4I62A

1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
236
Chain Sequence
IEAIKSKGKLVVALNPDFAPFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAKKVGAQKGSIQETMAKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNFEKQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, periplasmic amino acid-binding p
publication title 1.05 Angstrom crystal structure of an amino acid ABC transporter substrate-binding protein from Streptococcus pneumoniae Canada MDR_19A bound to L-arginine
rcsb
source organism Streptococcus pneumoniae
total genus 85
structure length 236
sequence length 238
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4i62A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4i62A02
4U1ZA 1S9TA 2XXXA 1OMPA 5CRYA 2KLFA 2O7IA 3RUMA 4R74A 2RC8A 4ZEKA 3VLUA 4KI0E 4F31B 1QJMA 1XT8A 1VR5A 3QIMA 4Q8RA 3PU5A 4NF6B 3SKPA 3V83A 5BWJA 3FXQA 3V8XB 1POY1 4X1DA 3MBPA 4Q30B 2XX8A 3VVEA 5J1DA 4YZZA 4EXKA 2ANJA 3H06B 4F1YA 1Y4TA 2DE2A 3LSWA 1YAEA 1B6HA 2XXTA 3LUYA 4R75A 4R2FA 1MPDA 3C9HA 4IGRA 3H6VA 3MP1A 1NFTA 4PFTA 3SETA 1B2HA 3ZS6A 2VOZA 1LFIA 4F29A 3I6VA 2PT1A 3VDFA 1ZBMA 5I56B 2XXRA 3R7XA 2I58A 2RKMA 2D5WA 2PYYA 3CIJA 3U92A 3PPRA 3IB1A 5B7DA 1I69A 1B05A 1Y1ZA 1BP5A 3OXNA 1QVSA 5DVJA 2O84X 2P1SA 4ZEDA 3IOWA 5CMKA 1DOTA 5I59A 3MP8A 3VXCA 3U72A 5TPAA 1N84A 3MP6A 2R71A 3FVOA 4OVJA 3SEUA 3G3KA 4LA9A 3PPOA 4YAHX 3FVNA 1LGBC 4RPNA 3ZKKA 1B0HA 3UK4A 3C36A 1H3DA 4GF8A 1AIVA 4OWDA 4NF4A 2G29A 4OEUA 1HSLA 3M3KA 2ZNUA 3VV5A 4NF8B 1NNTA 4G8NA 1ZKBA 2E0SA 3HSTA 3OEMA 1XVXA 1R1NA 1FQEA 1XC1A 2ONSA 4WXJA 3K00A 3IOTA 4XKNA 3RPWA 1R9LA 4DZ1A 3IJOB 4U4SA 3OSQA 3OOAA 1P99A 5A5XB 1SVXB 3PMWA 1XHYA 4U21A 3IB2A 4R9FA 4BDMA 2DVCA 4Q5TA 3MAMA 1DSNA 1FTLA 4KCCA 1Y3NA 3HN0A 4G77A 1B51A 5ITPA 1WVJA 1UTBA 3KGCA 4GL8A 4F1UA 5L9MA 5L9SA 1Y9UA 3M3LA 3B7DA 3E9XA 1B3EA 4U1OA 4IO4A 4PP0A 4H65A 4X1BA 2GH9A 1A55A 4OENA 3S2VA 3RT6B 3C34A 4I62A 2XXUA 1NL5A 2XXQA 1DTZA 4KQPA 4EQ9A 2PMSA 5BUUA 3SEWA 4RPOA 2UYFA 3JZJA 5I57A 2Q2AA 2GFEA 4FE8A 4TQUQ 4LQ5A 4OQOA 2AL5A 4DXUA 4O3AA 4DE8A 2I4CA 1B7HA 1MM7A 3O6HA 1M5EA 4OMBA 3TAJA 1JETA 3A3CA 4XKRA 3H3GA 2B65A 3C31A 3H6WA 2I3WA 4QFKA 5L9OA 4RY1A 2DVZA 2O51A 5DEXA 2OWTA 1MXXA 5CBRA 1FQDA 1XS5A 3DP4A 1LAGE 2ONRA 1M5FA 1VE4A 1Z7NE 2Q88A 2NUVA 1OLCA 3U8QA 2VGQA 2F5XA 1MQDA 2O1LA 1SD3A 5FHOA 2QS4A 2PVUA 2Q8JA 4LVQA 1MPBA 5F7VA 2DSFA 2VD2A 2THIA 5ICTA 2CZLA 2OWSA 2XX9A 4XKQA 1FCKA 1OQHA 5H8FA 4ESWA 4ZE8A 4AQ4A 4H8JA 3SEXA 1N0TA 3MQ9A 3TFLA 1JNFA 2ONKE 2XXYA 1B5HA 1PDAA 3ILTB 3UA8A 2O6AA 3WAFA 2DXYA 2HCAA 5I58A 4ELPA 1AH5A 4QFPA 3A09A 4H67A 2I6EA 2V84A 1VSOA 4C1UA 4YU0A 3ECRA 4X48A 1MXWA 3KSXA 4OTEA 4P11A 2F97A 1B46A 3FV1A 3OENA 2YPNA 5CMMA 1SI1A 4TOZA 1MQHA 5DVIA 3U93A 3JYRA 4EXLA 1BIYA 4IB2A 3L6GA 4EQBA 2YJPA 5AA4B 4QF9A 1NNPA 5F1QA 3EHSA 1M5BA 2QS2A 5FHNA 1I6BA 4I9DA 1USYH 1D4NA 4PE5B 3KG2A 1PB8A 1GVCA 1YPNA 1DPPA 2Z8DA 4FEBA 5L8DA 5AA1A 3UGWA 1B3FA 4OERA 1MG1A 3PMXA 1ZU0A 2H98A 3QK6A 2UVIA 5K2XA 1OVBA 2NVUB 1EU8A 4NF6A 4LZ8A 5I2NB 3SDFA 2H99A 1P1OA 3QYTA 5JTYB 2M8CA 3FJ7A 1UTHB 3SEVA 3KEIA 3TTMA 3OO8A 2V3UA 4GL0A 1J1NA 4IO3A 4U2RA 1CE2A 1MXZA 2A5TB 2NXOA 3IJXB 2RCAA 4BDOA 4FECA 1PBPA 2DS9A 3G3FA 3PV0E 4TLLB 2XD3A 1EZOA 4LONB 3FD3A 1B0LA 1P1NA 1ZTYA 1LCTA 2F8DA 1EZPA 1UQWA 4GRKA 5I56A 3OO6A 2UXAA 1FW0A 3RT8A 4NE4A 4O3BA 1MM6A 1GV8A 1OIBA 3KN3A 4GIZA 1SDXA 3M8UA 4R73A 1D9YA 2UVGA 1F9BA 4QFOA 5M2VA 4UACA 4F22A 3RN8A 1A54A 2RF1A 4ZDMA 5KCJB 1RYOA 3FV2A 3Q27A 2DWHA 3TELA 3N94A 4KYEA 1MY0A 2ZNTA 5FTIA 1LAFE 2IEEA 4KR5A 5JEIA 3V5AA 1IIWA 1SW4A 3SESA 3FIRA 4JB7A 1LLSA 3LSLA 2V25A 4H5FA 3G3JA 1FQFA 4H1XA 1KWHA 1TT1A 4KFQA 3RY3A 3PUVE 2DP8A 3FASA 3FZVA 3BFUA 4FJPA 3TPAA 4GLIA 4PQJA 2Z8FA 1MY4A 1BKAA 3TUSA 3FVGA 4MLVA 3W15C 4G68C 4G8HA 4F18A 4PFYA 1JQFA 4G2ZA 4PFWA 1IQ7A 4WKMA 4GQOA 3H7MA 2ZMBA 3MZBA 3I5OA 5HM4B 4HTGA 1B9JA 3TEPA 3MUQA 2Q2CA 4JDFA 1MY1A 4G4PA 4IY5A 1MDQA 4YKPA 2FA7A 2AYSA 2W7YA 3MVWA 1QKAA 4MF3A 2QSXA 4R2BA 2Y84A 2F6PA 3M3FA 4ZEIA 2H9BA 2GHAA 1B32A 3T66A 1N3XA 4KHZE 1SBPA 3ONMA 3DELB 3K0VA 4ESXA 3ZKLA 2DWJA 1URGA 3E13X 1D3KA 1YTVA 3MC2A 4NF5A 1N3WA 2OCUA 1MDP1 3TQWA 4QRZA 3P7IA 3GBBA 2XD2A 2FYIA 3SEYA 3OD7A 2Q9TA 3B6QA 4G68A 2F7AA 1P1WA 2Q89A 3EHTA 1LFGA 3BFTA 5CBSA 4GOTA 2ESNA 2PX1A 3K02A 5I84A 1EH3A 1LCFA 2V3QA 2XXVA 1VFDA 4H0WA 2Y7WA 4F1VA 3CG1A 2I48A 1YCJA 2HQ0A 1TXFA 1BLFA 3W9VA 1QULA 1ZJLA 3H6UA 2XXPA 1N7WA 5AA3A 4ONYA 2VP1A 3IL1B 2DOJA 2I0CA 3N6UA 5H8HA 3HCQA 1US4A 3G3HA 5H8NB 1Q35A 3C32A 3VFJA 1QUIA 3EQ1A 3C4MA 3IORA 4NMYA 4NTLA 3HO7A 5TU0A 3CSBA 1B40A 1B7UA 2HXWA 2ZYKA 3PD8A 4EF1A 2YLNA 5H8QB 3K01A 2OJTA 4GXAA 1NNKA 4QHQA 3TCFA 4XTCQ 1IITA 2B3FA 1OLAA 3C35A 3K6WA 3PPPA 3QAXA 3GBAA 1MH3A 3GZGA 4DLDA 1PBQA 1LBBA 1PB9A 3SERA 3E3KA 3KZGA 4QSDA 3L6HA 3K2DA 4H5GA 2ZNSA 5CMBA 1IXHA 3O97A 3VXBA 4DIGA 4RJZA 3CR9A 1S7YA 3RLFE 1SYHA 2A5SA 2BJJX 5TP9A 4Q0CA 5ITOA 3K1MA 3HHFA 3OO7A 1NH7A 2HAVA 1B3GA 1Y3QA 2O69A 4POXA 5DT6A 3TODA 1MY3A 1UTBB 3KJ7A 2QRYA 3PUZE 4KPTA 3RNNA 1GR2A 2RC7A 2ZYOA 1N7XA 1B58A 3VVFA 1H45A 2R6GE 3D4CA 3DM0A 2DWIA 4ZECA 4F3PA 3OEKA 5AA4A 3O6GA 5DYHA 3EPEA 3PPQA 4MBPA 3T9UA 4ECFA 3T9VA 3OELA 5FTHA 4OFLA 2DE4A 4IO2A 2VD3A 4K3FA 4JBZA 1P1QA 5EHMA 4FAJA 3KOTA 4IO5A 1JVYA 2D21A 1DPEA 5ELVA 3TDJA 3C33A 3MWBA 5I2NA 4WEDA 3VLVA 4FATA 2UYEA 2Y7KA 4KD5A 1HSJA 1TWYA 1IXGA 1XVYA 4OZ9A 4PFUA 4U23A 2A5TA 4EUOA 2ZYMA 4Z7EA 1LAXA 1BTJA 2GRVA 1NH8A 2GHBA 2LAOA 4X9TA 1FQAA 4ZZAA 4HCYA 3HPIA 1TFDA 2ZYNA 1DMBA 5CM6A 4QSEA 4BDNA 3LBSA 5KDTB 4OESA 2E1SA 3ZSFA 4XIGQ 3PPNA 4DCXA 3FJMA 1SQYA 3E4RA 4ZZEA 5AA2A 4RA1A 2G93A 3U94A 1Z7ME 4DCYA 5I2KA 2VHAA 4F39A 5FHMA 3PGFA 1B5IA 3PMVA 3OSRA 1SI0A 1Y3PA 3K6UA 2HZKA 3KJTA 4LATA 4IO7A 4MFIA 5KCJA 3T22A 1SW5A 1ELJA 3THIA 3TTLA 1B7ZA 4FEDA 2CMOA 3DP6A 3K6VA 2P0SA 2DXRA 2QMXA 4P0GA 4YKKA 1DTGA 1B5JA 5IAIA 4OHNA 4GFRA 2F6GA 1FQCA 1POTA 1AL3A 4ELRA 4GD5A 1IEJA 3RTWB 3RQTA 3B6TA 4YB5A 3TYHA 5HBCA 1FTMA 3IK6B 1A40A 2X7QA 2NWJA 5I58B 2D3IA 1Y20A 1B52A 3TCGA 1A7LA 1NMUA 3MVZA 1LFHA 4ZEFA 1MH4A 2DE3A 2OBGA 3O9PA 1XOCA 3RTFB 2WKYA 3GLBA 3H03A 5CMCA 2Y7RA 3D4GA 3N26A 1Q1KA 2XXHA 3S9MC 4POWA 4N13A 1O7TA 4C0RA 2QS3A 3B6WA 4LZ7A 3JV9A 4GXSB 1LBCA 1NNFA 3ODBA 1AOVA 4KCDA 3RGYA 4IGTA 1WDNA 2QJEA 4NWCA 4QSCA 2QPQA 4DXCA 3VE1B 4JSDA 4IO6A 2RINA 1UIVA 4NWDA 1NKXA 3OMBA 4HCWA 3H4ZA 3Q25A 3TTKA 3N6TA 4PETA 4TLMB 4JSOA 5K2YA 5HPQA 3K4UA 3CFLA 4U22A 4HW8A 3DP8A 3PUXE 3MZ1A 4NF8A 3T93B 5DVFA 4OETA 4ZE9A 4F3GA 1QUKA 4ND9A 1URDA 3QSLA 1WODA 2F36A 3PUYE 3KN7A 3KN8A 4OFJA 2H25A 1B3HA 5A5XA 2Z8EA 3QUFA 4XXUA 3FXUA 3UN6A 4RK9A 1USYE 1S50A 3EF7A 1MQIA 3LC8A 4QFNA 3UP9A 3VVDA 1T0KA 1MXYA 2IA4A 4OFOA 4LP2B 1H76A 4JWYA 1A8FA 5CI5A 4F2OA 1PEBA 3KSJA 2QL3A 3CSGA 5H8NA 3TKDA 3O2AA 2F35A 3LR1A 1FQBA 1I6QA 2XXWA 3G7WA 1Y1MA 1MQJA 3AXFA 4EF2A 2R9JA 1FTOA 1R6ZA 3T96B 5IKBA 5H8QA 2XXIA 5DTBA 2HAUA 1LAHE 4NEDA 1FTJA 1GTKA 3DLNA 4BLAA 3PUWE 3A3UA 1JW5A 3KBRA 4EQ7A 3IR1A 2UVHA 5AE4A 3T9XB 4R9GA 1RKMA 3TCHA 5B70A 1R9QA 1US5A 3MPLA 1JEVA 4M1VA 1TFAA 2F34A 4R6HA 3TZAA 3KFMA 3IX1A 2H4IA 1ZLQA 3S9LC 1O63A 2PBWA 4YKJA 3S9NC 1D9VA 2I4BA 1JVXA 1SW2A 4G8MA 2DQVA 3EHUA 4ELOA 3R26A 1SW1A 3CRBA 4Z0IA 5ICQA 2DYXA 5I59B 1PC3A 2REJA 3TMGA 1IXIA 3CFXA 5TPAB 2QMWA 4YICA 1MQGA 3Q28A 4LUBA 1OQGA 3FATA 3LSXA 1JW4A 1II5A 2X7PA 1N04A 4O3CA 4H6DA 3CVGA 3WAEA 3UIFA 4C1TA 3K6XA 4I1DA 2ALUA 1MY2A 4NF4B 1LB8A 4OEVA 1GGGA 1IXCA 4NF5B 3U1OA 1L5TA 3BBRA 4DDDA 3IB0A 1URSA 3FUZA 2Z22A 4ISUA 4N6PA 3FJGA 4BDLA 2AL4A 3VLWA 1HSEA 4G68B 5H8SA 4YMAA 2B3BA 2XHDA 4THIA 1O64A 2AIXA 4I8CA 3K1NA 2I49A 1B1XA 3K1PA 2OZZA 3QXMA 2REGA 4JWOA 3Q26A 4BDRA 2OLBA 4OYVA 4AB5A 1M5DA 3OO9A 4GVOA 3HV1A 4F2QA 5KDTA 5JK4A 3W9WA 3O28A 3MJNA 3FVKA 4MLQA 1H44A 5H8HB 4ZS9A 4N07A 4RNSA 3IAZA 3USDA 1LSTA 3G3GA 1IZ1A 4HS7A 2HEUA 4BDQA 1EZ9A 3S9EA 3CG3A 3LSFB 1UIUA 4LZ5A 5KZTA 1H43A 2XX7A 4OXVA 3BKIB 3N5LA 3CFZA 4F3SA 2F7CA 5I57B 3G3IA 4E0WA 1A8EA 4YB6A 4R6YA 5JTYA 1P1UA 3HHGA 1UTHA 1N76A 3IO4A 2Y7PA 4MH5A 3F11A 4R6KA 3I3VA 4YB7A 3MW0A 3ILUB 1JEUA 2HFBA 4EDPA 2V93A 3KOSA 2I3VA 2V3TA 4M4GA 3EN3A 1B4ZA 3MVYA 1VFEA 5DEXB 2HZLA 5TP9B 3QUJA 1RYXA 4IY6A 1MS7A 2RCBA 3UORA 3Q29A 2UVJA 2Y7IA 1CB6A 2ABHA 1B1HA 2QS1A 5CC2A 4F3BA 1ATGA 2O1MA 3TTRA 1LB9A 1ZIUA 4UA8A 4E0XA 4KYDA 4YKIA 2O7UA 2NOOA 3R6UA 5ISUA 3O6IA 3MZ9A 1MXUA 2X26A 3MVXA 2ZXTA 4RXLA 4QFLA 3TTNA 4YMBA 5AA2D 1JW1A 1MXVA 4RK2A 4XKPA 2OK2A 3S4UA 3H6TA 3MPKA 1M5CA 4KYSA 5H8FB 1MPCA 2Z23A 4FIMA 1QKBA 4FORA 4ZEBA 1I6AA 4RYAA 2DWAA 5EYFA 3PD9A 1SYIA 1QW0A 4L17A 4JXIA 3FXRA 2P2AA 2O68A 2F78A 1FTKA 3TQLA 3IOUA 1ANFA 2FNCA 4JWXA 1PB7A 2I0BA 4H8IA 4WEPA 3V89B 1OVTA 1ZMGA 3IOVA 1AMFA 4AB6A 3T9HB 3CI8A 1MRPA 4R72A 3O66A 1Y4CA 4DXBA 1B3LA 3O29A 1IUDA 4U4XA 5EHSA 3IO6A 4ELQA 5LOMA 2PT2A 4F19A 4LQ2A 5AA2B 1A99A 3GXAA 1QUJA 4P0IA 2F7BA 3FGSA 2RC9A 4GWOA 2H5YA 5I2KB 1B4HA
