4H6DA

Crystal structure of plp-soaked hmp synthase thi5 from s. cerevisiae
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
335
structure length
314
Chain Sequence
DKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDMAILEPTNPSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITKSFQSLKGKKIGYVGEFGKIQIDELTKHYGMKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECMQQVELEEYLAKQGRPASDAKMLCCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWKEYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNEYLSWPEPEDPLEATRLMAGTFKRLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pyrimidine precursor biosynthesis enzyme THI5
publication title The Last Piece in the Vitamin B1 Biosynthesis Puzzle: STRUCTURAL AND FUNCTIONAL INSIGHT INTO YEAST 4-AMINO-5-HYDROXYMETHYL-2-METHYLPYRIMIDINE PHOSPHATE (HMP-P) SYNTHASE.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 115
structure length 314
sequence length 335
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h6dA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h6dA01
1OVTA 3MC2A 4LZ7A 4BDRA 2GHAA 2X7PA 4YB6A 4PFWA 3BBRA 3OO7A 5I58B 2ZNTA 3MBPA 2V3QA 3OXNA 5A5XB 1FTOA 2WKYA 3LC8A 3G3HA 3MZBA 3TZAA 4MF3A 3FXQA 5BWJA 2RKMA 4MH5A 4DLDA 3RN8A 4IY5A 4R74A 3JV9A 2XXUA 3VXBA 3BFTA 4HCWA 4GXAA 1WVJA 1B7UA 3VVFA 1Y3QA 1P1UA 4ESXA 4P11A 1A7LA 4RK9A 5FHNA 4GQOA 1NL5A 3LSXA 4NF4A 4ZEKA 5AA1A 2DSFA 4G8HA 1FQBA 4F22A 1B58A 3EHTA 4DXCA 3K1MA 3B6QA 1NFTA 1P1QA 1MDQA 1DTZA 5J1DA 3TTLA 2I58A 2NXOA 1B5HA 4IO6A 2DWHA 2AL4A 2Q88A 5FHMA 5IKBA 1HSJA 3CRBA 1R9LA 3CIJA 3Q27A 4I8CA 4UA8A 4R9GA 3H6WA 3K0VA 3KJTA 1ZLQA 4KYDA 3THIA 4MBPA 4GF8A 4FORA 3QUJA 1Z7NE 2QS1A 3CG3A 3MW0A 2QSXA 4KCCA 3H6UA 2XXXA 3UK4A 2XXIA 3S2VA 3EHSA 3OELA 3SEXA 1PB8A 5CI5A 1FW0A 4I1DA 3RGYA 1LAGE 4LZ8A 2R71A 1YCJA 1SW4A 3PMXA 2XHDA 1MPDA 3T96B 3VXCA 2XXQA 3VVDA 3O29A 4ZEBA 5DT6A 4KD5A 2P0SA 2PX1A 4XKRA 3LSFB 2DP8A 4WEDA 3TTNA 2KLFA 1IEJA 3FUZA 1A54A 1D9YA 4NE4A 2NOOA 3T93B 3G3KA 1PC3A 5L9SA 3MUQA 3KG2A 5JTYB 4DCYA 1JW5A 2E0SA 2F36A 4FEDA 2F7AA 4XKPA 3MZ9A 1LAHE 4PP0A 5TPAB 4F1VA 5ITPA 1DPPA 4HW8A 2CMOA 1BP5A 4RYAA 1LFHA 5CMKA 2UYEA 3JYRA 3FVNA 4H5FA 3E4RA 2I4BA 4LQ5A 3RQTA 1QUIA 4O3AA 1JEVA 1LBBA 4R72A 3HN0A 3IB1A 3L6GA 4F1UA 1SW2A 3PPOA 4OYVA 4FEBA 2QS2A 5CM6A 3IR1A 4MLQA 3KOTA 4BDNA 1LAXA 3UN6A 4G8MA 1QJMA 3N5LA 1JQFA 3TAJA 3A09A 2X26A 2ESNA 1RKMA 3QK6A 4X9TA 4POXA 5EHSA 4H8IA 3T22A 1H44A 1FQCA 3IL1B 3LBSA 2V93A 1ZIUA 2PT2A 1B2HA 3U8QA 3K1PA 3S9LC 4GIZA 4POWA 4G2ZA 1N04A 2H98A 1QKBA 1TFDA 3EF7A 5F7VA 3WAFA 1AMFA 1RYXA 1GV8A 4F1YA 4F3PA 4QFOA 2FA7A 3UA8A 3IOVA 1UIVA 5DEXA 4R2BA 3V83A 1OQHA 1KWHA 3H6TA 4C1UA 1Z7ME 3C31A 4GLIA 2ANJA 1PB7A 1B3HA 1B5JA 4EUOA 3O9PA 4FATA 3B7DA 4K3FA 1DMBA 2VGQA 3H7MA 2DS9A 2V25A 5I56B 2Y7KA 2RINA 1D4NA 3OO9A 1QUJA 4F19A 4JWXA 1SYHA 2DE4A 4RK2A 1B46A 5AA2D 4BLAA 1LCFA 2ZXTA 2V84A 3C34A 2ONKE 2XXHA 4M1VA 1MM7A 2VP1A 1CE2A 3QYTA 4U1ZA 4PFTA 1PEBA 2OBGA 3EQ1A 3N6TA 4HS7A 3I6VA 1USYH 4N6PA 1MQIA 2F35A 1S9TA 2HZLA 1R1NA 1M5FA 2F8DA 3E13X 2E1SA 4FECA 4GFRA 4KHZE 5KZTA 2HAVA 1MY3A 2VOZA 1N0TA 3UP9A 4X1DA 4P0IA 5I2KA 4OHNA 3KEIA 3BKIB 2OCUA 4L17A 4NF4B 3RUMA 1M5BA 1B51A 1GVCA 3S4UA 1EZPA 4YKPA 3TYHA 1OLCA 3HO7A 2REJA 3KSJA 3U93A 1B7HA 4F18A 4U21A 4U1OA 1AL3A 1UTHA 5HBCA 1P99A 2QRYA 2B3FA 3EPEA 3FJ7A 3TCFA 2M8CA 1Y20A 4XTCQ 3B6TA 1UIUA 4R6HA 1XT8A 1FTMA 2RC9A 3C36A 4ZEFA 2OWSA 2VD3A 1B4ZA 2QMXA 2DQVA 4EF1A 2XXRA 3H3GA 4F31B 4DCXA 2HQ0A 2ZYKA 5FHOA 4MLVA 3RTFB 3QAXA 3HHGA 3O6HA 2REGA 2HXWA 3CFLA 3V5AA 4JWYA 2HCAA 3T9HB 3H06B 4OFOA 3TELA 3N6UA 1FQEA 4WXJA 3TCHA 1XS5A 4ONYA 2UVIA 2UVGA 1N84A 4IO4A 3VFJA 1BIYA 2F34A 4HCYA 3PMWA 1A55A 1NKXA 3R6UA 2Y7WA 1XVXA 4HTGA 3OSQA 4GXSB 4ZZEA 5TP9A 1FQDA 2DYXA 5ICQA 2PT1A 3MJNA 4YKKA 5I56A 4ZECA 5AA4B 2Q2CA 1MS7A 4JB7A 2O1MA 3C32A 1YAEA 4XKNA 5H8HA 3FZVA 5CBSA 1P1NA 1VFEA 4JBZA 3TTRA 3O28A 2D21A 2GRVA 2OLBA 4ELOA 2O7UA 1Y4CA 4G8NA 5CMBA 3KSXA 4G77A 1MM6A 2THIA 1Q1KA 2XXVA 3PD8A 1OIBA 3IK6B 4ESWA 4GRKA 2A5SA 1FTKA 2OJTA 3M3KA 5IAIA 3FV1A 2PBWA 4QRZA 4IO3A 2ZYNA 3SETA 2HFBA 4OVJA 3T9XB 4NWDA 3LR1A 3ECRA 4NWCA 3U92A 4DXBA 1R9QA 4QHQA 2Z8FA 4LVQA 1LGBC 4OMBA 2A5TA 4WEPA 1MQHA 1ZJLA 3TTMA 5I59A 4U22A 3IORA 1O7TA 1PB9A 4F3GA 3H4ZA 3IX1A 1B52A 1SD3A 2IEEA 3CVGA 2XXYA 1ZBMA 1USYE 4LONB 4RNSA 2UVHA 3CI8A 4RXLA 3AXFA 1D9VA 2Z23A 3Q28A 5B7DA 2VHAA 1CB6A 3MQ9A 3PUWE 5DEXB 4U23A 2DXRA 4OEVA 1QW0A 4YB7A 2F7BA 2G29A 4EF2A 4JSDA 3MVYA 5CBRA 4IO2A 4DZ1A 3EHUA 3FJMA 2OK2A 1O64A 2W7YA 3BFUA 4IGRA 3ONMA 5H8QB 3MP8A 1B6HA 3C4MA 5L9MA 1D3KA 3Q26A 3ZKLA 1IUDA 1LAFE 1F9BA 1FTJA 4QFNA 2XXWA 4PETA 4NF8B 3K6XA 4F2QA 1N3XA 3RLFE 2XX8A 3ILUB 4LP2B 4RJZA 5H8FA 4H67A 4EQBA 3C35A 1EZ9A 2I49A 2DOJA 2DWAA 2F97A 4YU0A 5AA4A 1O63A 5JK4A 4GVOA 4EDPA 2F78A 5JEIA 3IJXB 3PU5A 1MQDA 4YICA 3Q29A 5I2KB 5FTIA 5K2YA 3G3FA 3GLBA 2ABHA 4I62A 4OFLA 1Y4TA 4YKIA 1I6QA 4RPNA 3FASA 1ELJA 5H8NB 1P1WA 2I3VA 4G4PA 3W15C 4OZ9A 2IA4A 3L6HA 1MXZA 4EQ9A 3U1OA 3TCGA 3MAMA 2DVCA 4NF5A 1UTHB 2ZNUA 3QXMA 1IXGA 3UGWA 2I0BA 3OENA 3QIMA 4FAJA 4H5GA 1QKAA 3VE1B 2LAOA 2Z8EA 1DOTA 2Q8JA 2F6PA 3FVGA 3TFLA 3GBBA 3SKPA 4ELQA 4Q30B 5AA3A 1FQAA 1MXXA 3S9EA 3MVWA 5FTHA 1A8FA 3U94A 2FNCA 4QF9A 4H6DA 5H8SA 2I48A 3OSRA 3VLVA 1MRPA 1LFGA 2B3BA 4Z7EA 5ICTA 2H4IA 1SI0A 2O68A 5M2VA 4KI0E 4TLLB 3TQWA 1AOVA 2AYSA 4XXUA 2NVUB 1OQGA 4I9DA 5TP9B 3ZSFA 1FTLA 4JWOA 4IO5A 1JVYA 3VDFA 4PFUA 3TEPA 1LB9A 3M8UA 3CSBA 1GTKA 1BTJA 4EQ7A 1IXIA 5H8QA 5CMCA 4LQ2A 4TOZA 4E0WA 2F7CA 1UQWA 1US4A 2PVUA 5H8HB 2RC7A 4KQPA 1IITA 1JNFA 2CZLA 3OOAA 1B3EA 3VVEA 4NF8A 3ZS6A 4OERA 3KOSA 1RYOA 4O3CA 5L8DA 1DPEA 4OQOA 3O2AA 4WKMA 3K6VA 1JW1A 4OFJA 3K4UA 4YMBA 1NNFA 5CRYA 3IOUA 3K01A 1URSA 3SEYA 1ZKBA 2V3TA 1QVSA 3PMVA 4ECFA 4IB2A 1NMUA 3RT6B 1JVXA 2A5TB 2QJEA 2GFEA 2D3IA 3MVZA 3PUYE 3E3KA 5F1QA 3DELB 1POTA 5I59B 5H8NA 1B32A 3PPNA 3EN3A 3Q25A 1OMPA 2H99A 2Y7IA 2QPQA 1M5EA 4H65A 3T9UA 4ZE9A 1B05A 1LBCA 4R75A 1B3GA 4E0XA 1LFIA 3O66A 4KYSA 1WDNA 1IQ7A 2DVZA 4KR5A 1S7YA 2B65A 1II5A 1IXHA 3MPLA 4IO7A 4TQUQ 1NNPA 4ZZAA 3T66A 1B3FA 1B40A 2DWIA 3FXUA 2Y7PA 3PD9A 3IO4A 2UYFA 1B3LA 1TWYA 2ONSA 1LB8A 3D4CA 4DIGA 4PFYA 2NWJA 5I2NA 3PUVE 1LCTA 4R9FA 3CFXA 3FV2A 1AH5A 5CMMA 5LOMA 4ZEDA 4JXIA 1FQFA 1XHYA 3PGFA 1BLFA 4YZZA 5KDTA 1M5DA 3MP1A 3OO8A 1VFDA 4EXLA 5H8FB 5BUUA 1N7WA 1SW1A 2V3UA 3A3UA 4F29A 2XX9A 4OESA 2Z8DA 4QSDA 3DLNA 1LSTA 3G7WA 3SEVA 1T0KA 2FYIA 1FCKA 4X1BA 1Y1ZA 1ATGA 2G93A 1DSNA 1PBQA 3IAZA 4H1XA 3CR9A 2DE3A 3I3VA 4NEDA 4BDLA 1MH3A 1J1NA 2ZYMA 4Q5TA 3W9WA 5AA2A 2ONRA 2XXPA 2PMSA 3TTKA 3GXAA 3OMBA 2I6EA 4NF5B 3MPKA 1OVBA 4GL8A 1N3WA 2DE2A 4GWOA 1MXWA 3ZKKA 3SERA 3S9NC 4F3BA 2XX7A 4NMYA 3PV0E 4R73A 3OEMA 3K00A 1NH8A 3JZJA 2H25A 1B4HA 5B70A 1Y9UA 1B1XA 2RCAA 4FE8A 4M4GA 2DXYA 2QL3A 4G68A 1VE4A 2RF1A 3MVXA 3K6WA 5TU0A 3TPAA 3FVOA 5I57B 3A3CA 2I4CA 3IB2A 2R9JA 3FJGA 4NF6B 3OO6A 1MG1A 4Q8RA 2F5XA 4KCDA 4U4XA 5DTBA 2Q2AA 5DVIA 1YPNA 1MPCA 3R26A 1EH3A 1POY1 3UORA 4AQ4A 3HCQA 1AIVA 2BJJX 4BDOA 2R6GE 3M3FA 1H76A 4ZS9A 1B7ZA 4JSOA 1SW5A 4P0GA 3GZGA 4RA1A 4JDFA 4ELPA 4YKJA 2YLNA 2PYYA 2O84X 4MFIA 1ANFA 1IIWA 5ISUA 4YMAA 3CSGA 1MXVA 4ZEIA 3ILTB 3IJOB 3V8XB 3TDJA 3I5OA 3MZ1A 1EU8A 3OD7A 5DVFA 1BKAA 1ZMGA 1MY4A 3IOWA 1B5IA 1VSOA 1JW4A 3LUYA 1SVXB 1B0HA 5HPQA 3C33A 4Z0IA 1I6BA 3KN7A 4ND9A 5KCJB 2I0CA 3OEKA 1VR5A 2Y7RA 3SEWA 1HSLA 2P1SA 1MH4A 4BDQA 3H03A 1B1HA 2H9BA 3KGCA 4RY1A 4AB5A 4XKQA 1B9JA 4O3BA 1A99A 3GBAA 4ZE8A 4Q0CA 3O97A 3USDA 2ZMBA 2XD3A 1IZ1A 3TKDA 1URGA 3QSLA 3IOTA 5I58A 3E9XA 2HEUA 3FVKA 2Q89A 1EZOA 4AB6A 1UTBB 1TT1A 1SI1A 3H6VA 5A5XA 3CFZA 4OETA 3V89B 3O6GA 1A40A 3WAEA 3RY3A 4LA9A 4OENA 4TLMB 4U2RA 4F3SA 1QULA 1HSEA 1MY2A 3LSLA 3PPPA 3SDFA 1H43A 4H8JA 1B0LA 3RTWB 1I6AA 1MXUA 3PUXE 4LUBA 1N7XA 1QUKA 4OEUA 5I2NB 1NNTA 2F6GA 3FATA 5I57A 1MDP1 4OTEA 5CC2A 3FGSA 2YJPA 3RPWA 4NF6A 4GD5A 4YB5A 3HSTA 3D4GA 1JEUA 4C1TA 3G3JA 4ZDMA 3SEUA 4IGTA 5KDTB 3DP8A 1LLSA 4UACA 1PBPA 3UIFA 3S9MC 3W9VA 1PDAA 3RT8A 4GOTA 2D5WA 5DYHA 1TXFA 1S50A 2O6AA 3TODA 3IO6A 1MQJA 1I69A 4QSEA 3KN8A 2AIXA 2Y84A 3G3GA 1A8EA 2X7QA 1XVYA 1M5CA 4PE5B 2ZNSA 1OLAA 3HHFA 4R6KA 3C9HA 4DXUA 2O69A 3PUZE 1Y3NA 4F2OA 3FIRA 4LATA 4THIA 1N76A 3LSWA 4QSCA 4R6YA 3KFMA 2GHBA 3VV5A 5EHMA 4QFKA 5AA2B 4R2FA 3VLUA 5KCJA 5I84A 4OXVA 4OWDA 2VD2A 4ISUA 1SDXA 2ZYOA 2HZKA 4YAHX 1Y3PA 4QFPA 1SBPA 5DVJA 1ZU0A 1H45A 2HAUA 3KZGA 4F39A 4LZ5A 4DDDA 3M3LA 1L5TA 3B6WA 1MY0A 4KPTA 3KN3A 4PQJA 1Q35A 3PPQA 3DM0A 3F11A 1DTGA 2OZZA 1H3DA 1URDA 1SYIA 3DP6A 1IXCA 1NH7A 3DP4A 5JTYA 2ALUA 3ODBA 1SQYA 4QFLA 4KFQA 3T9VA 4G68B 3HV1A 1US5A 5TPAA 1ZTYA 5HM4B 2NUVA 2O7IA 3MWBA 3P7IA 4BDMA 2UVJA 1UTBA 2AL5A 4N13A 2YPNA 2DWJA 3O6IA 2QS4A 5K2XA 3KJ7A 4X48A 2RCBA 4EXKA 4KYEA 2XD2A 3G3IA 3HPIA 1R6ZA 4NTLA 4H0WA 2P2AA 2GH9A 5EYFA 1MPBA 3K1NA 3TUSA 4GL0A 3FD3A 2Q9TA 2QS3A 5ELVA 3CG1A 4FIMA 3K2DA 1GGGA 1Y1MA 2UXAA 1TFAA 2O51A 1MY1A 2H5YA 4DE8A 4FJPA 3MP6A 3N94A 2XXTA 3FXRA 3PPRA 3K02A 1XOCA 1P1OA 3IB0A 3SESA 2O1LA 1JETA 1MXYA 1YTVA 3RNNA 3KBRA 3R7XA 5ITOA 3TQLA 3U72A 2I3WA 1GR2A 3K6UA 1MQGA 4U4SA 5AE4A 5L9OA 2RC8A 3QUFA 3VLWA 4IY6A 1XC1A 4ELRA 1WODA 4C0RA 4RPOA 2OWTA 2Z22A 3N26A 4XIGQ 4N07A 4G68C 3TMGA 2QMWA 1NNKA
