4R72A

Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (apo form)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
318
structure length
318
Chain Sequence
KGRLVIYCSATNVMCENAAKTFEQKYDVKTSFIRNGSGSTFAKIEAEKNNPQADVWYGGTLDPQSQAGELGLLEAYRSPNIDQIMPKFQDPAKVKGNLSSAVYIGILGFAVNTERLKKLGIEKIPQCWNDLTDPKLKGEIQIADPQSSGTAYTAIATFAQLWGEDKAFDYFKHLHPNISQYTKSGITPARNAARGETTVGIGFLHDYALEKEQGAPLEMVVPCEGTGYELGGVSILKGARNLDNAKLFVDFALSKEGQETAWKKGQALQTLTNTTAEQSPLAFDLTKLKLIDYDFEKYGASDERKRLINKWVDEIKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Transport of Phosphorylated Carbohydrates Promotes Intestinal Colonization and Transmission of a Bacterial Pathogen.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Transport protein
molecule keywords ABC-type Fe3+ transport system, periplasmic component
total genus 120
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r72A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r72A01
2PMSA 3CSGA 4R74A 4R9FA 3MUQA 4ZZEA 4C1UA 1B7ZA 3O6GA 3V83A 4MBPA 4DIGA 1F9BA 3TCHA 5AA2B 4L17A 5IKBA 2DSFA 2I3WA 2ZYMA 3QUJA 4KHZE 4LQ2A 3QIMA 3TCGA 1Y20A 1IEJA 3KSXA 3SERA 3E13X 1IIWA 4YB7A 5AA2D 2HFBA 1MXXA 2Q2AA 1MH3A 3M8UA 3PD9A 2DQVA 3IOTA 3OSRA 4U22A 1OLAA 3LSLA 2HZLA 3TPAA 4EXKA 1R1NA 3VVFA 1MXUA 3H06B 3SKPA 4R73A 4EDPA 4R6KA 1H3DA 4ELRA 5B7DA 1LCFA 4ESWA 3DP6A 2HEUA 1TT1A 5HBCA 2THIA 1NH8A 4GL0A 4EF2A 4G8MA 2V3QA 3IOVA 2QMWA 3RUMA 1LB8A 2I49A 4OTEA 3VLVA 1FTJA 3M3KA 3EF7A 3FUZA 5HM4B 4GRKA 4YKPA 2I0CA 1XVXA 1IXIA 3IB2A 3MBPA 1LFHA 2XXTA 5KCJB 4O3CA 3K1MA 1II5A 1LFIA 1LAGE 1QKAA 1QUKA 2ZMBA 3CR9A 3IB0A 4WXJA 3QAXA 3SEXA 1Y1ZA 2F78A 2P2AA 4TLLB 1B51A 3N26A 4ZEKA 1TFDA 3ECRA 5TP9B 1HSJA 2QRYA 4PFWA 3RQTA 3WAFA 4IO3A 4ECFA 4YAHX 3CFLA 3EQ1A 2UVGA 5ICQA 3BBRA 4U21A 4JSDA 4QHQA 3H6VA 1NNPA 4P0GA 3S2VA 3MP1A 2IEEA 3Q28A 2XXHA 1GVCA 2QS1A 4BDQA 1OLCA 4H0WA 4MFIA 3CSBA 1MY1A 5A5XB 1A8EA 3I5OA 3GZGA 3LUYA 2QS3A 4Z7EA 1M5CA 1ANFA 2XD3A 3MW0A 5DVFA 1N7XA 2PBWA 5H8HB 1ZLQA 2UVJA 2DWJA 3R26A 2R71A 1MG1A 1I6AA 3LC8A 2H98A 4POXA 3T9UA 5EHSA 1Q1KA 2UYFA 1FQAA 4P11A 2QMXA 3KBRA 4EQ9A 5KZTA 1LLSA 3FXRA 4JWYA 1FTKA 4EQBA 5BWJA 1EZOA 1NH7A 4QF9A 3PMVA 2I58A 3TAJA 1AIVA 2PT2A 4OFOA 3T66A 1NMUA 1XHYA 3JV9A 4X1BA 3N6TA 1ELJA 5H8QB 4IB2A 2R9JA 3ZKLA 1P99A 3FJGA 4G68B 4KYDA 3SETA 1BTJA 4I1DA 4FE8A 2GH9A 1US5A 3GBBA 5I56B 2QJEA 4ZE9A 3B7DA 2F6PA 3CG1A 5H8NA 2XX7A 1MM7A 2AL4A 2F6GA 4R2BA 4U1ZA 3U92A 5AA3A 1XC1A 4NF6B 5DEXB 5A5XA 4LQ5A 1LB9A 1O64A 1TWYA 2HXWA 2OBGA 3MJNA 1NL5A 3KZGA 4LVQA 1LAXA 4MLQA 4OETA 2I48A 5H8FB 3PPNA 4QFPA 4F1VA 3RPWA 3VLUA 1A7LA 2DS9A 3K0VA 1RKMA 1CB6A 1DPPA 3EHUA 1USYE 1YPNA 1LAFE 1USYH 1AMFA 4NTLA 5DEXA 4FORA 4ZECA 1VE4A 4EQ7A 2OWTA 1S50A 3KG2A 4I9DA 1UIUA 4LP2B 4ZZAA 1B5IA 4WEPA 1CE2A 1MM6A 2XXPA 3MWBA 5FHOA 1LBBA 3UGWA 3G3KA 1B05A 2DE4A 3C9HA 4KFQA 1SQYA 1Y4CA 4NF5B 2XXUA 1IZ1A 1EH3A 2P0SA 4LZ5A 2ABHA 2O1MA 3I6VA 3SEYA 2DVCA 1B3EA 4EF1A 1SDXA 3A3CA 3RY3A 5AA4A 3FGSA 1H44A 3C35A 1SD3A 1DPEA 1RYOA 3MZ1A 4RA1A 4N6PA 4GL8A 4F1YA 3PUZE 5JEIA 1Y9UA 2OZZA 2PX1A 2RC8A 3G3IA 3PMXA 3VLWA 2GHAA 2F7AA 3MAMA 4YMAA 4TQUQ 3T96B 3DLNA 2DXRA 3FJ7A 4R9GA 1L5TA 4DXUA 1B2HA 1SBPA 3N6UA 4QFNA 3T9HB 2NVUB 2H9BA 4KI0E 1JVXA 5AA1A 1B46A 3RT6B 4GLIA 1O7TA 3LSFB 3TDJA 1H45A 1Z7ME 3F11A 3Q29A 2ONRA 3RN8A 4GWOA 3SEWA 3TYHA 3PPPA 3H3GA 4EUOA 4OFJA 3K1PA 3ODBA 4KQPA 2QS2A 2R6GE 4OHNA 4GXAA 3O9PA 1MQHA 2Z8DA 3KSJA 1B5JA 5L9OA 2O68A 2ZYOA 5ITPA 1WODA 4NF8A 4TOZA 2LAOA 3USDA 1WVJA 1JEVA 2IA4A 4KR5A 4ZE8A 3PV0E 5I2NA 2FYIA 2Q2CA 2REGA 1PEBA 1LSTA 4AQ4A 3IJOB 4GF8A 4C0RA 4AB5A 3TUSA 1FTLA 5FHMA 1B0HA 3D4CA 4F3BA 5CBRA 2NXOA 1OVTA 4QFOA 4OVJA 5L9SA 1PBQA 3B6QA 3H7MA 1HSLA 3K01A 1B58A 4G2ZA 1N3WA 3O6HA 1GTKA 3H4ZA 1B9JA 1ZMGA 2KLFA 3HCQA 3EHSA 1DTZA 1GV8A 3C31A 2Z23A 2I6EA 2DE2A 3O66A 3W15C 5CC2A 1QUIA 3DM0A 1LBCA 2ZNTA 3FVNA 1IXGA 4R6HA 4H65A 4BDOA 3TTLA 5H8HA 2RCBA 3K6UA 3EHTA 4JB7A 4ELOA 1MQIA 1SI0A 2FNCA 2HCAA 1SW2A 2VP1A 1DOTA 3E9XA 3FVOA 4JSOA 2O7IA 1WDNA 3FVKA 3TEPA 1O63A 1OVBA 2X7QA 3V5AA 5I58B 2QPQA 2RCAA 1URSA 1JW5A 4NF6A 3ONMA 3TTNA 2FA7A 1SVXB 4ELPA 3KN7A 3B6TA 1IXCA 3FXQA 3K1NA 5K2XA 3CFXA 3MZBA 1JNFA 3OEMA 2Y7RA 1JEUA 3T9XB 1EZ9A 3M3FA 3IOUA 5I56A 1A55A 4QSCA 4LA9A 1SW5A 4GIZA 4DDDA 1MDQA 3KFMA 3PU5A 1QULA 2VOZA 4DCYA 3PUWE 4N13A 2O6AA 4DXCA 1ZTYA 4F2OA 5H8NB 5IAIA 4LUBA 4DZ1A 4RY1A 4MLVA 3VVDA 1D3KA 4PETA 1LCTA 1MH4A 1N04A 1GR2A 1A54A 3OELA 4Q5TA 3OENA 1ZBMA 3DP4A 1OIBA 3R7XA 1PB9A 1B4ZA 3WAEA 1SYIA 4FEDA 1VFEA 3TMGA 3THIA 1QW0A 3IOWA 1B7UA 3QXMA 5ELVA 3K02A 3OD7A 4OENA 2UXAA 3VVEA 4F22A 2OCUA 3O6IA 4H5FA 4JDFA 1N7WA 1AH5A 4K3FA 4H8IA 2B3FA 1MS7A 1B3FA 1D9VA 3H6UA 3KOSA 4FIMA 5KDTB 4NE4A 4RNSA 3FD3A 2I4BA 5I57B 3B6WA 3BFTA 3IL1B 2O69A 4G68A 2RC9A 4H8JA 4O3BA 1KWHA 4XXUA 3H6WA 2G29A 5AA4B 3GBAA 3OO6A 2VD3A 1I6QA 2ZNSA 1UTBA 4OMBA 4ELQA 2UVHA 3PUXE 3H6TA 1VFDA 4R75A 1DMBA 1MY3A 1FQBA 2AIXA 3IX1A 1QVSA 2PT1A 2DP8A 2XHDA 4XKRA 2XXRA 5I57A 3N94A 2G93A 3L6GA 4HCYA 1VSOA 2NOOA 3IB1A 4IO5A 1M5BA 2W7YA 1SW4A 4O3AA 5M2VA 3VDFA 4E0WA 3KJ7A 4GD5A 4F3SA 1S7YA 1NNFA 3FV1A 4LONB 2NWJA 1ZKBA 3RGYA 1M5EA 3UK4A 4YMBA 5CM6A 4M1VA 1MPBA 4YB5A 3LSXA 1XVYA 3TKDA 2DWIA 1BIYA 2XXIA 3CI8A 2QL3A 4ZEFA 1A8FA 3QYTA 4F2QA 3VXBA 1I69A 4F31B 2H5YA 3G3HA 1B3GA 1SI1A 2I0BA 1FQCA 2OLBA 3FVGA 3KGCA 4NF4A 1MPCA 3IK6B 1UTHB 3VE1B 3A09A 4RYAA 3OOAA 4BDMA 5ISUA 3TQLA 1M5DA 3MVXA 2XXWA 4OEUA 1D4NA 4XKQA 1MXYA 5HPQA 4FATA 5I59B 5I58A 3HN0A 3FATA 4FAJA 3I3VA 3Q27A 3RTFB 3T9VA 1JETA 1S9TA 2GRVA 3GLBA 3O97A 3QK6A 4H6DA 4X48A 4YKIA 5L8DA 5I2KB 5TPAA 4LZ8A 1JVYA 4FECA 5TU0A 1B1HA 3CFZA 4Q0CA 1XOCA 3RT8A 1P1UA 4OQOA 1BLFA 3Q26A 4G4PA 2RC7A 4DE8A 4OEVA 2Q8JA 3R6UA 3BFUA 5CMCA 2DXYA 2O51A 5F7VA 2DWHA 5K2YA 2OWSA 4DLDA 3W9WA 3P7IA 1POY1 4X1DA 3HO7A 5FHNA 3TFLA 5J1DA 5CMMA 5ITOA 3EN3A 4YICA 4P0IA 2A5SA 4I62A 4IO2A 3S9MC 4DXBA 2QS4A 3KOTA 1PB7A 3LSWA 2Y84A 3U93A 3ILUB 5LOMA 2Y7PA 1YTVA 3ZKKA 1HSEA 4M4GA 5CBSA 3MVZA 5JK4A 3S9LC 4QSEA 4E0XA 3PMWA 3T22A 4ZEDA 4PFUA 2HAVA 2WKYA 1LAHE 2F97A 3PGFA 4H1XA 3UIFA 1RYXA 3VV5A 2ANJA 4GQOA 1Y3QA 2DOJA 2YPNA 3M3LA 3MP8A 4NF8B 4U2RA 3TELA 5DVJA 1MXZA 2ONKE 1US4A 4U1OA 1NFTA 4UA8A 3W9VA 3BKIB 3HV1A 2B3BA 3K00A 1P1QA 2ZYNA 3OO8A 1URGA 2GFEA 2VGQA 5FTHA 2O1LA 3IAZA 3CVGA 1AOVA 3MPKA 4HS7A 3TQWA 1IXHA 4IO7A 1MQDA 4FEBA 4G68C 1QJMA 5KDTA 1TFAA 2XXXA 2QSXA 3H03A 3MPLA 3OXNA 2DWAA 4BDLA 2ZNUA 4NF4B 3ZSFA 3TTMA 1J1NA 2F5XA 3C4MA 3PPQA 4F18A 1MY2A 2REJA 3CG3A 4JBZA 3RLFE 1B4HA 4EXLA 4KYSA 1PB8A 1URDA 3RNNA 1H43A 4RK9A 3QUFA 4BLAA 1YAEA 1MXVA 1LGBC 2DVZA 3HSTA 3UP9A 3O2AA 4YB6A 2XXQA 1P1OA 4NWCA 5EYFA 1T0KA 3UORA 4ZEBA 1Y3PA 4C1TA 2F7CA 2Y7KA 3IO4A 5KCJA 1MPDA 3SDFA 2XXYA 4R6YA 3S4UA 4U4SA 1JQFA 4OERA 3K4UA 4AB6A 4WKMA 2Y7WA 2PVUA 4H67A 4YKJA 3RTWB 1IITA 3OEKA 1MY4A 