4I62A

1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
236
Chain Sequence
IEAIKSKGKLVVALNPDFAPFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAKKVGAQKGSIQETMAKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNFEKQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid ABC transporter, periplasmic amino acid-binding p
publication title 1.05 Angstrom crystal structure of an amino acid ABC transporter substrate-binding protein from Streptococcus pneumoniae Canada MDR_19A bound to L-arginine
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
total genus 85
structure length 236
sequence length 238
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4i62A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4i62A02
5KZTA 1WODA 3QAXA 3I5OA 4R6YA 4X48A 2I49A 1N0TA 2I48A 3FGSA 4TLLB 3PPRA 4OFLA 4YMBA 4GLIA 3O29A 1URGA 4H67A 1M5FA 3TDJA 1B1XA 3CVGA 5ICTA 3TFLA 2OK2A 1JVXA 2H9BA 3HHFA 1SVXB 3CFZA 5FHOA 3SESA 3R6UA 2F6PA 3H03A 2NUVA 3U94A 3FV1A 4DCYA 4OHNA 4IO7A 5B7DA 3ILTB 4JBZA 4ELQA 3T9VA 4NF8B 3KBRA 5I58B 3K6WA 2XXUA 2V3UA 2KLFA 2UYFA 1DTZA 5J1DA 1N3WA 1LBBA 5BUUA 2M8CA 4JWXA 3WAEA 2XXQA 4PFUA 3SEUA 3GXAA 3C31A 2QJEA 3PPPA 4X1DA 1FTMA 4I1DA 5DVIA 3VVFA 3EHSA 2Q2AA 3PU5A 4HTGA 1D9YA 3MC2A 2WKYA 3EQ1A 3HO7A 4YZZA 1B3GA 2DS9A 1S9TA 3OXNA 1DMBA 1MDQA 5I59A 4RXLA 1IEJA 1ANFA 1AH5A 4U1OA 4XIGQ 2VD2A 4ZECA 4AQ4A 2Y84A 1Z7NE 1NMUA 1ZMGA 4PFWA 3G3IA 4TLMB 3KGCA 4XKPA 3B7DA 1YPNA 2F34A 1P1WA 3FXUA 3JZJA 3S9EA 1N7XA 4HCWA 1NNKA 2E1SA 4TOZA 2NWJA 1MQDA 3W15C 5JTYB 3JYRA 4YKJA 4XKRA 5KCJB 5IKBA 4G8HA 4G2ZA 2ONKE 1UTHB 3UK4A 4H1XA 3TCGA 1LFIA 1JW1A 3EN3A 1MH4A 3C35A 1I6QA 1MQGA 2V25A 2NVUB 4F39A 1NNTA 5LOMA 1MH3A 4ZEBA 1JW5A 2PT1A 1N7WA 3UIFA 1VFDA 3CFLA 1Q35A 3B6WA 3RTFB 2F7BA 1ZU0A 3L6HA 2X26A 1SW1A 5IAIA 3UA8A 3N94A 3T9UA 4Q30B 3KN7A 4GIZA 5TU0A 2B65A 2ANJA 1VFEA 4AB5A 3DP4A 3VV5A 5AE4A 4LVQA 4QHQA 1FQCA 3CSBA 1Y20A 4YMAA 4RY1A 3OMBA 4ESXA 2VGQA 4P11A 4QFOA 3VLVA 3EHTA 2HXWA 2F78A 3B6TA 3RT8A 1B3HA 1MQHA 2OCUA 1VE4A 1MM6A 2PYYA 1A40A 1SI0A 2X7PA 2ZNSA 4H0WA 4Z0IA 4EXLA 1GVCA 1EZPA 2ZNTA 3H3GA 3TELA 4ZEIA 3MP1A 4DDDA 1O63A 2QPQA 1II5A 2QSXA 3CG1A 3HV1A 4BDLA 5I2KA 2XXTA 5FHNA 4QFLA 4IO4A 1B52A 2DE2A 4FJPA 4F22A 4YAHX 5I56B 4LATA 4QFNA 3G3FA 4C1UA 3CFXA 2QS2A 1ZKBA 2UVJA 5DEXB 4LQ2A 5CBSA 1QKBA 1YTVA 1B4HA 4GQOA 3O6HA 3VVDA 4ELOA 4E0XA 4DIGA 2HQ0A 4MLQA 1USYH 1AL3A 2H98A 1FQEA 3IB0A 3W9VA 5CMCA 3QK6A 3MVWA 3HN0A 3VFJA 4KCDA 5CRYA 3TTKA 2CZLA 1LAHE 4NE4A 4NF4A 3KEIA 5I57B 1ZLQA 5I2NB 1DTGA 4TQUQ 4PP0A 3TCFA 1M5BA 1I6BA 3E9XA 3OOAA 3P7IA 3C32A 2HZKA 4NMYA 3O66A 1MY2A 2YJPA 5CMKA 3PD8A 4ZS9A 2ZYOA 3RTWB 1MXZA 2LAOA 3S9LC 4QRZA 4DXBA 1AMFA 3ZKLA 1BKAA 3RPWA 2A5SA 5H8QA 3GBAA 1IQ7A 2O69A 4M1VA 3V8XB 1FQDA 5HPQA 3IB2A 3DP8A 1IXCA 1NNPA 5AA2B 4GFRA 3K0VA 4N6PA 4O3AA 4RK9A 1P1QA 3CRBA 5EHSA 1XC1A 4DE8A 1B58A 1FQFA 2E0SA 3HSTA 5ELVA 3ECRA 3FIRA 1A55A 3JV9A 3TTMA 1LAGE 2NOOA 4U22A 5H8SA 4FORA 1BIYA 4NF5B 2VD3A 5H8NA 1B7UA 4F3PA 1ZBMA 2RKMA 1B4ZA 3C9HA 5L9OA 4QF9A 3PMVA 5AA4B 4MFIA 1B9JA 4Q5TA 1MG1A 1EH3A 1FTOA 2V84A 2F36A 1Q1KA 4JWYA 5DYHA 2HZLA 1OLCA 1H44A 3D4CA 3ILUB 1YAEA 5H8HA 5L8DA 4FE8A 2Z8FA 5F7VA 4PFYA 3LSWA 4L17A 1A8EA 4EUOA 1LSTA 4F1YA 3PUVE 3HCQA 3H4ZA 2OZZA 4Z7EA 2ZYNA 4OENA 4NF6A 3M3LA 5AA3A 2XX8A 3MVYA 4POXA 3W9WA 5I84A 4QSDA 2ZYMA 3K6XA 1RYOA 3A3UA 1SW5A 3HPIA 1S50A 3BFUA 2V93A 1H45A 3Q29A 1NL5A 1B5JA 4DLDA 3ONMA 4OMBA 1SYHA 3IOVA 1I69A 4F1UA 3PPOA 3PMXA 2FA7A 1DOTA 1EZ9A 4MLVA 2OWTA 4I9DA 1PB8A 4KYEA 4FEBA 2R71A 4R74A 3FXRA 1H3DA 1MY1A 3TUSA 4KYDA 1XOCA 3VLWA 3C34A 1OQGA 3CI8A 1POTA 3RY3A 2DWHA 3VVEA 1RYXA 1A54A 3U8QA 4YKPA 2Z8EA 4R72A 2OWSA 3BFTA 4BDRA 1MPBA 1N84A 2B3BA 1B51A 4QFKA 4F31B 4FATA 3GBBA 3K1PA 3FVOA 5ISUA 2QL3A 2XX9A 2DYXA 2UYEA 1JNFA 3GZGA 2I3VA 1URSA 1L5TA 3DM0A 3I3VA 3LBSA 3OEKA 4RA1A 3KFMA 2VOZA 4OYVA 2Y7WA 5KDTA 1QUIA 2B3FA 3OO9A 1P1UA 1TFAA 3E13X 4EF1A 1D4NA 1MXWA 5TP9A 2OLBA 1R6ZA 2I4CA 1UTBB 3K6UA 3O2AA 3FZVA 3T9HB 2XD2A 2XXPA 3FVNA 1IITA 5CMMA 5DVJA 2RC9A 3CR9A 5BWJA 2HFBA 3SEXA 1N3XA 3EPEA 1LFGA 3LC8A 4O3BA 4DXCA 1I6AA 2DWJA 1FQAA 3MPKA 2AL5A 2Q2CA 1SD3A 1YCJA 3OO8A 4RK2A 4ZEFA 3PPQA 2ABHA 3IORA 5JK4A 4GVOA 1VSOA 4ELPA 2DOJA 4GRKA 3H06B 5HBCA 4EF2A 1GV8A 2AL4A 4H8JA 1ATGA 1FTLA 4FIMA 3K00A 2O1MA 3CG3A 3LSXA 2DP8A 3RGYA 5FHMA 2O68A 2DVZA 1GR2A 2CMOA 3N26A 1XVXA 2AYSA 4QSEA 4NF8A 5I58A 1B05A 4C0RA 5AA1A 1HSLA 3KJTA 3PMWA 1B1HA 4F19A 1WVJA 3BKIB 5L9MA 5JEIA 1TFDA 1URDA 3KZGA 4QFPA 1SW2A 3O9PA 2Q89A 1B7ZA 4G68B 4F3BA 1FTKA 4THIA 4E0WA 3T9XB 2QS1A 2GRVA 3IOWA 2QS3A 4ZE9A 4ZEKA 4H8IA 1IXHA 3T96B 4XXUA 3TTRA 1B7HA 3IR1A 2I58A 3C4MA 5TPAB 3FV2A 1BLFA 2Z22A 2P0SA 4GL0A 5CBRA 4ONYA 4FAJA 3KN8A 1VR5A 5F1QA 4KD5A 4EDPA 2DWIA 4NWCA 3KOTA 4RPOA 4N13A 3TQLA 1EU8A 1PEBA 1MM7A 1PBQA 3K1MA 2PVUA 1Y3PA 2HAVA 1WDNA 5A5XB 4ZZAA 3O6GA 2I6EA 4OEUA 3MZ9A 1O7TA 4QSCA 5FTIA 3H7MA 2QRYA 2XXHA 2Y7PA 5JTYA 3S9NC 3SEYA 4GXSB 1B40A 3H6TA 1ZIUA 1UTHA 4C1TA 4DCXA 1PB9A 2DVCA 4FEDA 1GGGA 2O51A 4BDOA 3MUQA 2ZNUA 3KSJA 4OFJA 3FJ7A 1MQIA 1MPCA 1B32A 2A5TB 1ZJLA 1LCFA 2BJJX 3L6GA 3OO6A 3U1OA 4IO6A 2F7AA 1AOVA 4F18A 2ESNA 1M5DA 3LUYA 3VLUA 2P2AA 3SERA 3T93B 1IXGA 1FQBA 4GL8A 1IUDA 3GLBA 4IO2A 3OD7A 3ZS6A 5H8FB 4DZ1A 4UA8A 3QYTA 4EQBA 3E4RA 4OZ9A 4YU0A 2VHAA 4JXIA 3M3KA 1A8FA 1JEUA 4R2BA 5CMBA 3VXCA 3EHUA 2W7YA 1QJMA 2ZXTA 3T22A 1IIWA 3KOSA 3IJXB 1XS5A 2F5XA 2ZYKA 2Q88A 4KFQA 2GHBA 1PBPA 5HM4B 2XX7A 2F8DA 4ZZEA 2H5YA 3SKPA 3Q28A 4P0GA 2D21A 4H65A 3FVGA 5DT6A 1B6HA 2I0BA 4MBPA 1T0KA 5ICQA 2Z8DA 3UORA 4UACA 3MWBA 4ELRA 3U92A 1JQFA 4IO5A 1NKXA 3B6QA 4O3CA 4F3GA 1MRPA 3C33A 1N76A 1DPEA 2PMSA 2UVIA 3ZSFA 3QXMA 5DEXA 2H25A 1QW0A 1Y3NA 3FXQA 4G8MA 2ALUA 4XTCQ 1SQYA 3G3HA 1JVYA 3G7WA 4OVJA 1PDAA 4U4XA 3M8UA 1JEVA 1OIBA 1Y3QA 2RCAA 3WAFA 4M4GA 4F3SA 5I57A 1S7YA 3FJMA 2ONSA 1OMPA 3OEMA 3VDFA 3QIMA 5B70A 3K1NA 3IB1A 3MQ9A 1PC3A 2X7QA 4N07A 2G93A 4H5FA 1FTJA 5L9SA 2PX1A 3FD3A 2XHDA 1MS7A 2RC8A 2I0CA 4HS7A 3UGWA 4XKQA 4LONB 1LB8A 5TP9B 3OSQA 4YB6A 1ELJA 1QVSA 2GH9A 3IK6B 5I59B 2O7IA 2DXRA 5AA2A 3KSXA 2HCAA 3MP8A 4LZ5A 4RJZA 3IX1A 3FASA 2O1LA 4RPNA 3K6VA 4KCCA 3IL1B 4IGTA 3FATA 3RLFE 1MPDA 3BBRA 3RUMA 3TODA 4NF5A 3S9MC 1SBPA 1Y4CA 4YICA 2PT2A 3A09A 1NFTA 2XXWA 1H43A 1GTKA 5ITPA 3PUXE 3OO7A 3K01A 5AA4A 3H6VA 4BDQA 3ZKKA 3FJGA 2OJTA 3RNNA 4F29A 2YLNA 4POWA 1B0HA 1CE2A 4OXVA 2ZMBA 2XXXA 4RNSA 2F7CA 3PV0E 1B3EA 1NH7A 1SYIA 2Y7KA 4R6KA 3TQWA 1KWHA 2AIXA 3PUZE 3ODBA 1N04A 4MH5A 2QMXA 3RN8A 2R9JA 4ND9A 2FNCA 1Y1ZA 3O6IA 3Q26A 3HHGA 2DXYA 2RINA 5CI5A 3PD9A 1NH8A 5K2XA 1MDP1 2XXRA 3MBPA 4R2FA 1XHYA 4G77A 1QULA 4LA9A 3TYHA 1LAXA 2VP1A 3I6VA 4MF3A 2ONRA 2THIA 1B3LA 4XKNA 4F1VA 3TPAA 4OESA 3G3JA 1LCTA 2OBGA 3TEPA 4KPTA 1USYE 1US4A 4NTLA 3OENA 3A3CA 4Q8RA 4YKKA 1OQHA 5CM6A 4F2QA 2IEEA 2I3WA 1B0LA 4Q0CA 3OSRA 3R7XA 1CB6A 4GOTA 4R75A 4ISUA 4KQPA 1MXVA 2PBWA 4HCYA 2IA4A 1TWYA 3V83A 3K4UA 1FCKA 4EXKA 2UVGA 4AB6A 4EQ9A 1FW0A 1PB7A 2Z23A 2REJA 3H6WA 3U72A 3T66A 4PFTA 1LFHA 2Y7RA 1QUJA 4ZE8A 3Q25A 3G3GA 3SDFA 4LQ5A 1BP5A 4NWDA 2UVHA 2NXOA 1H76A 2P1SA 2DWAA 3MP6A 3N6TA 5FTHA 3IOTA 2F97A 3PUYE 4G4PA 1B2HA 1LB9A 1Y1MA 1TT1A 3DELB 4I62A 4P0IA 5I2KB 3V5AA 4IY6A 1Z7ME 1P1NA 5DTBA 4U2RA 1R1NA 4YB5A 2G29A 3DP6A 4IB2A 4GXAA 1MY4A 1P1OA 4WXJA 2UXAA 3U93A 1QKAA 2QS4A 4PQJA 1ZTYA 3IO6A 3H6UA 2DSFA 3E3KA 2I4BA 1UTBA 4ESWA 3V89B 1EZOA 4NF4B 2RCBA 4WKMA 4U21A 3G3KA 3VE1B 1R9QA 3LR1A 4BLAA 1QUKA 1A99A 1F9BA 4ZEDA 2Q8JA 1RKMA 3TKDA 4KI0E 3RT6B 1XT8A 4KHZE 1IZ1A 4JSOA 2RC7A 3K02A 3Q27A 4LUBA 3TTNA 2DE3A 5EYFA 3LSFB 3N6UA 2HEUA 5H8QB 3R26A 3S4UA 2XXVA 3O28A 4KR5A 3UN6A 3PPNA 5KCJA 1OLAA 3S2VA 3QUJA 4G8NA 2O7UA 4GD5A 1D3KA 3TMGA 4JB7A 3IAZA 5EHMA 1BTJA 1DPPA 3IO4A 3MZ1A 2XXIA 4X1BA 4IY5A 4FECA 5ITOA 2O84X 3TCHA 3CIJA 5H8NB 3TTLA 2DQVA 2F35A 1M5EA 3AXFA 1OVTA 3IOUA 1LAFE 4OWDA 4G68A 4G68C 4OEVA 4U4SA 3MZBA 4RYAA 3KN3A 3D4GA 3K2DA 1B5IA 1HSEA 2H99A 1B5HA 4IGRA 4JWOA 4WEDA 4R6HA 4R9FA 2D5WA 3TZAA 5H8HB 5TPAA 1MXUA 2O6AA 4U23A 3MPLA 1OVBA 3SEVA 4LZ7A 4NEDA 1MQJA 1M5CA 3THIA 1B46A 1UQWA 1SW4A 2HAUA 1MY3A 2Q9TA 5A5XA 4NF6B 4GWOA 4OETA 1SI1A 1POY1 3MVZA 2V3TA 2QMWA 2RF1A 5K2YA 3MAMA 3SEWA 4JDFA 4OFOA 1P99A 5M2VA 4IO3A 5AA2D 1HSJA 3F11A 1IXIA 3MVXA 3FVKA 3PGFA 3EF7A 3VXBA 2YPNA 3IJOB 3LSLA 5I56A 1MXXA 1B3FA 4H6DA 1MY0A 1UIUA 2A5TA 3MW0A 1JETA 4YB7A 2H4IA 1LLSA 2F6GA 4K3FA 2REGA 5DVFA 3PUWE 3O97A 4PE5B 1NNFA 1UIVA 3KG2A 4YKIA 1SDXA 3USDA 4R73A 2V3QA 2XD3A 4LZ8A 1Y4TA 4EQ7A 1O64A 2GFEA 4KYSA 3KJ7A 4H5GA 2GHAA 1AIVA 5H8FA 4OERA 3OELA 4BDNA 4LP2B 3FUZA 1JW4A 3M3FA 4OTEA 4JSDA 3DLNA 4I8CA 5I2NA 2FYIA 3MJNA 4R9GA 2Y7IA 4F2OA 3TAJA 3QSLA 2D3IA 4WEPA 1LGBC 4ZDMA 1A7LA 4BDMA 1D9VA 1US5A 2XXYA 1LBCA 4HW8A 1R9LA 3SETA 5KDTB 1DSNA 4X9TA 1TXFA 3CSGA 3RQTA 2R6GE 3N5LA 1XVYA 1J1NA 5CC2A 3C36A 4GF8A 1Y9UA 4DXUA 3QUFA 1MXYA 2DE4A 4U1ZA 3UP9A 4OQOA 4PETA 4ECFA
