4R72A

Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (apo form)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
318
structure length
318
Chain Sequence
KGRLVIYCSATNVMCENAAKTFEQKYDVKTSFIRNGSGSTFAKIEAEKNNPQADVWYGGTLDPQSQAGELGLLEAYRSPNIDQIMPKFQDPAKVKGNLSSAVYIGILGFAVNTERLKKLGIEKIPQCWNDLTDPKLKGEIQIADPQSSGTAYTAIATFAQLWGEDKAFDYFKHLHPNISQYTKSGITPARNAARGETTVGIGFLHDYALEKEQGAPLEMVVPCEGTGYELGGVSILKGARNLDNAKLFVDFALSKEGQETAWKKGQALQTLTNTTAEQSPLAFDLTKLKLIDYDFEKYGASDERKRLINKWVDEIKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC-type Fe3+ transport system, periplasmic component
publication title Active Transport of Phosphorylated Carbohydrates Promotes Intestinal Colonization and Transmission of a Bacterial Pathogen.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
total genus 120
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r72A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r72A01
3QYTA 2GHBA 4WEDA 1P1WA 2GH9A 3HHFA 3L6HA 4H0WA 4RJZA 5EYFA 2X7QA 5M2VA 3ZKKA 2XXVA 2GFEA 1HSLA 1VFDA 1NNPA 1GGGA 4R74A 4P0IA 1D4NA 2H98A 2QL3A 1B4HA 3FV1A 4OYVA 4AB5A 4ZDMA 4C1UA 3IORA 3KN3A 4HCWA 4PP0A 4YMBA 2O84X 1P99A 3K6VA 3IJXB 1VR5A 4O3AA 2XXUA 1XC1A 4MH5A 1B0LA 3PMXA 5H8HB 5JTYA 1IXGA 1TWYA 4NF6B 2Y7PA 1QJMA 3QUJA 2HAUA 2E0SA 1LBBA 1LBCA 4N13A 4KHZE 2Z8FA 5K2YA 4OFLA 1N04A 3MP8A 1MQIA 2Q89A 3K6XA 3Q28A 1DTZA 2DWHA 5HM4B 1NFTA 5L9OA 2UVJA 3PGFA 3FGSA 4XIGQ 3MW0A 5EHSA 4L17A 5H8FB 2QS4A 1P1NA 2I0CA 3HCQA 1QVSA 1SDXA 3LC8A 2YPNA 1SD3A 4LZ8A 4ZEBA 4EF2A 4E0WA 4POXA 3IOTA 3MJNA 3H06B 3SKPA 3PU5A 1VE4A 1DSNA 2PT1A 5H8HA 2PMSA 2Z23A 1MQHA 1MPDA 1J1NA 3LUYA 2A5SA 1B4ZA 5CMMA 1YCJA 2Y84A 3TAJA 3MWBA 1A99A 4KYDA 2VD3A 3MPLA 4KFQA 3T66A 2OCUA 3PMWA 1SYIA 3SEYA 3SEVA 3KOTA 4NF8B 2QS3A 2HFBA 4G68A 4MLVA 3FJGA 1TXFA 4U1ZA 4NF4A 4Q0CA 3C4MA 3CFXA 4ZEFA 3M3KA 1MY2A 1FQFA 2QRYA 3C36A 3N5LA 1IZ1A 4HS7A 4KCCA 1QUJA 4BDNA 4ESWA 4KPTA 4LZ5A 2XXRA 1N0TA 2DVZA 4YMAA 2UYEA 4QFOA 4RYAA 4X1BA 5A5XB 1B58A 3HN0A 3U92A 3O6IA 3P7IA 2R9JA 3SESA 2DXRA 3ZKLA 2DQVA 3SERA 3OO6A 1XVYA 3K1PA 3OO8A 2DE4A 1TFAA 1MH3A 1SYHA 3FXUA 2B3FA 1LB9A 3M3LA 4Q30B 2H4IA 3G3KA 4WKMA 3A3UA 3RN8A 3V5AA 5H8NB 1NL5A 2O7UA 3EF7A 3TCGA 4F31B 1LB8A 4IY5A 2DYXA 4JWYA 4ELPA 3DP6A 1BLFA 1ZMGA 1OLCA 2DXYA 4F19A 2ANJA 1JVXA 4YKIA 2GRVA 2H5YA 3OSRA 1FQCA 2UVIA 1KWHA 3B6TA 2YJPA 2PX1A 4H1XA 2UXAA 5L8DA 1TT1A 4BDMA 5FHMA 5AA4A 5B70A 3TTLA 1ELJA 2ZYOA 1MXVA 1FQDA 3IOWA 3SETA 3T93B 3K02A 3KSJA 1L5TA 4FIMA 5CM6A 1B3GA 5HBCA 5DVJA 4OVJA 5L9MA 4F3BA 1B7ZA 5CBRA 5H8NA 3RTFB 4RY1A 3UORA 1B2HA 1NMUA 3H6UA 3VLUA 4F29A 1PEBA 4KCDA 3RQTA 3G3FA 1NNTA 4JB7A 3IB0A 4TQUQ 2Z8EA 1EH3A 4BLAA 2REGA 1R9QA 4I62A 1UTHB 3RLFE 2I48A 3ZS6A 4G8MA 1QW0A 4RNSA 4POWA 4KYSA 1MDP1 1MXZA 1LFIA 3PUXE 2OJTA 4YKKA 3Q26A 2P2AA 3EQ1A 3JV9A 1LAFE 3IR1A 4EF1A 1N7XA 1MQGA 3HSTA 4R9FA 2I3VA 1B3HA 3FXRA 4GFRA 1OVTA 4XKRA 3FIRA 3C31A 1CE2A 1JW1A 1MY3A 1M5BA 1NNFA 4TOZA 3T96B 3ILUB 2V25A 2XHDA 3U72A 3O9PA 4C1TA 1Q35A 1WDNA 1M5EA 1RKMA 3H4ZA 1EU8A 4OHNA 5H8SA 5AA2B 5CMCA 5KDTB 3N94A 3MVZA 4JWOA 1MXYA 1R9LA 2G29A 4FORA 3LR1A 2XXQA 1XT8A 4Q8RA 2I0BA 3A3CA 3TQLA 2F34A 1OIBA 2F7BA 4X1DA 2R6GE 2NVUB 2ZMBA 1Z7ME 3GBBA 1B3FA 4PFYA 1LFHA 1MY0A 3T22A 2V84A 3SEXA 3TFLA 1B5JA 3IL1B 4RK2A 4R72A 1XOCA 4PFUA 2XXWA 2RC9A 3UIFA 2F5XA 4QSDA 3G3IA 1H76A 4F1VA 1AH5A 4DIGA 4OXVA 4IO3A 1LCTA 3PPRA 4QRZA 1PB9A 1NH8A 3RT8A 3CFZA 2QJEA 1EZOA 4RPNA 3FVOA 3SEWA 2OBGA 4IY6A 1JW4A 1FQAA 1I6BA 3MQ9A 2HCAA 4OEVA 4LA9A 4F1YA 1FTKA 4IGTA 4NWCA 1JEVA 2AL4A 3DP8A 4RXLA 3VXCA 1OLAA 1US5A 1GR2A 4PQJA 1PB8A 2D5WA 3KN8A 3V83A 4XXUA 4NF5B 5L9SA 2Q2CA 3MVXA 4GRKA 3OXNA 4U21A 5F7VA 4BDLA 4ZZEA 3MP1A 4OETA 2Q9TA 4LP2B 3OO9A 1B51A 4LATA 2I3WA 4G68C 4KD5A 1QKAA 1WODA 1GV8A 1URSA 2O7IA 3EPEA 3N26A 3T9HB 2UYFA 2F97A 2D21A 4RPOA 3PMVA 3IK6B 4ZEDA 4U1OA 3DP4A 3HV1A 4ELQA 1SI1A 4JDFA 3JZJA 3PPPA 1BTJA 2A5TB 4LONB 1PDAA 4AB6A 3PPNA 3H7MA 4UACA 3C33A 3CG3A 1VFEA 4ZS9A 5TU0A 4DZ1A 5AA1A 2UVGA 3H03A 2X7PA 3G3HA 4QSCA 1LAXA 5IKBA 3BFUA 3TQWA 4H65A 2O51A 4F39A 3CI8A 1QULA 4R6YA 1A55A 3E4RA 1S50A 4GQOA 2X26A 4JSDA 3PUVE 1AL3A 1ATGA 3TCHA 4R75A 4LQ5A 1IUDA 4NE4A 1POY1 1EZPA 5I2KB 3EHSA 1Y9UA 2QMWA 4BDQA 3PUZE 3VE1B 4OERA 4GL0A 1MQJA 4NF6A 1B1HA 5KZTA 1SBPA 4OMBA 2RC8A 2RC7A 2A5TA 2QS1A 1VSOA 1B46A 3IOUA 1P1UA 1SW4A 3G3JA 1NH7A 4UA8A 3MZBA 4RA1A 3WAEA 4MLQA 4U23A 2QMXA 3R6UA 4DXUA 3D4GA 4IO7A 1Y3NA 3UP9A 1B0HA 3RUMA 4GD5A 3TTNA 2XX9A 1IXHA 1Y4TA 2AIXA 3KGCA 5H8FA 4EUOA 5FHNA 1QKBA 3M8UA 5LOMA 4LQ2A 1B5IA 1NKXA 1JVYA 2I4BA 1MPCA 1LSTA 1O63A 3O2AA 1CB6A 1OQGA 4R73A 3WAFA 3MUQA 1ZBMA 2IEEA 4GVOA 3PUWE 1H45A 4U4SA 1Y3PA 3VVDA 4KI0E 3FZVA 1YPNA 1WVJA 1ZU0A 2DWJA 5CRYA 3BFTA 4R6KA 1GTKA 3PV0E 5CMBA 2DE3A 4NF8A 3S9NC 4ZEIA 3FD3A 5J1DA 3MVYA 5DTBA 3ILTB 3TELA 2RF1A 2ONRA 3DELB 2ZYKA 3ZSFA 3W9VA 3MZ9A 1IITA 4MF3A 1LAHE 2F7CA 4ELOA 4NEDA 4F22A 4K3FA 1O7TA 4ZECA 2BJJX 1M5DA 4F1UA 1SVXB 2HZKA 4HW8A 4I8CA 5A5XA 2F8DA 4I1DA 3UA8A 1MRPA 2Y7IA 5JK4A 1MPBA 1QUIA 1UTBB 1O64A 3SDFA 2AYSA 2WKYA 3KFMA 3O97A 3M3FA 5FTHA 2XXIA 2RCAA 1MDQA 5DVIA 2ZNTA 3Q25A 4XKPA 1XVXA 2VD2A 5I58B 1IEJA 5DT6A 1BIYA 4YAHX 3E3KA 3RT6B 1JW5A 2Y7RA 2P1SA 1OMPA 3PPQA 2FYIA 3L6GA 4N07A 1DPPA 3C32A 1A8FA 3GLBA 2P0SA 3HPIA 5AA3A 3I3VA 1JNFA 3CFLA 4WEPA 2V3UA 5I59B 4ESXA 4IO6A 2O1MA 3MP6A 1D3KA 1MG1A 4XTCQ 3DLNA 4BDRA 1MM7A 4G2ZA 4LUBA 2ABHA 1UTBA 3OENA 3QUFA 5DEXB 4X48A 3OEMA 2ONKE 3O6HA 4MFIA 4FEDA 5EHMA 2XX7A 4DCYA 1MY4A 3E9XA 5CC2A 2HAVA 3R7XA 3TCFA 3TTRA 2LAOA 5I58A 3RNNA 3CG1A 3OSQA 4YB6A 3QIMA 3ECRA 3K2DA 2Z8DA 1SW2A 1B40A 4G4PA 1B32A 4JSOA 4P11A 1AIVA 4DXBA 1PB7A 2H9BA 3N6TA 4GOTA 5IAIA 4FJPA 1UTHA 3N6UA 3TKDA 1UIUA 4PFTA 3TZAA 3HHGA 5I2NB 3W15C 4GWOA 5ICQA 3QXMA 3OO7A 5I57B 3KZGA 3FJ7A 2Z22A 3TTKA 2VGQA 3TTMA 5H8QB 3ODBA 3ONMA 1USYH 4QSEA 4BDOA 4R6HA 2ZXTA 4ND9A 2DSFA 5DEXA 4ZE8A 1B52A 2OWTA 3K0VA 4JBZA 4OQOA 2OZZA 1D9YA 4EQ7A 1ZIUA 3IX1A 3THIA 1PBQA 1SW5A 4FE8A 4H8JA 2Q8JA 4FEBA 2H25A 1A40A 3KSXA 2VOZA 1ZTYA 3MPKA 3O29A 3VVEA 4YICA 5DVFA 3TUSA 1AOVA 2ONSA 1FTJA 3T9VA 4KQPA 4OFOA 3UGWA 5B7DA 3T9UA 3C34A 3S9EA 5AA2A 1FTLA 5KDTA 1HSJA 2O69A 4NWDA 2XXTA 1R6ZA 3V89B 4YB7A 1UIVA 3FV2A 4H5FA 5I2NA 2V3QA 5ELVA 1N3XA 2OK2A 3V8XB 1YAEA 4M1VA 4GXAA 4OTEA 4YU0A 1I6QA 5JTYB 4YKPA 3MZ1A 4YZZA 2PT2A 1MQDA 1SI0A 2W7YA 3S4UA 4AQ4A 3CVGA 1I6AA 5HPQA 1Y1MA 1D9VA 4IO2A 1URGA 4N6PA 4QFPA 3S9LC 1FW0A 1JEUA 2IA4A 4GF8A 2NUVA 1FCKA 5KCJB 4R9GA 2HQ0A 3FJMA 3FATA 4ZEKA 1MXUA 1Y4CA 3KBRA 1P1QA 3I6VA 3AXFA 2YLNA 4WXJA 2Q88A 3FVKA 1JETA 2CMOA 3O6GA 3VXBA 1LFGA 5CBSA 3IB2A 4YB5A 3I5OA 4DDDA 4X9TA 1SQYA 3PD8A 3TDJA 4PETA 5TPAB 3S9MC 4PE5B 1TFDA 3FVNA 2KLFA 4DXCA 5BUUA 5ICTA 3TEPA 3OMBA 3EHTA 3C9HA 4DLDA 2NOOA 3W9WA 2XD3A 1LGBC 4EXKA 3GZGA 2ZYMA 4NF5A 4GL8A 3IOVA 2F36A 3KEIA 3Q27A 1R1NA 5ITOA 3OEKA 4ZE9A 2DE2A 1PC3A 3LSWA 1URDA 2RCBA 4F2OA 5KCJA 3CRBA 2FA7A 3EN3A 4G68B 3PPOA 3FVGA 3B6WA 4FECA 1MXWA 2NXOA 1B7HA 1Y20A 4OWDA 4NF4B 1B1XA 4H67A 4GXSB 2F78A 4DCXA 2REJA 2XD2A 1DMBA 5BWJA 1Q1KA 1UQWA 2E1SA 1DTGA 3K6WA 4PFWA 5TPAA 2I49A 3TYHA 4DE8A 1N3WA 1PBPA 4G77A 5I56B 1B7UA 3OOAA 1N7WA 2F6PA 3QK6A 3K1MA 2OWSA 4LZ7A 1S9TA 2I4CA 1ZLQA 2QPQA 1LAGE 3FASA 1FQEA 1MY1A 4U2RA 3U8QA 1P1OA 2F35A 5AE4A 3DM0A 4G8HA 3SEUA 2DP8A 2VHAA 1Y1ZA 2ESNA 1RYXA 4QHQA 2O1LA 4H5GA 3JYRA 3K01A 2XXXA 1IIWA 1M5FA 1BP5A 4F3GA 4R2FA 3O66A 1NNKA 3KOSA 1SW1A 5I2KA 3IB1A 1FTMA 2ALUA 2DOJA 3H3GA 1A8EA 2PVUA 3D4CA 2THIA 2QSXA 3HO7A 2HXWA 1H44A 2FNCA 4OFJA 5I56A 4HTGA 1S7YA 3VDFA 3B7DA 1AMFA 3VLVA 5AA4B 1A7LA 3O28A 1MM6A 4EQBA 3KJ7A 3RY3A 3TPAA 3K6UA 1F9BA 4MBPA 4LVQA 2RKMA 2DWIA 4F2QA 4F18A 1FQBA 1IXCA 3A09A 2Y7KA 1ZJLA 1ZKBA 4EDPA 5K2XA 3K00A 3CSGA 4R2BA 3VVFA 3KG2A 1B05A 3U1OA 3UK4A 5FTIA 1Z7NE 1A54A 2B3BA 4OENA 5ISUA 2GHAA 4HCYA 3LSFB 4H6DA 3KN7A 1H3DA 1EZ9A 2XXHA 1DOTA 1OVBA 2O68A 3IO6A 3G3GA 4JXIA 3LBSA 3RTWB 3EHUA 3MC2A 3TODA 3OD7A 3QSLA 3MAMA 3CSBA 2Y7WA 3F11A 2B65A 5JEIA 1LCFA 2PBWA 1DPEA 1US4A 2HEUA 4EXLA 4GLIA 1FTOA 3UN6A 3U93A 4ISUA 1B3LA 4KYEA 4P0GA 4H8IA 3IJOB 4EQ9A 2DVCA 4GIZA 5CI5A 1OQHA 3TMGA 2XXPA 3CIJA 1B6HA 3USDA 4U4XA 4FATA 2QS2A 1XHYA 3LSLA 1N84A 4ELRA 2V93A 1BKAA 2Q2AA 3PD9A 3KJTA 1T0KA 2D3IA 5TP9B 1JQFA 4IB2A 2XX8A 4FAJA 3OELA 3R26A 5F1QA 2NWJA 3U94A 5AA2D 2ZNUA 4O3BA 1Y3QA 4Z0IA 3FUZA 4QFNA 3IAZA 4G8NA 4O3CA 1IQ7A 4ECFA 1N76A 2PYYA 2ZNSA 1LLSA 5DYHA 4U22A 4THIA 1B9JA 3H6WA 5I84A 1QUKA 3E13X 3VLWA 2R71A 1B3EA 3B6QA 4E0XA 1I69A 1ANFA 4I9DA 4QFKA 5FHOA 2RINA 1HSEA 1USYE 4IO5A 5I59A 1YTVA 3H6VA 4QF9A 3MVWA 4IGRA 2UVHA 4XKNA 2H99A 3BKIB 4OEUA 3IO4A 5TP9A 1POTA 1H43A 4KR5A 1M5CA 1MH4A 4Q5TA 4JWXA 3GXAA 2F7AA 4TLMB 1XS5A 3FXQA 3K1NA 4IO4A 4Z7EA 2O6AA 4XKQA 1MXXA 2I58A 5ITPA 4ZZAA 3RPWA 4OZ9A 1IXIA 4F3SA 1MS7A 3VFJA 3BBRA 3PUYE 3K4UA 2VP1A 4F3PA 3H6TA 4TLLB 2I6EA 4YKJA 3C35A 4RK9A 2V3TA 3LSXA 2AL5A 1GVCA 3RGYA 3S2VA 2M8CA 4QFLA 4NMYA 2OLBA 3GBAA 3QAXA 4NTLA 4ONYA 5I57A 1B5HA 3Q29A 4C0RA 4M4GA 2CZLA 4OESA 5H8QA 5CMKA 2HZLA 3G7WA 2DWAA 2XXYA 3VV5A 2ZYNA 1RYOA 2G93A 3T9XB 1II5A 3MBPA 2F6GA 3CR9A 2DS9A