5AA2A 2RKMA 1N84A 1UIVA 1VR5A 4OZ9A 2RINA 2OK2A 2P1SA 4NEDA 3PD8A 4PP0A 5CRYA 2O7UA 2V84A 2Y7IA 5F1QA 2D5WA 2ESNA 3FASA 4RPNA 2HZKA 2RF1A 5L9MA 4HCWA 2V3TA 1OQHA 4OXVA 2YJPA 2VHAA 3CIJA 4G8HA 2V93A 3OMBA 5CI5A 4Z0IA 4QSDA 2Q88A 3CRBA 2CMOA 4G77A 3S9EA 3V89B 1M5FA 3C32A 2D3IA 2F7BA 2ZYKA 3PPOA 3TTRA 4F3PA 4NF5A 5EHMA 3V8XB 1B40A 5CMKA 3MVYA 5CMBA 1QUJA 4NWDA 2GHBA 1P1WA 1PDAA 1SW1A 2A5TB 4IO6A 3C33A 1N76A 3N5LA 1NKXA 4I8CA 2UYEA 3IO6A 4ZEIA 4POWA 1TXFA 5TPAB 3SEVA 1B3HA 1A99A 1POTA 3KEIA 3K6WA 4DCXA 4Q8RA 4GVOA 2ALUA 1D9YA 3FIRA 3FXUA 2I4CA 3DELB 3JYRA 4G8NA 2HAUA 4F29A 5I59A 3G3GA 4HTGA 4KCDA 1Y1MA 4XKPA 4ND9A 1FCKA 3VFJA 2XXVA 3OSQA 1UTHA 1R9QA 3KN3A 1B7HA 1MXWA 3IORA 2AL5A 3D4GA 4JWOA 2CZLA 2YLNA 5DT6A 1FQFA 5H8SA 5I2KA 4OESA 1XT8A 1NNKA 1UTBB 2UVIA 1AL3A 2F8DA 4PQJA 3K2DA 4PFYA 1OQGA 3U94A 1DTGA 3K6VA 3AXFA 4QRZA 4IY6A 1PC3A 1FQEA 5I84A 4R72A 3HHFA 3PUVE 3FV2A 1XS5A 1B0LA 4KPTA 1Q35A 4ZS9A 3GXAA 4JWXA 1B52A 1ZU0A 1DSNA 3U8QA 1FW0A 2E1SA 4RPOA 5DTBA 1A40A 4UACA 2DYXA 4H5GA 3U1OA 2V3UA 3S9NC 5I2NB 5ICTA 2NUVA 3MC2A 3FJMA 4N07A 1BKAA 3TTKA 4MH5A 1B5HA 1R6ZA 3MQ9A 4RK2A 3T93B 2HQ0A 1IUDA 3OO7A 4YU0A 4U23A 4RXLA 2X7PA 3IJXB 3JZJA 4OWDA 3G3JA 1B1XA 4X9TA 1JW1A 3KN8A 2Z22A 4HW8A 3DP8A 4TLMB 2E0SA 4IGTA 2Z8EA 2I3VA 3MVWA 1ZJLA 3KJTA 4ONYA 3ZS6A 1PBPA 2H25A 4R2FA 5DVIA 4ZDMA 1EU8A 4PFTA 1I6BA 3UN6A 1BP5A 1YCJA 2ONSA 3HPIA 3C34A 4KCCA 4QFLA 4QFKA 4JXIA 3U72A 4NMYA 5AE4A 4F39A 4XTCQ 5TP9A 5BUUA 3LR1A 1ATGA 4GFRA 5JTYB 1MY0A 2OJTA 3G3FA 3MZ9A 4IO4A 1Y3NA 4OYVA 4PE5B 2AYSA 4THIA 3FZVA 4FJPA 4YZZA 5DYHA 3TZAA 2Z8FA 4ISUA 3VXCA 1MQJA 4BDRA 2Q9TA 3PUYE 2Q89A 2XX9A 4MF3A 4U4XA 2H4IA 2PYYA 5FTIA 2O84X 3C36A 5H8FA 4Q30B 2V25A 1FQDA 4LATA 3ILTB 1EZPA 4F19A 1GGGA 2H99A 4RJZA 1B6HA 1N0TA 2X26A 3L6HA 4OFLA 1SYHA 4BDNA 3Q25A 3SEUA 3LBSA 5JTYA 2D21A 1MDP1 2DE3A 2M8CA 2XD2A 1FTOA 3PPRA 1LFGA 1NNTA 4GXSB 2F35A 3A3UA 2BJJX 1Z7NE 1N3XA 2A5TA 3O29A 4LZ7A 1FTMA 1IQ7A 3E4RA 4IY5A 2VD2A 2F34A 3TODA 3G7WA 5H8QA 3HHGA 4ESXA 2ZXTA 4WEDA 4F1UA 3UA8A 1B3LA 4F3GA 1UQWA 3TCFA 1H76A 2B65A 1MRPA 1ZIUA 1B32A 1R9LA 3E3KA 3O28A 4YKKA 4IGRA 4XKNA 1P1NA 4XIGQ 3OO9A 3MP6A 1OMPA 1Y4TA 2F36A 1QKBA 4GOTA 4KD5A 3IR1A 5B70A 2XX8A 1MQGA 3QSLA 3K6XA 4KYEA 3SESA 3EPEA 1JW4A
chains in the Genus database with same CATH superfamily
4ZZEA 5AA2B 2DSFA 3QUJA 4LQ2A 3TCGA 3PD9A 2DQVA 3IOTA 3OSRA 4GWWA 3TPAA 2HZLA 4EXKA 4PFIA 1LCFA 1IMCA 4NG7A 5HBCA 4GX6A 2THIA 4GX3A 2WX9A 2V3QA 3RUMA 4OTEA 1NUWA 4YKPA 2I0CA 1IXIA 3MBPA 4TLLB 3N26A 3ECRA 3WAFA 4YAHX 3CFLA 3B50A 4U21A 4JSDA 4P0GA 3Q28A 1GVCA 4MFIA 3U65A 3LUYA 1M5CA 4JVIA 1NV2A 5H8HB 4N8GA 4POXA 5EHSA 2PCRA 4EQBA 1EZOA 3TAJA 3SETA 1LEVA 4QBAA 2F6PA 4R2BA 5AA3A 4U1ZA 4NF6B 4MNCA 1O64A 3MJNA 1NL5A 3KZGA 4OETA 2I48A 5H8FB 1A7LA 1RKMA 1USYE 1YPNA 4NTLA 4PDDA 4FORA 4ZECA 4I9DA 2XXPA 5FHOA 1LBBA 3G3KA 1B05A 1EH3A 3I6VA 4EF1A 4GL8A 3PUZE 1Y9UA 3PMXA 4YMAA 3T96B 3FJ7A 5H8NB 4KI0E 1JVXA 3RT6B 5ESYA 3TDJA 2ONRA 1NUYA 3TYHA 3PPPA 3H3GA 4EUOA 4OFJA 2VPOA 4OHNA 5IZ3A 2LAOA 2FYIA 1LSTA 4C0RA 1NV6A 3TUSA 5FHMA 4F3BA 1LBWA 2NXOA 3H7MA 1HSLA 3K01A 2B4LA 3O6HA 1DTZA 2Z23A 2I6EA 1LBCA 2ZNTA 1IXGA 5H8HA 2RCBA 3EHTA 1MQIA 2HCAA 5A5XB 2O7IA 4NN3A 3FVKA 3TEPA 5I58B 2FIXA 3FXQA 4JVDA 1RDXA 1BK4A 5K2XA 3OEMA 1FJ6A 5I56A 1EZ9A 3M3FA 4QSCA 4LA9A 4GIZA 3PU5A 2CEYA 5IAIA 1ZTYA 4RY1A 3VVDA 1D3KA 1LCTA 1N04A 1GR2A 1OIBA 5IM2A 3WAEA 1SYIA 4FEDA 3TMGA 3THIA 1QW0A 3QXMA 1B7UA 2UXAA 4K3FA 4JDFA 4H8IA 2B3FA 5KDTB 4NE4A 3FD3A 5I57B 1LBXA 4H8JA 4XXUA 4NAPA 3PUXE 3H6TA 1QVSA 2PT1A 2XHDA 3L6GA 4N81A 4AS4A 4E0WA 4FBPA 4LONB 3UK4A 4YB5A 4DI3D 3TKDA 3CI8A 4GWXA 2QL3A 1A8FA 4F2QA 1B3GA 1FQCA 3FVGA 4BDMA 2XXWA 1MXYA 5HPQA 5I58A 1SPIA 3FATA 4FAJA 2GRVA 3QK6A 1DK4A 4LZ8A 4P9KA 3Q26A 3R6UA 5CMCA 5FHNA 4I62A 3KOTA 5LOMA 3ZKKA 1HSEA 3IFCA 4PFUA 2HAVA 3MYUA 4NX1A 4NQ8A 2YPNA 4EXLA 4U2RA 4UA8A 2ZYNA 3OO8A 1URGA 4HS7A 2VPNA 2QSXA 3H03A 2DWAA 2REJA 3CG3A 1URDA 1H43A 3QUFA 4BLAA 2L5VA 5EYFA 4MNIA 5KCJA 1Y3PA 2Y7KA 3IO4A 2XXYA 3S4UA 2PVUA 4H67A 3RTWB 5AA2A 3FASA 2HZKA 1OQHA 4OXVA 2VHAA 3OMBA 4PE3A 2Q88A 2VT5A 3KBZA 1M5FA 2ZYKA 4H45A 2GHBA 2A5TB 3SEVA 1NKXA 2UYEA 5EQ9A 1TXFA 1A99A 3FXUA 3DELB 2HAUA 3G3GA 4XKPA 1AWBA 2XXVA 3OSQA 3T1BA 1MXWA 2AL5A 3D4GA 5I2KA 2CZLA 4PBHA 1XT8A 1UTBB 2UVIA 4PQJA 2F8DA 3K2DA 4PFYA 1OQGA 4QRZA 1PC3A 1FQEA 4R72A 1XS5A 1B0LA 3KC0A 2Y5KA 3U1OA 2NUVA 4HE1A 3MC2A 1R6ZA 4OVQA 2HQ0A 4YU0A 1FSAA 4U23A 3JZJA 4HW8A 1JW1A 3DP8A 2I3VA 3MVWA 4PF8A 3UN6A 1BP5A 1K9ZA 4QFLA 3U72A 4GFRA 4PC9A 3G3FA 5DYHA 4OYVA 4THIA 1FPBA 2Q9TA 4N6DA 4U4XA 2O84X 2CZHA 1G0HA 4LATA 2H99A 4RJZA 1SYHA 2D21A 2DE3A 2M8CA 2P3VA 1FTOA 1FBEA 1LFGA 2BJJX 4IY5A 1NV1A 1UQWA 4OVTA 1B32A 4IGRA 2WYKA 4KD5A 5B70A 3QSLA 3K6XA 4KYEA 2WYPA 2PMSA 4R74A 1B7ZA 3O6GA 4MBPA 5IKBA 4L17A 2I3WA 4KHZE 4OANA 1Y20A 1IIWA 2HFBA 3M8UA 4P1EA 4U22A 1R1NA 3VVFA 1MXUA 1FBGA 4MMPA 4P47A 4GL0A 3FXBA 2QMWA 2I49A 1LFHA 3IB2A 2XXTA 1NUXA 3IB0A 3QAXA 4PFWA 2UVGA 4QHQA 3S2VA 3MP1A 2IEEA 2QS1A 1OLCA 2F3BA 1A8EA 3I5OA 4PGNA 4Z7EA 2XD3A 3TTNA 1N7XA 2PBWA 1ZLQA 2DWJA 1I6AA 2H98A 1FQAA 4JWYA 1XI6A 3FXRA 5BWJA 1NH7A 4QF9A 1AIVA 2PT2A 1ELJA 4IB2A 1P99A 4KYDA 2GH9A 3GBBA 4ZE9A 3B7DA 3CG1A 5H8NA 2AL4A 3U92A 4X8RA 5DW8A 4LQ5A 1LB9A 1TWYA 2OBGA 1Q9DA 1LAXA 4F1VA 4NF0A 3VLUA 2DS9A 3EHUA 1LAFE 1G0IA 4PAIA 1VE4A 2WBBA 3KG2A 1UIUA 4LP2B 4ZZAA 3NOHA 3MWBA 2DE4A 2PFZA 2ABHA 2O1MA 1B3EA 3RY3A 5AA4A 5DTBA 3MZ1A 1DPEA 5JEIA 4N6PA 1FBFA 2PX1A 1RDZA 2DXRA 4DXUA 3T9HB 2H9BA 5AA1A 3Q29A 4GWOA 3SEWA 2R8TA 3K1PA 2R6GE 2XWIA 4GXAA 2Z8DA 4PDHA 4TOZA 1NV3A 2IA4A 1JEVA 4HE0A 3PV0E 2Q2CA 1PEBA 3IJOB 4AB5A 1FTLA 5CBRA 5ET7A 4QFOA 4OVJA 1GTKA 5A5LA 5CC2A 4R6HA 4BDOA 4JB7A 1K9YA 4ELOA 4ONYA 5KZTA 4KXPA 3FVOA 4JSOA 1OVBA 2X7QA 2QPQA 2RCAA 4N17A 1JW5A 1SVXB 1LBYA 3B6TA 3CFXA 2Y7RA 1JEUA 3IOUA 4DDDA 1MDQA 4DCYA 4F2OA 4N13A 5I5PA 4LUBA 2ZZVA 3OELA 1MH4A 3DP4A 3R7XA 1PB9A 3OD7A 3VVEA 4H5FA 1AH5A 1MS7A 2I4BA 3IL1B 2FIEA 4G68A 5AA4B 1UTBA 1KZ8A 5EQAA 1DMBA 1MY3A 1FRPA 1FQBA 3IX1A 4XKRA 2XXRA 5I57A 2Q74A 4I3EA 1EYKA 3RPLA 1VSOA 4IO5A 3KJ7A 4GD5A 4F3SA 3FV1A 4O8MA 1MPBA 1XVYA 5FBPA 3G3HA 4UABA 3IK6B 3OOAA 1M5DA 5I59B 3I3VA 3RTFB 3GLBA 3O97A 4YKIA 5TPAA 3BIGA 3CFZA 1FBDA 4G4PA 4OEVA 2B4MA 2Q8JA 2DWHA 2OWSA 3W9WA 1POY1 4IR8A 5CMMA 4P0IA 3U93A 5CBSA 3MVZA 4E0XA 3T22A 2WKYA 1LAHE 2F97A 3PGFA 4H1XA 3UIFA 1RYXA 4GQOA 5EQ7A 1MXZA 2B3BA 1IMBA 2GFEA 1FPGA 5FTHA 2O1LA 3IAZA 3MPKA 3TQWA 4IO7A 4G68C 1QJMA 2XXXA 4BDLA 1J1NA 3PPQA 4KYSA 4RK9A 4NGUA 5IGAA 1LGBC 3UP9A 4DI4B 4YB6A 2XXQA 3UORA 4P56A 4OERA 2HPGA 4AB6A 4YKJA 1IITA 1MY4A 2RKMA 4OZ9A 2RINA 4NEDA 4RPNA 5L9MA 5I7IA 4G8HA 4QSDA 4G77A 1NI9A 3S9EA 2MKZA 3V89B 2D3IA 2F7BA 4NF5A 1IMFA 1YXIA 5CMKA 4NWDA 4IO6A 4I8CA 1B3HA 4DCXA 1LBZA 3JYRA 4KCDA 1Y1MA 