chains in the Genus database with same CATH superfamily
2XA5A 4U1ZA 1S9TA 2XXXA 1OMPA 5CRYA 2KLFA 2O7IA 3RUMA 4R74A 2RC8A 3ISPA 4ZEKA 3VLUA 4KI0E 4F31B 1QJMA 1XT8A 1VR5A 1K9ZA 3QIMA 3RPLB 4Q8RA 5LTCA 3PU5A 1FBFA 4NF6B 3SKPA 4DI3D 3V83A 5BWJA 3FXQA 3MYUA 3V8XB 1POY1 4X1DA 3MBPA 4Q30B 2XX8A 3VVEA 1AWBA 2CZIA 5J1DA 4YZZA 4EXKA 1NUYA 2ANJA 3H06B 4F1YA 1XI6A 1Y4TA 5EQ8A 1INPA 2DE2A 3LSWA 1YAEA 1B6HA 2XXTA 3LUYA 4R75A 4R2FA 1MPDA 3C9HA 4IGRA 2Q74A 3H6VA 3MP1A 1NFTA 4PFTA 3SETA 1BK4A 1B2HA 4GWZA 3ZS6A 2VOZA 1LFIA 4F29A 3I6VA 2PT1A 3VDFA 4N15A 1ZBMA 5I56B 2XXRA 3R7XA 2I58A 2P3NA 2RKMA 2D5WA 2PYYA 3CIJA 3U92A 3PPRA 3IB1A 5B7DA 1I69A 1B05A 1Y1ZA 1BP5A 3OXNA 1QVSA 5DVJA 2O84X 2P1SA 4ZEDA 4P1LA 3IOWA 5CMKA 1DOTA 5I59A 3MP8A 3VXCA 3U72A 5TPAA 5EQ7A 1N84A 3MP6A 2R71A 3FVOA 4OVJA 4DI4B 3SEUA 3G3KA 4LA9A 3PPOA 4OVQA 4YAHX 3FVNA 1LGBC 4RPNA 1FTAA 3ZKKA 1B0HA 3UK4A 3C36A 1H3DA 4GF8A 1AIVA 4OWDA 4NF4A 2G29A 4OEUA 1HSLA 3M3KA 2ZNUA 3VV5A 4NF8B 1NNTA 4G8NA 1ZKBA 2E0SA 5I3SA 3HSTA 3OEMA 1XVXA 1R1NA 1FQEA 1XC1A 2ONSA 3RYDA 4WXJA 3K00A 3IOTA 4XKNA 3RPWA 1R9LA 4DZ1A 3IJOB 4U4SA 3OSQA 4AS5A 3OOAA 4PF8A 1P99A 4P47A 5A5XB 1SVXB 3PMWA 1XHYA 4U21A 2MKZA 4P8BA 3IB2A 4R9FA 2DVCA 4BDMA 4Q5TA 3MAMA 1DSNA 1FTLA 4KCCA 1Y3NA 3HN0A 2PFZA 4G77A 1B51A 5ITPA 4NHBA 1WVJA 1UTBA 3KGCA 2F3BA 4GL8A 4F1UA 5L9MA 5L9SA 1Y9UA 3M3LA 3B7DA 3E9XA 1B3EA 4U1OA 4IO4A 3NOHA 4H65A 4PP0A 4X1BA 2GH9A 4N17A 1A55A 4OENA 3S2VA 3RT6B 3C34A 4I62A 2XXUA 1NL5A 2XXQA 1DTZA 3CHGA 4KQPA 4EQ9A 4FBPA 2PMSA 5BUUA 3SEWA 4AS4A 4RPOA 2UYFA 4OVSA 3JZJA 5IZ3A 5I57A 2Q2AA 2GFEA 4FE8A 4TQUQ 4LQ5A 4OQOA 2AL5A 4O3AA 4DXUA 4DE8A 4PDDA 2I4CA 1B7HA 1MM7A 3O6HA 1M5EA 3FBPA 1IMBA 4PGNA 4OMBA 3TAJA 1JETA 3A3CA 4XKRA 3H3GA 5ET5A 4PE3A 2B65A 5J16A 3C31A 4PF6A 3H6WA 4NN3A 2XWIA 2I3WA 4QFKA 5L9OA 4RY1A 2DVZA 2O51A 5DEXA 2OWTA 4MX6A 1MXXA 5CBRA 4PBQA 1FQDA 1XS5A 3DP4A 1LAGE 2ONRA 1M5FA 3QMFA 1VE4A 3B50A 1Z7NE 2Q88A 2NUVA 1OLCA 3U8QA 2FIEA 2VGQA 2F5XA 1MQDA 2O1LA 1SD3A 4NG7A 5FHOA 4GBVA 2QS4A 2PVUA 4O8MA 2Q8JA 1FPEA 4LVQA 1MPBA 5F7VA 2DSFA 2VD2A 2THIA 5ICTA 4N8YA 2CZLA 2OWSA 1QGXA 2XX9A 2WEFA 2V4CA 4XKQA 1FCKA 1OQHA 5H8FA 4ESWA 1EYJA 2XWKA 4ZE8A 4AQ4A 4H8JA 3SEXA 5I7IA 1N0TA 3MQ9A 3TFLA 1JNFA 2ONKE 2XXYA 4HE2A 4LN5A 1B5HA 1PDAA 3ILTB 3UA8A 2O6AA 3WAFA 2DXYA 4N81A 2HCAA 3ROJA 5I58A 1AH5A 4ELPA 4QFPA 3A09A 4H67A 2I6EA 2V84A 1VSOA 4C1UA 4YU0A 3ECRA 3KC1A 4X48A 1MXWA 3KSXA 4OTEA 1FPFA 4P11A 2F97A 1B46A 3FV1A 1NUXA 3MSTA 3T0JA 3OENA 2YPNA 4MAGA 5CMMA 1SI1A 4TOZA 1MQHA 5DVIA 2Y5KA 4G61A 3U93A 3JYRA 4EXLA 1BIYA 4IB2A 2QVUA 3L6GA 4EQBA 2YJPA 5AA4B 4QF9A 1NNPA 5F1QA 3EHSA 1M5BA 2QS2A 5FHNA 1I6BA 4I9DA 1USYH 1D4NA 5EYHA 2FIXA 4PE5B 2XXKA 3KG2A 1PB8A 1GVCA 1YPNA 1DPPA 2Z8DA 4FEBA 5L8DA 5AA1A 3UGWA 1B3FA 3RPLA 4OERA 1MG1A 3PMXA 1ZU0A 2H98A 3QK6A 2UVIA 5K2XA 1OVBA 2NVUB 1EU8A 4NF6A 4LZ8A 3PTYA 5I2NB 3SDFA 2H99A 1P1OA 3QYTA 5JTYB 2M8CA 3FJ7A 4OVTA 2XWVA 1UTHB 3SEVA 3KEIA 3TTMA 3OO8A 2V3UA 4GL0A 5IZZA 1J1NA 4IO3A 4U2RA 1CE2A 1MXZA 2A5TB 2B4MA 2NXOA 3IJXB 2Y5LA 1DK4A 2RCAA 4BDOA 4N6KA 4FECA 2CZHA 1PBPA 1G0IA 1SPIA 4GBWA 5IGAA 2DS9A 3T1BA 3G3FA 3PV0E 1FPIA 4TLLB 2XD3A 1EZOA 4LONB 3FD3A 1B0LA 1P1NA 1ZTYA 5FBPA 1LCTA 2VT5A 2F8DA 1EZPA 1UQWA 2BJIA 4GRKA 5I56A 3OO6A 2UXAA 2VPNA 1NV0A 1FW0A 3RT8A 4P1EA 4NE4A 4O3BA 1MM6A 1GV8A 1OIBA 3KN3A 2L5VA 4GIZA 1SDXA 3M8UA 4R73A 1D9YA 2UVGA 1F9BA 4QFOA 5M2VA 4UACA 4F22A 3RN8A 1A54A 2RF1A 4ZDMA 5KCJB 1RYOA 3FV2A 3Q27A 2DWHA 3TELA 3N94A 4KYEA 1MY0A 2ZNTA 4MMPA 3KBZA 5FTIA 1LAFE 2IEEA 4KR5A 3EKIA 5JEIA 1FJ6A 3V5AA 1IIWA 1SW4A 3SESA 3FIRA 4JB7A 1LLSA 3LSLA 2V25A 4H5FA 3G3JA 1FQFA 4H1XA 1KWHA 1TT1A 4KFQA 3RY3A 3PUVE 2GQ1A 2DP8A 3FASA 3FZVA 4HE1A 3BFUA 4UABA 4FJPA 4PAKA 4JVIA 3TPAA 4XEQA 2CEXA 1RDZA 4GLIA 4PQJA 2Z8FA 1MY4A 1LBXA 1BKAA 3TUSA 3FVGA 4MLVA 3W15C 4G68C 4G8HA 1YZ0A 4F18A 4O94A 4PFYA 1JQFA 4G2ZA 4PFWA 1IQ7A 4WKMA 4KXPA 5EQ9A 4GQOA 3H7MA 2ZMBA 3MZBA 3I5OA 5HM4B 4HTGA 1B9JA 3TEPA 3MUQA 2Q2CA 4JDFA 1MY1A 4G4PA 4IY5A 1MDQA 4YKPA 2FA7A 2AYSA 1FPBA 2W7YA 3MVWA 1QKAA 4OVPA 4MF3A 2QSXA 4R2BA 1IMAA 2Y84A 2F6PA 3M3FA 4ZEIA 4NF0A 3HFUA 1Q9DA 2H9BA 2GHAA 1B32A 3T66A 1N3XA 4KHZE 1SBPA 3ONMA 3DELB 3K0VA 4HXVA 4ESXA 3ZKLA 2DWJA 5ET8A 1URGA 3E13X 1D3KA 1YTVA 3MC2A 4NF5A 1N3WA 2OCUA 1MDP1 3TQWA 4QRZA 4O7IA 3P7IA 3GBBA 2XD2A 2WBDA 4GWSA 2FYIA 4GWYA 3SEYA 3OD7A 2Q9TA 3B6QA 4G68A 2F7AA 1P1WA 2Q89A 3EHTA 4HE0A 1LFGA 3BFTA 5CBSA 4GOTA 2ESNA 2PX1A 3K02A 5I84A 1NI9A 1EH3A 1LCFA 4PFIA 2V3QA 2XXVA 1VFDA 3B8BA 4H0WA 2Y7WA 4F1VA 3CG1A 2I48A 1YCJA 2F3DA 2HQ0A 1TXFA 1BLFA 3W9VA 1QULA 1ZJLA 3H6UA 4PC9A 1FPGA 2XXPA 1N7WA 5AA3A 2WYKA 4ONYA 1FPDA 2VP1A 3IL1B 2DOJA 2I0CA 3N6UA 4PDHA 4GX3A 4N4UA 5H8HA 3HCQA 1US4A 3G3HA 5H8NB 1Q35A 3C32A 3VFJA 2FHYA 1QUIA 3EQ1A 3C4MA 3IORA 4NMYA 4NTLA 3HO7A 5TU0A 3CSBA 1B40A 1B7UA 2HXWA 2ZYKA 3PD8A 5IM2A 4EF1A 2YLNA 5H8QB 3K01A 2OJTA 4MNPA 4GXAA 1NNKA 4QHQA 3TCFA 4XTCQ 1IITA 2B3FA 1OLAA 3C35A 4GX6A 3K6WA 3PPPA 3QAXA 3GBAA 1MH3A 3GZGA 4NAPA 4DLDA 1PBQA 2Q8MA 1LBBA 1PB9A 5ESYA 3SERA 3E3KA 3KZGA 4I3YA 4QSDA 5ET6A 3L6HA 1YXIA 1DCUA 3K2DA 4H5GA 2ZNSA 4N91A 5CMBA 1IXHA 2FVZA 3O97A 1NV5A 3VXBA 4DIGA 4RJZA 3CR9A 1S7YA 3RLFE 1NV1A 1SYHA 4QBAA 2A5SA 2BJJX 5TP9A 4Q0CA 5ITOA 3K1MA 3HHFA 3OO7A 1NH7A 2XWOA 2HAVA 1B3GA 4PAFA 1Y3QA 2O69A 4MEVA 4POXA 5DT6A 3TODA 1MY3A 4P9KA 1UTBB 3KJ7A 2QRYA 1LBZA 3PUZE 4KPTA 3RNNA 1GR2A 2RC7A 2ZYOA 1N7XA 1B58A 3VVFA 1H45A 2R6GE 3D4CA 3DM0A 2DWIA 4ZECA 4F3PA 3OEKA 5AA4A 3O6GA 2QVRA 5DYHA 3EPEA 2ZZVA 3PPQA 4MBPA 4N6DA 3T9UA 4ECFA 3T9VA 3OELA 5FTHA 4OFLA 1YYZA 4XFEA 2DE4A 4IO2A 2VD3A 4K3FA 3BIGA 4JBZA 1P1QA 5EHMA 4FAJA 1IMEA 3KOTA 4H46A 4IO5A 1JVYA 2D21A 1DPEA 5ELVA 3TDJA 3C33A 3MWBA 5I2NA 4WEDA 3VLVA 4FATA 4QXDA 2UYEA 1FBHA 4JVDA 2Y7KA 4KD5A 1HSJA 1TWYA 1IXGA 1XVYA 4OZ9A 5EQAA 4PFUA 4U23A 2A5TA 4EUOA 2ZYMA 4Z7EA 2ZZWA 1LAXA 1BTJA 2GRVA 3KC0A 1NH8A 2GHBA 2LAOA 4X9TA 1FQAA 4PGPA 4ZZAA 4HCYA 3HPIA 5A5LA 1TFDA 2ZYNA 1DMBA 5CM6A 4QSEA 4BDNA 3LBSA 5KDTB 3GYYA 1LBVA 4OESA 2E1SA 3ZSFA 4XIGQ 3PPNA 4DCXA 3FJMA 1SQYA 3E4RA 5I5PA 4ZZEA 5AA2A 4RA1A 2G93A 3U94A 1Z7ME 4DCYA 5I2KA 2VHAA 4F39A 5FHMA 1IMDA 3PGFA 1B5IA 3PMVA 2KQZA 3OSRA 1SI0A 1Y3PA 3K6UA 2HZKA 3KJTA 4LATA 4IO7A 1FPKA 4MFIA 5KCJA 3T22A 1SW5A 4OVRA 1ELJA 3THIA 3TTLA 1B7ZA 4FEDA 3FXBA 1FBPA 2CMOA 3DP6A 3K6VA 2P0SA 2DXRA 4GWWA 2QMXA 4P0GA 4YKKA 1DTGA 1B5JA 5IAIA 4OHNA 4GFRA 2F6GA 4X8RA 5LDZA 1FQCA 1POTA 1AL3A 4ELRA 4GD5A 1IEJA 3RTWB 3RQTA 3B6TA 4YB5A 3TYHA 5HBCA 1FTMA 3IK6B 4PFBA 1A40A 2X7QA 2NWJA 5I58B 2D3IA 1RDYA 1Y20A 1B52A 3TCGA 1A7LA 1NMUA 3MVZA 1NV3A 1LFHA 4ZEFA 1MH4A 1VDWA 2DE3A 2OBGA 3O9PA 1XOCA 3RTFB 2WKYA 3GLBA 3H03A 2HPGA 5CMCA 2Y7RA 3D4GA 3N26A 3IFAA 1Q1KA 2XXHA 3S9MC 4POWA 4N13A 1O7TA 4C0RA 2QS3A 3B6WA 4MJOA 4LZ7A 3JV9A 4GXSB 1LBCA 1NNFA 3ODBA 1AOVA 4KCDA 3RGYA 4IGTA 4GX4A 1WDNA 2QJEA 4NWCA 3E78A 4QSCA 2QPQA 4DXCA 3VE1B 4JSDA 4O7MA 4IO6A 2RINA 1UIVA 4NWDA 1NKXA 3OMBA 4HCWA 3H4ZA 3Q25A 3TTKA 3N6TA 4X04A 4PETA 5EYGA 4TLMB 4JSOA 2OX3A 5K2YA 5HPQA 3K4UA 3CFLA 4U22A 4HW8A 3DP8A 3PUXE 3D1RA 3MZ1A 4NF8A 3T93B 2PFYA 5DVFA 4OETA 4ZE9A 4F3GA 1QUKA 4ND9A 1URDA 3IFCA 4PBHA 3QSLA 1WODA 2F36A 3PUYE 3KN7A 3KN8A 4OFJA 4H45A 2H25A 1B3HA 5A5XA 2Z8EA 3QUFA 1JP4A 4P3LA 5IZ1A 4XXUA 3FXUA 5F24A 4MHFA 3UN6A 4RK9A 1USYE 1S50A 3EF7A 2WX9A 1MQIA 3LC8A 4QFNA 3UP9A 3VVDA 1T0KA 5ET7A 5T3JA 1MXYA 2IA4A 4NX1A 4OFOA 4I3EA 4LP2B 3A29A 1H76A 1FBDA 4JWYA 1A8FA 5CI5A 4F2OA 1PEBA 3KSJA 2QL3A 4OA4A 1IMCA 3CSGA 5H8NA 3TKDA 3O2AA 2F35A 3LR1A 1FQBA 1I6QA 2XXWA 3G7WA 1Y1MA 1MQJA 3AXFA 4EF2A 1LBYA 2R9JA 1FTOA 1R6ZA 3T96B 1KZ8A 5IKBA 5H8QA 2XXIA 5DTBA 2HAUA 1LAHE 4NEDA 1FTJA 1GTKA 3DLNA 4BLAA 3PUWE 3A3UA 1JW5A 4P56A 3KBRA 4EQ7A 3IR1A 2WYPA 4XF5A 2B4LA 2UVHA 4IR8A 5AE4A 3T9XB 4R9GA 1RKMA 3TCHA 2PCRA 2CZKA 5B70A 1R9QA 