chains in the Genus database with same CATH superfamily
5KZTA 1WODA 3QAXA 4HE1A 3I5OA 4R6YA 4X48A 2I49A 1N0TA 2I48A 3FGSA 4TLLB 3PPRA 4OFLA 4YMBA 4GLIA 3O29A 1URGA 4H67A 4N81A 1M5FA 3TDJA 1B1XA 3CVGA 5ICTA 3TFLA 2OK2A 1K9YA 1JVXA 2H9BA 3HHFA 1SVXB 3CFZA 5FHOA 3SESA 3R6UA 2F6PA 4XF5A 3HFUA 3H03A 2NUVA 3U94A 3FV1A 4N6KA 4DCYA 4OHNA 4IO7A 5B7DA 3ILTB 4JBZA 4ELQA 3T9VA 4NF8B 3KBRA 5I58B 3K6WA 2XXUA 2V3UA 4PC9A 2KLFA 2UYFA 1DTZA 5J1DA 1YXIA 1N3WA 1LBBA 5BUUA 1XI6A 3SZPA 2M8CA 4JWXA 3WAEA 2XXQA 4PFUA 3SEUA 3GXAA 3C31A 2QJEA 3PPPA 4N91A 4X1DA 1FTMA 2ZZWA 4I1DA 5IGAA 5DVIA 3VVFA 3EHSA 2Q2AA 3PU5A 4HTGA 1D9YA 3MC2A 2WKYA 3EQ1A 3HO7A 4GWWA 4YZZA 1B3GA 2DS9A 1S9TA 3OXNA 1DMBA 1MDQA 5I59A 4PCDA 4RXLA 4MX6A 1IEJA 1ANFA 1AH5A 4U1OA 4XIGQ 2VD2A 4ZECA 4AQ4A 2Y84A 3E78A 2XWKA 1Z7NE 1NMUA 1ZMGA 4PFWA 3G3IA 4TLMB 1NI9A 3KGCA 4XKPA 3B7DA 1YPNA 2F34A 1P1WA 3FXUA 3JZJA 3S9EA 1N7XA 4HCWA 2GQ1A 1NNKA 5IZ3A 4NG7A 2E1SA 4DI3D 1IMCA 4TOZA 2NWJA 1MQDA 3W15C 5JTYB 4MJOA 3JYRA 4YKJA 4XKRA 5KCJB 5IKBA 4G8HA 4G2ZA 2ONKE 4DI4B 1UTHB 3UK4A 5T3JA 4H1XA 3TCGA 1LFIA 1JW1A 3EN3A 4HE2A 1MH4A 3C35A 1I6QA 1MQGA 2V25A 1FPFA 1G0HA 2NVUB 4F39A 1KA1A 1NNTA 4X8RA 5LOMA 1KZ8A 1MH3A 2VPNA 4ZEBA 1JW5A 2PT1A 1N7WA 1QGXA 3UIFA 2ZZXA 4PBQA 1VFDA 3CFLA 1Q35A 3B6WA 4PF8A 3RTFB 4PDDA 2F7BA 4UABA 4XEQA 1ZU0A 3L6HA 2X26A 4PGPA 1SW1A 5EYHA 5IAIA 1FPJA 3UA8A 3IFCA 3N94A 3T9UA 4Q30B 3KN7A 4GIZA 5TU0A 1RDZA 2ANJA 2B65A 1VFEA 4AB5A 3DP4A 1AWBA 2VPOA 3VV5A 5AE4A 4LVQA 4QHQA 2QVUA 1FQCA 3CSBA 1Y20A 4YMAA 4RY1A 3FBPA 3OMBA 4ESXA 2VT5A 2VGQA 4P11A 4QFOA 1YYZA 3VLVA 3EHTA 2HXWA 2F78A 2WYPA 3B6TA 3RT8A 1B3HA 1MQHA 4NX1A 2OCUA 1VE4A 1MM6A 2PYYA 1DCUA 1A40A 4GBVA 1SI0A 2X7PA 2ZNSA 4H0WA 4Z0IA 2XA5A 4EXLA 1GVCA 1EZPA 2ZNTA 3H3GA 4MMPA 3TELA 1DBZA 1K9ZA 4ZEIA 3MP1A 4DDDA 5LTCA 1O63A 2QPQA 1II5A 2QSXA 3CG1A 3HV1A 4BDLA 5I2KA 2XXTA 5FHNA 4QFLA 4IO4A 1B52A 2DE2A 4FJPA 4F22A 4YAHX 2R8TA 1IMDA 5I56B 4LATA 4QFNA 3G3FA 4C1UA 3CFXA 2QS2A 1ZKBA 2UVJA 2WBDA 5DEXB 4PAFA 4NGUA 3PTYA 4LQ2A 5CBSA 1QKBA 1YTVA 1B4HA 4GQOA 3RPLB 3A29A 3O6HA 3VVDA 3QMFA 4ELOA 4X04A 4E0XA 3B50A 4DIGA 2HQ0A 4MLQA 1USYH 1AL3A 2H98A 1FQEA 3GYYA 3IB0A 3W9VA 5CMCA 3QK6A 3MVWA 3HN0A 3VFJA 4KCDA 5CRYA 3TTKA 2CZLA 1FBEA 5FBPA 1LAHE 4NE4A 4NF4A 3KEIA 5I57B 4MNCA 1ZLQA 5I2NB 1DTGA 4TQUQ 4PP0A 3TCFA 1M5BA 1I6BA 3E9XA 3OOAA 3P7IA 3C32A 2HZKA 4NMYA 2P3VA 1NV3A 3O66A 1MY2A 2YJPA 5CMKA 3PD8A 2FIEA 4ZS9A 4MNIA 4PFBA 2ZYOA 4N4UA 3RTWB 2V4CA 1MXZA 2LAOA 3S9LC 4QRZA 4DXBA 1AMFA 3ZKLA 1BKAA 4OVTA 5EQ7A 3RPWA 4QBAA 2A5SA 5H8QA 3GBAA 1IQ7A 2O69A 4M1VA 3V8XB 1FQDA 5HPQA 3IB2A 3DP8A 1IXCA 1NNPA 5AA2B 4QXDA 4GFRA 3K0VA 4N6PA 4O3AA 4RK9A 1P1QA 3CRBA 5EHSA 1XC1A 4DE8A 1B58A 1FQFA 2E0SA 2HXRA 3HSTA 5ELVA 3ECRA 3FIRA 1A55A 3JV9A 3TTMA 1LAGE 4NN3A 2NOOA 4U22A 5H8SA 2CZIA 1BIYA 4FORA 4NF5B 2VD3A 5H8NA 1B7UA 4F3PA 1ZBMA 2RKMA 1B4ZA 3C9HA 5L9OA 4QF9A 3PMVA 5AA4B 4MFIA 1B9JA 4P9KA 4Q5TA 1MG1A 1EH3A 1FTOA 4OANA 2V84A 5ET7A 2F36A 1Q1KA 4JWYA 5DYHA 2HZLA 1OLCA 1H44A 4XFEA 3D4CA 3ILUB 1YAEA 5H8HA 5L8DA 4FE8A 2Z8FA 5F7VA 4PFYA 1LBYA 3LSWA 4L17A 1A8EA 4HE0A 4EUOA 1LSTA 4F1YA 4PAIA 3PUVE 2XXKA 3HCQA 3H4ZA 2OZZA 4Z7EA 2ZYNA 4OENA 4NF6A 2FBPA 3M3LA 5AA3A 2XX8A 3MVYA 4POXA 3W9WA 5I84A 4QSDA 2ZYMA 3K6XA 1RYOA 3A3UA 1SW5A 3HPIA 1S50A 3U65A 3BFUA 2V93A 4N17A 1H45A 3Q29A 1NL5A 1B5JA 4NQ8A 4DLDA 3ONMA 2PFZA 4OMBA 1SYHA 2CZKA 3IOVA 1I69A 3KBZA 2ZZVA 4F1UA 3PPOA 3PMXA 2FA7A 1DOTA 4MCOA 3BIGA 1EZ9A 4MLVA 2OWTA 4I9DA 1PB8A 4KYEA 4FEBA 4PFRA 4GWYA 1JP4A 2R71A 4R74A 3FXRA 1H3DA 1EYKA 1MY1A 3TUSA 4KYDA 1XOCA 2XWOA 3VLWA 3C34A 1OQGA 3CI8A 1POTA 3KC0A 4I40A 3RY3A 2DWHA 3VVEA 1RYXA 1A54A 3U8QA 4YKPA 2Z8EA 4R72A 2OWSA 3BFTA 4BDRA 1MPBA 1N84A 2B3BA 1B51A 4QFKA 4F31B 4FATA 3GBBA 3K1PA 3FVOA 5ISUA 2QL3A 2XX9A 2DYXA 2UYEA 1JNFA 3GZGA 2I3VA 1URSA 1L5TA 3DM0A 3I3VA 3LBSA 3OEKA 4RA1A 3KFMA 2VOZA 4OYVA 2Y7WA 5KDTA 1QUIA 2B3FA 3OO9A 1P1UA 1TFAA 4MEVA 3E13X 4PBHA 4EF1A 1D4NA 2WBBA 1MXWA 5TP9A 4OVSA 2OLBA 1IMEA 1R6ZA 2I4CA 1UTBB 3K6UA 3O2AA 3FZVA 3T9HB 2XD2A 2XXPA 3FVNA 1IITA 5CMMA 5DVJA 2RC9A 5A5LA 3CR9A 1SPIA 5ET5A 5BWJA 2HFBA 3SEXA 1N3XA 4GWZA 2KQZA 3EPEA 1LFGA 3LC8A 4O3BA 4DXCA 4JVCA 1I6AA 2DDKA 2DWJA 1FQAA 3MPKA 2AL5A 2Y5KA 2Q2CA 1SD3A 1YCJA 3OO8A 4RK2A 4ZEFA 3PPQA 2ABHA 3IORA 5JK4A 4N6DA 4GVOA 1VSOA 4ELPA 2DOJA 4GRKA 3H06B 4P47A 5HBCA 4EF2A 1GV8A 2AL4A 4H8JA 1ATGA 5IZ1A 1FTLA 3MSTA 4FIMA 3K00A 2O1MA 3CG3A 3LSXA 2DP8A 3LUZA 3RGYA 5FHMA 2O68A 2DVZA 1GR2A 4PE3A 2CMOA 4OVQA 3N26A 1XVXA 2AYSA 2F3BA 4QSEA 1FBPA 4NF8A 5I58A 1B05A 4C0RA 1FPKA 5AA1A 1HSLA 3KJTA 3PMWA 1B1HA 4F19A 1WVJA 3BKIB 5L9MA 5JEIA 1FPLA 1TFDA 1URDA 3KZGA 4QFPA 2XWIA 1SW2A 3O9PA 4GBWA 2Q89A 1B7ZA 4G68B 4F3BA 1FTKA 4THIA 4E0WA 3T9XB 2QS1A 5I5PA 3NOHA 4O7IA 4O7MA 2GRVA 2Q8MA 3IOWA 2QS3A 5DW8A 4ZE9A 4ZEKA 4H8IA 1IXHA 3T96B 2HHMA 4XXUA 3TTRA 1B7HA 3IR1A 2I58A 3C4MA 5TPAB 3FV2A 1BLFA 5ESYA 2Z22A 2P0SA 4GL0A 5CBRA 4ONYA 4FAJA 3KN8A 1VR5A 5F1QA 4KD5A 4EDPA 2DWIA 4NWCA 4GX6A 3KOTA 4RPOA 4N13A 3TQLA 1EU8A 1PEBA 1MM7A 4LN5A 1PBQA 3K1MA 3MYUA 2PVUA 1Y3PA 2HAVA 1WDNA 5A5XB 4ZZAA 3O6GA 4H46A 2I6EA 4OEUA 3MZ9A 1O7TA 4QSCA 5FTIA 1NV1A 3H7MA 4FBPA 2QRYA 2XXHA 2Y7PA 4G61A 5JTYA 3S9NC 3SEYA 4GXSB 4OVRA 1B40A 3H6TA 1NV2A 1ZIUA 5I3SA 1UTHA 1NUYA 4C1TA 4DCXA 1PB9A 2DVCA 4FEDA 1GGGA 2O51A 4N8YA 3MUQA 4BDOA 2ZNUA 3KSJA 4OFJA 3FJ7A 1MQIA 1MPCA 1B32A 2A5TB 1ZJLA 1LCFA 2BJJX 3L6GA 3OO6A 3U1OA 4IO6A 2F7AA 1AOVA 4F18A 2ESNA 4PF6A 1M5DA 3LUYA 3VLUA 5EQAA 2P2AA 3SERA 3T93B 1IXGA 1FQBA 3BIHA 4GL8A 1IUDA 3GLBA 1IMFA 4IO2A 3OD7A 3ZS6A 5H8FB 4DZ1A 4UA8A 3QYTA 3T1BA 4EQBA 1LBVA 3E4RA 3D1RA 4OZ9A 4YU0A 2VHAA 4PTKA 4JXIA 3M3KA 1A8FA 1JEUA 4R2BA 5CMBA 3VXCA 3EHUA 1YZ0A 2W7YA 1FRPA 1QJMA 2ZXTA 3T22A 1IIWA 3KOSA 1NV7A 3IJXB 1XS5A 2F5XA 2ZYKA 2Q88A 4KFQA 2GHBA 1PBPA 5HM4B 2XX7A 1BK4A 2F8DA 4ZZEA 2H5YA 1LBWA 3SKPA 3Q28A 4P0GA 2D21A 4H65A 3FVGA 5DT6A 1B6HA 2I0BA 4MBPA 1T0KA 5ICQA 1FJ6A 2Z8DA 3UORA 4UACA 4GWSA 3MWBA 4ELRA 3U92A 2QVRA 1JQFA 4IO5A 4JVIA 1NKXA 3B6QA 4N15A 4OA4A 4O3CA 4F3GA 1MRPA 4P1EA 3C33A 1N76A 1DPEA 2MKZA 2PMSA 2UVIA 3ZSFA 2WEFA 3QXMA 5DEXA 2H25A 5IZZA 2WX9A 1QW0A 1Y3NA 3FXQA 3RPLA 4PAKA 4G8MA 2ALUA 2XWVA 4MAGA 4XTCQ 1SQYA 3G3HA 1JVYA 3G7WA 4OVJA 1FJ9A 1FSAA 1PDAA 4U4XA 3IFAA 2JJKA 3M8UA 1JEVA 1OIBA 1Y3QA 4GX4A 2RCAA 3WAFA 4M4GA 4F3SA 5I57A 1S7YA 3FJMA 2ONSA 1OMPA 1NUWA 3OEMA 3VDFA 3QIMA 4GWXA 5B70A 3K1NA 3IB1A 3MQ9A 1PC3A 2X7QA 4N07A 2G93A 4H5FA 1FTJA 5L9SA 2PX1A 3FD3A 2XHDA 1MS7A 2RC8A 5ET8A 2I0CA 4HS7A 3UGWA 1NUZA 4XKQA 4LONB 1LB8A 5TP9B 3OSQA 2HPGA 4YB6A 1ELJA 1QVSA 2GH9A 3IK6B 5I59B 1EYIA 2O7IA 2DXRA 5AA2A 3KSXA 2CEXA 2HCAA 3MP8A 4LZ5A 4RJZA 3IX1A 3FASA 2O1LA 4RPNA 1FBDA 3K6VA 1FBCA 1FPEA 4KCCA 3IL1B 4IGTA 3FATA 3RLFE 1MPDA 3BBRA 3RUMA 3TODA 1LBXA 2FVZA 4NF5A 3LV0A 2B4LA 4NAPA 3S9MC 3CHGA 1FBFA 1SBPA 1Y4CA 4YICA 2PT2A 3A09A 1NFTA 5IZ3B 2XXWA 1H43A 1GTKA 5ITPA 3PUXE 3OO7A 2QVVA 3K01A 5AA4A 3H6VA 4BDQA 1Q9DA 2OJTA 3FJGA 3ZKKA 3RNNA 4F29A 2YLNA 4POWA 1B0HA 1CE2A 2B4MA 4OXVA 2ZMBA 2XXXA 4RNSA 2F7CA 1INPA 3PV0E 3RYDA 1B3EA 1NH7A 1SYIA 2Y7KA 4R6KA 3TQWA 2P3NA 5LDZA 1KWHA 2AIXA 3PUZE 3ODBA 1N04A 4MH5A 2QMXA 3RN8A 2L5VA 4MHFA 2R9JA 4MIJA 4ND9A 2FNCA 1Y1ZA 3O6IA 3Q26A 3HHGA 3B8BA 2DXYA 2RINA 5CI5A 2BJIA 3PD9A 3KC1A 1NH8A 5K2XA 1MDP1 2XXRA 3MBPA 4R2FA 1XHYA 4G77A 1QULA 4LA9A 4GWUA 3TYHA 1LAXA 1KA0A 2VP1A 1IMAA 3I6VA 4MF3A 2ONRA 2THIA 1B3LA 4XKNA 4F1VA 3TPAA 4OESA 3G3JA 1LCTA 2OBGA 3TEPA 4KPTA 1USYE 1US4A 4NTLA 3OENA 3A3CA 3EKIA 2PCRA 3E79A 4Q8RA 2OWZA 3FXBA 4YKKA 1OQHA 5CM6A 5EQ8A 4F2QA 2IEEA 2I3WA 1B0LA 4Q0CA 3OSRA 3R7XA 1CB6A 4GOTA 4HXVA 4R75A 4ISUA 4KQPA 1MXVA 2PBWA 4HCYA 2IA4A 4I3EA 1TWYA 3V83A 3K4UA 1FCKA 4EXKA 2UVGA 4AB6A 4EQ9A 1FW0A 1PB7A 2Z23A 2REJA 3H6WA 3U72A 3T66A 4PFTA 1LFHA 2Y7RA 