chains in the Genus database with same CATH superfamily
1OVTA 3MC2A 2B4LA 4LZ7A 4BDRA 2GHAA 2X7PA 4YB6A 4PDDA 1NV7A 3MSTA 4PFWA 3BBRA 3OO7A 5I58B 2ZNTA 3MBPA 2V3QA 3LUZA 1NV5A 3OXNA 4OVPA 2MKZA 5A5XB 2JJKA 1FTOA 2WKYA 3LC8A 3G3HA 3MZBA 3TZAA 4MF3A 4IR8A 3FXQA 5BWJA 2RKMA 4MH5A 4PC9A 4DLDA 3RN8A 4IY5A 4R74A 3JV9A 2XXUA 3VXBA 3BFTA 4HCWA 4P1EA 4GXAA 1WVJA 1B7UA 2WX9A 3VVFA 2VT5A 2CZKA 1Y3QA 1P1UA 4ESXA 4P11A 1A7LA 4RK9A 3PTYA 4GBVA 5FHNA 4GQOA 1NL5A 3LSXA 4NF4A 4ZEKA 5AA1A 2FVZA 2DSFA 4G8HA 1FQBA 4F22A 1B58A 3EHTA 4DXCA 3K1MA 2XXKA 3B6QA 1NFTA 1P1QA 1MDQA 1DTZA 5J1DA 3TTLA 2I58A 2NXOA 1B5HA 4IO6A 2DWHA 4I40A 2AL4A 2Q88A 5FHMA 5IKBA 1HSJA 1Q9DA 3CRBA 4N15A 1R9LA 3CIJA 3Q27A 4I8CA 4UA8A 4LN5A 4R9GA 1LBZA 3H6WA 3K0VA 3KJTA 1ZLQA 1LEVA 4KYDA 1FBPA 3THIA 4MBPA 4GF8A 4FORA 3QUJA 1Z7NE 2QS1A 4DI4B 1D9QA 3CG3A 1IMAA 3MW0A 2QSXA 4KCCA 3H6UA 2XXXA 3UK4A 2XXIA 3S2VA 3IFAA 3EHSA 3OELA 3SEXA 1PB8A 4HE2A 5CI5A 1FW0A 4I1DA 3RGYA 1LAGE 4PTKA 1IMDA 4LZ8A 2R71A 1YCJA 1SW4A 3PMXA 2XHDA 2FHYA 4OVTA 1MPDA 4N91A 3T96B 3VXCA 2XXQA 2XA5A 3VVDA 3O29A 1SPIA 4ZEBA 5DT6A 4KD5A 2P0SA 2PX1A 4XKRA 3LSFB 2DP8A 4WEDA 3TTNA 4P56A 2KLFA 1FPIA 1IEJA 3FUZA 1FBFA 1A54A 1D9YA 4NE4A 2NOOA 3T93B 3G3KA 1PC3A 5L9SA 3MUQA 1DBZA 3KG2A 5JTYB 4DCYA 1JW5A 3QMFA 2E0SA 2F36A 4FEDA 2F7AA 4XKPA 3MZ9A 1LAHE 4PP0A 5TPAB 4F1VA 5ITPA 1DPPA 4HW8A 2CMOA 1BP5A 4RYAA 1LFHA 5CMKA 2UYEA 3A29A 4NQ8A 3JYRA 2Q8MA 3FVNA 4H5FA 3E4RA 2I4BA 4LQ5A 3RQTA 1QUIA 4O3AA 1JEVA 3RPLA 1LBBA 4R72A 3HN0A 4OVSA 3IB1A 3L6GA 4F1UA 1SW2A 3PPOA 2PFZA 4OYVA 3KC1A 4FEBA 2QS2A 5CM6A 3IR1A 4JVDA 4MLQA 4NF0A 3ROJA 3KOTA 4BDNA 1LAXA 3UN6A 4G8MA 1QJMA 3N5LA 1JQFA 3TAJA 3A09A 2X26A 2VPOA 2ESNA 1RKMA 3QK6A 4X9TA 1INPA 4POXA 5EHSA 4H8IA 3T22A 1H44A 1FQCA 3IL1B 3LBSA 2V93A 1ZIUA 2PT2A 5IZ3A 3KBZA 1B2HA 3U8QA 3K1PA 5EYGA 3S9LC 4GIZA 4POWA 4G2ZA 1N04A 2H98A 1QKBA 1TFDA 3EF7A 5F7VA 3WAFA 1AMFA 1RYXA 2Y5KA 1GV8A 4F1YA 4F3PA 4QFOA 4GBWA 2FA7A 3UA8A 3IOVA 1UIVA 5DEXA 4R2BA 3V83A 1OQHA 1KWHA 3H6TA 5F24A 4C1UA 1Z7ME 3C31A 2HXRA 4GLIA 2ANJA 1PB7A 1B3HA 4PAKA 1B5JA 4EUOA 3O9PA 4FATA 3B7DA 4N17A 3CHGA 2OX3A 4K3FA 1DMBA 2VGQA 3H7MA 2DS9A 2V25A 5I56B 2Y7KA 2RINA 1D4NA 3OO9A 1QUJA 4F19A 4JWXA 1SYHA 4P47A 2DE4A 4RK2A 1B46A 5AA2D 4NX1A 4BLAA 1LCFA 2ZXTA 2V84A 3C34A 2ONKE 2XXHA 3BIGA 4PF8A 4M1VA 1MM7A 2VP1A 1CE2A 3QYTA 4XF5A 4U1ZA 2P3VA 4OANA 4PFTA 1PEBA 2OBGA 4GX6A 3EQ1A 3N6TA 4HS7A 5I7IA 4DI3D 3I6VA 1USYH 1FBCA 4N6PA 1KZ8A 1MQIA 2F35A 1S9TA 2HZLA 1R1NA 1M5FA 2F8DA 3E13X 2E1SA 4FECA 4GFRA 4KHZE 5KZTA 2HAVA 1MY3A 4PBQA 2P3NA 2VOZA 1N0TA 3UP9A 4X1DA 4PGNA 4P0IA 4XFEA 5I2KA 4OHNA 3KEIA 3BKIB 2OCUA 4L17A 4NF4B 3RUMA 3BIHA 1M5BA 1B51A 4H46A 1GVCA 3S4UA 1EZPA 4YKPA 2QVRA 3TYHA 1OLCA 3HO7A 2REJA 3KSJA 1NV1A 4MNPA 1NV3A 3U93A 4N4UA 5IGAA 1B7HA 4F18A 4U21A 4U1OA 1AL3A 1UTHA 5HBCA 1P99A 4OA4A 2QRYA 2B3FA 1K9YA 3EPEA 3FJ7A 3TCFA 2M8CA 1Y20A 4XTCQ 3B6TA 1UIUA 4R6HA 1XT8A 1FBEA 1FTMA 2RC9A 3C36A 4ZEFA 2OWSA 2VD3A 1B4ZA 2QMXA 2DQVA 4EF1A 2ZZXA 2XXRA 3H3GA 1KA0A 4F31B 4DCXA 2HQ0A 3U65A 2ZYKA 2CEXA 1FPFA 5FHOA 4MLVA 3RTFB 3QAXA 3HHGA 3O6HA 4UABA 2REGA 2HXWA 2PCRA 3CFLA 3V5AA 1LBVA 4JWYA 3E79A 4P8BA 2HCAA 3T9HB 4GWZA 3H06B 4OFOA 3TELA 3N6UA 1FQEA 4WXJA 3TCHA 1XS5A 4ONYA 2UVIA 2UVGA 1N84A 4IO4A 3VFJA 1BIYA 2F34A 4HCYA 1BK4A 3PMWA 1A55A 1FBHA 1NKXA 3R6UA 2Y7WA 1XVXA 4HTGA 3OSQA 4GXSB 4ZZEA 5TP9A 1FQDA 2R8TA 4GWYA 2DYXA 5ICQA 2PT1A 3MJNA 4YKKA 5I56A 4ZECA 5AA4B 2Q2CA 2F3BA 1MS7A 4JB7A 1FPJA 2O1MA 3C32A 1YAEA 5ESYA 4XKNA 5H8HA 3FZVA 5CBSA 1P1NA 2CZHA 2WYKA 1VFEA 4JBZA 3TTRA 3O28A 2D21A 2GRVA 2OLBA 4ELOA 2O7UA 1Y4CA 3SZPA 4G8NA 5CMBA 4P9KA 2HHMA 3KSXA 4G77A 1MM6A 2THIA 1Q1KA 2XXVA 3PD8A 1OIBA 3IK6B 4MHFA 4ESWA 4GRKA 2A5SA 1FTKA 3RPLB 2OJTA 3M3KA 5IM2A 5IAIA 4FBPA 3FV1A 2PBWA 4QRZA 4IO3A 2ZYNA 1FPGA 3SETA 2HFBA 4OVJA 3T9XB 2OWZA 4NWDA 3LR1A 3ECRA 4NWCA 3U92A 4DXBA 1R9QA 2F3DA 4QHQA 2Z8FA 4LVQA 4QXDA 1LGBC 4OMBA 1FTAA 2A5TA 4WEPA 1MQHA 1ZJLA 3TTMA 5I59A 4U22A 3IORA 1O7TA 1PB9A 4F3GA 3H4ZA 3B8BA 3IX1A 1B52A 5IZ3B 2QVVA 1SD3A 4PGPA 2IEEA 3CVGA 2XXYA 1ZBMA 1USYE 4LONB 4RNSA 2UVHA 3CI8A 3HFUA 4RXLA 3AXFA 1D9VA 2Z23A 3Q28A 5B7DA 2VHAA 3ISPA 1CB6A 3MQ9A 3PUWE 5DEXB 4U23A 2DXRA 4OEVA 1QW0A 3KC0A 4YB7A 2F7BA 2G29A 4EF2A 4JSDA 4O94A 3MVYA 5CBRA 4IO2A 4DZ1A 3EHUA 3FJMA 2WBBA 2OK2A 5EQAA 1O64A 2Y5LA 2W7YA 3BFUA 4IGRA 3T0JA 3ONMA 5H8QB 3MP8A 1B6HA 1AWBA 3C4MA 5L9MA 4MJOA 1D3KA 4PCDA 3Q26A 3ZKLA 1IUDA 1LAFE 4P1LA 1F9BA 1FTJA 4QFNA 2XXWA 1NUXA 4PETA 4NF8B 2QMWA 3K6XA 4F2QA 4MEVA 1N3XA 2XX8A 3RLFE 3ILUB 4LP2B 1FBGA 4RJZA 5H8FA 4H67A 2XWKA 4EQBA 4PAIA 3C35A 1EZ9A 2I49A 2DOJA 2DWAA 2F97A 4YU0A 5AA4A 1O63A 5JK4A 4GVOA 4EDPA 2F78A 5JEIA 3IJXB 3PU5A 1MQDA 4YICA 2L5VA 3Q29A 5I2KB 5FTIA 5K2YA 3G3FA 3T1BA 3GLBA 2ABHA 4I62A 4OFLA 1Y4TA 4YKIA 1LBYA 1I6QA 4RPNA 4H45A 3FASA 1FRPA 1ELJA 5I5PA 5H8NB 1P1WA 4O7MA 2I3VA 4G4PA 3W15C 4OZ9A 2IA4A 3L6HA 1MXZA 4EQ9A 3U1OA 3TCGA 3MAMA 3MYUA 2DVCA 4NF5A 1UTHB 2ZNUA 3QXMA 1IXGA 1CNQA 3UGWA 4O8MA 2I0BA 4GX3A 3OENA 3QIMA 4FAJA 4H5GA 1QKAA 4PDHA 3VE1B 2LAOA 2Z8EA 1DOTA 2Q8JA 4HXVA 4OVQA 2F6PA 3FVGA 3TFLA 1EYJA 3GBBA 3SKPA 4ELQA 4Q30B 5AA3A 1FQAA 1MXXA 4N8YA 3S9EA 3MVWA 5FTHA 1A8FA 2WEFA 3U94A 2FNCA 4QF9A 4H6DA 4AS5A 5H8SA 2I48A 3OSRA 3VLVA 1MRPA 1LFGA 2B3BA 4Z7EA 4PBHA 1FBDA 5A5LA 5ICTA 2H4IA 1SI0A 1IMBA 2O68A 1IMCA 1XI6A 4O7IA 5M2VA 4KI0E 4TLLB 3TQWA 1AOVA 2AYSA 4XXUA 2NVUB 1OQGA 4I9DA 5TP9B 3ZSFA 1FTLA 4JWOA 4IO5A 1JVYA 3VDFA 1YZ0A 4PFUA 3TEPA 1LB9A 3M8UA 3CSBA 1GTKA 1BTJA 4EQ7A 1IXIA 5H8QA 5CMCA 4LQ2A 4TOZA 4E0WA 2F7CA 1UQWA 1US4A 2PVUA 5H8HB 2RC7A 4KQPA 1IITA 1JNFA 2CZLA 3OOAA 1B3EA 3VVEA 4NF8A 3ZS6A 4OERA 4GWWA 3KOSA 1RYOA 4O3CA 5L8DA 1DPEA 4OQOA 3O2AA 4WKMA 3K6VA 1JW1A 4OFJA 4X04A 3K4UA 4YMBA 1NNFA 5CRYA 3IOUA 3K01A 1URSA 3SEYA 1G0HA 1ZKBA 4I3YA 2V3TA 1QVSA 3PMVA 4ECFA 5I3SA 4AS4A 4IB2A 1NMUA 3RT6B 1JVXA 2A5TB 2QJEA 2GFEA 2D3IA 3MVZA 3PUYE 5EQ7A 3E3KA 5F1QA 3DELB 5EYHA 1POTA 5I59B 5EQ8A 5H8NA 1B32A 3PPNA 3EN3A 4GX4A 3Q25A 5ET6A 1OMPA 2H99A 2Y7IA 2QPQA 1M5EA 4H65A 3T9UA 4ZE9A 1B05A 1LBCA 2PFYA 1KA1A 4R75A 1B3GA 4E0XA 1LFIA 3O66A 4KYSA 1WDNA 1FSAA 1EYKA 1IQ7A 2DVZA 4KR5A 2ZZVA 1EYIA 1S7YA 2B65A 1II5A 1IXHA 3MPLA 4IO7A 4TQUQ 1NNPA 4ZZAA 3T66A 1FJ9A 1B3FA 1B40A 2DWIA 3FXUA 2Y7PA 3PD9A 3IO4A 2UYFA 1B3LA 4P3LA 1TWYA 2ONSA 1LB8A 3D4CA 4DIGA 4PFYA 2NWJA 5I2NA 3PUVE 1LCTA 3GYYA 4GWSA 4R9FA 3CFXA 1RDZA 3FV2A 1AH5A 5CMMA 5LOMA 1K9ZA 4ZEDA 4JXIA 1FQFA 1XHYA 3PGFA 1BLFA 1DK4A 4YZZA 5KDTA 1M5DA 1NUZA 3MP1A 1RDXA 3OO8A 1VFDA 4EXLA 5H8FB 5BUUA 1N7WA 4OVRA 1SW1A 2V3UA 3A3UA 4F29A 2XX9A 4OESA 2Z8DA 4QSDA 3DLNA 1LSTA 5IZZA 3G7WA 2FBPA 3SEVA 4PE3A 1T0KA 2FYIA 3EKIA 1VDWA 4N8GA 1FCKA 4N6DA 4X1BA 1Y1ZA 1ATGA 2G93A 5ET7A 1PBQA 1DSNA 3IAZA 4H1XA 3CR9A 2DE3A 1FPKA 3I3VA 4NEDA 4BDLA 1MH3A 1J1NA 2ZYMA 4QBAA 4Q5TA 3W9WA 5AA2A 2ONRA 2XXPA 2PMSA 3TTKA 3GXAA 3OMBA 4NF5B 2I6EA 2WYPA 1OVBA 2ZZWA 3MPKA 1N3WA 4GL8A 2DE2A 4I3EA 2KR0A 4GWOA 1MXWA 4JVIA 3ZKKA 3SERA 1NI9A 3S9NC 4F3BA 5ET5A 2XX7A 4NMYA 2QFLA 3PV0E 4R73A 3OEMA 3K00A 1FPEA 1NH8A 3JZJA 2H25A 2WBDA 1DCUA 1B4HA 5EQ9A 5B70A 2DDKA 1Y9UA 1B1XA 2RCAA 4FE8A 4M4GA 2DXYA 2QL3A 2CEYA 4G68A 1VE4A 1QGXA 2RF1A 3MVXA 3K6WA 5TU0A 3TPAA 3FVOA 5I57B 3A3CA 2I4CA 3IB2A 2R9JA 3FJGA 4NF6B 3OO6A 1MG1A 4Q8RA 2F5XA 4MNIA 1IMFA 4KCDA 4U4XA 5DTBA 2Q2AA 5DVIA 1YPNA 1MPCA 3R26A 1EH3A 1POY1 3UORA 1RDYA 4AQ4A 3HCQA 1AIVA 2BJJX 1FPBA 1NV0A 4BDOA 2R6GE 3M3FA 1H76A 3D1RA 4ZS9A 1B7ZA 4JSOA 1SW5A 4P0GA 3GZGA 4RA1A 4JDFA 4ELPA 4YKJA 2YLNA 2PYYA 2O84X 4MFIA 1ANFA 