1US5A 3MPLA 1JEVA 4M1VA 1TFAA 2F34A 4R6HA 3TZAA 1FBGA 4I40A 3KFMA 3IX1A 2H4IA 1ZLQA 3S9LC 1O63A 2PBWA 4YKJA 3S9NC 4PTKA 1D9VA 2I4BA 1JVXA 1SW2A 4G8MA 2DQVA 3EHUA 4ELOA 3R26A 1SW1A 3CRBA 1FPJA 4Z0IA 5ICQA 2DYXA 5I59B 1PC3A 2REJA 3TMGA 1IXIA 3CFXA 5TPAB 2QMWA 4YICA 4GWUA 1MQGA 2HXRA 3Q28A 4LUBA 1OQGA 3FATA 1FBCA 3LSXA 1JW4A 1II5A 2X7PA 1N04A 4O3CA 4H6DA 3CVGA 2CEYA 2HHMA 3WAEA 3UIFA 4C1TA 3K6XA 4I1DA 2ALUA 1MY2A 4OEVA 1LB8A 4NF4B 1GGGA 2QFLA 1IXCA 4NF5B 4PFRA 3U1OA 1L5TA 3BBRA 4DDDA 1FSAA 3IB0A 2ZZXA 4GWXA 1URSA 3FUZA 1G0HA 3U65A 2Z22A 4ISUA 4N6PA 3FJGA 4BDLA 2AL4A 3VLWA 4OANA 1HSEA 4G68B 5H8SA 2JJKA 4YMAA 2B3BA 2XHDA 1RDXA 4THIA 1O64A 2WBBA 2AIXA 4I8CA 3K1NA 2I49A 1B1XA 3K1PA 2OZZA 3QXMA 2REGA 4JWOA 3Q26A 4BDRA 2OLBA 4OYVA 4AB5A 1M5DA 3OO9A 4GVOA 3HV1A 4F2QA 5KDTA 5JK4A 2VPOA 3O28A 3W9WA 3MJNA 3FVKA 1NV6A 4MLQA 1H44A 5H8HB 4ZS9A 4N07A 4RNSA 3IAZA 3USDA 1LSTA 1FJ9A 3G3GA 1IZ1A 4HS7A 2HEUA 4BDQA 1EZ9A 3S9EA 3CG3A 3LSFB 1NV4A 1UIUA 4LZ5A 5KZTA 1IMFA 1H43A 2XX7A 4OXVA 3BKIB 1K9YA 3CFZA 3N5LA 4F3SA 2F7CA 5IZ3B 5I57B 3G3IA 4YB6A 1A8EA 4E0WA 4R6YA 5JTYA 1P1UA 3HHGA 1UTHA 1N76A 4NGUA 3IO4A 2Y7PA 4MH5A 3F11A 4R6KA 3I3VA 4YB7A 3MW0A 3ILUB 1JEUA 2HFBA 4EDPA 2V93A 3KOSA 3E79A 2I3VA 2V3TA 4M4GA 1FBEA 3EN3A 1LBWA 4MNIA 1B4ZA 3MVYA 2FBPA 1FRPA 1VFEA 5DEXB 2HZLA 5TP9B 3QUJA 4MIJA 1RYXA 4PCDA 4IY6A 1MS7A 2RCBA 3Q29A 3UORA 2UVJA 2Y7IA 1CB6A 2ABHA 1B1HA 2QS1A 5CC2A 4F3BA 1ATGA 2O1MA 3TTRA 1LB9A 1KA1A 4NQ8A 1ZIUA 4UA8A 4E0XA 4KYDA 4YKIA 4MNCA 2O7UA 2NOOA 3R6UA 5ISUA 3O6IA 3MZ9A 1MXUA 1NUWA 2X26A 3MVXA 2ZXTA 4RXLA 4QFLA 3TTNA 4YMBA 4MCOA 5AA2D 1JW1A 1MXVA 4RK2A 4XKPA 5DW8A 1EYKA 3LUZA 2DDKA 2OK2A 3S4UA 3H6TA 3MPKA 1M5CA 4KYSA 5H8FB 2OWZA 1MPCA 2Z23A 4FIMA 1QKBA 4FORA 1EYIA 4ZEBA 1CNQA 1FPLA 1I6AA 1NUZA 4RYAA 2DWAA 2KR0A 5EYFA 3PD9A 4PAIA 1SYIA 1D9QA 1QW0A 4L17A 4JXIA 1NV7A 3FXRA 2P2AA 2O68A 3BIHA 2F78A 4JVCA 3LV0A 1FTKA 3TQLA 3IOUA 1ANFA 2FNCA 1LEVA 4JWXA 1PB7A 2I0BA 4N8GA 2P3VA 4H8IA 4WEPA 3V89B 1OVTA 1ZMGA 3IOVA 1AMFA 4AB6A 1NV2A 3T9HB 3SZPA 3CI8A 1MRPA 4R72A 3O66A 1Y4CA 4DXBA 1B3LA 3O29A 1IUDA 4U4XA 5EHSA 3IO6A 4ELQA 5LOMA 2QVVA 2PT2A 4F19A 4LQ2A 5AA2B 1A99A 3GXAA 2R8TA 1QUJA 4P0IA 2F7BA 3FGSA 2RC9A 1KA0A 4GWOA 2H5YA 5I2KB 1B4HA 1DBZA
chains in the Genus database with same CATH topology
4U1ZA 1S9TA 2XXXA 1OMPA 5CRYA 2KLFA 2O7IA 3RUMA 4R74A 2RC8A 4ZEKA 3VLUA 4KI0E 4F31B 1QJMA 1XT8A 1VR5A 3QIMA 4Q8RA 3PU5A 4NF6B 3SKPA 3V83A 5BWJA 3FXQA 3V8XB 1POY1 4X1DA 3MBPA 4Q30B 2XX8A 3VVEA 5J1DA 4YZZA 4EXKA 2ANJA 3H06B 4F1YA 1Y4TA 2DE2A 3LSWA 1YAEA 1B6HA 2XXTA 3LUYA 4R75A 4R2FA 1MPDA 3C9HA 4IGRA 3H6VA 3MP1A 1NFTA 4PFTA 3SETA 1B2HA 3ZS6A 2VOZA 1LFIA 4F29A 3I6VA 2PT1A 3VDFA 1ZBMA 5I56B 2XXRA 3R7XA 2I58A 2RKMA 2D5WA 2PYYA 3CIJA 3U92A 3PPRA 3IB1A 5B7DA 1I69A 1B05A 1Y1ZA 1BP5A 3OXNA 1QVSA 5DVJA 2O84X 2P1SA 4ZEDA 3IOWA 5CMKA 1DOTA 5I59A 3MP8A 3VXCA 3U72A 5TPAA 1N84A 3MP6A 2R71A 3FVOA 4OVJA 3SEUA 3G3KA 4LA9A 3PPOA 4YAHX 3FVNA 1LGBC 4RPNA 3ZKKA 1B0HA 3UK4A 3C36A 1H3DA 4GF8A 1AIVA 4OWDA 4NF4A 2G29A 4OEUA 1HSLA 3M3KA 2ZNUA 3VV5A 4NF8B 1NNTA 4G8NA 1ZKBA 2E0SA 3HSTA 3OEMA 1XVXA 1R1NA 1FQEA 1XC1A 2ONSA 4WXJA 3K00A 3IOTA 4XKNA 3RPWA 1R9LA 4DZ1A 3IJOB 4U4SA 3OSQA 3OOAA 1P99A 5A5XB 1SVXB 3PMWA 1XHYA 4U21A 3IB2A 4R9FA 4BDMA 2DVCA 4Q5TA 3MAMA 1DSNA 1FTLA 4KCCA 1Y3NA 3HN0A 4G77A 1B51A 5ITPA 1WVJA 1UTBA 3KGCA 4GL8A 4F1UA 5L9MA 5L9SA 1Y9UA 3M3LA 3B7DA 3E9XA 1B3EA 4U1OA 4IO4A 4PP0A 4H65A 4X1BA 2GH9A 1A55A 4OENA 3S2VA 3RT6B 3C34A 4I62A 2XXUA 1NL5A 2XXQA 1DTZA 4KQPA 4EQ9A 2PMSA 5BUUA 3SEWA 4RPOA 2UYFA 3JZJA 5I57A 2Q2AA 2GFEA 4FE8A 4TQUQ 4LQ5A 4OQOA 2AL5A 4DXUA 4O3AA 4DE8A 2I4CA 1B7HA 1MM7A 3O6HA 1M5EA 4OMBA 3TAJA 1JETA 3A3CA 4XKRA 3H3GA 2B65A 3C31A 3H6WA 2I3WA 4QFKA 5L9OA 4RY1A 2DVZA 2O51A 5DEXA 2OWTA 1MXXA 5CBRA 1FQDA 1XS5A 3DP4A 1LAGE 2ONRA 1M5FA 1VE4A 1Z7NE 2Q88A 2NUVA 1OLCA 3U8QA 2VGQA 2F5XA 1MQDA 2O1LA 1SD3A 5FHOA 2QS4A 2PVUA 2Q8JA 4LVQA 1MPBA 5F7VA 2DSFA 2VD2A 2THIA 5ICTA 2CZLA 2OWSA 2XX9A 4XKQA 1FCKA 1OQHA 5H8FA 4ESWA 4ZE8A 4AQ4A 4H8JA 3SEXA 1N0TA 3MQ9A 3TFLA 1JNFA 2ONKE 2XXYA 1B5HA 1PDAA 3ILTB 3UA8A 2O6AA 3WAFA 2DXYA 2HCAA 5I58A 4ELPA 1AH5A 4QFPA 3A09A 4H67A 2I6EA 2V84A 1VSOA 4C1UA 4YU0A 3ECRA 4X48A 1MXWA 3KSXA 4OTEA 4P11A 2F97A 1B46A 3FV1A 3OENA 2YPNA 5CMMA 1SI1A 4TOZA 1MQHA 5DVIA 3U93A 3JYRA 4EXLA 1BIYA 4IB2A 3L6GA 4EQBA 2YJPA 5AA4B 4QF9A 1NNPA 5F1QA 3EHSA 1M5BA 2QS2A 5FHNA 1I6BA 4I9DA 1USYH 1D4NA 4PE5B 3KG2A 1PB8A 1GVCA 1YPNA 1DPPA 2Z8DA 4FEBA 5L8DA 5AA1A 3UGWA 1B3FA 4OERA 1MG1A 3PMXA 1ZU0A 2H98A 3QK6A 2UVIA 5K2XA 1OVBA 2NVUB 1EU8A 4NF6A 4LZ8A 5I2NB 3SDFA 2H99A 1P1OA 3QYTA 5JTYB 2M8CA 3FJ7A 1UTHB 3SEVA 3KEIA 3TTMA 3OO8A 2V3UA 4GL0A 1J1NA 4IO3A 4U2RA 1CE2A 1MXZA 2A5TB 2NXOA 3IJXB 2RCAA 4BDOA 4FECA 1PBPA 2DS9A 3G3FA 3PV0E 4TLLB 2XD3A 1EZOA 4LONB 3FD3A 1B0LA 1P1NA 1ZTYA 1LCTA 2F8DA 1EZPA 1UQWA 4GRKA 5I56A 3OO6A 2UXAA 1FW0A 3RT8A 4NE4A 4O3BA 1MM6A 1GV8A 1OIBA 3KN3A 4GIZA 1SDXA 3M8UA 4R73A 1D9YA 2UVGA 1F9BA 4QFOA 5M2VA 4UACA 4F22A 3RN8A 1A54A 2RF1A 4ZDMA 5KCJB 1RYOA 3FV2A 3Q27A 2DWHA 3TELA 3N94A 4KYEA 1MY0A 2ZNTA 5FTIA 1LAFE 2IEEA 4KR5A 5JEIA 3V5AA 1IIWA 1SW4A 3SESA 3FIRA 4JB7A 1LLSA 3LSLA 2V25A 4H5FA 3G3JA 1FQFA 4H1XA 1KWHA 1TT1A 4KFQA 3RY3A 3PUVE 2DP8A 3FASA 3FZVA 3BFUA 4FJPA 3TPAA 4GLIA 4PQJA 2Z8FA 1MY4A 1BKAA 3TUSA 3FVGA 4MLVA 3W15C 4G68C 4G8HA 4F18A 4PFYA 1JQFA 4G2ZA 4PFWA 1IQ7A 4WKMA 4GQOA 3H7MA 2ZMBA 3MZBA 3I5OA 5HM4B 4HTGA 1B9JA 3TEPA 3MUQA 2Q2CA 4JDFA 1MY1A 4G4PA 4IY5A 1MDQA 4YKPA 2FA7A 2AYSA 2W7YA 3MVWA 1QKAA 4MF3A 2QSXA 4R2BA 2Y84A 2F6PA 3M3FA 4ZEIA 2H9BA 2GHAA 1B32A 3T66A 1N3XA 4KHZE 1SBPA 3ONMA 3DELB 3K0VA 4ESXA 3ZKLA 2DWJA 1URGA 3E13X 1D3KA 1YTVA 3MC2A 4NF5A 1N3WA 2OCUA 1MDP1 3TQWA 4QRZA 3P7IA 3GBBA 2XD2A 2FYIA 3SEYA 3OD7A 2Q9TA 3B6QA 4G68A 2F7AA 1P1WA 2Q89A 3EHTA 1LFGA 3BFTA 5CBSA 4GOTA 2ESNA 2PX1A 3K02A 5I84A 1EH3A 1LCFA 2V3QA 2XXVA 1VFDA 4H0WA 2Y7WA 4F1VA 3CG1A 2I48A 1YCJA 2HQ0A 1TXFA 1BLFA 3W9VA 1QULA 1ZJLA 3H6UA 2XXPA 1N7WA 5AA3A 4ONYA 2VP1A 3IL1B 2DOJA 2I0CA 3N6UA 5H8HA 3HCQA 1US4A 3G3HA 5H8NB 1Q35A 3C32A 3VFJA 1QUIA 3EQ1A 3C4MA 3IORA 4NMYA 4NTLA 3HO7A 5TU0A 3CSBA 1B40A 1B7UA 2HXWA 2ZYKA 3PD8A 4EF1A 2YLNA 5H8QB 3K01A 2OJTA 4GXAA 1NNKA 4QHQA 3TCFA 4XTCQ 1IITA 2B3FA 1OLAA 3C35A 3K6WA 3PPPA 3QAXA 3GBAA 1MH3A 3GZGA 4DLDA 1PBQA 1LBBA 1PB9A 3SERA 3E3KA 3KZGA 4QSDA 3L6HA 3K2DA 4H5GA 2ZNSA 5CMBA 1IXHA 3O97A 3VXBA 4DIGA 4RJZA 3CR9A 1S7YA 3RLFE 1SYHA 2A5SA 2BJJX 5TP9A 4Q0CA 5ITOA 3K1MA 3HHFA 3OO7A 1NH7A 2HAVA 1B3GA 1Y3QA 2O69A 4POXA 5DT6A 3TODA 1MY3A 1UTBB 3KJ7A 2QRYA 3PUZE 4KPTA 3RNNA 1GR2A 2RC7A 2ZYOA 1N7XA 1B58A 3VVFA 1H45A 2R6GE 3D4CA 3DM0A 2DWIA 4ZECA 4F3PA 3OEKA 5AA4A 3O6GA 5DYHA 3EPEA 3PPQA 4MBPA 3T9UA 4ECFA 3T9VA 3OELA 5FTHA 4OFLA 2DE4A 4IO2A 2VD3A 4K3FA 4JBZA 1P1QA 5EHMA 4FAJA 3KOTA 4IO5A 1JVYA 2D21A 1DPEA 5ELVA 3TDJA 3C33A 3MWBA 5I2NA 4WEDA 3VLVA 4FATA 2UYEA 2Y7KA 4KD5A 1HSJA 1TWYA 1IXGA 1XVYA 4OZ9A 4PFUA 4U23A 2A5TA 4EUOA 2ZYMA 4Z7EA 1LAXA 1BTJA 2GRVA 1NH8A 2GHBA 2LAOA 4X9TA 1FQAA 4ZZAA 4HCYA 3HPIA 1TFDA 2ZYNA 1DMBA 5CM6A 4QSEA 4BDNA 3LBSA 5KDTB 4OESA 2E1SA 3ZSFA 4XIGQ 3PPNA 4DCXA 3FJMA 1SQYA 3E4RA 4ZZEA 5AA2A 4RA1A 2G93A 3U94A 1Z7ME 4DCYA 5I2KA 2VHAA 4F39A 5FHMA 3PGFA 1B5IA 3PMVA 3OSRA 1SI0A 1Y3PA 3K6UA 2HZKA 3KJTA 4LATA 4IO7A 4MFIA 5KCJA 3T22A 1SW5A 1ELJA 3THIA 3TTLA 1B7ZA 4FEDA 2CMOA 3DP6A 3K6VA 2P0SA 2DXRA 2QMXA 4P0GA 4YKKA 1DTGA 1B5JA 5IAIA 4OHNA 4GFRA 2F6GA 1FQCA 1POTA 1AL3A 4ELRA 4GD5A 1IEJA 3RTWB 3RQTA 3B6TA 4YB5A 3TYHA 5HBCA 1FTMA 3IK6B 1A40A 2X7QA 2NWJA 5I58B 2D3IA 1Y20A 1B52A 3TCGA 1A7LA 1NMUA 3MVZA 1LFHA 4ZEFA 1MH4A 2DE3A 2OBGA 3O9PA 1XOCA 3RTFB 2WKYA 3GLBA 3H03A 5CMCA 2Y7RA 3D4GA 3N26A 1Q1KA 2XXHA 3S9MC 4POWA 4N13A 1O7TA 4C0RA 2QS3A 3B6WA 4LZ7A 3JV9A 4GXSB 1LBCA 1NNFA 3ODBA 1AOVA 4KCDA 3RGYA 4IGTA 1WDNA 2QJEA 4NWCA 4QSCA 2QPQA 4DXCA 3VE1B 4JSDA 4IO6A 2RINA 1UIVA 4NWDA 1NKXA 3OMBA 4HCWA 3H4ZA 3Q25A 3TTKA 3N6TA 4PETA 4TLMB 4JSOA 5K2YA 5HPQA 3K4UA 3CFLA 4U22A 4HW8A 3DP8A 3PUXE 3MZ1A 4NF8A 3T93B 5DVFA 4OETA 4ZE9A 4F3GA 1QUKA 4ND9A 1URDA 3QSLA 1WODA 2F36A 3PUYE 3KN7A 3KN8A 4OFJA 2H25A 1B3HA 5A5XA 2Z8EA 3QUFA 4XXUA 3FXUA 3UN6A 4RK9A 1USYE 1S50A 3EF7A 1MQIA 3LC8A 4QFNA 3UP9A 3VVDA 1T0KA 1MXYA 2IA4A 4OFOA 4LP2B 1H76A 4JWYA 1A8FA 5CI5A 4F2OA 1PEBA 3KSJA 2QL3A 3CSGA 5H8NA 3TKDA 3O2AA 