1R9QA 4JWOA 2YLNA 1DTGA 3AXFA 1RDYA 4MAGA 3HFUA 1Q35A 1ZU0A 1DSNA 1FW0A 4UACA 3S9NC 5ICTA 4MEVA 4N07A 3TTKA 4PGPA 3IJXB 4N15A 1B1XA 3KN8A 4GWYA 1FBCA 2FBPA 5ET8A 3ZS6A 5DVIA 1EU8A 2ONSA 4QFKA 1YCJA 1NUZA 4JXIA 5AE4A 5TP9A 1ATGA 5JTYB 4IO4A 1FPEA 3VXCA 1MQJA 4BDRA 2Q89A 2XX9A 3D1RA 4Q30B 1FQDA 2Y5LA 4F19A 1DBZA 3L6HA 3SEUA 2XD2A 2CZIA 4GXSB 2F35A 2V4CA 1KA1A 1FTMA 3E4RA 2VD2A 4ESXA 4F1UA 5H8QA 3HHGA 3TCFA 2B65A 3BIHA 1R9LA 3E3KA 4YKKA 2HXRA 1OMPA 3IR1A 3CHGA 2QVUA 3SESA 3EPEA 1LBVA 4C1UA 3MUQA 4PTKA 1F9BA 2ZYMA 3QIMA 3SERA 5AA2D 4GBVA 3KC1A 1MXXA 2Q2AA 4PFBA 1OLAA 4EDPA 3H06B 3SKPA 4R73A 4R6KA 1H3DA 4ELRA 5B7DA 4ESWA 2HEUA 1TT1A 4MNPA 1NH8A 3IOVA 1LB8A 3VLVA 1FTJA 3EF7A 3FUZA 5HM4B 4GRKA 3ISPA 5KCJB 4O3CA 3K1MA 1II5A 1LAGE 1QKAA 1QUKA 2ZMBA 3CR9A 2QFLA 3SEXA 1FJ9A 1Y1ZA 2F78A 1B51A 4ZEKA 3RQTA 5TP9B 1HSJA 4ECFA 3EQ1A 3BBRA 4PF6A 3H6VA 2XXHA 4H0WA 3CSBA 1MY1A 2KR0A 3GZGA 4XEQA 2QS3A 3MW0A 5DVFA 4MCOA 2UVJA 3R26A 2R71A 3LC8A 3T9UA 1NV4A 2QMXA 1LLSA 2I58A 3SZPA 4OFOA 3T66A 1XHYA 3JV9A 4X1BA 3N6TA 5H8QB 2R9JA 4G68B 5I56B 2PFYA 4FE8A 1US5A 2QJEA 1MM7A 1IMDA 2F6GA 4GBWA 5A5XA 4LVQA 1NV5A 3PPNA 4QFPA 3RPWA 1CB6A 1USYH 2Q8MA 1AMFA 2OWTA 1S50A 1DCUA 1CE2A 1Y4CA 4NF5B 2XXUA 1IZ1A 4LZ5A 2P0SA 1SDXA 3A3CA 3FGSA 1H44A 4F1YA 1SD3A 4RA1A 4PAKA 2RC8A 3G3IA 3VLWA 4R9GA 1L5TA 3N6UA 2NVUB 2FVZA 1B46A 4N91A 1FPLA 3LSFB 4KQPA 1FPFA 2XA5A 1MQHA 3KSJA 2O68A 4NF8A 3USDA 1WVJA 2REGA 4GF8A 4PCDA 1B0HA 3D4CA 4AS5A 4GX4A 1PBQA 3E78A 1B58A 1N3WA 1ZMGA 3HCQA 3EHSA 1GV8A 3C31A 3O66A 3DM0A 1SI0A 2P3NA 4EF2A 1DOTA 5IZZA 1WDNA 4GWUA 1URSA 4LN5A 4NF6A 3ONMA 2FA7A 5EYGA 1FPDA 1IXCA 3MZBA 1JNFA 5T3JA 3T9XB 2F3DA 1A55A 1SW5A 3KFMA 2VOZA 4DXCA 2O6AA 4DZ1A 4Q5TA 3OENA 1IMEA 3K02A 2XWVA 1N7WA 3H6UA 3KOSA 1B3FA 4RNSA 4O3BA 1KWHA 3GBAA 1I6QA 2ZNSA 2QVVA 3FBPA 4R75A 1VFDA 2OX3A 3N94A 5M2VA 4O3AA 3VDFA 1S7YA 1NNFA 1ZKBA 3LSXA 1BIYA 4ZEFA 3VXBA 1I69A 4F31B 2OLBA 4NF4A 3KGCA 1MPCA 1UTHB 3VE1B 5ISUA 3A29A 3TQLA 4OEUA 4XKQA 1D4NA 4FATA 4PFRA 1D9QA 4OA4A 3Q27A 1JETA 1S9TA 4H6DA 5I2KB 1JVYA 5TU0A 2XWOA 3RT8A 1P1UA 4OQOA 1BLFA 2RC7A 4DE8A 5F7VA 3BFUA 5LTCA 3P7IA 3TFLA 4X1DA 3HO7A 5J1DA 5ITOA 4YICA 4IO2A 4DXBA 1PB7A 2Y84A 3ILUB 5IZ3B 3S9LC 4M4GA 5JK4A 3LUZA 4H46A 4QSEA 4ZEDA 2DOJA 3MP8A 3TELA 5DVJA 3W9VA 4MX6A 2XXKA 1FTAA 2VGQA 1IXHA 1MQDA 5KDTA 1TFAA 3MPLA 3OXNA 3ZSFA 4NF4B 3TTMA 3C4MA 4JBZA 1B4HA 3RNNA 3EKIA 1FPKA 1MXVA 3HSTA 2KQZA 3O2AA 1P1OA 4NWCA 4X04A 2F7CA 4I3YA 4R6YA 1JQFA 3K4UA 2Y7WA 4PAFA 1VR5A 2P1SA 2Y7IA 2D5WA 2RF1A 2V3TA 2YJPA 3CIJA 5CI5A 3CRBA 2CMOA 4F3PA 3TTRA 3PPOA 3V8XB 5CMBA 1QUJA 1SW1A 3RYDA 3C33A 1N76A 3N5LA 4ZEIA 4MIJA 3IO6A 4POWA 3K6WA 2ALUA 3FIRA 4G8NA 4HTGA 1FCKA 1UTHA 3KN3A 1B7HA 5DT6A 1NNKA 1AL3A 2CZKA 5I84A 3ROJA 4XFEA 4ZS9A 3GXAA 3U8QA 2E1SA 2DYXA 4H5GA 2V3UA 5I2NB 1BKAA 1B5HA 3T93B 4RK2A 1IUDA 3OO7A 4OWDA 4IGTA 1VDWA 1ZJLA 3KJTA 1PBPA 2H25A 4R2FA 4ZDMA 4PFTA 3C34A 4XTCQ 5BUUA 3LR1A 2QVRA 2OJTA 4YZZA 1EYJA 4FJPA 3TZAA 2Z8FA 2FHYA 3IFAA 4MF3A 2PYYA 5FTIA 2V25A 5EYHA 3ILTB 1GGGA 1B6HA 1N0TA 2X26A 4OFLA 3Q25A 3LBSA 5JTYA 3B8BA 1NNTA 1Z7NE 5I3SA 2A5TA 3O29A 1IQ7A 4F39A 2F34A 5J16A 3UA8A 2GQ1A 5EQ8A 1MRPA 5ET6A 3O28A 4XKNA 1P1NA 4XIGQ 3OO9A 1JP4A 1Y4TA 2F36A 1QKBA 2XX8A 4P1LA 3CSGA 4R9FA 3V83A 4DIGA 3TCHA 1FPIA 3KSXA 1IEJA 3E13X 4YB7A 1MH3A 3LSLA 3DP6A 4G8MA 3M3KA 1XVXA 2ZZWA 5F24A 1LFIA 4HXVA 4WXJA 2P2AA 1TFDA 2QRYA 4IO3A 4N4UA 5ICQA 1NNPA 4BDQA 1YYZA 3QMFA 1ANFA 2CEXA 3T0JA 1MG1A 1Q1KA 2UYFA 4P11A 3KBRA 4OVRA 4EQ9A 1FTKA 3PMVA 1NV7A 1NMUA 1YZ0A 1FBPA 3ZKLA 3FJGA 1BTJA 4I1DA 2XX7A 1XC1A 5DEXB 5LDZA 2HXWA 4MLQA 3K0VA 1DPPA 4EQ7A 1B5IA 4WEPA 1MM6A 3UGWA 3C9HA 4KFQA 1SQYA 2DDKA 3SEYA 2DVCA 1AOVA 3C35A 1RYOA 2OZZA 2GHAA 2F7AA 3MAMA 4TQUQ 3DLNA 4HE2A 1B2HA 1SBPA 4QFNA 2WEFA 4GLIA 1O7TA 1H45A 1Z7ME 3F11A 3RN8A 3ODBA 2QS2A 3O9PA 5L9OA 1B5JA 2ZYOA 3MSTA 1WODA 5ITPA 3E79A 4JVCA 4KR5A 4ZE8A 5I2NA 4AQ4A 1OVTA 5L9SA 3B6QA 4QXDA 4G2ZA 3H4ZA 1B9JA 2KLFA 2DE2A 3W15C 1QUIA 3FVNA 1INPA 4G61A 4H65A 3TTLA 3K6UA 2VP1A 2FNCA 5DEXA 1SW2A 3E9XA 1O63A 3V5AA 1NV0A 4ELPA 3KN7A 3K1NA 1QULA 3PUWE 4MLVA 4PETA 1A54A 1ZBMA 1B4ZA 1VFEA 3IOWA 4P3LA 5ELVA 4OENA 4F22A 2OCUA 3O6IA 3LV0A 1D9VA 4FIMA 4OVSA 3B6WA 3BFTA 2O69A 2RC9A 3H6WA 2G29A 3OO6A 2WBDA 2VD3A 4OMBA 4ELQA 2UVHA 4O7MA 1KA0A 2AIXA 2DP8A 2G93A 4HCYA 5ET5A 2NOOA 3IB1A 1M5BA 2W7YA 1SW4A 1EYIA 4YMBA 2NWJA 3RGYA 1M5EA 5CM6A 4M1VA 2DWIA 2XXIA 3QYTA 2H5YA 1SI1A 2I0BA 1CNQA 4N8YA 3GYYA 1FBHA 3A09A 4RYAA 3MVXA 4N6KA 3HN0A 3T9VA 4X48A 5L8DA 4FECA 5IZ1A 1B1HA 4Q0CA 1XOCA 4MHFA 2DXYA 2O51A 5K2YA 4DLDA 3S9MC 3EN3A 2A5SA 2QS4A 3LSWA 4O7IA 2Y7PA 1YTVA 3PMWA 3VV5A 2ANJA 4OVPA 1Y3QA 3M3LA 4NF8B 2ONKE 1US4A 4U1OA 1FPJA 1NFTA 3BKIB 3HV1A 3K00A 2OWZA 1P1QA 3CVGA 4FEBA 2ZNUA 2F5XA 4F18A 1MY2A 3RLFE 1PB8A 2ZZXA 1YAEA 4P8BA 2DVZA 4XF5A 1T0KA 4ZEBA 4C1TA 1MPDA 3SDFA 4U4SA 4GWSA 4WKMA 3RPLB 3OEKA 1N84A 1UIVA 2OK2A 3PD8A 4PP0A 5CRYA 2O7UA 2V84A 5F1QA 2HHMA 2ESNA 4MJOA 4HCWA 2V93A 4Z0IA 4I40A 3C32A 1IMAA 5EHMA 2JJKA 1B40A 3MVYA 1QGXA 1P1WA 1PDAA 5TPAB 1POTA 4Q8RA 3KEIA 4GVOA 3PTYA 1D9YA 4F29A 2I4CA 5I59A 4ND9A 3VFJA 3IORA 4GWZA 5H8SA 1FQFA 4OESA 3U94A 3K6VA 4IY6A 3HHFA 3PUVE 3FV2A 4O94A 4KPTA 4PBQA 4JWXA 1B52A 4RPOA 1A40A 3FJMA 4MH5A 3MQ9A 4RXLA 2X7PA 3G3JA 4X9TA 2Z22A 4TLMB 2E0SA 2Z8EA 1I6BA 3HPIA 4KCCA 4NMYA 1MY0A 4PE5B 3MZ9A 4NHBA 1Y3NA 2AYSA 3FZVA 4ISUA 3PUYE 2H4IA 3C36A 5H8FA 1EZPA 4BDNA 2BJIA 1MDP1 3PPRA 3A3UA 1N3XA 4LZ7A 3TODA 3G7WA 2ZXTA 4WEDA 1B3LA 4F3GA 2XWKA 1H76A 1ZIUA 3MP6A 4GOTA 1MQGA 1JW4A
chains in the Genus database with same CATH topology
2PMSA 3CSGA 4R74A 4R9FA 3MUQA 4ZZEA 4C1UA 1B7ZA 3O6GA 3V83A 4MBPA 4DIGA 1F9BA 3TCHA 5AA2B 4L17A 5IKBA 2DSFA 2I3WA 2ZYMA 3QUJA 4KHZE 4LQ2A 3QIMA 3TCGA 1Y20A 1IEJA 3KSXA 3SERA 3E13X 1IIWA 4YB7A 5AA2D 2HFBA 1MXXA 2Q2AA 1MH3A 3M8UA 3PD9A 2DQVA 3IOTA 3OSRA 4U22A 1OLAA 3LSLA 2HZLA 3TPAA 4EXKA 1R1NA 3VVFA 1MXUA 3H06B 3SKPA 4R73A 4EDPA 4R6KA 1H3DA 4ELRA 5B7DA 1LCFA 4ESWA 3DP6A 2HEUA 1TT1A 5HBCA 2THIA 1NH8A 4GL0A 4EF2A 4G8MA 2V3QA 3IOVA 2QMWA 3RUMA 1LB8A 2I49A 4OTEA 3VLVA 1FTJA 3M3KA 3EF7A 3FUZA 5HM4B 4GRKA 4YKPA 2I0CA 1XVXA 1IXIA 3IB2A 3MBPA 1LFHA 2XXTA 5KCJB 4O3CA 3K1MA 1II5A 1LFIA 1LAGE 1QKAA 1QUKA 2ZMBA 3CR9A 3IB0A 4WXJA 3QAXA 3SEXA 1Y1ZA 2F78A 2P2AA 4TLLB 1B51A 3N26A 4ZEKA 1TFDA 3ECRA 5TP9B 1HSJA 2QRYA 4PFWA 3RQTA 3WAFA 4IO3A 4ECFA 4YAHX 3CFLA 3EQ1A 2UVGA 5ICQA 3BBRA 4U21A 4JSDA 4QHQA 3H6VA 1NNPA 4P0GA 3S2VA 3MP1A 2IEEA 3Q28A 2XXHA 1GVCA 2QS1A 4BDQA 1OLCA 4H0WA 4MFIA 3CSBA 1MY1A 5A5XB 1A8EA 3I5OA 3GZGA 3LUYA 2QS3A 4Z7EA 1M5CA 1ANFA 2XD3A 3MW0A 5DVFA 1N7XA 2PBWA 5H8HB 1ZLQA 2UVJA 2DWJA 3R26A 2R71A 1MG1A 1I6AA 3LC8A 2H98A 4POXA 3T9UA 5EHSA 1Q1KA 2UYFA 1FQAA 4P11A 2QMXA 3KBRA 4EQ9A 5KZTA 1LLSA 3FXRA 4JWYA 1FTKA 4EQBA 