3IFCA 4MIJA 1IIWA 5ISUA 2VPNA 4YMAA 3CSGA 1MXVA 4ZEIA 3ILTB 4PFRA 3IJOB 5LDZA 3V8XB 3TDJA 3I5OA 3MZ1A 1EU8A 1YXIA 3OD7A 5DVFA 1BKAA 1ZMGA 1MY4A 3IOWA 1B5IA 1VSOA 1JW4A 3LUYA 1SVXB 4NN3A 1B0HA 5HPQA 3C33A 4Z0IA 1I6BA 3KN7A 4ND9A 5KCJB 2I0CA 3OEKA 1VR5A 2Y7RA 3SEWA 2XWIA 1HSLA 2P1SA 1MH4A 4BDQA 3H03A 1B1HA 2BJIA 4JVCA 2H9BA 3KGCA 4RY1A 4PFIA 4AB5A 4XKQA 4KXPA 1B9JA 4O3BA 1A99A 3GBAA 4ZE8A 4Q0CA 3O97A 3USDA 2ZMBA 2XD3A 1IZ1A 3TKDA 1URGA 3QSLA 3IOTA 5I58A 3E9XA 2HEUA 3FVKA 2Q89A 1EZOA 4AB6A 1UTBB 4MNCA 1TT1A 1SI1A 3H6VA 5A5XA 3CFZA 4OETA 3V89B 3O6GA 1A40A 5T3JA 4MAGA 3WAEA 1YYZA 3RY3A 5FBPA 1IMEA 4LA9A 4OENA 4TLMB 4U2RA 4F3SA 1QULA 1HSEA 1MY2A 3LSLA 3PPPA 3SDFA 1H43A 4H8JA 1B0LA 3RTWB 1I6AA 1MXUA 3PUXE 4LUBA 1N7XA 1QUKA 4OEUA 5I2NB 1NNTA 2F6GA 3FATA 5I57A 4NHBA 1MDP1 4OTEA 5CC2A 3FGSA 2YJPA 3NOHA 4NF6A 3RPWA 4X8RA 4GD5A 1JP4A 2CZIA 4YB5A 3HSTA 3D4GA 1JEUA 5DW8A 4C1TA 2XWOA 3G3JA 4ZDMA 3SEUA 4IGTA 5KDTB 4N6KA 3DP8A 1LLSA 4UACA 1PBPA 3UIFA 3S9MC 3W9VA 1PDAA 3RT8A 1FJ6A 4GOTA 2D5WA 4MMPA 5DYHA 1TXFA 1S50A 2O6AA 3TODA 3IO6A 1MQJA 1I69A 4QSEA 3KN8A 2FIXA 2AIXA 4MX6A 2Y84A 3G3GA 1A8EA 2X7QA 1XVYA 1M5CA 4GWXA 4PE5B 5LTCA 1FPLA 2ZNSA 1OLAA 3HHFA 4R6KA 1NV2A 3C9HA 4DXUA 2O69A 3PUZE 1Y3NA 4F2OA 3FIRA 4LATA 4THIA 1N76A 3LSWA 4QSCA 4R6YA 3KFMA 4XEQA 2FIEA 5ET8A 2GHBA 3VV5A 5EHMA 4QFKA 5AA2B 4R2FA 3VLUA 5KCJA 5I84A 4OXVA 4OWDA 2VD2A 4ISUA 1SDXA 2ZYOA 2HZKA 1NV4A 4YAHX 1Y3PA 4NGUA 4QFPA 1SBPA 5DVJA 1ZU0A 1H45A 2HAUA 3KZGA 4F39A 4LZ5A 4DDDA 2GQ1A 3M3LA 1L5TA 1LBWA 3B6WA 1MY0A 4KPTA 3KN3A 4PQJA 1Q35A 3PPQA 2XWVA 4HE1A 3DM0A 3F11A 4HE0A 1DTGA 2OZZA 1H3DA 1URDA 1SYIA 3DP6A 2B4MA 1IXCA 1NH7A 3DP4A 5JTYA 2ALUA 3ODBA 1SQYA 4QFLA 4KFQA 3T9VA 4G68B 3HV1A 3RYDA 1US5A 5TPAA 1ZTYA 5HM4B 2NUVA 2O7IA 3MWBA 3P7IA 4BDMA 2HPGA 2UVJA 1UTBA 1FPDA 2AL5A 3B50A 4N13A 2QVUA 2DWJA 2YPNA 3O6IA 2QS4A 5K2XA 3FBPA 1NUWA 3KJ7A 4X48A 2RCBA 4EXKA 4KYEA 4PFBA 2XD2A 3G3IA 3HPIA 1R6ZA 3LV0A 4NTLA 4PAFA 2V4CA 4H0WA 2P2AA 2GH9A 5EYFA 1MPBA 3K1NA 4NAPA 3TUSA 4GL0A 3FD3A 2Q9TA 2QS3A 5ELVA 3CG1A 4FIMA 3K2DA 4MCOA 1GGGA 1Y1MA 3E78A 2UXAA 1TFAA 2O51A 1NUYA 1MY1A 2H5YA 4DE8A 5IZ1A 4FJPA 3MP6A 1NV6A 3N94A 5J16A 3FXBA 2XXTA 3FXRA 4GWUA 2Q74A 3PPRA 3K02A 1XOCA 1P1OA 3IB0A 3SESA 4N81A 2KQZA 4PF6A 2O1LA 1JETA 1MXYA 1YTVA 3RNNA 3KBRA 3R7XA 1LBXA 5ITOA 3TQLA 3U72A 2I3WA 1GR2A 3K6UA 1MQGA 4U4SA 5AE4A 5L9OA 4NG7A 2RC8A 3QUFA 3VLWA 4IY6A 1XC1A 1G0IA 4ELRA 1WODA 4C0RA 4RPOA 2OWTA 2Z22A 3N26A 4XIGQ 4N07A 4G68C 3TMGA 4G61A 1NNKA
chains in the Genus database with same CATH topology
1OVTA 3MC2A 4LZ7A 4BDRA 2GHAA 2X7PA 4YB6A 4PFWA 3BBRA 3OO7A 5I58B 2ZNTA 3MBPA 2V3QA 3OXNA 5A5XB 1FTOA 2WKYA 3LC8A 3G3HA 3MZBA 3TZAA 4MF3A 3FXQA 5BWJA 2RKMA 4MH5A 4DLDA 3RN8A 4IY5A 4R74A 3JV9A 2XXUA 3VXBA 3BFTA 4HCWA 4GXAA 1WVJA 1B7UA 3VVFA 1Y3QA 1P1UA 4ESXA 4P11A 1A7LA 4RK9A 5FHNA 4GQOA 1NL5A 3LSXA 4NF4A 4ZEKA 5AA1A 2DSFA 4G8HA 1FQBA 4F22A 1B58A 3EHTA 4DXCA 3K1MA 3B6QA 1NFTA 1P1QA 1MDQA 1DTZA 5J1DA 3TTLA 2I58A 2NXOA 1B5HA 4IO6A 2DWHA 2AL4A 2Q88A 5FHMA 5IKBA 1HSJA 3CRBA 1R9LA 3CIJA 3Q27A 4I8CA 4UA8A 4R9GA 3H6WA 3K0VA 3KJTA 1ZLQA 4KYDA 3THIA 4MBPA 4GF8A 4FORA 3QUJA 1Z7NE 2QS1A 3CG3A 3MW0A 2QSXA 4KCCA 3H6UA 2XXXA 3UK4A 2XXIA 3S2VA 3EHSA 3OELA 3SEXA 1PB8A 5CI5A 1FW0A 4I1DA 3RGYA 1LAGE 4LZ8A 2R71A 1YCJA 1SW4A 3PMXA 2XHDA 1MPDA 3T96B 3VXCA 2XXQA 3VVDA 3O29A 4ZEBA 5DT6A 4KD5A 2P0SA 2PX1A 4XKRA 3LSFB 2DP8A 4WEDA 3TTNA 2KLFA 1IEJA 3FUZA 1A54A 1D9YA 4NE4A 2NOOA 3T93B 3G3KA 1PC3A 5L9SA 3MUQA 3KG2A 5JTYB 4DCYA 1JW5A 2E0SA 2F36A 4FEDA 2F7AA 4XKPA 3MZ9A 1LAHE 4PP0A 5TPAB 4F1VA 5ITPA 1DPPA 4HW8A 2CMOA 1BP5A 4RYAA 1LFHA 5CMKA 2UYEA 3JYRA 3FVNA 4H5FA 3E4RA 2I4BA 4LQ5A 3RQTA 1QUIA 4O3AA 1JEVA 1LBBA 4R72A 3HN0A 3IB1A 3L6GA 4F1UA 1SW2A 3PPOA 4OYVA 4FEBA 2QS2A 5CM6A 3IR1A 4MLQA 3KOTA 4BDNA 1LAXA 3UN6A 4G8MA 1QJMA 3N5LA 1JQFA 3TAJA 3A09A 2X26A 2ESNA 1RKMA 3QK6A 4X9TA 4POXA 5EHSA 4H8IA 3T22A 1H44A 1FQCA 3IL1B 3LBSA 2V93A 1ZIUA 2PT2A 1B2HA 3U8QA 3K1PA 3S9LC 4GIZA 4POWA 4G2ZA 1N04A 2H98A 1QKBA 1TFDA 3EF7A 5F7VA 3WAFA 1AMFA 1RYXA 1GV8A 4F1YA 4F3PA 4QFOA 2FA7A 3UA8A 3IOVA 1UIVA 5DEXA 4R2BA 3V83A 1OQHA 1KWHA 3H6TA 4C1UA 1Z7ME 3C31A 4GLIA 2ANJA 1PB7A 1B3HA 1B5JA 4EUOA 3O9PA 4FATA 3B7DA 4K3FA 1DMBA 2VGQA 3H7MA 2DS9A 2V25A 5I56B 2Y7KA 2RINA 1D4NA 3OO9A 1QUJA 4F19A 4JWXA 1SYHA 2DE4A 4RK2A 1B46A 5AA2D 4BLAA 1LCFA 2ZXTA 2V84A 3C34A 2ONKE 2XXHA 4M1VA 1MM7A 2VP1A 1CE2A 3QYTA 4U1ZA 4PFTA 1PEBA 2OBGA 3EQ1A 3N6TA 4HS7A 3I6VA 1USYH 4N6PA 1MQIA 2F35A 1S9TA 2HZLA 1R1NA 1M5FA 2F8DA 3E13X 2E1SA 4FECA 4GFRA 4KHZE 5KZTA 2HAVA 1MY3A 2VOZA 1N0TA 3UP9A 4X1DA 4P0IA 5I2KA 4OHNA 3KEIA 3BKIB 2OCUA 4L17A 4NF4B 3RUMA 1M5BA 1B51A 1GVCA 3S4UA 1EZPA 4YKPA 3TYHA 1OLCA 3HO7A 2REJA 3KSJA 3U93A 1B7HA 4F18A 4U21A 4U1OA 1AL3A 1UTHA 5HBCA 1P99A 2QRYA 2B3FA 3EPEA 3FJ7A 3TCFA 2M8CA 1Y20A 4XTCQ 3B6TA 1UIUA 4R6HA 1XT8A 1FTMA 2RC9A 3C36A 4ZEFA 2OWSA 2VD3A 1B4ZA 2QMXA 2DQVA 4EF1A 2XXRA 3H3GA 4F31B 4DCXA 2HQ0A 2ZYKA 5FHOA 4MLVA 3RTFB 3QAXA 3HHGA 3O6HA 2REGA 2HXWA 3CFLA 3V5AA 4JWYA 2HCAA 3T9HB 3H06B 4OFOA 3TELA 3N6UA 1FQEA 4WXJA 3TCHA 1XS5A 4ONYA 2UVIA 2UVGA 1N84A 4IO4A 3VFJA 1BIYA 2F34A 4HCYA 3PMWA 1A55A 1NKXA 3R6UA 2Y7WA 1XVXA 4HTGA 3OSQA 4GXSB 4ZZEA 5TP9A 1FQDA 2DYXA 5ICQA 2PT1A 3MJNA 4YKKA 5I56A 4ZECA 5AA4B 2Q2CA 1MS7A 4JB7A 2O1MA 3C32A 1YAEA 4XKNA 5H8HA 3FZVA 5CBSA 1P1NA 1VFEA 4JBZA 3TTRA 3O28A 2D21A 2GRVA 2OLBA 4ELOA 2O7UA 1Y4CA 4G8NA 5CMBA 3KSXA 4G77A 1MM6A 2THIA 1Q1KA 2XXVA 3PD8A 1OIBA 3IK6B 4ESWA 4GRKA 2A5SA 1FTKA 2OJTA 3M3KA 5IAIA 3FV1A 2PBWA 4QRZA 4IO3A 2ZYNA 3SETA 2HFBA 4OVJA 3T9XB 4NWDA 3LR1A 3ECRA 4NWCA 3U92A 4DXBA 1R9QA 4QHQA 2Z8FA 4LVQA 1LGBC 4OMBA 2A5TA 4WEPA 1MQHA 1ZJLA 3TTMA 5I59A 4U22A 3IORA 1O7TA 1PB9A 4F3GA 3H4ZA 3IX1A 1B52A 1SD3A 2IEEA 3CVGA 2XXYA 1ZBMA 1USYE 4LONB 4RNSA 2UVHA 3CI8A 4RXLA 3AXFA 1D9VA 2Z23A 3Q28A 5B7DA 2VHAA 1CB6A 3MQ9A 3PUWE 5DEXB 4U23A 2DXRA 4OEVA 1QW0A 4YB7A 2F7BA 2G29A 4EF2A 4JSDA 3MVYA 5CBRA 4IO2A 4DZ1A 3EHUA 3FJMA 2OK2A 1O64A 2W7YA 3BFUA 4IGRA 3ONMA 5H8QB 3MP8A 1B6HA 3C4MA 5L9MA 1D3KA 3Q26A 3ZKLA 1IUDA 1LAFE 1F9BA 1FTJA 4QFNA 2XXWA 4PETA 4NF8B 3K6XA 4F2QA 1N3XA 3RLFE 2XX8A 3ILUB 4LP2B 4RJZA 5H8FA 4H67A 4EQBA 3C35A 1EZ9A 2I49A 2DOJA 2DWAA 2F97A 4YU0A 5AA4A 1O63A 5JK4A 4GVOA 4EDPA 2F78A 5JEIA 3IJXB 3PU5A 1MQDA 4YICA 3Q29A 5I2KB 5FTIA 5K2YA 3G3FA 3GLBA 2ABHA 4I62A 4OFLA 1Y4TA 4YKIA 1I6QA 4RPNA 3FASA 1ELJA 5H8NB 1P1WA 2I3VA 4G4PA 3W15C 4OZ9A 2IA4A 3L6HA 1MXZA 4EQ9A 3U1OA 3TCGA 3MAMA 2DVCA 4NF5A 1UTHB 2ZNUA 3QXMA 1IXGA 3UGWA 2I0BA 3OENA 3QIMA 4FAJA 4H5GA 1QKAA 3VE1B 2LAOA 2Z8EA 1DOTA 2Q8JA 2F6PA 3FVGA 3TFLA 3GBBA 3SKPA 4ELQA 4Q30B 5AA3A 1FQAA 1MXXA 3S9EA 3MVWA 5FTHA 1A8FA 3U94A 2FNCA 4QF9A 4H6DA 5H8SA 2I48A 3OSRA 3VLVA 1MRPA 1LFGA 2B3BA 4Z7EA 5ICTA 2H4IA 1SI0A 2O68A 5M2VA 4KI0E 4TLLB 3TQWA 1AOVA 2AYSA 4XXUA 2NVUB 1OQGA 4I9DA 5TP9B 3ZSFA 1FTLA 4JWOA 4IO5A 1JVYA 3VDFA 4PFUA 3TEPA 1LB9A 3M8UA 3CSBA 1GTKA 1BTJA 4EQ7A 1IXIA 5H8QA 5CMCA 4LQ2A 4TOZA 4E0WA 2F7CA 1UQWA 1US4A 2PVUA 5H8HB 2RC7A 4KQPA 1IITA 1JNFA 2CZLA 3OOAA 1B3EA 3VVEA 4NF8A 3ZS6A 4OERA 3KOSA 1RYOA 4O3CA 5L8DA 1DPEA 4OQOA 3O2AA 4WKMA 3K6VA 1JW1A 4OFJA 3K4UA 4YMBA 1NNFA 5CRYA 3IOUA 3K01A 1URSA 3SEYA 1ZKBA 2V3TA 1QVSA 3PMVA 4ECFA 4IB2A 1NMUA 3RT6B 1JVXA 2A5TB 2QJEA 2GFEA 2D3IA 3MVZA 3PUYE 3E3KA 5F1QA 3DELB 1POTA 5I59B 5H8NA 1B32A 3PPNA 3EN3A 3Q25A 1OMPA 2H99A 2Y7IA 2QPQA 1M5EA 4H65A 3T9UA 4ZE9A 1B05A 1LBCA 4R75A 1B3GA 4E0XA 1LFIA 3O66A 4KYSA 1WDNA 1IQ7A 2DVZA 4KR5A 1S7YA 2B65A 1II5A 1IXHA 3MPLA 4IO7A 4TQUQ 1NNPA 4ZZAA 3T66A 1B3FA 1B40A 2DWIA 3FXUA 2Y7PA 3PD9A 3IO4A 2UYFA 1B3LA 1TWYA 2ONSA 1LB8A 3D4CA 4DIGA 4PFYA 2NWJA 5I2NA 3PUVE 1LCTA 4R9FA 3CFXA 3FV2A 1AH5A 5CMMA 5LOMA 4ZEDA 4JXIA 1FQFA 1XHYA 3PGFA 1BLFA 4YZZA 5KDTA 1M5DA 3MP1A 3OO8A 1VFDA 4EXLA 5H8FB 5BUUA 1N7WA 1SW1A 2V3UA 3A3UA 4F29A 2XX9A 4OESA 2Z8DA 4QSDA 3DLNA 1LSTA 3G7WA 3SEVA 1T0KA 2FYIA 1FCKA 4X1BA 1Y1ZA 1ATGA 2G93A 1DSNA 1PBQA 3IAZA 4H1XA 3CR9A 2DE3A 3I3VA 4NEDA 4BDLA 1MH3A 1J1NA 2ZYMA 4Q5TA 3W9WA 5AA2A 2ONRA 2XXPA 2PMSA 3TTKA 3GXAA 3OMBA 2I6EA 4NF5B 3MPKA 1OVBA 4GL8A 1N3WA 2DE2A 4GWOA 1MXWA 3ZKKA 3SERA 3S9NC 4F3BA 2XX7A 4NMYA 3PV0E 4R73A 3OEMA 3K00A 1NH8A 3JZJA 2H25A 1B4HA 5B70A 1Y9UA 1B1XA 2RCAA 4FE8A 4M4GA 2DXYA 2QL3A 4G68A 1VE4A 2RF1A 3MVXA 3K6WA 5TU0A 3TPAA 3FVOA 5I57B 3A3CA 2I4CA 3IB2A 2R9JA 3FJGA 4NF6B 