1QUJA 4ZE8A 3Q25A 3G3GA 3SDFA 4LQ5A 1BP5A 4NWDA 2UVHA 2NXOA 1H76A 4P3LA 2P1SA 2FHYA 2DWAA 3MP6A 3N6TA 5FTHA 3IOTA 2F97A 4H45A 3PUYE 4G4PA 1B2HA 1LB9A 1Y1MA 1TT1A 3DELB 1NUXA 4I62A 4P0IA 5I2KB 3V5AA 2CZHA 4IY6A 1Z7ME 4PDHA 1P1NA 5DTBA 4U2RA 1R1NA 4YB5A 2G29A 5J16A 3DP6A 4IB2A 2Q74A 4GXAA 1MY4A 1P1OA 1D9QA 4WXJA 2UXAA 3U93A 1QKAA 1NV0A 2QS4A 4PQJA 1ZTYA 3IO6A 3H6UA 2DSFA 3E3KA 2I4BA 1UTBA 4ESWA 3V89B 1EZOA 4NF4B 2RCBA 4NHBA 4WKMA 4U21A 1NV4A 3G3KA 3ISPA 3VE1B 1R9QA 3LR1A 2F3DA 4BLAA 1QUKA 1A99A 4O8MA 1F9BA 1FBHA 4ZEDA 2Q8JA 1RKMA 4P56A 3TKDA 4KI0E 3RT6B 1XT8A 4KHZE 1IZ1A 4JSOA 2RC7A 3K02A 3Q27A 4LUBA 1G0IA 3TTNA 2Y5LA 2DE3A 5EYFA 3LSFB 3N6UA 4I3YA 2HEUA 5H8QB 4IR8A 3R26A 3S4UA 2XXVA 3O28A 4KR5A 3UN6A 3PPNA 5KCJA 1OLAA 3S2VA 3QUJA 4G8NA 2O7UA 4GD5A 1D3KA 2QFLA 3TMGA 4JB7A 3IAZA 5EHMA 1BTJA 1DPPA 3IO4A 3MZ1A 2XXIA 1DK4A 4X1BA 4IY5A 4FECA 5ITOA 2O84X 3TCHA 3CIJA 4PFIA 5H8NB 3TTLA 1FPDA 2DQVA 2F35A 1M5EA 3AXFA 1OVTA 3IOUA 1LAFE 4OWDA 4G68A 4G68C 4OEVA 4U4SA 3MZBA 4RYAA 3KN3A 3D4GA 4N8GA 2CEYA 5I7IA 3K2DA 1B5IA 1HSEA 4PGNA 1EYJA 2H99A 1B5HA 4IGRA 4JWOA 1FTAA 4WEDA 4R6HA 4R9FA 2D5WA 1RDYA 3TZAA 3ROJA 5H8HB 5TPAA 1MXUA 2O6AA 4U23A 3MPLA 1OVBA 3SEVA 4AS5A 4LZ7A 4NEDA 1MQJA 1M5CA 3THIA 1VDWA 1B46A 1UQWA 1SW4A 2HAUA 2OX3A 1MY3A 2Q9TA 5A5XA 4NF6B 4GWOA 4OETA 1SI1A 1FPBA 1POY1 3MVZA 2FIXA 2V3TA 2QMWA 1LEVA 2RF1A 5K2YA 3MAMA 3SEWA 4JDFA 4OFOA 1P99A 5M2VA 4AS4A 4IO3A 5AA2D 1IMBA 1HSJA 3F11A 1IXIA 3MVXA 3FVKA 5IM2A 4P1LA 3PGFA 3EF7A 3VXBA 2YPNA 3IJOB 3LSLA 5I56A 1MXXA 1B3FA 4NF0A 4H6DA 1MY0A 1UIUA 1NV5A 2A5TA 3MW0A 1JETA 4YB7A 2H4IA 1LLSA 2WYKA 4GX3A 2F6GA 4MNPA 2KR0A 4K3FA 4OVPA 2REGA 4O94A 5DVFA 3PUWE 3O97A 4PE5B 3T0JA 1NNFA 1UIVA 3KG2A 4YKIA 1SDXA 3USDA 4R73A 2V3QA 1FPIA 2XD3A 4LZ8A 1Y4TA 4EQ7A 4P8BA 1O64A 2GFEA 4KYSA 3KJ7A 4H5GA 2GHAA 1AIVA 5H8FA 4OERA 3OELA 4BDNA 4LP2B 3FUZA 5EYGA 1JW4A 3M3FA 4OTEA 5F24A 4JSDA 4JVDA 3DLNA 4I8CA 5I2NA 2FYIA 3MJNA 4R9GA 2Y7IA 4F2OA 3TAJA 3QSLA 2D3IA 4WEPA 1LGBC 4ZDMA 1A7LA 4BDMA 1LBZA 1D9VA 1US5A 2XXYA 1LBCA 4HW8A 5ET6A 1R9LA 1FBGA 3SETA 5KDTB 1DSNA 4KXPA 4X9TA 1CNQA 1TXFA 3CSGA 1NV6A 2PFYA 1FPGA 1RDXA 3RQTA 2R6GE 3N5LA 1XVYA 1J1NA 5CC2A 3C36A 4GF8A 1Y9UA 4DXUA 3QUFA 1MXYA 5EQ9A 2DE4A 4U1ZA 3UP9A 4OQOA 4PETA 4ECFA
chains in the Genus database with same CATH topology
5KZTA 1WODA 3QAXA 3I5OA 4R6YA 4X48A 2I49A 1N0TA 2I48A 3FGSA 4TLLB 3PPRA 4OFLA 4YMBA 4GLIA 3O29A 1URGA 4H67A 1M5FA 3TDJA 1B1XA 3CVGA 5ICTA 3TFLA 2OK2A 1JVXA 2H9BA 3HHFA 1SVXB 3CFZA 5FHOA 3SESA 3R6UA 2F6PA 3H03A 2NUVA 3U94A 3FV1A 4DCYA 4OHNA 4IO7A 5B7DA 3ILTB 4JBZA 4ELQA 3T9VA 4NF8B 3KBRA 5I58B 3K6WA 2XXUA 2V3UA 2KLFA 2UYFA 1DTZA 5J1DA 1N3WA 1LBBA 5BUUA 2M8CA 4JWXA 3WAEA 2XXQA 4PFUA 3SEUA 3GXAA 3C31A 2QJEA 3PPPA 4X1DA 1FTMA 4I1DA 5DVIA 3VVFA 3EHSA 2Q2AA 3PU5A 4HTGA 1D9YA 3MC2A 2WKYA 3EQ1A 3HO7A 4YZZA 1B3GA 2DS9A 1S9TA 3OXNA 1DMBA 1MDQA 5I59A 4RXLA 1IEJA 1ANFA 1AH5A 4U1OA 4XIGQ 2VD2A 4ZECA 4AQ4A 2Y84A 1Z7NE 1NMUA 1ZMGA 4PFWA 3G3IA 4TLMB 3KGCA 4XKPA 3B7DA 1YPNA 2F34A 1P1WA 3FXUA 3JZJA 3S9EA 1N7XA 4HCWA 1NNKA 2E1SA 4TOZA 2NWJA 1MQDA 3W15C 5JTYB 3JYRA 4YKJA 4XKRA 5KCJB 5IKBA 4G8HA 4G2ZA 2ONKE 1UTHB 3UK4A 4H1XA 3TCGA 1LFIA 1JW1A 3EN3A 1MH4A 3C35A 1I6QA 1MQGA 2V25A 2NVUB 4F39A 1NNTA 5LOMA 1MH3A 4ZEBA 1JW5A 2PT1A 1N7WA 3UIFA 1VFDA 3CFLA 1Q35A 3B6WA 3RTFB 2F7BA 1ZU0A 3L6HA 2X26A 1SW1A 5IAIA 3UA8A 3N94A 3T9UA 4Q30B 3KN7A 4GIZA 5TU0A 2B65A 2ANJA 1VFEA 4AB5A 3DP4A 3VV5A 5AE4A 4LVQA 4QHQA 1FQCA 3CSBA 1Y20A 4YMAA 4RY1A 3OMBA 4ESXA 2VGQA 4P11A 4QFOA 3VLVA 3EHTA 2HXWA 2F78A 3B6TA 3RT8A 1B3HA 1MQHA 2OCUA 1VE4A 1MM6A 2PYYA 1A40A 1SI0A 2X7PA 2ZNSA 4H0WA 4Z0IA 4EXLA 1GVCA 1EZPA 2ZNTA 3H3GA 3TELA 4ZEIA 3MP1A 4DDDA 1O63A 2QPQA 1II5A 2QSXA 3CG1A 3HV1A 4BDLA 5I2KA 2XXTA 5FHNA 4QFLA 4IO4A 1B52A 2DE2A 4FJPA 4F22A 4YAHX 5I56B 4LATA 4QFNA 3G3FA 4C1UA 3CFXA 2QS2A 1ZKBA 2UVJA 5DEXB 4LQ2A 5CBSA 1QKBA 1YTVA 1B4HA 4GQOA 3O6HA 3VVDA 4ELOA 4E0XA 4DIGA 2HQ0A 4MLQA 1USYH 1AL3A 2H98A 1FQEA 3IB0A 3W9VA 5CMCA 3QK6A 3MVWA 3HN0A 3VFJA 4KCDA 5CRYA 3TTKA 2CZLA 1LAHE 4NE4A 4NF4A 3KEIA 5I57B 1ZLQA 5I2NB 1DTGA 4TQUQ 4PP0A 3TCFA 1M5BA 1I6BA 3E9XA 3OOAA 3P7IA 3C32A 2HZKA 4NMYA 3O66A 1MY2A 2YJPA 5CMKA 3PD8A 4ZS9A 2ZYOA 3RTWB 1MXZA 2LAOA 3S9LC 4QRZA 4DXBA 1AMFA 3ZKLA 1BKAA 3RPWA 2A5SA 5H8QA 3GBAA 1IQ7A 2O69A 4M1VA 3V8XB 1FQDA 5HPQA 3IB2A 3DP8A 1IXCA 1NNPA 5AA2B 4GFRA 3K0VA 4N6PA 4O3AA 4RK9A 1P1QA 3CRBA 5EHSA 1XC1A 4DE8A 1B58A 1FQFA 2E0SA 3HSTA 5ELVA 3ECRA 3FIRA 1A55A 3JV9A 3TTMA 1LAGE 2NOOA 4U22A 5H8SA 4FORA 1BIYA 4NF5B 2VD3A 5H8NA 1B7UA 4F3PA 1ZBMA 2RKMA 1B4ZA 3C9HA 5L9OA 4QF9A 3PMVA 5AA4B 4MFIA 1B9JA 4Q5TA 1MG1A 1EH3A 1FTOA 2V84A 2F36A 1Q1KA 4JWYA 5DYHA 2HZLA 1OLCA 1H44A 3D4CA 3ILUB 1YAEA 5H8HA 5L8DA 4FE8A 2Z8FA 5F7VA 4PFYA 3LSWA 4L17A 1A8EA 4EUOA 1LSTA 4F1YA 3PUVE 3HCQA 3H4ZA 2OZZA 4Z7EA 2ZYNA 4OENA 4NF6A 3M3LA 5AA3A 2XX8A 3MVYA 4POXA 3W9WA 5I84A 4QSDA 2ZYMA 3K6XA 1RYOA 3A3UA 1SW5A 3HPIA 1S50A 3BFUA 2V93A 1H45A 3Q29A 1NL5A 1B5JA 4DLDA 3ONMA 4OMBA 1SYHA 3IOVA 1I69A 4F1UA 3PPOA 3PMXA 2FA7A 1DOTA 1EZ9A 4MLVA 2OWTA 4I9DA 1PB8A 4KYEA 4FEBA 2R71A 4R74A 3FXRA 1H3DA 1MY1A 3TUSA 4KYDA 1XOCA 3VLWA 3C34A 1OQGA 3CI8A 1POTA 3RY3A 2DWHA 3VVEA 1RYXA 1A54A 3U8QA 4YKPA 2Z8EA 4R72A 2OWSA 3BFTA 4BDRA 1MPBA 1N84A 2B3BA 1B51A 4QFKA 4F31B 4FATA 3GBBA 3K1PA 3FVOA 5ISUA 2QL3A 2XX9A 2DYXA 2UYEA 1JNFA 3GZGA 2I3VA 1URSA 1L5TA 3DM0A 3I3VA 3LBSA 3OEKA 4RA1A 3KFMA 2VOZA 4OYVA 2Y7WA 5KDTA 1QUIA 2B3FA 3OO9A 1P1UA 1TFAA 3E13X 4EF1A 1D4NA 1MXWA 5TP9A 2OLBA 1R6ZA 2I4CA 1UTBB 3K6UA 3O2AA 3FZVA 3T9HB 2XD2A 2XXPA 3FVNA 1IITA 5CMMA 5DVJA 2RC9A 3CR9A 5BWJA 2HFBA 3SEXA 1N3XA 3EPEA 1LFGA 3LC8A 4O3BA 4DXCA 1I6AA 2DWJA 1FQAA 3MPKA 2AL5A 2Q2CA 1SD3A 1YCJA 3OO8A 4RK2A 4ZEFA 3PPQA 2ABHA 3IORA 5JK4A 4GVOA 1VSOA 4ELPA 2DOJA 4GRKA 3H06B 5HBCA 4EF2A 1GV8A 2AL4A 4H8JA 1ATGA 1FTLA 4FIMA 3K00A 2O1MA 3CG3A 3LSXA 2DP8A 3RGYA 5FHMA 2O68A 2DVZA 1GR2A 2CMOA 3N26A 1XVXA 2AYSA 4QSEA 4NF8A 5I58A 1B05A 4C0RA 5AA1A 1HSLA 3KJTA 3PMWA 1B1HA 4F19A 1WVJA 3BKIB 5L9MA 5JEIA 1TFDA 1URDA 3KZGA 4QFPA 1SW2A 3O9PA 2Q89A 1B7ZA 4G68B 4F3BA 1FTKA 4THIA 4E0WA 3T9XB 2QS1A 2GRVA 3IOWA 2QS3A 4ZE9A 4ZEKA 4H8IA 1IXHA 3T96B 4XXUA 3TTRA 1B7HA 3IR1A 2I58A 3C4MA 5TPAB 3FV2A 1BLFA 2Z22A 2P0SA 4GL0A 5CBRA 4ONYA 4FAJA 3KN8A 1VR5A 5F1QA 4KD5A 4EDPA 2DWIA 4NWCA 3KOTA 4RPOA 4N13A 3TQLA 1EU8A 1PEBA 1MM7A 1PBQA 3K1MA 2PVUA 1Y3PA 2HAVA 1WDNA 5A5XB 4ZZAA 3O6GA 2I6EA 4OEUA 3MZ9A 1O7TA 4QSCA 5FTIA 3H7MA 2QRYA 2XXHA 2Y7PA 5JTYA 3S9NC 3SEYA 4GXSB 1B40A 3H6TA 1ZIUA 1UTHA 4C1TA 4DCXA 1PB9A 2DVCA 4FEDA 1GGGA 2O51A 4BDOA 3MUQA 2ZNUA 3KSJA 4OFJA 3FJ7A 1MQIA 1MPCA 1B32A 2A5TB 1ZJLA 1LCFA 2BJJX 3L6GA 3OO6A 3U1OA 4IO6A 2F7AA 1AOVA 4F18A 2ESNA 1M5DA 3LUYA 3VLUA 2P2AA 3SERA 3T93B 1IXGA 1FQBA 4GL8A 1IUDA 3GLBA 4IO2A 3OD7A 3ZS6A 5H8FB 4DZ1A 4UA8A 3QYTA 4EQBA 3E4RA 4OZ9A 4YU0A 2VHAA 4JXIA 3M3KA 1A8FA 1JEUA 4R2BA 5CMBA 3VXCA 3EHUA 2W7YA 1QJMA 2ZXTA 3T22A 1IIWA 3KOSA 3IJXB 1XS5A 2F5XA 2ZYKA 2Q88A 4KFQA 2GHBA 1PBPA 5HM4B 2XX7A 2F8DA 4ZZEA 2H5YA 3SKPA 3Q28A 4P0GA 2D21A 4H65A 3FVGA 5DT6A 1B6HA 2I0BA 4MBPA 1T0KA 5ICQA 2Z8DA 3UORA 4UACA 3MWBA 4ELRA 3U92A 1JQFA 4IO5A 1NKXA 3B6QA 4O3CA 4F3GA 1MRPA 3C33A 1N76A 1DPEA 2PMSA 2UVIA 3ZSFA 3QXMA 5DEXA 2H25A 1QW0A 1Y3NA 3FXQA 4G8MA 2ALUA 4XTCQ 1SQYA 3G3HA 1JVYA 3G7WA 4OVJA 1PDAA 4U4XA 3M8UA 1JEVA 1OIBA 1Y3QA 2RCAA 3WAFA 4M4GA 4F3SA 5I57A 1S7YA 3FJMA 2ONSA 1OMPA 3OEMA 3VDFA 3QIMA 5B70A 3K1NA 3IB1A 3MQ9A 1PC3A 2X7QA 4N07A 2G93A 4H5FA 1FTJA 5L9SA 2PX1A 3FD3A 2XHDA 1MS7A 2RC8A 2I0CA 4HS7A 3UGWA 4XKQA 4LONB 1LB8A 5TP9B 3OSQA 4YB6A 1ELJA 1QVSA 2GH9A 3IK6B 5I59B 2O7IA 2DXRA 5AA2A 3KSXA 2HCAA 3MP8A 4LZ5A 4RJZA 3IX1A 3FASA 2O1LA 4RPNA 3K6VA 4KCCA 3IL1B 4IGTA 3FATA 3RLFE 1MPDA 3BBRA 3RUMA 3TODA 4NF5A 3S9MC 1SBPA 1Y4CA 4YICA 2PT2A 3A09A 1NFTA 2XXWA 1H43A 1GTKA 5ITPA 3PUXE 3OO7A 3K01A 5AA4A 3H6VA 4BDQA 3ZKKA 3FJGA 2OJTA 3RNNA 4F29A 2YLNA 4POWA 1B0HA 1CE2A 4OXVA 2ZMBA 2XXXA 4RNSA 2F7CA 3PV0E 1B3EA 1NH7A 1SYIA 2Y7KA 4R6KA 3TQWA 1KWHA 2AIXA 3PUZE 3ODBA 1N04A 4MH5A 2QMXA 3RN8A 2R9JA 4ND9A 2FNCA 1Y1ZA 3O6IA 3Q26A 3HHGA 2DXYA 2RINA 5CI5A 3PD9A 1NH8A 5K2XA 1MDP1 2XXRA 3MBPA 4R2FA 1XHYA 4G77A 1QULA 4LA9A 3TYHA 1LAXA 2VP1A 3I6VA 4MF3A 2ONRA 2THIA 1B3LA 4XKNA 4F1VA 3TPAA 4OESA 3G3JA 1LCTA 2OBGA 3TEPA 4KPTA 1USYE 1US4A 4NTLA 3OENA 