chains in the Genus database with same CATH superfamily
3QYTA 2GHBA 4WEDA 1P1WA 2GH9A 3NOHA 3HHFA 3L6HA 4H0WA 4RJZA 5EYFA 2X7QA 5M2VA 3ZKKA 2XXVA 2GFEA 1HSLA 1VFDA 1NNPA 1GGGA 4R74A 4P0IA 1D4NA 2H98A 2QL3A 1B4HA 3FV1A 4I40A 4OYVA 4AB5A 4ZDMA 4C1UA 3IORA 3KN3A 4HCWA 4PP0A 5I5PA 4YMBA 2O84X 1P99A 3K6VA 3IJXB 1VR5A 2WYPA 4O3AA 2XXUA 1XC1A 4MH5A 1B0LA 3PMXA 1FRPA 5H8HB 5JTYA 1IXGA 1TWYA 4NF6B 2Y7PA 1QJMA 3QUJA 2HAUA 2E0SA 2B4LA 1LBBA 5F24A 1LBCA 3E78A 4N13A 4KHZE 2Z8FA 5K2YA 4OFLA 3IFCA 1N04A 3MP8A 1MQIA 2Q89A 3K6XA 3Q28A 1DTZA 2DWHA 5HM4B 1NFTA 5L9OA 2UVJA 3PGFA 3FGSA 4XIGQ 3MW0A 1XI6A 4N15A 5EHSA 4L17A 5H8FB 2QS4A 1P1NA 2I0CA 3HCQA 4NX1A 1QVSA 1SDXA 3LC8A 2YPNA 1SD3A 4LZ8A 4ZEBA 4EF2A 4PFRA 4E0WA 4POXA 3IOTA 3MJNA 3H06B 3SKPA 3PU5A 1VE4A 1DSNA 2PT1A 5H8HA 2HXRA 4MEVA 2PMSA 2Z23A 1MQHA 1MPDA 1J1NA 3LUYA 2A5SA 1B4ZA 5CMMA 1YCJA 2CZIA 2Y84A 3BIHA 3TAJA 3MWBA 4PC9A 2FVZA 1A99A 4KYDA 2VD3A 3MPLA 4KFQA 3T66A 2OCUA 3PMWA 1LBYA 1SYIA 2CEXA 3SEYA 3KC0A 3SEVA 3KOTA 4NF8B 3RPLB 3ISPA 2QS3A 2HFBA 4G68A 4MLVA 3FJGA 4GBWA 1TXFA 4U1ZA 4NF4A 1CNQA 4Q0CA 3MSTA 3C4MA 3CFXA 5EQ7A 4ZEFA 3M3KA 1MY2A 2VT5A 1FQFA 2QRYA 3C36A 3N5LA 4X04A 1IZ1A 4HS7A 4KCCA 1QUJA 4BDNA 4ESWA 4KPTA 4LZ5A 2XXRA 1N0TA 2XWIA 2DVZA 4YMAA 2UYEA 4QFOA 4RYAA 4X1BA 5A5XB 1B58A 3HN0A 3U92A 3O6IA 3P7IA 1SPIA 2R9JA 3SESA 2DXRA 3ZKLA 2DQVA 3SERA 3OO6A 1XVYA 3K1PA 3OO8A 2DE4A 1TFAA 1MH3A 1SYHA 3FXUA 1G0HA 2B3FA 4PBHA 1LB9A 3M3LA 4Q30B 2H4IA 3G3KA 4WKMA 3A3UA 3RN8A 3V5AA 2PCRA 5H8NB 2ZZVA 1NL5A 2O7UA 3EF7A 3TCGA 4F31B 1LB8A 4IY5A 2DYXA 2DDKA 4JWYA 4PGNA 4ELPA 4P9KA 4O94A 4NG7A 3DP6A 1BLFA 1ZMGA 1OLCA 2DXYA 4F19A 4I3YA 1JP4A 1QGXA 2ANJA 1JVXA 4YKIA 2GRVA 2H5YA 3OSRA 4DI4B 1FQCA 2UVIA 1KWHA 3B6TA 2YJPA 2PX1A 4H1XA 2UXAA 5J16A 5L8DA 1IMCA 1TT1A 5EQ8A 4BDMA 5FHMA 5AA4A 5B70A 3TTLA 1ELJA 2ZYOA 5I7IA 1MXVA 1FQDA 3IOWA 3SETA 3T93B 3K02A 3KSJA 1L5TA 4FIMA 3FBPA 5CM6A 4P8BA 1B3GA 5HBCA 5DVJA 4OVJA 5L9MA 4F3BA 1B7ZA 5CBRA 5H8NA 3RTFB 4RY1A 3UORA 1B2HA 1NMUA 3H6UA 1Q9DA 3VLUA 4GWYA 4F29A 1PEBA 4KCDA 3RQTA 3G3FA 1NNTA 2F3DA 4JB7A 3IB0A 4TQUQ 2Z8EA 1EH3A 1FBDA 4BLAA 2REGA 1R9QA 4I62A 1UTHB 3RLFE 1FPBA 2I48A 3ZS6A 3KBZA 4G8MA 1QW0A 4N8YA 4RNSA 4POWA 4KYSA 1MDP1 1FSAA 1MXZA 1LFIA 3PUXE 2OJTA 4YKKA 3Q26A 2P2AA 2CZKA 1IMEA 3EQ1A 3JV9A 1LAFE 3IR1A 5A5LA 4EF1A 1N7XA 1MQGA 3HSTA 4R9FA 2I3VA 1B3HA 1KA0A 3FXRA 4GFRA 4OVTA 1OVTA 4XKRA 3FIRA 3IFAA 3BIGA 1RDZA 5ET6A 3C31A 1CE2A 1JW1A 1MY3A 1FJ9A 1M5BA 1NNFA 4TOZA 3T96B 4H46A 3ILUB 2V25A 2XHDA 3U72A 2BJIA 3O9PA 4C1TA 5FBPA 1Q35A 1WDNA 1M5EA 1RKMA 3H4ZA 1EU8A 5EQ9A 4OHNA 5H8SA 5AA2B 5CMCA 5KDTB 3N94A 3MVZA 4JWOA 1MXYA 1R9LA 2G29A 4FORA 2WYKA 3LR1A 2XXQA 1XT8A 4Q8RA 2I0BA 3A3CA 3TQLA 4PDHA 2F34A 1OIBA 2F7BA 3PTYA 4X1DA 2R6GE 2NVUB 2ZMBA 1Z7ME 3GBBA 1B3FA 2QFLA 4PFYA 1LFHA 5EYGA 4MIJA 1MY0A 3T22A 2V84A 3SEXA 2PFYA 3TFLA 1NUYA 1B5JA 1LBXA 3IL1B 4RK2A 4R72A 5IM2A 1XOCA 2CZHA 4PFUA 4NHBA 4MJOA 4PBQA 2XXWA 2RC9A 3UIFA 2F5XA 4QSDA 3G3IA 1H76A 4F1VA 1AH5A 4GWXA 4DIGA 4OXVA 4IO3A 1LCTA 3PPRA 4QRZA 1PB9A 1NH8A 3RT8A 3CFZA 2QJEA 1EZOA 4RPNA 3FVOA 4NF0A 3SEWA 4JVDA 2OBGA 4IY6A 1JW4A 1FQAA 4MAGA 1I6BA 3MQ9A 2HCAA 4P1LA 4OEVA 4LA9A 4P56A 4F1YA 1FTKA 4IGTA 3RYDA 4NWCA 1JEVA 2AL4A 3DP8A 4RXLA 3VXCA 2OWZA 1OLAA 1US5A 4OA4A 2FHYA 1GR2A 4PQJA 1PB8A 2D5WA 3KN8A 3V83A 4XXUA 4NF5B 5L9SA 2Q2CA 3MVXA 4GRKA 5DW8A 4N6DA 3OXNA 4U21A 5F7VA 4BDLA 4XF5A 4ZZEA 3MP1A 3EKIA 4OETA 2Q9TA 4OVRA 4LP2B 3OO9A 1B51A 4LATA 4NN3A 2HHMA 2I3WA 4G68C 4KD5A 1QKAA 1WODA 1GV8A 1URSA 2O7IA 3EPEA 3N26A 3T9HB 3LV0A 2UYFA 2F97A 2D21A 4RPOA 1FPGA 1NUZA 3PMVA 3IK6B 4ZEDA 1FPLA 5ET5A 4X8RA 4U1OA 3DP4A 3HV1A 4ELQA 1SI1A 4JDFA 3JZJA 3PPPA 1BTJA 2A5TB 4LONB 1PDAA 2KR0A 4AB6A 1IMBA 3PPNA 4OVPA 3H7MA 4UACA 3C33A 1EYJA 3CG3A 1VFEA 4ZS9A 5TU0A 4DZ1A 5AA1A 5LTCA 2UVGA 3H03A 2X7PA 3G3HA 4QSCA 1LAXA 5IKBA 3BFUA 3TQWA 4H65A 2O51A 4F39A 3CI8A 1NUXA 1QULA 4R6YA 1A55A 4O8MA 3E4RA 1S50A 4GQOA 2X26A 4JSDA 3PUVE 1AL3A 1ATGA 3TCHA 4R75A 4LQ5A 1IUDA 4NE4A 1POY1 1EZPA 5I2KB 2Q74A 3EHSA 2WBBA 1Y9UA 2QMWA 4BDQA 3PUZE 4GX3A 3VE1B 4OERA 4GL0A 1MQJA 4NF6A 1B1HA 5KZTA 1SBPA 3GYYA 4OMBA 4NQ8A 2RC8A 2RC7A 1FPKA 4JVCA 4N17A 2A5TA 2QS1A 1VSOA 1B46A 3IOUA 1P1UA 1SW4A 3G3JA 1NH7A 4UA8A 3MZBA 4RA1A 3WAEA 4MLQA 4U23A 1YZ0A 2QMXA 3R6UA 4DXUA 3D4GA 3T1BA 4IO7A 1Y3NA 3UP9A 2VPNA 1B0HA 3HFUA 3RUMA 5LDZA 4GD5A 1D9QA 3TTNA 2XX9A 1IXHA 4UABA 1Y4TA 2AIXA 1IMFA 3KGCA 5H8FA 4EUOA 5FHNA 1QKBA 3M8UA 5LOMA 4LQ2A 1B5IA 1NKXA 1JVYA 2I4BA 1MPCA 1LSTA 1O63A 3O2AA 1CB6A 1FPDA 1OQGA 4R73A 3WAFA 3MUQA 1ZBMA 2IEEA 4GVOA 3PUWE 1H45A 4U4SA 1Y3PA 3VVDA 4KI0E 4PFBA 4GBVA 3FZVA 5ET8A 2Q8MA 1YPNA 1WVJA 1ZU0A 2DWJA 5CRYA 3B8BA 1LEVA 3BFTA 4R6KA 4MMPA 1GTKA 3PV0E 4PAKA 2QVRA 5CMBA 2DE3A 4NF8A 3RPLA 4GWZA 3S9NC 4MNIA 4ZEIA 3FD3A 5J1DA 4PDDA 3MVYA 5DTBA 2VPOA 3ILTB 3TELA 2RF1A 4PCDA 2ONRA 1KZ8A 2FBPA 3DELB 2ZYKA 3ZSFA 3W9VA 3MZ9A 1IITA 2P3VA 4MF3A 1LAHE 1VDWA 2F7CA 4ELOA 4NEDA 4F22A 4K3FA 1O7TA 4ZECA 2BJJX 1M5DA 2B4MA 4F1UA 1SVXB 2HZKA 4HW8A 4I8CA 5A5XA 2F8DA 4I1DA 3UA8A 1MRPA 2Y7IA 5JK4A 1MPBA 1QUIA 1UTBB 3A29A 1O64A 2F3BA 3SDFA 2AYSA 2WKYA 3KFMA 3O97A 3M3FA 5FTHA 2XXIA 2RCAA 1MDQA 5DVIA 2ZNTA 3Q25A 4XKPA 1XVXA 2VD2A 4PF6A 5I58B 1IEJA 5DT6A 1BIYA 4QXDA 3MYUA 4YAHX 3E3KA 3RT6B 1JW5A 2Y7RA 2P1SA 1OMPA 1FPEA 3PPQA 2FYIA 1FBHA 2ZZWA 3L6GA 4N07A 5EYHA 1DPPA 3C32A 1A8FA 3GLBA 2P0SA 3HPIA 1NV7A 5AA3A 4MNCA 3I3VA 1JNFA 2R8TA 3CFLA 4WEPA 2V3UA 5I59B 4ESXA 4IO6A 2O1MA 1K9ZA 3MP6A 1D3KA 1MG1A 4XTCQ 3DLNA 4BDRA 1MM7A 4G2ZA 4LUBA 2ABHA 1UTBA 3OENA 3QUFA 5DEXB 4X48A 1DK4A 2XWVA 3OEMA 2CEYA 2ONKE 3O6HA 4MFIA 4FEDA 5EHMA 2XX7A 4DCYA 1MY4A 3E9XA 5CC2A 2HAVA 2WEFA 3R7XA 3TCFA 3TTRA 2LAOA 5I58A 3RNNA 3CG1A 3OSQA 4YB6A 4PF8A 5T3JA 3QIMA 3ECRA 3K2DA 2Z8DA 4O7MA 2V4CA 1SW2A 4QBAA 2Y5KA 1B40A 4G4PA 1B32A 2XWOA 4JSOA 4P11A 4HXVA 1AIVA 4DXBA 1PB7A 2H9BA 3N6TA 4GOTA 5IAIA 4FJPA 1UTHA 3N6UA 3TKDA 4HE1A 4XEQA 1UIUA 1FBFA 4PFTA 3ROJA 4HE0A 3TZAA 3HHGA 5I2NB 3W15C 4GWOA 5ICQA 3QXMA 3OO7A 1FBEA 5I57B 3KZGA 1NV0A 3FJ7A 3QMFA 3SZPA 2JJKA 2Z22A 3TTKA 4P1EA 2VGQA 3TTMA 5H8QB 3ODBA 3ONMA 1USYH 4QSEA 4BDOA 4R6HA 2ZXTA 4ND9A 2DSFA 5DEXA 4ZE8A 1B52A 2OWTA 3K0VA 4JBZA 2HPGA 4OQOA 2OZZA 1G0IA 1D9YA 4EQ7A 1ZIUA 3IX1A 3THIA 1SW5A 1PBQA 4FE8A 4H8JA 2Q8JA 4FEBA 2H25A 1A40A 3KSXA 2VOZA 1ZTYA 3MPKA 3O29A 3VVEA 4YICA 5ET7A 5DVFA 3TUSA 1AOVA 2ONSA 1FTJA 3T9VA 4KQPA 4OFOA 4NAPA 3UGWA 5B7DA 3T9UA 3C34A 3S9EA 5AA2A 1FTLA 5KDTA 1HSJA 2O69A 4NWDA 2XXTA 1R6ZA 3V89B 4YB7A 1UIVA 3FV2A 4H5FA 5I2NA 2V3QA 5ELVA 1N3XA 2OK2A 3V8XB 1YAEA 1FPFA 4M1VA 4O7IA 2GQ1A 4FBPA 4GXAA 4OTEA 4YU0A 1I6QA 5JTYB 4YKPA 1DCUA 2FIXA 3MZ1A 4PE3A 4YZZA 2PT2A 4NGUA 1MQDA 1SI0A 2W7YA 4PTKA 3S4UA 4AQ4A 4GWUA 3CVGA 1I6AA 5HPQA 1Y1MA 1D9VA 2P3NA 4IO2A 2WBDA 1DBZA 1URGA 4N6PA 4QFPA 3S9LC 1FW0A 4KXPA 1JEUA 2IA4A 4GF8A 2NUVA 1FCKA 5KCJB 4R9GA 2HQ0A 3FJMA 3FATA 1RDYA 4ZEKA 3T0JA 1MXUA 4N4UA 1Y4CA 4PAFA 3KBRA 1P1QA 3I6VA 3AXFA 2YLNA 4WXJA 2Q88A 3FVKA 1JETA 2CMOA 3O6GA 3VXBA 1LFGA 5CBSA 3IB2A 4YB5A 3I5OA 4OANA 4DDDA 4X9TA 1SQYA 3PD8A 3TDJA 5IZ3B 4PETA 5TPAB 3S9MC 4PE5B 3U65A 1TFDA 3FVNA 2KLFA 1NV4A 4DXCA 5BUUA 5ICTA 3TEPA 3OMBA 3EHTA 3C9HA 4DLDA 2NOOA 3KC1A 3W9WA 2XD3A 1LGBC 4EXKA 3GZGA 2ZYMA 4NF5A 4GL8A 4N6KA 3IOVA 2F36A 3KEIA 3Q27A 1R1NA 5ITOA 3OEKA 4ZE9A 2DE2A 1PC3A 1FBCA 3LSWA 1URDA 2RCBA 4F2OA 5KCJA 3CRBA 2FA7A 3EN3A 4G68B 3PPOA 3LUZA 3FVGA 3B6WA 4FECA 1MXWA 2NXOA 1B7HA 1Y20A 4OWDA 4NF4B 1B1XA 4H67A 4GXSB 2F78A 2XXKA 4DCXA 1INPA 2REJA 2XD2A 1DMBA 5BWJA 1Q1KA 1UQWA 2E1SA 1DTGA 3K6WA 4MNPA 4PGPA 5IZ3A 4PFWA 5TPAA 2I49A 3TYHA 4DE8A 1N3WA 1PBPA 4G77A 5I56B 1B7UA 3OOAA 