3OO6A 1MG1A 4Q8RA 2F5XA 4KCDA 4U4XA 5DTBA 2Q2AA 5DVIA 1YPNA 1MPCA 3R26A 1EH3A 1POY1 3UORA 4AQ4A 3HCQA 1AIVA 2BJJX 4BDOA 2R6GE 3M3FA 1H76A 4ZS9A 1B7ZA 4JSOA 1SW5A 4P0GA 3GZGA 4RA1A 4JDFA 4ELPA 4YKJA 2YLNA 2PYYA 2O84X 4MFIA 1ANFA 1IIWA 5ISUA 4YMAA 3CSGA 1MXVA 4ZEIA 3ILTB 3IJOB 3V8XB 3TDJA 3I5OA 3MZ1A 1EU8A 3OD7A 5DVFA 1BKAA 1ZMGA 1MY4A 3IOWA 1B5IA 1VSOA 1JW4A 3LUYA 1SVXB 1B0HA 5HPQA 3C33A 4Z0IA 1I6BA 3KN7A 4ND9A 5KCJB 2I0CA 3OEKA 1VR5A 2Y7RA 3SEWA 1HSLA 2P1SA 1MH4A 4BDQA 3H03A 1B1HA 2H9BA 3KGCA 4RY1A 4AB5A 4XKQA 1B9JA 4O3BA 1A99A 3GBAA 4ZE8A 4Q0CA 3O97A 3USDA 2ZMBA 2XD3A 1IZ1A 3TKDA 1URGA 3QSLA 3IOTA 5I58A 3E9XA 2HEUA 3FVKA 2Q89A 1EZOA 4AB6A 1UTBB 1TT1A 1SI1A 3H6VA 5A5XA 3CFZA 4OETA 3V89B 3O6GA 1A40A 3WAEA 3RY3A 4LA9A 4OENA 4TLMB 4U2RA 4F3SA 1QULA 1HSEA 1MY2A 3LSLA 3PPPA 3SDFA 1H43A 4H8JA 1B0LA 3RTWB 1I6AA 1MXUA 3PUXE 4LUBA 1N7XA 1QUKA 4OEUA 5I2NB 1NNTA 2F6GA 3FATA 5I57A 1MDP1 4OTEA 5CC2A 3FGSA 2YJPA 3RPWA 4NF6A 4GD5A 4YB5A 3HSTA 3D4GA 1JEUA 4C1TA 3G3JA 4ZDMA 3SEUA 4IGTA 5KDTB 3DP8A 1LLSA 4UACA 1PBPA 3UIFA 3S9MC 3W9VA 1PDAA 3RT8A 4GOTA 2D5WA 5DYHA 1TXFA 1S50A 2O6AA 3TODA 3IO6A 1MQJA 1I69A 4QSEA 3KN8A 2AIXA 2Y84A 3G3GA 1A8EA 2X7QA 1XVYA 1M5CA 4PE5B 2ZNSA 1OLAA 3HHFA 4R6KA 3C9HA 4DXUA 2O69A 3PUZE 1Y3NA 4F2OA 3FIRA 4LATA 4THIA 1N76A 3LSWA 4QSCA 4R6YA 3KFMA 2GHBA 3VV5A 5EHMA 4QFKA 5AA2B 4R2FA 3VLUA 5KCJA 5I84A 4OXVA 4OWDA 2VD2A 4ISUA 1SDXA 2ZYOA 2HZKA 4YAHX 1Y3PA 4QFPA 1SBPA 5DVJA 1ZU0A 1H45A 2HAUA 3KZGA 4F39A 4LZ5A 4DDDA 3M3LA 1L5TA 3B6WA 1MY0A 4KPTA 3KN3A 4PQJA 1Q35A 3PPQA 3DM0A 3F11A 1DTGA 2OZZA 1H3DA 1URDA 1SYIA 3DP6A 1IXCA 1NH7A 3DP4A 5JTYA 2ALUA 3ODBA 1SQYA 4QFLA 4KFQA 3T9VA 4G68B 3HV1A 1US5A 5TPAA 1ZTYA 5HM4B 2NUVA 2O7IA 3MWBA 3P7IA 4BDMA 2UVJA 1UTBA 2AL5A 4N13A 2YPNA 2DWJA 3O6IA 2QS4A 5K2XA 3KJ7A 4X48A 2RCBA 4EXKA 4KYEA 2XD2A 3G3IA 3HPIA 1R6ZA 4NTLA 4H0WA 2P2AA 2GH9A 5EYFA 1MPBA 3K1NA 3TUSA 4GL0A 3FD3A 2Q9TA 2QS3A 5ELVA 3CG1A 4FIMA 3K2DA 1GGGA 1Y1MA 2UXAA 1TFAA 2O51A 1MY1A 2H5YA 4DE8A 4FJPA 3MP6A 3N94A 2XXTA 3FXRA 3PPRA 3K02A 1XOCA 1P1OA 3IB0A 3SESA 2O1LA 1JETA 1MXYA 1YTVA 3RNNA 3KBRA 3R7XA 5ITOA 3TQLA 3U72A 2I3WA 1GR2A 3K6UA 1MQGA 4U4SA 5AE4A 5L9OA 2RC8A 3QUFA 3VLWA 4IY6A 1XC1A 4ELRA 1WODA 4C0RA 4RPOA 2OWTA 2Z22A 3N26A 4XIGQ 4N07A 4G68C 3TMGA 2QMWA 1NNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVT A;  3MC2 A;  4LZ7 A;  4BDR A;  2GHA A;  2X7P A;  4YB6 A;  4PFW A;  3BBR A;  3OO7 A;  5I58 B;  2ZNT A;  3MBP A;  2V3Q A;  3OXN A;  5A5X B;  1FTO A;  2WKY A;  3LC8 A;  3G3H A;  3MZB A;  3TZA A;  4MF3 A;  3FXQ A;  5BWJ A;  2RKM A;  4MH5 A;  4DLD A;  3RN8 A;  4IY5 A;  4R74 A;  3JV9 A;  2XXU A;  3VXB A;  3BFT A;  4HCW A;  4GXA A;  1WVJ A;  1B7U A;  3VVF A;  1Y3Q A;  1P1U A;  4ESX A;  4P11 A;  1A7L A;  4RK9 A;  5FHN A;  4GQO A;  1NL5 A;  3LSX A;  4NF4 A;  4ZEK A;  5AA1 A;  2DSF A;  4G8H A;  1FQB A;  4F22 A;  1B58 A;  3EHT A;  4DXC A;  3K1M A;  3B6Q A;  1NFT A;  1P1Q A;  1MDQ A;  1DTZ A;  5J1D A;  3TTL A;  2I58 A;  2NXO A;  1B5H A;  4IO6 A;  2DWH A;  2AL4 A;  2Q88 A;  5FHM A;  5IKB A;  1HSJ A;  3CRB A;  1R9L A;  3CIJ A;  3Q27 A;  4I8C A;  4UA8 A;  4R9G A;  3H6W A;  3K0V A;  3KJT A;  1ZLQ A;  4KYD A;  3THI A;  4MBP A;  4GF8 A;  4FOR A;  3QUJ A;  1Z7N E;  2QS1 A;  3CG3 A;  3MW0 A;  2QSX A;  4KCC A;  3H6U A;  2XXX A;  3UK4 A;  2XXI A;  3S2V A;  3EHS A;  3OEL A;  3SEX A;  1PB8 A;  5CI5 A;  1FW0 A;  4I1D A;  3RGY A;  1LAG E;  4LZ8 A;  2R71 A;  1YCJ A;  1SW4 A;  3PMX A;  2XHD A;  1MPD A;  3T96 B;  3VXC A;  2XXQ A;  3VVD A;  3O29 A;  4ZEB A;  5DT6 A;  4KD5 A;  2P0S A;  2PX1 A;  4XKR A;  3LSF B;  2DP8 A;  4WED A;  3TTN A;  2KLF A;  1IEJ A;  3FUZ A;  1A54 A;  1D9Y A;  4NE4 A;  2NOO A;  3T93 B;  3G3K A;  1PC3 A;  5L9S A;  3MUQ A;  3KG2 A;  5JTY B;  4DCY A;  1JW5 A;  2E0S A;  2F36 A;  4FED A;  2F7A A;  4XKP A;  3MZ9 A;  1LAH E;  4PP0 A;  5TPA B;  4F1V A;  5ITP A;  1DPP A;  4HW8 A;  2CMO A;  1BP5 A;  4RYA A;  1LFH A;  5CMK A;  2UYE A;  3JYR A;  3FVN A;  4H5F A;  3E4R A;  2I4B A;  4LQ5 A;  3RQT A;  1QUI A;  4O3A A;  1JEV A;  1LBB A;  4R72 A;  3HN0 A;  3IB1 A;  3L6G A;  4F1U A;  1SW2 A;  3PPO A;  4OYV A;  4FEB A;  2QS2 A;  5CM6 A;  3IR1 A;  4MLQ A;  3KOT A;  4BDN A;  1LAX A;  3UN6 A;  4G8M A;  1QJM A;  3N5L A;  1JQF A;  3TAJ A;  3A09 A;  2X26 A;  2ESN A;  1RKM A;  3QK6 A;  4X9T A;  4POX A;  5EHS A;  4H8I A;  3T22 A;  1H44 A;  1FQC A;  3IL1 B;  3LBS A;  2V93 A;  1ZIU A;  2PT2 A;  1B2H A;  3U8Q A;  3K1P A;  3S9L C;  4GIZ A;  4POW A;  4G2Z A;  1N04 A;  2H98 A;  1QKB A;  1TFD A;  3EF7 A;  5F7V A;  3WAF A;  1AMF A;  1RYX A;  1GV8 A;  4F1Y A;  4F3P A;  4QFO A;  2FA7 A;  3UA8 A;  3IOV A;  1UIV A;  5DEX A;  4R2B A;  3V83 A;  1OQH A;  1KWH A;  3H6T A;  4C1U A;  1Z7M E;  3C31 A;  4GLI A;  2ANJ A;  1PB7 A;  1B3H A;  1B5J A;  4EUO A;  3O9P A;  4FAT A;  3B7D A;  4K3F A;  1DMB A;  2VGQ A;  3H7M A;  2DS9 A;  2V25 A;  5I56 B;  2Y7K A;  2RIN A;  1D4N A;  3OO9 A;  1QUJ A;  4F19 A;  4JWX A;  1SYH A;  2DE4 A;  4RK2 A;  1B46 A;  5AA2 D;  4BLA A;  1LCF A;  2ZXT A;  2V84 A;  3C34 A;  2ONK E;  2XXH A;  4M1V A;  1MM7 A;  2VP1 A;  1CE2 A;  3QYT A;  4U1Z A;  4PFT A;  1PEB A;  2OBG A;  3EQ1 A;  3N6T A;  4HS7 A;  3I6V A;  1USY H;  4N6P A;  1MQI A;  2F35 A;  1S9T A;  2HZL A;  1R1N A;  1M5F A;  2F8D A;  3E13 X;  2E1S A;  4FEC A;  4GFR A;  4KHZ E;  5KZT A;  2HAV A;  1MY3 A;  2VOZ A;  1N0T A;  3UP9 A;  4X1D A;  4P0I A;  5I2K A;  4OHN A;  3KEI A;  3BKI B;  2OCU A;  4L17 A;  4NF4 B;  3RUM A;  1M5B A;  1B51 A;  1GVC A;  3S4U A;  1EZP A;  4YKP A;  3TYH A;  1OLC A;  3HO7 A;  2REJ A;  3KSJ A;  3U93 A;  1B7H A;  4F18 A;  4U21 A;  4U1O A;  1AL3 A;  1UTH A;  5HBC A;  1P99 A;  2QRY A;  2B3F A;  3EPE A;  3FJ7 A;  3TCF A;  2M8C A;  1Y20 A;  4XTC Q;  3B6T A;  1UIU A;  4R6H A;  1XT8 A;  1FTM A;  2RC9 A;  3C36 A;  4ZEF A;  2OWS A;  2VD3 A;  1B4Z A;  2QMX A;  2DQV A;  4EF1 A;  2XXR A;  3H3G A;  4F31 B;  4DCX A;  2HQ0 A;  2ZYK A;  5FHO A;  4MLV A;  3RTF B;  3QAX A;  3HHG A;  3O6H A;  2REG A;  2HXW A;  3CFL A;  3V5A A;  4JWY A;  2HCA A;  3T9H B;  3H06 B;  4OFO A;  3TEL A;  3N6U A;  1FQE A;  4WXJ A;  3TCH A;  1XS5 A;  4ONY A;  2UVI A;  2UVG A;  1N84 A;  4IO4 A;  3VFJ A;  1BIY A;  2F34 A;  4HCY A;  3PMW A;  1A55 A;  1NKX A;  3R6U A;  2Y7W A;  1XVX A;  4HTG A;  3OSQ A;  4GXS B;  4ZZE A;  5TP9 A;  1FQD A;  2DYX A;  5ICQ A;  2PT1 A;  3MJN A;  4YKK A;  5I56 A;  4ZEC A;  5AA4 B;  2Q2C A;  1MS7 A;  4JB7 A;  2O1M A;  3C32 A;  1YAE A;  4XKN A;  5H8H A;  3FZV A;  5CBS A;  1P1N A;  1VFE A;  4JBZ A;  3TTR A;  3O28 A;  2D21 A;  2GRV A;  2OLB A;  4ELO A;  2O7U A;  1Y4C A;  4G8N A;  5CMB A;  3KSX A;  4G77 A;  1MM6 A;  2THI A;  1Q1K A;  2XXV A;  3PD8 A;  1OIB A;  3IK6 B;  4ESW A;  4GRK A;  2A5S A;  1FTK A;  2OJT A;  3M3K A;  5IAI A;  3FV1 A;  2PBW A;  4QRZ A;  4IO3 A;  2ZYN A;  3SET A;  2HFB A;  4OVJ A;  3T9X B;  4NWD A;  3LR1 A;  3ECR A;  4NWC A;  3U92 A;  4DXB A;  1R9Q A;  4QHQ A;  2Z8F A;  4LVQ A;  1LGB C;  4OMB A;  2A5T A;  4WEP A;  1MQH A;  1ZJL A;  3TTM A;  5I59 A;  4U22 A;  3IOR A;  1O7T A;  1PB9 A;  4F3G A;  3H4Z A;  3IX1 A;  1B52 A;  1SD3 A;  2IEE A;  3CVG A;  2XXY A;  1ZBM A;  1USY E;  4LON B;  4RNS A;  2UVH A;  3CI8 A;  4RXL A;  3AXF A;  1D9V A;  2Z23 A;  3Q28 A;  5B7D A;  2VHA A;  1CB6 A;  3MQ9 A;  3PUW E;  5DEX B;  4U23 A;  2DXR A;  4OEV A;  1QW0 A;  4YB7 A;  2F7B A;  2G29 A;  4EF2 A;  4JSD A;  3MVY A;  5CBR A;  4IO2 A;  4DZ1 A;  3EHU A;  3FJM A;  2OK2 A;  1O64 A;  2W7Y A;  3BFU A;  4IGR A;  3ONM A;  5H8Q B;  3MP8 A;  1B6H A;  3C4M A;  5L9M A;  1D3K A;  3Q26 A;  3ZKL A;  1IUD A;  1LAF E;  1F9B A;  1FTJ A;  4QFN A;  2XXW A;  4PET A;  4NF8 B;  3K6X A;  4F2Q A;  1N3X A;  3RLF E;  2XX8 A;  3ILU B;  4LP2 B;  4RJZ A;  5H8F A;  4H67 A;  4EQB A;  3C35 A;  1EZ9 A;  2I49 A;  2DOJ A;  2DWA A;  2F97 A;  4YU0 A;  5AA4 A;  1O63 A;  5JK4 A;  4GVO A;  4EDP A;  2F78 A;  5JEI A;  3IJX B;  3PU5 A;  1MQD A;  4YIC A;  3Q29 A;  5I2K B;  5FTI A;  5K2Y A;  3G3F A;  3GLB A;  2ABH A;  4I62 A;  4OFL A;  1Y4T A;  4YKI A;  1I6Q A;  4RPN A;  3FAS A;  1ELJ A;  5H8N B;  1P1W A;  2I3V A;  4G4P A;  3W15 C;  4OZ9 A;  2IA4 A;  3L6H A;  1MXZ A;  4EQ9 A;  3U1O A;  3TCG A;  3MAM A;  2DVC A;  4NF5 A;  1UTH B;  2ZNU A;  3QXM A;  1IXG A;  3UGW A;  2I0B A;  3OEN A;  3QIM A;  4FAJ A;  4H5G A;  1QKA A;  3VE1 B;  