3A3CA 4Q8RA 4YKKA 1OQHA 5CM6A 4F2QA 2IEEA 2I3WA 1B0LA 4Q0CA 3OSRA 3R7XA 1CB6A 4GOTA 4R75A 4ISUA 4KQPA 1MXVA 2PBWA 4HCYA 2IA4A 1TWYA 3V83A 3K4UA 1FCKA 4EXKA 2UVGA 4AB6A 4EQ9A 1FW0A 1PB7A 2Z23A 2REJA 3H6WA 3U72A 3T66A 4PFTA 1LFHA 2Y7RA 1QUJA 4ZE8A 3Q25A 3G3GA 3SDFA 4LQ5A 1BP5A 4NWDA 2UVHA 2NXOA 1H76A 2P1SA 2DWAA 3MP6A 3N6TA 5FTHA 3IOTA 2F97A 3PUYE 4G4PA 1B2HA 1LB9A 1Y1MA 1TT1A 3DELB 4I62A 4P0IA 5I2KB 3V5AA 4IY6A 1Z7ME 1P1NA 5DTBA 4U2RA 1R1NA 4YB5A 2G29A 3DP6A 4IB2A 4GXAA 1MY4A 1P1OA 4WXJA 2UXAA 3U93A 1QKAA 2QS4A 4PQJA 1ZTYA 3IO6A 3H6UA 2DSFA 3E3KA 2I4BA 1UTBA 4ESWA 3V89B 1EZOA 4NF4B 2RCBA 4WKMA 4U21A 3G3KA 3VE1B 1R9QA 3LR1A 4BLAA 1QUKA 1A99A 1F9BA 4ZEDA 2Q8JA 1RKMA 3TKDA 4KI0E 3RT6B 1XT8A 4KHZE 1IZ1A 4JSOA 2RC7A 3K02A 3Q27A 4LUBA 3TTNA 2DE3A 5EYFA 3LSFB 3N6UA 2HEUA 5H8QB 3R26A 3S4UA 2XXVA 3O28A 4KR5A 3UN6A 3PPNA 5KCJA 1OLAA 3S2VA 3QUJA 4G8NA 2O7UA 4GD5A 1D3KA 3TMGA 4JB7A 3IAZA 5EHMA 1BTJA 1DPPA 3IO4A 3MZ1A 2XXIA 4X1BA 4IY5A 4FECA 5ITOA 2O84X 3TCHA 3CIJA 5H8NB 3TTLA 2DQVA 2F35A 1M5EA 3AXFA 1OVTA 3IOUA 1LAFE 4OWDA 4G68A 4G68C 4OEVA 4U4SA 3MZBA 4RYAA 3KN3A 3D4GA 3K2DA 1B5IA 1HSEA 2H99A 1B5HA 4IGRA 4JWOA 4WEDA 4R6HA 4R9FA 2D5WA 3TZAA 5H8HB 5TPAA 1MXUA 2O6AA 4U23A 3MPLA 1OVBA 3SEVA 4LZ7A 4NEDA 1MQJA 1M5CA 3THIA 1B46A 1UQWA 1SW4A 2HAUA 1MY3A 2Q9TA 5A5XA 4NF6B 4GWOA 4OETA 1SI1A 1POY1 3MVZA 2V3TA 2QMWA 2RF1A 5K2YA 3MAMA 3SEWA 4JDFA 4OFOA 1P99A 5M2VA 4IO3A 5AA2D 1HSJA 3F11A 1IXIA 3MVXA 3FVKA 3PGFA 3EF7A 3VXBA 2YPNA 3IJOB 3LSLA 5I56A 1MXXA 1B3FA 4H6DA 1MY0A 1UIUA 2A5TA 3MW0A 1JETA 4YB7A 2H4IA 1LLSA 2F6GA 4K3FA 2REGA 5DVFA 3PUWE 3O97A 4PE5B 1NNFA 1UIVA 3KG2A 4YKIA 1SDXA 3USDA 4R73A 2V3QA 2XD3A 4LZ8A 1Y4TA 4EQ7A 1O64A 2GFEA 4KYSA 3KJ7A 4H5GA 2GHAA 1AIVA 5H8FA 4OERA 3OELA 4BDNA 4LP2B 3FUZA 1JW4A 3M3FA 4OTEA 4JSDA 3DLNA 4I8CA 5I2NA 2FYIA 3MJNA 4R9GA 2Y7IA 4F2OA 3TAJA 3QSLA 2D3IA 4WEPA 1LGBC 4ZDMA 1A7LA 4BDMA 1D9VA 1US5A 2XXYA 1LBCA 4HW8A 1R9LA 3SETA 5KDTB 1DSNA 4X9TA 1TXFA 3CSGA 3RQTA 2R6GE 3N5LA 1XVYA 1J1NA 5CC2A 3C36A 4GF8A 1Y9UA 4DXUA 3QUFA 1MXYA 2DE4A 4U1ZA 3UP9A 4OQOA 4PETA 4ECFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KZT A;  1WOD A;  3QAX A;  3I5O A;  4R6Y A;  4X48 A;  2I49 A;  1N0T A;  2I48 A;  3FGS A;  4TLL B;  3PPR A;  4OFL A;  4YMB A;  4GLI A;  3O29 A;  1URG A;  4H67 A;  1M5F A;  3TDJ A;  1B1X A;  3CVG A;  5ICT A;  3TFL A;  2OK2 A;  1JVX A;  2H9B A;  3HHF A;  1SVX B;  3CFZ A;  5FHO A;  3SES A;  3R6U A;  2F6P A;  3H03 A;  2NUV A;  3U94 A;  3FV1 A;  4DCY A;  4OHN A;  4IO7 A;  5B7D A;  3ILT B;  4JBZ A;  4ELQ A;  3T9V A;  4NF8 B;  3KBR A;  5I58 B;  3K6W A;  2XXU A;  2V3U A;  2KLF A;  2UYF A;  1DTZ A;  5J1D A;  1N3W A;  1LBB A;  5BUU A;  2M8C A;  4JWX A;  3WAE A;  2XXQ A;  4PFU A;  3SEU A;  3GXA A;  3C31 A;  2QJE A;  3PPP A;  4X1D A;  1FTM A;  4I1D A;  5DVI A;  3VVF A;  3EHS A;  2Q2A A;  3PU5 A;  4HTG A;  1D9Y A;  3MC2 A;  2WKY A;  3EQ1 A;  3HO7 A;  4YZZ A;  1B3G A;  2DS9 A;  1S9T A;  3OXN A;  1DMB A;  1MDQ A;  5I59 A;  4RXL A;  1IEJ A;  1ANF A;  1AH5 A;  4U1O A;  4XIG Q;  2VD2 A;  4ZEC A;  4AQ4 A;  2Y84 A;  1Z7N E;  1NMU A;  1ZMG A;  4PFW A;  3G3I A;  4TLM B;  3KGC A;  4XKP A;  3B7D A;  1YPN A;  2F34 A;  1P1W A;  3FXU A;  3JZJ A;  3S9E A;  1N7X A;  4HCW A;  1NNK A;  2E1S A;  4TOZ A;  2NWJ A;  1MQD A;  3W15 C;  5JTY B;  3JYR A;  4YKJ A;  4XKR A;  5KCJ B;  5IKB A;  4G8H A;  4G2Z A;  2ONK E;  1UTH B;  3UK4 A;  4H1X A;  3TCG A;  1LFI A;  1JW1 A;  3EN3 A;  1MH4 A;  3C35 A;  1I6Q A;  1MQG A;  2V25 A;  2NVU B;  4F39 A;  1NNT A;  5LOM A;  1MH3 A;  4ZEB A;  1JW5 A;  2PT1 A;  1N7W A;  3UIF A;  1VFD A;  3CFL A;  1Q35 A;  3B6W A;  3RTF B;  2F7B A;  1ZU0 A;  3L6H A;  2X26 A;  1SW1 A;  5IAI A;  3UA8 A;  3N94 A;  3T9U A;  4Q30 B;  3KN7 A;  4GIZ A;  5TU0 A;  2B65 A;  2ANJ A;  1VFE A;  4AB5 A;  3DP4 A;  3VV5 A;  5AE4 A;  4LVQ A;  4QHQ A;  1FQC A;  3CSB A;  1Y20 A;  4YMA A;  4RY1 A;  3OMB A;  4ESX A;  2VGQ A;  4P11 A;  4QFO A;  3VLV A;  3EHT A;  2HXW A;  2F78 A;  3B6T A;  3RT8 A;  1B3H A;  1MQH A;  2OCU A;  1VE4 A;  1MM6 A;  2PYY A;  1A40 A;  1SI0 A;  2X7P A;  2ZNS A;  4H0W A;  4Z0I A;  4EXL A;  1GVC A;  1EZP A;  2ZNT A;  3H3G A;  3TEL A;  4ZEI A;  3MP1 A;  4DDD A;  1O63 A;  2QPQ A;  1II5 A;  2QSX A;  3CG1 A;  3HV1 A;  4BDL A;  5I2K A;  2XXT A;  5FHN A;  4QFL A;  4IO4 A;  1B52 A;  2DE2 A;  4FJP A;  4F22 A;  4YAH X;  5I56 B;  4LAT A;  4QFN A;  3G3F A;  4C1U A;  3CFX A;  2QS2 A;  1ZKB A;  2UVJ A;  5DEX B;  4LQ2 A;  5CBS A;  1QKB A;  1YTV A;  1B4H A;  4GQO A;  3O6H A;  3VVD A;  4ELO A;  4E0X A;  4DIG A;  2HQ0 A;  4MLQ A;  1USY H;  1AL3 A;  2H98 A;  1FQE A;  3IB0 A;  3W9V A;  5CMC A;  3QK6 A;  3MVW A;  3HN0 A;  3VFJ A;  4KCD A;  5CRY A;  3TTK A;  2CZL A;  1LAH E;  4NE4 A;  4NF4 A;  3KEI A;  5I57 B;  1ZLQ A;  5I2N B;  1DTG A;  4TQU Q;  4PP0 A;  3TCF A;  1M5B A;  1I6B A;  3E9X A;  3OOA A;  3P7I A;  3C32 A;  2HZK A;  4NMY A;  3O66 A;  1MY2 A;  2YJP A;  5CMK A;  3PD8 A;  4ZS9 A;  2ZYO A;  3RTW B;  1MXZ A;  2LAO A;  3S9L C;  4QRZ A;  4DXB A;  1AMF A;  3ZKL A;  1BKA A;  3RPW A;  2A5S A;  5H8Q A;  3GBA A;  1IQ7 A;  2O69 A;  4M1V A;  3V8X B;  1FQD A;  5HPQ A;  3IB2 A;  3DP8 A;  1IXC A;  1NNP A;  5AA2 B;  4GFR A;  3K0V A;  4N6P A;  4O3A A;  4RK9 A;  1P1Q A;  3CRB A;  5EHS A;  1XC1 A;  4DE8 A;  1B58 A;  1FQF A;  2E0S A;  3HST A;  5ELV A;  3ECR A;  3FIR A;  1A55 A;  3JV9 A;  3TTM A;  1LAG E;  2NOO A;  4U22 A;  5H8S A;  4FOR A;  1BIY A;  4NF5 B;  2VD3 A;  5H8N A;  1B7U A;  4F3P A;  1ZBM A;  2RKM A;  1B4Z A;  3C9H A;  5L9O A;  4QF9 A;  3PMV A;  5AA4 B;  4MFI A;  1B9J A;  4Q5T A;  1MG1 A;  1EH3 A;  1FTO A;  2V84 A;  2F36 A;  1Q1K A;  4JWY A;  5DYH A;  2HZL A;  1OLC A;  1H44 A;  3D4C A;  3ILU B;  1YAE A;  5H8H A;  5L8D A;  4FE8 A;  2Z8F A;  5F7V A;  4PFY A;  3LSW A;  4L17 A;  1A8E A;  4EUO A;  1LST A;  4F1Y A;  3PUV E;  3HCQ A;  3H4Z A;  2OZZ A;  4Z7E A;  2ZYN A;  4OEN A;  4NF6 A;  3M3L A;  5AA3 A;  2XX8 A;  3MVY A;  4POX A;  3W9W A;  5I84 A;  4QSD A;  2ZYM A;  3K6X A;  1RYO A;  3A3U A;  1SW5 A;  3HPI A;  1S50 A;  3BFU A;  2V93 A;  1H45 A;  3Q29 A;  1NL5 A;  1B5J A;  4DLD A;  3ONM A;  4OMB A;  1SYH A;  3IOV A;  1I69 A;  4F1U A;  3PPO A;  3PMX A;  2FA7 A;  1DOT A;  1EZ9 A;  4MLV A;  2OWT A;  4I9D A;  1PB8 A;  4KYE A;  4FEB A;  2R71 A;  4R74 A;  3FXR A;  1H3D A;  1MY1 A;  3TUS A;  4KYD A;  1XOC A;  3VLW A;  3C34 A;  1OQG A;  3CI8 A;  1POT A;  3RY3 A;  2DWH A;  3VVE A;  1RYX A;  1A54 A;  3U8Q A;  4YKP A;  2Z8E A;  4R72 A;  2OWS A;  3BFT A;  4BDR A;  1MPB A;  1N84 A;  2B3B A;  1B51 A;  4QFK A;  4F31 B;  4FAT A;  3GBB A;  3K1P A;  3FVO A;  5ISU A;  2QL3 A;  2XX9 A;  2DYX A;  2UYE A;  1JNF A;  3GZG A;  2I3V A;  1URS A;  1L5T A;  3DM0 A;  3I3V A;  3LBS A;  3OEK A;  4RA1 A;  3KFM A;  2VOZ A;  4OYV A;  2Y7W A;  5KDT A;  1QUI A;  2B3F A;  3OO9 A;  1P1U A;  1TFA A;  3E13 X;  4EF1 A;  1D4N A;  1MXW A;  5TP9 A;  2OLB A;  1R6Z A;  2I4C A;  1UTB B;  3K6U A;  3O2A A;  3FZV A;  3T9H B;  2XD2 A;  2XXP A;  3FVN A;  1IIT A;  5CMM A;  5DVJ A;  2RC9 A;  3CR9 A;  5BWJ A;  2HFB A;  3SEX A;  1N3X A;  3EPE A;  1LFG A;  3LC8 A;  4O3B A;  4DXC A;  1I6A A;  2DWJ A;  1FQA A;  3MPK A;  2AL5 A;  2Q2C A;  1SD3 A;  1YCJ A;  3OO8 A;  4RK2 A;  4ZEF A;  3PPQ A;  2ABH A;  3IOR A;  5JK4 A;  4GVO A;  1VSO A;  4ELP A;  2DOJ A;  4GRK A;  3H06 B;  5HBC A;  4EF2 A;  1GV8 A;  2AL4 A;  4H8J A;  1ATG A;  1FTL A;  4FIM A;  3K00 A;  2O1M A;  3CG3 A;  3LSX A;  2DP8 A;  3RGY A;  5FHM A;  2O68 A;  2DVZ A;  1GR2 A;  2CMO A;  3N26 A;  1XVX A;  2AYS A;  4QSE A;  4NF8 A;  5I58 A;  1B05 A;  4C0R A;  5AA1 A;  1HSL A;  3KJT A;  3PMW A;  1B1H A;  4F19 A;  1WVJ A;  3BKI B;  5L9M A;  5JEI A;  1TFD A;  1URD A;  3KZG A;  4QFP A;  1SW2 A;  3O9P A;  2Q89 A;  1B7Z A;  4G68 B;  4F3B A;  1FTK A;  4THI A;  4E0W A;  3T9X B;  2QS1 A;  2GRV A;  3IOW A;  2QS3 A;  4ZE9 A;  4ZEK A;  4H8I A;  1IXH A;  3T96 B;  4XXU A;  3TTR A;  1B7H A;  3IR1 A;  2I58 A;  3C4M A;  5TPA B;  3FV2 A;  1BLF A;  2Z22 A;  2P0S A;  4GL0 A;  5CBR A;  4ONY A;  4FAJ A;  3KN8 A;  1VR5 A;  5F1Q A;  4KD5 A;  4EDP A;  2DWI A;  4NWC A;  3KOT A;  4RPO A;  4N13 A;  3TQL A;  1EU8 A;  1PEB A;  1MM7 A;  1PBQ A;  3K1M A;  2PVU A;  1Y3P A;  2HAV A;  1WDN A;  5A5X B;  4ZZA A;  3O6G A;  2I6E A;  4OEU A;  3MZ9 