2F35A 3LR1A 1FQBA 1I6QA 2XXWA 3G7WA 1Y1MA 1MQJA 3AXFA 4EF2A 2R9JA 1FTOA 1R6ZA 3T96B 5IKBA 5H8QA 2XXIA 5DTBA 2HAUA 1LAHE 4NEDA 1FTJA 1GTKA 3DLNA 4BLAA 3PUWE 3A3UA 1JW5A 3KBRA 4EQ7A 3IR1A 2UVHA 5AE4A 3T9XB 4R9GA 1RKMA 3TCHA 5B70A 1R9QA 1US5A 3MPLA 1JEVA 4M1VA 1TFAA 2F34A 4R6HA 3TZAA 3KFMA 3IX1A 2H4IA 1ZLQA 3S9LC 1O63A 2PBWA 4YKJA 3S9NC 1D9VA 2I4BA 1JVXA 1SW2A 4G8MA 2DQVA 3EHUA 4ELOA 3R26A 1SW1A 3CRBA 4Z0IA 5ICQA 2DYXA 5I59B 1PC3A 2REJA 3TMGA 1IXIA 3CFXA 5TPAB 2QMWA 4YICA 1MQGA 3Q28A 4LUBA 1OQGA 3FATA 3LSXA 1JW4A 1II5A 2X7PA 1N04A 4O3CA 4H6DA 3CVGA 3WAEA 3UIFA 4C1TA 3K6XA 4I1DA 2ALUA 1MY2A 4NF4B 1LB8A 4OEVA 1GGGA 1IXCA 4NF5B 3U1OA 1L5TA 3BBRA 4DDDA 3IB0A 1URSA 3FUZA 2Z22A 4ISUA 4N6PA 3FJGA 4BDLA 2AL4A 3VLWA 1HSEA 4G68B 5H8SA 4YMAA 2B3BA 2XHDA 4THIA 1O64A 2AIXA 4I8CA 3K1NA 2I49A 1B1XA 3K1PA 2OZZA 3QXMA 2REGA 4JWOA 3Q26A 4BDRA 2OLBA 4OYVA 4AB5A 1M5DA 3OO9A 4GVOA 3HV1A 4F2QA 5KDTA 5JK4A 3W9WA 3O28A 3MJNA 3FVKA 4MLQA 1H44A 5H8HB 4ZS9A 4N07A 4RNSA 3IAZA 3USDA 1LSTA 3G3GA 1IZ1A 4HS7A 2HEUA 4BDQA 1EZ9A 3S9EA 3CG3A 3LSFB 1UIUA 4LZ5A 5KZTA 1H43A 2XX7A 4OXVA 3BKIB 3N5LA 3CFZA 4F3SA 2F7CA 5I57B 3G3IA 4E0WA 1A8EA 4YB6A 4R6YA 5JTYA 1P1UA 3HHGA 1UTHA 1N76A 3IO4A 2Y7PA 4MH5A 3F11A 4R6KA 3I3VA 4YB7A 3MW0A 3ILUB 1JEUA 2HFBA 4EDPA 2V93A 3KOSA 2I3VA 2V3TA 4M4GA 3EN3A 1B4ZA 3MVYA 1VFEA 5DEXB 2HZLA 5TP9B 3QUJA 1RYXA 4IY6A 1MS7A 2RCBA 3UORA 3Q29A 2UVJA 2Y7IA 1CB6A 2ABHA 1B1HA 2QS1A 5CC2A 4F3BA 1ATGA 2O1MA 3TTRA 1LB9A 1ZIUA 4UA8A 4E0XA 4KYDA 4YKIA 2O7UA 2NOOA 3R6UA 5ISUA 3O6IA 3MZ9A 1MXUA 2X26A 3MVXA 2ZXTA 4RXLA 4QFLA 3TTNA 4YMBA 5AA2D 1JW1A 1MXVA 4RK2A 4XKPA 2OK2A 3S4UA 3H6TA 3MPKA 1M5CA 4KYSA 5H8FB 1MPCA 2Z23A 4FIMA 1QKBA 4FORA 4ZEBA 1I6AA 4RYAA 2DWAA 5EYFA 3PD9A 1SYIA 1QW0A 4L17A 4JXIA 3FXRA 2P2AA 2O68A 2F78A 1FTKA 3TQLA 3IOUA 1ANFA 2FNCA 4JWXA 1PB7A 2I0BA 4H8IA 4WEPA 3V89B 1OVTA 1ZMGA 3IOVA 1AMFA 4AB6A 3T9HB 3CI8A 1MRPA 4R72A 3O66A 1Y4CA 4DXBA 1B3LA 3O29A 1IUDA 4U4XA 5EHSA 3IO6A 4ELQA 5LOMA 2PT2A 4F19A 4LQ2A 5AA2B 1A99A 3GXAA 1QUJA 4P0IA 2F7BA 3FGSA 2RC9A 4GWOA 2H5YA 5I2KB 1B4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U1Z A;  1S9T A;  2XXX A;  1OMP A;  5CRY A;  2KLF A;  2O7I A;  3RUM A;  4R74 A;  2RC8 A;  4ZEK A;  3VLU A;  4KI0 E;  4F31 B;  1QJM A;  1XT8 A;  1VR5 A;  3QIM A;  4Q8R A;  3PU5 A;  4NF6 B;  3SKP A;  3V83 A;  5BWJ A;  3FXQ A;  3V8X B;  1POY 1;  4X1D A;  3MBP A;  4Q30 B;  2XX8 A;  3VVE A;  5J1D A;  4YZZ A;  4EXK A;  2ANJ A;  3H06 B;  4F1Y A;  1Y4T A;  2DE2 A;  3LSW A;  1YAE A;  1B6H A;  2XXT A;  3LUY A;  4R75 A;  4R2F A;  1MPD A;  3C9H A;  4IGR A;  3H6V A;  3MP1 A;  1NFT A;  4PFT A;  3SET A;  1B2H A;  3ZS6 A;  2VOZ A;  1LFI A;  4F29 A;  3I6V A;  2PT1 A;  3VDF A;  1ZBM A;  5I56 B;  2XXR A;  3R7X A;  2I58 A;  2RKM A;  2D5W A;  2PYY A;  3CIJ A;  3U92 A;  3PPR A;  3IB1 A;  5B7D A;  1I69 A;  1B05 A;  1Y1Z A;  1BP5 A;  3OXN A;  1QVS A;  5DVJ A;  2O84 X;  2P1S A;  4ZED A;  3IOW A;  5CMK A;  1DOT A;  5I59 A;  3MP8 A;  3VXC A;  3U72 A;  5TPA A;  1N84 A;  3MP6 A;  2R71 A;  3FVO A;  4OVJ A;  3SEU A;  3G3K A;  4LA9 A;  3PPO A;  4YAH X;  3FVN A;  1LGB C;  4RPN A;  3ZKK A;  1B0H A;  3UK4 A;  3C36 A;  1H3D A;  4GF8 A;  1AIV A;  4OWD A;  4NF4 A;  2G29 A;  4OEU A;  1HSL A;  3M3K A;  2ZNU A;  3VV5 A;  4NF8 B;  1NNT A;  4G8N A;  1ZKB A;  2E0S A;  3HST A;  3OEM A;  1XVX A;  1R1N A;  1FQE A;  1XC1 A;  2ONS A;  4WXJ A;  3K00 A;  3IOT A;  4XKN A;  3RPW A;  1R9L A;  4DZ1 A;  3IJO B;  4U4S A;  3OSQ A;  3OOA A;  1P99 A;  5A5X B;  1SVX B;  3PMW A;  1XHY A;  4U21 A;  3IB2 A;  4R9F A;  4BDM A;  2DVC A;  4Q5T A;  3MAM A;  1DSN A;  1FTL A;  4KCC A;  1Y3N A;  3HN0 A;  4G77 A;  1B51 A;  5ITP A;  1WVJ A;  1UTB A;  3KGC A;  4GL8 A;  4F1U A;  5L9M A;  5L9S A;  1Y9U A;  3M3L A;  3B7D A;  3E9X A;  1B3E A;  4U1O A;  4IO4 A;  4PP0 A;  4H65 A;  4X1B A;  2GH9 A;  1A55 A;  4OEN A;  3S2V A;  3RT6 B;  3C34 A;  4I62 A;  2XXU A;  1NL5 A;  2XXQ A;  1DTZ A;  4KQP A;  4EQ9 A;  2PMS A;  5BUU A;  3SEW A;  4RPO A;  2UYF A;  3JZJ A;  5I57 A;  2Q2A A;  2GFE A;  4FE8 A;  4TQU Q;  4LQ5 A;  4OQO A;  2AL5 A;  4DXU A;  4O3A A;  4DE8 A;  2I4C A;  1B7H A;  1MM7 A;  3O6H A;  1M5E A;  4OMB A;  3TAJ A;  1JET A;  3A3C A;  4XKR A;  3H3G A;  2B65 A;  3C31 A;  3H6W A;  2I3W A;  4QFK A;  5L9O A;  4RY1 A;  2DVZ A;  2O51 A;  5DEX A;  2OWT A;  1MXX A;  5CBR A;  1FQD A;  1XS5 A;  3DP4 A;  1LAG E;  2ONR A;  1M5F A;  1VE4 A;  1Z7N E;  2Q88 A;  2NUV A;  1OLC A;  3U8Q A;  2VGQ A;  2F5X A;  1MQD A;  2O1L A;  1SD3 A;  5FHO A;  2QS4 A;  2PVU A;  2Q8J A;  4LVQ A;  1MPB A;  5F7V A;  2DSF A;  2VD2 A;  2THI A;  5ICT A;  2CZL A;  2OWS A;  2XX9 A;  4XKQ A;  1FCK A;  1OQH A;  5H8F A;  4ESW A;  4ZE8 A;  4AQ4 A;  4H8J A;  3SEX A;  1N0T A;  3MQ9 A;  3TFL A;  1JNF A;  2ONK E;  2XXY A;  1B5H A;  1PDA A;  3ILT B;  3UA8 A;  2O6A A;  3WAF A;  2DXY A;  2HCA A;  5I58 A;  4ELP A;  1AH5 A;  4QFP A;  3A09 A;  4H67 A;  2I6E A;  2V84 A;  1VSO A;  4C1U A;  4YU0 A;  3ECR A;  4X48 A;  1MXW A;  3KSX A;  4OTE A;  4P11 A;  2F97 A;  1B46 A;  3FV1 A;  3OEN A;  2YPN A;  5CMM A;  1SI1 A;  4TOZ A;  1MQH A;  5DVI A;  3U93 A;  3JYR A;  4EXL A;  1BIY A;  4IB2 A;  3L6G A;  4EQB A;  2YJP A;  5AA4 B;  4QF9 A;  1NNP A;  5F1Q A;  3EHS A;  1M5B A;  2QS2 A;  5FHN A;  1I6B A;  4I9D A;  1USY H;  1D4N A;  4PE5 B;  3KG2 A;  1PB8 A;  1GVC A;  1YPN A;  1DPP A;  2Z8D A;  4FEB A;  5L8D A;  5AA1 A;  3UGW A;  1B3F A;  4OER A;  1MG1 A;  3PMX A;  1ZU0 A;  2H98 A;  3QK6 A;  2UVI A;  5K2X A;  1OVB A;  2NVU B;  1EU8 A;  4NF6 A;  4LZ8 A;  5I2N B;  3SDF A;  2H99 A;  1P1O A;  3QYT A;  5JTY B;  2M8C A;  3FJ7 A;  1UTH B;  3SEV A;  3KEI A;  3TTM A;  3OO8 A;  2V3U A;  4GL0 A;  1J1N A;  4IO3 A;  4U2R A;  1CE2 A;  1MXZ A;  2A5T B;  2NXO A;  3IJX B;  2RCA A;  4BDO A;  4FEC A;  1PBP A;  2DS9 A;  3G3F A;  3PV0 E;  4TLL B;  2XD3 A;  1EZO A;  4LON B;  3FD3 A;  1B0L A;  1P1N A;  1ZTY A;  1LCT A;  2F8D A;  1EZP A;  1UQW A;  4GRK A;  5I56 A;  3OO6 A;  2UXA A;  1FW0 A;  3RT8 A;  4NE4 A;  4O3B A;  1MM6 A;  1GV8 A;  1OIB A;  3KN3 A;  4GIZ A;  1SDX A;  3M8U A;  4R73 A;  1D9Y A;  2UVG A;  1F9B A;  4QFO A;  5M2V A;  4UAC A;  4F22 A;  3RN8 A;  1A54 A;  2RF1 A;  4ZDM A;  5KCJ B;  1RYO A;  3FV2 A;  3Q27 A;  2DWH A;  3TEL A;  3N94 A;  4KYE A;  1MY0 A;  2ZNT A;  5FTI A;  1LAF E;  2IEE A;  4KR5 A;  5JEI A;  3V5A A;  1IIW A;  1SW4 A;  3SES A;  3FIR A;  4JB7 A;  1LLS A;  3LSL A;  2V25 A;  4H5F A;  3G3J A;  1FQF A;  4H1X A;  1KWH A;  1TT1 A;  4KFQ A;  3RY3 A;  3PUV E;  2DP8 A;  3FAS A;  3FZV A;  3BFU A;  4FJP A;  3TPA A;  4GLI A;  4PQJ A;  2Z8F A;  1MY4 A;  1BKA A;  3TUS A;  3FVG A;  4MLV A;  3W15 C;  4G68 C;  4G8H A;  4F18 A;  4PFY A;  1JQF A;  4G2Z A;  4PFW A;  1IQ7 A;  4WKM A;  4GQO A;  3H7M A;  2ZMB A;  3MZB A;  3I5O A;  5HM4 B;  4HTG A;  1B9J A;  3TEP A;  3MUQ A;  2Q2C A;  4JDF A;  1MY1 A;  4G4P A;  4IY5 A;  1MDQ A;  4YKP A;  2FA7 A;  2AYS A;  2W7Y A;  3MVW A;  1QKA A;  4MF3 A;  2QSX A;  4R2B A;  2Y84 A;  2F6P A;  3M3F A;  4ZEI A;  2H9B A;  2GHA A;  1B32 A;  3T66 A;  1N3X A;  4KHZ E;  1SBP A;  3ONM A;  3DEL B;  3K0V A;  4ESX A;  3ZKL A;  2DWJ A;  1URG A;  3E13 X;  1D3K A;  1YTV A;  3MC2 A;  4NF5 A;  1N3W A;  2OCU A;  1MDP 1;  3TQW A;  4QRZ A;  3P7I A;  3GBB A;  2XD2 A;  2FYI A;  3SEY A;  3OD7 A;  2Q9T A;  3B6Q A;  4G68 A;  2F7A A;  1P1W A;  2Q89 A;  3EHT A;  1LFG A;  3BFT A;  5CBS A;  4GOT A;  2ESN A;  2PX1 A;  3K02 A;  5I84 A;  1EH3 A;  1LCF A;  2V3Q A;  2XXV A;  1VFD A;  4H0W A;  2Y7W A;  4F1V A;  3CG1 A;  2I48 A;  1YCJ A;  2HQ0 A;  1TXF A;  1BLF A;  3W9V A;  1QUL A;  1ZJL A;  3H6U A;  2XXP A;  1N7W A;  5AA3 A;  4ONY A;  2VP1 A;  3IL1 B;  2DOJ A;  2I0C A;  3N6U A;  5H8H A;  3HCQ A;  1US4 A;  3G3H A;  5H8N B;  1Q35 A;  3C32 A;  3VFJ A;  1QUI A;  3EQ1 A;  3C4M A;  3IOR A;  4NMY A;  4NTL A;  3HO7 A;  5TU0 A;  3CSB A;  1B40 A;  1B7U A;  2HXW A;  2ZYK A;  3PD8 A;  4EF1 A;  2YLN A;  5H8Q B;  3K01 A;  2OJT A;  4GXA A;  1NNK A;  4QHQ A;  3TCF A;  4XTC Q;  1IIT A;  2B3F A;  1OLA A;  3C35 A;  3K6W A;  3PPP A;  3QAX A;  3GBA A;  1MH3 A;  3GZG A;  4DLD A;  1PBQ A;  1LBB A;  1PB9 A;  3SER A;  3E3K A;  3KZG A;  4QSD A;  3L6H A;  3K2D A;  4H5G A;  2ZNS A;  5CMB A;  1IXH A;  3O97 A;  3VXB A;  4DIG A;  4RJZ A;  3CR9 A;  1S7Y A;  3RLF E;  