2LAO A;  2Z8E A;  1DOT A;  2Q8J A;  2F6P A;  3FVG A;  3TFL A;  3GBB A;  3SKP A;  4ELQ A;  4Q30 B;  5AA3 A;  1FQA A;  1MXX A;  3S9E A;  3MVW A;  5FTH A;  1A8F A;  3U94 A;  2FNC A;  4QF9 A;  4H6D A;  5H8S A;  2I48 A;  3OSR A;  3VLV A;  1MRP A;  1LFG A;  2B3B A;  4Z7E A;  5ICT A;  2H4I A;  1SI0 A;  2O68 A;  5M2V A;  4KI0 E;  4TLL B;  3TQW A;  1AOV A;  2AYS A;  4XXU A;  2NVU B;  1OQG A;  4I9D A;  5TP9 B;  3ZSF A;  1FTL A;  4JWO A;  4IO5 A;  1JVY A;  3VDF A;  4PFU A;  3TEP A;  1LB9 A;  3M8U A;  3CSB A;  1GTK A;  1BTJ A;  4EQ7 A;  1IXI A;  5H8Q A;  5CMC A;  4LQ2 A;  4TOZ A;  4E0W A;  2F7C A;  1UQW A;  1US4 A;  2PVU A;  5H8H B;  2RC7 A;  4KQP A;  1IIT A;  1JNF A;  2CZL A;  3OOA A;  1B3E A;  3VVE A;  4NF8 A;  3ZS6 A;  4OER A;  3KOS A;  1RYO A;  4O3C A;  5L8D A;  1DPE A;  4OQO A;  3O2A A;  4WKM A;  3K6V A;  1JW1 A;  4OFJ A;  3K4U A;  4YMB A;  1NNF A;  5CRY A;  3IOU A;  3K01 A;  1URS A;  3SEY A;  1ZKB A;  2V3T A;  1QVS A;  3PMV A;  4ECF A;  4IB2 A;  1NMU A;  3RT6 B;  1JVX A;  2A5T B;  2QJE A;  2GFE A;  2D3I A;  3MVZ A;  3PUY E;  3E3K A;  5F1Q A;  3DEL B;  1POT A;  5I59 B;  5H8N A;  1B32 A;  3PPN A;  3EN3 A;  3Q25 A;  1OMP A;  2H99 A;  2Y7I A;  2QPQ A;  1M5E A;  4H65 A;  3T9U A;  4ZE9 A;  1B05 A;  1LBC A;  4R75 A;  1B3G A;  4E0X A;  1LFI A;  3O66 A;  4KYS A;  1WDN A;  1IQ7 A;  2DVZ A;  4KR5 A;  1S7Y A;  2B65 A;  1II5 A;  1IXH A;  3MPL A;  4IO7 A;  4TQU Q;  1NNP A;  4ZZA A;  3T66 A;  1B3F A;  1B40 A;  2DWI A;  3FXU A;  2Y7P A;  3PD9 A;  3IO4 A;  2UYF A;  1B3L A;  1TWY A;  2ONS A;  1LB8 A;  3D4C A;  4DIG A;  4PFY A;  2NWJ A;  5I2N A;  3PUV E;  1LCT A;  4R9F A;  3CFX A;  3FV2 A;  1AH5 A;  5CMM A;  5LOM A;  4ZED A;  4JXI A;  1FQF A;  1XHY A;  3PGF A;  1BLF A;  4YZZ A;  5KDT A;  1M5D A;  3MP1 A;  3OO8 A;  1VFD A;  4EXL A;  5H8F B;  5BUU A;  1N7W A;  1SW1 A;  2V3U A;  3A3U A;  4F29 A;  2XX9 A;  4OES A;  2Z8D A;  4QSD A;  3DLN A;  1LST A;  3G7W A;  3SEV A;  1T0K A;  2FYI A;  1FCK A;  4X1B A;  1Y1Z A;  1ATG A;  2G93 A;  1DSN A;  1PBQ A;  3IAZ A;  4H1X A;  3CR9 A;  2DE3 A;  3I3V A;  4NED A;  4BDL A;  1MH3 A;  1J1N A;  2ZYM A;  4Q5T A;  3W9W A;  5AA2 A;  2ONR A;  2XXP A;  2PMS A;  3TTK A;  3GXA A;  3OMB A;  2I6E A;  4NF5 B;  3MPK A;  1OVB A;  4GL8 A;  1N3W A;  2DE2 A;  4GWO A;  1MXW A;  3ZKK A;  3SER A;  3S9N C;  4F3B A;  2XX7 A;  4NMY A;  3PV0 E;  4R73 A;  3OEM A;  3K00 A;  1NH8 A;  3JZJ A;  2H25 A;  1B4H A;  5B70 A;  1Y9U A;  1B1X A;  2RCA A;  4FE8 A;  4M4G A;  2DXY A;  2QL3 A;  4G68 A;  1VE4 A;  2RF1 A;  3MVX A;  3K6W A;  5TU0 A;  3TPA A;  3FVO A;  5I57 B;  3A3C A;  2I4C A;  3IB2 A;  2R9J A;  3FJG A;  4NF6 B;  3OO6 A;  1MG1 A;  4Q8R A;  2F5X A;  4KCD A;  4U4X A;  5DTB A;  2Q2A A;  5DVI A;  1YPN A;  1MPC A;  3R26 A;  1EH3 A;  1POY 1;  3UOR A;  4AQ4 A;  3HCQ A;  1AIV A;  2BJJ X;  4BDO A;  2R6G E;  3M3F A;  1H76 A;  4ZS9 A;  1B7Z A;  4JSO A;  1SW5 A;  4P0G A;  3GZG A;  4RA1 A;  4JDF A;  4ELP A;  4YKJ A;  2YLN A;  2PYY A;  2O84 X;  4MFI A;  1ANF A;  1IIW A;  5ISU A;  4YMA A;  3CSG A;  1MXV A;  4ZEI A;  3ILT B;  3IJO B;  3V8X B;  3TDJ A;  3I5O A;  3MZ1 A;  1EU8 A;  3OD7 A;  5DVF A;  1BKA A;  1ZMG A;  1MY4 A;  3IOW A;  1B5I A;  1VSO A;  1JW4 A;  3LUY A;  1SVX B;  1B0H A;  5HPQ A;  3C33 A;  4Z0I A;  1I6B A;  3KN7 A;  4ND9 A;  5KCJ B;  2I0C A;  3OEK A;  1VR5 A;  2Y7R A;  3SEW A;  1HSL A;  2P1S A;  1MH4 A;  4BDQ A;  3H03 A;  1B1H A;  2H9B A;  3KGC A;  4RY1 A;  4AB5 A;  4XKQ A;  1B9J A;  4O3B A;  1A99 A;  3GBA A;  4ZE8 A;  4Q0C A;  3O97 A;  3USD A;  2ZMB A;  2XD3 A;  1IZ1 A;  3TKD A;  1URG A;  3QSL A;  3IOT A;  5I58 A;  3E9X A;  2HEU A;  3FVK A;  2Q89 A;  1EZO A;  4AB6 A;  1UTB B;  1TT1 A;  1SI1 A;  3H6V A;  5A5X A;  3CFZ A;  4OET A;  3V89 B;  3O6G A;  1A40 A;  3WAE A;  3RY3 A;  4LA9 A;  4OEN A;  4TLM B;  4U2R A;  4F3S A;  1QUL A;  1HSE A;  1MY2 A;  3LSL A;  3PPP A;  3SDF A;  1H43 A;  4H8J A;  1B0L A;  3RTW B;  1I6A A;  1MXU A;  3PUX E;  4LUB A;  1N7X A;  1QUK A;  4OEU A;  5I2N B;  1NNT A;  2F6G A;  3FAT A;  5I57 A;  1MDP 1;  4OTE A;  5CC2 A;  3FGS A;  2YJP A;  3RPW A;  4NF6 A;  4GD5 A;  4YB5 A;  3HST A;  3D4G A;  1JEU A;  4C1T A;  3G3J A;  4ZDM A;  3SEU A;  4IGT A;  5KDT B;  3DP8 A;  1LLS A;  4UAC A;  1PBP A;  3UIF A;  3S9M C;  3W9V A;  1PDA A;  3RT8 A;  4GOT A;  2D5W A;  5DYH A;  1TXF A;  1S50 A;  2O6A A;  3TOD A;  3IO6 A;  1MQJ A;  1I69 A;  4QSE A;  3KN8 A;  2AIX A;  2Y84 A;  3G3G A;  1A8E A;  2X7Q A;  1XVY A;  1M5C A;  4PE5 B;  2ZNS A;  1OLA A;  3HHF A;  4R6K A;  3C9H A;  4DXU A;  2O69 A;  3PUZ E;  1Y3N A;  4F2O A;  3FIR A;  4LAT A;  4THI A;  1N76 A;  3LSW A;  4QSC A;  4R6Y A;  3KFM A;  2GHB A;  3VV5 A;  5EHM A;  4QFK A;  5AA2 B;  4R2F A;  3VLU A;  5KCJ A;  5I84 A;  4OXV A;  4OWD A;  2VD2 A;  4ISU A;  1SDX A;  2ZYO A;  2HZK A;  4YAH X;  1Y3P A;  4QFP A;  1SBP A;  5DVJ A;  1ZU0 A;  1H45 A;  2HAU A;  3KZG A;  4F39 A;  4LZ5 A;  4DDD A;  3M3L A;  1L5T A;  3B6W A;  1MY0 A;  4KPT A;  3KN3 A;  4PQJ A;  1Q35 A;  3PPQ A;  3DM0 A;  3F11 A;  1DTG A;  2OZZ A;  1H3D A;  1URD A;  1SYI A;  3DP6 A;  1IXC A;  1NH7 A;  3DP4 A;  5JTY A;  2ALU A;  3ODB A;  1SQY A;  4QFL A;  4KFQ A;  3T9V A;  4G68 B;  3HV1 A;  1US5 A;  5TPA A;  1ZTY A;  5HM4 B;  2NUV A;  2O7I A;  3MWB A;  3P7I A;  4BDM A;  2UVJ A;  1UTB A;  2AL5 A;  4N13 A;  2YPN A;  2DWJ A;  3O6I A;  2QS4 A;  5K2X A;  3KJ7 A;  4X48 A;  2RCB A;  4EXK A;  4KYE A;  2XD2 A;  3G3I A;  3HPI A;  1R6Z A;  4NTL A;  4H0W A;  2P2A A;  2GH9 A;  5EYF A;  1MPB A;  3K1N A;  3TUS A;  4GL0 A;  3FD3 A;  2Q9T A;  2QS3 A;  5ELV A;  3CG1 A;  4FIM A;  3K2D A;  1GGG A;  1Y1M A;  2UXA A;  1TFA A;  2O51 A;  1MY1 A;  2H5Y A;  4DE8 A;  4FJP A;  3MP6 A;  3N94 A;  2XXT A;  3FXR A;  3PPR A;  3K02 A;  1XOC A;  1P1O A;  3IB0 A;  3SES A;  2O1L A;  1JET A;  1MXY A;  1YTV A;  3RNN A;  3KBR A;  3R7X A;  5ITO A;  3TQL A;  3U72 A;  2I3W A;  1GR2 A;  3K6U A;  1MQG A;  4U4S A;  5AE4 A;  5L9O A;  2RC8 A;  3QUF A;  3VLW A;  4IY6 A;  1XC1 A;  4ELR A;  1WOD A;  4C0R A;  4RPO A;  2OWT A;  2Z22 A;  3N26 A;  4XIG Q;  4N07 A;  4G68 C;  3TMG A;  2QMW A;  1NNK A; 
#chains in the Genus database with same CATH topology
 1OVT A;  3MC2 A;  2B4L A;  4LZ7 A;  4BDR A;  2GHA A;  2X7P A;  4YB6 A;  4PDD A;  1NV7 A;  3MST A;  4PFW A;  3BBR A;  3OO7 A;  5I58 B;  2ZNT A;  3MBP A;  2V3Q A;  3LUZ A;  1NV5 A;  3OXN A;  4OVP A;  2MKZ A;  5A5X B;  2JJK A;  1FTO A;  2WKY A;  3LC8 A;  3G3H A;  3MZB A;  3TZA A;  4MF3 A;  4IR8 A;  3FXQ A;  5BWJ A;  2RKM A;  4MH5 A;  4PC9 A;  4DLD A;  3RN8 A;  4IY5 A;  4R74 A;  3JV9 A;  2XXU A;  3VXB A;  3BFT A;  4HCW A;  4P1E A;  4GXA A;  1WVJ A;  1B7U A;  2WX9 A;  3VVF A;  2VT5 A;  2CZK A;  1Y3Q A;  1P1U A;  4ESX A;  4P11 A;  1A7L A;  4RK9 A;  3PTY A;  4GBV A;  5FHN A;  4GQO A;  1NL5 A;  3LSX A;  4NF4 A;  4ZEK A;  5AA1 A;  2FVZ A;  2DSF A;  4G8H A;  1FQB A;  4F22 A;  1B58 A;  3EHT A;  4DXC A;  3K1M A;  2XXK A;  3B6Q A;  1NFT A;  1P1Q A;  1MDQ A;  1DTZ A;  5J1D A;  3TTL A;  2I58 A;  2NXO A;  1B5H A;  4IO6 A;  2DWH A;  4I40 A;  2AL4 A;  2Q88 A;  5FHM A;  5IKB A;  1HSJ A;  1Q9D A;  3CRB A;  4N15 A;  1R9L A;  3CIJ A;  3Q27 A;  4I8C A;  4UA8 A;  4LN5 A;  4R9G A;  1LBZ A;  3H6W A;  3K0V A;  3KJT A;  1ZLQ A;  1LEV A;  4KYD A;  1FBP A;  3THI A;  4MBP A;  4GF8 A;  4FOR A;  3QUJ A;  1Z7N E;  2QS1 A;  4DI4 B;  1D9Q A;  3CG3 A;  1IMA A;  3MW0 A;  2QSX A;  4KCC A;  3H6U A;  2XXX A;  3UK4 A;  2XXI A;  3S2V A;  3IFA A;  3EHS A;  3OEL A;  3SEX A;  1PB8 A;  4HE2 A;  5CI5 A;  1FW0 A;  4I1D A;  3RGY A;  1LAG E;  4PTK A;  1IMD A;  4LZ8 A;  2R71 A;  1YCJ A;  1SW4 A;  3PMX A;  2XHD A;  2FHY A;  4OVT A;  1MPD A;  4N91 A;  3T96 B;  3VXC A;  2XXQ A;  2XA5 A;  3VVD A;  3O29 A;  1SPI A;  4ZEB A;  5DT6 A;  4KD5 A;  2P0S A;  2PX1 A;  4XKR A;  3LSF B;  2DP8 A;  4WED A;  3TTN A;  4P56 A;  2KLF A;  1FPI A;  1IEJ A;  3FUZ A;  1FBF A;  1A54 A;  1D9Y A;  4NE4 A;  2NOO A;  3T93 B;  3G3K A;  1PC3 A;  5L9S A;  3MUQ A;  1DBZ A;  3KG2 A;  5JTY B;  4DCY A;  1JW5 A;  3QMF A;  2E0S A;  2F36 A;  4FED A;  2F7A A;  4XKP A;  3MZ9 A;  1LAH E;  4PP0 A;  5TPA B;  4F1V A;  5ITP A;  1DPP A;  4HW8 A;  2CMO A;  1BP5 A;  4RYA A;  1LFH A;  5CMK A;  2UYE A;  3A29 A;  4NQ8 A;  3JYR A;  2Q8M A;  3FVN A;  4H5F A;  3E4R A;  2I4B A;  4LQ5 A;  3RQT A;  1QUI A;  4O3A A;  1JEV A;  3RPL A;  