 1HSLA 2DOJA 2VPNA 2ALUA 4I1DA 4F1UA 3VLVA 1JEUA 4NTLA 2WEFA 2CEYA 4ELOA 1B58A 4O3CA 1PDAA 4NHBA 5LDZA 2VT5A 3KC1A 5I2NA 4TLLB 2XXPA 1QULA 2B4LA 3V83A 4LZ5A 2W7YA 4OTEA 5BUUA 5EYFA 2F3BA 3WAFA 1KWHA 3PV0E 4QSEA 2FHYA 3VDFA 4R2FA 5J1DA 1B52A 3OSQA 3OO9A 3G3KA 5FTHA 2DSFA 4C1UA 1UIVA 4NWCA 2XX7A 1I6QA 1Q1KA 3QXMA 3L6GA 3SKPA 4TOZA 1FPKA 2CZLA 1FTAA 3H6VA 3TQLA 4MFIA 3DP8A 1TT1A 1R9QA 3LR1A 2GHAA 1FQDA 1XOCA 4ZEIA 4DLDA 2F8DA 4OESA 3ODBA 1OLCA 3FATA 1FQCA 3EHUA 4QFNA 4ESXA 3TFLA 3T0JA 4PCDA 3PTYA 1Y3NA 2DXRA 1QUIA 4KQPA 2I48A 3D1RA 2LAOA 3PPQA 1MY2A 3SEWA 4YKIA 3OELA 2XXTA 3OO6A 4MAGA 3TUSA 1OMPA 4MH5A 4G68B 5IM2A 2O84X 5CM6A 3IR1A 3KJ7A 1D9QA 1N0TA 3UK4A 3GXAA 2I0BA 4H6DA 2DQVA 4NF4B 4MLQA 2IA4A 3M8UA 4R9FA 4YZZA 3USDA 4LN5A 1SI0A 4GX3A 2QL3A 4QXDA 4DI4B 1B2HA 4ZEBA 1QKBA 5K2XA 3KBRA 3B7DA 4PFRA 1FBEA 3GZGA 3VV5A 2F35A 3H6WA 4XKNA 1B5IA 4GBWA 1NNFA 4U23A 2Z8DA 1EZ9A 3RLFE 2R9JA 4HE0A 3CVGA 1BTJA 2F3DA 5IKBA 4PBHA 3RPLB 3H6UA 3JYRA 1N7WA 4XIGQ 5B70A 3OMBA 4IY5A 1PB7A 4AS4A 2DVCA 1AWBA 3E9XA 3OOAA 4LA9A 1JW5A 2ESNA 1YXIA 2OLBA 1B3GA 2O1LA 4XF5A 3VLWA 2QVRA 4N8GA 1MXUA 2CZIA 3PPOA 4ECFA 1FTJA 2L5VA 1H45A 3SETA 5ET8A 3KGCA 4F39A 4Q30B 1IQ7A 2XX9A 5JEIA 3K1NA 5BWJA 1NV3A 2UVJA 1BP5A 2DXYA 4O3BA 3PD9A 2R71A 2CEXA 5EQ9A 2QS2A 3OD7A 1B51A 4YB6A 3MJNA 3DLNA 3QUJA 3TODA 5I56A 1NUZA 2XXWA 4PGNA 3EHSA 5ITOA 3RTWB 2WX9A 4G77A 2OBGA 3HV1A 1BK4A 4H0WA 1FTLA 1VSOA 1MXXA 4GRKA 3RPWA 1LSTA 1M5EA 4DI3D 2PMSA 3L6HA 5I59A 2BJIA 1FPGA 2QS4A 4GXAA 3K6VA 3PD8A 1P1WA 1N7XA 2XXIA 2I6EA 3FUZA 1SQYA 2Q9TA 4NN3A 3IJXB 1P1UA 4Z0IA 1P1QA 1B1XA 3QMFA 3SEYA 3T9UA 4FBPA 4RPNA 4OVRA 3LSXA 1Y9UA 5A5XA 2P1SA 3MP1A 1BKAA 1GVCA 4O8MA 1IMDA 1P99A 4AQ4A 1XVXA 1B5JA 2ZYKA 4FAJA 4YKPA 3S9EA 5DVJA 3ECRA 1UTHB 3DM0A 4P1LA 1MY3A 1MRPA 2HZKA 2QVUA 4P8BA 5L9OA 3HSTA 1NV0A 4P56A 3N94A 3RQTA 3A3CA 4KHZE 5H8HB 3BIHA 4X04A 1P1OA 3IL1B 3E79A 4N13A 2P3NA 2F97A 1QVSA 1FSAA 3MVWA 1NL5A 4PDDA 5AA4A 4LP2B 2ZYNA 3TDJA 2OX3A 1POY1 1MQIA 3OENA 3TTRA 1AIVA 2DVZA 2PYYA 4BDLA 1YAEA 4NQ8A 5IGAA 4MLVA 2B4MA 5ET6A 2DWAA 2OWZA 4EF1A 4FEBA 4GD5A 2QMWA 4UACA 4F3SA 4PETA 1B4HA 4F3BA 1URDA 1B40A 4X1DA 3V89B 4YB7A 4ZE9A 4WKMA 2DWJA 4YMBA 1QGXA 3KFMA 4HCWA 3S9MC 1D4NA 1SW1A 2UVGA 4GOTA 3S9LC 3VXBA 3TMGA 3U92A 4F29A 2FBPA 3O6GA 3HFUA 4O94A 1A8EA 1PBPA 4RK2A 4PF6A 1CB6A 3KOSA 4JXIA 1NV5A 1NUYA 2E1SA 3KC0A 1FPBA 5EHSA 1IIWA 4NF8A 1T0KA 2Q2AA 4X8RA 1GR2A 3TTMA 4U2RA 5TPAA 3LSWA 3E4RA 5I58B 2X26A 4H8IA 3CRBA 1FRPA 1FBGA 2D21A 4OA4A 1B32A 2Z8EA 1NKXA 3MC2A 2DP8A 3MZ1A 4HTGA 3UIFA 5KDTA 3FJMA 4C1TA 1POTA 3CFXA 4YMAA 4XKRA 5KCJB 3G7WA 3W9WA 3LUYA 3BBRA 1IXIA 2ZXTA 2IEEA 5AA2A 3IB1A 5T3JA 3HHGA 5DEXB 4P0GA 5DVFA 2F6GA 4XTCQ 2B3FA 1S9TA 3F11A 1OLAA 1MXVA 1H76A 1Y4TA 2H5YA 3I5OA 3QUFA 4U4SA 5DYHA 5AA3A 1LBYA 2HXWA 4LVQA 3DELB 5A5LA 3IB0A 5CRYA 3Q29A 1ZKBA 3FJGA 1NI9A 2RC7A 4LQ2A 3KN8A 4AS5A 5I84A 2Y7PA 4X9TA 3DP4A 3T9VA 1B05A 3LBSA 1HSEA 1XS5A 2VGQA 1M5CA 3S4UA 3P7IA 1ELJA 2NOOA 3O97A 3IORA 3OO7A 3TCGA 1FPIA 1J1NA 4H45A 3UGWA 4EXLA 4PAKA 4Q5TA 2VPOA 4OVJA 4U1OA 3H06B 3FD3A 2ONKE 3W9VA 4GLIA 4I62A 5I57B 2WYPA 2I3WA 3GYYA 2PCRA 3G3HA 3K6UA 1ZMGA 3R6UA 2H99A 2RINA 4PFYA 2OWSA 4R6YA 1DK4A 4PAFA 2Y7WA 3T9HB 3MSTA 3TZAA 1UTBB 4GF8A 2KQZA 2F6PA 2F34A 3I6VA 2DE2A 2HXRA 1MQJA 3C4MA 3MP8A 3BKIB 1QJMA 4JSDA 1NUXA 1FPLA 1O63A 1FPDA 1INPA 4OVPA 2AL5A 1FPJA 4OVTA 2Y84A 4N6DA 1LB9A 1LEVA 3B6TA 2FIEA 3K00A 5IZ3A 4KYSA 2AL4A 4GX4A 2GQ1A 1H43A 1OQGA 4F18A 1USYE 3LV0A 2G29A 4DXUA 5B7DA 1IXHA 4H5FA 2ZZVA 5EYHA 2A5TB 4PFTA 4YB5A 1MXZA 2GH9A 4I40A 4Q0CA 3K2DA 4AB5A 2Y7RA 4NE4A 5FBPA 5DW8A 1JW4A 4JVDA 3B50A 3MWBA 3OSRA 1NFTA 1ZBMA 1ZJLA 1WODA 4MCOA 1MM6A 4NF5A 1PEBA 4ELQA 3OO8A 3IB2A 3IO4A 4RPOA 1LAHE 1FBPA 1IXCA 4PFWA 1DPPA 4MBPA 4GBVA 4H65A 2ANJA 1K9ZA 1SPIA 4KYEA 1RDZA 5H8QA 5TP9A 2XHDA 3CFZA 2M8CA 2I0CA 2FVZA 2HEUA 3SDFA 1NH8A 1FQBA 1D9YA 1UIUA 4H67A 2Z8FA
chains in the Genus database with same CATH topology
4OETA 1S50A 3TQWA 3UN6A 1H3DA 2FA7A 3N5LA 1L5TA 1Y20A 2F78A 5I2KA 4JWYA 1Y4CA 3R7XA 1N3XA 2H25A 4HS7A 4Z7EA 3EF7A 5JK4A 5FHNA 1B9JA 1UQWA 3PPPA 3TYHA 3FJ7A 4KPTA 3FIRA 3MVYA 1MG1A 4E0WA 3SEXA 1Y3PA 4ND9A 2RC8A 1F9BA 5JTYA 1WVJA 4F1VA 2PBWA 1DTGA 2BJJX 5L9SA 3IAZA 4POXA 2OZZA 3QK6A 4ESWA 1MXYA 3K1MA 1URSA 3MAMA 3TTKA 4I9DA 5I2NB 4GXSB 3RTFB 4ZS9A 3VVFA 2XXQA 1QW0A 1XHYA 1BIYA 1D3KA 1SD3A 3TPAA 3D4CA 2I4BA 1A54A 4JDFA 4U22A 3UORA 2QS3A 2UYEA 4EXKA 5HPQA 1MQHA 4AB6A 3PMWA 2AIXA 3OEMA 2O51A 2A5SA 1LGBC 3SEVA 5KZTA 3O6IA 4JB7A 4EQ9A 3VFJA 4L17A 4OEUA 3TEPA 3FZVA 5ELVA 4QRZA 3TCFA 3TKDA 4NF6A 3T93B 5ICTA 1EH3A 2ABHA 3HHFA 3QIMA 4M4GA 2F7BA 3ZKLA 2V3TA 1MQDA 3HCQA 3K02A 1I6AA 1JEVA 3G3IA 3N26A 1MPDA 4OMBA 4OHNA 1B5HA 4JWXA 1SBPA 3WAEA 4BDNA 2XXYA 5H8NA 1HSJA 4P11A 3RN8A 3B6QA 2AYSA 2NXOA 4ZZAA 4IO7A 4EQBA 1B3LA 1B6HA 3RT8A 4OXVA 1XC1A 1FTKA 4E0XA 3KN3A 2PX1A 1DOTA 3TTLA 3M3FA 1JVYA 3KZGA 4KR5A 2V25A 1IXGA 1IZ1A 1LBCA 4GL0A 3K0VA 2VP1A 2HFBA 5H8FA 2H9BA 2WKYA 1OIBA 3IK6B 1DSNA 3O66A 1MDQA 1SDXA 3K01A 1B7HA 4R74A 4FATA 3T9XB 2FYIA 2YPNA 1MS7A 4YAHX 4DCXA 4RYAA 3VVEA 4LQ5A 1ZIUA 4ZZEA 4F1YA 2DS9A 1GGGA 3RY3A 2P2AA 4LZ8A 3OXNA 4EQ7A 1FW0A 3FXQA 2RF1A 3CI8A 5FTIA 4G2ZA 2XXUA 4KI0E 3G3JA 4XXUA 3VVDA 1B0HA 4H5GA 4NMYA 2HZLA 4KD5A 3OEKA 2P0SA 1VFDA 5I56B 4N07A 2D5WA 2PVUA 2UVHA 2QS1A 1MDP1 4EDPA 1MY0A 3PMXA 3ILUB 2GFEA 1FQFA 1TFDA 3MW0A 4FE8A 4KFQA 4BLAA 5I59B 4I8CA 2OWTA 1Z7NE 4OZ9A 3K1PA 4KCDA 1DTZA 4G8HA 3H4ZA 1SW2A 1YPNA 2PT1A 3MPKA 4OEVA 4RXLA 1MH3A 3FV1A 5F1QA 4QSDA 4DE8A 5A5XB 1A55A 2NWJA 1MM7A 4TQUQ 1AOVA 4F2OA 3H03A 3KSXA 4X48A 5DT6A 1MXWA 4OQOA 4LATA 2QSXA 3ILTB 4H1XA 2I58A 2G93A 4IO6A 1MY1A 4O3AA 2VHAA 4C0RA 1GTKA 2DWHA 4QF9A 4YU0A 1P1NA 4IB2A 5L9MA 3C33A 1O64A 2UVIA 3A3UA 4QFKA 2KLFA 4R75A 4G68A 1LFGA 2B65A 4FJPA 5L8DA 3Q25A 1JVXA 4F31B 3U1OA 3V5AA 1Y1ZA 3IOUA 4NWDA 2DWIA 5CC2A 1US4A 3C32A 4NF4A 5AA4B 5HM4B 3IO6A 3UA8A 1N04A 2DE4A 5ITPA 3PMVA 3H3GA 3FVNA 4KYDA 1LAFE 2RKMA 4OENA 2O7IA 1BLFA 4P0IA 1ZU0A 1VR5A 3G3FA 4OWDA 4BDRA 2R6GE 3EQ1A 3Q28A 4G8MA 3PPNA 3GBAA 3V8XB 3HPIA 1LLSA 1QUJA 2XD3A 3H6TA 2VOZA 4QSCA 3C9HA 3PUVE 1FCKA 2I3VA 5CI5A 1AMFA 1LBBA 1Y3QA 3CIJA 1B1HA 1FTMA 3FXRA 3EHTA 4GIZA 5TU0A 1M5BA 3E13X 4ZEDA 1R9LA 4N6PA 2HCAA 1MPBA 1DPEA 1JETA 1PB8A 3KJTA 4FIMA 2YLNA 3MP6A 2XX8A 2RC9A 3K6WA 2F5XA 4NF8B 1I69A 3FVOA 4IY6A 5TPAB 1ZTYA 1B3FA 2PT2A 4ISUA 4BDMA 3O9PA 4IGTA 4ZEKA 1JQFA 2ZMBA 3MUQA 5KDTB 4LONB 1VE4A 