1N7WA 2F6PA 4PAIA 1YXIA 3QK6A 3K1MA 2OWSA 4P47A 4LZ7A 1S9TA 2I4CA 1ZLQA 2QPQA 1LAGE 4PFIA 3FASA 1FQEA 1MY1A 4U2RA 3U8QA 1P1OA 2F35A 2OX3A 3FXBA 5AE4A 3DM0A 4G8HA 3SEUA 2DP8A 2VHAA 1Y1ZA 2ESNA 1RYXA 4QHQA 2O1LA 4H5GA 3JYRA 3K01A 1KA1A 2XXXA 1IIWA 1M5FA 4MX6A 1BP5A 4F3GA 1RDXA 4GX6A 4R2FA 3O66A 1NNKA 3KOSA 4I3EA 1SW1A 5I2KA 3IB1A 1FTMA 2ALUA 2DOJA 3H3GA 4GX4A 1A8EA 2PVUA 3D4CA 2THIA 2QSXA 3HO7A 2HXWA 1H44A 2FNCA 3B50A 4OFJA 5I56A 1LBVA 1EYIA 1S7YA 4HTGA 3VDFA 1FBGA 3B7DA 1AMFA 3VLVA 5AA4B 1A7LA 1NV5A 2PFZA 3O28A 1MM6A 4EQBA 3KJ7A 3RY3A 4OVQA 2XA5A 3TPAA 2QVVA 4OVSA 3E79A 3K6UA 4MCOA 1F9BA 4MBPA 4LVQA 2RKMA 2DWIA 4F2QA 4F18A 1FQBA 1IXCA 1IMAA 3A09A 2Y7KA 1ZJLA 1AWBA 1ZKBA 4EDPA 5K2XA 3K00A 5EQAA 3CSGA 4R2BA 3VVFA 3KG2A 1B05A 3U1OA 3UK4A 5FTIA 3CHGA 1NV6A 1Z7NE 5IZ1A 1A54A 4GWSA 2B3BA 4OENA 5ISUA 2GHAA 4HCYA 3LSFB 4H6DA 3KN7A 1H3DA 1EZ9A 2XXHA 1DOTA 1OVBA 2O68A 3IO6A 3G3GA 4JXIA 4P3LA 3LBSA 3RTWB 4H45A 3EHUA 3MC2A 3TODA 3OD7A 3QSLA 3MAMA 2QVUA 3CSBA 2Y7WA 3F11A 1IMDA 2B65A 2FIEA 5JEIA 1LCFA 2PBWA 1DPEA 1US4A 1NUWA 2HEUA 4EXLA 1NV2A 4GLIA 1FTOA 3UN6A 3U93A 4ISUA 1B3LA 4KYEA 4P0GA 4H8IA 3IJOB 4EQ9A 2DVCA 1NV3A 4GIZA 5CI5A 1OQHA 3TMGA 2XXPA 3CIJA 5IZZA 1B6HA 4U4XA 3USDA 4FATA 2QS2A 1XHYA 3LSLA 1LBZA 1N84A 4ELRA 2V93A 1BKAA 2Q2AA 2KQZA 3PD9A 3KJTA 1T0KA 2D3IA 5TP9B 1JQFA 3D1RA 4IB2A 2XX8A 4FAJA 3OELA 3R26A 5F1QA 2Y5LA 1FPIA 2NWJA 3U94A 5AA2D 2ZNUA 4O3BA 1Y3QA 4Z0IA 3FUZA 4QFNA 3IAZA 4XFEA 4G8NA 4O3CA 4IR8A 1IQ7A 4ECFA 1BK4A 4AS4A 5ESYA 1N76A 2PYYA 2ZNSA 1LLSA 5DYHA 4U22A 4THIA 1B9JA 3H6WA 5I84A 1QUKA 3E13X 3VLWA 2R71A 1B3EA 3B6QA 4E0XA 1I69A 1ANFA 4I9DA 4DI3D 4QFKA 5FHOA 2RINA 1HSEA 5I3SA 1USYE 1EYKA 4IO5A 5I59A 1YTVA 3H6VA 4QF9A 1FTAA 3MVWA 4IGRA 2UVHA 4XKNA 1FBPA 2H99A 3BKIB 2ZZXA 4OEUA 3IO4A 5TP9A 1POTA 2XWKA 4LN5A 1K9YA 1H43A 1LBWA 4KR5A 1M5CA 1NV1A 4N91A 1MH4A 2WX9A 4Q5TA 4JWXA 3GXAA 2F7AA 4TLMB 2L5VA 1XS5A 4G61A 3FXQA 5IGAA 3K1NA 4IO4A 4MHFA 4Z7EA 2O6AA 4XKQA 4AS5A 1MXXA 2I58A 5ITPA 4ZZAA 3RPWA 4OZ9A 1IXIA 4F3SA 1MS7A 3VFJA 3BBRA 3PUYE 3K4UA 2VP1A 4F3PA 3H6TA 4TLLB 2I6EA 4YKJA 3C35A 4RK9A 2V3TA 3LSXA 1FJ6A 2AL5A 1GVCA 3RGYA 3S2VA 2M8CA 4QFLA 4NMYA 2OLBA 4HE2A 3GBAA 3QAXA 4NTLA 4ONYA 5I57A 1B5HA 3Q29A 4C0RA 4M4GA 4OESA 2CZLA 4N8GA 5H8QA 5CMKA 1YYZA 2HZLA 3G7WA 1NI9A 2DWAA 2XXYA 3VV5A 2ZYNA 1RYOA 2G93A 2MKZA 3T9XB 1II5A 4JVIA 1FPJA 4N81A 3MBPA 2F6GA 4GWWA 3CR9A 2DS9A
chains in the Genus database with same CATH topology
3QYTA 2GHBA 4WEDA 1P1WA 2GH9A 3HHFA 3L6HA 4H0WA 4RJZA 5EYFA 2X7QA 5M2VA 3ZKKA 2XXVA 2GFEA 1HSLA 1VFDA 1NNPA 1GGGA 4R74A 4P0IA 1D4NA 2H98A 2QL3A 1B4HA 3FV1A 4OYVA 4AB5A 4ZDMA 4C1UA 3IORA 3KN3A 4HCWA 4PP0A 4YMBA 2O84X 1P99A 3K6VA 3IJXB 1VR5A 4O3AA 2XXUA 1XC1A 4MH5A 1B0LA 3PMXA 5H8HB 5JTYA 1IXGA 1TWYA 4NF6B 2Y7PA 1QJMA 3QUJA 2HAUA 2E0SA 1LBBA 1LBCA 4N13A 4KHZE 2Z8FA 5K2YA 4OFLA 1N04A 3MP8A 1MQIA 2Q89A 3K6XA 3Q28A 1DTZA 2DWHA 5HM4B 1NFTA 5L9OA 2UVJA 3PGFA 3FGSA 4XIGQ 3MW0A 5EHSA 4L17A 5H8FB 2QS4A 1P1NA 2I0CA 3HCQA 1QVSA 1SDXA 3LC8A 2YPNA 1SD3A 4LZ8A 4ZEBA 4EF2A 4E0WA 4POXA 3IOTA 3MJNA 3H06B 3SKPA 3PU5A 1VE4A 1DSNA 2PT1A 5H8HA 2PMSA 2Z23A 1MQHA 1MPDA 1J1NA 3LUYA 2A5SA 1B4ZA 5CMMA 1YCJA 2Y84A 3TAJA 3MWBA 1A99A 4KYDA 2VD3A 3MPLA 4KFQA 3T66A 2OCUA 3PMWA 1SYIA 3SEYA 3SEVA 3KOTA 4NF8B 2QS3A 2HFBA 4G68A 4MLVA 3FJGA 1TXFA 4U1ZA 4NF4A 4Q0CA 3C4MA 3CFXA 4ZEFA 3M3KA 1MY2A 1FQFA 2QRYA 3C36A 3N5LA 1IZ1A 4HS7A 4KCCA 1QUJA 4BDNA 4ESWA 4KPTA 4LZ5A 2XXRA 1N0TA 2DVZA 4YMAA 2UYEA 4QFOA 4RYAA 4X1BA 5A5XB 1B58A 3HN0A 3U92A 3O6IA 3P7IA 2R9JA 3SESA 2DXRA 3ZKLA 2DQVA 3SERA 3OO6A 1XVYA 3K1PA 3OO8A 2DE4A 1TFAA 1MH3A 1SYHA 3FXUA 2B3FA 1LB9A 3M3LA 4Q30B 2H4IA 3G3KA 4WKMA 3A3UA 3RN8A 3V5AA 5H8NB 1NL5A 2O7UA 3EF7A 3TCGA 4F31B 1LB8A 4IY5A 2DYXA 4JWYA 4ELPA 3DP6A 1BLFA 1ZMGA 1OLCA 2DXYA 4F19A 2ANJA 1JVXA 4YKIA 2GRVA 2H5YA 3OSRA 1FQCA 2UVIA 1KWHA 3B6TA 2YJPA 2PX1A 4H1XA 2UXAA 5L8DA 1TT1A 4BDMA 5FHMA 5AA4A 5B70A 3TTLA 1ELJA 2ZYOA 1MXVA 1FQDA 3IOWA 3SETA 3T93B 3K02A 3KSJA 1L5TA 4FIMA 5CM6A 1B3GA 5HBCA 5DVJA 4OVJA 5L9MA 4F3BA 1B7ZA 5CBRA 5H8NA 3RTFB 4RY1A 3UORA 1B2HA 1NMUA 3H6UA 3VLUA 4F29A 1PEBA 4KCDA 3RQTA 3G3FA 1NNTA 4JB7A 3IB0A 4TQUQ 2Z8EA 1EH3A 4BLAA 2REGA 1R9QA 4I62A 1UTHB 3RLFE 2I48A 3ZS6A 4G8MA 1QW0A 4RNSA 4POWA 4KYSA 1MDP1 1MXZA 1LFIA 3PUXE 2OJTA 4YKKA 3Q26A 2P2AA 3EQ1A 3JV9A 1LAFE 3IR1A 4EF1A 1N7XA 1MQGA 3HSTA 4R9FA 2I3VA 1B3HA 3FXRA 4GFRA 1OVTA 4XKRA 3FIRA 3C31A 1CE2A 1JW1A 1MY3A 1M5BA 1NNFA 4TOZA 3T96B 3ILUB 2V25A 2XHDA 3U72A 3O9PA 4C1TA 1Q35A 1WDNA 1M5EA 1RKMA 3H4ZA 1EU8A 4OHNA 5H8SA 5AA2B 5CMCA 5KDTB 3N94A 3MVZA 4JWOA 1MXYA 1R9LA 2G29A 4FORA 3LR1A 2XXQA 1XT8A 4Q8RA 2I0BA 3A3CA 3TQLA 2F34A 1OIBA 2F7BA 4X1DA 2R6GE 2NVUB 2ZMBA 1Z7ME 3GBBA 1B3FA 4PFYA 1LFHA 1MY0A 3T22A 2V84A 3SEXA 3TFLA 1B5JA 3IL1B 4RK2A 4R72A 1XOCA 4PFUA 2XXWA 2RC9A 3UIFA 2F5XA 4QSDA 3G3IA 1H76A 4F1VA 1AH5A 4DIGA 4OXVA 4IO3A 1LCTA 3PPRA 4QRZA 1PB9A 1NH8A 3RT8A 3CFZA 2QJEA 1EZOA 4RPNA 3FVOA 3SEWA 2OBGA 4IY6A 1JW4A 1FQAA 1I6BA 3MQ9A 2HCAA 4OEVA 4LA9A 4F1YA 1FTKA 4IGTA 4NWCA 1JEVA 2AL4A 3DP8A 4RXLA 3VXCA 1OLAA 1US5A 1GR2A 4PQJA 1PB8A 2D5WA 3KN8A 3V83A 4XXUA 4NF5B 5L9SA 2Q2CA 3MVXA 4GRKA 3OXNA 4U21A 5F7VA 4BDLA 4ZZEA 3MP1A 4OETA 2Q9TA 4LP2B 3OO9A 1B51A 4LATA 2I3WA 4G68C 4KD5A 1QKAA 1WODA 1GV8A 1URSA 2O7IA 3EPEA 3N26A 3T9HB 2UYFA 2F97A 2D21A 4RPOA 3PMVA 3IK6B 4ZEDA 4U1OA 3DP4A 3HV1A 4ELQA 1SI1A 4JDFA 3JZJA 3PPPA 1BTJA 2A5TB 4LONB 1PDAA 4AB6A 3PPNA 3H7MA 4UACA 3C33A 3CG3A 1VFEA 4ZS9A 5TU0A 4DZ1A 5AA1A 2UVGA 3H03A 2X7PA 3G3HA 4QSCA 1LAXA 5IKBA 3BFUA 3TQWA 4H65A 2O51A 4F39A 3CI8A 1QULA 4R6YA 1A55A 3E4RA 1S50A 4GQOA 2X26A 4JSDA 3PUVE 1AL3A 1ATGA 3TCHA 4R75A 4LQ5A 1IUDA 4NE4A 1POY1 1EZPA 5I2KB 3EHSA 1Y9UA 2QMWA 4BDQA 3PUZE 3VE1B 4OERA 4GL0A 1MQJA 4NF6A 1B1HA 5KZTA 1SBPA 4OMBA 2RC8A 2RC7A 2A5TA 2QS1A 1VSOA 1B46A 3IOUA 1P1UA 1SW4A 3G3JA 1NH7A 4UA8A 3MZBA 4RA1A 3WAEA 4MLQA 4U23A 2QMXA 3R6UA 4DXUA 3D4GA 4IO7A 1Y3NA 3UP9A 1B0HA 3RUMA 4GD5A 3TTNA 2XX9A 1IXHA 1Y4TA 2AIXA 3KGCA 5H8FA 4EUOA 5FHNA 1QKBA 3M8UA 5LOMA 4LQ2A 1B5IA 1NKXA 1JVYA 2I4BA 1MPCA 1LSTA 1O63A 3O2AA 1CB6A 1OQGA 4R73A 3WAFA 3MUQA 1ZBMA 2IEEA 4GVOA 3PUWE 1H45A 4U4SA 1Y3PA 3VVDA 4KI0E 3FZVA 1YPNA 1WVJA 1ZU0A 2DWJA 5CRYA 3BFTA 4R6KA 1GTKA 3PV0E 5CMBA 2DE3A 4NF8A 3S9NC 4ZEIA 3FD3A 5J1DA 3MVYA 5DTBA 3ILTB 3TELA 2RF1A 2ONRA 3DELB 2ZYKA 3ZSFA 3W9VA 3MZ9A 1IITA 4MF3A 1LAHE 2F7CA 4ELOA 4NEDA 4F22A 4K3FA 1O7TA 4ZECA 2BJJX 1M5DA 4F1UA 1SVXB 2HZKA 4HW8A 4I8CA 5A5XA 2F8DA 4I1DA 3UA8A 1MRPA 2Y7IA 5JK4A 1MPBA 1QUIA 1UTBB 1O64A 3SDFA 2AYSA 2WKYA 3KFMA 3O97A 3M3FA 5FTHA 2XXIA 2RCAA 1MDQA 5DVIA 2ZNTA 3Q25A 4XKPA 1XVXA 2VD2A 5I58B 1IEJA 5DT6A 1BIYA 4YAHX 3E3KA 3RT6B 1JW5A 2Y7RA 2P1SA 1OMPA 3PPQA 2FYIA 3L6GA 4N07A 1DPPA 3C32A 1A8FA 3GLBA 2P0SA 3HPIA 5AA3A 3I3VA 1JNFA 3CFLA 4WEPA 2V3UA 5I59B 4ESXA 4IO6A 2O1MA 3MP6A 1D3KA 1MG1A 4XTCQ 3DLNA 4BDRA 1MM7A 4G2ZA 4LUBA 2ABHA 1UTBA 3OENA 3QUFA 5DEXB 4X48A 3OEMA 2ONKE 3O6HA 4MFIA 4FEDA 5EHMA 2XX7A 4DCYA 1MY4A 3E9XA 5CC2A 2HAVA 3R7XA 3TCFA 3TTRA 2LAOA 5I58A 3RNNA 3CG1A 3OSQA 4YB6A 3QIMA 3ECRA 3K2DA 2Z8DA 1SW2A 1B40A 4G4PA 1B32A 4JSOA 4P11A 1AIVA 4DXBA 1PB7A 2H9BA 3N6TA 4GOTA 5IAIA 4FJPA 1UTHA 3N6UA 3TKDA 1UIUA 4PFTA 3TZAA 3HHGA 5I2NB 3W15C 4GWOA 5ICQA 3QXMA 3OO7A 5I57B 3KZGA 3FJ7A 2Z22A 3TTKA 2VGQA 3TTMA 5H8QB 3ODBA 3ONMA 1USYH 4QSEA 4BDOA 4R6HA 2ZXTA 4ND9A 2DSFA 5DEXA 4ZE8A 1B52A 2OWTA 3K0VA 4JBZA 4OQOA 2OZZA 1D9YA 4EQ7A 1ZIUA 3IX1A 3THIA 1PBQA 1SW5A 4FE8A 4H8JA 2Q8JA 4FEBA 2H25A 1A40A 3KSXA 2VOZA 1ZTYA 3MPKA 3O29A 3VVEA 4YICA 5DVFA 3TUSA 1AOVA 2ONSA 1FTJA 3T9VA 4KQPA 4OFOA 3UGWA 5B7DA 3T9UA 3C34A 3S9EA 5AA2A 1FTLA 5KDTA 1HSJA 2O69A 4NWDA 2XXTA 1R6ZA 3V89B 4YB7A 1UIVA 3FV2A 4H5FA 5I2NA 2V3QA 5ELVA 1N3XA 2OK2A 3V8XB 1YAEA 4M1VA 4GXAA 4OTEA 4YU0A 1I6QA 5JTYB 4YKPA 3MZ1A 4YZZA 2PT2A 1MQDA 1SI0A 2W7YA 3S4UA 4AQ4A 3CVGA 1I6AA 5HPQA 1Y1MA 1D9VA 4IO2A 1URGA 4N6PA 4QFPA 3S9LC 1FW0A 1JEUA 2IA4A 4GF8A 2NUVA 1FCKA 5KCJB 4R9GA 2HQ0A 3FJMA 3FATA 4ZEKA 1MXUA 1Y4CA 3KBRA 1P1QA 3I6VA 3AXFA 2YLNA 4WXJA 2Q88A 3FVKA 1JETA 2CMOA 3O6GA 3VXBA 1LFGA 5CBSA 3IB2A 4YB5A 3I5OA 4DDDA 4X9TA 1SQYA 3PD8A 3TDJA 4PETA 5TPAB 3S9MC 4PE5B 1TFDA 3FVNA 2KLFA 4DXCA 5BUUA 5ICTA 3TEPA 3OMBA 3EHTA 3C9HA 4DLDA 2NOOA 3W9WA 2XD3A 1LGBC 4EXKA 3GZGA 2ZYMA 4NF5A 4GL8A 3IOVA 2F36A 3KEIA 3Q27A 1R1NA 5ITOA 3OEKA 4ZE9A 2DE2A 1PC3A 3LSWA 1URDA 2RCBA 4F2OA 5KCJA 3CRBA 2FA7A 3EN3A 4G68B 3PPOA 3FVGA 3B6WA 4FECA 1MXWA 2NXOA 1B7HA 1Y20A 4OWDA 4NF4B 1B1XA 4H67A 4GXSB 2F78A 4DCXA 2REJA 2XD2A 1DMBA 5BWJA 1Q1KA 1UQWA 2E1SA 1DTGA 3K6WA 4PFWA 5TPAA 2I49A 3TYHA 4DE8A 1N3WA 1PBPA 4G77A 5I56B 1B7UA 3OOAA 1N7WA 2F6PA 3QK6A 3K1MA 2OWSA 4LZ7A 1S9TA 2I4CA 1ZLQA 2QPQA 1LAGE 3FASA 1FQEA 1MY1A 4U2RA 3U8QA 1P1OA 2F35A 5AE4A 3DM0A 4G8HA 3SEUA 2DP8A 2VHAA 1Y1ZA 2ESNA 1RYXA 4QHQA 2O1LA 4H5GA 3JYRA 3K01A 2XXXA 1IIWA 1M5FA 1BP5A 4F3GA 4R2FA 3O66A 1NNKA 3KOSA 1SW1A 5I2KA 3IB1A 1FTMA 2ALUA 2DOJA 3H3GA 1A8EA 2PVUA 3D4CA 2THIA 2QSXA 3HO7A 2HXWA 1H44A 2FNCA 4OFJA 5I56A 4HTGA 1S7YA 3VDFA 3B7DA 1AMFA 3VLVA 5AA4B 1A7LA 3O28A 1MM6A 4EQBA 3KJ7A 3RY3A 3TPAA 3K6UA 1F9BA 4MBPA 4LVQA 2RKMA 2DWIA 4F2QA 4F18A 1FQBA 1IXCA 3A09A 2Y7KA 1ZJLA 1ZKBA 4EDPA 5K2XA 3K00A 3CSGA 4R2BA 3VVFA 3KG2A 1B05A 3U1OA 3UK4A 5FTIA 1Z7NE 1A54A 2B3BA 4OENA 5ISUA 2GHAA 4HCYA 3LSFB 4H6DA 3KN7A 1H3DA 1EZ9A 2XXHA 1DOTA 1OVBA 2O68A 3IO6A 3G3GA 4JXIA 3LBSA 3RTWB 3EHUA 3MC2A 3TODA 3OD7A 3QSLA 3MAMA 3CSBA 2Y7WA 3F11A 2B65A 5JEIA 1LCFA 2PBWA 1DPEA 1US4A 2HEUA 4EXLA 4GLIA 1FTOA 3UN6A 3U93A 4ISUA 1B3LA 4KYEA 4P0GA 4H8IA 3IJOB 4EQ9A 2DVCA 4GIZA 5CI5A 1OQHA 3TMGA 2XXPA 3CIJA 1B6HA 3USDA 4U4XA 4FATA 2QS2A 1XHYA 3LSLA 1N84A 4ELRA 2V93A 1BKAA 2Q2AA 3PD9A 3KJTA 1T0KA 2D3IA 5TP9B 1JQFA 4IB2A 2XX8A 4FAJA 3OELA 3R26A 5F1QA 2NWJA 3U94A 5AA2D 2ZNUA 4O3BA 1Y3QA 4Z0IA 3FUZA 4QFNA 3IAZA 4G8NA 4O3CA 1IQ7A 4ECFA 1N76A 2PYYA 2ZNSA 1LLSA 5DYHA 4U22A 4THIA 1B9JA 3H6WA 5I84A 1QUKA 3E13X 3VLWA 2R71A 1B3EA 3B6QA 4E0XA 1I69A 1ANFA 4I9DA 4QFKA 5FHOA 2RINA 1HSEA 1USYE 4IO5A 5I59A 1YTVA 3H6VA 4QF9A 3MVWA 4IGRA 2UVHA 4XKNA 2H99A 3BKIB 4OEUA 3IO4A 5TP9A 1POTA 1H43A 4KR5A 1M5CA 1MH4A 4Q5TA 4JWXA 3GXAA 2F7AA 4TLMB 1XS5A 3FXQA 3K1NA 4IO4A 4Z7EA 2O6AA 4XKQA 1MXXA 2I58A 5ITPA 4ZZAA 3RPWA 4OZ9A 1IXIA 4F3SA 1MS7A 3VFJA 3BBRA 3PUYE 3K4UA 2VP1A 4F3PA 3H6TA 4TLLB 2I6EA 4YKJA 3C35A 4RK9A 2V3TA 3LSXA 2AL5A 1GVCA 3RGYA 3S2VA 2M8CA 4QFLA 4NMYA 2OLBA 3GBAA 3QAXA 4NTLA 4ONYA 5I57A 1B5HA 3Q29A 4C0RA 4M4GA 2CZLA 4OESA 5H8QA 5CMKA 2HZLA 3G7WA 2DWAA 2XXYA 3VV5A 2ZYNA 1RYOA 2G93A 3T9XB 1II5A 3MBPA 2F6GA 3CR9A 2DS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYT A;  2GHB A;  4WED A;  1P1W A;  2GH9 A;  3HHF A;  3L6H A;  4H0W A;  4RJZ A;  5EYF A;  2X7Q A;  5M2V A;  3ZKK A;  2XXV A;  2GFE A;  1HSL A;  1VFD A;  1NNP A;  1GGG A;  4R74 A;  4P0I A;  1D4N A;  2H98 A;  2QL3 A;  1B4H A;  3FV1 A;  4OYV A;  4AB5 A;  4ZDM A;  4C1U A;  3IOR A;  3KN3 A;  4HCW A;  4PP0 A;  4YMB A;  2O84 X;  1P99 A;  3K6V A;  3IJX B;  1VR5 A;  4O3A A;  2XXU A;  1XC1 A;  4MH5 A;  1B0L A;  3PMX A;  5H8H B;  5JTY A;  1IXG A;  1TWY A;  4NF6 B;  2Y7P A;  1QJM A;  3QUJ A;  2HAU A;  2E0S A;  1LBB A;  1LBC A;  4N13 A;  4KHZ E;  2Z8F A;  5K2Y A;  4OFL A;  1N04 A;  3MP8 A;  1MQI A;  2Q89 A;  3K6X A;  3Q28 A;  1DTZ A;  2DWH A;  5HM4 B;  1NFT A;  5L9O A;  2UVJ A;  3PGF A;  3FGS A;  4XIG Q;  3MW0 A;  5EHS A;  4L17 A;  5H8F B;  2QS4 A;  1P1N A;  2I0C A;  3HCQ A;  1QVS A;  1SDX A;  3LC8 A;  2YPN A;  1SD3 A;  4LZ8 A;  4ZEB A;  4EF2 A;  4E0W A;  4POX A;  3IOT A;  3MJN A;  3H06 B;  3SKP A;  3PU5 A;  1VE4 A;  1DSN A;  2PT1 A;  5H8H A;  2PMS A;  2Z23 A;  1MQH A;  1MPD A;  1J1N A;  3LUY A;  2A5S A;  1B4Z A;  5CMM A;  1YCJ A;  2Y84 A;  3TAJ A;  3MWB A;  1A99 A;  4KYD A;  2VD3 A;  3MPL A;  4KFQ A;  3T66 A;  2OCU A;  3PMW A;  1SYI A;  3SEY A;  3SEV A;  3KOT A;  4NF8 B;  2QS3 A;  2HFB A;  4G68 A;  4MLV A;  3FJG A;  1TXF A;  4U1Z A;  4NF4 A;  4Q0C A;  3C4M A;  3CFX A;  4ZEF A;  3M3K A;  1MY2 A;  1FQF A;  2QRY A;  3C36 A;  3N5L A;  1IZ1 A;  4HS7 A;  4KCC A;  1QUJ A;  4BDN A;  4ESW A;  4KPT A;  4LZ5 A;  2XXR A;  1N0T A;  2DVZ A;  4YMA A;  2UYE A;  4QFO A;  4RYA A;  4X1B A;  5A5X B;  1B58 A;  3HN0 A;  3U92 A;  3O6I A;  3P7I A;  2R9J A;  3SES A;  2DXR A;  3ZKL A;  2DQV A;  3SER A;  3OO6 A;  1XVY A;  3K1P A;  3OO8 A;  2DE4 A;  1TFA A;  1MH3 A;  1SYH A;  3FXU A;  2B3F A;  1LB9 A;  3M3L A;  4Q30 B;  2H4I A;  3G3K A;  4WKM A;  3A3U A;  3RN8 A;  3V5A A;  5H8N B;  1NL5 A;  2O7U A;  3EF7 A;  3TCG A;  4F31 B;  1LB8 A;  4IY5 A;  2DYX A;  4JWY A;  4ELP A;  3DP6 A;  1BLF A;  1ZMG A;  1OLC A;  2DXY A;  4F19 A;  2ANJ A;  1JVX A;  4YKI A;  2GRV A;  2H5Y A;  3OSR A;  1FQC A;  2UVI A;  1KWH A;  3B6T A;  2YJP A;  2PX1 A;  4H1X A;  2UXA A;  5L8D A;  1TT1 A;  4BDM A;  5FHM A;  5AA4 A;  5B70 A;  3TTL A;  1ELJ A;  2ZYO A;  1MXV A;  1FQD A;  3IOW A;  3SET A;  3T93 B;  3K02 A;  3KSJ A;  1L5T A;  4FIM A;  5CM6 A;  1B3G A;  5HBC A;  5DVJ A;  4OVJ A;  5L9M A;  4F3B A;  1B7Z A;  5CBR A;  5H8N A;  3RTF B;  4RY1 A;  3UOR A;  1B2H A;  1NMU A;  3H6U A;  3VLU A;  4F29 A;  1PEB A;  4KCD A;  3RQT A;  3G3F A;  1NNT A;  4JB7 A;  3IB0 A;  4TQU Q;  2Z8E A;  1EH3 A;  4BLA A;  2REG A;  1R9Q A;  4I62 A;  1UTH B;  3RLF E;  2I48 A;  3ZS6 A;  4G8M A;  1QW0 A;  4RNS A;  4POW A;  4KYS A;  1MDP 1;  1MXZ A;  1LFI A;  3PUX E;  2OJT A;  4YKK A;  3Q26 A;  2P2A A;  3EQ1 A;  3JV9 A;  1LAF E;  3IR1 A;  4EF1 A;  1N7X A;  1MQG A;  3HST A;  4R9F A;  2I3V A;  1B3H A;  3FXR A;  4GFR A;  1OVT A;  4XKR A;  3FIR A;  3C31 A;  1CE2 A;  1JW1 A;  1MY3 A;  1M5B A;  1NNF A;  4TOZ A;  3T96 B;  3ILU B;  2V25 A;  2XHD A;  3U72 A;  3O9P A;  4C1T A;  1Q35 A;  1WDN A;  1M5E A;  1RKM A;  3H4Z A;  1EU8 A;  4OHN A;  5H8S A;  5AA2 B;  5CMC A;  5KDT B;  3N94 A;  3MVZ A;  4JWO A;  1MXY A;  1R9L A;  2G29 A;  4FOR A;  3LR1 A;  2XXQ A;  1XT8 A;  4Q8R A;  2I0B A;  3A3C A;  3TQL A;  2F34 A;  1OIB A;  2F7B A;  4X1D A;  2R6G E;  2NVU B;  2ZMB A;  1Z7M E;  3GBB A;  1B3F A;  4PFY A;  1LFH A;  1MY0 A;  3T22 A;  2V84 A;  3SEX A;  3TFL A;  1B5J A;  3IL1 B;  4RK2 A;  4R72 A;  1XOC A;  4PFU A;  2XXW A;  2RC9 A;  3UIF A;  2F5X A;  4QSD A;  3G3I A;  1H76 A;  4F1V A;  1AH5 A;  4DIG A;  4OXV A;  4IO3 A;  1LCT A;  3PPR A;  4QRZ A;  1PB9 A;  1NH8 A;  3RT8 A;  3CFZ A;  2QJE A;  1EZO A;  4RPN A;  3FVO A;  3SEW A;  2OBG A;  4IY6 A;  1JW4 A;  1FQA A;  1I6B A;  3MQ9 A;  2HCA A;  4OEV A;  4LA9 A;  4F1Y A;  1FTK A;  4IGT A;  4NWC A;  1JEV A;  2AL4 A;  3DP8 A;  4RXL A;  3VXC A;  1OLA A;  1US5 A;  1GR2 A;  4PQJ A;  1PB8 A;  2D5W A;  3KN8 A;  3V83 A;  4XXU A;  4NF5 B;  5L9S A;  2Q2C A;  3MVX A;  4GRK A;  3OXN A;  4U21 A;  5F7V A;  4BDL A;  4ZZE A;  3MP1 A;  4OET A;  2Q9T A;  4LP2 B;  3OO9 A;  1B51 A;  4LAT A;  2I3W A;  4G68 C;  4KD5 A;  1QKA A;  1WOD A;  1GV8 A;  1URS A;  2O7I A;  3EPE A;  3N26 A;  3T9H B;  2UYF A;  2F97 A;  2D21 A;  4RPO A;  3PMV A;  3IK6 B;  4ZED A;  4U1O A;  3DP4 A;  3HV1 A;  4ELQ A;  1SI1 A;  4JDF A;  3JZJ A;  3PPP A;  1BTJ A;  2A5T B;  4LON B;  1PDA A;  4AB6 A;  3PPN A;  3H7M A;  4UAC A;  3C33 A;  3CG3 A;  1VFE A;  4ZS9 A;  5TU0 A;  4DZ1 A;  5AA1 A;  2UVG A;  3H03 A;  2X7P A;  3G3H A;  4QSC A;  1LAX A;  5IKB A;  3BFU A;  3TQW A;  4H65 A;  2O51 A;  4F39 A;  3CI8 A;  1QUL A;  4R6Y A;  1A55 A;  3E4R A;  1S50 A;  4GQO A;  2X26 A;  4JSD A;  3PUV E;  1AL3 A;  1ATG A;  3TCH A;  4R75 A;  4LQ5 A;  1IUD A;  4NE4 A;  1POY 1;  1EZP A;  5I2K B;  3EHS A;  1Y9U A;  2QMW A;  4BDQ A;  3PUZ E;  3VE1 B;  4OER A;  4GL0 A;  1MQJ A;  4NF6 A;  1B1H A;  5KZT A;  1SBP A;  4OMB A;  2RC8 A;  2RC7 A;  2A5T A;  2QS1 A;  1VSO A;  1B46 A;  3IOU A;  1P1U A;  1SW4 A;  3G3J A;  1NH7 A;  4UA8 A;  3MZB A;  4RA1 A;  3WAE A;  4MLQ A;  4U23 A;  2QMX A;  3R6U A;  4DXU A;  3D4G A;  4IO7 A;  1Y3N A;  3UP9 A;  1B0H A;  3RUM A;  4GD5 A;  3TTN A;  2XX9 A;  1IXH A;  1Y4T A;  2AIX A;  3KGC A;  5H8F A;  4EUO A;  5FHN A;  1QKB A;  3M8U A;  5LOM A;  4LQ2 A;  1B5I A;  1NKX A;  1JVY A;  2I4B A;  1MPC A;  1LST A;  1O63 A;  3O2A A;  1CB6 A;  1OQG A;  4R73 A;  3WAF A;  3MUQ A;  1ZBM A;  2IEE A;  4GVO A;  3PUW E;  1H45 A;  4U4S A;  1Y3P A;  3VVD A;  4KI0 E;  3FZV A;  1YPN A;  1WVJ A;  1ZU0 A;  2DWJ A;  5CRY A;  3BFT A;  4R6K A;  1GTK A;  3PV0 E;  5CMB A;  2DE3 A;  4NF8 A;  3S9N C;  4ZEI A;  3FD3 A;  5J1D A;  3MVY A;  5DTB A;  3ILT B;  3TEL A;  2RF1 A;  2ONR A;  3DEL B;  2ZYK A;  3ZSF A;  3W9V A;  3MZ9 A;  1IIT A;  4MF3 A;  1LAH E;  2F7C A;  4ELO A;  4NED A;  4F22 A;  4K3F A;  1O7T A;  4ZEC A;  2BJJ X;  1M5D A;  4F1U A;  1SVX B;  2HZK A;  4HW8 A;  4I8C A;  5A5X A;  2F8D A;  4I1D A;  3UA8 A;  1MRP A;  2Y7I A;  5JK4 A;  