1LBB A;  4R72 A;  3HN0 A;  4OVS A;  3IB1 A;  3L6G A;  4F1U A;  1SW2 A;  3PPO A;  2PFZ A;  4OYV A;  3KC1 A;  4FEB A;  2QS2 A;  5CM6 A;  3IR1 A;  4JVD A;  4MLQ A;  4NF0 A;  3ROJ A;  3KOT A;  4BDN A;  1LAX A;  3UN6 A;  4G8M A;  1QJM A;  3N5L A;  1JQF A;  3TAJ A;  3A09 A;  2X26 A;  2VPO A;  2ESN A;  1RKM A;  3QK6 A;  4X9T A;  1INP A;  4POX A;  5EHS A;  4H8I A;  3T22 A;  1H44 A;  1FQC A;  3IL1 B;  3LBS A;  2V93 A;  1ZIU A;  2PT2 A;  5IZ3 A;  3KBZ A;  1B2H A;  3U8Q A;  3K1P A;  5EYG A;  3S9L C;  4GIZ A;  4POW A;  4G2Z A;  1N04 A;  2H98 A;  1QKB A;  1TFD A;  3EF7 A;  5F7V A;  3WAF A;  1AMF A;  1RYX A;  2Y5K A;  1GV8 A;  4F1Y A;  4F3P A;  4QFO A;  4GBW A;  2FA7 A;  3UA8 A;  3IOV A;  1UIV A;  5DEX A;  4R2B A;  3V83 A;  1OQH A;  1KWH A;  3H6T A;  5F24 A;  4C1U A;  1Z7M E;  3C31 A;  2HXR A;  4GLI A;  2ANJ A;  1PB7 A;  1B3H A;  4PAK A;  1B5J A;  4EUO A;  3O9P A;  4FAT A;  3B7D A;  4N17 A;  3CHG A;  2OX3 A;  4K3F A;  1DMB A;  2VGQ A;  3H7M A;  2DS9 A;  2V25 A;  5I56 B;  2Y7K A;  2RIN A;  1D4N A;  3OO9 A;  1QUJ A;  4F19 A;  4JWX A;  1SYH A;  4P47 A;  2DE4 A;  4RK2 A;  1B46 A;  5AA2 D;  4NX1 A;  4BLA A;  1LCF A;  2ZXT A;  2V84 A;  3C34 A;  2ONK E;  2XXH A;  3BIG A;  4PF8 A;  4M1V A;  1MM7 A;  2VP1 A;  1CE2 A;  3QYT A;  4XF5 A;  4U1Z A;  2P3V A;  4OAN A;  4PFT A;  1PEB A;  2OBG A;  4GX6 A;  3EQ1 A;  3N6T A;  4HS7 A;  5I7I A;  4DI3 D;  3I6V A;  1USY H;  1FBC A;  4N6P A;  1KZ8 A;  1MQI A;  2F35 A;  1S9T A;  2HZL A;  1R1N A;  1M5F A;  2F8D A;  3E13 X;  2E1S A;  4FEC A;  4GFR A;  4KHZ E;  5KZT A;  2HAV A;  1MY3 A;  4PBQ A;  2P3N A;  2VOZ A;  1N0T A;  3UP9 A;  4X1D A;  4PGN A;  4P0I A;  4XFE A;  5I2K A;  4OHN A;  3KEI A;  3BKI B;  2OCU A;  4L17 A;  4NF4 B;  3RUM A;  3BIH A;  1M5B A;  1B51 A;  4H46 A;  1GVC A;  3S4U A;  1EZP A;  4YKP A;  2QVR A;  3TYH A;  1OLC A;  3HO7 A;  2REJ A;  3KSJ A;  1NV1 A;  4MNP A;  1NV3 A;  3U93 A;  4N4U A;  5IGA A;  1B7H A;  4F18 A;  4U21 A;  4U1O A;  1AL3 A;  1UTH A;  5HBC A;  1P99 A;  4OA4 A;  2QRY A;  2B3F A;  1K9Y A;  3EPE A;  3FJ7 A;  3TCF A;  2M8C A;  1Y20 A;  4XTC Q;  3B6T A;  1UIU A;  4R6H A;  1XT8 A;  1FBE A;  1FTM A;  2RC9 A;  3C36 A;  4ZEF A;  2OWS A;  2VD3 A;  1B4Z A;  2QMX A;  2DQV A;  4EF1 A;  2ZZX A;  2XXR A;  3H3G A;  1KA0 A;  4F31 B;  4DCX A;  2HQ0 A;  3U65 A;  2ZYK A;  2CEX A;  1FPF A;  5FHO A;  4MLV A;  3RTF B;  3QAX A;  3HHG A;  3O6H A;  4UAB A;  2REG A;  2HXW A;  2PCR A;  3CFL A;  3V5A A;  1LBV A;  4JWY A;  3E79 A;  4P8B A;  2HCA A;  3T9H B;  4GWZ A;  3H06 B;  4OFO A;  3TEL A;  3N6U A;  1FQE A;  4WXJ A;  3TCH A;  1XS5 A;  4ONY A;  2UVI A;  2UVG A;  1N84 A;  4IO4 A;  3VFJ A;  1BIY A;  2F34 A;  4HCY A;  1BK4 A;  3PMW A;  1A55 A;  1FBH A;  1NKX A;  3R6U A;  2Y7W A;  1XVX A;  4HTG A;  3OSQ A;  4GXS B;  4ZZE A;  5TP9 A;  1FQD A;  2R8T A;  4GWY A;  2DYX A;  5ICQ A;  2PT1 A;  3MJN A;  4YKK A;  5I56 A;  4ZEC A;  5AA4 B;  2Q2C A;  2F3B A;  1MS7 A;  4JB7 A;  1FPJ A;  2O1M A;  3C32 A;  1YAE A;  5ESY A;  4XKN A;  5H8H A;  3FZV A;  5CBS A;  1P1N A;  2CZH A;  2WYK A;  1VFE A;  4JBZ A;  3TTR A;  3O28 A;  2D21 A;  2GRV A;  2OLB A;  4ELO A;  2O7U A;  1Y4C A;  3SZP A;  4G8N A;  5CMB A;  4P9K A;  2HHM A;  3KSX A;  4G77 A;  1MM6 A;  2THI A;  1Q1K A;  2XXV A;  3PD8 A;  1OIB A;  3IK6 B;  4MHF A;  4ESW A;  4GRK A;  2A5S A;  1FTK A;  3RPL B;  2OJT A;  3M3K A;  5IM2 A;  5IAI A;  4FBP A;  3FV1 A;  2PBW A;  4QRZ A;  4IO3 A;  2ZYN A;  1FPG A;  3SET A;  2HFB A;  4OVJ A;  3T9X B;  2OWZ A;  4NWD A;  3LR1 A;  3ECR A;  4NWC A;  3U92 A;  4DXB A;  1R9Q A;  2F3D A;  4QHQ A;  2Z8F A;  4LVQ A;  4QXD A;  1LGB C;  4OMB A;  1FTA A;  2A5T A;  4WEP A;  1MQH A;  1ZJL A;  3TTM A;  5I59 A;  4U22 A;  3IOR A;  1O7T A;  1PB9 A;  4F3G A;  3H4Z A;  3B8B A;  3IX1 A;  1B52 A;  5IZ3 B;  2QVV A;  1SD3 A;  4PGP A;  2IEE A;  3CVG A;  2XXY A;  1ZBM A;  1USY E;  4LON B;  4RNS A;  2UVH A;  3CI8 A;  3HFU A;  4RXL A;  3AXF A;  1D9V A;  2Z23 A;  3Q28 A;  5B7D A;  2VHA A;  3ISP A;  1CB6 A;  3MQ9 A;  3PUW E;  5DEX B;  4U23 A;  2DXR A;  4OEV A;  1QW0 A;  3KC0 A;  4YB7 A;  2F7B A;  2G29 A;  4EF2 A;  4JSD A;  4O94 A;  3MVY A;  5CBR A;  4IO2 A;  4DZ1 A;  3EHU A;  3FJM A;  2WBB A;  2OK2 A;  5EQA A;  1O64 A;  2Y5L A;  2W7Y A;  3BFU A;  4IGR A;  3T0J A;  3ONM A;  5H8Q B;  3MP8 A;  1B6H A;  1AWB A;  3C4M A;  5L9M A;  4MJO A;  1D3K A;  4PCD A;  3Q26 A;  3ZKL A;  1IUD A;  1LAF E;  4P1L A;  1F9B A;  1FTJ A;  4QFN A;  2XXW A;  1NUX A;  4PET A;  4NF8 B;  2QMW A;  3K6X A;  4F2Q A;  4MEV A;  1N3X A;  2XX8 A;  3RLF E;  3ILU B;  4LP2 B;  1FBG A;  4RJZ A;  5H8F A;  4H67 A;  2XWK A;  4EQB A;  4PAI A;  3C35 A;  1EZ9 A;  2I49 A;  2DOJ A;  2DWA A;  2F97 A;  4YU0 A;  5AA4 A;  1O63 A;  5JK4 A;  4GVO A;  4EDP A;  2F78 A;  5JEI A;  3IJX B;  3PU5 A;  1MQD A;  4YIC A;  2L5V A;  3Q29 A;  5I2K B;  5FTI A;  5K2Y A;  3G3F A;  3T1B A;  3GLB A;  2ABH A;  4I62 A;  4OFL A;  1Y4T A;  4YKI A;  1LBY A;  1I6Q A;  4RPN A;  4H45 A;  3FAS A;  1FRP A;  1ELJ A;  5I5P A;  5H8N B;  1P1W A;  4O7M A;  2I3V A;  4G4P A;  3W15 C;  4OZ9 A;  2IA4 A;  3L6H A;  1MXZ A;  4EQ9 A;  3U1O A;  3TCG A;  3MAM A;  3MYU A;  2DVC A;  4NF5 A;  1UTH B;  2ZNU A;  3QXM A;  1IXG A;  1CNQ A;  3UGW A;  4O8M A;  2I0B A;  4GX3 A;  3OEN A;  3QIM A;  4FAJ A;  4H5G A;  1QKA A;  4PDH A;  3VE1 B;  2LAO A;  2Z8E A;  1DOT A;  2Q8J A;  4HXV A;  4OVQ A;  2F6P A;  3FVG A;  3TFL A;  1EYJ A;  3GBB A;  3SKP A;  4ELQ A;  4Q30 B;  5AA3 A;  1FQA A;  1MXX A;  4N8Y A;  3S9E A;  3MVW A;  5FTH A;  1A8F A;  2WEF A;  3U94 A;  2FNC A;  4QF9 A;  4H6D A;  4AS5 A;  5H8S A;  2I48 A;  3OSR A;  3VLV A;  1MRP A;  1LFG A;  2B3B A;  4Z7E A;  4PBH A;  1FBD A;  5A5L A;  5ICT A;  2H4I A;  1SI0 A;  1IMB A;  2O68 A;  1IMC A;  1XI6 A;  4O7I A;  5M2V A;  4KI0 E;  4TLL B;  3TQW A;  1AOV A;  2AYS A;  4XXU A;  2NVU B;  1OQG A;  4I9D A;  5TP9 B;  3ZSF A;  1FTL A;  4JWO A;  4IO5 A;  1JVY A;  3VDF A;  1YZ0 A;  4PFU A;  3TEP A;  1LB9 A;  3M8U A;  3CSB A;  1GTK A;  1BTJ A;  4EQ7 A;  1IXI A;  5H8Q A;  5CMC A;  4LQ2 A;  4TOZ A;  4E0W A;  2F7C A;  1UQW A;  1US4 A;  2PVU A;  5H8H B;  2RC7 A;  4KQP A;  1IIT A;  1JNF A;  2CZL A;  3OOA A;  1B3E A;  3VVE A;  4NF8 A;  3ZS6 A;  4OER A;  4GWW A;  3KOS A;  1RYO A;  4O3C A;  5L8D A;  1DPE A;  4OQO A;  3O2A A;  4WKM A;  3K6V A;  1JW1 A;  4OFJ A;  4X04 A;  3K4U A;  4YMB A;  1NNF A;  5CRY A;  3IOU A;  3K01 A;  1URS A;  3SEY A;  1G0H A;  1ZKB A;  4I3Y A;  2V3T A;  1QVS A;  3PMV A;  4ECF A;  5I3S A;  4AS4 A;  4IB2 A;  1NMU A;  3RT6 B;  1JVX A;  2A5T B;  2QJE A;  2GFE A;  2D3I A;  3MVZ A;  3PUY E;  5EQ7 A;  3E3K A;  5F1Q A;  3DEL B;  5EYH A;  1POT A;  5I59 B;  5EQ8 A;  5H8N A;  1B32 A;  3PPN A;  3EN3 A;  4GX4 A;  3Q25 A;  5ET6 A;  1OMP A;  2H99 A;  2Y7I A;  2QPQ A;  1M5E A;  4H65 A;  3T9U A;  4ZE9 A;  1B05 A;  1LBC A;  2PFY A;  1KA1 A;  4R75 A;  1B3G A;  4E0X A;  1LFI A;  3O66 A;  4KYS A;  1WDN A;  1FSA A;  1EYK A;  1IQ7 A;  2DVZ A;  4KR5 A;  2ZZV A;  1EYI A;  1S7Y A;  2B65 A;  1II5 A;  1IXH A;  3MPL A;  4IO7 A;  4TQU Q;  1NNP A;  4ZZA A;  3T66 A;  1FJ9 A;  1B3F A;  1B40 A;  2DWI A;  3FXU A;  2Y7P A;  3PD9 A;  3IO4 A;  2UYF A;  1B3L A;  4P3L A;  1TWY A;  2ONS A;  1LB8 A;  3D4C A;  4DIG A;  4PFY A;  2NWJ A;  5I2N A;  3PUV E;  1LCT A;  3GYY A;  4GWS A;  4R9F A;  3CFX A;  1RDZ A;  3FV2 A;  1AH5 A;  5CMM A;  5LOM A;  1K9Z A;  4ZED A;  4JXI A;  1FQF A;  1XHY A;  3PGF A;  1BLF A;  1DK4 A;  4YZZ A;  5KDT A;  1M5D A;  1NUZ A;  3MP1 A;  1RDX A;  3OO8 A;  1VFD A;  4EXL A;  5H8F B;  5BUU A;  1N7W A;  4OVR A;  1SW1 A;  2V3U A;  3A3U A;  4F29 A;  2XX9 A;  4OES A;  2Z8D A;  4QSD A;  3DLN A;  1LST A;  5IZZ A;  3G7W A;  2FBP A;  3SEV A;  4PE3 A;  1T0K A;  2FYI A;  3EKI A;  1VDW A;  4N8G A;  1FCK A;  4N6D A;  4X1B A;  1Y1Z A;  1ATG A;  2G93 A;  5ET7 A;  1PBQ A;  1DSN A;  3IAZ A;  4H1X A;  3CR9 A;  2DE3 A;  1FPK A;  3I3V A;  4NED A;  4BDL A;  1MH3 A;  1J1N A;  2ZYM A;  4QBA A;  4Q5T A;  3W9W A;  5AA2 A;  2ONR A;  2XXP A;  2PMS A;  3TTK A;  3GXA A;  3OMB A;  4NF5 B;  2I6E A;  2WYP A;  1OVB A;  2ZZW A;  3MPK A;  1N3W A;  4GL8 A;  2DE2 A;  4I3E A;  2KR0 A;  4GWO A;  1MXW A;  4JVI A;  3ZKK A;  3SER A;  1NI9 A;  3S9N C;  4F3B A;  5ET5 A;  2XX7 A;  4NMY A;  2QFL A;  3PV0 E;  4R73 A;  3OEM A;  3K00 A;  1FPE A;  1NH8 A;  3JZJ A;  2H25 A;  2WBD A;  