1SVXB 3CR9A 3ZS6A 5CMCA 2O7UA 3CSGA 5AA2B 4ONYA 1AL3A 1RYXA 4XKQA 1RKMA 5ISUA 1RYOA 5DVIA 4ELPA 1OVBA 2O1MA 3N6UA 4UA8A 2XXXA 3PGFA 1GV8A 3PUYE 3RNNA 3ONMA 3SERA 5EHMA 3E3KA 3QYTA 4R73A 4U21A 3QAXA 4F19A 1NNKA 3TTNA 4GVOA 4KCCA 1WDNA 4OFLA 2OCUA 1URGA 3W15C 3B6WA 3BFUA 1VFEA 4RNSA 2HQ0A 1N76A 4QFPA 3Q27A 1UTHA 4EUOA 4YKKA 4QFLA 1OQHA 2O69A 1B3HA 2Y7IA 1DMBA 3BFTA 3SESA 2QMXA 1FQEA 5H8HA 5CBRA 1EZOA 1XT8A 2I4CA 3O6HA 1B3EA 1LAXA 2B3BA 4HW8A 2DYXA 2DE3A 2GRVA 4GWOA 2QPQA 1Q35A 3C31A 3PU5A 1A7LA 2V3QA 4PQJA 1AH5A 2F36A 1ANFA 4H8JA 5CBSA 3PUWE 1PC3A 5F7VA 4WEDA 2F7AA 4TLMB 4R2BA 4R9GA 4U4XA 1LCTA 1I6BA 3IOTA 2VD2A 3IX1A 1QUKA 1MY4A 3VE1B 3C35A 1Y1MA 4R6HA 1YTVA 3JV9A 2ONSA 4GQOA 4FEDA 1D9VA 2XXVA 4GFRA 5AA1A 2XXHA 4ZEFA 1LFHA 4PE5B 4WXJA 1B46A 3H7MA 1FQAA 4NEDA 4RK9A 3D4GA 4RA1A 1M5DA 4QFOA 4RY1A 4Q8RA 1B0LA 1B7UA 3ZSFA 2XD2A 4F2QA 3G3GA 3K4UA 3AXFA 4X1BA 2Q2CA 4GL8A 3N6TA 3CSBA 3LC8A 2Z22A 3MBPA 4IO3A 3FVGA 1LFIA 4NF5B 3FGSA 1Z7ME 1LB8A 2I49A 3KSJA 3MZ9A 5I58A 2ZNTA 2XXRA 4ELRA 1S7YA 4POWA 2O6AA 1SYIA 3PUZE 1IITA 2RCBA 4YICA 3TCHA 1SI1A 2ZNSA 3S9NC 3O2AA 1JW1A 5H8QB 5TP9B 5KCJA 1A40A 4LZ7A 5DEXA 2Q89A 3O28A 4FECA 4XKPA 1B7ZA 1A8FA 1EU8A 2E0SA 2H98A 3CFLA 5I2KB 4ZE8A 3U93A 4IO4A 4DDDA 4YKJA 4G4PA 2Q88A 1MH4A 4R72A 3HN0A 4OFJA 1NH7A 2HAUA 3PUXE 4QHQA 5FHOA 1NMUA 3EPEA 2ONRA 2F7CA 2NVUB 4BDOA 2HAVA 3MZBA 3DP6A 5JTYB 2V93A 2UYFA 3IOWA 5HBCA 2RCAA 3FASA 3KEIA 3VXCA 1OVTA 1SW5A 3JZJA 4IO2A 2NUVA 2V3UA 4G8NA 4WEPA 3M3LA 1R1NA 5I57A 3TELA 4BDQA 1USYH 1TWYA 3O29A 4ZECA 4DXCA 5CMMA 3M3KA 3S2VA 4IO5A 1UTBA 3GLBA 3KOTA 3PPRA 5AE4A 5IAIA 4ZDMA 3QSLA 1O7TA 2H4IA 2ZYMA 4OFOA 2ZNUA 4NF6B 3I3VA 3RUMA 4DXBA 4PP0A 1YCJA 2QRYA 1B4ZA 2Y7KA 5FHMA 2OJTA 3Q26A 4M1VA 1SW4A 4OERA 1XVYA 3R26A 4JBZA 4F3PA 5H8NB 1ATGA 3FV2A 3ZKKA 5K2YA 2Q8JA 2THIA 4U1ZA 1US5A 2A5TA 2O68A 1N3WA 1IEJA 3IOVA 3MQ9A 5LOMA 2REJA 3TAJA 1IUDA 4PFUA 1A99A 3RT6B 5DTBA 2GHBA 3RGYA 1TFAA 3U72A 2ZYOA 3C34A 3CG3A 5M2VA 1SYHA 4MF3A 1LAGE 2X7QA 4HCYA 4JSOA 3LSLA 3T22A 3LSFB 3MVXA 5H8SA 2UXAA 3GBBA 1FTOA 1M5FA 1N84A 2FNCA 2QJEA 5AA2D 3CG1A 3SEUA 4F3GA 5H8FB 3MVZA 4LUBA 1LCFA 3FVKA 4EF2A 3T96B 4JWOA 4DIGA 4F22A 1NNTA 3MPLA 2REGA 4THIA 3KN7A 1NNPA 1MQGA 4IGRA 1ZLQA 3U94A 1CE2A 4FORA 1JNFA 1H44A 3K6XA 1MPCA 5CMBA 1PBQA 4R6KA 3UP9A 3KG2A 3THIA 2VD3A 1TXFA 4DZ1A 4OYVA 3U8QA 3HO7A 4G68C 4RJZA 3FXUA 4K3FA 1R6ZA 2D3IA 2YJPA 2OK2A 3C36A 3EN3A 5CMKA 2X7PA 2Z23A 1QKAA 3IJOB 1PB9A 2CMOA 3T66A 1II5A 1EZPA 5ICQA 3VLUA 3A09A 2V84A 4DCYA 1HSLA 2DOJA 2ALUA 4I1DA 4F1UA 3VLVA 1JEUA 4NTLA 4ELOA 1B58A 4O3CA 1PDAA 5I2NA 4TLLB 2XXPA 1QULA 3V83A 4LZ5A 2W7YA 4OTEA 5BUUA 5EYFA 3WAFA 1KWHA 3PV0E 4QSEA 3VDFA 4R2FA 5J1DA 1B52A 3OSQA 3OO9A 3G3KA 5FTHA 2DSFA 4C1UA 1UIVA 4NWCA 2XX7A 1I6QA 1Q1KA 3QXMA 3SKPA 3L6GA 4TOZA 2CZLA 3TQLA 3H6VA 4MFIA 3DP8A 1TT1A 1R9QA 3LR1A 2GHAA 1FQDA 1XOCA 4ZEIA 4DLDA 2F8DA 4OESA 3ODBA 1OLCA 3FATA 1FQCA 3EHUA 4QFNA 4ESXA 3TFLA 1Y3NA 2DXRA 1QUIA 4KQPA 2I48A 3PPQA 2LAOA 1MY2A 3SEWA 4YKIA 3OELA 2XXTA 3OO6A 3TUSA 1OMPA 4MH5A 4G68B 2O84X 5CM6A 3IR1A 3KJ7A 1N0TA 3UK4A 3GXAA 2I0BA 4H6DA 2DQVA 4NF4B 4MLQA 2IA4A 3M8UA 4R9FA 4YZZA 3USDA 1SI0A 2QL3A 1B2HA 4ZEBA 1QKBA 5K2XA 3KBRA 3B7DA 3GZGA 3VV5A 2F35A 3H6WA 4XKNA 1B5IA 1NNFA 4U23A 2Z8DA 1EZ9A 3RLFE 2R9JA 3CVGA 1BTJA 5IKBA 3H6UA 3JYRA 1N7WA 4XIGQ 5B70A 3OMBA 4IY5A 1PB7A 2DVCA 3E9XA 3OOAA 4LA9A 1JW5A 2ESNA 2OLBA 1B3GA 2O1LA 3VLWA 1MXUA 3PPOA 4ECFA 1FTJA 1H45A 3SETA 3KGCA 4F39A 4Q30B 1IQ7A 2XX9A 5JEIA 3K1NA 5BWJA 2UVJA 1BP5A 2DXYA 4O3BA 3PD9A 2R71A 2QS2A 3OD7A 1B51A 4YB6A 3MJNA 3DLNA 3QUJA 3TODA 5I56A 2XXWA 3EHSA 5ITOA 3RTWB 4G77A 2OBGA 3HV1A 4H0WA 1FTLA 1VSOA 1MXXA 4GRKA 3RPWA 1LSTA 1M5EA 2PMSA 3L6HA 5I59A 2QS4A 4GXAA 3K6VA 3PD8A 1P1WA 1N7XA 2XXIA 2I6EA 3FUZA 1SQYA 2Q9TA 3IJXB 1P1UA 4Z0IA 1P1QA 1B1XA 3SEYA 3T9UA 4RPNA 3LSXA 1Y9UA 5A5XA 2P1SA 3MP1A 1BKAA 1GVCA 1P99A 4AQ4A 1XVXA 1B5JA 2ZYKA 4FAJA 4YKPA 3S9EA 5DVJA 3ECRA 1UTHB 3DM0A 1MY3A 1MRPA 2HZKA 5L9OA 3HSTA 3N94A 3RQTA 3A3CA 4KHZE 5H8HB 1P1OA 3IL1B 4N13A 2F97A 1QVSA 3MVWA 1NL5A 5AA4A 4LP2B 2ZYNA 3TDJA 1POY1 1MQIA 3OENA 3TTRA 1AIVA 2DVZA 2PYYA 4BDLA 1YAEA 4MLVA 2DWAA 4EF1A 4FEBA 4GD5A 2QMWA 4UACA 4F3SA 4PETA 1B4HA 4F3BA 1URDA 1B40A 4X1DA 3V89B 4YB7A 4ZE9A 4WKMA 2DWJA 4YMBA 3KFMA 4HCWA 3S9MC 1D4NA 1SW1A 2UVGA 4GOTA 3S9LC 3VXBA 3TMGA 3U92A 4F29A 3O6GA 1A8EA 1PBPA 4RK2A 1CB6A 3KOSA 4JXIA 2E1SA 5EHSA 1IIWA 4NF8A 1T0KA 2Q2AA 3TTMA 1GR2A 4U2RA 5TPAA 3LSWA 3E4RA 5I58B 2X26A 4H8IA 3CRBA 2D21A 1B32A 2Z8EA 1NKXA 3MC2A 2DP8A 3MZ1A 4HTGA 3UIFA 5KDTA 3FJMA 4C1TA 1POTA 3CFXA 4YMAA 4XKRA 5KCJB 3G7WA 3W9WA 3LUYA 3BBRA 1IXIA 2ZXTA 2IEEA 5AA2A 3IB1A 3HHGA 5DEXB 4P0GA 5DVFA 2F6GA 4XTCQ 2B3FA 1S9TA 3F11A 1OLAA 1MXVA 1H76A 1Y4TA 2H5YA 3I5OA 3QUFA 4U4SA 5DYHA 5AA3A 2HXWA 4LVQA 3DELB 3IB0A 5CRYA 3Q29A 1ZKBA 3FJGA 2RC7A 4LQ2A 3KN8A 5I84A 2Y7PA 4X9TA 3DP4A 3T9VA 1B05A 3LBSA 1HSEA 1XS5A 2VGQA 1M5CA 3S4UA 3P7IA 1ELJA 2NOOA 3O97A 3IORA 3OO7A 3TCGA 1J1NA 3UGWA 4EXLA 4Q5TA 4OVJA 4U1OA 3H06B 3FD3A 2ONKE 3W9VA 4GLIA 4I62A 5I57B 2I3WA 3G3HA 3K6UA 1ZMGA 3R6UA 2H99A 2RINA 4PFYA 2OWSA 4R6YA 2Y7WA 3T9HB 3TZAA 1UTBB 4GF8A 2F6PA 2F34A 3I6VA 2DE2A 1MQJA 3C4MA 3MP8A 3BKIB 1QJMA 4JSDA 1O63A 2AL5A 2Y84A 1LB9A 3B6TA 3K00A 4KYSA 2AL4A 1H43A 1OQGA 4F18A 1USYE 2G29A 4DXUA 5B7DA 1IXHA 4H5FA 2A5TB 4PFTA 4YB5A 1MXZA 2GH9A 4Q0CA 3K2DA 4AB5A 2Y7RA 4NE4A 1JW4A 3MWBA 3OSRA 1NFTA 1ZBMA 1ZJLA 1WODA 1MM6A 4NF5A 1PEBA 4ELQA 3OO8A 3IB2A 3IO4A 4RPOA 1LAHE 1IXCA 4PFWA 1DPPA 4MBPA 4H65A 2ANJA 4KYEA 5H8QA 5TP9A 2XHDA 3CFZA 2M8CA 2I0CA 3SDFA 2HEUA 1NH8A 1FQBA 1D9YA 1UIUA 4H67A 2Z8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OET A;  1S50 A;  3TQW A;  3UN6 A;  1H3D A;  2FA7 A;  3N5L A;  1L5T A;  1Y20 A;  2F78 A;  5I2K A;  4JWY A;  1Y4C A;  3R7X A;  1N3X A;  2H25 A;  4HS7 A;  4Z7E A;  3EF7 A;  5JK4 A;  5FHN A;  1B9J A;  1UQW A;  3PPP A;  3TYH A;  3FJ7 A;  4KPT A;  3FIR A;  3MVY A;  1MG1 A;  4E0W A;  3SEX A;  1Y3P A;  4ND9 A;  2RC8 A;  1F9B A;  5JTY A;  1WVJ A;  4F1V A;  2PBW A;  1DTG A;  2BJJ X;  5L9S A;  3IAZ A;  4POX A;  2OZZ A;  3QK6 A;  4ESW A;  1MXY A;  3K1M A;  1URS A;  3MAM A;  3TTK A;  4I9D A;  5I2N B;  4GXS B;  3RTF B;  4ZS9 A;  3VVF A;  2XXQ A;  1QW0 A;  1XHY A;  1BIY A;  1D3K A;  1SD3 A;  3TPA A;  3D4C A;  2I4B A;  1A54 A;  4JDF A;  4U22 A;  3UOR A;  2QS3 A;  2UYE A;  4EXK A;  5HPQ A;  1MQH A;  4AB6 A;  3PMW A;  2AIX A;  3OEM A;  2O51 A;  