1MPB A;  1QUI A;  1UTB B;  1O64 A;  3SDF A;  2AYS A;  2WKY A;  3KFM A;  3O97 A;  3M3F A;  5FTH A;  2XXI A;  2RCA A;  1MDQ A;  5DVI A;  2ZNT A;  3Q25 A;  4XKP A;  1XVX A;  2VD2 A;  5I58 B;  1IEJ A;  5DT6 A;  1BIY A;  4YAH X;  3E3K A;  3RT6 B;  1JW5 A;  2Y7R A;  2P1S A;  1OMP A;  3PPQ A;  2FYI A;  3L6G A;  4N07 A;  1DPP A;  3C32 A;  1A8F A;  3GLB A;  2P0S A;  3HPI A;  5AA3 A;  3I3V A;  1JNF A;  3CFL A;  4WEP A;  2V3U A;  5I59 B;  4ESX A;  4IO6 A;  2O1M A;  3MP6 A;  1D3K A;  1MG1 A;  4XTC Q;  3DLN A;  4BDR A;  1MM7 A;  4G2Z A;  4LUB A;  2ABH A;  1UTB A;  3OEN A;  3QUF A;  5DEX B;  4X48 A;  3OEM A;  2ONK E;  3O6H A;  4MFI A;  4FED A;  5EHM A;  2XX7 A;  4DCY A;  1MY4 A;  3E9X A;  5CC2 A;  2HAV A;  3R7X A;  3TCF A;  3TTR A;  2LAO A;  5I58 A;  3RNN A;  3CG1 A;  3OSQ A;  4YB6 A;  3QIM A;  3ECR A;  3K2D A;  2Z8D A;  1SW2 A;  1B40 A;  4G4P A;  1B32 A;  4JSO A;  4P11 A;  1AIV A;  4DXB A;  1PB7 A;  2H9B A;  3N6T A;  4GOT A;  5IAI A;  4FJP A;  1UTH A;  3N6U A;  3TKD A;  1UIU A;  4PFT A;  3TZA A;  3HHG A;  5I2N B;  3W15 C;  4GWO A;  5ICQ A;  3QXM A;  3OO7 A;  5I57 B;  3KZG A;  3FJ7 A;  2Z22 A;  3TTK A;  2VGQ A;  3TTM A;  5H8Q B;  3ODB A;  3ONM A;  1USY H;  4QSE A;  4BDO A;  4R6H A;  2ZXT A;  4ND9 A;  2DSF A;  5DEX A;  4ZE8 A;  1B52 A;  2OWT A;  3K0V A;  4JBZ A;  4OQO A;  2OZZ A;  1D9Y A;  4EQ7 A;  1ZIU A;  3IX1 A;  3THI A;  1PBQ A;  1SW5 A;  4FE8 A;  4H8J A;  2Q8J A;  4FEB A;  2H25 A;  1A40 A;  3KSX A;  2VOZ A;  1ZTY A;  3MPK A;  3O29 A;  3VVE A;  4YIC A;  5DVF A;  3TUS A;  1AOV A;  2ONS A;  1FTJ A;  3T9V A;  4KQP A;  4OFO A;  3UGW A;  5B7D A;  3T9U A;  3C34 A;  3S9E A;  5AA2 A;  1FTL A;  5KDT A;  1HSJ A;  2O69 A;  4NWD A;  2XXT A;  1R6Z A;  3V89 B;  4YB7 A;  1UIV A;  3FV2 A;  4H5F A;  5I2N A;  2V3Q A;  5ELV A;  1N3X A;  2OK2 A;  3V8X B;  1YAE A;  4M1V A;  4GXA A;  4OTE A;  4YU0 A;  1I6Q A;  5JTY B;  4YKP A;  3MZ1 A;  4YZZ A;  2PT2 A;  1MQD A;  1SI0 A;  2W7Y A;  3S4U A;  4AQ4 A;  3CVG A;  1I6A A;  5HPQ A;  1Y1M A;  1D9V A;  4IO2 A;  1URG A;  4N6P A;  4QFP A;  3S9L C;  1FW0 A;  1JEU A;  2IA4 A;  4GF8 A;  2NUV A;  1FCK A;  5KCJ B;  4R9G A;  2HQ0 A;  3FJM A;  3FAT A;  4ZEK A;  1MXU A;  1Y4C A;  3KBR A;  1P1Q A;  3I6V A;  3AXF A;  2YLN A;  4WXJ A;  2Q88 A;  3FVK A;  1JET A;  2CMO A;  3O6G A;  3VXB A;  1LFG A;  5CBS A;  3IB2 A;  4YB5 A;  3I5O A;  4DDD A;  4X9T A;  1SQY A;  3PD8 A;  3TDJ A;  4PET A;  5TPA B;  3S9M C;  4PE5 B;  1TFD A;  3FVN A;  2KLF A;  4DXC A;  5BUU A;  5ICT A;  3TEP A;  3OMB A;  3EHT A;  3C9H A;  4DLD A;  2NOO A;  3W9W A;  2XD3 A;  1LGB C;  4EXK A;  3GZG A;  2ZYM A;  4NF5 A;  4GL8 A;  3IOV A;  2F36 A;  3KEI A;  3Q27 A;  1R1N A;  5ITO A;  3OEK A;  4ZE9 A;  2DE2 A;  1PC3 A;  3LSW A;  1URD A;  2RCB A;  4F2O A;  5KCJ A;  3CRB A;  2FA7 A;  3EN3 A;  4G68 B;  3PPO A;  3FVG A;  3B6W A;  4FEC A;  1MXW A;  2NXO A;  1B7H A;  1Y20 A;  4OWD A;  4NF4 B;  1B1X A;  4H67 A;  4GXS B;  2F78 A;  4DCX A;  2REJ A;  2XD2 A;  1DMB A;  5BWJ A;  1Q1K A;  1UQW A;  2E1S A;  1DTG A;  3K6W A;  4PFW A;  5TPA A;  2I49 A;  3TYH A;  4DE8 A;  1N3W A;  1PBP A;  4G77 A;  5I56 B;  1B7U A;  3OOA A;  1N7W A;  2F6P A;  3QK6 A;  3K1M A;  2OWS A;  4LZ7 A;  1S9T A;  2I4C A;  1ZLQ A;  2QPQ A;  1LAG E;  3FAS A;  1FQE A;  1MY1 A;  4U2R A;  3U8Q A;  1P1O A;  2F35 A;  5AE4 A;  3DM0 A;  4G8H A;  3SEU A;  2DP8 A;  2VHA A;  1Y1Z A;  2ESN A;  1RYX A;  4QHQ A;  2O1L A;  4H5G A;  3JYR A;  3K01 A;  2XXX A;  1IIW A;  1M5F A;  1BP5 A;  4F3G A;  4R2F A;  3O66 A;  1NNK A;  3KOS A;  1SW1 A;  5I2K A;  3IB1 A;  1FTM A;  2ALU A;  2DOJ A;  3H3G A;  1A8E A;  2PVU A;  3D4C A;  2THI A;  2QSX A;  3HO7 A;  2HXW A;  1H44 A;  2FNC A;  4OFJ A;  5I56 A;  4HTG A;  1S7Y A;  3VDF A;  3B7D A;  1AMF A;  3VLV A;  5AA4 B;  1A7L A;  3O28 A;  1MM6 A;  4EQB A;  3KJ7 A;  3RY3 A;  3TPA A;  3K6U A;  1F9B A;  4MBP A;  4LVQ A;  2RKM A;  2DWI A;  4F2Q A;  4F18 A;  1FQB A;  1IXC A;  3A09 A;  2Y7K A;  1ZJL A;  1ZKB A;  4EDP A;  5K2X A;  3K00 A;  3CSG A;  4R2B A;  3VVF A;  3KG2 A;  1B05 A;  3U1O A;  3UK4 A;  5FTI A;  1Z7N E;  1A54 A;  2B3B A;  4OEN A;  5ISU A;  2GHA A;  4HCY A;  3LSF B;  4H6D A;  3KN7 A;  1H3D A;  1EZ9 A;  2XXH A;  1DOT A;  1OVB A;  2O68 A;  3IO6 A;  3G3G A;  4JXI A;  3LBS A;  3RTW B;  3EHU A;  3MC2 A;  3TOD A;  3OD7 A;  3QSL A;  3MAM A;  3CSB A;  2Y7W A;  3F11 A;  2B65 A;  5JEI A;  1LCF A;  2PBW A;  1DPE A;  1US4 A;  2HEU A;  4EXL A;  4GLI A;  1FTO A;  3UN6 A;  3U93 A;  4ISU A;  1B3L A;  4KYE A;  4P0G A;  4H8I A;  3IJO B;  4EQ9 A;  2DVC A;  4GIZ A;  5CI5 A;  1OQH A;  3TMG A;  2XXP A;  3CIJ A;  1B6H A;  3USD A;  4U4X A;  4FAT A;  2QS2 A;  1XHY A;  3LSL A;  1N84 A;  4ELR A;  2V93 A;  1BKA A;  2Q2A A;  3PD9 A;  3KJT A;  1T0K A;  2D3I A;  5TP9 B;  1JQF A;  4IB2 A;  2XX8 A;  4FAJ A;  3OEL A;  3R26 A;  5F1Q A;  2NWJ A;  3U94 A;  5AA2 D;  2ZNU A;  4O3B A;  1Y3Q A;  4Z0I A;  3FUZ A;  4QFN A;  3IAZ A;  4G8N A;  4O3C A;  1IQ7 A;  4ECF A;  1N76 A;  2PYY A;  2ZNS A;  1LLS A;  5DYH A;  4U22 A;  4THI A;  1B9J A;  3H6W A;  5I84 A;  1QUK A;  3E13 X;  3VLW A;  2R71 A;  1B3E A;  3B6Q A;  4E0X A;  1I69 A;  1ANF A;  4I9D A;  4QFK A;  5FHO A;  2RIN A;  1HSE A;  1USY E;  4IO5 A;  5I59 A;  1YTV A;  3H6V A;  4QF9 A;  3MVW A;  4IGR A;  2UVH A;  4XKN A;  2H99 A;  3BKI B;  4OEU A;  3IO4 A;  5TP9 A;  1POT A;  1H43 A;  4KR5 A;  1M5C A;  1MH4 A;  4Q5T A;  4JWX A;  3GXA A;  2F7A A;  4TLM B;  1XS5 A;  3FXQ A;  3K1N A;  4IO4 A;  4Z7E A;  2O6A A;  4XKQ A;  1MXX A;  2I58 A;  5ITP A;  4ZZA A;  3RPW A;  4OZ9 A;  1IXI A;  4F3S A;  1MS7 A;  3VFJ A;  3BBR A;  3PUY E;  3K4U A;  2VP1 A;  4F3P A;  3H6T A;  4TLL B;  2I6E A;  4YKJ A;  3C35 A;  4RK9 A;  2V3T A;  3LSX A;  2AL5 A;  1GVC A;  3RGY A;  3S2V A;  2M8C A;  4QFL A;  4NMY A;  2OLB A;  3GBA A;  3QAX A;  4NTL A;  4ONY A;  5I57 A;  1B5H A;  3Q29 A;  4C0R A;  4M4G A;  2CZL A;  4OES A;  5H8Q A;  5CMK A;  2HZL A;  3G7W A;  2DWA A;  2XXY A;  3VV5 A;  2ZYN A;  1RYO A;  2G93 A;  3T9X B;  1II5 A;  3MBP A;  2F6G A;  3CR9 A;  2DS9 A; 
#chains in the Genus database with same CATH topology
 3QYT A;  2GHB A;  4WED A;  1P1W A;  2GH9 A;  3NOH A;  3HHF A;  3L6H A;  4H0W A;  4RJZ A;  5EYF A;  2X7Q A;  5M2V A;  3ZKK A;  2XXV A;  2GFE A;  1HSL A;  1VFD A;  1NNP A;  1GGG A;  4R74 A;  4P0I A;  1D4N A;  2H98 A;  2QL3 A;  1B4H A;  3FV1 A;  4I40 A;  4OYV A;  4AB5 A;  4ZDM A;  4C1U A;  3IOR A;  3KN3 A;  4HCW A;  4PP0 A;  5I5P A;  4YMB A;  2O84 X;  1P99 A;  3K6V A;  3IJX B;  1VR5 A;  2WYP A;  4O3A A;  2XXU A;  1XC1 A;  4MH5 A;  1B0L A;  3PMX A;  1FRP A;  5H8H B;  5JTY A;  1IXG A;  1TWY A;  4NF6 B;  2Y7P A;  1QJM A;  3QUJ A;  2HAU A;  2E0S A;  2B4L A;  1LBB A;  5F24 A;  1LBC A;  3E78 A;  4N13 A;  4KHZ E;  2Z8F A;  5K2Y A;  4OFL A;  3IFC A;  1N04 A;  3MP8 A;  1MQI A;  2Q89 A;  3K6X A;  3Q28 A;  1DTZ A;  2DWH A;  5HM4 B;  1NFT A;  5L9O A;  2UVJ A;  3PGF A;  3FGS A;  4XIG Q;  3MW0 A;  1XI6 A;  4N15 A;  5EHS A;  4L17 A;  5H8F B;  2QS4 A;  1P1N A;  2I0C A;  3HCQ A;  4NX1 A;  1QVS A;  1SDX A;  3LC8 A;  2YPN A;  1SD3 A;  4LZ8 A;  4ZEB A;  4EF2 A;  4PFR A;  4E0W A;  4POX A;  3IOT A;  3MJN A;  3H06 B;  3SKP A;  3PU5 A;  1VE4 A;  1DSN A;  2PT1 A;  5H8H A;  2HXR A;  4MEV A;  2PMS A;  2Z23 A;  1MQH A;  1MPD A;  1J1N A;  3LUY A;  2A5S A;  1B4Z A;  5CMM A;  1YCJ A;  2CZI A;  2Y84 A;  3BIH A;  3TAJ A;  3MWB A;  4PC9 A;  2FVZ A;  1A99 A;  4KYD A;  2VD3 A;  3MPL A;  4KFQ A;  3T66 A;  2OCU A;  3PMW A;  1LBY A;  1SYI A;  2CEX A;  3SEY A;  3KC0 A;  3SEV A;  3KOT A;  4NF8 B;  3RPL B;  3ISP A;  2QS3 A;  2HFB A;  4G68 A;  4MLV A;  3FJG A;  4GBW A;  1TXF A;  4U1Z A;  4NF4 A;  1CNQ A;  4Q0C A;  3MST A;  3C4M A;  3CFX A;  5EQ7 A;  4ZEF A;  3M3K A;  1MY2 A;  2VT5 A;  1FQF A;  2QRY A;  3C36 A;  3N5L A;  4X04 A;  1IZ1 A;  4HS7 A;  4KCC A;  1QUJ A;  4BDN A;  4ESW A;  4KPT A;  4LZ5 A;  2XXR A;  1N0T A;  2XWI A;  2DVZ A;  4YMA A;  2UYE A;  4QFO A;  4RYA A;  4X1B A;  5A5X B;  1B58 A;  3HN0 A;  3U92 A;  3O6I A;  3P7I A;  1SPI A;  2R9J A;  3SES A;  2DXR A;  3ZKL A;  2DQV A;  3SER A;  3OO6 A;  1XVY A;  3K1P A;  3OO8 A;  2DE4 A;  1TFA A;  1MH3 A;  1SYH A;  3FXU A;  1G0H A;  2B3F A;  4PBH A;  1LB9 A;  3M3L A;  4Q30 B;  2H4I A;  3G3K A;  4WKM A;  3A3U A;  3RN8 A;  3V5A A;  2PCR A;  5H8N B;  2ZZV A;  1NL5 A;  2O7U