A;  1O7T A;  4QSC A;  5FTI A;  3H7M A;  2QRY A;  2XXH A;  2Y7P A;  5JTY A;  3S9N C;  3SEY A;  4GXS B;  1B40 A;  3H6T A;  1ZIU A;  1UTH A;  4C1T A;  4DCX A;  1PB9 A;  2DVC A;  4FED A;  1GGG A;  2O51 A;  4BDO A;  3MUQ A;  2ZNU A;  3KSJ A;  4OFJ A;  3FJ7 A;  1MQI A;  1MPC A;  1B32 A;  2A5T B;  1ZJL A;  1LCF A;  2BJJ X;  3L6G A;  3OO6 A;  3U1O A;  4IO6 A;  2F7A A;  1AOV A;  4F18 A;  2ESN A;  1M5D A;  3LUY A;  3VLU A;  2P2A A;  3SER A;  3T93 B;  1IXG A;  1FQB A;  4GL8 A;  1IUD A;  3GLB A;  4IO2 A;  3OD7 A;  3ZS6 A;  5H8F B;  4DZ1 A;  4UA8 A;  3QYT A;  4EQB A;  3E4R A;  4OZ9 A;  4YU0 A;  2VHA A;  4JXI A;  3M3K A;  1A8F A;  1JEU A;  4R2B A;  5CMB A;  3VXC A;  3EHU A;  2W7Y A;  1QJM A;  2ZXT A;  3T22 A;  1IIW A;  3KOS A;  3IJX B;  1XS5 A;  2F5X A;  2ZYK A;  2Q88 A;  4KFQ A;  2GHB A;  1PBP A;  5HM4 B;  2XX7 A;  2F8D A;  4ZZE A;  2H5Y A;  3SKP A;  3Q28 A;  4P0G A;  2D21 A;  4H65 A;  3FVG A;  5DT6 A;  1B6H A;  2I0B A;  4MBP A;  1T0K A;  5ICQ A;  2Z8D A;  3UOR A;  4UAC A;  3MWB A;  4ELR A;  3U92 A;  1JQF A;  4IO5 A;  1NKX A;  3B6Q A;  4O3C A;  4F3G A;  1MRP A;  3C33 A;  1N76 A;  1DPE A;  2PMS A;  2UVI A;  3ZSF A;  3QXM A;  5DEX A;  2H25 A;  1QW0 A;  1Y3N A;  3FXQ A;  4G8M A;  2ALU A;  4XTC Q;  1SQY A;  3G3H A;  1JVY A;  3G7W A;  4OVJ A;  1PDA A;  4U4X A;  3M8U A;  1JEV A;  1OIB A;  1Y3Q A;  2RCA A;  3WAF A;  4M4G A;  4F3S A;  5I57 A;  1S7Y A;  3FJM A;  2ONS A;  1OMP A;  3OEM A;  3VDF A;  3QIM A;  5B70 A;  3K1N A;  3IB1 A;  3MQ9 A;  1PC3 A;  2X7Q A;  4N07 A;  2G93 A;  4H5F A;  1FTJ A;  5L9S A;  2PX1 A;  3FD3 A;  2XHD A;  1MS7 A;  2RC8 A;  2I0C A;  4HS7 A;  3UGW A;  4XKQ A;  4LON B;  1LB8 A;  5TP9 B;  3OSQ A;  4YB6 A;  1ELJ A;  1QVS A;  2GH9 A;  3IK6 B;  5I59 B;  2O7I A;  2DXR A;  5AA2 A;  3KSX A;  2HCA A;  3MP8 A;  4LZ5 A;  4RJZ A;  3IX1 A;  3FAS A;  2O1L A;  4RPN A;  3K6V A;  4KCC A;  3IL1 B;  4IGT A;  3FAT A;  3RLF E;  1MPD A;  3BBR A;  3RUM A;  3TOD A;  4NF5 A;  3S9M C;  1SBP A;  1Y4C A;  4YIC A;  2PT2 A;  3A09 A;  1NFT A;  2XXW A;  1H43 A;  1GTK A;  5ITP A;  3PUX E;  3OO7 A;  3K01 A;  5AA4 A;  3H6V A;  4BDQ A;  3ZKK A;  3FJG A;  2OJT A;  3RNN A;  4F29 A;  2YLN A;  4POW A;  1B0H A;  1CE2 A;  4OXV A;  2ZMB A;  2XXX A;  4RNS A;  2F7C A;  3PV0 E;  1B3E A;  1NH7 A;  1SYI A;  2Y7K A;  4R6K A;  3TQW A;  1KWH A;  2AIX A;  3PUZ E;  3ODB A;  1N04 A;  4MH5 A;  2QMX A;  3RN8 A;  2R9J A;  4ND9 A;  2FNC A;  1Y1Z A;  3O6I A;  3Q26 A;  3HHG A;  2DXY A;  2RIN A;  5CI5 A;  3PD9 A;  1NH8 A;  5K2X A;  1MDP 1;  2XXR A;  3MBP A;  4R2F A;  1XHY A;  4G77 A;  1QUL A;  4LA9 A;  3TYH A;  1LAX A;  2VP1 A;  3I6V A;  4MF3 A;  2ONR A;  2THI A;  1B3L A;  4XKN A;  4F1V A;  3TPA A;  4OES A;  3G3J A;  1LCT A;  2OBG A;  3TEP A;  4KPT A;  1USY E;  1US4 A;  4NTL A;  3OEN A;  3A3C A;  4Q8R A;  4YKK A;  1OQH A;  5CM6 A;  4F2Q A;  2IEE A;  2I3W A;  1B0L A;  4Q0C A;  3OSR A;  3R7X A;  1CB6 A;  4GOT A;  4R75 A;  4ISU A;  4KQP A;  1MXV A;  2PBW A;  4HCY A;  2IA4 A;  1TWY A;  3V83 A;  3K4U A;  1FCK A;  4EXK A;  2UVG A;  4AB6 A;  4EQ9 A;  1FW0 A;  1PB7 A;  2Z23 A;  2REJ A;  3H6W A;  3U72 A;  3T66 A;  4PFT A;  1LFH A;  2Y7R A;  1QUJ A;  4ZE8 A;  3Q25 A;  3G3G A;  3SDF A;  4LQ5 A;  1BP5 A;  4NWD A;  2UVH A;  2NXO A;  1H76 A;  2P1S A;  2DWA A;  3MP6 A;  3N6T A;  5FTH A;  3IOT A;  2F97 A;  3PUY E;  4G4P A;  1B2H A;  1LB9 A;  1Y1M A;  1TT1 A;  3DEL B;  4I62 A;  4P0I A;  5I2K B;  3V5A A;  4IY6 A;  1Z7M E;  1P1N A;  5DTB A;  4U2R A;  1R1N A;  4YB5 A;  2G29 A;  3DP6 A;  4IB2 A;  4GXA A;  1MY4 A;  1P1O A;  4WXJ A;  2UXA A;  3U93 A;  1QKA A;  2QS4 A;  4PQJ A;  1ZTY A;  3IO6 A;  3H6U A;  2DSF A;  3E3K A;  2I4B A;  1UTB A;  4ESW A;  3V89 B;  1EZO A;  4NF4 B;  2RCB A;  4WKM A;  4U21 A;  3G3K A;  3VE1 B;  1R9Q A;  3LR1 A;  4BLA A;  1QUK A;  1A99 A;  1F9B A;  4ZED A;  2Q8J A;  1RKM A;  3TKD A;  4KI0 E;  3RT6 B;  1XT8 A;  4KHZ E;  1IZ1 A;  4JSO A;  2RC7 A;  3K02 A;  3Q27 A;  4LUB A;  3TTN A;  2DE3 A;  5EYF A;  3LSF B;  3N6U A;  2HEU A;  5H8Q B;  3R26 A;  3S4U A;  2XXV A;  3O28 A;  4KR5 A;  3UN6 A;  3PPN A;  5KCJ A;  1OLA A;  3S2V A;  3QUJ A;  4G8N A;  2O7U A;  4GD5 A;  1D3K A;  3TMG A;  4JB7 A;  3IAZ A;  5EHM A;  1BTJ A;  1DPP A;  3IO4 A;  3MZ1 A;  2XXI A;  4X1B A;  4IY5 A;  4FEC A;  5ITO A;  2O84 X;  3TCH A;  3CIJ A;  5H8N B;  3TTL A;  2DQV A;  2F35 A;  1M5E A;  3AXF A;  1OVT A;  3IOU A;  1LAF E;  4OWD A;  4G68 A;  4G68 C;  4OEV A;  4U4S A;  3MZB A;  4RYA A;  3KN3 A;  3D4G A;  3K2D A;  1B5I A;  1HSE A;  2H99 A;  1B5H A;  4IGR A;  4JWO A;  4WED A;  4R6H A;  4R9F A;  2D5W A;  3TZA A;  5H8H B;  5TPA A;  1MXU A;  2O6A A;  4U23 A;  3MPL A;  1OVB A;  3SEV A;  4LZ7 A;  4NED A;  1MQJ A;  1M5C A;  3THI A;  1B46 A;  1UQW A;  1SW4 A;  2HAU A;  1MY3 A;  2Q9T A;  5A5X A;  4NF6 B;  4GWO A;  4OET A;  1SI1 A;  1POY 1;  3MVZ A;  2V3T A;  2QMW A;  2RF1 A;  5K2Y A;  3MAM A;  3SEW A;  4JDF A;  4OFO A;  1P99 A;  5M2V A;  4IO3 A;  5AA2 D;  1HSJ A;  3F11 A;  1IXI A;  3MVX A;  3FVK A;  3PGF A;  3EF7 A;  3VXB A;  2YPN A;  3IJO B;  3LSL A;  5I56 A;  1MXX A;  1B3F A;  4H6D A;  1MY0 A;  1UIU A;  2A5T A;  3MW0 A;  1JET A;  4YB7 A;  2H4I A;  1LLS A;  2F6G A;  4K3F A;  2REG A;  5DVF A;  3PUW E;  3O97 A;  4PE5 B;  1NNF A;  1UIV A;  3KG2 A;  4YKI A;  1SDX A;  3USD A;  4R73 A;  2V3Q A;  2XD3 A;  4LZ8 A;  1Y4T A;  4EQ7 A;  1O64 A;  2GFE A;  4KYS A;  3KJ7 A;  4H5G A;  2GHA A;  1AIV A;  5H8F A;  4OER A;  3OEL A;  4BDN A;  4LP2 B;  3FUZ A;  1JW4 A;  3M3F A;  4OTE A;  4JSD A;  3DLN A;  4I8C A;  5I2N A;  2FYI A;  3MJN A;  4R9G A;  2Y7I A;  4F2O A;  3TAJ A;  3QSL A;  2D3I A;  4WEP A;  1LGB C;  4ZDM A;  1A7L A;  4BDM A;  1D9V A;  1US5 A;  2XXY A;  1LBC A;  4HW8 A;  1R9L A;  3SET A;  5KDT B;  1DSN A;  4X9T A;  1TXF A;  3CSG A;  3RQT A;  2R6G E;  3N5L A;  1XVY A;  1J1N A;  5CC2 A;  3C36 A;  4GF8 A;  1Y9U A;  4DXU A;  3QUF A;  1MXY A;  2DE4 A;  4U1Z A;  3UP9 A;  4OQO A;  4PET A;  4ECF A; 
#chains in the Genus database with same CATH topology
 5KZT A;  1WOD A;  3QAX A;  4HE1 A;  3I5O A;  4R6Y A;  4X48 A;  2I49 A;  1N0T A;  2I48 A;  3FGS A;  4TLL B;  3PPR A;  4OFL A;  4YMB A;  4GLI A;  3O29 A;  1URG A;  4H67 A;  4N81 A;  1M5F A;  3TDJ A;  1B1X A;  3CVG A;  5ICT A;  3TFL A;  2OK2 A;  1K9Y A;  1JVX A;  2H9B A;  3HHF A;  1SVX B;  3CFZ A;  5FHO A;  3SES A;  3R6U A;  2F6P A;  4XF5 A;  3HFU A;  3H03 A;  2NUV A;  3U94 A;  3FV1 A;  4N6K A;  4DCY A;  4OHN A;  4IO7 A;  5B7D A;  3ILT B;  4JBZ A;  4ELQ A;  3T9V A;  4NF8 B;  3KBR A;  5I58 B;  3K6W A;  2XXU A;  2V3U A;  4PC9 A;  2KLF A;  2UYF A;  1DTZ A;  5J1D A;  1YXI A;  1N3W A;  1LBB A;  5BUU A;  1XI6 A;  3SZP A;  2M8C A;  4JWX A;  3WAE A;  2XXQ A;  4PFU A;  3SEU A;  3GXA A;  3C31 A;  2QJE A;  3PPP A;  4N91 A;  4X1D A;  1FTM A;  2ZZW A;  4I1D A;  5IGA A;  5DVI A;  3VVF A;  3EHS A;  2Q2A A;  3PU5 A;  4HTG A;  1D9Y A;  3MC2 A;  2WKY A;  3EQ1 A;  3HO7 A;  4GWW A;  4YZZ A;  1B3G A;  2DS9 A;  1S9T A;  3OXN A;  1DMB A;  1MDQ A;  5I59 A;  4PCD A;  4RXL A;  4MX6 A;  1IEJ A;  1ANF A;  1AH5 A;  4U1O A;  4XIG Q;  2VD2 A;  4ZEC A;  4AQ4 A;  2Y84 A;  3E78 A;  2XWK A;  1Z7N E;  1NMU A;  1ZMG A;  4PFW A;  3G3I A;  4TLM B;  1NI9 A;  3KGC A;  4XKP A;  3B7D A;  1YPN A;  2F34 A;  1P1W A;  3FXU A;  3JZJ A;  3S9E A;  1N7X A;  4HCW A;  2GQ1 A;  1NNK A;  5IZ3 A;  4NG7 A;  2E1S A;  4DI3 D;  1IMC A;  4TOZ A;  2NWJ A;  1MQD A;  3W15 C;  5JTY B;  4MJO A;  3JYR A;  4YKJ A;  4XKR A;  5KCJ B;  5IKB A;  4G8H A;  4G2Z A;  2ONK E;  4DI4 B;  1UTH B;  3UK4 A;  5T3J A;  4H1X A;  3TCG A;  1LFI A;  1JW1 A;  3EN3 A;  4HE2 A;  1MH4 A;  3C35 A;  1I6Q A;  1MQG A;  2V25 A;  1FPF A;  1G0H A;  2NVU B;  4F39 A;  1KA1 A;  1NNT A;  4X8R A;  5LOM A;  1KZ8 A;  1MH3 A;  2VPN A;  4ZEB A;  1JW5 A;  2PT1 A;  1N7W A;  1QGX A;  3UIF A;  2ZZX A;  4PBQ A;  1VFD A;  3CFL A;  1Q35 A;  3B6W A;  4PF8 A;  3RTF B;  4PDD A;  2F7B A;  4UAB A;  4XEQ A;  1ZU0 A;  3L6H A;  2X26 A;  4PGP A;  1SW1 A;  5EYH A;  5IAI A;  1FPJ A;  3UA8 A;  3IFC A;  3N94 A;  3T9U A;  4Q30 B;  3KN7 A;  4GIZ A;  5TU0 A;  1RDZ A;  2ANJ A;  2B65 A;  1VFE A;  4AB5 A;  3DP4 A;  1AWB A;  2VPO A;  3VV5 A;  5AE4 A;  4LVQ A;  4QHQ A;  2QVU A;  1FQC A;  3CSB A;  1Y20 A;  4YMA A;  4RY1 A;  3FBP A;  3OMB A;  4ESX A;  2VT5 A;  2VGQ A;  4P11 