2A5S A;  1LGB C;  3SEV A;  5KZT A;  3O6I A;  4JB7 A;  4EQ9 A;  3VFJ A;  4L17 A;  4OEU A;  3TEP A;  3FZV A;  5ELV A;  4QRZ A;  3TCF A;  3TKD A;  4NF6 A;  3T93 B;  5ICT A;  1EH3 A;  2ABH A;  3HHF A;  3QIM A;  4M4G A;  2F7B A;  3ZKL A;  2V3T A;  1MQD A;  3HCQ A;  3K02 A;  1I6A A;  1JEV A;  3G3I A;  3N26 A;  1MPD A;  4OMB A;  4OHN A;  1B5H A;  4JWX A;  1SBP A;  3WAE A;  4BDN A;  2XXY A;  5H8N A;  1HSJ A;  4P11 A;  3RN8 A;  3B6Q A;  2AYS A;  2NXO A;  4ZZA A;  4IO7 A;  4EQB A;  1B3L A;  1B6H A;  3RT8 A;  4OXV A;  1XC1 A;  1FTK A;  4E0X A;  3KN3 A;  2PX1 A;  1DOT A;  3TTL A;  3M3F A;  1JVY A;  3KZG A;  4KR5 A;  2V25 A;  1IXG A;  1IZ1 A;  1LBC A;  4GL0 A;  3K0V A;  2VP1 A;  2HFB A;  5H8F A;  2H9B A;  2WKY A;  1OIB A;  3IK6 B;  1DSN A;  3O66 A;  1MDQ A;  1SDX A;  3K01 A;  1B7H A;  4R74 A;  4FAT A;  3T9X B;  2FYI A;  2YPN A;  1MS7 A;  4YAH X;  4DCX A;  4RYA A;  3VVE A;  4LQ5 A;  1ZIU A;  4ZZE A;  4F1Y A;  2DS9 A;  1GGG A;  3RY3 A;  2P2A A;  4LZ8 A;  3OXN A;  4EQ7 A;  1FW0 A;  3FXQ A;  2RF1 A;  3CI8 A;  5FTI A;  4G2Z A;  2XXU A;  4KI0 E;  3G3J A;  4XXU A;  3VVD A;  1B0H A;  4H5G A;  4NMY A;  2HZL A;  4KD5 A;  3OEK A;  2P0S A;  1VFD A;  5I56 B;  4N07 A;  2D5W A;  2PVU A;  2UVH A;  2QS1 A;  1MDP 1;  4EDP A;  1MY0 A;  3PMX A;  3ILU B;  2GFE A;  1FQF A;  1TFD A;  3MW0 A;  4FE8 A;  4KFQ A;  4BLA A;  5I59 B;  4I8C A;  2OWT A;  1Z7N E;  4OZ9 A;  3K1P A;  4KCD A;  1DTZ A;  4G8H A;  3H4Z A;  1SW2 A;  1YPN A;  2PT1 A;  3MPK A;  4OEV A;  4RXL A;  1MH3 A;  3FV1 A;  5F1Q A;  4QSD A;  4DE8 A;  5A5X B;  1A55 A;  2NWJ A;  1MM7 A;  4TQU Q;  1AOV A;  4F2O A;  3H03 A;  3KSX A;  4X48 A;  5DT6 A;  1MXW A;  4OQO A;  4LAT A;  2QSX A;  3ILT B;  4H1X A;  2I58 A;  2G93 A;  4IO6 A;  1MY1 A;  4O3A A;  2VHA A;  4C0R A;  1GTK A;  2DWH A;  4QF9 A;  4YU0 A;  1P1N A;  4IB2 A;  5L9M A;  3C33 A;  1O64 A;  2UVI A;  3A3U A;  4QFK A;  2KLF A;  4R75 A;  4G68 A;  1LFG A;  2B65 A;  4FJP A;  5L8D A;  3Q25 A;  1JVX A;  4F31 B;  3U1O A;  3V5A A;  1Y1Z A;  3IOU A;  4NWD A;  2DWI A;  5CC2 A;  1US4 A;  3C32 A;  4NF4 A;  5AA4 B;  5HM4 B;  3IO6 A;  3UA8 A;  1N04 A;  2DE4 A;  5ITP A;  3PMV A;  3H3G A;  3FVN A;  4KYD A;  1LAF E;  2RKM A;  4OEN A;  2O7I A;  1BLF A;  4P0I A;  1ZU0 A;  1VR5 A;  3G3F A;  4OWD A;  4BDR A;  2R6G E;  3EQ1 A;  3Q28 A;  4G8M A;  3PPN A;  3GBA A;  3V8X B;  3HPI A;  1LLS A;  1QUJ A;  2XD3 A;  3H6T A;  2VOZ A;  4QSC A;  3C9H A;  3PUV E;  1FCK A;  2I3V A;  5CI5 A;  1AMF A;  1LBB A;  1Y3Q A;  3CIJ A;  1B1H A;  1FTM A;  3FXR A;  3EHT A;  4GIZ A;  5TU0 A;  1M5B A;  3E13 X;  4ZED A;  1R9L A;  4N6P A;  2HCA A;  1MPB A;  1DPE A;  1JET A;  1PB8 A;  3KJT A;  4FIM A;  2YLN A;  3MP6 A;  2XX8 A;  2RC9 A;  3K6W A;  2F5X A;  4NF8 B;  1I69 A;  3FVO A;  4IY6 A;  5TPA B;  1ZTY A;  1B3F A;  2PT2 A;  4ISU A;  4BDM A;  3O9P A;  4IGT A;  4ZEK A;  1JQF A;  2ZMB A;  3MUQ A;  5KDT B;  4LON B;  1VE4 A;  1SVX B;  3CR9 A;  3ZS6 A;  5CMC A;  2O7U A;  3CSG A;  5AA2 B;  4ONY A;  1AL3 A;  1RYX A;  4XKQ A;  1RKM A;  5ISU A;  1RYO A;  5DVI A;  4ELP A;  1OVB A;  2O1M A;  3N6U A;  4UA8 A;  2XXX A;  3PGF A;  1GV8 A;  3PUY E;  3RNN A;  3ONM A;  3SER A;  5EHM A;  3E3K A;  3QYT A;  4R73 A;  4U21 A;  3QAX A;  4F19 A;  1NNK A;  3TTN A;  4GVO A;  4KCC A;  1WDN A;  4OFL A;  2OCU A;  1URG A;  3W15 C;  3B6W A;  3BFU A;  1VFE A;  4RNS A;  2HQ0 A;  1N76 A;  4QFP A;  3Q27 A;  1UTH A;  4EUO A;  4YKK A;  4QFL A;  1OQH A;  2O69 A;  1B3H A;  2Y7I A;  1DMB A;  3BFT A;  3SES A;  2QMX A;  1FQE A;  5H8H A;  5CBR A;  1EZO A;  1XT8 A;  2I4C A;  3O6H A;  1B3E A;  1LAX A;  2B3B A;  4HW8 A;  2DYX A;  2DE3 A;  2GRV A;  4GWO A;  2QPQ A;  1Q35 A;  3C31 A;  3PU5 A;  1A7L A;  2V3Q A;  4PQJ A;  1AH5 A;  2F36 A;  1ANF A;  4H8J A;  5CBS A;  3PUW E;  1PC3 A;  5F7V A;  4WED A;  2F7A A;  4TLM B;  4R2B A;  4R9G A;  4U4X A;  1LCT A;  1I6B A;  3IOT A;  2VD2 A;  3IX1 A;  1QUK A;  1MY4 A;  3VE1 B;  3C35 A;  1Y1M A;  4R6H A;  1YTV A;  3JV9 A;  2ONS A;  4GQO A;  4FED A;  1D9V A;  2XXV A;  4GFR A;  5AA1 A;  2XXH A;  4ZEF A;  1LFH A;  4PE5 B;  4WXJ A;  1B46 A;  3H7M A;  1FQA A;  4NED A;  4RK9 A;  3D4G A;  4RA1 A;  1M5D A;  4QFO A;  4RY1 A;  4Q8R A;  1B0L A;  1B7U A;  3ZSF A;  2XD2 A;  4F2Q A;  3G3G A;  3K4U A;  3AXF A;  4X1B A;  2Q2C A;  4GL8 A;  3N6T A;  3CSB A;  3LC8 A;  2Z22 A;  3MBP A;  4IO3 A;  3FVG A;  1LFI A;  4NF5 B;  3FGS A;  1Z7M E;  1LB8 A;  2I49 A;  3KSJ A;  3MZ9 A;  5I58 A;  2ZNT A;  2XXR A;  4ELR A;  1S7Y A;  4POW A;  2O6A A;  1SYI A;  3PUZ E;  1IIT A;  2RCB A;  4YIC A;  3TCH A;  1SI1 A;  2ZNS A;  3S9N C;  3O2A A;  1JW1 A;  5H8Q B;  5TP9 B;  5KCJ A;  1A40 A;  4LZ7 A;  5DEX A;  2Q89 A;  3O28 A;  4FEC A;  4XKP A;  1B7Z A;  1A8F A;  1EU8 A;  2E0S A;  2H98 A;  3CFL A;  5I2K B;  4ZE8 A;  3U93 A;  4IO4 A;  4DDD A;  4YKJ A;  4G4P A;  2Q88 A;  1MH4 A;  4R72 A;  3HN0 A;  4OFJ A;  1NH7 A;  2HAU A;  3PUX E;  4QHQ A;  5FHO A;  1NMU A;  3EPE A;  2ONR A;  2F7C A;  2NVU B;  4BDO A;  2HAV A;  3MZB A;  3DP6 A;  5JTY B;  2V93 A;  2UYF A;  3IOW A;  5HBC A;  2RCA A;  3FAS A;  3KEI A;  3VXC A;  1OVT A;  1SW5 A;  3JZJ A;  4IO2 A;  2NUV A;  2V3U A;  4G8N A;  4WEP A;  3M3L A;  1R1N A;  5I57 A;  3TEL A;  4BDQ A;  1USY H;  1TWY A;  3O29 A;  4ZEC A;  4DXC A;  5CMM A;  3M3K A;  3S2V A;  4IO5 A;  1UTB A;  3GLB A;  3KOT A;  3PPR A;  5AE4 A;  5IAI A;  4ZDM A;  3QSL A;  1O7T A;  2H4I A;  2ZYM A;  4OFO A;  2ZNU A;  4NF6 B;  3I3V A;  3RUM A;  4DXB A;  4PP0 A;  1YCJ A;  2QRY A;  1B4Z A;  2Y7K A;  5FHM A;  2OJT A;  3Q26 A;  4M1V A;  1SW4 A;  4OER A;  1XVY A;  3R26 A;  4JBZ A;  4F3P A;  5H8N B;  1ATG A;  3FV2 A;  3ZKK A;  5K2Y A;  2Q8J A;  2THI A;  4U1Z A;  1US5 A;  2A5T A;  2O68 A;  1N3W A;  1IEJ A;  3IOV A;  3MQ9 A;  5LOM A;  2REJ A;  3TAJ A;  1IUD A;  4PFU A;  1A99 A;  3RT6 B;  5DTB A;  2GHB A;  3RGY A;  1TFA A;  3U72 A;  2ZYO A;  3C34 A;  3CG3 A;  5M2V A;  1SYH A;  4MF3 A;  1LAG E;  2X7Q A;  4HCY A;  4JSO A;  3LSL A;  3T22 A;  3LSF B;  3MVX A;  5H8S A;  2UXA A;  3GBB A;  1FTO A;  1M5F A;  1N84 A;  2FNC A;  2QJE A;  5AA2 D;  3CG1 A;  3SEU A;  4F3G A;  5H8F B;  3MVZ A;  4LUB A;  1LCF A;  3FVK A;  4EF2 A;  3T96 B;  4JWO A;  4DIG A;  4F22 A;  1NNT A;  3MPL A;  2REG A;  4THI A;  3KN7 A;  1NNP A;  1MQG A;  4IGR A;  1ZLQ A;  3U94 A;  1CE2 A;  4FOR A;  1JNF A;  1H44 A;  3K6X A;  1MPC A;  5CMB A;  1PBQ A;  4R6K A;  3UP9 A;  3KG2 A;  3THI A;  2VD3 A;  1TXF A;  