A;  3EF7 A;  3TCG A;  4F31 B;  1LB8 A;  4IY5 A;  2DYX A;  2DDK A;  4JWY A;  4PGN A;  4ELP A;  4P9K A;  4O94 A;  4NG7 A;  3DP6 A;  1BLF A;  1ZMG A;  1OLC A;  2DXY A;  4F19 A;  4I3Y A;  1JP4 A;  1QGX A;  2ANJ A;  1JVX A;  4YKI A;  2GRV A;  2H5Y A;  3OSR A;  4DI4 B;  1FQC A;  2UVI A;  1KWH A;  3B6T A;  2YJP A;  2PX1 A;  4H1X A;  2UXA A;  5J16 A;  5L8D A;  1IMC A;  1TT1 A;  5EQ8 A;  4BDM A;  5FHM A;  5AA4 A;  5B70 A;  3TTL A;  1ELJ A;  2ZYO A;  5I7I A;  1MXV A;  1FQD A;  3IOW A;  3SET A;  3T93 B;  3K02 A;  3KSJ A;  1L5T A;  4FIM A;  3FBP A;  5CM6 A;  4P8B A;  1B3G A;  5HBC A;  5DVJ A;  4OVJ A;  5L9M A;  4F3B A;  1B7Z A;  5CBR A;  5H8N A;  3RTF B;  4RY1 A;  3UOR A;  1B2H A;  1NMU A;  3H6U A;  1Q9D A;  3VLU A;  4GWY A;  4F29 A;  1PEB A;  4KCD A;  3RQT A;  3G3F A;  1NNT A;  2F3D A;  4JB7 A;  3IB0 A;  4TQU Q;  2Z8E A;  1EH3 A;  1FBD A;  4BLA A;  2REG A;  1R9Q A;  4I62 A;  1UTH B;  3RLF E;  1FPB A;  2I48 A;  3ZS6 A;  3KBZ A;  4G8M A;  1QW0 A;  4N8Y A;  4RNS A;  4POW A;  4KYS A;  1MDP 1;  1FSA A;  1MXZ A;  1LFI A;  3PUX E;  2OJT A;  4YKK A;  3Q26 A;  2P2A A;  2CZK A;  1IME A;  3EQ1 A;  3JV9 A;  1LAF E;  3IR1 A;  5A5L A;  4EF1 A;  1N7X A;  1MQG A;  3HST A;  4R9F A;  2I3V A;  1B3H A;  1KA0 A;  3FXR A;  4GFR A;  4OVT A;  1OVT A;  4XKR A;  3FIR A;  3IFA A;  3BIG A;  1RDZ A;  5ET6 A;  3C31 A;  1CE2 A;  1JW1 A;  1MY3 A;  1FJ9 A;  1M5B A;  1NNF A;  4TOZ A;  3T96 B;  4H46 A;  3ILU B;  2V25 A;  2XHD A;  3U72 A;  2BJI A;  3O9P A;  4C1T A;  5FBP A;  1Q35 A;  1WDN A;  1M5E A;  1RKM A;  3H4Z A;  1EU8 A;  5EQ9 A;  4OHN A;  5H8S A;  5AA2 B;  5CMC A;  5KDT B;  3N94 A;  3MVZ A;  4JWO A;  1MXY A;  1R9L A;  2G29 A;  4FOR A;  2WYK A;  3LR1 A;  2XXQ A;  1XT8 A;  4Q8R A;  2I0B A;  3A3C A;  3TQL A;  4PDH A;  2F34 A;  1OIB A;  2F7B A;  3PTY A;  4X1D A;  2R6G E;  2NVU B;  2ZMB A;  1Z7M E;  3GBB A;  1B3F A;  2QFL A;  4PFY A;  1LFH A;  5EYG A;  4MIJ A;  1MY0 A;  3T22 A;  2V84 A;  3SEX A;  2PFY A;  3TFL A;  1NUY A;  1B5J A;  1LBX A;  3IL1 B;  4RK2 A;  4R72 A;  5IM2 A;  1XOC A;  2CZH A;  4PFU A;  4NHB A;  4MJO A;  4PBQ A;  2XXW A;  2RC9 A;  3UIF A;  2F5X A;  4QSD A;  3G3I A;  1H76 A;  4F1V A;  1AH5 A;  4GWX A;  4DIG A;  4OXV A;  4IO3 A;  1LCT A;  3PPR A;  4QRZ A;  1PB9 A;  1NH8 A;  3RT8 A;  3CFZ A;  2QJE A;  1EZO A;  4RPN A;  3FVO A;  4NF0 A;  3SEW A;  4JVD A;  2OBG A;  4IY6 A;  1JW4 A;  1FQA A;  4MAG A;  1I6B A;  3MQ9 A;  2HCA A;  4P1L A;  4OEV A;  4LA9 A;  4P56 A;  4F1Y A;  1FTK A;  4IGT A;  3RYD A;  4NWC A;  1JEV A;  2AL4 A;  3DP8 A;  4RXL A;  3VXC A;  2OWZ A;  1OLA A;  1US5 A;  4OA4 A;  2FHY A;  1GR2 A;  4PQJ A;  1PB8 A;  2D5W A;  3KN8 A;  3V83 A;  4XXU A;  4NF5 B;  5L9S A;  2Q2C A;  3MVX A;  4GRK A;  5DW8 A;  4N6D A;  3OXN A;  4U21 A;  5F7V A;  4BDL A;  4XF5 A;  4ZZE A;  3MP1 A;  3EKI A;  4OET A;  2Q9T A;  4OVR A;  4LP2 B;  3OO9 A;  1B51 A;  4LAT A;  4NN3 A;  2HHM A;  2I3W A;  4G68 C;  4KD5 A;  1QKA A;  1WOD A;  1GV8 A;  1URS A;  2O7I A;  3EPE A;  3N26 A;  3T9H B;  3LV0 A;  2UYF A;  2F97 A;  2D21 A;  4RPO A;  1FPG A;  1NUZ A;  3PMV A;  3IK6 B;  4ZED A;  1FPL A;  5ET5 A;  4X8R A;  4U1O A;  3DP4 A;  3HV1 A;  4ELQ A;  1SI1 A;  4JDF A;  3JZJ A;  3PPP A;  1BTJ A;  2A5T B;  4LON B;  1PDA A;  2KR0 A;  4AB6 A;  1IMB A;  3PPN A;  4OVP A;  3H7M A;  4UAC A;  3C33 A;  1EYJ A;  3CG3 A;  1VFE A;  4ZS9 A;  5TU0 A;  4DZ1 A;  5AA1 A;  5LTC A;  2UVG A;  3H03 A;  2X7P A;  3G3H A;  4QSC A;  1LAX A;  5IKB A;  3BFU A;  3TQW A;  4H65 A;  2O51 A;  4F39 A;  3CI8 A;  1NUX A;  1QUL A;  4R6Y A;  1A55 A;  4O8M A;  3E4R A;  1S50 A;  4GQO A;  2X26 A;  4JSD A;  3PUV E;  1AL3 A;  1ATG A;  3TCH A;  4R75 A;  4LQ5 A;  1IUD A;  4NE4 A;  1POY 1;  1EZP A;  5I2K B;  2Q74 A;  3EHS A;  2WBB A;  1Y9U A;  2QMW A;  4BDQ A;  3PUZ E;  4GX3 A;  3VE1 B;  4OER A;  4GL0 A;  1MQJ A;  4NF6 A;  1B1H A;  5KZT A;  1SBP A;  3GYY A;  4OMB A;  4NQ8 A;  2RC8 A;  2RC7 A;  1FPK A;  4JVC A;  4N17 A;  2A5T A;  2QS1 A;  1VSO A;  1B46 A;  3IOU A;  1P1U A;  1SW4 A;  3G3J A;  1NH7 A;  4UA8 A;  3MZB A;  4RA1 A;  3WAE A;  4MLQ A;  4U23 A;  1YZ0 A;  2QMX A;  3R6U A;  4DXU A;  3D4G A;  3T1B A;  4IO7 A;  1Y3N A;  3UP9 A;  2VPN A;  1B0H A;  3HFU A;  3RUM A;  5LDZ A;  4GD5 A;  1D9Q A;  3TTN A;  2XX9 A;  1IXH A;  4UAB A;  1Y4T A;  2AIX A;  1IMF A;  3KGC A;  5H8F A;  4EUO A;  5FHN A;  1QKB A;  3M8U A;  5LOM A;  4LQ2 A;  1B5I A;  1NKX A;  1JVY A;  2I4B A;  1MPC A;  1LST A;  1O63 A;  3O2A A;  1CB6 A;  1FPD A;  1OQG A;  4R73 A;  3WAF A;  3MUQ A;  1ZBM A;  2IEE A;  4GVO A;  3PUW E;  1H45 A;  4U4S A;  1Y3P A;  3VVD A;  4KI0 E;  4PFB A;  4GBV A;  3FZV A;  5ET8 A;  2Q8M A;  1YPN A;  1WVJ A;  1ZU0 A;  2DWJ A;  5CRY A;  3B8B A;  1LEV A;  3BFT A;  4R6K A;  4MMP A;  1GTK A;  3PV0 E;  4PAK A;  2QVR A;  5CMB A;  2DE3 A;  4NF8 A;  3RPL A;  4GWZ A;  3S9N C;  4MNI A;  4ZEI A;  3FD3 A;  5J1D A;  4PDD A;  3MVY A;  5DTB A;  2VPO A;  3ILT B;  3TEL A;  2RF1 A;  4PCD A;  2ONR A;  1KZ8 A;  2FBP A;  3DEL B;  2ZYK A;  3ZSF A;  3W9V A;  3MZ9 A;  1IIT A;  2P3V A;  4MF3 A;  1LAH E;  1VDW A;  2F7C A;  4ELO A;  4NED A;  4F22 A;  4K3F A;  1O7T A;  4ZEC A;  2BJJ X;  1M5D A;  2B4M A;  4F1U A;  1SVX B;  2HZK A;  4HW8 A;  4I8C A;  5A5X A;  2F8D A;  4I1D A;  3UA8 A;  1MRP A;  2Y7I A;  5JK4 A;  1MPB A;  1QUI A;  1UTB B;  3A29 A;  1O64 A;  2F3B A;  3SDF A;  2AYS A;  2WKY A;  3KFM A;  3O97 A;  3M3F A;  5FTH A;  2XXI A;  2RCA A;  1MDQ A;  5DVI A;  2ZNT A;  3Q25 A;  4XKP A;  1XVX A;  2VD2 A;  4PF6 A;  5I58 B;  1IEJ A;  5DT6 A;  1BIY A;  4QXD A;  3MYU A;  4YAH X;  3E3K A;  3RT6 B;  1JW5 A;  2Y7R A;  2P1S A;  1OMP A;  1FPE A;  3PPQ A;  2FYI A;  1FBH A;  2ZZW A;  3L6G A;  4N07 A;  5EYH A;  1DPP A;  3C32 A;  1A8F A;  3GLB A;  2P0S A;  3HPI A;  1NV7 A;  5AA3 A;  4MNC A;  3I3V A;  1JNF A;  2R8T A;  3CFL A;  4WEP A;  2V3U A;  5I59 B;  4ESX A;  4IO6 A;  2O1M A;  1K9Z A;  3MP6 A;  1D3K A;  1MG1 A;  4XTC Q;  3DLN A;  4BDR A;  1MM7 A;  4G2Z A;  4LUB A;  2ABH A;  1UTB A;  3OEN A;  3QUF A;  5DEX B;  4X48 A;  1DK4 A;  2XWV A;  3OEM A;  2CEY A;  2ONK E;  3O6H A;  4MFI A;  4FED A;  5EHM A;  2XX7 A;  4DCY A;  1MY4 A;  3E9X A;  5CC2 A;  2HAV A;  2WEF A;  3R7X A;  3TCF A;  3TTR A;  2LAO A;  5I58 A;  3RNN A;  3CG1 A;  3OSQ A;  4YB6 A;  4PF8 A;  5T3J A;  3QIM A;  3ECR A;  3K2D A;  2Z8D A;  4O7M A;  2V4C A;  1SW2 A;  4QBA A;  2Y5K A;  1B40 A;  4G4P A;  1B32 A;  2XWO A;  4JSO A;  4P11 A;  4HXV A;  1AIV A;  4DXB A;  1PB7 A;  2H9B A;  3N6T A;  4GOT A;  5IAI A;  4FJP A;  1UTH A;  3N6U A;  3TKD A;  4HE1 A;  4XEQ A;  1UIU A;  1FBF A;  4PFT A;  3ROJ A;  4HE0 A;  3TZA A;  3HHG A;  5I2N B;  3W15 C;  4GWO A;  5ICQ A;  3QXM A;  3OO7 A;  1FBE A;  5I57 B;  3KZG A;  1NV0 A;  3FJ7 A;  3QMF A;  3SZP A;  2JJK A;  2Z22 A;  3TTK A;  4P1E A;  2VGQ A;  3TTM A;  5H8Q B;  3ODB A;  3ONM A;  1USY H;  4QSE A;  4BDO A;  4R6H A;  2ZXT A;  4ND9 A;  2DSF A;  5DEX A;  4ZE8 A;  1B52 A;  2OWT A;  3K0V A;  4JBZ A;  2HPG A;  4OQO A;  2OZZ A;  1G0I A;  1D9Y A;  4EQ7 A;  1ZIU A;  3IX1 A;  3THI A;  1SW5 A;  1PBQ A;  4FE8 A;  4H8J A;  2Q8J A;  4FEB A;  2H25 A;  1A40 A;  3KSX A;  2VOZ A;  1ZTY A;  3MPK A;  3O29 A;  3VVE A;  4YIC A;  5ET7 A;  5DVF A;  3TUS A;  1AOV A;  2ONS A;  1FTJ A;  3T9V A;  4KQP A;  4OFO A;  4NAP A;  3UGW A;  5B7D A;  3T9U A;  3C34 A;  3S9E A;  5AA2 A;  1FTL A;  5KDT A;  1HSJ A;  2O69 A;  4NWD A;  2XXT A;  1R6Z A;  3V89 B;  4YB7 A;  1UIV A;  3FV2 A;  4H5F A;  5I2N A;  2V3Q A;  5ELV A;  1N3X A;  2OK2 A;  3V8X B;  1YAE A;  1FPF A;  4M1V A;  4O7I A;  2GQ1 A;  4FBP A;  4GXA A;  4OTE A;  4YU0 A;  1I6Q A;  5JTY B;  4YKP A;  1DCU A;  2FIX A;  3MZ1 A;  4PE3 A;  4YZZ A;  2PT2 A;  4NGU A;  1MQD A;  1SI0 A;  2W7Y A;  4PTK A;  3S4U A;  4AQ4 A;  4GWU A;  3CVG A;  1I6A A;  5HPQ A;  1Y1M A;  1D9V A;  2P3N A;  4IO2 A;  2WBD A;  1DBZ A;  1URG A;  4N6P A;  4QFP A;  3S9L C;  1FW0 A;  4KXP A;  1JEU A;  2IA4 A;  4GF8 A;  2NUV A;  1FCK A;  5KCJ B;  4R9G A;  2HQ0 A;  3FJM A;  3FAT A;  1RDY A;  4ZEK A;  3T0J A;  1MXU A;  4N4U A;  1Y4C A;  4PAF A;  3KBR A;  1P1Q A;  3I6V A;  3AXF A;  2YLN A;  4WXJ A;  2Q88 A;  3FVK A;  1JET A;  2CMO A;  3O6G A;  3VXB A;  1LFG A;  5CBS A;  3IB2 A;  4YB5 A;  3I5O A;  4OAN A;  4DDD A;  4X9T A;  1SQY A;  3PD8 A;  3TDJ A;  5IZ3 B;  4PET A;  5TPA B;  3S9M C;  4PE5 