5BWJA 1EZOA 1NH7A 4QF9A 3PMVA 2I58A 3TAJA 1AIVA 2PT2A 4OFOA 3T66A 1NMUA 1XHYA 3JV9A 4X1BA 3N6TA 1ELJA 5H8QB 4IB2A 2R9JA 3ZKLA 1P99A 3FJGA 4G68B 4KYDA 3SETA 1BTJA 4I1DA 4FE8A 2GH9A 1US5A 3GBBA 5I56B 2QJEA 4ZE9A 3B7DA 2F6PA 3CG1A 5H8NA 2XX7A 1MM7A 2AL4A 2F6GA 4R2BA 4U1ZA 3U92A 5AA3A 1XC1A 4NF6B 5DEXB 5A5XA 4LQ5A 1LB9A 1O64A 1TWYA 2HXWA 2OBGA 3MJNA 1NL5A 3KZGA 4LVQA 1LAXA 4MLQA 4OETA 2I48A 5H8FB 3PPNA 4QFPA 4F1VA 3RPWA 3VLUA 1A7LA 2DS9A 3K0VA 1RKMA 1CB6A 1DPPA 3EHUA 1USYE 1YPNA 1LAFE 1USYH 1AMFA 4NTLA 5DEXA 4FORA 4ZECA 1VE4A 4EQ7A 2OWTA 1S50A 3KG2A 4I9DA 1UIUA 4LP2B 4ZZAA 1B5IA 4WEPA 1CE2A 1MM6A 2XXPA 3MWBA 5FHOA 1LBBA 3UGWA 3G3KA 1B05A 2DE4A 3C9HA 4KFQA 1SQYA 1Y4CA 4NF5B 2XXUA 1IZ1A 1EH3A 2P0SA 4LZ5A 2ABHA 2O1MA 3I6VA 3SEYA 2DVCA 1B3EA 4EF1A 1SDXA 3A3CA 3RY3A 5AA4A 3FGSA 1H44A 3C35A 1SD3A 1DPEA 1RYOA 3MZ1A 4RA1A 4N6PA 4GL8A 4F1YA 3PUZE 5JEIA 1Y9UA 2OZZA 2PX1A 2RC8A 3G3IA 3PMXA 3VLWA 2GHAA 2F7AA 3MAMA 4YMAA 4TQUQ 3T96B 3DLNA 2DXRA 3FJ7A 4R9GA 1L5TA 4DXUA 1B2HA 1SBPA 3N6UA 4QFNA 3T9HB 2NVUB 2H9BA 4KI0E 1JVXA 5AA1A 1B46A 3RT6B 4GLIA 1O7TA 3LSFB 3TDJA 1H45A 1Z7ME 3F11A 3Q29A 2ONRA 3RN8A 4GWOA 3SEWA 3TYHA 3PPPA 3H3GA 4EUOA 4OFJA 3K1PA 3ODBA 4KQPA 2QS2A 2R6GE 4OHNA 4GXAA 3O9PA 1MQHA 2Z8DA 3KSJA 1B5JA 5L9OA 2O68A 2ZYOA 5ITPA 1WODA 4NF8A 4TOZA 2LAOA 3USDA 1WVJA 1JEVA 2IA4A 4KR5A 4ZE8A 3PV0E 5I2NA 2FYIA 2Q2CA 2REGA 1PEBA 1LSTA 4AQ4A 3IJOB 4GF8A 4C0RA 4AB5A 3TUSA 1FTLA 5FHMA 1B0HA 3D4CA 4F3BA 5CBRA 2NXOA 1OVTA 4QFOA 4OVJA 5L9SA 1PBQA 3B6QA 3H7MA 1HSLA 3K01A 1B58A 4G2ZA 1N3WA 3O6HA 1GTKA 3H4ZA 1B9JA 1ZMGA 2KLFA 3HCQA 3EHSA 1DTZA 1GV8A 3C31A 2Z23A 2I6EA 2DE2A 3O66A 3W15C 5CC2A 1QUIA 3DM0A 1LBCA 2ZNTA 3FVNA 1IXGA 4R6HA 4H65A 4BDOA 3TTLA 5H8HA 2RCBA 3K6UA 3EHTA 4JB7A 4ELOA 1MQIA 1SI0A 2FNCA 2HCAA 1SW2A 2VP1A 1DOTA 3E9XA 3FVOA 4JSOA 2O7IA 1WDNA 3FVKA 3TEPA 1O63A 1OVBA 2X7QA 3V5AA 5I58B 2QPQA 2RCAA 1URSA 1JW5A 4NF6A 3ONMA 3TTNA 2FA7A 1SVXB 4ELPA 3KN7A 3B6TA 1IXCA 3FXQA 3K1NA 5K2XA 3CFXA 3MZBA 1JNFA 3OEMA 2Y7RA 1JEUA 3T9XB 1EZ9A 3M3FA 3IOUA 5I56A 1A55A 4QSCA 4LA9A 1SW5A 4GIZA 4DDDA 1MDQA 3KFMA 3PU5A 1QULA 2VOZA 4DCYA 3PUWE 4N13A 2O6AA 4DXCA 1ZTYA 4F2OA 5H8NB 5IAIA 4LUBA 4DZ1A 4RY1A 4MLVA 3VVDA 1D3KA 4PETA 1LCTA 1MH4A 1N04A 1GR2A 1A54A 3OELA 4Q5TA 3OENA 1ZBMA 3DP4A 1OIBA 3R7XA 1PB9A 1B4ZA 3WAEA 1SYIA 4FEDA 1VFEA 3TMGA 3THIA 1QW0A 3IOWA 1B7UA 3QXMA 5ELVA 3K02A 3OD7A 4OENA 2UXAA 3VVEA 4F22A 2OCUA 3O6IA 4H5FA 4JDFA 1N7WA 1AH5A 4K3FA 4H8IA 2B3FA 1MS7A 1B3FA 1D9VA 3H6UA 3KOSA 4FIMA 5KDTB 4NE4A 4RNSA 3FD3A 2I4BA 5I57B 3B6WA 3BFTA 3IL1B 2O69A 4G68A 2RC9A 4H8JA 4O3BA 1KWHA 4XXUA 3H6WA 2G29A 5AA4B 3GBAA 3OO6A 2VD3A 1I6QA 2ZNSA 1UTBA 4OMBA 4ELQA 2UVHA 3PUXE 3H6TA 1VFDA 4R75A 1DMBA 1MY3A 1FQBA 2AIXA 3IX1A 1QVSA 2PT1A 2DP8A 2XHDA 4XKRA 2XXRA 5I57A 3N94A 2G93A 3L6GA 4HCYA 1VSOA 2NOOA 3IB1A 4IO5A 1M5BA 2W7YA 1SW4A 4O3AA 5M2VA 3VDFA 4E0WA 3KJ7A 4GD5A 4F3SA 1S7YA 1NNFA 3FV1A 4LONB 2NWJA 1ZKBA 3RGYA 1M5EA 3UK4A 4YMBA 5CM6A 4M1VA 1MPBA 4YB5A 3LSXA 1XVYA 3TKDA 2DWIA 1BIYA 2XXIA 3CI8A 2QL3A 4ZEFA 1A8FA 3QYTA 4F2QA 3VXBA 1I69A 4F31B 2H5YA 3G3HA 1B3GA 1SI1A 2I0BA 1FQCA 2OLBA 3FVGA 3KGCA 4NF4A 1MPCA 3IK6B 1UTHB 3VE1B 3A09A 4RYAA 3OOAA 4BDMA 5ISUA 3TQLA 1M5DA 3MVXA 2XXWA 4OEUA 1D4NA 4XKQA 1MXYA 5HPQA 4FATA 5I59B 5I58A 3HN0A 3FATA 4FAJA 3I3VA 3Q27A 3RTFB 3T9VA 1JETA 1S9TA 2GRVA 3GLBA 3O97A 3QK6A 4H6DA 4X48A 4YKIA 5L8DA 5I2KB 5TPAA 4LZ8A 1JVYA 4FECA 5TU0A 1B1HA 3CFZA 4Q0CA 1XOCA 3RT8A 1P1UA 4OQOA 1BLFA 3Q26A 4G4PA 2RC7A 4DE8A 4OEVA 2Q8JA 3R6UA 3BFUA 5CMCA 2DXYA 2O51A 5F7VA 2DWHA 5K2YA 2OWSA 4DLDA 3W9WA 3P7IA 1POY1 4X1DA 3HO7A 5FHNA 3TFLA 5J1DA 5CMMA 5ITOA 3EN3A 4YICA 4P0IA 2A5SA 4I62A 4IO2A 3S9MC 4DXBA 2QS4A 3KOTA 1PB7A 3LSWA 2Y84A 3U93A 3ILUB 5LOMA 2Y7PA 1YTVA 3ZKKA 1HSEA 4M4GA 5CBSA 3MVZA 5JK4A 3S9LC 4QSEA 4E0XA 3PMWA 3T22A 4ZEDA 4PFUA 2HAVA 2WKYA 1LAHE 2F97A 3PGFA 4H1XA 3UIFA 1RYXA 3VV5A 2ANJA 4GQOA 1Y3QA 2DOJA 2YPNA 3M3LA 3MP8A 4NF8B 4U2RA 3TELA 5DVJA 1MXZA 2ONKE 1US4A 4U1OA 1NFTA 4UA8A 3W9VA 3BKIB 3HV1A 2B3BA 3K00A 1P1QA 2ZYNA 3OO8A 1URGA 2GFEA 2VGQA 5FTHA 2O1LA 3IAZA 3CVGA 1AOVA 3MPKA 4HS7A 3TQWA 1IXHA 4IO7A 1MQDA 4FEBA 4G68C 1QJMA 5KDTA 1TFAA 2XXXA 2QSXA 3H03A 3MPLA 3OXNA 2DWAA 4BDLA 2ZNUA 4NF4B 3ZSFA 3TTMA 1J1NA 2F5XA 3C4MA 3PPQA 4F18A 1MY2A 2REJA 3CG3A 4JBZA 3RLFE 1B4HA 4EXLA 4KYSA 1PB8A 1URDA 3RNNA 1H43A 4RK9A 3QUFA 4BLAA 1YAEA 1MXVA 1LGBC 2DVZA 3HSTA 3UP9A 3O2AA 4YB6A 2XXQA 1P1OA 4NWCA 5EYFA 1T0KA 3UORA 4ZEBA 1Y3PA 4C1TA 2F7CA 2Y7KA 3IO4A 5KCJA 1MPDA 3SDFA 2XXYA 4R6YA 3S4UA 4U4SA 1JQFA 4OERA 3K4UA 4AB6A 4WKMA 2Y7WA 2PVUA 4H67A 4YKJA 3RTWB 1IITA 3OEKA 1MY4A 5AA2A 2RKMA 1N84A 1UIVA 1VR5A 4OZ9A 2RINA 2OK2A 2P1SA 4NEDA 3PD8A 4PP0A 5CRYA 2O7UA 2V84A 2Y7IA 5F1QA 2D5WA 2ESNA 3FASA 4RPNA 2HZKA 2RF1A 5L9MA 4HCWA 2V3TA 1OQHA 4OXVA 2YJPA 2VHAA 3CIJA 4G8HA 2V93A 3OMBA 5CI5A 4Z0IA 4QSDA 2Q88A 3CRBA 2CMOA 4G77A 3S9EA 3V89B 1M5FA 3C32A 2D3IA 2F7BA 2ZYKA 3PPOA 3TTRA 4F3PA 4NF5A 5EHMA 3V8XB 1B40A 5CMKA 3MVYA 5CMBA 1QUJA 4NWDA 2GHBA 1P1WA 1PDAA 1SW1A 2A5TB 4IO6A 3C33A 1N76A 3N5LA 1NKXA 4I8CA 2UYEA 3IO6A 4ZEIA 4POWA 1TXFA 5TPAB 3SEVA 1B3HA 1A99A 1POTA 3KEIA 3K6WA 4DCXA 4Q8RA 4GVOA 2ALUA 1D9YA 3FIRA 3FXUA 2I4CA 3DELB 3JYRA 4G8NA 2HAUA 4F29A 5I59A 3G3GA 4HTGA 4KCDA 1Y1MA 4XKPA 4ND9A 1FCKA 3VFJA 2XXVA 3OSQA 1UTHA 1R9QA 3KN3A 1B7HA 1MXWA 3IORA 2AL5A 3D4GA 4JWOA 2CZLA 2YLNA 5DT6A 1FQFA 5H8SA 5I2KA 4OESA 1XT8A 1NNKA 1UTBB 2UVIA 1AL3A 2F8DA 4PQJA 3K2DA 4PFYA 1OQGA 3U94A 1DTGA 3K6VA 3AXFA 4QRZA 4IY6A 1PC3A 1FQEA 5I84A 4R72A 3HHFA 3PUVE 3FV2A 1XS5A 1B0LA 4KPTA 1Q35A 4ZS9A 3GXAA 4JWXA 1B52A 1ZU0A 1DSNA 3U8QA 1FW0A 2E1SA 4RPOA 5DTBA 1A40A 4UACA 2DYXA 4H5GA 3U1OA 2V3UA 3S9NC 5I2NB 5ICTA 2NUVA 3MC2A 3FJMA 4N07A 1BKAA 3TTKA 4MH5A 1B5HA 1R6ZA 3MQ9A 4RK2A 3T93B 2HQ0A 1IUDA 3OO7A 4YU0A 4U23A 4RXLA 2X7PA 3IJXB 3JZJA 4OWDA 3G3JA 1B1XA 4X9TA 1JW1A 3KN8A 2Z22A 4HW8A 3DP8A 4TLMB 2E0SA 4IGTA 2Z8EA 2I3VA 3MVWA 1ZJLA 3KJTA 4ONYA 3ZS6A 1PBPA 2H25A 4R2FA 5DVIA 4ZDMA 1EU8A 4PFTA 1I6BA 3UN6A 1BP5A 1YCJA 2ONSA 3HPIA 3C34A 4KCCA 4QFLA 4QFKA 4JXIA 3U72A 4NMYA 5AE4A 4F39A 4XTCQ 5TP9A 5BUUA 3LR1A 1ATGA 4GFRA 5JTYB 1MY0A 2OJTA 3G3FA 3MZ9A 4IO4A 1Y3NA 4OYVA 4PE5B 2AYSA 4THIA 3FZVA 4FJPA 4YZZA 5DYHA 3TZAA 2Z8FA 4ISUA 3VXCA 1MQJA 4BDRA 2Q9TA 3PUYE 2Q89A 2XX9A 4MF3A 4U4XA 2H4IA 2PYYA 5FTIA 2O84X 3C36A 5H8FA 4Q30B 2V25A 1FQDA 4LATA 3ILTB 1EZPA 4F19A 1GGGA 2H99A 4RJZA 1B6HA 1N0TA 2X26A 3L6HA 4OFLA 1SYHA 4BDNA 3Q25A 3SEUA 3LBSA 5JTYA 2D21A 1MDP1 2DE3A 2M8CA 2XD2A 1FTOA 3PPRA 1LFGA 1NNTA 4GXSB 2F35A 3A3UA 2BJJX 1Z7NE 1N3XA 2A5TA 3O29A 4LZ7A 1FTMA 1IQ7A 3E4RA 4IY5A 2VD2A 2F34A 3TODA 3G7WA 5H8QA 3HHGA 4ESXA 2ZXTA 4WEDA 4F1UA 3UA8A 1B3LA 4F3GA 1UQWA 3TCFA 1H76A 2B65A 1MRPA 1ZIUA 1B32A 1R9LA 3E3KA 3O28A 4YKKA 4IGRA 4XKNA 1P1NA 