4DZ1 A;  4OYV A;  3U8Q A;  3HO7 A;  4G68 C;  4RJZ A;  3FXU A;  4K3F A;  1R6Z A;  2D3I A;  2YJP A;  2OK2 A;  3C36 A;  3EN3 A;  5CMK A;  2X7P A;  2Z23 A;  1QKA A;  3IJO B;  1PB9 A;  2CMO A;  3T66 A;  1II5 A;  1EZP A;  5ICQ A;  3VLU A;  3A09 A;  2V84 A;  4DCY A;  1HSL A;  2DOJ A;  2ALU A;  4I1D A;  4F1U A;  3VLV A;  1JEU A;  4NTL A;  4ELO A;  1B58 A;  4O3C A;  1PDA A;  5I2N A;  4TLL B;  2XXP A;  1QUL A;  3V83 A;  4LZ5 A;  2W7Y A;  4OTE A;  5BUU A;  5EYF A;  3WAF A;  1KWH A;  3PV0 E;  4QSE A;  3VDF A;  4R2F A;  5J1D A;  1B52 A;  3OSQ A;  3OO9 A;  3G3K A;  5FTH A;  2DSF A;  4C1U A;  1UIV A;  4NWC A;  2XX7 A;  1I6Q A;  1Q1K A;  3QXM A;  3SKP A;  3L6G A;  4TOZ A;  2CZL A;  3TQL A;  3H6V A;  4MFI A;  3DP8 A;  1TT1 A;  1R9Q A;  3LR1 A;  2GHA A;  1FQD A;  1XOC A;  4ZEI A;  4DLD A;  2F8D A;  4OES A;  3ODB A;  1OLC A;  3FAT A;  1FQC A;  3EHU A;  4QFN A;  4ESX A;  3TFL A;  1Y3N A;  2DXR A;  1QUI A;  4KQP A;  2I48 A;  3PPQ A;  2LAO A;  1MY2 A;  3SEW A;  4YKI A;  3OEL A;  2XXT A;  3OO6 A;  3TUS A;  1OMP A;  4MH5 A;  4G68 B;  2O84 X;  5CM6 A;  3IR1 A;  3KJ7 A;  1N0T A;  3UK4 A;  3GXA A;  2I0B A;  4H6D A;  2DQV A;  4NF4 B;  4MLQ A;  2IA4 A;  3M8U A;  4R9F A;  4YZZ A;  3USD A;  1SI0 A;  2QL3 A;  1B2H A;  4ZEB A;  1QKB A;  5K2X A;  3KBR A;  3B7D A;  3GZG A;  3VV5 A;  2F35 A;  3H6W A;  4XKN A;  1B5I A;  1NNF A;  4U23 A;  2Z8D A;  1EZ9 A;  3RLF E;  2R9J A;  3CVG A;  1BTJ A;  5IKB A;  3H6U A;  3JYR A;  1N7W A;  4XIG Q;  5B70 A;  3OMB A;  4IY5 A;  1PB7 A;  2DVC A;  3E9X A;  3OOA A;  4LA9 A;  1JW5 A;  2ESN A;  2OLB A;  1B3G A;  2O1L A;  3VLW A;  1MXU A;  3PPO A;  4ECF A;  1FTJ A;  1H45 A;  3SET A;  3KGC A;  4F39 A;  4Q30 B;  1IQ7 A;  2XX9 A;  5JEI A;  3K1N A;  5BWJ A;  2UVJ A;  1BP5 A;  2DXY A;  4O3B A;  3PD9 A;  2R71 A;  2QS2 A;  3OD7 A;  1B51 A;  4YB6 A;  3MJN A;  3DLN A;  3QUJ A;  3TOD A;  5I56 A;  2XXW A;  3EHS A;  5ITO A;  3RTW B;  4G77 A;  2OBG A;  3HV1 A;  4H0W A;  1FTL A;  1VSO A;  1MXX A;  4GRK A;  3RPW A;  1LST A;  1M5E A;  2PMS A;  3L6H A;  5I59 A;  2QS4 A;  4GXA A;  3K6V A;  3PD8 A;  1P1W A;  1N7X A;  2XXI A;  2I6E A;  3FUZ A;  1SQY A;  2Q9T A;  3IJX B;  1P1U A;  4Z0I A;  1P1Q A;  1B1X A;  3SEY A;  3T9U A;  4RPN A;  3LSX A;  1Y9U A;  5A5X A;  2P1S A;  3MP1 A;  1BKA A;  1GVC A;  1P99 A;  4AQ4 A;  1XVX A;  1B5J A;  2ZYK A;  4FAJ A;  4YKP A;  3S9E A;  5DVJ A;  3ECR A;  1UTH B;  3DM0 A;  1MY3 A;  1MRP A;  2HZK A;  5L9O A;  3HST A;  3N94 A;  3RQT A;  3A3C A;  4KHZ E;  5H8H B;  1P1O A;  3IL1 B;  4N13 A;  2F97 A;  1QVS A;  3MVW A;  1NL5 A;  5AA4 A;  4LP2 B;  2ZYN A;  3TDJ A;  1POY 1;  1MQI A;  3OEN A;  3TTR A;  1AIV A;  2DVZ A;  2PYY A;  4BDL A;  1YAE A;  4MLV A;  2DWA A;  4EF1 A;  4FEB A;  4GD5 A;  2QMW A;  4UAC A;  4F3S A;  4PET A;  1B4H A;  4F3B A;  1URD A;  1B40 A;  4X1D A;  3V89 B;  4YB7 A;  4ZE9 A;  4WKM A;  2DWJ A;  4YMB A;  3KFM A;  4HCW A;  3S9M C;  1D4N A;  1SW1 A;  2UVG A;  4GOT A;  3S9L C;  3VXB A;  3TMG A;  3U92 A;  4F29 A;  3O6G A;  1A8E A;  1PBP A;  4RK2 A;  1CB6 A;  3KOS A;  4JXI A;  2E1S A;  5EHS A;  1IIW A;  4NF8 A;  1T0K A;  2Q2A A;  3TTM A;  1GR2 A;  4U2R A;  5TPA A;  3LSW A;  3E4R A;  5I58 B;  2X26 A;  4H8I A;  3CRB A;  2D21 A;  1B32 A;  2Z8E A;  1NKX A;  3MC2 A;  2DP8 A;  3MZ1 A;  4HTG A;  3UIF A;  5KDT A;  3FJM A;  4C1T A;  1POT A;  3CFX A;  4YMA A;  4XKR A;  5KCJ B;  3G7W A;  3W9W A;  3LUY A;  3BBR A;  1IXI A;  2ZXT A;  2IEE A;  5AA2 A;  3IB1 A;  3HHG A;  5DEX B;  4P0G A;  5DVF A;  2F6G A;  4XTC Q;  2B3F A;  1S9T A;  3F11 A;  1OLA A;  1MXV A;  1H76 A;  1Y4T A;  2H5Y A;  3I5O A;  3QUF A;  4U4S A;  5DYH A;  5AA3 A;  2HXW A;  4LVQ A;  3DEL B;  3IB0 A;  5CRY A;  3Q29 A;  1ZKB A;  3FJG A;  2RC7 A;  4LQ2 A;  3KN8 A;  5I84 A;  2Y7P A;  4X9T A;  3DP4 A;  3T9V A;  1B05 A;  3LBS A;  1HSE A;  1XS5 A;  2VGQ A;  1M5C A;  3S4U A;  3P7I A;  1ELJ A;  2NOO A;  3O97 A;  3IOR A;  3OO7 A;  3TCG A;  1J1N A;  3UGW A;  4EXL A;  4Q5T A;  4OVJ A;  4U1O A;  3H06 B;  3FD3 A;  2ONK E;  3W9V A;  4GLI A;  4I62 A;  5I57 B;  2I3W A;  3G3H A;  3K6U A;  1ZMG A;  3R6U A;  2H99 A;  2RIN A;  4PFY A;  2OWS A;  4R6Y A;  2Y7W A;  3T9H B;  3TZA A;  1UTB B;  4GF8 A;  2F6P A;  2F34 A;  3I6V A;  2DE2 A;  1MQJ A;  3C4M A;  3MP8 A;  3BKI B;  1QJM A;  4JSD A;  1O63 A;  2AL5 A;  2Y84 A;  1LB9 A;  3B6T A;  3K00 A;  4KYS A;  2AL4 A;  1H43 A;  1OQG A;  4F18 A;  1USY E;  2G29 A;  4DXU A;  5B7D A;  1IXH A;  4H5F A;  2A5T B;  4PFT A;  4YB5 A;  1MXZ A;  2GH9 A;  4Q0C A;  3K2D A;  4AB5 A;  2Y7R A;  4NE4 A;  1JW4 A;  3MWB A;  3OSR A;  1NFT A;  1ZBM A;  1ZJL A;  1WOD A;  1MM6 A;  4NF5 A;  1PEB A;  4ELQ A;  3OO8 A;  3IB2 A;  3IO4 A;  4RPO A;  1LAH E;  1IXC A;  4PFW A;  1DPP A;  4MBP A;  4H65 A;  2ANJ A;  4KYE A;  5H8Q A;  5TP9 A;  2XHD A;  3CFZ A;  2M8C A;  2I0C A;  3SDF A;  2HEU A;  1NH8 A;  1FQB A;  1D9Y A;  1UIU A;  4H67 A;  2Z8F A; 
#chains in the Genus database with same CATH topology
 4QBA A;  4OET A;  1S50 A;  3TQW A;  3UN6 A;  1H3D A;  2FA7 A;  3N5L A;  1L5T A;  1Y20 A;  2F78 A;  4MEV A;  5I2K A;  4JWY A;  1Y4C A;  3R7X A;  1EYJ A;  1N3X A;  2H25 A;  4HS7 A;  4Z7E A;  3EF7 A;  5JK4 A;  2CZH A;  5FHN A;  1B9J A;  1UQW A;  3PPP A;  3TYH A;  3FJ7 A;  4KPT A;  3FIR A;  3MVY A;  1MG1 A;  4E0W A;  3SEX A;  1Y3P A;  1RDX A;  1LBV A;  4ND9 A;  2RC8 A;  1F9B A;  5JTY A;  1WVJ A;  4F1V A;  2PBW A;  1DTG A;  3LUZ A;  2BJJ X;  5L9S A;  3IAZ A;  4POX A;  2OZZ A;  3QK6 A;  4ESW A;  1MXY A;  3K1M A;  1URS A;  3MAM A;  3TTK A;  4I9D A;  5I2N B;  4GXS B;  3RTF B;  4ZS9 A;  3VVF A;  2XXQ A;  4P9K A;  1QW0 A;  1XHY A;  1BIY A;  1D3K A;  4PBQ A;  1SD3 A;  1FJ6 A;  3TPA A;  4HXV A;  3D4C A;  2I4B A;  1A54 A;  4JDF A;  4HE2 A;  1NV2 A;  4U22 A;  3UOR A;  2QS3 A;  2UYE A;  1FBF A;  4EXK A;  5HPQ A;  1MQH A;  4AB6 A;  3PMW A;  2AIX A;  3OEM A;  1NUW A;  2O51 A;  2A5S A;  1LGB C;  3SEV A;  5KZT A;  3O6I A;  4P47 A;  4JB7 A;  4EQ9 A;  3VFJ A;  4L17 A;  4OEU A;  3NOH A;  3TEP A;  3FZV A;  5ELV A;  4NX1 A;  4QRZ A;  3TCF A;  3TKD A;  4NF6 A;  4MNP A;  3T93 B;  5ICT A;  1EH3 A;  2ABH A;  3HHF A;  4I3E A;  3QIM A;  4M4G A;  2F7B A;  3ZKL A;  5IZ1 A;  2V3T A;  1MQD A;  3HCQ A;  3K02 A;  1I6A A;  1JEV A;  3G3I A;  3N26 A;  1MPD A;  3U65 A;  4PE3 A;  4OMB A;  4OHN A;  1B5H A;  4JWX A;  1SBP A;  3WAE A;  4OVQ A;  4BDN A;  2XXY A;  5H8N A;  1HSJ A;  4P11 A;  4GWX A;  3B6Q A;  3RN8 A;  2AYS