1DCU A;  1B4H A;  5EQ9 A;  5B70 A;  2DDK A;  1Y9U A;  1B1X A;  2RCA A;  4FE8 A;  4M4G A;  2DXY A;  2QL3 A;  2CEY A;  4G68 A;  1VE4 A;  1QGX A;  2RF1 A;  3MVX A;  3K6W A;  5TU0 A;  3TPA A;  3FVO A;  5I57 B;  3A3C A;  2I4C A;  3IB2 A;  2R9J A;  3FJG A;  4NF6 B;  3OO6 A;  1MG1 A;  4Q8R A;  2F5X A;  4MNI A;  1IMF A;  4KCD A;  4U4X A;  5DTB A;  2Q2A A;  5DVI A;  1YPN A;  1MPC A;  3R26 A;  1EH3 A;  1POY 1;  3UOR A;  1RDY A;  4AQ4 A;  3HCQ A;  1AIV A;  2BJJ X;  1FPB A;  1NV0 A;  4BDO A;  2R6G E;  3M3F A;  1H76 A;  3D1R A;  4ZS9 A;  1B7Z A;  4JSO A;  1SW5 A;  4P0G A;  3GZG A;  4RA1 A;  4JDF A;  4ELP A;  4YKJ A;  2YLN A;  2PYY A;  2O84 X;  4MFI A;  1ANF A;  3IFC A;  4MIJ A;  1IIW A;  5ISU A;  2VPN A;  4YMA A;  3CSG A;  1MXV A;  4ZEI A;  3ILT B;  4PFR A;  3IJO B;  5LDZ A;  3V8X B;  3TDJ A;  3I5O A;  3MZ1 A;  1EU8 A;  1YXI A;  3OD7 A;  5DVF A;  1BKA A;  1ZMG A;  1MY4 A;  3IOW A;  1B5I A;  1VSO A;  1JW4 A;  3LUY A;  1SVX B;  4NN3 A;  1B0H A;  5HPQ A;  3C33 A;  4Z0I A;  1I6B A;  3KN7 A;  4ND9 A;  5KCJ B;  2I0C A;  3OEK A;  1VR5 A;  2Y7R A;  3SEW A;  2XWI A;  1HSL A;  2P1S A;  1MH4 A;  4BDQ A;  3H03 A;  1B1H A;  2BJI A;  4JVC A;  2H9B A;  3KGC A;  4RY1 A;  4PFI A;  4AB5 A;  4XKQ A;  4KXP A;  1B9J A;  4O3B A;  1A99 A;  3GBA A;  4ZE8 A;  4Q0C A;  3O97 A;  3USD A;  2ZMB A;  2XD3 A;  1IZ1 A;  3TKD A;  1URG A;  3QSL A;  3IOT A;  5I58 A;  3E9X A;  2HEU A;  3FVK A;  2Q89 A;  1EZO A;  4AB6 A;  1UTB B;  4MNC A;  1TT1 A;  1SI1 A;  3H6V A;  5A5X A;  3CFZ A;  4OET A;  3V89 B;  3O6G A;  1A40 A;  5T3J A;  4MAG A;  3WAE A;  1YYZ A;  3RY3 A;  5FBP A;  1IME A;  4LA9 A;  4OEN A;  4TLM B;  4U2R A;  4F3S A;  1QUL A;  1HSE A;  1MY2 A;  3LSL A;  3PPP A;  3SDF A;  1H43 A;  4H8J A;  1B0L A;  3RTW B;  1I6A A;  1MXU A;  3PUX E;  4LUB A;  1N7X A;  1QUK A;  4OEU A;  5I2N B;  1NNT A;  2F6G A;  3FAT A;  5I57 A;  4NHB A;  1MDP 1;  4OTE A;  5CC2 A;  3FGS A;  2YJP A;  3NOH A;  4NF6 A;  3RPW A;  4X8R A;  4GD5 A;  1JP4 A;  2CZI A;  4YB5 A;  3HST A;  3D4G A;  1JEU A;  5DW8 A;  4C1T A;  2XWO A;  3G3J A;  4ZDM A;  3SEU A;  4IGT A;  5KDT B;  4N6K A;  3DP8 A;  1LLS A;  4UAC A;  1PBP A;  3UIF A;  3S9M C;  3W9V A;  1PDA A;  3RT8 A;  1FJ6 A;  4GOT A;  2D5W A;  4MMP A;  5DYH A;  1TXF A;  1S50 A;  2O6A A;  3TOD A;  3IO6 A;  1MQJ A;  1I69 A;  4QSE A;  3KN8 A;  2FIX A;  2AIX A;  4MX6 A;  2Y84 A;  3G3G A;  1A8E A;  2X7Q A;  1XVY A;  1M5C A;  4GWX A;  4PE5 B;  5LTC A;  1FPL A;  2ZNS A;  1OLA A;  3HHF A;  4R6K A;  1NV2 A;  3C9H A;  4DXU A;  2O69 A;  3PUZ E;  1Y3N A;  4F2O A;  3FIR A;  4LAT A;  4THI A;  1N76 A;  3LSW A;  4QSC A;  4R6Y A;  3KFM A;  4XEQ A;  2FIE A;  5ET8 A;  2GHB A;  3VV5 A;  5EHM A;  4QFK A;  5AA2 B;  4R2F A;  3VLU A;  5KCJ A;  5I84 A;  4OXV A;  4OWD A;  2VD2 A;  4ISU A;  1SDX A;  2ZYO A;  2HZK A;  1NV4 A;  4YAH X;  1Y3P A;  4NGU A;  4QFP A;  1SBP A;  5DVJ A;  1ZU0 A;  1H45 A;  2HAU A;  3KZG A;  4F39 A;  4LZ5 A;  4DDD A;  2GQ1 A;  3M3L A;  1L5T A;  1LBW A;  3B6W A;  1MY0 A;  4KPT A;  3KN3 A;  4PQJ A;  1Q35 A;  3PPQ A;  2XWV A;  4HE1 A;  3DM0 A;  3F11 A;  4HE0 A;  1DTG A;  2OZZ A;  1H3D A;  1URD A;  1SYI A;  3DP6 A;  2B4M A;  1IXC A;  1NH7 A;  3DP4 A;  5JTY A;  2ALU A;  3ODB A;  1SQY A;  4QFL A;  4KFQ A;  3T9V A;  4G68 B;  3HV1 A;  3RYD A;  1US5 A;  5TPA A;  1ZTY A;  5HM4 B;  2NUV A;  2O7I A;  3MWB A;  3P7I A;  4BDM A;  2HPG A;  2UVJ A;  1UTB A;  1FPD A;  2AL5 A;  3B50 A;  4N13 A;  2QVU A;  2DWJ A;  2YPN A;  3O6I A;  2QS4 A;  5K2X A;  3FBP A;  1NUW A;  3KJ7 A;  4X48 A;  2RCB A;  4EXK A;  4KYE A;  4PFB A;  2XD2 A;  3G3I A;  3HPI A;  1R6Z A;  3LV0 A;  4NTL A;  4PAF A;  2V4C A;  4H0W A;  2P2A A;  2GH9 A;  5EYF A;  1MPB A;  3K1N A;  4NAP A;  3TUS A;  4GL0 A;  3FD3 A;  2Q9T A;  2QS3 A;  5ELV A;  3CG1 A;  4FIM A;  3K2D A;  4MCO A;  1GGG A;  1Y1M A;  3E78 A;  2UXA A;  1TFA A;  2O51 A;  1NUY A;  1MY1 A;  2H5Y A;  4DE8 A;  5IZ1 A;  4FJP A;  3MP6 A;  1NV6 A;  3N94 A;  5J16 A;  3FXB A;  2XXT A;  3FXR A;  4GWU A;  2Q74 A;  3PPR A;  3K02 A;  1XOC A;  1P1O A;  3IB0 A;  3SES A;  4N81 A;  2KQZ A;  4PF6 A;  2O1L A;  1JET A;  1MXY A;  1YTV A;  3RNN A;  3KBR A;  3R7X A;  1LBX A;  5ITO A;  3TQL A;  3U72 A;  2I3W A;  1GR2 A;  3K6U A;  1MQG A;  4U4S A;  5AE4 A;  5L9O A;  4NG7 A;  2RC8 A;  3QUF A;  3VLW A;  4IY6 A;  1XC1 A;  1G0I A;  4ELR A;  1WOD A;  4C0R A;  4RPO A;  2OWT A;  2Z22 A;  3N26 A;  4XIG Q;  4N07 A;  4G68 C;  3TMG A;  4G61 A;  1NNK A; 
#chains in the Genus database with same CATH homology
 1OVT A;  3MC2 A;  4LZ7 A;  4BDR A;  2GHA A;  2X7P A;  4YB6 A;  4PFW A;  3BBR A;  3OO7 A;  5I58 B;  2ZNT A;  3MBP A;  2V3Q A;  3OXN A;  5A5X B;  1FTO A;  2WKY A;  3LC8 A;  3G3H A;  3MZB A;  3TZA A;  4MF3 A;  3FXQ A;  5BWJ A;  2RKM A;  4MH5 A;  4DLD A;  3RN8 A;  4IY5 A;  4R74 A;  3JV9 A;  2XXU A;  3VXB A;  3BFT A;  4HCW A;  4GXA A;  1WVJ A;  1B7U A;  3VVF A;  1Y3Q A;  1P1U A;  4ESX A;  4P11 A;  1A7L A;  4RK9 A;  5FHN A;  4GQO A;  1NL5 A;  3LSX A;  4NF4 A;  4ZEK A;  5AA1 A;  2DSF A;  4G8H A;  1FQB A;  4F22 A;  1B58 A;  3EHT A;  4DXC A;  3K1M A;  3B6Q A;  1NFT A;  1P1Q A;  1MDQ A;  1DTZ A;  5J1D A;  3TTL A;  2I58 A;  2NXO A;  1B5H A;  4IO6 A;  2DWH A;  2AL4 A;  2Q88 A;  5FHM A;  5IKB A;  1HSJ A;  3CRB A;  1R9L A;  3CIJ A;  3Q27 A;  4I8C A;  4UA8 A;  4R9G A;  3H6W A;  3K0V A;  3KJT A;  1ZLQ A;  4KYD A;  3THI A;  4MBP A;  4GF8 A;  4FOR A;  3QUJ A;  1Z7N E;  2QS1 A;  3CG3 A;  3MW0 A;  2QSX A;  4KCC A;  3H6U A;  2XXX A;  3UK4 A;  2XXI A;  3S2V A;  3EHS A;  3OEL A;  3SEX A;  1PB8 A;  5CI5 A;  1FW0 A;  4I1D A;  3RGY A;  1LAG E;  4LZ8 A;  2R71 A;  1YCJ A;  1SW4 A;  3PMX A;  2XHD A;  1MPD A;  3T96 B;  3VXC A;  2XXQ A;  3VVD A;  3O29 A;  4ZEB A;  5DT6 A;  4KD5 A;  2P0S A;  2PX1 A;  4XKR A;  3LSF B;  2DP8 A;  4WED A;  3TTN A;  2KLF A;  1IEJ A;  3FUZ A;  1A54 A;  1D9Y A;  4NE4 A;  2NOO A;  3T93 B;  3G3K A;  1PC3 A;  5L9S A;  3MUQ A;  3KG2 A;  5JTY B;  4DCY A;  1JW5 A;  2E0S A;  2F36 A;  4FED A;  2F7A A;  4XKP A;  3MZ9 A;  1LAH E;  4PP0 A;  5TPA B;  4F1V A;  5ITP A;  1DPP A;  4HW8 A;  2CMO A;  1BP5 A;  4RYA A;  1LFH A;  5CMK A;  2UYE A;  3JYR A;  3FVN A;  4H5F A;  3E4R A;  2I4B A;  4LQ5 A;  3RQT A;  1QUI A;  4O3A A;  1JEV A;  1LBB A;  4R72 A;  3HN0 A;  3IB1 A;  3L6G A;  4F1U A;  1SW2 A;  3PPO A;  4OYV A;  4FEB A;  2QS2 A;  5CM6 A;  3IR1 A;  4MLQ A;  3KOT A;  4BDN A;  1LAX A;  3UN6 A;  4G8M A;  1QJM A;  3N5L A;  1JQF A;  3TAJ A;  3A09 A;  2X26 A;  2ESN A;  1RKM A;  3QK6 A;  4X9T A;  4POX A;  5EHS A;  4H8I A;  3T22 A;  1H44 A;  1FQC A;  3IL1 B;  3LBS A;  2V93 A;  1ZIU A;  2PT2 A;  1B2H A;  3U8Q A;  3K1P A;  3S9L C;  4GIZ A;  4POW A;  4G2Z A;  1N04 A;  2H98 A;  1QKB A;  1TFD A;  3EF7 A;  5F7V A;  3WAF A;  1AMF A;  1RYX A;  1GV8 A;  4F1Y A;  4F3P A;  4QFO A;  2FA7 A;  3UA8 A;  3IOV A;  1UIV A;  5DEX A;  4R2B A;  3V83 A;  1OQH A;  1KWH A;  3H6T A;  4C1U A;  1Z7M E;  3C31 A;  4GLI A;  2ANJ A;  1PB7 A;  1B3H A;  1B5J A;  4EUO A;  3O9P A;  4FAT A;  3B7D A;  4K3F A;  1DMB A;  2VGQ A;  3H7M A;  2DS9 A;  2V25 A;  5I56 B;  2Y7K A;  2RIN A;  1D4N A;  3OO9 A;  1QUJ A;  4F19 A;  4JWX A;  1SYH A;  2DE4 A;  4RK2 A;  1B46 A;  5AA2 D;  4BLA A;  1LCF A;  2ZXT A;  2V84 A;  3C34 A;  2ONK E;  2XXH A;  4M1V A;  1MM7 A;  2VP1 A;  1CE2 A;  3QYT A;  4U1Z A;  4PFT A;  1PEB A;  2OBG A;  3EQ1 A;  3N6T A;  4HS7 A;  3I6V A;  1USY H;  4N6P A;  1MQI A;  2F35 A;  1S9T A;  2HZL A;  1R1N A;  1M5F A;  2F8D A;  3E13 X;  2E1S A;  4FEC A;  4GFR A;  4KHZ E;  5KZT A;  2HAV A;  1MY3 A;  2VOZ A;  1N0T A;  3UP9 A;  4X1D A;  4P0I A;  5I2K A;  4OHN A;  3KEI A;  3BKI B;  2OCU A;  4L17 A;  4NF4 B;  3RUM A;  1M5B A;  1B51 A;  1GVC A;  3S4U A;  1EZP A;  4YKP A;  3TYH A;  1OLC A;  3HO7 A;  2REJ A;  3KSJ A;  3U93 A;  1B7H A;  4F18 A;  4U21 A;  4U1O A;  1AL3 A;  1UTH A;  5HBC A;  1P99 A;  2QRY A;  2B3F A;  3EPE A;  3FJ7 A;  3TCF A;  2M8C A;  1Y20 A;  4XTC Q;  3B6T A;  1UIU A;  4R6H A;  1XT8 A;  1FTM A;  2RC9 A;  3C36 A;  4ZEF A;  2OWS A;  2VD3 A;  1B4Z A;  2QMX A;  2DQV A;  4EF1 A;  2XXR A;  3H3G A;  4F31 B;  4DCX A;  2HQ0 A;  2ZYK A;  5FHO A;  4MLV A;  3RTF B;  3QAX A;  3HHG A;  3O6H A;  2REG A;  2HXW A;  3CFL A;  3V5A A;  4JWY A;  2HCA A;  3T9H B;  3H06 B;  4OFO A;  3TEL A;  3N6U A;  1FQE A;  4WXJ A;  3TCH A;  1XS5 A;  4ONY A;  2UVI A;  2UVG