4XIGQ 3OO9A 3MP6A 1OMPA 1Y4TA 2F36A 1QKBA 4GOTA 4KD5A 3IR1A 5B70A 2XX8A 1MQGA 3QSLA 3K6XA 4KYEA 3SESA 3EPEA 1JW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMS A;  3CSG A;  4R74 A;  4R9F A;  3MUQ A;  4ZZE A;  4C1U A;  1B7Z A;  3O6G A;  3V83 A;  4MBP A;  4DIG A;  1F9B A;  3TCH A;  5AA2 B;  4L17 A;  5IKB A;  2DSF A;  2I3W A;  2ZYM A;  3QUJ A;  4KHZ E;  4LQ2 A;  3QIM A;  3TCG A;  1Y20 A;  1IEJ A;  3KSX A;  3SER A;  3E13 X;  1IIW A;  4YB7 A;  5AA2 D;  2HFB A;  1MXX A;  2Q2A A;  1MH3 A;  3M8U A;  3PD9 A;  2DQV A;  3IOT A;  3OSR A;  4U22 A;  1OLA A;  3LSL A;  2HZL A;  3TPA A;  4EXK A;  1R1N A;  3VVF A;  1MXU A;  3H06 B;  3SKP A;  4R73 A;  4EDP A;  4R6K A;  1H3D A;  4ELR A;  5B7D A;  1LCF A;  4ESW A;  3DP6 A;  2HEU A;  1TT1 A;  5HBC A;  2THI A;  1NH8 A;  4GL0 A;  4EF2 A;  4G8M A;  2V3Q A;  3IOV A;  2QMW A;  3RUM A;  1LB8 A;  2I49 A;  4OTE A;  3VLV A;  1FTJ A;  3M3K A;  3EF7 A;  3FUZ A;  5HM4 B;  4GRK A;  4YKP A;  2I0C A;  1XVX A;  1IXI A;  3IB2 A;  3MBP A;  1LFH A;  2XXT A;  5KCJ B;  4O3C A;  3K1M A;  1II5 A;  1LFI A;  1LAG E;  1QKA A;  1QUK A;  2ZMB A;  3CR9 A;  3IB0 A;  4WXJ A;  3QAX A;  3SEX A;  1Y1Z A;  2F78 A;  2P2A A;  4TLL B;  1B51 A;  3N26 A;  4ZEK A;  1TFD A;  3ECR A;  5TP9 B;  1HSJ A;  2QRY A;  4PFW A;  3RQT A;  3WAF A;  4IO3 A;  4ECF A;  4YAH X;  3CFL A;  3EQ1 A;  2UVG A;  5ICQ A;  3BBR A;  4U21 A;  4JSD A;  4QHQ A;  3H6V A;  1NNP A;  4P0G A;  3S2V A;  3MP1 A;  2IEE A;  3Q28 A;  2XXH A;  1GVC A;  2QS1 A;  4BDQ A;  1OLC A;  4H0W A;  4MFI A;  3CSB A;  1MY1 A;  5A5X B;  1A8E A;  3I5O A;  3GZG A;  3LUY A;  2QS3 A;  4Z7E A;  1M5C A;  1ANF A;  2XD3 A;  3MW0 A;  5DVF A;  1N7X A;  2PBW A;  5H8H B;  1ZLQ A;  2UVJ A;  2DWJ A;  3R26 A;  2R71 A;  1MG1 A;  1I6A A;  3LC8 A;  2H98 A;  4POX A;  3T9U A;  5EHS A;  1Q1K A;  2UYF A;  1FQA A;  4P11 A;  2QMX A;  3KBR A;  4EQ9 A;  5KZT A;  1LLS A;  3FXR A;  4JWY A;  1FTK A;  4EQB A;  5BWJ A;  1EZO A;  1NH7 A;  4QF9 A;  3PMV A;  2I58 A;  3TAJ A;  1AIV A;  2PT2 A;  4OFO A;  3T66 A;  1NMU A;  1XHY A;  3JV9 A;  4X1B A;  3N6T A;  1ELJ A;  5H8Q B;  4IB2 A;  2R9J A;  3ZKL A;  1P99 A;  3FJG A;  4G68 B;  4KYD A;  3SET A;  1BTJ A;  4I1D A;  4FE8 A;  2GH9 A;  1US5 A;  3GBB A;  5I56 B;  2QJE A;  4ZE9 A;  3B7D A;  2F6P A;  3CG1 A;  5H8N A;  2XX7 A;  1MM7 A;  2AL4 A;  2F6G A;  4R2B A;  4U1Z A;  3U92 A;  5AA3 A;  1XC1 A;  4NF6 B;  5DEX B;  5A5X A;  4LQ5 A;  1LB9 A;  1O64 A;  1TWY A;  2HXW A;  2OBG A;  3MJN A;  1NL5 A;  3KZG A;  4LVQ A;  1LAX A;  4MLQ A;  4OET A;  2I48 A;  5H8F B;  3PPN A;  4QFP A;  4F1V A;  3RPW A;  3VLU A;  1A7L A;  2DS9 A;  3K0V A;  1RKM A;  1CB6 A;  1DPP A;  3EHU A;  1USY E;  1YPN A;  1LAF E;  1USY H;  1AMF A;  4NTL A;  5DEX A;  4FOR A;  4ZEC A;  1VE4 A;  4EQ7 A;  2OWT A;  1S50 A;  3KG2 A;  4I9D A;  1UIU A;  4LP2 B;  4ZZA A;  1B5I A;  4WEP A;  1CE2 A;  1MM6 A;  2XXP A;  3MWB A;  5FHO A;  1LBB A;  3UGW A;  3G3K A;  1B05 A;  2DE4 A;  3C9H A;  4KFQ A;  1SQY A;  1Y4C A;  4NF5 B;  2XXU A;  1IZ1 A;  1EH3 A;  2P0S A;  4LZ5 A;  2ABH A;  2O1M A;  3I6V A;  3SEY A;  2DVC A;  1B3E A;  4EF1 A;  1SDX A;  3A3C A;  3RY3 A;  5AA4 A;  3FGS A;  1H44 A;  3C35 A;  1SD3 A;  1DPE A;  1RYO A;  3MZ1 A;  4RA1 A;  4N6P A;  4GL8 A;  4F1Y A;  3PUZ E;  5JEI A;  1Y9U A;  2OZZ A;  2PX1 A;  2RC8 A;  3G3I A;  3PMX A;  3VLW A;  2GHA A;  2F7A A;  3MAM A;  4YMA A;  4TQU Q;  3T96 B;  3DLN A;  2DXR A;  3FJ7 A;  4R9G A;  1L5T A;  4DXU A;  1B2H A;  1SBP A;  3N6U A;  4QFN A;  3T9H B;  2NVU B;  2H9B A;  4KI0 E;  1JVX A;  5AA1 A;  1B46 A;  3RT6 B;  4GLI A;  1O7T A;  3LSF B;  3TDJ A;  1H45 A;  1Z7M E;  3F11 A;  3Q29 A;  2ONR A;  3RN8 A;  4GWO A;  3SEW A;  3TYH A;  3PPP A;  3H3G A;  4EUO A;  4OFJ A;  3K1P A;  3ODB A;  4KQP A;  2QS2 A;  2R6G E;  4OHN A;  4GXA A;  3O9P A;  1MQH A;  2Z8D A;  3KSJ A;  1B5J A;  5L9O A;  2O68 A;  2ZYO A;  5ITP A;  1WOD A;  4NF8 A;  4TOZ A;  2LAO A;  3USD A;  1WVJ A;  1JEV A;  2IA4 A;  4KR5 A;  4ZE8 A;  3PV0 E;  5I2N A;  2FYI A;  2Q2C A;  2REG A;  1PEB A;  1LST A;  4AQ4 A;  3IJO B;  4GF8 A;  4C0R A;  4AB5 A;  3TUS A;  1FTL A;  5FHM A;  1B0H A;  3D4C A;  4F3B A;  5CBR A;  2NXO A;  1OVT A;  4QFO A;  4OVJ A;  5L9S A;  1PBQ A;  3B6Q A;  3H7M A;  1HSL A;  3K01 A;  1B58 A;  4G2Z A;  1N3W A;  3O6H A;  1GTK A;  3H4Z A;  1B9J A;  1ZMG A;  2KLF A;  3HCQ A;  3EHS A;  1DTZ A;  1GV8 A;  3C31 A;  2Z23 A;  2I6E A;  2DE2 A;  3O66 A;  3W15 C;  5CC2 A;  1QUI A;  3DM0 A;  1LBC A;  2ZNT A;  3FVN A;  1IXG A;  4R6H A;  4H65 A;  4BDO A;  3TTL A;  5H8H A;  2RCB A;  3K6U A;  3EHT A;  4JB7 A;  4ELO A;  1MQI A;  1SI0 A;  2FNC A;  2HCA A;  1SW2 A;  2VP1 A;  1DOT A;  3E9X A;  3FVO A;  4JSO A;  2O7I A;  1WDN A;  3FVK A;  3TEP A;  1O63 A;  1OVB A;  2X7Q A;  3V5A A;  5I58 B;  2QPQ A;  2RCA A;  1URS A;  1JW5 A;  4NF6 A;  3ONM A;  3TTN A;  2FA7 A;  1SVX B;  4ELP A;  3KN7 A;  3B6T A;  1IXC A;  3FXQ A;  3K1N A;  5K2X A;  3CFX A;  3MZB A;  1JNF A;  3OEM A;  2Y7R A;  1JEU A;  3T9X B;  1EZ9 A;  3M3F A;  3IOU A;  5I56 A;  1A55 A;  4QSC A;  4LA9 A;  1SW5 A;  4GIZ A;  4DDD A;  1MDQ A;  3KFM A;  3PU5 A;  1QUL A;  2VOZ A;  4DCY A;  3PUW E;  4N13 A;  2O6A A;  4DXC A;  1ZTY A;  4F2O A;  5H8N B;  5IAI A;  4LUB A;  4DZ1 A;  4RY1 A;  4MLV A;  3VVD A;  1D3K A;  4PET A;  1LCT A;  1MH4 A;  1N04 A;  1GR2 A;  1A54 A;  3OEL A;  4Q5T A;  3OEN A;  1ZBM A;  3DP4 A;  1OIB A;  3R7X A;  1PB9 A;  1B4Z A;  3WAE A;  1SYI A;  4FED A;  1VFE A;  3TMG A;  3THI A;  1QW0 A;  3IOW A;  1B7U A;  3QXM A;  5ELV A;  3K02 A;  3OD7 A;  4OEN A;  2UXA A;  3VVE A;  4F22 A;  2OCU A;  3O6I A;  4H5F A;  4JDF A;  1N7W A;  1AH5 A;  4K3F A;  4H8I A;  2B3F A;  1MS7 A;  1B3F A;  1D9V A;  3H6U A;  3KOS A;  4FIM A;  5KDT B;  4NE4 A;  4RNS A;  3FD3 A;  2I4B A;  5I57 B;  3B6W A;  3BFT A;  3IL1 B;  2O69 A;  4G68 A;  2RC9 A;  4H8J A;  4O3B A;  1KWH A;  4XXU A;  3H6W A;  2G29 A;  5AA4 B;  3GBA A;  3OO6 A;  2VD3 A;  1I6Q A;  2ZNS A;  1UTB A;  4OMB A;  4ELQ A;  2UVH A;  3PUX E;  3H6T A;  1VFD A;  4R75 A;  1DMB A;  1MY3 A;  1FQB A;  2AIX A;  3IX1 A;  1QVS A;  2PT1 A;  2DP8 A;  2XHD A;  4XKR A;  2XXR A;  5I57 A;  3N94 A;  2G93 A;  3L6G A;  4HCY A;  1VSO A;  2NOO A;  3IB1 A;  4IO5 A;  1M5B A;  2W7Y A;  1SW4 A;  4O3A A;  5M2V A;  3VDF A;  4E0W A;  3KJ7 A;  4GD5 A;  4F3S A;  1S7Y A;  1NNF A;  3FV1 A;  4LON B;  2NWJ A;  1ZKB A;  3RGY A;  1M5E A;  3UK4 A;  4YMB A;  5CM6 A;  4M1V A;  1MPB A;  4YB5 A;  3LSX A;  1XVY A;  3TKD A;  2DWI A;  1BIY A;  2XXI A;  3CI8 A;  2QL3 A;  4ZEF A;  1A8F A;  3QYT A;  4F2Q A;  3VXB A;  1I69 A;  4F31 B;  2H5Y A;  3G3H A;  1B3G A;  1SI1 A;  2I0B A;  1FQC A;  2OLB A;  3FVG A;  3KGC A;  4NF4 A;  1MPC A;  3IK6 B;  1UTH B;  3VE1 B;  3A09 A;  4RYA A;  3OOA A;  4BDM A;  5ISU A;  3TQL A;  1M5D A;  3MVX A;  2XXW A;  4OEU A;  1D4N A;  4XKQ A;  1MXY A;  5HPQ A;  4FAT A;  5I59 B;  5I58 A;  3HN0 A;  3FAT A;  4FAJ A;  3I3V A;  3Q27 A;  3RTF B;  3T9V A;  1JET A;  1S9T A;  2GRV A;  3GLB A;  3O97 A;  3QK6 A;  4H6D A;  4X48 A;  4YKI A;  5L8D A;  5I2K B;  5TPA A;  4LZ8 A;  1JVY A;  4FEC A;  5TU0 A;  1B1H A;  3CFZ A;  4Q0C A;  1XOC A;  3RT8 A;  1P1U A;  4OQO A;  1BLF A;  3Q26 A;  4G4P A;  2RC7 A;  4DE8 A;  4OEV A;  2Q8J A;  3R6U A;  3BFU A;  5CMC A;  2DXY A;  2O51 A;  5F7V A;  2DWH A;  5K2Y A;  2OWS A;  4DLD A;  3W9W A;  3P7I A;  1POY 1;  4X1D A;  3HO7 A;  5FHN A;  3TFL A;  5J1D A;  5CMM A;  5ITO A;  3EN3 A;  4YIC A;  4P0I A;  2A5S A;  4I62 A;  4IO2 A;  3S9M C;  4DXB A;  2QS4 A;  3KOT A;  1PB7 A;  3LSW A;  2Y84 A;  3U93 A;  3ILU B;  5LOM A;  2Y7P A;  1YTV A;  3ZKK A;  1HSE A;  4M4G A;  5CBS A;  3MVZ A;  5JK4 A;  3S9L C;  4QSE A;  4E0X A;  3PMW A;  3T22 A;  4ZED A;  4PFU A;  2HAV A;  2WKY A;  1LAH E;  2F97 A;  3PGF A;  4H1X A;  3UIF A;  1RYX A;  3VV5 A;  2ANJ A;  4GQO A;  1Y3Q A;  2DOJ A;  2YPN A;  3M3L A;  3MP8 A;  4NF8 B;  4U2R A;  3TEL A;  5DVJ A;  1MXZ A;  2ONK E;  1US4 A;  4U1O A;  1NFT A;  4UA8 A;  3W9V A;  3BKI B;  3HV1 A;  2B3B A;  3K00 A;  1P1Q A;  2ZYN A;  3OO8 A;  1URG A;  2GFE A;  2VGQ A;  5FTH A;  2O1L A;  3IAZ A;  3CVG A;  1AOV A;  3MPK A;  4HS7 A;  3TQW A;  1IXH A;  4IO7 A;  1MQD A;  4FEB A;  4G68 C;  1QJM A;  5KDT A;  1TFA A;  2XXX A;  2QSX A;  3H03 A;  3MPL A;  3OXN A;  2DWA A;  4BDL A;  2ZNU A;  4NF4 B;  3ZSF A;  3TTM A;  1J1N A;  2F5X A;  3C4M A;  3PPQ A;  4F18 A;  1MY2 A;  2REJ A;  3CG3 A;  4JBZ A;  3RLF E;  1B4H A;  4EXL A;  4KYS A;  1PB8 A;  1URD A;  3RNN A;  1H43 A;  4RK9 A;  3QUF A;  4BLA A;  1YAE A;  1MXV A;  1LGB C;  2DVZ A;  3HST A;  3UP9 A;  3O2A A;  4YB6 A;  2XXQ A;  1P1O A;  4NWC A;  5EYF A;  1T0K A;  3UOR A;  4ZEB A;  1Y3P A;  4C1T A;  2F7C A;  2Y7K A;  3IO4 A;  5KCJ A;  1MPD A;  3SDF A;  2XXY A;  4R6Y A;  3S4U A;  4U4S A;  1JQF A;  4OER A;  3K4U A;  4AB6 A;  4WKM A;  2Y7W A;  2PVU A;  4H67 A;  4YKJ A;  3RTW B;  1IIT A;  3OEK A;  1MY4 A;  5AA2 A;  2RKM A;  1N84 A;  1UIV A;  1VR5 A;  4OZ9 A;  2RIN A;  2OK2 A;  2P1S A;  4NED A;  3PD8 A;  4PP0 A;  5CRY A;  2O7U A;  2V84 A;  2Y7I A;  5F1Q A;  2D5W A;  2ESN A;  3FAS A;  4RPN A;  2HZK A;  2RF1 A;  5L9M A;  4HCW A;  2V3T A;  1OQH A;  4OXV A;  2YJP A;  2VHA A;  3CIJ A;  4G8H A;  2V93 A;  3OMB A;  5CI5 A;  4Z0I A;  4QSD A;  2Q88 A;  3CRB A;  2CMO A;  4G77 A;  3S9E A;  3V89 B;  1M5F A;  3C32 A;  2D3I A;  2F7B A;  2ZYK A;  3PPO A;  3TTR A;  4F3P A;  4NF5 A;  5EHM A;  3V8X B;  1B40 A;  5CMK A;  3MVY A;  5CMB A;  1QUJ A;  4NWD A;  2GHB A;  1P1W A;  1PDA A;  1SW1 A;  2A5T B;  4IO6 A;  3C33 A;  1N76 A;  3N5L A;  1NKX A;  4I8C A;  2UYE A;  3IO6 A;  4ZEI A;  4POW A;  1TXF A;  5TPA B;  3SEV A;  1B3H A;  1A99 A;  1POT A;  3KEI A;  3K6W A;  4DCX A;  4Q8R A;  4GVO A;  2ALU A;  1D9Y A;  3FIR A;  3FXU A;  2I4C A;  3DEL B;  3JYR A;  4G8N A;  2HAU A;  4F29 A;  5I59 A;  3G3G A;  4HTG A;  4KCD A;  1Y1M A;  4XKP A;  4ND9 A;  1FCK A;  3VFJ A;  2XXV A;  3OSQ A;  1UTH A;  1R9Q A;  3KN3 A;  1B7H A;  1MXW A;  3IOR A;  2AL5 A;  3D4G A;  4JWO A;  2CZL A;  2YLN A;  5DT6 A;  1FQF A;  5H8S A;  5I2K A;  4OES A;  1XT8 A;  1NNK A;  1UTB B;  2UVI A;  1AL3 A;  2F8D A;  4PQJ A;  3K2D A;  4PFY A;  1OQG A;  3U94 A;  1DTG A;  3K6V A;  3AXF A;  4QRZ A;  4IY6 A;  1PC3 A;  1FQE A;  5I84 A;  4R72 A;  3HHF A;  3PUV E;  3FV2 A;  1XS5 A;  1B0L A;  4KPT A;  1Q35 A;  4ZS9 A;  3GXA A;  4JWX A;  1B52 A;  1ZU0 A;  1DSN A;  3U8Q A;  1FW0 A;  2E1S A;  4RPO A;  5DTB A;  1A40 A;  4UAC A;  2DYX A;  4H5G A;  3U1O A;  2V3U A;  3S9N C;  5I2N B;  5ICT A;  2NUV A;  3MC2 A;  3FJM A;  4N07 A;  1BKA A;  3TTK A;  4MH5 A;  1B5H A;  1R6Z A;  3MQ9 A;  4RK2 A;  3T93 B;  2HQ0 A;  1IUD A;  3OO7 A;  4YU0 A;  4U23 A;  4RXL A;  2X7P A;  3IJX B;  3JZJ A;  4OWD A;  3G3J A;  1B1X A;  4X9T A;  1JW1 A;  3KN8 A;  2Z22 A;  4HW8 A;  3DP8 A;  4TLM B;  2E0S A;  4IGT A;  2Z8E A;  2I3V A;  3MVW A;  1ZJL A;  3KJT A;  4ONY A;  3ZS6 A;  1PBP A;  2H25 A;  4R2F A;  5DVI A;  4ZDM A;  1EU8 A;  4PFT A;  1I6B A;  3UN6 A;  1BP5 A;  1YCJ A;  2ONS A;  3HPI A;  3C34 A;  4KCC A;  4QFL A;  4QFK A;  4JXI A;  3U72 A;  4NMY A;  5AE4 A;  4F39 A;  4XTC Q;  5TP9 A;  5BUU A;  3LR1 A;  1ATG A;  4GFR A;  5JTY B;  1MY0 A;  2OJT A;  3G3F A;  3MZ9 A;  4IO4 A;  1Y3N A;  4OYV A;  4PE5 B;  2AYS A;  4THI A;  3FZV A;  4FJP A;  4YZZ A;  5DYH A;  3TZA A;  2Z8F A;  4ISU A;  3VXC A;  1MQJ A;  4BDR A;  2Q9T A;  3PUY E;  2Q89 A;  2XX9 A;  4MF3 A;  4U4X A;  2H4I A;  2PYY A;  5FTI A;  2O84 X;  3C36 A;  5H8F A;  4Q30 B;  2V25 A;  1FQD A;  4LAT A;  3ILT B;  1EZP A;  4F19 A;  1GGG A;  2H99 A;  4RJZ A;  1B6H A;  1N0T A;  2X26 A;  3L6H A;  4OFL A;  1SYH A;  4BDN A;  3Q25 A;  3SEU A;  3LBS A;  5JTY A;  2D21 A;  1MDP 1;  2DE3 A;  2M8C A;  2XD2 A;  1FTO A;  3PPR A;  1LFG A;  1NNT A;  4GXS B;  2F35 A;  3A3U A;  2BJJ X;  1Z7N E;  1N3X A;  2A5T A;  3O29 A;  4LZ7 A;  1FTM A;  1IQ7 A;  3E4R A;  4IY5 A;  2VD2 A;  2F34 A;  3TOD A;  3G7W A;  5H8Q A;  3HHG A;  4ESX A;  2ZXT A;  4WED A;  4F1U A;  3UA8 A;  1B3L A;  4F3G A;  1UQW A;  3TCF A;  1H76 A;  2B65 A;  1MRP A;  1ZIU A;  1B32 A;  1R9L A;  3E3K A;  3O28 A;  4YKK A;  4IGR A;  4XKN A;  1P1N A;  4XIG Q;  3OO9 A;  3MP6 A;  1OMP A;  1Y4T A;  2F36 A;  1QKB A;  4GOT A;  4KD5 A;  3IR1 A;  5B70 A;  2XX8 A;  1MQG A;  3QSL A;  3K6X A;  4KYE A;  3SES A;  3EPE A;  1JW4 A; 
#chains in the Genus database with same CATH topology
 4ZZE A;  5AA2 B;  2DSF A;  3QUJ A;  4LQ2 A;  3TCG A;  3PD9 A;  2DQV A;  3IOT A;  3OSR A;  4GWW A;  3TPA A;  2HZL A;  4EXK A;  4PFI A;  1LCF A;  1IMC A;  4NG7 A;  5HBC A;  4GX6 A;  2THI A;  4GX3 A;  2WX9 A;  2V3Q A;  3RUM A;  4OTE A;  1NUW A;  4YKP A;  2I0C A;  1IXI A;  3MBP A;  4TLL B;  3N26 A;  3ECR A;  3WAF A;  4YAH X;  3CFL A;  3B50 A;  4U21 A;  4JSD A;  4P0G A;  3Q28 A;  1GVC A;  4MFI A;  3U65 A;  3LUY A;  1M5C A;  4JVI A;  1NV2 A;  5H8H B;  4N8G A;  4POX A;  5EHS A;  2PCR A;  4EQB A;  1EZO A;  3TAJ A;  3SET A;  1LEV A;  4QBA A;  2F6P A;  4R2B A;  5AA3 A;  4U1Z A;  4NF6 B;  4MNC A;  1O64 A;  3MJN A;  1NL5 A;  3KZG A;  4OET A;  2I48 A;  5H8F B;  1A7L A;  1RKM A;  1USY E;  1YPN A;  4NTL A;  4PDD A;  4FOR A;  4ZEC A;  4I9D A;  2XXP A;  5FHO A;  1LBB A;  3G3K A;  1B05 A;  1EH3 A;  3I6V A;  4EF1 A;  4GL8 A;  3PUZ E;  1Y9U A;  3PMX A;  4YMA A;  3T96 B;  3FJ7 A;  5H8N B;  4KI0 E;  1JVX A;  3RT6 B;  5ESY A;  3TDJ A;  2ONR A;  1NUY A;  3TYH A;  3PPP A;  3H3G A;  4EUO A;  4OFJ A;  2VPO A;  4OHN A;  5IZ3 A;  2LAO A;  2FYI A;  1LST A;  4C0R A;  1NV6 A;  3TUS A;  5FHM A;  4F3B A;  1LBW A;  2NXO A;  3H7M A;  1HSL A;  3K01 A;  2B4L A;  3O6H A;  1DTZ A;  2Z23 A;  2I6E A;  1LBC A;  2ZNT A;  1IXG A;  5H8H A;  2RCB A;  3EHT A;  1MQI A;  2HCA A;  5A5X B;  2O7I A;  4NN3 A;  3FVK A;  3TEP A;  5I58 B;  2FIX A;  3FXQ A;  4JVD A;  1RDX A;  1BK4 A;  5K2X A;  3OEM A;  1FJ6 A;  5I56 A;  1EZ9 A;  3M3F A;  4QSC A;  4LA9 A;  4GIZ A;  3PU5 A;  2CEY A;  5IAI A;  1ZTY A;  4RY1 A;  3VVD A;  1D3K A;  1LCT A;  1N04 A;  1GR2 A;  1OIB A;  5IM2 A;  3WAE A;  1SYI A;  4FED A;  3TMG A;  3THI A;  1QW0 A;  3QXM A;  1B7U A;  2UXA A;  4K3F A;  4JDF A;  4H8I A;  2B3F A;  5KDT B;  4NE4 A;  3FD3 A;  5I57 B;  1LBX A;  4H8J A;  4XXU A;  4NAP A;  3PUX E;  3H6T A;  1QVS A;  2PT1 A;  2XHD A;  3L6G A;  4N81 A;  4AS4 A;  4E0W A;  4FBP A;  4LON B;  3UK4 A;  4YB5 A;  4DI3 D;  3TKD A;  3CI8 A;  4GWX A;  2QL3 A;  1A8F A;  4F2Q A;  1B3G A;  1FQC A;  3FVG A;  4BDM A;  2XXW A;  1MXY A;  5HPQ A;  5I58 A;  1SPI A;  3FAT A;  4FAJ A;  2GRV A;  3QK6 A;  1DK4 A;  4LZ8 A;  4P9K A;  3Q26 A;  3R6U A;  5CMC A;  5FHN A;  4I62 A;  3KOT A;  5LOM A;  3ZKK A;  1HSE A;  3IFC A;  4PFU A;  2HAV A;  3MYU A;  4NX1 A;  4NQ8 A;  2YPN A;  4EXL A;  4U2R A;  4UA8 A;  2ZYN A;  3OO8 A;  1URG A;  4HS7 A;  2VPN A;  2QSX A;  3H03 A;  2DWA A;  2REJ A;  3CG3 A;  1URD A;  1H43 A;  3QUF A;  4BLA A;  2L5V A;  5EYF A;  4MNI A;  5KCJ A;  1Y3P A;  2Y7K A;  3IO4 A;  2XXY A;  3S4U A;  2PVU A;  4H67 A;  3RTW B;  5AA2 A;  3FAS A;  2HZK A;  1OQH A;  4OXV A;  2VHA A;  3OMB A;  4PE3 A;  2Q88 A;  2VT5 A;  3KBZ A;  1M5F A;  2ZYK A;  4H45 A;  2GHB A;  2A5T B;  3SEV A;  1NKX A;  2UYE A;  5EQ9 A;  1TXF A;  1A99 A;  3FXU A;  3DEL B;  2HAU A;  3G3G A;  4XKP A;  1AWB A;  2XXV A;  3OSQ A;  3T1B A;  1MXW A;  2AL5 A;  3D4G A;  5I2K A;  2CZL A;  4PBH A;  1XT8 A;  1UTB B;  2UVI A;  4PQJ A;  2F8D A;  3K2D A;  4PFY A;  1OQG A;  4QRZ A;  1PC3 A;  1FQE A;  4R72 A;  1XS5 A;  1B0L A;  3KC0 A;  2Y5K A;  3U1O A;  2NUV A;  4HE1 A;  3MC2 A;  1R6Z A;  4OVQ A;  2HQ0 A;  4YU0 A;  1FSA A;  4U23 A;  3JZJ A;  4HW8 A;  1JW1 A;  3DP8 A;  2I3V A;  3MVW A;  4PF8 A;  3UN6 A;  1BP5 A;  1K9Z A;  4QFL A;  3U72 A;  4GFR A;  4PC9 A;  3G3F A;  5DYH A;  4OYV A;  4THI A;  1FPB A;  2Q9T A;  4N6D A;  4U4X A;  2O84 X;  2CZH A;  1G0H A;  4LAT A;  2H99 A;  4RJZ A;  1SYH A;  2D21 A;  2DE3 A;  2M8C A;  2P3V A;  1FTO A;  1FBE A;  1LFG A;  2BJJ X;  4IY5 A;  1NV1 A;  1UQW A;  4OVT A;  1B32 A;  4IGR A;  2WYK A;  4KD5 A;  5B70 A;  3QSL A;  3K6X A;  4KYE A;  2WYP A;  2PMS A;  4R74 A;  1B7Z A;  3O6G A;  4MBP A;  5IKB A;  4L17 A;  2I3W A;  4KHZ E;  4OAN A;  1Y20 A;  1IIW A;  2HFB A;  3M8U A;  4P1E A;  4U22 A;  1R1N A;  3VVF A;  1MXU A;  1FBG A;  4MMP A;  4P47 A;  4GL0 A;  3FXB A;  2QMW A;  2I49 A;  1LFH A;  3IB2 A;  2XXT A;  1NUX A;  3IB0 A;  3QAX A;  4PFW A;  2UVG A;  4QHQ A;  3S2V A;  3MP1 A;  2IEE A;  2QS1 A;  1OLC A;  2F3B A;  1A8E A;  3I5O A;  4PGN A;  4Z7E A;  2XD3 A;  3TTN A;  1N7X A;  2PBW A;  1ZLQ A;  2DWJ A;  1I6A A;  2H98 A;  1FQA A;  4JWY A;  1XI6 A;  3FXR A;  5BWJ A;  1NH7 A;  4QF9 A;  1AIV A;  2PT2 A;  1ELJ A;  4IB2 A;  1P99 A;  4KYD A;  2GH9 A;  3GBB A;  4ZE9 A;  3B7D A;  3CG1 A;  5H8N A;  2AL4 A;  3U92 A;  4X8R A;  5DW8 A;  4LQ5 A;  1LB9 A;  1TWY A;  2OBG A;  1Q9D A;  1LAX A;  4F1V A;  4NF0 A;  3VLU A;  2DS9 A;  3EHU A;  1LAF E;  1G0I A;  4PAI A;  1VE4 A;  2WBB A;  3KG2 A;  1UIU A;  4LP2 B;  4ZZA A;  3NOH A;  3MWB A;  2DE4 A;  2PFZ A;  2ABH A;  2O1M A;  1B3E A;  3RY3 A;  5AA4 A;  5DTB A;  3MZ1 A;  1DPE A;  5JEI A;  4N6P A;  1FBF A;  2PX1 A;  1RDZ A;  2DXR A;  4DXU A;  3T9H B;  2H9B A;  5AA1 A;  3Q29 A;  4GWO A;  3SEW A;  2R8T A;  3K1P A;  2R6G E;  2XWI A;  4GXA A;  2Z8D A;  4PDH A;  4TOZ A;  1NV3 A;  2IA4 A;  1JEV A;  4HE0 A;  3PV0 E;  2Q2C A;  1PEB A;  3IJO B;  4AB5 A;  1FTL A;  5CBR A;  5ET7 A;  4QFO A;  4OVJ A;  1GTK A;  5A5L A;  5CC2 A;  4R6H A;  4BDO A;  4JB7 A;  1K9Y A;  4ELO A;  4ONY A;  5KZT A;  4KXP A;  3FVO A;  4JSO A;  1OVB A;  2X7Q A;  2QPQ A;  2RCA A;  4N17 A;  1JW5 A;  1SVX B;  1LBY A;  3B6T A;  3CFX A;  2Y7R A;  1JEU A;  3IOU A;  4DDD A;  1MDQ A;  4DCY A;  4F2O A;  4N13 A;  5I5P A;  4LUB A;  2ZZV A;  3OEL A;  1MH4 A;  3DP4 A;  3R7X A;  1PB9 A;  3OD7 A;  3VVE A;  4H5F A;  1AH5 A;  1MS7 A;  2I4B A;  3IL1 B;  2FIE A;  4G68 A;  5AA4 B;  1UTB A;  1KZ8 A;  5EQA A;  1DMB A;  1MY3 A;  1FRP A;  1FQB A;  3IX1 A;  4XKR A;  2XXR A;  5I57 A;  2Q74 A;  4I3E A;  1EYK A;  3RPL A;  1VSO A;  4IO5 A;  3KJ7 A;  4GD5 A;  4F3S A;  3FV1 A;  4O8M A;  1MPB A;  1XVY A;  5FBP A;  3G3H A;  4UAB A;  3IK6 B;  3OOA A;  1M5D A;  5I59 B;  3I3V A;  3RTF B;  3GLB A;  3O97 A;  4YKI A;  5TPA A;  3BIG A;  3CFZ A;  1FBD A;  4G4P A;  4OEV A;  2B4M A;  2Q8J A;  2DWH A;  2OWS A;  3W9W A;  1POY 1;  4IR8 A;  5CMM A;  4P0I A;  3U93 A;  5CBS A;  3MVZ A;  4E0X A;  3T22 A;  2WKY A;  1LAH E;  2F97 A;  3PGF A;  4H1X A;  3UIF A;  1RYX A;  4GQO A;  5EQ7 A;  1MXZ A;  2B3B A;  1IMB A;  2GFE A;  1FPG A;  5FTH A;  2O1L A;  3IAZ A;  3MPK A;  3TQW A;  4IO7 A;  4G68 C;  1QJM A;  2XXX A;  4BDL A;  1J1N A;  3PPQ A;  4KYS A;  4RK9 A;  4NGU A;  5IGA A;  1LGB C;  3UP9 A;  4DI4 B;  4YB6 A;  2XXQ A;  3UOR A;  4P56 A;  4OER A;  2HPG A;  4AB6 A;  4YKJ A;  1IIT A;  1MY4 A;  2RKM A;  4OZ9 A;  2RIN A;  4NED A;  4RPN A;  5L9M A;  5I7I A;  4G8H A;  4QSD A;  4G77 A;  1NI9 A;  3S9E A;  2MKZ A;  3V89 B;  2D3I A;  2F7B A;  4NF5 A;  1IMF A;  1YXI A;  5CMK A;  4NWD A;  4IO6 A;  4I8C A;  1B3H A;  4DCX A;  1LBZ A;  3JYR A;  4KCD A;  1Y1M A;  1R9Q A;  4JWO A;  2YLN A;  1DTG A;  3AXF A;  1RDY A;  4MAG A;  3HFU A;  1Q35 A;  1ZU0 A;  1DSN A;  1FW0 A;  4UAC A;  3S9N C;  5ICT A;  4MEV A;  4N07 A;  3TTK A;  4PGP A;  3IJX B;  4N15 A;  1B1X A;  3KN8 A;  4GWY A;  1FBC A;  2FBP A;  5ET8 A;  3ZS6 A;  5DVI A;  1EU8 A;  2ONS A;  4QFK A;  1YCJ A;  1NUZ A;  4JXI A;  5AE4 A;  5TP9 A;  1ATG A;  5JTY B;  4IO4 A;  1FPE A;  3VXC A;  1MQJ A;  4BDR A;  2Q89 A;  2XX9 A;  3D1R A;  4Q30 B;  1FQD A;  2Y5L A;  4F19 A;  1DBZ A;  3L6H A;  3SEU A;  2XD2 A;  2CZI A;  4GXS B;  2F35 A;  2V4C A;  1KA1 A;  1FTM A;  3E4R A;  2VD2 A;  4ESX A;  4F1U A;  5H8Q A;  3HHG A;  3TCF A;  2B65 A;  3BIH A;  1R9L A;  3E3K A;  4YKK A;  2HXR A;  1OMP A;  3IR1 A;  3CHG A;  2QVU A;  3SES A;  3EPE A;  1LBV A;  4C1U A;  3MUQ A;  4PTK A;  1F9B A;  2ZYM A;  3QIM A;  3SER A;  5AA2 D;  4GBV A;  3KC1 A;  1MXX A;  2Q2A A;  4PFB A;  1OLA A;  4EDP A;  3H06 B;  3SKP A;  4R73 A;  4R6K A;  1H3D A;  4ELR A;  5B7D A;  4ESW A;  2HEU A;  1TT1 A;  4MNP A;  1NH8 A;  3IOV A;  1LB8 A;  3VLV A;  1FTJ A;  3EF7 A;  3FUZ A;  5HM4 B;  4GRK A;  3ISP A;  5KCJ B;  4O3C A;  3K1M A;  1II5 A;  1LAG E;  1QKA A;  1QUK A;  2ZMB A;  3CR9 A;  2QFL A;  3SEX A;  1FJ9 A;  1Y1Z A;  2F78 A;  1B51 A;  4ZEK A;  3RQT A;  5TP9 B;  1HSJ A;  4ECF A;  3EQ1 A;  3BBR A;  4PF6 