A;  1Q9D A;  2NXO A;  4N6K A;  4ZZA A;  4IO7 A;  4EQB A;  1B3L A;  1FJ9 A;  1B6H A;  4PC9 A;  3RT8 A;  4OXV A;  2ZZW A;  1XC1 A;  2DDK A;  2R8T A;  1FTK A;  1FBC A;  4E0X A;  3KN3 A;  5ESY A;  2PX1 A;  1DOT A;  3TTL A;  3M3F A;  1JVY A;  3KZG A;  4KR5 A;  2V25 A;  1IXG A;  1IZ1 A;  1LBC A;  4GL0 A;  3K0V A;  3SZP A;  2P3V A;  2VP1 A;  4GWW A;  2HFB A;  5H8F A;  2H9B A;  4MHF A;  2WKY A;  1OIB A;  1NV4 A;  3IK6 B;  1DCU A;  1DSN A;  3O66 A;  1MDQ A;  1SDX A;  3K01 A;  1B7H A;  4R74 A;  4PGP A;  4FAT A;  3T9X B;  2FYI A;  2YPN A;  1MS7 A;  4YAH X;  4DCX A;  4RYA A;  3VVE A;  4LQ5 A;  1ZIU A;  4ZZE A;  4F1Y A;  2DS9 A;  1GGG A;  3RY3 A;  2P2A A;  4LZ8 A;  5I5P A;  3OXN A;  4EQ7 A;  1FW0 A;  3FXQ A;  2RF1 A;  3CI8 A;  5FTI A;  4G2Z A;  2XXU A;  4KI0 E;  3G3J A;  4XXU A;  3VVD A;  1B0H A;  4H5G A;  4NMY A;  2HZL A;  4KD5 A;  3OEK A;  2P0S A;  1VFD A;  5I56 B;  4N07 A;  2D5W A;  2XWV A;  2PVU A;  2UVH A;  2QS1 A;  1MDP 1;  4EDP A;  1G0I A;  1MY0 A;  3PMX A;  4PDH A;  3ILU B;  2GFE A;  1FQF A;  1TFD A;  3MW0 A;  4FE8 A;  4KFQ A;  4BLA A;  5I59 B;  4I8C A;  2OWT A;  4PFI A;  1VDW A;  1Z7N E;  4OZ9 A;  3K1P A;  4KCD A;  4OAN A;  1DTZ A;  4G8H A;  3H4Z A;  1SW2 A;  1YPN A;  2PT1 A;  3MPK A;  4OEV A;  4RXL A;  1MH3 A;  3FV1 A;  5F1Q A;  3RYD A;  4QSD A;  4DE8 A;  5A5X B;  1A55 A;  2NWJ A;  1MM7 A;  4TQU Q;  1IMC A;  1AOV A;  4F2O A;  3H03 A;  4XEQ A;  4N4U A;  3KSX A;  4X48 A;  5DT6 A;  1MXW A;  4OQO A;  4LAT A;  2QSX A;  4NF0 A;  3ILT B;  4MIJ A;  4H1X A;  2I58 A;  1IME A;  2G93 A;  4IO6 A;  1MY1 A;  1G0H A;  4O3A A;  2VHA A;  4C0R A;  1GTK A;  2DWH A;  5EQ7 A;  4PF8 A;  4QF9 A;  4YU0 A;  1P1N A;  4IB2 A;  3IFC A;  5L9M A;  3C33 A;  1O64 A;  2UVI A;  3A3U A;  4QFK A;  2KLF A;  4R75 A;  4G68 A;  1LFG A;  2B65 A;  4FJP A;  5L8D A;  3Q25 A;  1JVX A;  4F31 B;  3U1O A;  3V5A A;  1Y1Z A;  3IOU A;  4NWD A;  2DWI A;  5CC2 A;  1US4 A;  3C32 A;  4NF4 A;  5AA4 B;  5HM4 B;  5J16 A;  3IO6 A;  3T1B A;  3UA8 A;  1N04 A;  2DE4 A;  5ITP A;  3PMV A;  3H3G A;  3FVN A;  4KYD A;  4O7M A;  1LAF E;  2RKM A;  4OEN A;  2O7I A;  1BLF A;  4P0I A;  2KR0 A;  1ZU0 A;  1VR5 A;  3G3F A;  4OWD A;  4BDR A;  2R6G E;  3RPL A;  3EQ1 A;  3Q28 A;  4G8M A;  4PAI A;  3PPN A;  3GBA A;  4PTK A;  4N17 A;  3V8X B;  3HPI A;  1LLS A;  1QUJ A;  2XD3 A;  3H6T A;  2Y5K A;  2VOZ A;  4QSC A;  3C9H A;  3PUV E;  1FCK A;  2I3V A;  5CI5 A;  1AMF A;  1LBB A;  1Y3Q A;  3CIJ A;  2HHM A;  1B1H A;  1FTM A;  1NV1 A;  3FXR A;  3EHT A;  4GIZ A;  3ISP A;  5TU0 A;  4GWY A;  1M5B A;  3E13 X;  4ZED A;  2CZK A;  1K9Y A;  1R9L A;  4N6P A;  2HCA A;  1MPB A;  4G61 A;  1DPE A;  1JET A;  1PB8 A;  3KJT A;  4FIM A;  2YLN A;  3MP6 A;  2XX8 A;  2RC9 A;  3K6W A;  2F5X A;  5EYG A;  1NV6 A;  3FXB A;  4NF8 B;  1I69 A;  2Q8M A;  3FVO A;  4IY6 A;  5TPA B;  1ZTY A;  1B3F A;  2PFY A;  2PT2 A;  4ISU A;  4BDM A;  3O9P A;  4IGT A;  4ZEK A;  1JQF A;  2ZMB A;  3MUQ A;  5KDT B;  4LON B;  1FBD A;  1VE4 A;  2XWI A;  1SVX B;  3CR9 A;  3ZS6 A;  5CMC A;  2O7U A;  4MNI A;  3CSG A;  5AA2 B;  4ONY A;  5ET5 A;  1AL3 A;  1RYX A;  4XKQ A;  1RKM A;  5ISU A;  1RYO A;  5DVI A;  4ELP A;  1OVB A;  2O1M A;  3N6U A;  4UA8 A;  2XXX A;  3PGF A;  1GV8 A;  3PUY E;  3RNN A;  3ONM A;  3SER A;  5EHM A;  3E3K A;  3QYT A;  4R73 A;  4U21 A;  3QAX A;  4F19 A;  1NNK A;  3TTN A;  4GVO A;  4KCC A;  1WDN A;  4OFL A;  2OCU A;  1URG A;  3W15 C;  3B6W A;  3BFU A;  5IZZ A;  1VFE A;  4RNS A;  2HQ0 A;  1N76 A;  4QFP A;  3Q27 A;  1UTH A;  4EUO A;  1RDY A;  4YKK A;  4QFL A;  1OQH A;  2O69 A;  1B3H A;  2Y7I A;  1DMB A;  2WBB A;  3BFT A;  3SES A;  2QMX A;  1FQE A;  5H8H A;  5CBR A;  1EZO A;  1XT8 A;  4N91 A;  2I4C A;  3O6H A;  1B3E A;  1LAX A;  2WYK A;  2B3B A;  4HW8 A;  2DYX A;  2DE3 A;  4NG7 A;  2GRV A;  4GWO A;  2QPQ A;  1Q35 A;  3C31 A;  3PU5 A;  1A7L A;  2V3Q A;  4PQJ A;  1AH5 A;  2F36 A;  1ANF A;  4H8J A;  2JJK A;  5CBS A;  3PUW E;  1PC3 A;  4WED A;  5F7V A;  1JP4 A;  2F7A A;  4TLM B;  4R2B A;  4R9G A;  4U4X A;  1LCT A;  1NV7 A;  5I7I A;  1I6B A;  3IOT A;  2VD2 A;  4NGU A;  3IX1 A;  1QUK A;  1MY4 A;  3VE1 B;  3C35 A;  4GWZ A;  1Y1M A;  4R6H A;  1YTV A;  3JV9 A;  2ONS A;  4GQO A;  4FED A;  2QVV A;  1D9V A;  2XXV A;  4GFR A;  5AA1 A;  2ZZX A;  1IMB A;  2XXH A;  2WBD A;  4ZEF A;  1LFH A;  4PE5 B;  4WXJ A;  1B46 A;  3H7M A;  5IZ3 B;  1FQA A;  4NED A;  4RK9 A;  3D4G A;  4N8Y A;  4RA1 A;  1IMF A;  1M5D A;  4QFO A;  4RY1 A;  4Q8R A;  2XWK A;  1B0L A;  1B7U A;  3E78 A;  3ZSF A;  2XA5 A;  2XD2 A;  2V4C A;  3A29 A;  5EQA A;  4F2Q A;  3G3G A;  3K4U A;  2Q74 A;  3AXF A;  1KZ8 A;  4X1B A;  2Q2C A;  1YZ0 A;  4GL8 A;  3N6T A;  3CSB A;  3LC8 A;  2Z22 A;  3MBP A;  4IO3 A;  3FVG A;  1LFI A;  4HE1 A;  4NF5 B;  1FBH A;  3FGS A;  1Z7M E;  1LB8 A;  2I49 A;  3KSJ A;  3MZ9 A;  5I58 A;  4KXP A;  2ZNT A;  2XXR A;  4ELR A;  1S7Y A;  4POW A;  2O6A A;  1SYI A;  3PUZ E;  1IIT A;  2RCB A;  1YYZ A;  4YIC A;  1XI6 A;  3EKI A;  3TCH A;  1SI1 A;  2ZNS A;  3S9N C;  3O2A A;  1JW1 A;  5H8Q B;  4MX6 A;  5TP9 B;  5KCJ A;  3KBZ A;  1A40 A;  1EYI A;  4LZ7 A;  5DEX A;  2Q89 A;  5F24 A;  3O28 A;  4FEC A;  4XKP A;  1B7Z A;  1A8F A;  1EU8 A;  2E0S A;  2H98 A;  3CFL A;  5I2K B;  4ZE8 A;  3U93 A;  4IO4 A;  4DDD A;  4YKJ A;  4G4P A;  2Q88 A;  1MH4 A;  4R72 A;  3HN0 A;  4OFJ A;  1NH7 A;  4IR8 A;  2HAU A;  3PUX E;  4QHQ A;  5FHO A;  1NMU A;  3EPE A;  2ONR A;  2F7C A;  2NVU B;  3IFA A;  4BDO A;  2HAV A;  3MZB A;  3DP6 A;  5JTY B;  2V93 A;  2UYF A;  1FPE A;  3IOW A;  5HBC A;  2RCA A;  3FAS A;  3KEI A;  3VXC A;  1LBX A;  1OVT A;  2XWO A;  1FPF A;  1SW5 A;  3JZJ A;  2HPG A;  4IO2 A;  2NUV A;  2V3U A;  4G8N A;  4WEP A;  3M3L A;  4I3Y A;  4MNC A;  1R1N A;  5I57 A;  3TEL A;  4BDQ A;  4NAP A;  1USY H;  1CNQ A;  1KA1 A;  1TWY A;  5LTC A;  3O29 A;  4ZEC A;  4DXC A;  5CMM A;  3ROJ A;  3M3K A;  3S2V A;  4IO5 A;  1UTB A;  3GLB A;  4GWU A;  3KOT A;  3PPR A;  5AE4 A;  5IAI A;  4ZDM A;  3QSL A;  1O7T A;  2H4I A;  2XXK A;  2ZYM A;  2ZNU A;  4NF6 B;  4OFO A;  3I3V A;  3MYU A;  3B8B A;  3RUM A;  4DXB A;  4PP0 A;  2Y5L A;  4PFB A;  1YCJ A;  2QRY A;  2FIX A;  4P3L A;  1B4Z A;  1IMA A;  2Y7K A;  5FHM A;  2OJT A;  3Q26 A;  5EQ8 A;  4M1V A;  1SW4 A;  4OER A;  1LBW A;  1XVY A;  4H46 A;  3R26 A;  4JBZ A;  4F3P A;  5H8N B;  1ATG A;  3FV2 A;  3ZKK A;  5K2Y A;  2Q8J A;  2THI A;  4U1Z A;  1US5 A;  2A5T A;  2O68 A;  1N3W A;  1IEJ A;  3IOV A;  3MQ9 A;  4P1E A;  5LOM A;  2REJ A;  3TAJ A;  1IUD A;  4PFU A;  1A99 A;  3RT6 B;  5DTB A;  2GHB A;  3RGY A;  4N15 A;  1TFA A;  3U72 A;  2ZYO A;  3C34 A;  3CG3 A;  5M2V A;  5I3S A;  1SYH A;  4MF3 A;  1LAG E;  2X7Q A;  4HCY A;  4JSO A;  3LSL A;  2QFL A;  5ET7 A;  3T22 A;  3LSF B;  4O7I A;  3MVX A;  5H8S A;  2UXA A;  3GBB A;  1FTO A;  1M5F A;  1KA0 A;  1N84 A;  2FNC A;  4MJO A;  2QJE A;  5AA2 D;  4MMP A;  3CG1 A;  3SEU A;  4F3G A;  5H8F B;  1LBZ A;  3MVZ A;  4JVC A;  4LUB A;  4UAB A;  1LCF A;  3FVK A;  4EF2 A;  3T96 B;  4JWO A;  4DIG A;  4F22 A;  1NNT A;  3MPL A;  2REG A;  4THI A;  3KN7 A;  1NNP A;  1MQG A;  4IGR A;  1ZLQ A;  3U94 A;  1CE2 A;  4FOR A;  4GWS A;  4JVI A;  1JNF A;  1H44 A;  3CHG A;  3K6X A;  4GX6 A;  1MPC A;  5CMB A;  1PBQ A;  4R6K A;  3UP9 A;  3KG2 A;  3THI A;  2VD3 A;  1DBZ A;  4OVS A;  2PFZ A;  4XFE A;  1TXF A;  4DZ1 A;  4OYV A;  4N81 A;  3U8Q A;  3HO7 A;  4G68 C;  3BIG A;  4RJZ A;  1EYK A;  3FXU A;  4K3F A;  1R6Z A;  2D3I A;  2YJP A;  2OK2 A;  2MKZ A;  3C36 A;  3EN3 A;  5CMK A;  2X7P A;  2Z23 A;  1QKA A;  3FBP A;  3IJO B;  1PB9 A;  2CMO A;  3T66 A;  1II5 A;  1EZP A;  5ICQ A;  3VLU A;  3A09 A;  2V84 A;  4DCY A;  1HSL A;  2DOJ A;  2VPN A;  2ALU A;  4I1D A;  4F1U A;  3VLV A;  1JEU A;  4NTL A;  2WEF A;  2CEY A;  4ELO A;  1B58 A;  4O3C A;  1PDA A;  4NHB A;  5LDZ A;  2VT5 A;  3KC1 A;  5I2N A;  4TLL B;  2XXP A;  1QUL A;  2B4L A;  3V83 A;  4LZ5 A;  2W7Y A;  4OTE A;  5BUU A;  5EYF A;  2F3B A;  3WAF A;  1KWH A;  3PV0 E;  4QSE A;  2FHY A;  3VDF A;  4R2F A;  5J1D A;  1B52 A;  3OSQ A;  3OO9 A;  3G3K A;  5FTH A;  2DSF A;  4C1U A;  1UIV A;  4NWC A;  2XX7 A;  1I6Q A;  1Q1K A;  3QXM A;  3L6G A;  3SKP A;  4TOZ A;  1FPK A;  2CZL A;  1FTA A;  3H6V A;  3TQL A;  4MFI A;  3DP8 A;  1TT1 A;  1R9Q A;  3LR1 A;  2GHA A;  1FQD A;  1XOC A;  4ZEI A;  4DLD A;  2F8D A;  4OES A;  3ODB A;  1OLC A;  3FAT A;  1FQC A;  3EHU A;  4QFN A;  4ESX A;  3TFL A;  3T0J A;  4PCD A;  3PTY A;  1Y3N A;  2DXR A;  1QUI A;  4KQP A;  2I48 A;  3D1R A;  2LAO A;  3PPQ A;  1MY2 A;  3SEW A;  4YKI A;  3OEL A;  2XXT A;  3OO6 A;  4MAG A;  3TUS A;  1OMP A;  4MH5 A;  4G68 B;  5IM2 A;  2O84 X;  5CM6 A;  3IR1 A;  3KJ7 A;  1D9Q A;  1N0T A;  3UK4 A;  3GXA A;  2I0B A;  4H6D A;  2DQV A;  4NF4 B;  4MLQ A;  2IA4 A;  3M8U A;  4R9F A;  4YZZ A;  3USD A;  4LN5 A;  1SI0 A;  4GX3 A;  2QL3 A;  4QXD A;  4DI4 B;  1B2H A;  4ZEB A;  1QKB A;  5K2X A;  3KBR A;  3B7D A;  4PFR A;  1FBE A;  3GZG A;  3VV5 A;  2F35 A;  3H6W A;  4XKN A;  1B5I A;  4GBW A;  1NNF A;  4U23 A;  2Z8D A;  1EZ9 A;  3RLF E;  2R9J A;  4HE0 A;  3CVG A;  1BTJ A;  2F3D A;  5IKB A;  4PBH A;  3RPL B;  3H6U A;  3JYR A;  1N7W A;  4XIG Q;  5B70 A;  3OMB A;  4IY5 A;  1PB7 A;  4AS4 A;  2DVC A;  1AWB A;  3E9X A;  3OOA A;  4LA9 A;  1JW5 A;  2ESN A;  1YXI A;  2OLB A;  1B3G A;  2O1L A;  4XF5 A;  3VLW A;  2QVR A;  4N8G A;  1MXU A;  2CZI A;  3PPO A;  4ECF A;  1FTJ A;  2L5V A;  1H45 A;  3SET A;  5ET8 A;  3KGC A;  4F39 A;  4Q30 B;  1IQ7 A;  2XX9 A;  5JEI A;  3K1N A;  5BWJ A;  1NV3 A;  2UVJ A;  1BP5 A;  2DXY A;  4O3B A;  3PD9 A;  2R71 A;  2CEX A;  5EQ9 A;  2QS2 A;  3OD7 A;  1B51 A;  4YB6 A;  3MJN A;  3DLN A;  3QUJ A;  3TOD A;  5I56 A;  1NUZ A;  2XXW A;  4PGN A;  3EHS A;  5ITO A;  3RTW B;  2WX9 A;  4G77 A;  2OBG A;  3HV1 A;  1BK4 A;  4H0W A;  1FTL A;  1VSO A;  1MXX A;  4GRK A;  3RPW A;  1LST A;  1M5E A;  4DI3 D;  2PMS A;  3L6H A;  5I59 A;  2BJI A;  1FPG A;  2QS4 A;  4GXA A;  3K6V A;  3PD8 A;  1P1W A;  1N7X A;  2XXI A;  2I6E A;  3FUZ A;  1SQY A;  2Q9T A;  4NN3 A;  3IJX B;  1P1U A;  4Z0I A;  1P1Q A;  1B1X A;  3QMF A;  3SEY A;  3T9U A;  4FBP A;  4RPN A;  4OVR A;  3LSX A;  1Y9U A;  5A5X A;  2P1S A;  3MP1 A;  1BKA A;  1GVC A;  4O8M A;  1IMD A;  1P99 A;  4AQ4 A;  1XVX A;  1B5J A;  2ZYK A;  4FAJ A;  4YKP A;  3S9E A;  5DVJ A;  3ECR A;  1UTH B;  3DM0 A;  4P1L A;  1MY3 A;  1MRP A;  2HZK A;  2QVU A;  4P8B A;  5L9O A;  3HST A;  1NV0 A;  4P56 A;  3N94 A;  3RQT A;  3A3C A;  4KHZ E;  5H8H B;  3BIH A;  4X04 A;  1P1O A;  3IL1 B;  3E79 A;  4N13 A;  2P3N A;  2F97 A;  1QVS A;  1FSA A;  3MVW A;  1NL5 A;  4PDD A;  5AA4 A;  4LP2 B;  2ZYN A;  3TDJ A;  2OX3 A;  1POY 1;  1MQI A;  3OEN A;  3TTR A;  1AIV A;  2DVZ A;  2PYY A;  4BDL A;  1YAE A;  4NQ8 A;  5IGA A;  4MLV A;  2B4M A;  5ET6 A;  2DWA A;  2OWZ A;  4EF1 A;  4FEB A;  4GD5 A;  2QMW A;  4UAC A;  4F3S A;  4PET A;  1B4H A;  4F3B A;  1URD A;  1B40 A;  4X1D A;  3V89 B;  4YB7 A;  4ZE9 A;  4WKM A;  2DWJ A;  4YMB A;  1QGX A;  3KFM A;  4HCW A;  3S9M C;  1D4N A;  1SW1 A;  2UVG A;  4GOT A;  3S9L C;  3VXB A;  3TMG A;  3U92 A;  4F29 A;  2FBP A;  3O6G A;  3HFU A;  4O94 A;  1A8E A;  1PBP A;  4RK2 A;  4PF6 A;  1CB6 A;  3KOS A;  4JXI A;  1NV5 A;  1NUY A;  2E1S A;  3KC0 A;  1FPB A;  5EHS A;  1IIW A;  4NF8 A;  1T0K A;  2Q2A A;  4X8R A;  1GR2 A;  3TTM A;  4U2R A;  5TPA A;  3LSW A;  3E4R A;  5I58 B;  2X26 A;  4H8I A;  3CRB A;  1FRP A;  1FBG A;  2D21 A;  4OA4 A;  1B32 A;  2Z8E A;  1NKX A;  3MC2 A;  2DP8 A;  3MZ1 A;  4HTG A;  3UIF A;  5KDT A;  3FJM A;  4C1T A;  1POT A;  3CFX A;  4YMA A;  4XKR A;  5KCJ B;  3G7W A;  3W9W A;  3LUY A;  3BBR A;  1IXI A;  2ZXT A;  2IEE A;  5AA2 A;  3IB1 A;  5T3J A;  3HHG A;  5DEX B;  4P0G A;  5DVF A;  2F6G A;  4XTC Q;  2B3F A;  1S9T A;  3F11 A;  1OLA A;  1MXV A;  1H76 A;  1Y4T A;  2H5Y A;  3I5O A;  3QUF A;  4U4S A;  5DYH A;  5AA3 A;  1LBY A;  2HXW A;  4LVQ A;  3DEL B;  5A5L A;  3IB0 A;  5CRY A;  3Q29 A;  1ZKB A;  3FJG A;  1NI9 A;  2RC7 A;  4LQ2 A;  3KN8 A;  4AS5 A;  5I84 A;  2Y7P A;  4X9T A;  3DP4 A;  3T9V A;  1B05 A;  3LBS A;  1HSE A;  1XS5 A;  2VGQ A;  1M5C A;  3S4U A;  3P7I A;  1ELJ A;  2NOO A;  3O97 A;  3IOR A;  3OO7 A;  3TCG A;  1FPI A;  1J1N A;  4H45 A;  3UGW A;  4EXL A;  4PAK A;  4Q5T A;  2VPO A;  4OVJ A;  4U1O A;  3H06 B;  3FD3 A;  2ONK E;  3W9V A;  4GLI A;  4I62 A;  5I57 B;  2WYP A;  2I3W A;  3GYY A;  2PCR A;  3G3H A;  3K6U A;  1ZMG A;  3R6U A;  2H99 A;  2RIN A;  4PFY A;  2OWS A;  4R6Y A;  1DK4 A;  4PAF A;  2Y7W A;  3T9H B;  3MST A;  3TZA A;  1UTB B;  4GF8 A;  2KQZ A;  2F6P A;  2F34 A;  3I6V A;  2DE2 A;  2HXR A;  1MQJ A;  3C4M A;  3MP8 A;  3BKI B;  1QJM A;  4JSD A;  1NUX A;  1FPL A;  1O63 A;  1FPD A;  1INP A;  4OVP A;  2AL5 A;  1FPJ A;  4OVT A;  2Y84 A;  4N6D A;  1LB9 A;  1LEV A;  3B6T A;  2FIE A;  3K00 A;  5IZ3 A;  4KYS A;  2AL4 A;  4GX4 A;  2GQ1 A;  1H43 A;  1OQG A;  4F18 A;  1USY E;  3LV0 A;  2G29 A;  4DXU A;  5B7D A;  1IXH A;  4H5F A;  2ZZV A;  5EYH A;  2A5T B;  4PFT A;  4YB5 A;  1MXZ A;  2GH9 A;  4I40 A;  4Q0C A;  3K2D A;  4AB5 A;  2Y7R A;  4NE4 A;  5FBP A;  5DW8 A;  1JW4 A;  4JVD A;  3B50 A;  3MWB A;  3OSR A;  1NFT A;  1ZBM A;  1ZJL A;  1WOD A;  4MCO A;  1MM6 A;  4NF5 A;  1PEB A;  4ELQ A;  3OO8 A;  3IB2 A;  3IO4 A;  4RPO A;  1LAH E;  1FBP A;  1IXC A;  4PFW A;  1DPP A;  4MBP A;  4GBV A;  4H65 A;  2ANJ A;  1K9Z A;  1SPI A;  4KYE A;  1RDZ A;  5H8Q A;  5TP9 A;  2XHD A;  3CFZ A;  2M8C A;  2I0C A;  2FVZ A;  2HEU A;  3SDF A;  1NH8 A;  1FQB A;  1D9Y A;  1UIU A;  4H67 A;  2Z8F A; 