B;  3U65 A;  1TFD A;  3FVN A;  2KLF A;  1NV4 A;  4DXC A;  5BUU A;  5ICT A;  3TEP A;  3OMB A;  3EHT A;  3C9H A;  4DLD A;  2NOO A;  3KC1 A;  3W9W A;  2XD3 A;  1LGB C;  4EXK A;  3GZG A;  2ZYM A;  4NF5 A;  4GL8 A;  4N6K A;  3IOV A;  2F36 A;  3KEI A;  3Q27 A;  1R1N A;  5ITO A;  3OEK A;  4ZE9 A;  2DE2 A;  1PC3 A;  1FBC A;  3LSW A;  1URD A;  2RCB A;  4F2O A;  5KCJ A;  3CRB A;  2FA7 A;  3EN3 A;  4G68 B;  3PPO A;  3LUZ A;  3FVG A;  3B6W A;  4FEC A;  1MXW A;  2NXO A;  1B7H A;  1Y20 A;  4OWD A;  4NF4 B;  1B1X A;  4H67 A;  4GXS B;  2F78 A;  2XXK A;  4DCX A;  1INP A;  2REJ A;  2XD2 A;  1DMB A;  5BWJ A;  1Q1K A;  1UQW A;  2E1S A;  1DTG A;  3K6W A;  4MNP A;  4PGP A;  5IZ3 A;  4PFW A;  5TPA A;  2I49 A;  3TYH A;  4DE8 A;  1N3W A;  1PBP A;  4G77 A;  5I56 B;  1B7U A;  3OOA A;  1N7W A;  2F6P A;  4PAI A;  1YXI A;  3QK6 A;  3K1M A;  2OWS A;  4P47 A;  4LZ7 A;  1S9T A;  2I4C A;  1ZLQ A;  2QPQ A;  1LAG E;  4PFI A;  3FAS A;  1FQE A;  1MY1 A;  4U2R A;  3U8Q A;  1P1O A;  2F35 A;  2OX3 A;  3FXB A;  5AE4 A;  3DM0 A;  4G8H A;  3SEU A;  2DP8 A;  2VHA A;  1Y1Z A;  2ESN A;  1RYX A;  4QHQ A;  2O1L A;  4H5G A;  3JYR A;  3K01 A;  1KA1 A;  2XXX A;  1IIW A;  1M5F A;  4MX6 A;  1BP5 A;  4F3G A;  1RDX A;  4GX6 A;  4R2F A;  3O66 A;  1NNK A;  3KOS A;  4I3E A;  1SW1 A;  5I2K A;  3IB1 A;  1FTM A;  2ALU A;  2DOJ A;  3H3G A;  4GX4 A;  1A8E A;  2PVU A;  3D4C A;  2THI A;  2QSX A;  3HO7 A;  2HXW A;  1H44 A;  2FNC A;  3B50 A;  4OFJ A;  5I56 A;  1LBV A;  1EYI A;  1S7Y A;  4HTG A;  3VDF A;  1FBG A;  3B7D A;  1AMF A;  3VLV A;  5AA4 B;  1A7L A;  1NV5 A;  2PFZ A;  3O28 A;  1MM6 A;  4EQB A;  3KJ7 A;  3RY3 A;  4OVQ A;  2XA5 A;  3TPA A;  2QVV A;  4OVS A;  3E79 A;  3K6U A;  4MCO A;  1F9B A;  4MBP A;  4LVQ A;  2RKM A;  2DWI A;  4F2Q A;  4F18 A;  1FQB A;  1IXC A;  1IMA A;  3A09 A;  2Y7K A;  1ZJL A;  1AWB A;  1ZKB A;  4EDP A;  5K2X A;  3K00 A;  5EQA A;  3CSG A;  4R2B A;  3VVF A;  3KG2 A;  1B05 A;  3U1O A;  3UK4 A;  5FTI A;  3CHG A;  1NV6 A;  1Z7N E;  5IZ1 A;  1A54 A;  4GWS A;  2B3B A;  4OEN A;  5ISU A;  2GHA A;  4HCY A;  3LSF B;  4H6D A;  3KN7 A;  1H3D A;  1EZ9 A;  2XXH A;  1DOT A;  1OVB A;  2O68 A;  3IO6 A;  3G3G A;  4JXI A;  4P3L A;  3LBS A;  3RTW B;  4H45 A;  3EHU A;  3MC2 A;  3TOD A;  3OD7 A;  3QSL A;  3MAM A;  2QVU A;  3CSB A;  2Y7W A;  3F11 A;  1IMD A;  2B65 A;  2FIE A;  5JEI A;  1LCF A;  2PBW A;  1DPE A;  1US4 A;  1NUW A;  2HEU A;  4EXL A;  1NV2 A;  4GLI A;  1FTO A;  3UN6 A;  3U93 A;  4ISU A;  1B3L A;  4KYE A;  4P0G A;  4H8I A;  3IJO B;  4EQ9 A;  2DVC A;  1NV3 A;  4GIZ A;  5CI5 A;  1OQH A;  3TMG A;  2XXP A;  3CIJ A;  5IZZ A;  1B6H A;  4U4X A;  3USD A;  4FAT A;  2QS2 A;  1XHY A;  3LSL A;  1LBZ A;  1N84 A;  4ELR A;  2V93 A;  1BKA A;  2Q2A A;  2KQZ A;  3PD9 A;  3KJT A;  1T0K A;  2D3I A;  5TP9 B;  1JQF A;  3D1R A;  4IB2 A;  2XX8 A;  4FAJ A;  3OEL A;  3R26 A;  5F1Q A;  2Y5L A;  1FPI A;  2NWJ A;  3U94 A;  5AA2 D;  2ZNU A;  4O3B A;  1Y3Q A;  4Z0I A;  3FUZ A;  4QFN A;  3IAZ A;  4XFE A;  4G8N A;  4O3C A;  4IR8 A;  1IQ7 A;  4ECF A;  1BK4 A;  4AS4 A;  5ESY A;  1N76 A;  2PYY A;  2ZNS A;  1LLS A;  5DYH A;  4U22 A;  4THI A;  1B9J A;  3H6W A;  5I84 A;  1QUK A;  3E13 X;  3VLW A;  2R71 A;  1B3E A;  3B6Q A;  4E0X A;  1I69 A;  1ANF A;  4I9D A;  4DI3 D;  4QFK A;  5FHO A;  2RIN A;  1HSE A;  5I3S A;  1USY E;  1EYK A;  4IO5 A;  5I59 A;  1YTV A;  3H6V A;  4QF9 A;  1FTA A;  3MVW A;  4IGR A;  2UVH A;  4XKN A;  1FBP A;  2H99 A;  3BKI B;  2ZZX A;  4OEU A;  3IO4 A;  5TP9 A;  1POT A;  2XWK A;  4LN5 A;  1K9Y A;  1H43 A;  1LBW A;  4KR5 A;  1M5C A;  1NV1 A;  4N91 A;  1MH4 A;  2WX9 A;  4Q5T A;  4JWX A;  3GXA A;  2F7A A;  4TLM B;  2L5V A;  1XS5 A;  4G61 A;  3FXQ A;  5IGA A;  3K1N A;  4IO4 A;  4MHF A;  4Z7E A;  2O6A A;  4XKQ A;  4AS5 A;  1MXX A;  2I58 A;  5ITP A;  4ZZA A;  3RPW A;  4OZ9 A;  1IXI A;  4F3S A;  1MS7 A;  3VFJ A;  3BBR A;  3PUY E;  3K4U A;  2VP1 A;  4F3P A;  3H6T A;  4TLL B;  2I6E A;  4YKJ A;  3C35 A;  4RK9 A;  2V3T A;  3LSX A;  1FJ6 A;  2AL5 A;  1GVC A;  3RGY A;  3S2V A;  2M8C A;  4QFL A;  4NMY A;  2OLB A;  4HE2 A;  3GBA A;  3QAX A;  4NTL A;  4ONY A;  5I57 A;  1B5H A;  3Q29 A;  4C0R A;  4M4G A;  4OES A;  2CZL A;  4N8G A;  5H8Q A;  5CMK A;  1YYZ A;  2HZL A;  3G7W A;  1NI9 A;  2DWA A;  2XXY A;  3VV5 A;  2ZYN A;  1RYO A;  2G93 A;  2MKZ A;  3T9X B;  1II5 A;  4JVI A;  1FPJ A;  4N81 A;  3MBP A;  2F6G A;  4GWW A;  3CR9 A;  2DS9 A; 
#chains in the Genus database with same CATH homology
 3QYT A;  2GHB A;  4WED A;  1P1W A;  2GH9 A;  3HHF A;  3L6H A;  4H0W A;  4RJZ A;  5EYF A;  2X7Q A;  5M2V A;  3ZKK A;  2XXV A;  2GFE A;  1HSL A;  1VFD A;  1NNP A;  1GGG A;  4R74 A;  4P0I A;  1D4N A;  2H98 A;  2QL3 A;  1B4H A;  3FV1 A;  4OYV A;  4AB5 A;  4ZDM A;  4C1U A;  3IOR A;  3KN3 A;  4HCW A;  4PP0 A;  4YMB A;  2O84 X;  1P99 A;  3K6V A;  3IJX B;  1VR5 A;  4O3A A;  2XXU A;  1XC1 A;  4MH5 A;  1B0L A;  3PMX A;  5H8H B;  5JTY A;  1IXG A;  1TWY A;  4NF6 B;  2Y7P A;  1QJM A;  3QUJ A;  2HAU A;  2E0S A;  1LBB A;  1LBC A;  4N13 A;  4KHZ E;  2Z8F A;  5K2Y A;  4OFL A;  1N04 A;  3MP8 A;  1MQI A;  2Q89 A;  3K6X A;  3Q28 A;  1DTZ A;  2DWH A;  5HM4 B;  1NFT A;  5L9O A;  2UVJ A;  3PGF A;  3FGS A;  4XIG Q;  3MW0 A;  5EHS A;  4L17 A;  5H8F B;  2QS4 A;  1P1N A;  2I0C A;  3HCQ A;  1QVS A;  1SDX A;  3LC8 A;  2YPN A;  1SD3 A;  4LZ8 A;  4ZEB A;  4EF2 A;  4E0W A;  4POX A;  3IOT A;  3MJN A;  3H06 B;  3SKP A;  3PU5 A;  1VE4 A;  1DSN A;  2PT1 A;  5H8H A;  2PMS A;  2Z23 A;  1MQH A;  1MPD A;  1J1N A;  3LUY A;  2A5S A;  1B4Z A;  5CMM A;  1YCJ A;  2Y84 A;  3TAJ A;  3MWB A;  1A99 A;  4KYD A;  2VD3 A;  3MPL A;  4KFQ A;  3T66 A;  2OCU A;  3PMW A;  1SYI A;  3SEY A;  3SEV A;  3KOT A;  4NF8 B;  2QS3 A;  2HFB A;  4G68 A;  4MLV A;  3FJG A;  1TXF A;  4U1Z A;  4NF4 A;  4Q0C A;  3C4M A;  3CFX A;  4ZEF A;  3M3K A;  1MY2 A;  1FQF A;  2QRY A;  3C36 A;  3N5L A;  1IZ1 A;  4HS7 A;  4KCC A;  1QUJ A;  4BDN A;  4ESW A;  4KPT A;  4LZ5 A;  2XXR A;  1N0T A;  2DVZ A;  4YMA A;  2UYE A;  4QFO A;  4RYA A;  4X1B A;  5A5X B;  1B58 A;  3HN0 A;  3U92 A;  3O6I A;  3P7I A;  2R9J A;  3SES A;  2DXR A;  3ZKL A;  2DQV A;  3SER A;  3OO6 A;  1XVY A;  3K1P A;  3OO8 A;  2DE4 A;  1TFA A;  1MH3 A;  1SYH A;  3FXU A;  2B3F A;  1LB9 A;  3M3L A;  4Q30 B;  2H4I A;  3G3K A;  4WKM A;  3A3U A;  3RN8 A;  3V5A A;  5H8N B;  1NL5 A;  2O7U A;  3EF7 A;  3TCG A;  4F31 B;  1LB8 A;  4IY5 A;  2DYX A;  4JWY A;  4ELP A;  3DP6 A;  1BLF A;  1ZMG A;  1OLC A;  2DXY A;  4F19 A;  2ANJ A;  1JVX A;  4YKI A;  2GRV A;  2H5Y A;  3OSR A;  1FQC A;  2UVI A;  1KWH A;  3B6T A;  2YJP A;  2PX1 A;  4H1X A;  2UXA A;  5L8D A;  1TT1 A;  4BDM A;  5FHM A;  5AA4 A;  5B70 A;  3TTL A;  1ELJ A;  2ZYO A;  1MXV A;  1FQD A;  3IOW A;  3SET A;  3T93 B;  3K02 A;  3KSJ A;  1L5T A;  4FIM A;  5CM6 A;  1B3G A;  5HBC A;  5DVJ A;  4OVJ A;  5L9M A;  4F3B A;  1B7Z A;  5CBR A;  5H8N A;  3RTF B;  4RY1 A;  3UOR A;  1B2H A;  1NMU A;  3H6U A;  3VLU A;  4F29 A;  1PEB A;  4KCD A;  3RQT A;  3G3F A;  1NNT A;  4JB7 A;  3IB0 A;  4TQU Q;  2Z8E A;  1EH3 A;  4BLA A;  2REG A;  1R9Q A;  4I62 A;  1UTH B;  3RLF E;  2I48 A;  3ZS6 A;  4G8M A;  1QW0 A;  4RNS A;  4POW A;  4KYS A;  1MDP 1;  1MXZ A;  1LFI A;  3PUX E;  2OJT A;  4YKK A;  3Q26 A;  2P2A A;  3EQ1 A;  3JV9 A;  1LAF E;  3IR1 A;  4EF1 A;  1N7X A;  1MQG A;  3HST A;  4R9F A;  2I3V A;  1B3H A;  3FXR A;  4GFR A;  1OVT A;  4XKR A;  3FIR A;  3C31 A;  1CE2 A;  1JW1 A;  1MY3 A;  1M5B A;  1NNF A;  4TOZ A;  3T96 B;  3ILU B;  2V25 A;  2XHD A;  3U72 A;  3O9P A;  4C1T A;  1Q35 A;  1WDN A;  1M5E A;  1RKM A;  3H4Z A;  1EU8 A;  4OHN A;  5H8S A;  5AA2 B;  5CMC A;  5KDT B;  3N94 A;  3MVZ A;  4JWO A;  1MXY A;  1R9L A;  2G29 A;  4FOR A;  3LR1 A;  2XXQ A;  1XT8 A;  4Q8R A;  2I0B A;  3A3C A;  3TQL A;  2F34 A;  1OIB A;  2F7B A;  4X1D A;  2R6G E;  2NVU B;  2ZMB A;  1Z7M E;  3GBB A;  1B3F A;  4PFY A;  1LFH A;  1MY0 A;  3T22 A;  2V84 A;  3SEX A;  3TFL A;  1B5J A;  3IL1 B;  4RK2 A;  4R72 A;  1XOC A;  4PFU A;  2XXW A;  2RC9 A;  3UIF A;  2F5X A;  4QSD A;  3G3I A;  1H76 A;  4F1V A;  1AH5 A;  4DIG A;  4OXV A;  4IO3 A;  1LCT A;  3PPR A;  4QRZ A;  1PB9 A;  1NH8 A;  3RT8 A;  3CFZ A;  2QJE A;  1EZO A;  4RPN A;  3FVO A;  3SEW A;  2OBG A;  4IY6 A;  1JW4 A;  1FQA A;  1I6B A;  3MQ9 A;  2HCA A;  4OEV A;  4LA9 A;  4F1Y A;  