1SYH A;  2A5S A;  2BJJ X;  5TP9 A;  4Q0C A;  5ITO A;  3K1M A;  3HHF A;  3OO7 A;  1NH7 A;  2HAV A;  1B3G A;  1Y3Q A;  2O69 A;  4POX A;  5DT6 A;  3TOD A;  1MY3 A;  1UTB B;  3KJ7 A;  2QRY A;  3PUZ E;  4KPT A;  3RNN A;  1GR2 A;  2RC7 A;  2ZYO A;  1N7X A;  1B58 A;  3VVF A;  1H45 A;  2R6G E;  3D4C A;  3DM0 A;  2DWI A;  4ZEC A;  4F3P A;  3OEK A;  5AA4 A;  3O6G A;  5DYH A;  3EPE A;  3PPQ A;  4MBP A;  3T9U A;  4ECF A;  3T9V A;  3OEL A;  5FTH A;  4OFL A;  2DE4 A;  4IO2 A;  2VD3 A;  4K3F A;  4JBZ A;  1P1Q A;  5EHM A;  4FAJ A;  3KOT A;  4IO5 A;  1JVY A;  2D21 A;  1DPE A;  5ELV A;  3TDJ A;  3C33 A;  3MWB A;  5I2N A;  4WED A;  3VLV A;  4FAT A;  2UYE A;  2Y7K A;  4KD5 A;  1HSJ A;  1TWY A;  1IXG A;  1XVY A;  4OZ9 A;  4PFU A;  4U23 A;  2A5T A;  4EUO A;  2ZYM A;  4Z7E A;  1LAX A;  1BTJ A;  2GRV A;  1NH8 A;  2GHB A;  2LAO A;  4X9T A;  1FQA A;  4ZZA A;  4HCY A;  3HPI A;  1TFD A;  2ZYN A;  1DMB A;  5CM6 A;  4QSE A;  4BDN A;  3LBS A;  5KDT B;  4OES A;  2E1S A;  3ZSF A;  4XIG Q;  3PPN A;  4DCX A;  3FJM A;  1SQY A;  3E4R A;  4ZZE A;  5AA2 A;  4RA1 A;  2G93 A;  3U94 A;  1Z7M E;  4DCY A;  5I2K A;  2VHA A;  4F39 A;  5FHM A;  3PGF A;  1B5I A;  3PMV A;  3OSR A;  1SI0 A;  1Y3P A;  3K6U A;  2HZK A;  3KJT A;  4LAT A;  4IO7 A;  4MFI A;  5KCJ A;  3T22 A;  1SW5 A;  1ELJ A;  3THI A;  3TTL A;  1B7Z A;  4FED A;  2CMO A;  3DP6 A;  3K6V A;  2P0S A;  2DXR A;  2QMX A;  4P0G A;  4YKK A;  1DTG A;  1B5J A;  5IAI A;  4OHN A;  4GFR A;  2F6G A;  1FQC A;  1POT A;  1AL3 A;  4ELR A;  4GD5 A;  1IEJ A;  3RTW B;  3RQT A;  3B6T A;  4YB5 A;  3TYH A;  5HBC A;  1FTM A;  3IK6 B;  1A40 A;  2X7Q A;  2NWJ A;  5I58 B;  2D3I A;  1Y20 A;  1B52 A;  3TCG A;  1A7L A;  1NMU A;  3MVZ A;  1LFH A;  4ZEF A;  1MH4 A;  2DE3 A;  2OBG A;  3O9P A;  1XOC A;  3RTF B;  2WKY A;  3GLB A;  3H03 A;  5CMC A;  2Y7R A;  3D4G A;  3N26 A;  1Q1K A;  2XXH A;  3S9M C;  4POW A;  4N13 A;  1O7T A;  4C0R A;  2QS3 A;  3B6W A;  4LZ7 A;  3JV9 A;  4GXS B;  1LBC A;  1NNF A;  3ODB A;  1AOV A;  4KCD A;  3RGY A;  4IGT A;  1WDN A;  2QJE A;  4NWC A;  4QSC A;  2QPQ A;  4DXC A;  3VE1 B;  4JSD A;  4IO6 A;  2RIN A;  1UIV A;  4NWD A;  1NKX A;  3OMB A;  4HCW A;  3H4Z A;  3Q25 A;  3TTK A;  3N6T A;  4PET A;  4TLM B;  4JSO A;  5K2Y A;  5HPQ A;  3K4U A;  3CFL A;  4U22 A;  4HW8 A;  3DP8 A;  3PUX E;  3MZ1 A;  4NF8 A;  3T93 B;  5DVF A;  4OET A;  4ZE9 A;  4F3G A;  1QUK A;  4ND9 A;  1URD A;  3QSL A;  1WOD A;  2F36 A;  3PUY E;  3KN7 A;  3KN8 A;  4OFJ A;  2H25 A;  1B3H A;  5A5X A;  2Z8E A;  3QUF A;  4XXU A;  3FXU A;  3UN6 A;  4RK9 A;  1USY E;  1S50 A;  3EF7 A;  1MQI A;  3LC8 A;  4QFN A;  3UP9 A;  3VVD A;  1T0K A;  1MXY A;  2IA4 A;  4OFO A;  4LP2 B;  1H76 A;  4JWY A;  1A8F A;  5CI5 A;  4F2O A;  1PEB A;  3KSJ A;  2QL3 A;  3CSG A;  5H8N A;  3TKD A;  3O2A A;  2F35 A;  3LR1 A;  1FQB A;  1I6Q A;  2XXW A;  3G7W A;  1Y1M A;  1MQJ A;  3AXF A;  4EF2 A;  2R9J A;  1FTO A;  1R6Z A;  3T96 B;  5IKB A;  5H8Q A;  2XXI A;  5DTB A;  2HAU A;  1LAH E;  4NED A;  1FTJ A;  1GTK A;  3DLN A;  4BLA A;  3PUW E;  3A3U A;  1JW5 A;  3KBR A;  4EQ7 A;  3IR1 A;  2UVH A;  5AE4 A;  3T9X B;  4R9G A;  1RKM A;  3TCH A;  5B70 A;  1R9Q A;  1US5 A;  3MPL A;  1JEV A;  4M1V A;  1TFA A;  2F34 A;  4R6H A;  3TZA A;  3KFM A;  3IX1 A;  2H4I A;  1ZLQ A;  3S9L C;  1O63 A;  2PBW A;  4YKJ A;  3S9N C;  1D9V A;  2I4B A;  1JVX A;  1SW2 A;  4G8M A;  2DQV A;  3EHU A;  4ELO A;  3R26 A;  1SW1 A;  3CRB A;  4Z0I A;  5ICQ A;  2DYX A;  5I59 B;  1PC3 A;  2REJ A;  3TMG A;  1IXI A;  3CFX A;  5TPA B;  2QMW A;  4YIC A;  1MQG A;  3Q28 A;  4LUB A;  1OQG A;  3FAT A;  3LSX A;  1JW4 A;  1II5 A;  2X7P A;  1N04 A;  4O3C A;  4H6D A;  3CVG A;  3WAE A;  3UIF A;  4C1T A;  3K6X A;  4I1D A;  2ALU A;  1MY2 A;  4NF4 B;  1LB8 A;  4OEV A;  1GGG A;  1IXC A;  4NF5 B;  3U1O A;  1L5T A;  3BBR A;  4DDD A;  3IB0 A;  1URS A;  3FUZ A;  2Z22 A;  4ISU A;  4N6P A;  3FJG A;  4BDL A;  2AL4 A;  3VLW A;  1HSE A;  4G68 B;  5H8S A;  4YMA A;  2B3B A;  2XHD A;  4THI A;  1O64 A;  2AIX A;  4I8C A;  3K1N A;  2I49 A;  1B1X A;  3K1P A;  2OZZ A;  3QXM A;  2REG A;  4JWO A;  3Q26 A;  4BDR A;  2OLB A;  4OYV A;  4AB5 A;  1M5D A;  3OO9 A;  4GVO A;  3HV1 A;  4F2Q A;  5KDT A;  5JK4 A;  3W9W A;  3O28 A;  3MJN A;  3FVK A;  4MLQ A;  1H44 A;  5H8H B;  4ZS9 A;  4N07 A;  4RNS A;  3IAZ A;  3USD A;  1LST A;  3G3G A;  1IZ1 A;  4HS7 A;  2HEU A;  4BDQ A;  1EZ9 A;  3S9E A;  3CG3 A;  3LSF B;  1UIU A;  4LZ5 A;  5KZT A;  1H43 A;  2XX7 A;  4OXV A;  3BKI B;  3N5L A;  3CFZ A;  4F3S A;  2F7C A;  5I57 B;  3G3I A;  4E0W A;  1A8E A;  4YB6 A;  4R6Y A;  5JTY A;  1P1U A;  3HHG A;  1UTH A;  1N76 A;  3IO4 A;  2Y7P A;  4MH5 A;  3F11 A;  4R6K A;  3I3V A;  4YB7 A;  3MW0 A;  3ILU B;  1JEU A;  2HFB A;  4EDP A;  2V93 A;  3KOS A;  2I3V A;  2V3T A;  4M4G A;  3EN3 A;  1B4Z A;  3MVY A;  1VFE A;  5DEX B;  2HZL A;  5TP9 B;  3QUJ A;  1RYX A;  4IY6 A;  1MS7 A;  2RCB A;  3UOR A;  3Q29 A;  2UVJ A;  2Y7I A;  1CB6 A;  2ABH A;  1B1H A;  2QS1 A;  5CC2 A;  4F3B A;  1ATG A;  2O1M A;  3TTR A;  1LB9 A;  1ZIU A;  4UA8 A;  4E0X A;  4KYD A;  4YKI A;  2O7U A;  2NOO A;  3R6U A;  5ISU A;  3O6I A;  3MZ9 A;  1MXU A;  2X26 A;  3MVX A;  2ZXT A;  4RXL A;  4QFL A;  3TTN A;  4YMB A;  5AA2 D;  1JW1 A;  1MXV A;  4RK2 A;  4XKP A;  2OK2 A;  3S4U A;  3H6T A;  3MPK A;  1M5C A;  4KYS A;  5H8F B;  1MPC A;  2Z23 A;  4FIM A;  1QKB A;  4FOR A;  4ZEB A;  1I6A A;  4RYA A;  2DWA A;  5EYF A;  3PD9 A;  1SYI A;  1QW0 A;  4L17 A;  4JXI A;  3FXR A;  2P2A A;  2O68 A;  2F78 A;  1FTK A;  3TQL A;  3IOU A;  1ANF A;  2FNC A;  4JWX A;  1PB7 A;  2I0B A;  4H8I A;  4WEP A;  3V89 B;  1OVT A;  1ZMG A;  3IOV A;  1AMF A;  4AB6 A;  3T9H B;  3CI8 A;  1MRP A;  4R72 A;  3O66 A;  1Y4C A;  4DXB A;  1B3L A;  3O29 A;  1IUD A;  4U4X A;  5EHS A;  3IO6 A;  4ELQ A;  5LOM A;  2PT2 A;  4F19 A;  4LQ2 A;  5AA2 B;  1A99 A;  3GXA A;  1QUJ A;  4P0I A;  2F7B A;  3FGS A;  2RC9 A;  4GWO A;  2H5Y A;  5I2K B;  1B4H A; 
#chains in the Genus database with same CATH topology
 2XA5 A;  4U1Z A;  1S9T A;  2XXX A;  1OMP A;  5CRY A;  2KLF A;  2O7I A;  3RUM A;  4R74 A;  2RC8 A;  3ISP A;  4ZEK A;  3VLU A;  4KI0 E;  4F31 B;  1QJM A;  1XT8 A;  1VR5 A;  1K9Z A;  3QIM A;  3RPL B;  4Q8R A;  5LTC A;  3PU5 A;  1FBF A;  4NF6 B;  3SKP A;  4DI3 D;  3V83 A;  5BWJ A;  3FXQ A;  3MYU A;  3V8X B;  1POY 1;  4X1D A;  3MBP A;  4Q30 B;  2XX8 A;  3VVE A;  1AWB A;  2CZI A;  5J1D A;  4YZZ A;  4EXK A;  1NUY A;  2ANJ A;  3H06 B;  4F1Y A;  1XI6 A;  1Y4T A;  5EQ8 A;  1INP A;  2DE2 A;  3LSW A;  1YAE A;  1B6H A;  2XXT A;  3LUY A;  4R75 A;  4R2F A;  1MPD A;  3C9H A;  4IGR A;  2Q74 A;  3H6V A;  3MP1 A;  1NFT A;  4PFT A;  3SET A;  1BK4 A;  1B2H A;  4GWZ A;  3ZS6 A;  2VOZ A;  1LFI A;  4F29 A;  3I6V A;  2PT1 A;  3VDF A;  4N15 A;  1ZBM A;  5I56 B;  2XXR A;  3R7X A;  2I58 A;  2P3N A;  2RKM A;  2D5W A;  2PYY A;  3CIJ A;  3U92 A;  3PPR A;  3IB1 A;  5B7D A;  1I69 A;  1B05 A;  1Y1Z A;  1BP5 A;  3OXN A;  1QVS A;  5DVJ A;  2O84 X;  2P1S A;  4ZED A;  4P1L A;  3IOW A;  5CMK A;  1DOT A;  5I59 A;  3MP8 A;  3VXC A;  3U72 A;  5TPA A;  5EQ7 A;  1N84 A;  3MP6 A;  2R71 A;  3FVO A;  4OVJ A;  4DI4 B;  3SEU A;  3G3K A;  4LA9 A;  3PPO A;  4OVQ A;  4YAH X;  3FVN A;  1LGB C;  4RPN A;  1FTA A;  3ZKK A;  1B0H A;  3UK4 A;  3C36 A;  1H3D A;  4GF8 A;  1AIV A;  4OWD A;  4NF4 A;  2G29 A;  4OEU A;  1HSL A;  3M3K A;  2ZNU A;  3VV5 A;  4NF8 B;  1NNT A;  4G8N A;  1ZKB A;  2E0S A;  5I3S A;  3HST A;  3OEM A;  1XVX A;  1R1N A;  1FQE A;  1XC1 A;  2ONS A;  3RYD A;  4WXJ A;  3K00 A;  3IOT A;  4XKN A;  3RPW A;  1R9L A;  4DZ1 A;  3IJO B;  4U4S A;  3OSQ A;  4AS5 A;  3OOA A;  4PF8 A;  1P99 A;  4P47 A;  5A5X B;  1SVX B;  3PMW A;  1XHY A;  4U21 A;  2MKZ A;  4P8B A;  3IB2 A;  4R9F A;  2DVC A;  4BDM A;  4Q5T A;  3MAM A;  1DSN A;  1FTL A;  4KCC A;  1Y3N A;  3HN0 A;  2PFZ A;  4G77 A;  1B51 A;  5ITP A;  4NHB A;  1WVJ A;  1UTB A;  3KGC A;  2F3B A;  4GL8 A;  4F1U A;  5L9M A;  5L9S A;  1Y9U A;  3M3L A;  3B7D A;  3E9X A;  1B3E A;  4U1O A;  4IO4 A;  3NOH A;  4H65 A;  4PP0 A;  4X1B A;  2GH9 A;  4N17 A;  1A55 A;  4OEN A;  3S2V A;  3RT6 B;  3C34 A;  4I62 A;  2XXU A;  1NL5 A;  2XXQ A;  1DTZ A;  3CHG A;  4KQP A;  4EQ9 A;  4FBP A;  2PMS A;  5BUU A;  3SEW A;  4AS4 A;  4RPO A;  2UYF A;  4OVS A;  3JZJ A;  5IZ3 A;  5I57 