A;  4QFO A;  1YYZ A;  3VLV A;  3EHT A;  2HXW A;  2F78 A;  2WYP A;  3B6T A;  3RT8 A;  1B3H A;  1MQH A;  4NX1 A;  2OCU A;  1VE4 A;  1MM6 A;  2PYY A;  1DCU A;  1A40 A;  4GBV A;  1SI0 A;  2X7P A;  2ZNS A;  4H0W A;  4Z0I A;  2XA5 A;  4EXL A;  1GVC A;  1EZP A;  2ZNT A;  3H3G A;  4MMP A;  3TEL A;  1DBZ A;  1K9Z A;  4ZEI A;  3MP1 A;  4DDD A;  5LTC A;  1O63 A;  2QPQ A;  1II5 A;  2QSX A;  3CG1 A;  3HV1 A;  4BDL A;  5I2K A;  2XXT A;  5FHN A;  4QFL A;  4IO4 A;  1B52 A;  2DE2 A;  4FJP A;  4F22 A;  4YAH X;  2R8T A;  1IMD A;  5I56 B;  4LAT A;  4QFN A;  3G3F A;  4C1U A;  3CFX A;  2QS2 A;  1ZKB A;  2UVJ A;  2WBD A;  5DEX B;  4PAF A;  4NGU A;  3PTY A;  4LQ2 A;  5CBS A;  1QKB A;  1YTV A;  1B4H A;  4GQO A;  3RPL B;  3A29 A;  3O6H A;  3VVD A;  3QMF A;  4ELO A;  4X04 A;  4E0X A;  3B50 A;  4DIG A;  2HQ0 A;  4MLQ A;  1USY H;  1AL3 A;  2H98 A;  1FQE A;  3GYY A;  3IB0 A;  3W9V A;  5CMC A;  3QK6 A;  3MVW A;  3HN0 A;  3VFJ A;  4KCD A;  5CRY A;  3TTK A;  2CZL A;  1FBE A;  5FBP A;  1LAH E;  4NE4 A;  4NF4 A;  3KEI A;  5I57 B;  4MNC A;  1ZLQ A;  5I2N B;  1DTG A;  4TQU Q;  4PP0 A;  3TCF A;  1M5B A;  1I6B A;  3E9X A;  3OOA A;  3P7I A;  3C32 A;  2HZK A;  4NMY A;  2P3V A;  1NV3 A;  3O66 A;  1MY2 A;  2YJP A;  5CMK A;  3PD8 A;  2FIE A;  4ZS9 A;  4MNI A;  4PFB A;  2ZYO A;  4N4U A;  3RTW B;  2V4C A;  1MXZ A;  2LAO A;  3S9L C;  4QRZ A;  4DXB A;  1AMF A;  3ZKL A;  1BKA A;  4OVT A;  5EQ7 A;  3RPW A;  4QBA A;  2A5S A;  5H8Q A;  3GBA A;  1IQ7 A;  2O69 A;  4M1V A;  3V8X B;  1FQD A;  5HPQ A;  3IB2 A;  3DP8 A;  1IXC A;  1NNP A;  5AA2 B;  4QXD A;  4GFR A;  3K0V A;  4N6P A;  4O3A A;  4RK9 A;  1P1Q A;  3CRB A;  5EHS A;  1XC1 A;  4DE8 A;  1B58 A;  1FQF A;  2E0S A;  2HXR A;  3HST A;  5ELV A;  3ECR A;  3FIR A;  1A55 A;  3JV9 A;  3TTM A;  1LAG E;  4NN3 A;  2NOO A;  4U22 A;  5H8S A;  2CZI A;  1BIY A;  4FOR A;  4NF5 B;  2VD3 A;  5H8N A;  1B7U A;  4F3P A;  1ZBM A;  2RKM A;  1B4Z A;  3C9H A;  5L9O A;  4QF9 A;  3PMV A;  5AA4 B;  4MFI A;  1B9J A;  4P9K A;  4Q5T A;  1MG1 A;  1EH3 A;  1FTO A;  4OAN A;  2V84 A;  5ET7 A;  2F36 A;  1Q1K A;  4JWY A;  5DYH A;  2HZL A;  1OLC A;  1H44 A;  4XFE A;  3D4C A;  3ILU B;  1YAE A;  5H8H A;  5L8D A;  4FE8 A;  2Z8F A;  5F7V A;  4PFY A;  1LBY A;  3LSW A;  4L17 A;  1A8E A;  4HE0 A;  4EUO A;  1LST A;  4F1Y A;  4PAI A;  3PUV E;  2XXK A;  3HCQ A;  3H4Z A;  2OZZ A;  4Z7E A;  2ZYN A;  4OEN A;  4NF6 A;  2FBP A;  3M3L A;  5AA3 A;  2XX8 A;  3MVY A;  4POX A;  3W9W A;  5I84 A;  4QSD A;  2ZYM A;  3K6X A;  1RYO A;  3A3U A;  1SW5 A;  3HPI A;  1S50 A;  3U65 A;  3BFU A;  2V93 A;  4N17 A;  1H45 A;  3Q29 A;  1NL5 A;  1B5J A;  4NQ8 A;  4DLD A;  3ONM A;  2PFZ A;  4OMB A;  1SYH A;  2CZK A;  3IOV A;  1I69 A;  3KBZ A;  2ZZV A;  4F1U A;  3PPO A;  3PMX A;  2FA7 A;  1DOT A;  4MCO A;  3BIG A;  1EZ9 A;  4MLV A;  2OWT A;  4I9D A;  1PB8 A;  4KYE A;  4FEB A;  4PFR A;  4GWY A;  1JP4 A;  2R71 A;  4R74 A;  3FXR A;  1H3D A;  1EYK A;  1MY1 A;  3TUS A;  4KYD A;  1XOC A;  2XWO A;  3VLW A;  3C34 A;  1OQG A;  3CI8 A;  1POT A;  3KC0 A;  4I40 A;  3RY3 A;  2DWH A;  3VVE A;  1RYX A;  1A54 A;  3U8Q A;  4YKP A;  2Z8E A;  4R72 A;  2OWS A;  3BFT A;  4BDR A;  1MPB A;  1N84 A;  2B3B A;  1B51 A;  4QFK A;  4F31 B;  4FAT A;  3GBB A;  3K1P A;  3FVO A;  5ISU A;  2QL3 A;  2XX9 A;  2DYX A;  2UYE A;  1JNF A;  3GZG A;  2I3V A;  1URS A;  1L5T A;  3DM0 A;  3I3V A;  3LBS A;  3OEK A;  4RA1 A;  3KFM A;  2VOZ A;  4OYV A;  2Y7W A;  5KDT A;  1QUI A;  2B3F A;  3OO9 A;  1P1U A;  1TFA A;  4MEV A;  3E13 X;  4PBH A;  4EF1 A;  1D4N A;  2WBB A;  1MXW A;  5TP9 A;  4OVS A;  2OLB A;  1IME A;  1R6Z A;  2I4C A;  1UTB B;  3K6U A;  3O2A A;  3FZV A;  3T9H B;  2XD2 A;  2XXP A;  3FVN A;  1IIT A;  5CMM A;  5DVJ A;  2RC9 A;  5A5L A;  3CR9 A;  1SPI A;  5ET5 A;  5BWJ A;  2HFB A;  3SEX A;  1N3X A;  4GWZ A;  2KQZ A;  3EPE A;  1LFG A;  3LC8 A;  4O3B A;  4DXC A;  4JVC A;  1I6A A;  2DDK A;  2DWJ A;  1FQA A;  3MPK A;  2AL5 A;  2Y5K A;  2Q2C A;  1SD3 A;  1YCJ A;  3OO8 A;  4RK2 A;  4ZEF A;  3PPQ A;  2ABH A;  3IOR A;  5JK4 A;  4N6D A;  4GVO A;  1VSO A;  4ELP A;  2DOJ A;  4GRK A;  3H06 B;  4P47 A;  5HBC A;  4EF2 A;  1GV8 A;  2AL4 A;  4H8J A;  1ATG A;  5IZ1 A;  1FTL A;  3MST A;  4FIM A;  3K00 A;  2O1M A;  3CG3 A;  3LSX A;  2DP8 A;  3LUZ A;  3RGY A;  5FHM A;  2O68 A;  2DVZ A;  1GR2 A;  4PE3 A;  2CMO A;  4OVQ A;  3N26 A;  1XVX A;  2AYS A;  2F3B A;  4QSE A;  1FBP A;  4NF8 A;  5I58 A;  1B05 A;  4C0R A;  1FPK A;  5AA1 A;  1HSL A;  3KJT A;  3PMW A;  1B1H A;  4F19 A;  1WVJ A;  3BKI B;  5L9M A;  5JEI A;  1FPL A;  1TFD A;  1URD A;  3KZG A;  4QFP A;  2XWI A;  1SW2 A;  3O9P A;  4GBW A;  2Q89 A;  1B7Z A;  4G68 B;  4F3B A;  1FTK A;  4THI A;  4E0W A;  3T9X B;  2QS1 A;  5I5P A;  3NOH A;  4O7I A;  4O7M A;  2GRV A;  2Q8M A;  3IOW A;  2QS3 A;  5DW8 A;  4ZE9 A;  4ZEK A;  4H8I A;  1IXH A;  3T96 B;  2HHM A;  4XXU A;  3TTR A;  1B7H A;  3IR1 A;  2I58 A;  3C4M A;  5TPA B;  3FV2 A;  1BLF A;  5ESY A;  2Z22 A;  2P0S A;  4GL0 A;  5CBR A;  4ONY A;  4FAJ A;  3KN8 A;  1VR5 A;  5F1Q A;  4KD5 A;  4EDP A;  2DWI A;  4NWC A;  4GX6 A;  3KOT A;  4RPO A;  4N13 A;  3TQL A;  1EU8 A;  1PEB A;  1MM7 A;  4LN5 A;  1PBQ A;  3K1M A;  3MYU A;  2PVU A;  1Y3P A;  2HAV A;  1WDN A;  5A5X B;  4ZZA A;  3O6G A;  4H46 A;  2I6E A;  4OEU A;  3MZ9 A;  1O7T A;  4QSC A;  5FTI A;  1NV1 A;  3H7M A;  4FBP A;  2QRY A;  2XXH A;  2Y7P A;  4G61 A;  5JTY A;  3S9N C;  3SEY A;  4GXS B;  4OVR A;  1B40 A;  3H6T A;  1NV2 A;  1ZIU A;  5I3S A;  1UTH A;  1NUY A;  4C1T A;  4DCX A;  1PB9 A;  2DVC A;  4FED A;  1GGG A;  2O51 A;  4N8Y A;  3MUQ A;  4BDO A;  2ZNU A;  3KSJ A;  4OFJ A;  3FJ7 A;  1MQI A;  1MPC A;  1B32 A;  2A5T B;  1ZJL A;  1LCF A;  2BJJ X;  3L6G A;  3OO6 A;  3U1O A;  4IO6 A;  2F7A A;  1AOV A;  4F18 A;  2ESN A;  4PF6 A;  1M5D A;  3LUY A;  3VLU A;  5EQA A;  2P2A A;  3SER A;  3T93 B;  1IXG A;  1FQB A;  3BIH A;  4GL8 A;  1IUD A;  3GLB A;  1IMF A;  4IO2 A;  3OD7 A;  3ZS6 A;  5H8F B;  4DZ1 A;  4UA8 A;  3QYT A;  3T1B A;  4EQB A;  1LBV A;  3E4R A;  3D1R A;  4OZ9 A;  4YU0 A;  2VHA A;  4PTK A;  4JXI A;  3M3K A;  1A8F A;  1JEU A;  4R2B A;  5CMB A;  3VXC A;  3EHU A;  1YZ0 A;  2W7Y A;  1FRP A;  1QJM A;  2ZXT A;  3T22 A;  1IIW A;  3KOS A;  1NV7 A;  3IJX B;  1XS5 A;  2F5X A;  2ZYK A;  2Q88 A;  4KFQ A;  2GHB A;  1PBP A;  5HM4 B;  2XX7 A;  1BK4 A;  2F8D A;  4ZZE A;  2H5Y A;  1LBW A;  3SKP A;  3Q28 A;  4P0G A;  2D21 A;  4H65 A;  3FVG A;  5DT6 A;  1B6H A;  2I0B A;  4MBP A;  1T0K A;  5ICQ A;  1FJ6 A;  2Z8D A;  3UOR A;  4UAC A;  4GWS A;  3MWB A;  4ELR A;  3U92 A;  2QVR A;  1JQF A;  4IO5 A;  4JVI A;  1NKX A;  3B6Q A;  4N15 A;  4OA4 A;  4O3C A;  4F3G A;  1MRP A;  4P1E A;  3C33 A;  1N76 A;  1DPE A;  2MKZ A;  2PMS A;  2UVI A;  3ZSF A;  2WEF A;  3QXM A;  5DEX A;  2H25 A;  5IZZ A;  2WX9 A;  1QW0 A;  1Y3N A;  3FXQ A;  3RPL A;  4PAK A;  4G8M A;  2ALU A;  2XWV A;  4MAG A;  4XTC Q;  1SQY A;  3G3H A;  1JVY A;  3G7W A;  4OVJ A;  1FJ9 A;  1FSA A;  1PDA A;  4U4X A;  3IFA A;  2JJK A;  3M8U A;  1JEV A;  1OIB A;  1Y3Q A;  4GX4 A;  2RCA A;  3WAF A;  4M4G A;  4F3S A;  5I57 A;  1S7Y A;  3FJM A;  2ONS A;  1OMP A;  1NUW A;  3OEM A;  3VDF A;  3QIM A;  4GWX A;  5B70 A;  3K1N A;  3IB1 A;  3MQ9 A;  1PC3 A;  2X7Q A;  4N07 A;  2G93 A;  4H5F A;  1FTJ A;  5L9S A;  2PX1 A;  3FD3 A;  2XHD A;  1MS7 A;  2RC8 A;  5ET8 A;  2I0C A;  4HS7 A;  3UGW A;  1NUZ A;  4XKQ A;  4LON B;  1LB8 A;  5TP9 B;  3OSQ A;  2HPG A;  4YB6 A;  1ELJ A;  1QVS A;  2GH9 A;  3IK6 B;  5I59 B;  1EYI A;  2O7I A;  2DXR A;  5AA2 A;  3KSX A;  2CEX A;  2HCA A;  3MP8 A;  4LZ5 A;  4RJZ A;  3IX1 A;  3FAS A;  2O1L A;  4RPN A;  1FBD A;  3K6V A;  1FBC A;  1FPE A;  4KCC A;  3IL1 B;  4IGT A;  3FAT A;  3RLF E;  1MPD A;  3BBR A;  3RUM A;  3TOD A;  1LBX A;  2FVZ A;  4NF5 A;  3LV0 A;  2B4L A;  4NAP A;  3S9M C;  3CHG A;  1FBF A;  1SBP A;  1Y4C A;  4YIC A;  2PT2 A;  3A09 A;  1NFT A;  5IZ3 B;  2XXW A;  1H43 A;  1GTK A;  5ITP A;  3PUX E;  3OO7 A;  2QVV A;  3K01 A;  5AA4 A;  3H6V A;  4BDQ A;  1Q9D A;  2OJT A;  3FJG A;  3ZKK A;  3RNN A;  4F29 A;  2YLN A;  4POW A;  1B0H A;  1CE2 A;  2B4M A;  4OXV A;  2ZMB A;  2XXX A;  4RNS A;  2F7C A;  1INP A;  3PV0 E;  3RYD A;  1B3E A;  1NH7 A;  1SYI A;  2Y7K A;  4R6K A;  3TQW A;  2P3N A;  5LDZ A;  1KWH A;  2AIX A;  3PUZ E;  3ODB