#chains in the Genus database with same CATH homology
 4OET A;  1S50 A;  3TQW A;  3UN6 A;  1H3D A;  2FA7 A;  3N5L A;  1L5T A;  1Y20 A;  2F78 A;  5I2K A;  4JWY A;  1Y4C A;  3R7X A;  1N3X A;  2H25 A;  4HS7 A;  4Z7E A;  3EF7 A;  5JK4 A;  5FHN A;  1B9J A;  1UQW A;  3PPP A;  3TYH A;  3FJ7 A;  4KPT A;  3FIR A;  3MVY A;  1MG1 A;  4E0W A;  3SEX A;  1Y3P A;  4ND9 A;  2RC8 A;  1F9B A;  5JTY A;  1WVJ A;  4F1V A;  2PBW A;  1DTG A;  2BJJ X;  5L9S A;  3IAZ A;  4POX A;  2OZZ A;  3QK6 A;  4ESW A;  1MXY A;  3K1M A;  1URS A;  3MAM A;  3TTK A;  4I9D A;  5I2N B;  4GXS B;  3RTF B;  4ZS9 A;  3VVF A;  2XXQ A;  1QW0 A;  1XHY A;  1BIY A;  1D3K A;  1SD3 A;  3TPA A;  3D4C A;  2I4B A;  1A54 A;  4JDF A;  4U22 A;  3UOR A;  2QS3 A;  2UYE A;  4EXK A;  5HPQ A;  1MQH A;  4AB6 A;  3PMW A;  2AIX A;  3OEM A;  2O51 A;  2A5S A;  1LGB C;  3SEV A;  5KZT A;  3O6I A;  4JB7 A;  4EQ9 A;  3VFJ A;  4L17 A;  4OEU A;  3TEP A;  3FZV A;  5ELV A;  4QRZ A;  3TCF A;  3TKD A;  4NF6 A;  3T93 B;  5ICT A;  1EH3 A;  2ABH A;  3HHF A;  3QIM A;  4M4G A;  2F7B A;  3ZKL A;  2V3T A;  1MQD A;  3HCQ A;  3K02 A;  1I6A A;  1JEV A;  3G3I A;  3N26 A;  1MPD A;  4OMB A;  4OHN A;  1B5H A;  4JWX A;  1SBP A;  3WAE A;  4BDN A;  2XXY A;  5H8N A;  1HSJ A;  4P11 A;  3RN8 A;  3B6Q A;  2AYS A;  2NXO A;  4ZZA A;  4IO7 A;  4EQB A;  1B3L A;  1B6H A;  3RT8 A;  4OXV A;  1XC1 A;  1FTK A;  4E0X A;  3KN3 A;  2PX1 A;  1DOT A;  3TTL A;  3M3F A;  1JVY A;  3KZG A;  4KR5 A;  2V25 A;  1IXG A;  1IZ1 A;  1LBC A;  4GL0 A;  3K0V A;  2VP1 A;  2HFB A;  5H8F A;  2H9B A;  2WKY A;  1OIB A;  3IK6 B;  1DSN A;  3O66 A;  1MDQ A;  1SDX A;  3K01 A;  1B7H A;  4R74 A;  4FAT A;  3T9X B;  2FYI A;  2YPN A;  1MS7 A;  4YAH X;  4DCX A;  4RYA A;  3VVE A;  4LQ5 A;  1ZIU A;  4ZZE A;  4F1Y A;  2DS9 A;  1GGG A;  3RY3 A;  2P2A A;  4LZ8 A;  3OXN A;  4EQ7 A;  1FW0 A;  3FXQ A;  2RF1 A;  3CI8 A;  5FTI A;  4G2Z A;  2XXU A;  4KI0 E;  3G3J A;  4XXU A;  3VVD A;  1B0H A;  4H5G A;  4NMY A;  2HZL A;  4KD5 A;  3OEK A;  2P0S A;  1VFD A;  5I56 B;  4N07 A;  2D5W A;  2PVU A;  2UVH A;  2QS1 A;  1MDP 1;  4EDP A;  1MY0 A;  3PMX A;  3ILU B;  2GFE A;  1FQF A;  1TFD A;  3MW0 A;  4FE8 A;  4KFQ A;  4BLA A;  5I59 B;  4I8C A;  2OWT A;  1Z7N E;  4OZ9 A;  3K1P A;  4KCD A;  1DTZ A;  4G8H A;  3H4Z A;  1SW2 A;  1YPN A;  2PT1 A;  3MPK A;  4OEV A;  4RXL A;  1MH3 A;  3FV1 A;  5F1Q A;  4QSD A;  4DE8 A;  5A5X B;  1A55 A;  2NWJ A;  1MM7 A;  4TQU Q;  1AOV A;  4F2O A;  3H03 A;  3KSX A;  4X48 A;  5DT6 A;  1MXW A;  4OQO A;  4LAT A;  2QSX A;  3ILT B;  4H1X A;  2I58 A;  2G93 A;  4IO6 A;  1MY1 A;  4O3A A;  2VHA A;  4C0R A;  1GTK A;  2DWH A;  4QF9 A;  4YU0 A;  1P1N A;  4IB2 A;  5L9M A;  3C33 A;  1O64 A;  2UVI A;  3A3U A;  4QFK A;  2KLF A;  4R75 A;  4G68 A;  1LFG A;  2B65 A;  4FJP A;  5L8D A;  3Q25 A;  1JVX A;  4F31 B;  3U1O A;  3V5A A;  1Y1Z A;  3IOU A;  4NWD A;  2DWI A;  5CC2 A;  1US4 A;  3C32 A;  4NF4 A;  5AA4 B;  5HM4 B;  3IO6 A;  3UA8 A;  1N04 A;  2DE4 A;  5ITP A;  3PMV A;  3H3G A;  3FVN A;  4KYD A;  1LAF E;  2RKM A;  4OEN A;  2O7I A;  1BLF A;  4P0I A;  1ZU0 A;  1VR5 A;  3G3F A;  4OWD A;  4BDR A;  2R6G E;  3EQ1 A;  3Q28 A;  4G8M A;  3PPN A;  3GBA A;  3V8X B;  3HPI A;  1LLS A;  1QUJ A;  2XD3 A;  3H6T A;  2VOZ A;  4QSC A;  3C9H A;  3PUV E;  1FCK A;  2I3V A;  5CI5 A;  1AMF A;  1LBB A;  1Y3Q A;  3CIJ A;  1B1H A;  1FTM A;  3FXR A;  3EHT A;  4GIZ A;  5TU0 A;  1M5B A;  3E13 X;  4ZED A;  1R9L A;  4N6P A;  2HCA A;  1MPB A;  1DPE A;  1JET A;  1PB8 A;  3KJT A;  4FIM A;  2YLN A;  3MP6 A;  2XX8 A;  2RC9 A;  3K6W A;  2F5X A;  4NF8 B;  1I69 A;  3FVO A;  4IY6 A;  5TPA B;  1ZTY A;  1B3F A;  2PT2 A;  4ISU A;  4BDM A;  3O9P A;  4IGT A;  4ZEK A;  1JQF A;  2ZMB A;  3MUQ A;  5KDT B;  4LON B;  1VE4 A;  1SVX B;  3CR9 A;  3ZS6 A;  5CMC A;  2O7U A;  3CSG A;  5AA2 B;  4ONY A;  1AL3 A;  1RYX A;  4XKQ A;  1RKM A;  5ISU A;  1RYO A;  5DVI A;  4ELP A;  1OVB A;  2O1M A;  3N6U A;  4UA8 A;  2XXX A;  3PGF A;  1GV8 A;  3PUY E;  3RNN A;  3ONM A;  3SER A;  5EHM A;  3E3K A;  3QYT A;  4R73 A;  4U21 A;  3QAX A;  4F19 A;  1NNK A;  3TTN A;  4GVO A;  4KCC A;  1WDN A;  4OFL A;  2OCU A;  1URG A;  3W15 C;  3B6W A;  3BFU A;  1VFE A;  4RNS A;  2HQ0 A;  1N76 A;  4QFP A;  3Q27 A;  1UTH A;  4EUO A;  4YKK A;  4QFL A;  1OQH A;  2O69 A;  1B3H A;  2Y7I A;  1DMB A;  3BFT A;  3SES A;  2QMX A;  1FQE A;  5H8H A;  5CBR A;  1EZO A;  1XT8 A;  2I4C A;  3O6H A;  1B3E A;  1LAX A;  2B3B A;  4HW8 A;  2DYX A;  2DE3 A;  2GRV A;  4GWO A;  2QPQ A;  1Q35 A;  3C31 A;  3PU5 A;  1A7L A;  2V3Q A;  4PQJ A;  1AH5 A;  2F36 A;  1ANF A;  4H8J A;  5CBS A;  3PUW E;  1PC3 A;  5F7V A;  4WED A;  2F7A A;  4TLM B;  4R2B A;  4R9G A;  4U4X A;  1LCT A;  1I6B A;  3IOT A;  2VD2 A;  3IX1 A;  1QUK A;  1MY4 A;  3VE1 B;  3C35 A;  1Y1M A;  4R6H A;  1YTV A;  3JV9 A;  2ONS A;  4GQO A;  4FED A;  1D9V A;  2XXV A;  4GFR A;  5AA1 A;  2XXH A;  4ZEF A;  1LFH A;  4PE5 B;  4WXJ A;  1B46 A;  3H7M A;  1FQA A;  4NED A;  4RK9 A;  3D4G A;  4RA1 A;  1M5D A;  4QFO A;  4RY1 A;  4Q8R A;  1B0L A;  1B7U A;  3ZSF A;  2XD2 A;  4F2Q A;  3G3G A;  3K4U A;  3AXF A;  4X1B A;  2Q2C A;  4GL8 A;  3N6T A;  3CSB A;  3LC8 A;  2Z22 A;  3MBP A;  4IO3 A;  3FVG A;  1LFI A;  4NF5 B;  3FGS A;  1Z7M E;  1LB8 A;  2I49 A;  3KSJ A;  3MZ9 A;  5I58 A;  2ZNT A;  2XXR A;  4ELR A;  1S7Y A;  4POW A;  2O6A A;  1SYI A;  3PUZ E;  1IIT A;  2RCB A;  4YIC A;  3TCH A;  1SI1 A;  2ZNS A;  3S9N C;  3O2A A;  1JW1 A;  5H8Q B;  5TP9 B;  5KCJ A;  1A40 A;  4LZ7 A;  5DEX A;  2Q89 A;  3O28 A;  4FEC A;  4XKP A;  1B7Z A;  1A8F A;  1EU8 A;  2E0S A;  2H98 A;  3CFL A;  5I2K B;  4ZE8 A;  3U93 A;  4IO4 A;  4DDD A;  4YKJ A;  4G4P A;  2Q88 A;  1MH4 A;  4R72 A;  3HN0 A;  4OFJ A;  1NH7 A;  2HAU A;  3PUX E;  4QHQ A;  5FHO A;  1NMU A;  3EPE A;  2ONR