A;  2Q2A A;  2GFE A;  4FE8 A;  4TQU Q;  4LQ5 A;  4OQO A;  2AL5 A;  4O3A A;  4DXU A;  4DE8 A;  4PDD A;  2I4C A;  1B7H A;  1MM7 A;  3O6H A;  1M5E A;  3FBP A;  1IMB A;  4PGN A;  4OMB A;  3TAJ A;  1JET A;  3A3C A;  4XKR A;  3H3G A;  5ET5 A;  4PE3 A;  2B65 A;  5J16 A;  3C31 A;  4PF6 A;  3H6W A;  4NN3 A;  2XWI A;  2I3W A;  4QFK A;  5L9O A;  4RY1 A;  2DVZ A;  2O51 A;  5DEX A;  2OWT A;  4MX6 A;  1MXX A;  5CBR A;  4PBQ A;  1FQD A;  1XS5 A;  3DP4 A;  1LAG E;  2ONR A;  1M5F A;  3QMF A;  1VE4 A;  3B50 A;  1Z7N E;  2Q88 A;  2NUV A;  1OLC A;  3U8Q A;  2FIE A;  2VGQ A;  2F5X A;  1MQD A;  2O1L A;  1SD3 A;  4NG7 A;  5FHO A;  4GBV A;  2QS4 A;  2PVU A;  4O8M A;  2Q8J A;  1FPE A;  4LVQ A;  1MPB A;  5F7V A;  2DSF A;  2VD2 A;  2THI A;  5ICT A;  4N8Y A;  2CZL A;  2OWS A;  1QGX A;  2XX9 A;  2WEF A;  2V4C A;  4XKQ A;  1FCK A;  1OQH A;  5H8F A;  4ESW A;  1EYJ A;  2XWK A;  4ZE8 A;  4AQ4 A;  4H8J A;  3SEX A;  5I7I A;  1N0T A;  3MQ9 A;  3TFL A;  1JNF A;  2ONK E;  2XXY A;  4HE2 A;  4LN5 A;  1B5H A;  1PDA A;  3ILT B;  3UA8 A;  2O6A A;  3WAF A;  2DXY A;  4N81 A;  2HCA A;  3ROJ A;  5I58 A;  1AH5 A;  4ELP A;  4QFP A;  3A09 A;  4H67 A;  2I6E A;  2V84 A;  1VSO A;  4C1U A;  4YU0 A;  3ECR A;  3KC1 A;  4X48 A;  1MXW A;  3KSX A;  4OTE A;  1FPF A;  4P11 A;  2F97 A;  1B46 A;  3FV1 A;  1NUX A;  3MST A;  3T0J A;  3OEN A;  2YPN A;  4MAG A;  5CMM A;  1SI1 A;  4TOZ A;  1MQH A;  5DVI A;  2Y5K A;  4G61 A;  3U93 A;  3JYR A;  4EXL A;  1BIY A;  4IB2 A;  2QVU A;  3L6G A;  4EQB A;  2YJP A;  5AA4 B;  4QF9 A;  1NNP A;  5F1Q A;  3EHS A;  1M5B A;  2QS2 A;  5FHN A;  1I6B A;  4I9D A;  1USY H;  1D4N A;  5EYH A;  2FIX A;  4PE5 B;  2XXK A;  3KG2 A;  1PB8 A;  1GVC A;  1YPN A;  1DPP A;  2Z8D A;  4FEB A;  5L8D A;  5AA1 A;  3UGW A;  1B3F A;  3RPL A;  4OER A;  1MG1 A;  3PMX A;  1ZU0 A;  2H98 A;  3QK6 A;  2UVI A;  5K2X A;  1OVB A;  2NVU B;  1EU8 A;  4NF6 A;  4LZ8 A;  3PTY A;  5I2N B;  3SDF A;  2H99 A;  1P1O A;  3QYT A;  5JTY B;  2M8C A;  3FJ7 A;  4OVT A;  2XWV A;  1UTH B;  3SEV A;  3KEI A;  3TTM A;  3OO8 A;  2V3U A;  4GL0 A;  5IZZ A;  1J1N A;  4IO3 A;  4U2R A;  1CE2 A;  1MXZ A;  2A5T B;  2B4M A;  2NXO A;  3IJX B;  2Y5L A;  1DK4 A;  2RCA A;  4BDO A;  4N6K A;  4FEC A;  2CZH A;  1PBP A;  1G0I A;  1SPI A;  4GBW A;  5IGA A;  2DS9 A;  3T1B A;  3G3F A;  3PV0 E;  1FPI A;  4TLL B;  2XD3 A;  1EZO A;  4LON B;  3FD3 A;  1B0L A;  1P1N A;  1ZTY A;  5FBP A;  1LCT A;  2VT5 A;  2F8D A;  1EZP A;  1UQW A;  2BJI A;  4GRK A;  5I56 A;  3OO6 A;  2UXA A;  2VPN A;  1NV0 A;  1FW0 A;  3RT8 A;  4P1E A;  4NE4 A;  4O3B A;  1MM6 A;  1GV8 A;  1OIB A;  3KN3 A;  2L5V A;  4GIZ A;  1SDX A;  3M8U A;  4R73 A;  1D9Y A;  2UVG A;  1F9B A;  4QFO A;  5M2V A;  4UAC A;  4F22 A;  3RN8 A;  1A54 A;  2RF1 A;  4ZDM A;  5KCJ B;  1RYO A;  3FV2 A;  3Q27 A;  2DWH A;  3TEL A;  3N94 A;  4KYE A;  1MY0 A;  2ZNT A;  4MMP A;  3KBZ A;  5FTI A;  1LAF E;  2IEE A;  4KR5 A;  3EKI A;  5JEI A;  1FJ6 A;  3V5A A;  1IIW A;  1SW4 A;  3SES A;  3FIR A;  4JB7 A;  1LLS A;  3LSL A;  2V25 A;  4H5F A;  3G3J A;  1FQF A;  4H1X A;  1KWH A;  1TT1 A;  4KFQ A;  3RY3 A;  3PUV E;  2GQ1 A;  2DP8 A;  3FAS A;  3FZV A;  4HE1 A;  3BFU A;  4UAB A;  4FJP A;  4PAK A;  4JVI A;  3TPA A;  4XEQ A;  2CEX A;  1RDZ A;  4GLI A;  4PQJ A;  2Z8F A;  1MY4 A;  1LBX A;  1BKA A;  3TUS A;  3FVG A;  4MLV A;  3W15 C;  4G68 C;  4G8H A;  1YZ0 A;  4F18 A;  4O94 A;  4PFY A;  1JQF A;  4G2Z A;  4PFW A;  1IQ7 A;  4WKM A;  4KXP A;  5EQ9 A;  4GQO A;  3H7M A;  2ZMB A;  3MZB A;  3I5O A;  5HM4 B;  4HTG A;  1B9J A;  3TEP A;  3MUQ A;  2Q2C A;  4JDF A;  1MY1 A;  4G4P A;  4IY5 A;  1MDQ A;  4YKP A;  2FA7 A;  2AYS A;  1FPB A;  2W7Y A;  3MVW A;  1QKA A;  4OVP A;  4MF3 A;  2QSX A;  4R2B A;  1IMA A;  2Y84 A;  2F6P A;  3M3F A;  4ZEI A;  4NF0 A;  3HFU A;  1Q9D A;  2H9B A;  2GHA A;  1B32 A;  3T66 A;  1N3X A;  4KHZ E;  1SBP A;  3ONM A;  3DEL B;  3K0V A;  4HXV A;  4ESX A;  3ZKL A;  2DWJ A;  5ET8 A;  1URG A;  3E13 X;  1D3K A;  1YTV A;  3MC2 A;  4NF5 A;  1N3W A;  2OCU A;  1MDP 1;  3TQW A;  4QRZ A;  4O7I A;  3P7I A;  3GBB A;  2XD2 A;  2WBD A;  4GWS A;  2FYI A;  4GWY A;  3SEY A;  3OD7 A;  2Q9T A;  3B6Q A;  4G68 A;  2F7A A;  1P1W A;  2Q89 A;  3EHT A;  4HE0 A;  1LFG A;  3BFT A;  5CBS A;  4GOT A;  2ESN A;  2PX1 A;  3K02 A;  5I84 A;  1NI9 A;  1EH3 A;  1LCF A;  4PFI A;  2V3Q A;  2XXV A;  1VFD A;  3B8B A;  4H0W A;  2Y7W A;  4F1V A;  3CG1 A;  2I48 A;  1YCJ A;  2F3D A;  2HQ0 A;  1TXF A;  1BLF A;  3W9V A;  1QUL A;  1ZJL A;  3H6U A;  4PC9 A;  1FPG A;  2XXP A;  1N7W A;  5AA3 A;  2WYK A;  4ONY A;  1FPD A;  2VP1 A;  3IL1 B;  2DOJ A;  2I0C A;  3N6U A;  4PDH A;  4GX3 A;  4N4U A;  5H8H A;  3HCQ A;  1US4 A;  3G3H A;  5H8N B;  1Q35 A;  3C32 A;  3VFJ A;  2FHY A;  1QUI A;  3EQ1 A;  3C4M A;  3IOR A;  4NMY A;  4NTL A;  3HO7 A;  5TU0 A;  3CSB A;  1B40 A;  1B7U A;  2HXW A;  2ZYK A;  3PD8 A;  5IM2 A;  4EF1 A;  2YLN A;  5H8Q B;  3K01 A;  2OJT A;  4MNP A;  4GXA A;  1NNK A;  4QHQ A;  3TCF A;  4XTC Q;  1IIT A;  2B3F A;  1OLA A;  3C35 A;  4GX6 A;  3K6W A;  3PPP A;  3QAX A;  3GBA A;  1MH3 A;  3GZG A;  4NAP A;  4DLD A;  1PBQ A;  2Q8M A;  1LBB A;  1PB9 A;  5ESY A;  3SER A;  3E3K A;  3KZG A;  4I3Y A;  4QSD A;  5ET6 A;  3L6H A;  1YXI A;  1DCU A;  3K2D A;  4H5G A;  2ZNS A;  4N91 A;  5CMB A;  1IXH A;  2FVZ A;  3O97 A;  1NV5 A;  3VXB A;  4DIG A;  4RJZ A;  3CR9 A;  1S7Y A;  3RLF E;  1NV1 A;  1SYH A;  4QBA A;  2A5S A;  2BJJ X;  5TP9 A;  4Q0C A;  5ITO A;  3K1M A;  3HHF A;  3OO7 A;  1NH7 A;  2XWO A;  2HAV A;  1B3G A;  4PAF A;  1Y3Q A;  2O69 A;  4MEV A;  4POX A;  5DT6 A;  3TOD A;  1MY3 A;  4P9K A;  1UTB B;  3KJ7 A;  2QRY A;  1LBZ A;  3PUZ E;  4KPT A;  3RNN A;  1GR2 A;  2RC7 A;  2ZYO A;  1N7X A;  1B58 A;  3VVF A;  1H45 A;  2R6G E;  3D4C A;  3DM0 A;  2DWI A;  4ZEC A;  4F3P A;  3OEK A;  5AA4 A;  3O6G A;  2QVR A;  5DYH A;  3EPE A;  2ZZV A;  3PPQ A;  4MBP A;  4N6D A;  3T9U A;  4ECF A;  3T9V A;  3OEL A;  5FTH A;  4OFL A;  1YYZ A;  4XFE A;  2DE4 A;  4IO2 A;  2VD3 A;  4K3F A;  3BIG A;  4JBZ A;  1P1Q A;  5EHM A;  4FAJ A;  1IME A;  3KOT A;  4H46 A;  4IO5 A;  1JVY A;  2D21 A;  1DPE A;  5ELV A;  3TDJ A;  3C33 A;  3MWB A;  5I2N A;  4WED A;  3VLV A;  4FAT A;  4QXD A;  2UYE A;  1FBH A;  4JVD A;  2Y7K A;  4KD5 A;  1HSJ A;  1TWY A;  1IXG A;  1XVY A;  4OZ9 A;  5EQA A;  4PFU A;  4U23 A;  2A5T A;  4EUO A;  2ZYM A;  4Z7E A;  2ZZW A;  1LAX A;  1BTJ A;  2GRV A;  3KC0 A;  1NH8 A;  2GHB A;  2LAO A;  4X9T A;  1FQA A;  4PGP A;  4ZZA A;  4HCY A;  3HPI A;  5A5L A;  1TFD A;  2ZYN A;  1DMB A;  5CM6 A;  4QSE A;  4BDN A;  3LBS A;  5KDT B;  3GYY A;  1LBV A;  4OES A;  2E1S A;  3ZSF A;  4XIG Q;  3PPN A;  4DCX A;  3FJM A;  1SQY A;  3E4R A;  5I5P A;  4ZZE A;  5AA2 A;  4RA1 A;  2G93 A;  3U94 A;  1Z7M E;  4DCY A;  5I2K A;  2VHA A;  4F39 A;  5FHM A;  1IMD A;  3PGF A;  1B5I A;  3PMV A;  2KQZ A;  3OSR A;  1SI0 A;  1Y3P A;  3K6U A;  2HZK A;  3KJT A;  4LAT A;  4IO7 A;  1FPK A;  4MFI A;  5KCJ A;  3T22 A;  1SW5 A;  4OVR A;  1ELJ A;  3THI A;  3TTL A;  1B7Z A;  4FED A;  3FXB A;  1FBP A;  2CMO A;  3DP6 A;  3K6V A;  2P0S A;  2DXR A;  4GWW A;  2QMX A;  4P0G A;  4YKK A;  1DTG A;  1B5J A;  5IAI A;  4OHN A;  4GFR A;  2F6G A;  4X8R A;  5LDZ A;  1FQC A;  1POT A;  1AL3 A;  4ELR A;  4GD5 A;  1IEJ A;  3RTW B;  3RQT A;  3B6T A;  4YB5 A;  3TYH A;  5HBC A;  1FTM A;  3IK6 B;  4PFB A;  1A40 A;  2X7Q A;  2NWJ A;  5I58 B;  2D3I A;  1RDY A;  1Y20 A;  1B52 A;  3TCG A;  1A7L A;  1NMU A;  3MVZ A;  1NV3 A;  1LFH A;  4ZEF A;  1MH4 A;  1VDW A;  2DE3 A;  2OBG A;  3O9P A;  1XOC A;  3RTF B;  2WKY A;  3GLB A;  3H03 A;  2HPG A;  5CMC A;  2Y7R A;  3D4G A;  3N26 A;  3IFA A;  1Q1K A;  2XXH A;  3S9M C;  4POW A;  4N13 A;  1O7T A;  4C0R A;  2QS3 A;  3B6W A;  4MJO A;  4LZ7 A;  3JV9 A;  4GXS B;  1LBC A;  1NNF A;  3ODB A;  1AOV A;  4KCD A;  3RGY A;  4IGT A;  4GX4 A;  1WDN A;  2QJE A;  4NWC A;  3E78 A;  4QSC A;  2QPQ A;  4DXC A;  3VE1 B;  4JSD A;  4O7M A;  4IO6 A;  2RIN A;  1UIV A;  4NWD A;  1NKX A;  3OMB A;  4HCW A;  3H4Z A;  3Q25 A;  3TTK A;  3N6T A;  4X04 A;  4PET A;  5EYG A;  4TLM B;  4JSO A;  2OX3 A;  5K2Y A;  5HPQ A;  3K4U A;  3CFL A;  4U22 A;  4HW8 A;  3DP8 A;  3PUX E;  3D1R A;  3MZ1 A;  4NF8 A;  3T93 B;  2PFY A;  5DVF A;  4OET A;  4ZE9 A;  4F3G A;  1QUK A;  4ND9 A;  1URD A;  3IFC A;  