A;  1N04 A;  4MH5 A;  2QMX A;  3RN8 A;  2L5V A;  4MHF A;  2R9J A;  4MIJ A;  4ND9 A;  2FNC A;  1Y1Z A;  3O6I A;  3Q26 A;  3HHG A;  3B8B A;  2DXY A;  2RIN A;  5CI5 A;  2BJI A;  3PD9 A;  3KC1 A;  1NH8 A;  5K2X A;  1MDP 1;  2XXR A;  3MBP A;  4R2F A;  1XHY A;  4G77 A;  1QUL A;  4LA9 A;  4GWU A;  3TYH A;  1LAX A;  1KA0 A;  2VP1 A;  1IMA A;  3I6V A;  4MF3 A;  2ONR A;  2THI A;  1B3L A;  4XKN A;  4F1V A;  3TPA A;  4OES A;  3G3J A;  1LCT A;  2OBG A;  3TEP A;  4KPT A;  1USY E;  1US4 A;  4NTL A;  3OEN A;  3A3C A;  3EKI A;  2PCR A;  3E79 A;  4Q8R A;  2OWZ A;  3FXB A;  4YKK A;  1OQH A;  5CM6 A;  5EQ8 A;  4F2Q A;  2IEE A;  2I3W A;  1B0L A;  4Q0C A;  3OSR A;  3R7X A;  1CB6 A;  4GOT A;  4HXV A;  4R75 A;  4ISU A;  4KQP A;  1MXV A;  2PBW A;  4HCY A;  2IA4 A;  4I3E A;  1TWY A;  3V83 A;  3K4U A;  1FCK A;  4EXK A;  2UVG A;  4AB6 A;  4EQ9 A;  1FW0 A;  1PB7 A;  2Z23 A;  2REJ A;  3H6W A;  3U72 A;  3T66 A;  4PFT A;  1LFH A;  2Y7R A;  1QUJ A;  4ZE8 A;  3Q25 A;  3G3G A;  3SDF A;  4LQ5 A;  1BP5 A;  4NWD A;  2UVH A;  2NXO A;  1H76 A;  4P3L A;  2P1S A;  2FHY A;  2DWA A;  3MP6 A;  3N6T A;  5FTH A;  3IOT A;  2F97 A;  4H45 A;  3PUY E;  4G4P A;  1B2H A;  1LB9 A;  1Y1M A;  1TT1 A;  3DEL B;  1NUX A;  4I62 A;  4P0I A;  5I2K B;  3V5A A;  2CZH A;  4IY6 A;  1Z7M E;  4PDH A;  1P1N A;  5DTB A;  4U2R A;  1R1N A;  4YB5 A;  2G29 A;  5J16 A;  3DP6 A;  4IB2 A;  2Q74 A;  4GXA A;  1MY4 A;  1P1O A;  1D9Q A;  4WXJ A;  2UXA A;  3U93 A;  1QKA A;  1NV0 A;  2QS4 A;  4PQJ A;  1ZTY A;  3IO6 A;  3H6U A;  2DSF A;  3E3K A;  2I4B A;  1UTB A;  4ESW A;  3V89 B;  1EZO A;  4NF4 B;  2RCB A;  4NHB A;  4WKM A;  4U21 A;  1NV4 A;  3G3K A;  3ISP A;  3VE1 B;  1R9Q A;  3LR1 A;  2F3D A;  4BLA A;  1QUK A;  1A99 A;  4O8M A;  1F9B A;  1FBH A;  4ZED A;  2Q8J A;  1RKM A;  4P56 A;  3TKD A;  4KI0 E;  3RT6 B;  1XT8 A;  4KHZ E;  1IZ1 A;  4JSO A;  2RC7 A;  3K02 A;  3Q27 A;  4LUB A;  1G0I A;  3TTN A;  2Y5L A;  2DE3 A;  5EYF A;  3LSF B;  3N6U A;  4I3Y A;  2HEU A;  5H8Q B;  4IR8 A;  3R26 A;  3S4U A;  2XXV A;  3O28 A;  4KR5 A;  3UN6 A;  3PPN A;  5KCJ A;  1OLA A;  3S2V A;  3QUJ A;  4G8N A;  2O7U A;  4GD5 A;  1D3K A;  2QFL A;  3TMG A;  4JB7 A;  3IAZ A;  5EHM A;  1BTJ A;  1DPP A;  3IO4 A;  3MZ1 A;  2XXI A;  1DK4 A;  4X1B A;  4IY5 A;  4FEC A;  5ITO A;  2O84 X;  3TCH A;  3CIJ A;  4PFI A;  5H8N B;  3TTL A;  1FPD A;  2DQV A;  2F35 A;  1M5E A;  3AXF A;  1OVT A;  3IOU A;  1LAF E;  4OWD A;  4G68 A;  4G68 C;  4OEV A;  4U4S A;  3MZB A;  4RYA A;  3KN3 A;  3D4G A;  4N8G A;  2CEY A;  5I7I A;  3K2D A;  1B5I A;  1HSE A;  4PGN A;  1EYJ A;  2H99 A;  1B5H A;  4IGR A;  4JWO A;  1FTA A;  4WED A;  4R6H A;  4R9F A;  2D5W A;  1RDY A;  3TZA A;  3ROJ A;  5H8H B;  5TPA A;  1MXU A;  2O6A A;  4U23 A;  3MPL A;  1OVB A;  3SEV A;  4AS5 A;  4LZ7 A;  4NED A;  1MQJ A;  1M5C A;  3THI A;  1VDW A;  1B46 A;  1UQW A;  1SW4 A;  2HAU A;  2OX3 A;  1MY3 A;  2Q9T A;  5A5X A;  4NF6 B;  4GWO A;  4OET A;  1SI1 A;  1FPB A;  1POY 1;  3MVZ A;  2FIX A;  2V3T A;  2QMW A;  1LEV A;  2RF1 A;  5K2Y A;  3MAM A;  3SEW A;  4JDF A;  4OFO A;  1P99 A;  5M2V A;  4AS4 A;  4IO3 A;  5AA2 D;  1IMB A;  1HSJ A;  3F11 A;  1IXI A;  3MVX A;  3FVK A;  5IM2 A;  4P1L A;  3PGF A;  3EF7 A;  3VXB A;  2YPN A;  3IJO B;  3LSL A;  5I56 A;  1MXX A;  1B3F A;  4NF0 A;  4H6D A;  1MY0 A;  1UIU A;  1NV5 A;  2A5T A;  3MW0 A;  1JET A;  4YB7 A;  2H4I A;  1LLS A;  2WYK A;  4GX3 A;  2F6G A;  4MNP A;  2KR0 A;  4K3F A;  4OVP A;  2REG A;  4O94 A;  5DVF A;  3PUW E;  3O97 A;  4PE5 B;  3T0J A;  1NNF A;  1UIV A;  3KG2 A;  4YKI A;  1SDX A;  3USD A;  4R73 A;  2V3Q A;  1FPI A;  2XD3 A;  4LZ8 A;  1Y4T A;  4EQ7 A;  4P8B A;  1O64 A;  2GFE A;  4KYS A;  3KJ7 A;  4H5G A;  2GHA A;  1AIV A;  5H8F A;  4OER A;  3OEL A;  4BDN A;  4LP2 B;  3FUZ A;  5EYG A;  1JW4 A;  3M3F A;  4OTE A;  5F24 A;  4JSD A;  4JVD A;  3DLN A;  4I8C A;  5I2N A;  2FYI A;  3MJN A;  4R9G A;  2Y7I A;  4F2O A;  3TAJ A;  3QSL A;  2D3I A;  4WEP A;  1LGB C;  4ZDM A;  1A7L A;  4BDM A;  1LBZ A;  1D9V A;  1US5 A;  2XXY A;  1LBC A;  4HW8 A;  5ET6 A;  1R9L A;  1FBG A;  3SET A;  5KDT B;  1DSN A;  4KXP A;  4X9T A;  1CNQ A;  1TXF A;  3CSG A;  1NV6 A;  2PFY A;  1FPG A;  1RDX A;  3RQT A;  2R6G E;  3N5L A;  1XVY A;  1J1N A;  5CC2 A;  3C36 A;  4GF8 A;  1Y9U A;  4DXU A;  3QUF A;  1MXY A;  5EQ9 A;  2DE4 A;  4U1Z A;  3UP9 A;  4OQO A;  4PET A;  4ECF A; 
#chains in the Genus database with same CATH homology
 5KZT A;  1WOD A;  3QAX A;  3I5O A;  4R6Y A;  4X48 A;  2I49 A;  1N0T A;  2I48 A;  3FGS A;  4TLL B;  3PPR A;  4OFL A;  4YMB A;  4GLI A;  3O29 A;  1URG A;  4H67 A;  1M5F A;  3TDJ A;  1B1X A;  3CVG A;  5ICT A;  3TFL A;  2OK2 A;  1JVX A;  2H9B A;  3HHF A;  1SVX B;  3CFZ A;  5FHO A;  3SES A;  3R6U A;  2F6P A;  3H03 A;  2NUV A;  3U94 A;  3FV1 A;  4DCY A;  4OHN A;  4IO7 A;  5B7D A;  3ILT B;  4JBZ A;  4ELQ A;  3T9V A;  4NF8 B;  3KBR A;  5I58 B;  3K6W A;  2XXU A;  2V3U A;  2KLF A;  2UYF A;  1DTZ A;  5J1D A;  1N3W A;  1LBB A;  5BUU A;  2M8C A;  4JWX A;  3WAE A;  2XXQ A;  4PFU A;  3SEU A;  3GXA A;  3C31 A;  2QJE A;  3PPP A;  4X1D A;  1FTM A;  4I1D A;  5DVI A;  3VVF A;  3EHS A;  2Q2A A;  3PU5 A;  4HTG A;  1D9Y A;  3MC2 A;  2WKY A;  3EQ1 A;  3HO7 A;  4YZZ A;  1B3G A;  2DS9 A;  1S9T A;  3OXN A;  1DMB A;  1MDQ A;  5I59 A;  4RXL A;  1IEJ A;  1ANF A;  1AH5 A;  4U1O A;  4XIG Q;  2VD2 A;  4ZEC A;  4AQ4 A;  2Y84 A;  1Z7N E;  1NMU A;  1ZMG A;  4PFW A;  3G3I A;  4TLM B;  3KGC A;  4XKP A;  3B7D A;  1YPN A;  2F34 A;  1P1W A;  3FXU A;  3JZJ A;  3S9E A;  1N7X A;  4HCW A;  1NNK A;  2E1S A;  4TOZ A;  2NWJ A;  1MQD A;  3W15 C;  5JTY B;  3JYR A;  4YKJ A;  4XKR A;  5KCJ B;  5IKB A;  4G8H A;  4G2Z A;  2ONK E;  1UTH B;  3UK4 A;  4H1X A;  3TCG A;  1LFI A;  1JW1 A;  3EN3 A;  1MH4 A;  3C35 A;  1I6Q A;  1MQG A;  2V25 A;  2NVU B;  4F39 A;  1NNT A;  5LOM A;  1MH3 A;  4ZEB A;  1JW5 A;  2PT1 A;  1N7W A;  3UIF A;  1VFD A;  3CFL A;  1Q35 A;  3B6W A;  3RTF B;  2F7B A;  1ZU0 A;  3L6H A;  2X26 A;  1SW1 A;  5IAI A;  3UA8 A;  3N94 A;  3T9U A;  4Q30 B;  3KN7 A;  4GIZ A;  5TU0 A;  2B65 A;  2ANJ A;  1VFE A;  4AB5 A;  3DP4 A;  3VV5 A;  5AE4 A;  4LVQ A;  4QHQ A;  1FQC A;  3CSB A;  1Y20 A;  4YMA A;  4RY1 A;  3OMB A;  4ESX A;  2VGQ A;  4P11 A;  4QFO A;  3VLV A;  3EHT A;  2HXW A;  2F78 A;  3B6T A;  3RT8 A;  1B3H A;  1MQH A;  2OCU A;  1VE4 A;  1MM6 A;  2PYY A;  1A40 A;  1SI0 A;  2X7P A;  2ZNS A;  4H0W A;  4Z0I A;  4EXL A;  1GVC A;  1EZP A;  2ZNT A;  3H3G A;  3TEL A;  4ZEI A;  3MP1 A;  4DDD A;  1O63 A;  2QPQ A;  1II5 A;  2QSX A;  3CG1 A;  3HV1 A;  4BDL A;  5I2K A;  2XXT A;  5FHN A;  4QFL A;  4IO4 A;  1B52 A;  2DE2 A;  4FJP A;  4F22 A;  4YAH X;  5I56 B;  4LAT A;  4QFN A;  3G3F A;  4C1U A;  3CFX A;  2QS2 A;  1ZKB A;  2UVJ A;  5DEX B;  4LQ2 A;  5CBS A;  1QKB A;  1YTV A;  1B4H A;  4GQO A;  3O6H A;  3VVD A;  4ELO A;  4E0X A;  4DIG A;  2HQ0 A;  4MLQ A;  1USY H;  1AL3 A;  2H98 A;  1FQE A;  3IB0 A;  3W9V A;  5CMC A;  3QK6 A;  3MVW A;  3HN0 A;  3VFJ A;  4KCD A;  5CRY A;  3TTK A;  2CZL A;  1LAH E;  4NE4 A;  4NF4 A;  3KEI A;  5I57 B;  1ZLQ A;  5I2N B;  1DTG A;  4TQU Q;  4PP0 A;  3TCF A;  1M5B A;  1I6B A;  3E9X A;  3OOA A;  3P7I A;  3C32 A;  2HZK A;  4NMY A;  3O66 A;  1MY2 A;  2YJP A;  5CMK A;  3PD8 A;  4ZS9 A;  2ZYO A;  3RTW B;  1MXZ A;  2LAO A;  3S9L C;  4QRZ A;  4DXB A;  1AMF A;  3ZKL A;  1BKA A;  3RPW A;  2A5S A;  5H8Q A;  3GBA A;  1IQ7 A;  2O69 A;  4M1V A;  3V8X B;  1FQD A;  5HPQ A;  3IB2 A;  3DP8 A;  1IXC A;  1NNP A;  5AA2 B;  4GFR A;  3K0V A;  4N6P A;  4O3A A;  4RK9 A;  1P1Q A;  3CRB A;  5EHS A;  1XC1 A;  4DE8 A;  1B58 A;  1FQF A;  2E0S A;  3HST A;  5ELV A;  3ECR A;  3FIR A;  1A55 A;  3JV9 A;  3TTM A;  1LAG E;  2NOO A;  4U22 A;  5H8S A;  4FOR A;  1BIY A;  4NF5 B;  2VD3 A;  5H8N A;  1B7U A;  4F3P A;  1ZBM A;  2RKM A;  1B4Z A;  3C9H A;  5L9O A;  4QF9 A;  3PMV A;  5AA4 B;  4MFI A;  1B9J A;  4Q5T A;  1MG1 A;  1EH3 A;  1FTO A;  2V84 A;  2F36 A;  1Q1K A;  4JWY A;  5DYH A;  2HZL A;  1OLC A;  1H44 A;  3D4C A;  3ILU B;  1YAE A;  5H8H A;  5L8D A;  4FE8 A;  2Z8F A;  5F7V A;  4PFY A;  3LSW A;  4L17 A;  1A8E A;  4EUO A;  1LST A;  4F1Y A;  3PUV E;  3HCQ A;  3H4Z A;  2OZZ A;  4Z7E A;  2ZYN A;  4OEN A;  4NF6 A;  3M3L A;  5AA3 A;  2XX8 A;  3MVY A;  4POX A;  3W9W A;  5I84 A;  4QSD A;  2ZYM