A;  1N84 A;  4IO4 A;  3VFJ A;  1BIY A;  2F34 A;  4HCY A;  3PMW A;  1A55 A;  1NKX A;  3R6U A;  2Y7W A;  1XVX A;  4HTG A;  3OSQ A;  4GXS B;  4ZZE A;  5TP9 A;  1FQD A;  2DYX A;  5ICQ A;  2PT1 A;  3MJN A;  4YKK A;  5I56 A;  4ZEC A;  5AA4 B;  2Q2C A;  1MS7 A;  4JB7 A;  2O1M A;  3C32 A;  1YAE A;  4XKN A;  5H8H A;  3FZV A;  5CBS A;  1P1N A;  1VFE A;  4JBZ A;  3TTR A;  3O28 A;  2D21 A;  2GRV A;  2OLB A;  4ELO A;  2O7U A;  1Y4C A;  4G8N A;  5CMB A;  3KSX A;  4G77 A;  1MM6 A;  2THI A;  1Q1K A;  2XXV A;  3PD8 A;  1OIB A;  3IK6 B;  4ESW A;  4GRK A;  2A5S A;  1FTK A;  2OJT A;  3M3K A;  5IAI A;  3FV1 A;  2PBW A;  4QRZ A;  4IO3 A;  2ZYN A;  3SET A;  2HFB A;  4OVJ A;  3T9X B;  4NWD A;  3LR1 A;  3ECR A;  4NWC A;  3U92 A;  4DXB A;  1R9Q A;  4QHQ A;  2Z8F A;  4LVQ A;  1LGB C;  4OMB A;  2A5T A;  4WEP A;  1MQH A;  1ZJL A;  3TTM A;  5I59 A;  4U22 A;  3IOR A;  1O7T A;  1PB9 A;  4F3G A;  3H4Z A;  3IX1 A;  1B52 A;  1SD3 A;  2IEE A;  3CVG A;  2XXY A;  1ZBM A;  1USY E;  4LON B;  4RNS A;  2UVH A;  3CI8 A;  4RXL A;  3AXF A;  1D9V A;  2Z23 A;  3Q28 A;  5B7D A;  2VHA A;  1CB6 A;  3MQ9 A;  3PUW E;  5DEX B;  4U23 A;  2DXR A;  4OEV A;  1QW0 A;  4YB7 A;  2F7B A;  2G29 A;  4EF2 A;  4JSD A;  3MVY A;  5CBR A;  4IO2 A;  4DZ1 A;  3EHU A;  3FJM A;  2OK2 A;  1O64 A;  2W7Y A;  3BFU A;  4IGR A;  3ONM A;  5H8Q B;  3MP8 A;  1B6H A;  3C4M A;  5L9M A;  1D3K A;  3Q26 A;  3ZKL A;  1IUD A;  1LAF E;  1F9B A;  1FTJ A;  4QFN A;  2XXW A;  4PET A;  4NF8 B;  3K6X A;  4F2Q A;  1N3X A;  3RLF E;  2XX8 A;  3ILU B;  4LP2 B;  4RJZ A;  5H8F A;  4H67 A;  4EQB A;  3C35 A;  1EZ9 A;  2I49 A;  2DOJ A;  2DWA A;  2F97 A;  4YU0 A;  5AA4 A;  1O63 A;  5JK4 A;  4GVO A;  4EDP A;  2F78 A;  5JEI A;  3IJX B;  3PU5 A;  1MQD A;  4YIC A;  3Q29 A;  5I2K B;  5FTI A;  5K2Y A;  3G3F A;  3GLB A;  2ABH A;  4I62 A;  4OFL A;  1Y4T A;  4YKI A;  1I6Q A;  4RPN A;  3FAS A;  1ELJ A;  5H8N B;  1P1W A;  2I3V A;  4G4P A;  3W15 C;  4OZ9 A;  2IA4 A;  3L6H A;  1MXZ A;  4EQ9 A;  3U1O A;  3TCG A;  3MAM A;  2DVC A;  4NF5 A;  1UTH B;  2ZNU A;  3QXM A;  1IXG A;  3UGW A;  2I0B A;  3OEN A;  3QIM A;  4FAJ A;  4H5G A;  1QKA A;  3VE1 B;  2LAO A;  2Z8E A;  1DOT A;  2Q8J A;  2F6P A;  3FVG A;  3TFL A;  3GBB A;  3SKP A;  4ELQ A;  4Q30 B;  5AA3 A;  1FQA A;  1MXX A;  3S9E A;  3MVW A;  5FTH A;  1A8F A;  3U94 A;  2FNC A;  4QF9 A;  4H6D A;  5H8S A;  2I48 A;  3OSR A;  3VLV A;  1MRP A;  1LFG A;  2B3B A;  4Z7E A;  5ICT A;  2H4I A;  1SI0 A;  2O68 A;  5M2V A;  4KI0 E;  4TLL B;  3TQW A;  1AOV A;  2AYS A;  4XXU A;  2NVU B;  1OQG A;  4I9D A;  5TP9 B;  3ZSF A;  1FTL A;  4JWO A;  4IO5 A;  1JVY A;  3VDF A;  4PFU A;  3TEP A;  1LB9 A;  3M8U A;  3CSB A;  1GTK A;  1BTJ A;  4EQ7 A;  1IXI A;  5H8Q A;  5CMC A;  4LQ2 A;  4TOZ A;  4E0W A;  2F7C A;  1UQW A;  1US4 A;  2PVU A;  5H8H B;  2RC7 A;  4KQP A;  1IIT A;  1JNF A;  2CZL A;  3OOA A;  1B3E A;  3VVE A;  4NF8 A;  3ZS6 A;  4OER A;  3KOS A;  1RYO A;  4O3C A;  5L8D A;  1DPE A;  4OQO A;  3O2A A;  4WKM A;  3K6V A;  1JW1 A;  4OFJ A;  3K4U A;  4YMB A;  1NNF A;  5CRY A;  3IOU A;  3K01 A;  1URS A;  3SEY A;  1ZKB A;  2V3T A;  1QVS A;  3PMV A;  4ECF A;  4IB2 A;  1NMU A;  3RT6 B;  1JVX A;  2A5T B;  2QJE A;  2GFE A;  2D3I A;  3MVZ A;  3PUY E;  3E3K A;  5F1Q A;  3DEL B;  1POT A;  5I59 B;  5H8N A;  1B32 A;  3PPN A;  3EN3 A;  3Q25 A;  1OMP A;  2H99 A;  2Y7I A;  2QPQ A;  1M5E A;  4H65 A;  3T9U A;  4ZE9 A;  1B05 A;  1LBC A;  4R75 A;  1B3G A;  4E0X A;  1LFI A;  3O66 A;  4KYS A;  1WDN A;  1IQ7 A;  2DVZ A;  4KR5 A;  1S7Y A;  2B65 A;  1II5 A;  1IXH A;  3MPL A;  4IO7 A;  4TQU Q;  1NNP A;  4ZZA A;  3T66 A;  1B3F A;  1B40 A;  2DWI A;  3FXU A;  2Y7P A;  3PD9 A;  3IO4 A;  2UYF A;  1B3L A;  1TWY A;  2ONS A;  1LB8 A;  3D4C A;  4DIG A;  4PFY A;  2NWJ A;  5I2N A;  3PUV E;  1LCT A;  4R9F A;  3CFX A;  3FV2 A;  1AH5 A;  5CMM A;  5LOM A;  4ZED A;  4JXI A;  1FQF A;  1XHY A;  3PGF A;  1BLF A;  4YZZ A;  5KDT A;  1M5D A;  3MP1 A;  3OO8 A;  1VFD A;  4EXL A;  5H8F B;  5BUU A;  1N7W A;  1SW1 A;  2V3U A;  3A3U A;  4F29 A;  2XX9 A;  4OES A;  2Z8D A;  4QSD A;  3DLN A;  1LST A;  3G7W A;  3SEV A;  1T0K A;  2FYI A;  1FCK A;  4X1B A;  1Y1Z A;  1ATG A;  2G93 A;  1DSN A;  1PBQ A;  3IAZ A;  4H1X A;  3CR9 A;  2DE3 A;  3I3V A;  4NED A;  4BDL A;  1MH3 A;  1J1N A;  2ZYM A;  4Q5T A;  3W9W A;  5AA2 A;  2ONR A;  2XXP A;  2PMS A;  3TTK A;  3GXA A;  3OMB A;  2I6E A;  4NF5 B;  3MPK A;  1OVB A;  4GL8 A;  1N3W A;  2DE2 A;  4GWO A;  1MXW A;  3ZKK A;  3SER A;  3S9N C;  4F3B A;  2XX7 A;  4NMY A;  3PV0 E;  4R73 A;  3OEM A;  3K00 A;  1NH8 A;  3JZJ A;  2H25 A;  1B4H A;  5B70 A;  1Y9U A;  1B1X A;  2RCA A;  4FE8 A;  4M4G A;  2DXY A;  2QL3 A;  4G68 A;  1VE4 A;  2RF1 A;  3MVX A;  3K6W A;  5TU0 A;  3TPA A;  3FVO A;  5I57 B;  3A3C A;  2I4C A;  3IB2 A;  2R9J A;  3FJG A;  4NF6 B;  3OO6 A;  1MG1 A;  4Q8R A;  2F5X A;  4KCD A;  4U4X A;  5DTB A;  2Q2A A;  5DVI A;  1YPN A;  1MPC A;  3R26 A;  1EH3 A;  1POY 1;  3UOR A;  4AQ4 A;  3HCQ A;  1AIV A;  2BJJ X;  4BDO A;  2R6G E;  3M3F A;  1H76 A;  4ZS9 A;  1B7Z A;  4JSO A;  1SW5 A;  4P0G A;  3GZG A;  4RA1 A;  4JDF A;  4ELP A;  4YKJ A;  2YLN A;  2PYY A;  2O84 X;  4MFI A;  1ANF A;  1IIW A;  5ISU A;  4YMA A;  3CSG A;  1MXV A;  4ZEI A;  3ILT B;  3IJO B;  3V8X B;  3TDJ A;  3I5O A;  3MZ1 A;  1EU8 A;  3OD7 A;  5DVF A;  1BKA A;  1ZMG A;  1MY4 A;  3IOW A;  1B5I A;  1VSO A;  1JW4 A;  3LUY A;  1SVX B;  1B0H A;  5HPQ A;  3C33 A;  4Z0I A;  1I6B A;  3KN7 A;  4ND9 A;  5KCJ B;  2I0C A;  3OEK A;  1VR5 A;  2Y7R A;  3SEW A;  1HSL A;  2P1S A;  1MH4 A;  4BDQ A;  3H03 A;  1B1H A;  2H9B A;  3KGC A;  4RY1 A;  4AB5 A;  4XKQ A;  1B9J A;  4O3B A;  1A99 A;  3GBA A;  4ZE8 A;  4Q0C A;  3O97 A;  3USD A;  2ZMB A;  2XD3 A;  1IZ1 A;  3TKD A;  1URG A;  3QSL A;  3IOT A;  5I58 A;  3E9X A;  2HEU A;  3FVK A;  2Q89 A;  1EZO A;  4AB6 A;  1UTB B;  1TT1 A;  1SI1 A;  3H6V A;  5A5X A;  3CFZ A;  4OET A;  3V89 B;  3O6G A;  1A40 A;  3WAE A;  3RY3 A;  4LA9 A;  4OEN A;  4TLM B;  4U2R A;  4F3S A;  1QUL A;  1HSE A;  1MY2 A;  3LSL A;  3PPP A;  3SDF A;  1H43 A;  4H8J A;  1B0L A;  3RTW B;  1I6A A;  1MXU A;  3PUX E;  4LUB A;  1N7X A;  1QUK A;  4OEU A;  5I2N B;  1NNT A;  2F6G A;  3FAT A;  5I57 A;  1MDP 1;  4OTE A;  5CC2 A;  3FGS A;  2YJP A;  3RPW A;  4NF6 A;  4GD5 A;  4YB5 A;  3HST A;  3D4G A;  1JEU A;  4C1T A;  3G3J A;  4ZDM A;  3SEU A;  4IGT A;  5KDT B;  3DP8 A;  1LLS A;  4UAC A;  1PBP A;  3UIF A;  3S9M C;  3W9V A;  1PDA A;  3RT8 A;  4GOT A;  2D5W A;  5DYH A;  1TXF A;  1S50 A;  2O6A A;  3TOD A;  3IO6 A;  1MQJ A;  1I69 A;  4QSE A;  3KN8 A;  2AIX A;  2Y84 A;  3G3G A;  1A8E A;  2X7Q A;  1XVY A;  1M5C A;  4PE5 B;  2ZNS A;  1OLA A;  3HHF A;  4R6K A;  3C9H A;  4DXU A;  2O69 A;  3PUZ E;  1Y3N A;  4F2O A;  3FIR A;  4LAT A;  4THI A;  1N76 A;  3LSW A;  4QSC A;  4R6Y A;  3KFM A;  2GHB A;  3VV5 A;  5EHM A;  4QFK A;  5AA2 B;  4R2F A;  3VLU A;  5KCJ A;  5I84 A;  4OXV A;  4OWD A;  2VD2 A;  4ISU A;  1SDX A;  2ZYO A;  2HZK A;  4YAH X;  1Y3P A;  4QFP A;  1SBP A;  5DVJ A;  1ZU0 A;  1H45 A;  2HAU A;  3KZG A;  4F39 A;  4LZ5 A;  4DDD A;  3M3L A;  1L5T A;  3B6W A;  1MY0 A;  4KPT A;  3KN3 A;  4PQJ A;  1Q35 A;  3PPQ A;  3DM0 A;  3F11 A;  1DTG A;  2OZZ A;  1H3D A;  1URD A;  1SYI A;  3DP6 A;  1IXC A;  1NH7 A;  3DP4 A;  5JTY A;  2ALU A;  3ODB A;  1SQY A;  4QFL A;  4KFQ A;  3T9V A;  4G68 B;  3HV1 A;  1US5 A;  5TPA A;  1ZTY A;  5HM4 B;  2NUV A;  2O7I A;  3MWB A;  3P7I A;  4BDM A;  2UVJ A;  1UTB A;  2AL5 A;  4N13 A;  2YPN A;  2DWJ A;  3O6I A;  2QS4 A;  5K2X A;  3KJ7 A;  4X48 A;  2RCB A;  4EXK A;  4KYE A;  2XD2 A;  3G3I A;  3HPI A;  1R6Z A;  4NTL A;  4H0W A;  2P2A A;  2GH9 A;  5EYF A;  1MPB A;  3K1N A;  3TUS A;  4GL0 A;  3FD3 A;  2Q9T A;  2QS3 A;  5ELV A;  3CG1 A;  4FIM A;  3K2D A;  1GGG A;  1Y1M A;  2UXA A;  1TFA A;  2O51 A;  1MY1 A;  2H5Y A;  4DE8 A;  4FJP A;  3MP6 A;  3N94 A;  2XXT A;  3FXR A;  3PPR A;  3K02 A;  1XOC A;  1P1O A;  3IB0 A;  3SES A;  2O1L A;  1JET A;  1MXY A;  1YTV A;  3RNN A;  3KBR A;  3R7X A;  5ITO A;  3TQL A;  3U72 A;  2I3W A;  1GR2 A;  3K6U A;  1MQG A;  4U4S A;  5AE4 A;  5L9O A;  2RC8 A;  3QUF A;  3VLW A;  4IY6 A;  1XC1 A;  4ELR A;  1WOD A;  4C0R A;  4RPO A;  2OWT A;  2Z22 A;  3N26 A;  4XIG Q;  4N07 A;  4G68 C;  3TMG A;  2QMW A;  1NNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...