4PBH A;  3QSL A;  1WOD A;  2F36 A;  3PUY E;  3KN7 A;  3KN8 A;  4OFJ A;  4H45 A;  2H25 A;  1B3H A;  5A5X A;  2Z8E A;  3QUF A;  1JP4 A;  4P3L A;  5IZ1 A;  4XXU A;  3FXU A;  5F24 A;  4MHF A;  3UN6 A;  4RK9 A;  1USY E;  1S50 A;  3EF7 A;  2WX9 A;  1MQI A;  3LC8 A;  4QFN A;  3UP9 A;  3VVD A;  1T0K A;  5ET7 A;  5T3J A;  1MXY A;  2IA4 A;  4NX1 A;  4OFO A;  4I3E A;  4LP2 B;  3A29 A;  1H76 A;  1FBD A;  4JWY A;  1A8F A;  5CI5 A;  4F2O A;  1PEB A;  3KSJ A;  2QL3 A;  4OA4 A;  1IMC A;  3CSG A;  5H8N A;  3TKD A;  3O2A A;  2F35 A;  3LR1 A;  1FQB A;  1I6Q A;  2XXW A;  3G7W A;  1Y1M A;  1MQJ A;  3AXF A;  4EF2 A;  1LBY A;  2R9J A;  1FTO A;  1R6Z A;  3T96 B;  1KZ8 A;  5IKB A;  5H8Q A;  2XXI A;  5DTB A;  2HAU A;  1LAH E;  4NED A;  1FTJ A;  1GTK A;  3DLN A;  4BLA A;  3PUW E;  3A3U A;  1JW5 A;  4P56 A;  3KBR A;  4EQ7 A;  3IR1 A;  2WYP A;  4XF5 A;  2B4L A;  2UVH A;  4IR8 A;  5AE4 A;  3T9X B;  4R9G A;  1RKM A;  3TCH A;  2PCR A;  2CZK A;  5B70 A;  1R9Q A;  1US5 A;  3MPL A;  1JEV A;  4M1V A;  1TFA A;  2F34 A;  4R6H A;  3TZA A;  1FBG A;  4I40 A;  3KFM A;  3IX1 A;  2H4I A;  1ZLQ A;  3S9L C;  1O63 A;  2PBW A;  4YKJ A;  3S9N C;  4PTK A;  1D9V A;  2I4B A;  1JVX A;  1SW2 A;  4G8M A;  2DQV A;  3EHU A;  4ELO A;  3R26 A;  1SW1 A;  3CRB A;  1FPJ A;  4Z0I A;  5ICQ A;  2DYX A;  5I59 B;  1PC3 A;  2REJ A;  3TMG A;  1IXI A;  3CFX A;  5TPA B;  2QMW A;  4YIC A;  4GWU A;  1MQG A;  2HXR A;  3Q28 A;  4LUB A;  1OQG A;  3FAT A;  1FBC A;  3LSX A;  1JW4 A;  1II5 A;  2X7P A;  1N04 A;  4O3C A;  4H6D A;  3CVG A;  2CEY A;  2HHM A;  3WAE A;  3UIF A;  4C1T A;  3K6X A;  4I1D A;  2ALU A;  1MY2 A;  4OEV A;  1LB8 A;  4NF4 B;  1GGG A;  2QFL A;  1IXC A;  4NF5 B;  4PFR A;  3U1O A;  1L5T A;  3BBR A;  4DDD A;  1FSA A;  3IB0 A;  2ZZX A;  4GWX A;  1URS A;  3FUZ A;  1G0H A;  3U65 A;  2Z22 A;  4ISU A;  4N6P A;  3FJG A;  4BDL A;  2AL4 A;  3VLW A;  4OAN A;  1HSE A;  4G68 B;  5H8S A;  2JJK A;  4YMA A;  2B3B A;  2XHD A;  1RDX A;  4THI A;  1O64 A;  2WBB A;  2AIX A;  4I8C A;  3K1N A;  2I49 A;  1B1X A;  3K1P A;  2OZZ A;  3QXM A;  2REG A;  4JWO A;  3Q26 A;  4BDR A;  2OLB A;  4OYV A;  4AB5 A;  1M5D A;  3OO9 A;  4GVO A;  3HV1 A;  4F2Q A;  5KDT A;  5JK4 A;  2VPO A;  3O28 A;  3W9W A;  3MJN A;  3FVK A;  1NV6 A;  4MLQ A;  1H44 A;  5H8H B;  4ZS9 A;  4N07 A;  4RNS A;  3IAZ A;  3USD A;  1LST A;  1FJ9 A;  3G3G A;  1IZ1 A;  4HS7 A;  2HEU A;  4BDQ A;  1EZ9 A;  3S9E A;  3CG3 A;  3LSF B;  1NV4 A;  1UIU A;  4LZ5 A;  5KZT A;  1IMF A;  1H43 A;  2XX7 A;  4OXV A;  3BKI B;  1K9Y A;  3CFZ A;  3N5L A;  4F3S A;  2F7C A;  5IZ3 B;  5I57 B;  3G3I A;  4YB6 A;  1A8E A;  4E0W A;  4R6Y A;  5JTY A;  1P1U A;  3HHG A;  1UTH A;  1N76 A;  4NGU A;  3IO4 A;  2Y7P A;  4MH5 A;  3F11 A;  4R6K A;  3I3V A;  4YB7 A;  3MW0 A;  3ILU B;  1JEU A;  2HFB A;  4EDP A;  2V93 A;  3KOS A;  3E79 A;  2I3V A;  2V3T A;  4M4G A;  1FBE A;  3EN3 A;  1LBW A;  4MNI A;  1B4Z A;  3MVY A;  2FBP A;  1FRP A;  1VFE A;  5DEX B;  2HZL A;  5TP9 B;  3QUJ A;  4MIJ A;  1RYX A;  4PCD A;  4IY6 A;  1MS7 A;  2RCB A;  3Q29 A;  3UOR A;  2UVJ A;  2Y7I A;  1CB6 A;  2ABH A;  1B1H A;  2QS1 A;  5CC2 A;  4F3B A;  1ATG A;  2O1M A;  3TTR A;  1LB9 A;  1KA1 A;  4NQ8 A;  1ZIU A;  4UA8 A;  4E0X A;  4KYD A;  4YKI A;  4MNC A;  2O7U A;  2NOO A;  3R6U A;  5ISU A;  3O6I A;  3MZ9 A;  1MXU A;  1NUW A;  2X26 A;  3MVX A;  2ZXT A;  4RXL A;  4QFL A;  3TTN A;  4YMB A;  4MCO A;  5AA2 D;  1JW1 A;  1MXV A;  4RK2 A;  4XKP A;  5DW8 A;  1EYK A;  3LUZ A;  2DDK A;  2OK2 A;  3S4U A;  3H6T A;  3MPK A;  1M5C A;  4KYS A;  5H8F B;  2OWZ A;  1MPC A;  2Z23 A;  4FIM A;  1QKB A;  4FOR A;  1EYI A;  4ZEB A;  1CNQ A;  1FPL A;  1I6A A;  1NUZ A;  4RYA A;  2DWA A;  2KR0 A;  5EYF A;  3PD9 A;  4PAI A;  1SYI A;  1D9Q A;  1QW0 A;  4L17 A;  4JXI A;  1NV7 A;  3FXR A;  2P2A A;  2O68 A;  3BIH A;  2F78 A;  4JVC A;  3LV0 A;  1FTK A;  3TQL A;  3IOU A;  1ANF A;  2FNC A;  1LEV A;  4JWX A;  1PB7 A;  2I0B A;  4N8G A;  2P3V A;  4H8I A;  4WEP A;  3V89 B;  1OVT A;  1ZMG A;  3IOV A;  1AMF A;  4AB6 A;  1NV2 A;  3T9H B;  3SZP A;  3CI8 A;  1MRP A;  4R72 A;  3O66 A;  1Y4C A;  4DXB A;  1B3L A;  3O29 A;  1IUD A;  4U4X A;  5EHS A;  3IO6 A;  4ELQ A;  5LOM A;  2QVV A;  2PT2 A;  4F19 A;  4LQ2 A;  5AA2 B;  1A99 A;  3GXA A;  2R8T A;  1QUJ A;  4P0I A;  2F7B A;  3FGS A;  2RC9 A;  1KA0 A;  4GWO A;  2H5Y A;  5I2K B;  1B4H A;  1DBZ A; 
#chains in the Genus database with same CATH homology
 4U1Z A;  1S9T A;  2XXX A;  1OMP A;  5CRY A;  2KLF A;  2O7I A;  3RUM A;  4R74 A;  2RC8 A;  4ZEK A;  3VLU A;  4KI0 E;  4F31 B;  1QJM A;  1XT8 A;  1VR5 A;  3QIM A;  4Q8R A;  3PU5 A;  4NF6 B;  3SKP A;  3V83 A;  5BWJ A;  3FXQ A;  3V8X B;  1POY 1;  4X1D A;  3MBP A;  4Q30 B;  2XX8 A;  3VVE A;  5J1D A;  4YZZ A;  4EXK A;  2ANJ A;  3H06 B;  4F1Y A;  1Y4T A;  2DE2 A;  3LSW A;  1YAE A;  1B6H A;  2XXT A;  3LUY A;  4R75 A;  4R2F A;  1MPD A;  3C9H A;  4IGR A;  3H6V A;  3MP1 A;  1NFT A;  4PFT A;  3SET A;  1B2H A;  3ZS6 A;  2VOZ A;  1LFI A;  4F29 A;  3I6V A;  2PT1 A;  3VDF A;  1ZBM A;  5I56 B;  2XXR A;  3R7X A;  2I58 A;  2RKM A;  2D5W A;  2PYY A;  3CIJ A;  3U92 A;  3PPR A;  3IB1 A;  5B7D A;  1I69 A;  1B05 A;  1Y1Z A;  1BP5 A;  3OXN A;  1QVS A;  5DVJ A;  2O84 X;  2P1S A;  4ZED A;  3IOW A;  5CMK A;  1DOT A;  5I59 A;  3MP8 A;  3VXC A;  3U72 A;  5TPA A;  1N84 A;  3MP6 A;  2R71 A;  3FVO A;  4OVJ A;  3SEU A;  3G3K A;  4LA9 A;  3PPO A;  4YAH X;  3FVN A;  1LGB C;  4RPN A;  3ZKK A;  1B0H A;  3UK4 A;  3C36 A;  1H3D A;  4GF8 A;  1AIV A;  4OWD A;  4NF4 A;  2G29 A;  4OEU A;  1HSL A;  3M3K A;  2ZNU A;  3VV5 A;  4NF8 B;  1NNT A;  4G8N A;  1ZKB A;  2E0S A;  3HST A;  3OEM A;  1XVX A;  1R1N A;  1FQE A;  1XC1 A;  2ONS A;  4WXJ A;  3K00 A;  3IOT A;  4XKN A;  3RPW A;  1R9L A;  4DZ1 A;  3IJO B;  4U4S A;  3OSQ A;  3OOA A;  1P99 A;  5A5X B;  1SVX B;  3PMW A;  1XHY A;  4U21 A;  3IB2 A;  4R9F A;  4BDM A;  2DVC A;  4Q5T A;  3MAM A;  1DSN A;  1FTL A;  4KCC A;  1Y3N A;  3HN0 A;  4G77 A;  1B51 A;  5ITP A;  1WVJ A;  1UTB A;  3KGC A;  4GL8 A;  4F1U A;  5L9M A;  5L9S A;  1Y9U A;  3M3L A;  3B7D A;  3E9X A;  1B3E A;  4U1O A;  4IO4 A;  4PP0 A;  4H65 A;  4X1B A;  2GH9 A;  1A55 A;  4OEN A;  3S2V A;  3RT6 B;  3C34 A;  4I62 A;  2XXU A;  1NL5 A;  2XXQ A;  1DTZ A;  4KQP A;  4EQ9 A;  2PMS A;  5BUU A;  3SEW A;  4RPO A;  2UYF A;  3JZJ A;  5I57 A;  2Q2A A;  2GFE A;  4FE8 A;  4TQU Q;  4LQ5 A;  4OQO A;  2AL5 A;  4DXU A;  4O3A A;  4DE8 A;  2I4C A;  1B7H A;  1MM7 A;  3O6H A;  1M5E A;  4OMB A;  3TAJ A;  1JET A;  3A3C A;  4XKR A;  3H3G A;  2B65 A;  3C31 A;  3H6W A;  2I3W A;  4QFK A;  5L9O A;  4RY1 A;  2DVZ A;  2O51 A;  5DEX A;  2OWT A;  1MXX A;  5CBR A;  1FQD A;  1XS5 A;  3DP4 A;  1LAG E;  2ONR A;  1M5F A;  1VE4 A;  1Z7N E;  2Q88 A;  2NUV A;  1OLC A;  3U8Q A;  2VGQ A;  2F5X A;  1MQD A;  2O1L A;  1SD3 A;  5FHO A;  2QS4 A;  2PVU A;  2Q8J A;  4LVQ A;  1MPB A;  5F7V A;  2DSF A;  2VD2 A;  2THI A;  5ICT A;  2CZL A;  2OWS A;  2XX9 A;  4XKQ A;  1FCK A;  1OQH A;  5H8F A;  4ESW A;  4ZE8 A;  4AQ4 A;  4H8J A;  3SEX A;  1N0T A;  3MQ9 A;  3TFL A;  1JNF A;  2ONK E;  2XXY A;  1B5H A;  1PDA A;  3ILT B;  3UA8 A;  2O6A A;  3WAF A;  2DXY A;  2HCA A;  5I58 A;  4ELP A;  1AH5 A;  4QFP A;  3A09 A;  4H67 A;  2I6E A;  2V84 A;  1VSO A;  4C1U A;  4YU0 A;  3ECR A;  4X48 A;  1MXW A;  3KSX A;  4OTE A;  4P11 A;  2F97 A;  1B46 A;  3FV1 A;  3OEN A;  2YPN A;  5CMM A;  1SI1 A;  4TOZ A;  1MQH A;  5DVI A;  3U93 A;  3JYR A;  4EXL A;  1BIY A;  4IB2 A;  3L6G A;  4EQB A;  2YJP A;  5AA4 B;  4QF9 A;  1NNP A;  5F1Q A;  3EHS A;  1M5B A;  2QS2 A;  5FHN A;  1I6B A;  4I9D A;  1USY H;  1D4N A;  4PE5 B;  3KG2 A;  1PB8 A;  1GVC A;  1YPN A;  1DPP A;  2Z8D A;  4FEB A;  5L8D A;  5AA1 A;  3UGW A;  1B3F A;  4OER A;  1MG1 A;  3PMX A;  1ZU0 A;  2H98 A;  3QK6 A;  2UVI A;  5K2X A;  1OVB A;  2NVU B;  1EU8 A;  4NF6 A;  4LZ8 A;  5I2N B;  3SDF A;  2H99 A;  1P1O A;  3QYT A;  5JTY B;  2M8C A;  3FJ7 A;  1UTH B;  3SEV A;  3KEI A;  3TTM A;  3OO8 A;  2V3U A;  4GL0 A;  1J1N A;  4IO3 A;  4U2R A;  1CE2 A;  1MXZ A;  2A5T B;  2NXO A;  3IJX B;  2RCA A;  4BDO A;  4FEC A;  1PBP A;  2DS9 A;  3G3F A;  3PV0 E;  4TLL B;  2XD3 A;  1EZO A;  4LON B;  3FD3 A;  1B0L A;  1P1N A;  1ZTY A;  1LCT A;  2F8D A;  1EZP A;  1UQW A;  4GRK A;  5I56 A;  3OO6 A;  2UXA A;  1FW0 A;  