A;  3K6X A;  1RYO A;  3A3U A;  1SW5 A;  3HPI A;  1S50 A;  3BFU A;  2V93 A;  1H45 A;  3Q29 A;  1NL5 A;  1B5J A;  4DLD A;  3ONM A;  4OMB A;  1SYH A;  3IOV A;  1I69 A;  4F1U A;  3PPO A;  3PMX A;  2FA7 A;  1DOT A;  1EZ9 A;  4MLV A;  2OWT A;  4I9D A;  1PB8 A;  4KYE A;  4FEB A;  2R71 A;  4R74 A;  3FXR A;  1H3D A;  1MY1 A;  3TUS A;  4KYD A;  1XOC A;  3VLW A;  3C34 A;  1OQG A;  3CI8 A;  1POT A;  3RY3 A;  2DWH A;  3VVE A;  1RYX A;  1A54 A;  3U8Q A;  4YKP A;  2Z8E A;  4R72 A;  2OWS A;  3BFT A;  4BDR A;  1MPB A;  1N84 A;  2B3B A;  1B51 A;  4QFK A;  4F31 B;  4FAT A;  3GBB A;  3K1P A;  3FVO A;  5ISU A;  2QL3 A;  2XX9 A;  2DYX A;  2UYE A;  1JNF A;  3GZG A;  2I3V A;  1URS A;  1L5T A;  3DM0 A;  3I3V A;  3LBS A;  3OEK A;  4RA1 A;  3KFM A;  2VOZ A;  4OYV A;  2Y7W A;  5KDT A;  1QUI A;  2B3F A;  3OO9 A;  1P1U A;  1TFA A;  3E13 X;  4EF1 A;  1D4N A;  1MXW A;  5TP9 A;  2OLB A;  1R6Z A;  2I4C A;  1UTB B;  3K6U A;  3O2A A;  3FZV A;  3T9H B;  2XD2 A;  2XXP A;  3FVN A;  1IIT A;  5CMM A;  5DVJ A;  2RC9 A;  3CR9 A;  5BWJ A;  2HFB A;  3SEX A;  1N3X A;  3EPE A;  1LFG A;  3LC8 A;  4O3B A;  4DXC A;  1I6A A;  2DWJ A;  1FQA A;  3MPK A;  2AL5 A;  2Q2C A;  1SD3 A;  1YCJ A;  3OO8 A;  4RK2 A;  4ZEF A;  3PPQ A;  2ABH A;  3IOR A;  5JK4 A;  4GVO A;  1VSO A;  4ELP A;  2DOJ A;  4GRK A;  3H06 B;  5HBC A;  4EF2 A;  1GV8 A;  2AL4 A;  4H8J A;  1ATG A;  1FTL A;  4FIM A;  3K00 A;  2O1M A;  3CG3 A;  3LSX A;  2DP8 A;  3RGY A;  5FHM A;  2O68 A;  2DVZ A;  1GR2 A;  2CMO A;  3N26 A;  1XVX A;  2AYS A;  4QSE A;  4NF8 A;  5I58 A;  1B05 A;  4C0R A;  5AA1 A;  1HSL A;  3KJT A;  3PMW A;  1B1H A;  4F19 A;  1WVJ A;  3BKI B;  5L9M A;  5JEI A;  1TFD A;  1URD A;  3KZG A;  4QFP A;  1SW2 A;  3O9P A;  2Q89 A;  1B7Z A;  4G68 B;  4F3B A;  1FTK A;  4THI A;  4E0W A;  3T9X B;  2QS1 A;  2GRV A;  3IOW A;  2QS3 A;  4ZE9 A;  4ZEK A;  4H8I A;  1IXH A;  3T96 B;  4XXU A;  3TTR A;  1B7H A;  3IR1 A;  2I58 A;  3C4M A;  5TPA B;  3FV2 A;  1BLF A;  2Z22 A;  2P0S A;  4GL0 A;  5CBR A;  4ONY A;  4FAJ A;  3KN8 A;  1VR5 A;  5F1Q A;  4KD5 A;  4EDP A;  2DWI A;  4NWC A;  3KOT A;  4RPO A;  4N13 A;  3TQL A;  1EU8 A;  1PEB A;  1MM7 A;  1PBQ A;  3K1M A;  2PVU A;  1Y3P A;  2HAV A;  1WDN A;  5A5X B;  4ZZA A;  3O6G A;  2I6E A;  4OEU A;  3MZ9 A;  1O7T A;  4QSC A;  5FTI A;  3H7M A;  2QRY A;  2XXH A;  2Y7P A;  5JTY A;  3S9N C;  3SEY A;  4GXS B;  1B40 A;  3H6T A;  1ZIU A;  1UTH A;  4C1T A;  4DCX A;  1PB9 A;  2DVC A;  4FED A;  1GGG A;  2O51 A;  4BDO A;  3MUQ A;  2ZNU A;  3KSJ A;  4OFJ A;  3FJ7 A;  1MQI A;  1MPC A;  1B32 A;  2A5T B;  1ZJL A;  1LCF A;  2BJJ X;  3L6G A;  3OO6 A;  3U1O A;  4IO6 A;  2F7A A;  1AOV A;  4F18 A;  2ESN A;  1M5D A;  3LUY A;  3VLU A;  2P2A A;  3SER A;  3T93 B;  1IXG A;  1FQB A;  4GL8 A;  1IUD A;  3GLB A;  4IO2 A;  3OD7 A;  3ZS6 A;  5H8F B;  4DZ1 A;  4UA8 A;  3QYT A;  4EQB A;  3E4R A;  4OZ9 A;  4YU0 A;  2VHA A;  4JXI A;  3M3K A;  1A8F A;  1JEU A;  4R2B A;  5CMB A;  3VXC A;  3EHU A;  2W7Y A;  1QJM A;  2ZXT A;  3T22 A;  1IIW A;  3KOS A;  3IJX B;  1XS5 A;  2F5X A;  2ZYK A;  2Q88 A;  4KFQ A;  2GHB A;  1PBP A;  5HM4 B;  2XX7 A;  2F8D A;  4ZZE A;  2H5Y A;  3SKP A;  3Q28 A;  4P0G A;  2D21 A;  4H65 A;  3FVG A;  5DT6 A;  1B6H A;  2I0B A;  4MBP A;  1T0K A;  5ICQ A;  2Z8D A;  3UOR A;  4UAC A;  3MWB A;  4ELR A;  3U92 A;  1JQF A;  4IO5 A;  1NKX A;  3B6Q A;  4O3C A;  4F3G A;  1MRP A;  3C33 A;  1N76 A;  1DPE A;  2PMS A;  2UVI A;  3ZSF A;  3QXM A;  5DEX A;  2H25 A;  1QW0 A;  1Y3N A;  3FXQ A;  4G8M A;  2ALU A;  4XTC Q;  1SQY A;  3G3H A;  1JVY A;  3G7W A;  4OVJ A;  1PDA A;  4U4X A;  3M8U A;  1JEV A;  1OIB A;  1Y3Q A;  2RCA A;  3WAF A;  4M4G A;  4F3S A;  5I57 A;  1S7Y A;  3FJM A;  2ONS A;  1OMP A;  3OEM A;  3VDF A;  3QIM A;  5B70 A;  3K1N A;  3IB1 A;  3MQ9 A;  1PC3 A;  2X7Q A;  4N07 A;  2G93 A;  4H5F A;  1FTJ A;  5L9S A;  2PX1 A;  3FD3 A;  2XHD A;  1MS7 A;  2RC8 A;  2I0C A;  4HS7 A;  3UGW A;  4XKQ A;  4LON B;  1LB8 A;  5TP9 B;  3OSQ A;  4YB6 A;  1ELJ A;  1QVS A;  2GH9 A;  3IK6 B;  5I59 B;  2O7I A;  2DXR A;  5AA2 A;  3KSX A;  2HCA A;  3MP8 A;  4LZ5 A;  4RJZ A;  3IX1 A;  3FAS A;  2O1L A;  4RPN A;  3K6V A;  4KCC A;  3IL1 B;  4IGT A;  3FAT A;  3RLF E;  1MPD A;  3BBR A;  3RUM A;  3TOD A;  4NF5 A;  3S9M C;  1SBP A;  1Y4C A;  4YIC A;  2PT2 A;  3A09 A;  1NFT A;  2XXW A;  1H43 A;  1GTK A;  5ITP A;  3PUX E;  3OO7 A;  3K01 A;  5AA4 A;  3H6V A;  4BDQ A;  3ZKK A;  3FJG A;  2OJT A;  3RNN A;  4F29 A;  2YLN A;  4POW A;  1B0H A;  1CE2 A;  4OXV A;  2ZMB A;  2XXX A;  4RNS A;  2F7C A;  3PV0 E;  1B3E A;  1NH7 A;  1SYI A;  2Y7K A;  4R6K A;  3TQW A;  1KWH A;  2AIX A;  3PUZ E;  3ODB A;  1N04 A;  4MH5 A;  2QMX A;  3RN8 A;  2R9J A;  4ND9 A;  2FNC A;  1Y1Z A;  3O6I A;  3Q26 A;  3HHG A;  2DXY A;  2RIN A;  5CI5 A;  3PD9 A;  1NH8 A;  5K2X A;  1MDP 1;  2XXR A;  3MBP A;  4R2F A;  1XHY A;  4G77 A;  1QUL A;  4LA9 A;  3TYH A;  1LAX A;  2VP1 A;  3I6V A;  4MF3 A;  2ONR A;  2THI A;  1B3L A;  4XKN A;  4F1V A;  3TPA A;  4OES A;  3G3J A;  1LCT A;  2OBG A;  3TEP A;  4KPT A;  1USY E;  1US4 A;  4NTL A;  3OEN A;  3A3C A;  4Q8R A;  4YKK A;  1OQH A;  5CM6 A;  4F2Q A;  2IEE A;  2I3W A;  1B0L A;  4Q0C A;  3OSR A;  3R7X A;  1CB6 A;  4GOT A;  4R75 A;  4ISU A;  4KQP A;  1MXV A;  2PBW A;  4HCY A;  2IA4 A;  1TWY A;  3V83 A;  3K4U A;  1FCK A;  4EXK A;  2UVG A;  4AB6 A;  4EQ9 A;  1FW0 A;  1PB7 A;  2Z23 A;  2REJ A;  3H6W A;  3U72 A;  3T66 A;  4PFT A;  1LFH A;  2Y7R A;  1QUJ A;  4ZE8 A;  3Q25 A;  3G3G A;  3SDF A;  4LQ5 A;  1BP5 A;  4NWD A;  2UVH A;  2NXO A;  1H76 A;  2P1S A;  2DWA A;  3MP6 A;  3N6T A;  5FTH A;  3IOT A;  2F97 A;  3PUY E;  4G4P A;  1B2H A;  1LB9 A;  1Y1M A;  1TT1 A;  3DEL B;  4I62 A;  4P0I A;  5I2K B;  3V5A A;  4IY6 A;  1Z7M E;  1P1N A;  5DTB A;  4U2R A;  1R1N A;  4YB5 A;  2G29 A;  3DP6 A;  4IB2 A;  4GXA A;  1MY4 A;  1P1O A;  4WXJ A;  2UXA A;  3U93 A;  1QKA A;  2QS4 A;  4PQJ A;  1ZTY A;  3IO6 A;  3H6U A;  2DSF A;  3E3K A;  2I4B A;  1UTB A;  4ESW A;  3V89 B;  1EZO A;  4NF4 B;  2RCB A;  4WKM A;  4U21 A;  3G3K A;  3VE1 B;  1R9Q A;  3LR1 A;  4BLA A;  1QUK A;  1A99 A;  1F9B A;  4ZED A;  2Q8J A;  1RKM A;  3TKD A;  4KI0 E;  3RT6 B;  1XT8 A;  4KHZ E;  1IZ1 A;  4JSO A;  2RC7 A;  3K02 A;  3Q27 A;  4LUB A;  3TTN A;  2DE3 A;  5EYF A;  3LSF B;  3N6U A;  2HEU A;  5H8Q B;  3R26 A;  3S4U A;  2XXV A;  3O28 A;  4KR5 A;  3UN6 A;  3PPN A;  5KCJ A;  1OLA A;  3S2V A;  3QUJ A;  4G8N A;  2O7U A;  4GD5 A;  1D3K A;  3TMG A;  4JB7 A;  3IAZ A;  5EHM A;  1BTJ A;  1DPP A;  3IO4 A;  3MZ1 A;  2XXI A;  4X1B A;  4IY5 A;  4FEC A;  5ITO A;  2O84 X;  3TCH A;  3CIJ A;  5H8N B;  3TTL A;  2DQV A;  2F35 A;  1M5E A;  3AXF A;  1OVT A;  3IOU A;  1LAF E;  4OWD A;  4G68 A;  4G68 C;  4OEV A;  4U4S A;  3MZB A;  4RYA A;  3KN3 A;  3D4G A;  3K2D A;  1B5I A;  1HSE A;  2H99 A;  1B5H A;  4IGR A;  4JWO A;  4WED A;  4R6H A;  4R9F A;  2D5W A;  3TZA A;  5H8H B;  5TPA A;  1MXU A;  2O6A A;  4U23 A;  3MPL A;  1OVB A;  3SEV A;  4LZ7 A;  4NED A;  1MQJ A;  1M5C A;  3THI A;  1B46 A;  1UQW A;  1SW4 A;  2HAU A;  1MY3 A;  2Q9T A;  5A5X A;  4NF6 B;  4GWO A;  4OET A;  1SI1 A;  1POY 1;  3MVZ A;  2V3T A;  2QMW A;  2RF1 A;  5K2Y A;  3MAM A;  3SEW A;  4JDF A;  4OFO A;  1P99 A;  5M2V A;  4IO3 A;  5AA2 D;  1HSJ A;  3F11 A;  1IXI A;  3MVX A;  3FVK A;  3PGF A;  3EF7 A;  3VXB A;  2YPN A;  3IJO B;  3LSL A;  5I56 A;  1MXX A;  1B3F A;  4H6D A;  1MY0 A;  1UIU A;  2A5T A;  3MW0 A;  1JET A;  4YB7 A;  2H4I A;  1LLS A;  2F6G A;  4K3F A;  2REG A;  5DVF A;  3PUW E;  3O97 A;  4PE5 B;  1NNF A;  1UIV A;  3KG2 A;  4YKI A;  1SDX A;  3USD A;  4R73 A;  2V3Q A;  2XD3 A;  4LZ8 A;  1Y4T A;  4EQ7 A;  1O64 A;  2GFE A;  4KYS A;  3KJ7 A;  4H5G A;  2GHA A;  1AIV A;  5H8F A;  4OER A;  3OEL A;  4BDN A;  4LP2 B;  3FUZ A;  1JW4 A;  3M3F A;  4OTE A;  4JSD A;  3DLN A;  4I8C A;  5I2N A;  2FYI A;  3MJN A;  4R9G A;  2Y7I A;  4F2O A;  3TAJ A;  3QSL A;  2D3I A;  4WEP A;  1LGB C;  4ZDM A;  1A7L A;  4BDM A;  1D9V A;  1US5 A;  2XXY A;  1LBC A;  4HW8 A;  1R9L A;  3SET A;  5KDT B;  1DSN A;  4X9T A;  1TXF A;  3CSG A;  3RQT A;  2R6G E;  3N5L A;  1XVY A;  1J1N A;  5CC2 A;  3C36 A;  4GF8 A;  1Y9U A;  4DXU A;  3QUF A;  1MXY A;  2DE4 A;  4U1Z A;  3UP9 A;  4OQO A;  4PET A;  4ECF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...