A;  2F7C A;  2NVU B;  4BDO A;  2HAV A;  3MZB A;  3DP6 A;  5JTY B;  2V93 A;  2UYF A;  3IOW A;  5HBC A;  2RCA A;  3FAS A;  3KEI A;  3VXC A;  1OVT A;  1SW5 A;  3JZJ A;  4IO2 A;  2NUV A;  2V3U A;  4G8N A;  4WEP A;  3M3L A;  1R1N A;  5I57 A;  3TEL A;  4BDQ A;  1USY H;  1TWY A;  3O29 A;  4ZEC A;  4DXC A;  5CMM A;  3M3K A;  3S2V A;  4IO5 A;  1UTB A;  3GLB A;  3KOT A;  3PPR A;  5AE4 A;  5IAI A;  4ZDM A;  3QSL A;  1O7T A;  2H4I A;  2ZYM A;  4OFO A;  2ZNU A;  4NF6 B;  3I3V A;  3RUM A;  4DXB A;  4PP0 A;  1YCJ A;  2QRY A;  1B4Z A;  2Y7K A;  5FHM A;  2OJT A;  3Q26 A;  4M1V A;  1SW4 A;  4OER A;  1XVY A;  3R26 A;  4JBZ A;  4F3P A;  5H8N B;  1ATG A;  3FV2 A;  3ZKK A;  5K2Y A;  2Q8J A;  2THI A;  4U1Z A;  1US5 A;  2A5T A;  2O68 A;  1N3W A;  1IEJ A;  3IOV A;  3MQ9 A;  5LOM A;  2REJ A;  3TAJ A;  1IUD A;  4PFU A;  1A99 A;  3RT6 B;  5DTB A;  2GHB A;  3RGY A;  1TFA A;  3U72 A;  2ZYO A;  3C34 A;  3CG3 A;  5M2V A;  1SYH A;  4MF3 A;  1LAG E;  2X7Q A;  4HCY A;  4JSO A;  3LSL A;  3T22 A;  3LSF B;  3MVX A;  5H8S A;  2UXA A;  3GBB A;  1FTO A;  1M5F A;  1N84 A;  2FNC A;  2QJE A;  5AA2 D;  3CG1 A;  3SEU A;  4F3G A;  5H8F B;  3MVZ A;  4LUB A;  1LCF A;  3FVK A;  4EF2 A;  3T96 B;  4JWO A;  4DIG A;  4F22 A;  1NNT A;  3MPL A;  2REG A;  4THI A;  3KN7 A;  1NNP A;  1MQG A;  4IGR A;  1ZLQ A;  3U94 A;  1CE2 A;  4FOR A;  1JNF A;  1H44 A;  3K6X A;  1MPC A;  5CMB A;  1PBQ A;  4R6K A;  3UP9 A;  3KG2 A;  3THI A;  2VD3 A;  1TXF A;  4DZ1 A;  4OYV A;  3U8Q A;  3HO7 A;  4G68 C;  4RJZ A;  3FXU A;  4K3F A;  1R6Z A;  2D3I A;  2YJP A;  2OK2 A;  3C36 A;  3EN3 A;  5CMK A;  2X7P A;  2Z23 A;  1QKA A;  3IJO B;  1PB9 A;  2CMO A;  3T66 A;  1II5 A;  1EZP A;  5ICQ A;  3VLU A;  3A09 A;  2V84 A;  4DCY A;  1HSL A;  2DOJ A;  2ALU A;  4I1D A;  4F1U A;  3VLV A;  1JEU A;  4NTL A;  4ELO A;  1B58 A;  4O3C A;  1PDA A;  5I2N A;  4TLL B;  2XXP A;  1QUL A;  3V83 A;  4LZ5 A;  2W7Y A;  4OTE A;  5BUU A;  5EYF A;  3WAF A;  1KWH A;  3PV0 E;  4QSE A;  3VDF A;  4R2F A;  5J1D A;  1B52 A;  3OSQ A;  3OO9 A;  3G3K A;  5FTH A;  2DSF A;  4C1U A;  1UIV A;  4NWC A;  2XX7 A;  1I6Q A;  1Q1K A;  3QXM A;  3SKP A;  3L6G A;  4TOZ A;  2CZL A;  3TQL A;  3H6V A;  4MFI A;  3DP8 A;  1TT1 A;  1R9Q A;  3LR1 A;  2GHA A;  1FQD A;  1XOC A;  4ZEI A;  4DLD A;  2F8D A;  4OES A;  3ODB A;  1OLC A;  3FAT A;  1FQC A;  3EHU A;  4QFN A;  4ESX A;  3TFL A;  1Y3N A;  2DXR A;  1QUI A;  4KQP A;  2I48 A;  3PPQ A;  2LAO A;  1MY2 A;  3SEW A;  4YKI A;  3OEL A;  2XXT A;  3OO6 A;  3TUS A;  1OMP A;  4MH5 A;  4G68 B;  2O84 X;  5CM6 A;  3IR1 A;  3KJ7 A;  1N0T A;  3UK4 A;  3GXA A;  2I0B A;  4H6D A;  2DQV A;  4NF4 B;  4MLQ A;  2IA4 A;  3M8U A;  4R9F A;  4YZZ A;  3USD A;  1SI0 A;  2QL3 A;  1B2H A;  4ZEB A;  1QKB A;  5K2X A;  3KBR A;  3B7D A;  3GZG A;  3VV5 A;  2F35 A;  3H6W A;  4XKN A;  1B5I A;  1NNF A;  4U23 A;  2Z8D A;  1EZ9 A;  3RLF E;  2R9J A;  3CVG A;  1BTJ A;  5IKB A;  3H6U A;  3JYR A;  1N7W A;  4XIG Q;  5B70 A;  3OMB A;  4IY5 A;  1PB7 A;  2DVC A;  3E9X A;  3OOA A;  4LA9 A;  1JW5 A;  2ESN A;  2OLB A;  1B3G A;  2O1L A;  3VLW A;  1MXU A;  3PPO A;  4ECF A;  1FTJ A;  1H45 A;  3SET A;  3KGC A;  4F39 A;  4Q30 B;  1IQ7 A;  2XX9 A;  5JEI A;  3K1N A;  5BWJ A;  2UVJ A;  1BP5 A;  2DXY A;  4O3B A;  3PD9 A;  2R71 A;  2QS2 A;  3OD7 A;  1B51 A;  4YB6 A;  3MJN A;  3DLN A;  3QUJ A;  3TOD A;  5I56 A;  2XXW A;  3EHS A;  5ITO A;  3RTW B;  4G77 A;  2OBG A;  3HV1 A;  4H0W A;  1FTL A;  1VSO A;  1MXX A;  4GRK A;  3RPW A;  1LST A;  1M5E A;  2PMS A;  3L6H A;  5I59 A;  2QS4 A;  4GXA A;  3K6V A;  3PD8 A;  1P1W A;  1N7X A;  2XXI A;  2I6E A;  3FUZ A;  1SQY A;  2Q9T A;  3IJX B;  1P1U A;  4Z0I A;  1P1Q A;  1B1X A;  3SEY A;  3T9U A;  4RPN A;  3LSX A;  1Y9U A;  5A5X A;  2P1S A;  3MP1 A;  1BKA A;  1GVC A;  1P99 A;  4AQ4 A;  1XVX A;  1B5J A;  2ZYK A;  4FAJ A;  4YKP A;  3S9E A;  5DVJ A;  3ECR A;  1UTH B;  3DM0 A;  1MY3 A;  1MRP A;  2HZK A;  5L9O A;  3HST A;  3N94 A;  3RQT A;  3A3C A;  4KHZ E;  5H8H B;  1P1O A;  3IL1 B;  4N13 A;  2F97 A;  1QVS A;  3MVW A;  1NL5 A;  5AA4 A;  4LP2 B;  2ZYN A;  3TDJ A;  1POY 1;  1MQI A;  3OEN A;  3TTR A;  1AIV A;  2DVZ A;  2PYY A;  4BDL A;  1YAE A;  4MLV A;  2DWA A;  4EF1 A;  4FEB A;  4GD5 A;  2QMW A;  4UAC A;  4F3S A;  4PET A;  1B4H A;  4F3B A;  1URD A;  1B40 A;  4X1D A;  3V89 B;  4YB7 A;  4ZE9 A;  4WKM A;  2DWJ A;  4YMB A;  3KFM A;  4HCW A;  3S9M C;  1D4N A;  1SW1 A;  2UVG A;  4GOT A;  3S9L C;  3VXB A;  3TMG A;  3U92 A;  4F29 A;  3O6G A;  1A8E A;  1PBP A;  4RK2 A;  1CB6 A;  3KOS A;  4JXI A;  2E1S A;  5EHS A;  1IIW A;  4NF8 A;  1T0K A;  2Q2A A;  3TTM A;  1GR2 A;  4U2R A;  5TPA A;  3LSW A;  3E4R A;  5I58 B;  2X26 A;  4H8I A;  3CRB A;  2D21 A;  1B32 A;  2Z8E A;  1NKX A;  3MC2 A;  2DP8 A;  3MZ1 A;  4HTG A;  3UIF A;  5KDT A;  3FJM A;  4C1T A;  1POT A;  3CFX A;  4YMA A;  4XKR A;  5KCJ B;  3G7W A;  3W9W A;  3LUY A;  3BBR A;  1IXI A;  2ZXT A;  2IEE A;  5AA2 A;  3IB1 A;  3HHG A;  5DEX B;  4P0G A;  5DVF A;  2F6G A;  4XTC Q;  2B3F A;  1S9T A;  3F11 A;  1OLA A;  1MXV A;  1H76 A;  1Y4T A;  2H5Y A;  3I5O A;  3QUF A;  4U4S A;  5DYH A;  5AA3 A;  2HXW A;  4LVQ A;  3DEL B;  3IB0 A;  5CRY A;  3Q29 A;  1ZKB A;  3FJG A;  2RC7 A;  4LQ2 A;  3KN8 A;  5I84 A;  2Y7P A;  4X9T A;  3DP4 A;  3T9V A;  1B05 A;  3LBS A;  1HSE A;  1XS5 A;  2VGQ A;  1M5C A;  3S4U A;  3P7I A;  1ELJ A;  2NOO A;  3O97 A;  3IOR A;  3OO7 A;  3TCG A;  1J1N A;  3UGW A;  4EXL A;  4Q5T A;  4OVJ A;  4U1O A;  3H06 B;  3FD3 A;  2ONK E;  3W9V A;  4GLI A;  4I62 A;  5I57 B;  2I3W A;  3G3H A;  3K6U A;  1ZMG A;  3R6U A;  2H99 A;  2RIN A;  4PFY A;  2OWS A;  4R6Y A;  2Y7W A;  3T9H B;  3TZA A;  1UTB B;  4GF8 A;  2F6P A;  2F34 A;  3I6V A;  2DE2 A;  1MQJ A;  3C4M A;  3MP8 A;  3BKI B;  1QJM A;  4JSD A;  1O63 A;  2AL5 A;  2Y84 A;  1LB9 A;  3B6T A;  3K00 A;  4KYS A;  2AL4 A;  1H43 A;  1OQG A;  4F18 A;  1USY E;  2G29 A;  4DXU A;  5B7D A;  1IXH A;  4H5F A;  2A5T B;  4PFT A;  4YB5 A;  1MXZ A;  2GH9 A;  4Q0C A;  3K2D A;  4AB5 A;  2Y7R A;  4NE4 A;  1JW4 A;  3MWB A;  3OSR A;  1NFT A;  1ZBM A;  1ZJL A;  1WOD A;  1MM6 A;  4NF5 A;  1PEB A;  4ELQ A;  3OO8 A;  3IB2 A;  3IO4 A;  4RPO A;  1LAH E;  1IXC A;  4PFW A;  1DPP A;  4MBP A;  4H65 A;  2ANJ A;  4KYE A;  5H8Q A;  5TP9 A;  2XHD A;  3CFZ A;  2M8C A;  2I0C A;  3SDF A;  2HEU A;  1NH8 A;  1FQB A;  1D9Y A;  1UIU A;  4H67 A;  2Z8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...