3RT8 A;  4NE4 A;  4O3B A;  1MM6 A;  1GV8 A;  1OIB A;  3KN3 A;  4GIZ A;  1SDX A;  3M8U A;  4R73 A;  1D9Y A;  2UVG A;  1F9B A;  4QFO A;  5M2V A;  4UAC A;  4F22 A;  3RN8 A;  1A54 A;  2RF1 A;  4ZDM A;  5KCJ B;  1RYO A;  3FV2 A;  3Q27 A;  2DWH A;  3TEL A;  3N94 A;  4KYE A;  1MY0 A;  2ZNT A;  5FTI A;  1LAF E;  2IEE A;  4KR5 A;  5JEI A;  3V5A A;  1IIW A;  1SW4 A;  3SES A;  3FIR A;  4JB7 A;  1LLS A;  3LSL A;  2V25 A;  4H5F A;  3G3J A;  1FQF A;  4H1X A;  1KWH A;  1TT1 A;  4KFQ A;  3RY3 A;  3PUV E;  2DP8 A;  3FAS A;  3FZV A;  3BFU A;  4FJP A;  3TPA A;  4GLI A;  4PQJ A;  2Z8F A;  1MY4 A;  1BKA A;  3TUS A;  3FVG A;  4MLV A;  3W15 C;  4G68 C;  4G8H A;  4F18 A;  4PFY A;  1JQF A;  4G2Z A;  4PFW A;  1IQ7 A;  4WKM A;  4GQO A;  3H7M A;  2ZMB A;  3MZB A;  3I5O A;  5HM4 B;  4HTG A;  1B9J A;  3TEP A;  3MUQ A;  2Q2C A;  4JDF A;  1MY1 A;  4G4P A;  4IY5 A;  1MDQ A;  4YKP A;  2FA7 A;  2AYS A;  2W7Y A;  3MVW A;  1QKA A;  4MF3 A;  2QSX A;  4R2B A;  2Y84 A;  2F6P A;  3M3F A;  4ZEI A;  2H9B A;  2GHA A;  1B32 A;  3T66 A;  1N3X A;  4KHZ E;  1SBP A;  3ONM A;  3DEL B;  3K0V A;  4ESX A;  3ZKL A;  2DWJ A;  1URG A;  3E13 X;  1D3K A;  1YTV A;  3MC2 A;  4NF5 A;  1N3W A;  2OCU A;  1MDP 1;  3TQW A;  4QRZ A;  3P7I A;  3GBB A;  2XD2 A;  2FYI A;  3SEY A;  3OD7 A;  2Q9T A;  3B6Q A;  4G68 A;  2F7A A;  1P1W A;  2Q89 A;  3EHT A;  1LFG A;  3BFT A;  5CBS A;  4GOT A;  2ESN A;  2PX1 A;  3K02 A;  5I84 A;  1EH3 A;  1LCF A;  2V3Q A;  2XXV A;  1VFD A;  4H0W A;  2Y7W A;  4F1V A;  3CG1 A;  2I48 A;  1YCJ A;  2HQ0 A;  1TXF A;  1BLF A;  3W9V A;  1QUL A;  1ZJL A;  3H6U A;  2XXP A;  1N7W A;  5AA3 A;  4ONY A;  2VP1 A;  3IL1 B;  2DOJ A;  2I0C A;  3N6U A;  5H8H A;  3HCQ A;  1US4 A;  3G3H A;  5H8N B;  1Q35 A;  3C32 A;  3VFJ A;  1QUI A;  3EQ1 A;  3C4M A;  3IOR A;  4NMY A;  4NTL A;  3HO7 A;  5TU0 A;  3CSB A;  1B40 A;  1B7U A;  2HXW A;  2ZYK A;  3PD8 A;  4EF1 A;  2YLN A;  5H8Q B;  3K01 A;  2OJT A;  4GXA A;  1NNK A;  4QHQ A;  3TCF A;  4XTC Q;  1IIT A;  2B3F A;  1OLA A;  3C35 A;  3K6W A;  3PPP A;  3QAX A;  3GBA A;  1MH3 A;  3GZG A;  4DLD A;  1PBQ A;  1LBB A;  1PB9 A;  3SER A;  3E3K A;  3KZG A;  4QSD A;  3L6H A;  3K2D A;  4H5G A;  2ZNS A;  5CMB A;  1IXH A;  3O97 A;  3VXB A;  4DIG A;  4RJZ A;  3CR9 A;  1S7Y A;  3RLF E;  1SYH A;  2A5S A;  2BJJ X;  5TP9 A;  4Q0C A;  5ITO A;  3K1M A;  3HHF A;  3OO7 A;  1NH7 A;  2HAV A;  1B3G A;  1Y3Q A;  2O69 A;  4POX A;  5DT6 A;  3TOD A;  1MY3 A;  1UTB B;  3KJ7 A;  2QRY A;  3PUZ E;  4KPT A;  3RNN A;  1GR2 A;  2RC7 A;  2ZYO A;  1N7X A;  1B58 A;  3VVF A;  1H45 A;  2R6G E;  3D4C A;  3DM0 A;  2DWI A;  4ZEC A;  4F3P A;  3OEK A;  5AA4 A;  3O6G A;  5DYH A;  3EPE A;  3PPQ A;  4MBP A;  3T9U A;  4ECF A;  3T9V A;  3OEL A;  5FTH A;  4OFL A;  2DE4 A;  4IO2 A;  2VD3 A;  4K3F A;  4JBZ A;  1P1Q A;  5EHM A;  4FAJ A;  3KOT A;  4IO5 A;  1JVY A;  2D21 A;  1DPE A;  5ELV A;  3TDJ A;  3C33 A;  3MWB A;  5I2N A;  4WED A;  3VLV A;  4FAT A;  2UYE A;  2Y7K A;  4KD5 A;  1HSJ A;  1TWY A;  1IXG A;  1XVY A;  4OZ9 A;  4PFU A;  4U23 A;  2A5T A;  4EUO A;  2ZYM A;  4Z7E A;  1LAX A;  1BTJ A;  2GRV A;  1NH8 A;  2GHB A;  2LAO A;  4X9T A;  1FQA A;  4ZZA A;  4HCY A;  3HPI A;  1TFD A;  2ZYN A;  1DMB A;  5CM6 A;  4QSE A;  4BDN A;  3LBS A;  5KDT B;  4OES A;  2E1S A;  3ZSF A;  4XIG Q;  3PPN A;  4DCX A;  3FJM A;  1SQY A;  3E4R A;  4ZZE A;  5AA2 A;  4RA1 A;  2G93 A;  3U94 A;  1Z7M E;  4DCY A;  5I2K A;  2VHA A;  4F39 A;  5FHM A;  3PGF A;  1B5I A;  3PMV A;  3OSR A;  1SI0 A;  1Y3P A;  3K6U A;  2HZK A;  3KJT A;  4LAT A;  4IO7 A;  4MFI A;  5KCJ A;  3T22 A;  1SW5 A;  1ELJ A;  3THI A;  3TTL A;  1B7Z A;  4FED A;  2CMO A;  3DP6 A;  3K6V A;  2P0S A;  2DXR A;  2QMX A;  4P0G A;  4YKK A;  1DTG A;  1B5J A;  5IAI A;  4OHN A;  4GFR A;  2F6G A;  1FQC A;  1POT A;  1AL3 A;  4ELR A;  4GD5 A;  1IEJ A;  3RTW B;  3RQT A;  3B6T A;  4YB5 A;  3TYH A;  5HBC A;  1FTM A;  3IK6 B;  1A40 A;  2X7Q A;  2NWJ A;  5I58 B;  2D3I A;  1Y20 A;  1B52 A;  3TCG A;  1A7L A;  1NMU A;  3MVZ A;  1LFH A;  4ZEF A;  1MH4 A;  2DE3 A;  2OBG A;  3O9P A;  1XOC A;  3RTF B;  2WKY A;  3GLB A;  3H03 A;  5CMC A;  2Y7R A;  3D4G A;  3N26 A;  1Q1K A;  2XXH A;  3S9M C;  4POW A;  4N13 A;  1O7T A;  4C0R A;  2QS3 A;  3B6W A;  4LZ7 A;  3JV9 A;  4GXS B;  1LBC A;  1NNF A;  3ODB A;  1AOV A;  4KCD A;  3RGY A;  4IGT A;  1WDN A;  2QJE A;  4NWC A;  4QSC A;  2QPQ A;  4DXC A;  3VE1 B;  4JSD A;  4IO6 A;  2RIN A;  1UIV A;  4NWD A;  1NKX A;  3OMB A;  4HCW A;  3H4Z A;  3Q25 A;  3TTK A;  3N6T A;  4PET A;  4TLM B;  4JSO A;  5K2Y A;  5HPQ A;  3K4U A;  3CFL A;  4U22 A;  4HW8 A;  3DP8 A;  3PUX E;  3MZ1 A;  4NF8 A;  3T93 B;  5DVF A;  4OET A;  4ZE9 A;  4F3G A;  1QUK A;  4ND9 A;  1URD A;  3QSL A;  1WOD A;  2F36 A;  3PUY E;  3KN7 A;  3KN8 A;  4OFJ A;  2H25 A;  1B3H A;  5A5X A;  2Z8E A;  3QUF A;  4XXU A;  3FXU A;  3UN6 A;  4RK9 A;  1USY E;  1S50 A;  3EF7 A;  1MQI A;  3LC8 A;  4QFN A;  3UP9 A;  3VVD A;  1T0K A;  1MXY A;  2IA4 A;  4OFO A;  4LP2 B;  1H76 A;  4JWY A;  1A8F A;  5CI5 A;  4F2O A;  1PEB A;  3KSJ A;  2QL3 A;  3CSG A;  5H8N A;  3TKD A;  3O2A A;  2F35 A;  3LR1 A;  1FQB A;  1I6Q A;  2XXW A;  3G7W A;  1Y1M A;  1MQJ A;  3AXF A;  4EF2 A;  2R9J A;  1FTO A;  1R6Z A;  3T96 B;  5IKB A;  5H8Q A;  2XXI A;  5DTB A;  2HAU A;  1LAH E;  4NED A;  1FTJ A;  1GTK A;  3DLN A;  4BLA A;  3PUW E;  3A3U A;  1JW5 A;  3KBR A;  4EQ7 A;  3IR1 A;  2UVH A;  5AE4 A;  3T9X B;  4R9G A;  1RKM A;  3TCH A;  5B70 A;  1R9Q A;  1US5 A;  3MPL A;  1JEV A;  4M1V A;  1TFA A;  2F34 A;  4R6H A;  3TZA A;  3KFM A;  3IX1 A;  2H4I A;  1ZLQ A;  3S9L C;  1O63 A;  2PBW A;  4YKJ A;  3S9N C;  1D9V A;  2I4B A;  1JVX A;  1SW2 A;  4G8M A;  2DQV A;  3EHU A;  4ELO A;  3R26 A;  1SW1 A;  3CRB A;  4Z0I A;  5ICQ A;  2DYX A;  5I59 B;  1PC3 A;  2REJ A;  3TMG A;  1IXI A;  3CFX A;  5TPA B;  2QMW A;  4YIC A;  1MQG A;  3Q28 A;  4LUB A;  1OQG A;  3FAT A;  3LSX A;  1JW4 A;  1II5 A;  2X7P A;  1N04 A;  4O3C A;  4H6D A;  3CVG A;  3WAE A;  3UIF A;  4C1T A;  3K6X A;  4I1D A;  2ALU A;  1MY2 A;  4NF4 B;  1LB8 A;  4OEV A;  1GGG A;  1IXC A;  4NF5 B;  3U1O A;  1L5T A;  3BBR A;  4DDD A;  3IB0 A;  1URS A;  3FUZ A;  2Z22 A;  4ISU A;  4N6P A;  3FJG A;  4BDL A;  2AL4 A;  3VLW A;  1HSE A;  4G68 B;  5H8S A;  4YMA A;  2B3B A;  2XHD A;  4THI A;  1O64 A;  2AIX A;  4I8C A;  3K1N A;  2I49 A;  1B1X A;  3K1P A;  2OZZ A;  3QXM A;  2REG A;  4JWO A;  3Q26 A;  4BDR A;  2OLB A;  4OYV A;  4AB5 A;  1M5D A;  3OO9 A;  4GVO A;  3HV1 A;  4F2Q A;  5KDT A;  5JK4 A;  3W9W A;  3O28 A;  3MJN A;  3FVK A;  4MLQ A;  1H44 A;  5H8H B;  4ZS9 A;  4N07 A;  4RNS A;  3IAZ A;  3USD A;  1LST A;  3G3G A;  1IZ1 A;  4HS7 A;  2HEU A;  4BDQ A;  1EZ9 A;  3S9E A;  3CG3 A;  3LSF B;  1UIU A;  4LZ5 A;  5KZT A;  1H43 A;  2XX7 A;  4OXV A;  3BKI B;  3N5L A;  3CFZ A;  4F3S A;  2F7C A;  5I57 B;  3G3I A;  4E0W A;  1A8E A;  4YB6 A;  4R6Y A;  5JTY A;  1P1U A;  3HHG A;  1UTH A;  1N76 A;  3IO4 A;  2Y7P A;  4MH5 A;  3F11 A;  4R6K A;  3I3V A;  4YB7 A;  3MW0 A;  3ILU B;  1JEU A;  2HFB A;  4EDP A;  2V93 A;  3KOS A;  2I3V A;  2V3T A;  4M4G A;  3EN3 A;  1B4Z A;  3MVY A;  1VFE A;  5DEX B;  2HZL A;  5TP9 B;  3QUJ A;  1RYX A;  4IY6 A;  1MS7 A;  2RCB A;  3UOR A;  3Q29 A;  2UVJ A;  2Y7I A;  1CB6 A;  2ABH A;  1B1H A;  2QS1 A;  5CC2 A;  4F3B A;  1ATG A;  2O1M A;  3TTR A;  1LB9 A;  1ZIU A;  4UA8 A;  4E0X A;  4KYD A;  4YKI A;  2O7U A;  2NOO A;  3R6U A;  5ISU A;  3O6I A;  3MZ9 A;  1MXU A;  2X26 A;  3MVX A;  2ZXT A;  4RXL A;  4QFL A;  3TTN A;  4YMB A;  5AA2 D;  1JW1 A;  1MXV A;  4RK2 A;  4XKP A;  2OK2 A;  3S4U A;  3H6T A;  3MPK A;  1M5C A;  4KYS A;  5H8F B;  1MPC A;  2Z23 A;  4FIM A;  1QKB A;  4FOR A;  4ZEB A;  1I6A A;  4RYA A;  2DWA A;  5EYF A;  3PD9 A;  1SYI A;  1QW0 A;  4L17 A;  4JXI A;  3FXR A;  2P2A A;  2O68 A;  2F78 A;  1FTK A;  3TQL A;  3IOU A;  1ANF A;  2FNC A;  4JWX A;  1PB7 A;  2I0B A;  4H8I A;  4WEP A;  3V89 B;  1OVT A;  1ZMG A;  3IOV A;  1AMF A;  4AB6 A;  3T9H B;  3CI8 A;  1MRP A;  4R72 A;  3O66 A;  1Y4C A;  4DXB A;  1B3L A;  3O29 A;  1IUD A;  4U4X A;  5EHS A;  3IO6 A;  4ELQ A;  5LOM A;  2PT2 A;  4F19 A;  4LQ2 A;  5AA2 B;  1A99 A;  3GXA A;  1QUJ A;  4P0I A;  2F7B A;  3FGS A;  2RC9 A;  4GWO A;  2H5Y A;  5I2K B;  1B4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...