1FTK A;  4IGT A;  4NWC A;  1JEV A;  2AL4 A;  3DP8 A;  4RXL A;  3VXC A;  1OLA A;  1US5 A;  1GR2 A;  4PQJ A;  1PB8 A;  2D5W A;  3KN8 A;  3V83 A;  4XXU A;  4NF5 B;  5L9S A;  2Q2C A;  3MVX A;  4GRK A;  3OXN A;  4U21 A;  5F7V A;  4BDL A;  4ZZE A;  3MP1 A;  4OET A;  2Q9T A;  4LP2 B;  3OO9 A;  1B51 A;  4LAT A;  2I3W A;  4G68 C;  4KD5 A;  1QKA A;  1WOD A;  1GV8 A;  1URS A;  2O7I A;  3EPE A;  3N26 A;  3T9H B;  2UYF A;  2F97 A;  2D21 A;  4RPO A;  3PMV A;  3IK6 B;  4ZED A;  4U1O A;  3DP4 A;  3HV1 A;  4ELQ A;  1SI1 A;  4JDF A;  3JZJ A;  3PPP A;  1BTJ A;  2A5T B;  4LON B;  1PDA A;  4AB6 A;  3PPN A;  3H7M A;  4UAC A;  3C33 A;  3CG3 A;  1VFE A;  4ZS9 A;  5TU0 A;  4DZ1 A;  5AA1 A;  2UVG A;  3H03 A;  2X7P A;  3G3H A;  4QSC A;  1LAX A;  5IKB A;  3BFU A;  3TQW A;  4H65 A;  2O51 A;  4F39 A;  3CI8 A;  1QUL A;  4R6Y A;  1A55 A;  3E4R A;  1S50 A;  4GQO A;  2X26 A;  4JSD A;  3PUV E;  1AL3 A;  1ATG A;  3TCH A;  4R75 A;  4LQ5 A;  1IUD A;  4NE4 A;  1POY 1;  1EZP A;  5I2K B;  3EHS A;  1Y9U A;  2QMW A;  4BDQ A;  3PUZ E;  3VE1 B;  4OER A;  4GL0 A;  1MQJ A;  4NF6 A;  1B1H A;  5KZT A;  1SBP A;  4OMB A;  2RC8 A;  2RC7 A;  2A5T A;  2QS1 A;  1VSO A;  1B46 A;  3IOU A;  1P1U A;  1SW4 A;  3G3J A;  1NH7 A;  4UA8 A;  3MZB A;  4RA1 A;  3WAE A;  4MLQ A;  4U23 A;  2QMX A;  3R6U A;  4DXU A;  3D4G A;  4IO7 A;  1Y3N A;  3UP9 A;  1B0H A;  3RUM A;  4GD5 A;  3TTN A;  2XX9 A;  1IXH A;  1Y4T A;  2AIX A;  3KGC A;  5H8F A;  4EUO A;  5FHN A;  1QKB A;  3M8U A;  5LOM A;  4LQ2 A;  1B5I A;  1NKX A;  1JVY A;  2I4B A;  1MPC A;  1LST A;  1O63 A;  3O2A A;  1CB6 A;  1OQG A;  4R73 A;  3WAF A;  3MUQ A;  1ZBM A;  2IEE A;  4GVO A;  3PUW E;  1H45 A;  4U4S A;  1Y3P A;  3VVD A;  4KI0 E;  3FZV A;  1YPN A;  1WVJ A;  1ZU0 A;  2DWJ A;  5CRY A;  3BFT A;  4R6K A;  1GTK A;  3PV0 E;  5CMB A;  2DE3 A;  4NF8 A;  3S9N C;  4ZEI A;  3FD3 A;  5J1D A;  3MVY A;  5DTB A;  3ILT B;  3TEL A;  2RF1 A;  2ONR A;  3DEL B;  2ZYK A;  3ZSF A;  3W9V A;  3MZ9 A;  1IIT A;  4MF3 A;  1LAH E;  2F7C A;  4ELO A;  4NED A;  4F22 A;  4K3F A;  1O7T A;  4ZEC A;  2BJJ X;  1M5D A;  4F1U A;  1SVX B;  2HZK A;  4HW8 A;  4I8C A;  5A5X A;  2F8D A;  4I1D A;  3UA8 A;  1MRP A;  2Y7I A;  5JK4 A;  1MPB A;  1QUI A;  1UTB B;  1O64 A;  3SDF A;  2AYS A;  2WKY A;  3KFM A;  3O97 A;  3M3F A;  5FTH A;  2XXI A;  2RCA A;  1MDQ A;  5DVI A;  2ZNT A;  3Q25 A;  4XKP A;  1XVX A;  2VD2 A;  5I58 B;  1IEJ A;  5DT6 A;  1BIY A;  4YAH X;  3E3K A;  3RT6 B;  1JW5 A;  2Y7R A;  2P1S A;  1OMP A;  3PPQ A;  2FYI A;  3L6G A;  4N07 A;  1DPP A;  3C32 A;  1A8F A;  3GLB A;  2P0S A;  3HPI A;  5AA3 A;  3I3V A;  1JNF A;  3CFL A;  4WEP A;  2V3U A;  5I59 B;  4ESX A;  4IO6 A;  2O1M A;  3MP6 A;  1D3K A;  1MG1 A;  4XTC Q;  3DLN A;  4BDR A;  1MM7 A;  4G2Z A;  4LUB A;  2ABH A;  1UTB A;  3OEN A;  3QUF A;  5DEX B;  4X48 A;  3OEM A;  2ONK E;  3O6H A;  4MFI A;  4FED A;  5EHM A;  2XX7 A;  4DCY A;  1MY4 A;  3E9X A;  5CC2 A;  2HAV A;  3R7X A;  3TCF A;  3TTR A;  2LAO A;  5I58 A;  3RNN A;  3CG1 A;  3OSQ A;  4YB6 A;  3QIM A;  3ECR A;  3K2D A;  2Z8D A;  1SW2 A;  1B40 A;  4G4P A;  1B32 A;  4JSO A;  4P11 A;  1AIV A;  4DXB A;  1PB7 A;  2H9B A;  3N6T A;  4GOT A;  5IAI A;  4FJP A;  1UTH A;  3N6U A;  3TKD A;  1UIU A;  4PFT A;  3TZA A;  3HHG A;  5I2N B;  3W15 C;  4GWO A;  5ICQ A;  3QXM A;  3OO7 A;  5I57 B;  3KZG A;  3FJ7 A;  2Z22 A;  3TTK A;  2VGQ A;  3TTM A;  5H8Q B;  3ODB A;  3ONM A;  1USY H;  4QSE A;  4BDO A;  4R6H A;  2ZXT A;  4ND9 A;  2DSF A;  5DEX A;  4ZE8 A;  1B52 A;  2OWT A;  3K0V A;  4JBZ A;  4OQO A;  2OZZ A;  1D9Y A;  4EQ7 A;  1ZIU A;  3IX1 A;  3THI A;  1PBQ A;  1SW5 A;  4FE8 A;  4H8J A;  2Q8J A;  4FEB A;  2H25 A;  1A40 A;  3KSX A;  2VOZ A;  1ZTY A;  3MPK A;  3O29 A;  3VVE A;  4YIC A;  5DVF A;  3TUS A;  1AOV A;  2ONS A;  1FTJ A;  3T9V A;  4KQP A;  4OFO A;  3UGW A;  5B7D A;  3T9U A;  3C34 A;  3S9E A;  5AA2 A;  1FTL A;  5KDT A;  1HSJ A;  2O69 A;  4NWD A;  2XXT A;  1R6Z A;  3V89 B;  4YB7 A;  1UIV A;  3FV2 A;  4H5F A;  5I2N A;  2V3Q A;  5ELV A;  1N3X A;  2OK2 A;  3V8X B;  1YAE A;  4M1V A;  4GXA A;  4OTE A;  4YU0 A;  1I6Q A;  5JTY B;  4YKP A;  3MZ1 A;  4YZZ A;  2PT2 A;  1MQD A;  1SI0 A;  2W7Y A;  3S4U A;  4AQ4 A;  3CVG A;  1I6A A;  5HPQ A;  1Y1M A;  1D9V A;  4IO2 A;  1URG A;  4N6P A;  4QFP A;  3S9L C;  1FW0 A;  1JEU A;  2IA4 A;  4GF8 A;  2NUV A;  1FCK A;  5KCJ B;  4R9G A;  2HQ0 A;  3FJM A;  3FAT A;  4ZEK A;  1MXU A;  1Y4C A;  3KBR A;  1P1Q A;  3I6V A;  3AXF A;  2YLN A;  4WXJ A;  2Q88 A;  3FVK A;  1JET A;  2CMO A;  3O6G A;  3VXB A;  1LFG A;  5CBS A;  3IB2 A;  4YB5 A;  3I5O A;  4DDD A;  4X9T A;  1SQY A;  3PD8 A;  3TDJ A;  4PET A;  5TPA B;  3S9M C;  4PE5 B;  1TFD A;  3FVN A;  2KLF A;  4DXC A;  5BUU A;  5ICT A;  3TEP A;  3OMB A;  3EHT A;  3C9H A;  4DLD A;  2NOO A;  3W9W A;  2XD3 A;  1LGB C;  4EXK A;  3GZG A;  2ZYM A;  4NF5 A;  4GL8 A;  3IOV A;  2F36 A;  3KEI A;  3Q27 A;  1R1N A;  5ITO A;  3OEK A;  4ZE9 A;  2DE2 A;  1PC3 A;  3LSW A;  1URD A;  2RCB A;  4F2O A;  5KCJ A;  3CRB A;  2FA7 A;  3EN3 A;  4G68 B;  3PPO A;  3FVG A;  3B6W A;  4FEC A;  1MXW A;  2NXO A;  1B7H A;  1Y20 A;  4OWD A;  4NF4 B;  1B1X A;  4H67 A;  4GXS B;  2F78 A;  4DCX A;  2REJ A;  2XD2 A;  1DMB A;  5BWJ A;  1Q1K A;  1UQW A;  2E1S A;  1DTG A;  3K6W A;  4PFW A;  5TPA A;  2I49 A;  3TYH A;  4DE8 A;  1N3W A;  1PBP A;  4G77 A;  5I56 B;  1B7U A;  3OOA A;  1N7W A;  2F6P A;  3QK6 A;  3K1M A;  2OWS A;  4LZ7 A;  1S9T A;  2I4C A;  1ZLQ A;  2QPQ A;  1LAG E;  3FAS A;  1FQE A;  1MY1 A;  4U2R A;  3U8Q A;  1P1O A;  2F35 A;  5AE4 A;  3DM0 A;  4G8H A;  3SEU A;  2DP8 A;  2VHA A;  1Y1Z A;  2ESN A;  1RYX A;  4QHQ A;  2O1L A;  4H5G A;  3JYR A;  3K01 A;  2XXX A;  1IIW A;  1M5F A;  1BP5 A;  4F3G A;  4R2F A;  3O66 A;  1NNK A;  3KOS A;  1SW1 A;  5I2K A;  3IB1 A;  1FTM A;  2ALU A;  2DOJ A;  3H3G A;  1A8E A;  2PVU A;  3D4C A;  2THI A;  2QSX A;  3HO7 A;  2HXW A;  1H44 A;  2FNC A;  4OFJ A;  5I56 A;  4HTG A;  1S7Y A;  3VDF A;  3B7D A;  1AMF A;  3VLV A;  5AA4 B;  1A7L A;  3O28 A;  1MM6 A;  4EQB A;  3KJ7 A;  3RY3 A;  3TPA A;  3K6U A;  1F9B A;  4MBP A;  4LVQ A;  2RKM A;  2DWI A;  4F2Q A;  4F18 A;  1FQB A;  1IXC A;  3A09 A;  2Y7K A;  1ZJL A;  1ZKB A;  4EDP A;  5K2X A;  3K00 A;  3CSG A;  4R2B A;  3VVF A;  3KG2 A;  1B05 A;  3U1O A;  3UK4 A;  5FTI A;  1Z7N E;  1A54 A;  2B3B A;  4OEN A;  5ISU A;  2GHA A;  4HCY A;  3LSF B;  4H6D A;  3KN7 A;  1H3D A;  1EZ9 A;  2XXH A;  1DOT A;  1OVB A;  2O68 A;  3IO6 A;  3G3G A;  4JXI A;  3LBS A;  3RTW B;  3EHU A;  3MC2 A;  3TOD A;  3OD7 A;  3QSL A;  3MAM A;  3CSB A;  2Y7W A;  3F11 A;  2B65 A;  5JEI A;  1LCF A;  2PBW A;  1DPE A;  1US4 A;  2HEU A;  4EXL A;  4GLI A;  1FTO A;  3UN6 A;  3U93 A;  4ISU A;  1B3L A;  4KYE A;  4P0G A;  4H8I A;  3IJO B;  4EQ9 A;  2DVC A;  4GIZ A;  5CI5 A;  1OQH A;  3TMG A;  2XXP A;  3CIJ A;  1B6H A;  3USD A;  4U4X A;  4FAT A;  2QS2 A;  1XHY A;  3LSL A;  1N84 A;  4ELR A;  2V93 A;  1BKA A;  2Q2A A;  3PD9 A;  3KJT A;  1T0K A;  2D3I A;  5TP9 B;  1JQF A;  4IB2 A;  2XX8 A;  4FAJ A;  3OEL A;  3R26 A;  5F1Q A;  2NWJ A;  3U94 A;  5AA2 D;  2ZNU A;  4O3B A;  1Y3Q A;  4Z0I A;  3FUZ A;  4QFN A;  3IAZ A;  4G8N A;  4O3C A;  1IQ7 A;  4ECF A;  1N76 A;  2PYY A;  2ZNS A;  1LLS A;  5DYH A;  4U22 A;  4THI A;  1B9J A;  3H6W A;  5I84 A;  1QUK A;  3E13 X;  3VLW A;  2R71 A;  1B3E A;  3B6Q A;  4E0X A;  1I69 A;  1ANF A;  4I9D A;  4QFK A;  5FHO A;  2RIN A;  1HSE A;  1USY E;  4IO5 A;  5I59 A;  1YTV A;  3H6V A;  4QF9 A;  3MVW A;  4IGR A;  2UVH A;  4XKN A;  2H99 A;  3BKI B;  4OEU A;  3IO4 A;  5TP9 A;  1POT A;  1H43 A;  4KR5 A;  1M5C A;  1MH4 A;  4Q5T A;  4JWX A;  3GXA A;  2F7A A;  4TLM B;  1XS5 A;  3FXQ A;  3K1N A;  4IO4 A;  4Z7E A;  2O6A A;  4XKQ A;  1MXX A;  2I58 A;  5ITP A;  4ZZA A;  3RPW A;  4OZ9 A;  1IXI A;  4F3S A;  1MS7 A;  3VFJ A;  3BBR A;  3PUY E;  3K4U A;  2VP1 A;  4F3P A;  3H6T A;  4TLL B;  2I6E A;  4YKJ A;  3C35 A;  4RK9 A;  2V3T A;  3LSX A;  2AL5 A;  1GVC A;  3RGY A;  3S2V A;  2M8C A;  4QFL A;  4NMY A;  2OLB A;  3GBA A;  3QAX A;  4NTL A;  4ONY A;  5I57 A;  1B5H A;  3Q29 A;  4C0R A;  4M4G A;  2CZL A;  4OES A;  5H8Q A;  5CMK A;  2HZL A;  3G7W A;  2DWA A;  2XXY A;  3VV5 A;  2ZYN A;  1RYO A;  2G93 A;  3T9X B;  1II5 A;  3MBP A;  2F6G A;  3CR9 A;  2DS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...