A;  3H6V A;  2XXH A;  4H0W A;  3CSB A;  1MY1 A;  2KR0 A;  3GZG A;  4XEQ A;  2QS3 A;  3MW0 A;  5DVF A;  4MCO A;  2UVJ A;  3R26 A;  2R71 A;  3LC8 A;  3T9U A;  1NV4 A;  2QMX A;  1LLS A;  2I58 A;  3SZP A;  4OFO A;  3T66 A;  1XHY A;  3JV9 A;  4X1B A;  3N6T A;  5H8Q B;  2R9J A;  4G68 B;  5I56 B;  2PFY A;  4FE8 A;  1US5 A;  2QJE A;  1MM7 A;  1IMD A;  2F6G A;  4GBW A;  5A5X A;  4LVQ A;  1NV5 A;  3PPN A;  4QFP A;  3RPW A;  1CB6 A;  1USY H;  2Q8M A;  1AMF A;  2OWT A;  1S50 A;  1DCU A;  1CE2 A;  1Y4C A;  4NF5 B;  2XXU A;  1IZ1 A;  4LZ5 A;  2P0S A;  1SDX A;  3A3C A;  3FGS A;  1H44 A;  4F1Y A;  1SD3 A;  4RA1 A;  4PAK A;  2RC8 A;  3G3I A;  3VLW A;  4R9G A;  1L5T A;  3N6U A;  2NVU B;  2FVZ A;  1B46 A;  4N91 A;  1FPL A;  3LSF B;  4KQP A;  1FPF A;  2XA5 A;  1MQH A;  3KSJ A;  2O68 A;  4NF8 A;  3USD A;  1WVJ A;  2REG A;  4GF8 A;  4PCD A;  1B0H A;  3D4C A;  4AS5 A;  4GX4 A;  1PBQ A;  3E78 A;  1B58 A;  1N3W A;  1ZMG A;  3HCQ A;  3EHS A;  1GV8 A;  3C31 A;  3O66 A;  3DM0 A;  1SI0 A;  2P3N A;  4EF2 A;  1DOT A;  5IZZ A;  1WDN A;  4GWU A;  1URS A;  4LN5 A;  4NF6 A;  3ONM A;  2FA7 A;  5EYG A;  1FPD A;  1IXC A;  3MZB A;  1JNF A;  5T3J A;  3T9X B;  2F3D A;  1A55 A;  1SW5 A;  3KFM A;  2VOZ A;  4DXC A;  2O6A A;  4DZ1 A;  4Q5T A;  3OEN A;  1IME A;  3K02 A;  2XWV A;  1N7W A;  3H6U A;  3KOS A;  1B3F A;  4RNS A;  4O3B A;  1KWH A;  3GBA A;  1I6Q A;  2ZNS A;  2QVV A;  3FBP A;  4R75 A;  1VFD A;  2OX3 A;  3N94 A;  5M2V A;  4O3A A;  3VDF A;  1S7Y A;  1NNF A;  1ZKB A;  3LSX A;  1BIY A;  4ZEF A;  3VXB A;  1I69 A;  4F31 B;  2OLB A;  4NF4 A;  3KGC A;  1MPC A;  1UTH B;  3VE1 B;  5ISU A;  3A29 A;  3TQL A;  4OEU A;  4XKQ A;  1D4N A;  4FAT A;  4PFR A;  1D9Q A;  4OA4 A;  3Q27 A;  1JET A;  1S9T A;  4H6D A;  5I2K B;  1JVY A;  5TU0 A;  2XWO A;  3RT8 A;  1P1U A;  4OQO A;  1BLF A;  2RC7 A;  4DE8 A;  5F7V A;  3BFU A;  5LTC A;  3P7I A;  3TFL A;  4X1D A;  3HO7 A;  5J1D A;  5ITO A;  4YIC A;  4IO2 A;  4DXB A;  1PB7 A;  2Y84 A;  3ILU B;  5IZ3 B;  3S9L C;  4M4G A;  5JK4 A;  3LUZ A;  4H46 A;  4QSE A;  4ZED A;  2DOJ A;  3MP8 A;  3TEL A;  5DVJ A;  3W9V A;  4MX6 A;  2XXK A;  1FTA A;  2VGQ A;  1IXH A;  1MQD A;  5KDT A;  1TFA A;  3MPL A;  3OXN A;  3ZSF A;  4NF4 B;  3TTM A;  3C4M A;  4JBZ A;  1B4H A;  3RNN A;  3EKI A;  1FPK A;  1MXV A;  3HST A;  2KQZ A;  3O2A A;  1P1O A;  4NWC A;  4X04 A;  2F7C A;  4I3Y A;  4R6Y A;  1JQF A;  3K4U A;  2Y7W A;  4PAF A;  1VR5 A;  2P1S A;  2Y7I A;  2D5W A;  2RF1 A;  2V3T A;  2YJP A;  3CIJ A;  5CI5 A;  3CRB A;  2CMO A;  4F3P A;  3TTR A;  3PPO A;  3V8X B;  5CMB A;  1QUJ A;  1SW1 A;  3RYD A;  3C33 A;  1N76 A;  3N5L A;  4ZEI A;  4MIJ A;  3IO6 A;  4POW A;  3K6W A;  2ALU A;  3FIR A;  4G8N A;  4HTG A;  1FCK A;  1UTH A;  3KN3 A;  1B7H A;  5DT6 A;  1NNK A;  1AL3 A;  2CZK A;  5I84 A;  3ROJ A;  4XFE A;  4ZS9 A;  3GXA A;  3U8Q A;  2E1S A;  2DYX A;  4H5G A;  2V3U A;  5I2N B;  1BKA A;  1B5H A;  3T93 B;  4RK2 A;  1IUD A;  3OO7 A;  4OWD A;  4IGT A;  1VDW A;  1ZJL A;  3KJT A;  1PBP A;  2H25 A;  4R2F A;  4ZDM A;  4PFT A;  3C34 A;  4XTC Q;  5BUU A;  3LR1 A;  2QVR A;  2OJT A;  4YZZ A;  1EYJ A;  4FJP A;  3TZA A;  2Z8F A;  2FHY A;  3IFA A;  4MF3 A;  2PYY A;  5FTI A;  2V25 A;  5EYH A;  3ILT B;  1GGG A;  1B6H A;  1N0T A;  2X26 A;  4OFL A;  3Q25 A;  3LBS A;  5JTY A;  3B8B A;  1NNT A;  1Z7N E;  5I3S A;  2A5T A;  3O29 A;  1IQ7 A;  4F39 A;  2F34 A;  5J16 A;  3UA8 A;  2GQ1 A;  5EQ8 A;  1MRP A;  5ET6 A;  3O28 A;  4XKN A;  1P1N A;  4XIG Q;  3OO9 A;  1JP4 A;  1Y4T A;  2F36 A;  1QKB A;  2XX8 A;  4P1L A;  3CSG A;  4R9F A;  3V83 A;  4DIG A;  3TCH A;  1FPI A;  3KSX A;  1IEJ A;  3E13 X;  4YB7 A;  1MH3 A;  3LSL A;  3DP6 A;  4G8M A;  3M3K A;  1XVX A;  2ZZW A;  5F24 A;  1LFI A;  4HXV A;  4WXJ A;  2P2A A;  1TFD A;  2QRY A;  4IO3 A;  4N4U A;  5ICQ A;  1NNP A;  4BDQ A;  1YYZ A;  3QMF A;  1ANF A;  2CEX A;  3T0J A;  1MG1 A;  1Q1K A;  2UYF A;  4P11 A;  3KBR A;  4OVR A;  4EQ9 A;  1FTK A;  3PMV A;  1NV7 A;  1NMU A;  1YZ0 A;  1FBP A;  3ZKL A;  3FJG A;  1BTJ A;  4I1D A;  2XX7 A;  1XC1 A;  5DEX B;  5LDZ A;  2HXW A;  4MLQ A;  3K0V A;  1DPP A;  4EQ7 A;  1B5I A;  4WEP A;  1MM6 A;  3UGW A;  3C9H A;  4KFQ A;  1SQY A;  2DDK A;  3SEY A;  2DVC A;  1AOV A;  3C35 A;  1RYO A;  2OZZ A;  2GHA A;  2F7A A;  3MAM A;  4TQU Q;  3DLN A;  4HE2 A;  1B2H A;  1SBP A;  4QFN A;  2WEF A;  4GLI A;  1O7T A;  1H45 A;  1Z7M E;  3F11 A;  3RN8 A;  3ODB A;  2QS2 A;  3O9P A;  5L9O A;  1B5J A;  2ZYO A;  3MST A;  1WOD A;  5ITP A;  3E79 A;  4JVC A;  4KR5 A;  4ZE8 A;  5I2N A;  4AQ4 A;  1OVT A;  5L9S A;  3B6Q A;  4QXD A;  4G2Z A;  3H4Z A;  1B9J A;  2KLF A;  2DE2 A;  3W15 C;  1QUI A;  3FVN A;  1INP A;  4G61 A;  4H65 A;  3TTL A;  3K6U A;  2VP1 A;  2FNC A;  5DEX A;  1SW2 A;  3E9X A;  1O63 A;  3V5A A;  1NV0 A;  4ELP A;  3KN7 A;  3K1N A;  1QUL A;  3PUW E;  4MLV A;  4PET A;  1A54 A;  1ZBM A;  1B4Z A;  1VFE A;  3IOW A;  4P3L A;  5ELV A;  4OEN A;  4F22 A;  2OCU A;  3O6I A;  3LV0 A;  1D9V A;  4FIM A;  4OVS A;  3B6W A;  3BFT A;  2O69 A;  2RC9 A;  3H6W A;  2G29 A;  3OO6 A;  2WBD A;  2VD3 A;  4OMB A;  4ELQ A;  2UVH A;  4O7M A;  1KA0 A;  2AIX A;  2DP8 A;  2G93 A;  4HCY A;  5ET5 A;  2NOO A;  3IB1 A;  1M5B A;  2W7Y A;  1SW4 A;  1EYI A;  4YMB A;  2NWJ A;  3RGY A;  1M5E A;  5CM6 A;  4M1V A;  2DWI A;  2XXI A;  3QYT A;  2H5Y A;  1SI1 A;  2I0B A;  1CNQ A;  4N8Y A;  3GYY A;  1FBH A;  3A09 A;  4RYA A;  3MVX A;  4N6K A;  3HN0 A;  3T9V A;  4X48 A;  5L8D A;  4FEC A;  5IZ1 A;  1B1H A;  4Q0C A;  1XOC A;  4MHF A;  2DXY A;  2O51 A;  5K2Y A;  4DLD A;  3S9M C;  3EN3 A;  2A5S A;  2QS4 A;  3LSW A;  4O7I A;  2Y7P A;  1YTV A;  3PMW A;  3VV5 A;  2ANJ A;  4OVP A;  1Y3Q A;  3M3L A;  4NF8 B;  2ONK E;  1US4 A;  4U1O A;  1FPJ A;  1NFT A;  3BKI B;  3HV1 A;  3K00 A;  2OWZ A;  1P1Q A;  3CVG A;  4FEB A;  2ZNU A;  2F5X A;  4F18 A;  1MY2 A;  3RLF E;  1PB8 A;  2ZZX A;  1YAE A;  4P8B A;  2DVZ A;  4XF5 A;  1T0K A;  4ZEB A;  4C1T A;  1MPD A;  3SDF A;  4U4S A;  4GWS A;  4WKM A;  3RPL B;  3OEK A;  1N84 A;  1UIV A;  2OK2 A;  3PD8 A;  4PP0 A;  5CRY A;  2O7U A;  2V84 A;  5F1Q A;  2HHM A;  2ESN A;  4MJO A;  4HCW A;  2V93 A;  4Z0I A;  4I40 A;  3C32 A;  1IMA A;  5EHM A;  2JJK A;  1B40 A;  3MVY A;  1QGX A;  1P1W A;  1PDA A;  5TPA B;  1POT A;  4Q8R A;  3KEI A;  4GVO A;  3PTY A;  1D9Y A;  4F29 A;  2I4C A;  5I59 A;  4ND9 A;  3VFJ A;  3IOR A;  4GWZ A;  5H8S A;  1FQF A;  4OES A;  3U94 A;  3K6V A;  4IY6 A;  3HHF A;  3PUV E;  3FV2 A;  4O94 A;  4KPT A;  4PBQ A;  4JWX A;  1B52 A;  4RPO A;  1A40 A;  3FJM A;  4MH5 A;  3MQ9 A;  4RXL A;  2X7P A;  3G3J A;  4X9T A;  2Z22 A;  4TLM B;  2E0S A;  2Z8E A;  1I6B A;  3HPI A;  4KCC A;  4NMY A;  1MY0 A;  4PE5 B;  3MZ9 A;  4NHB A;  1Y3N A;  2AYS A;  3FZV A;  4ISU A;  3PUY E;  2H4I A;  3C36 A;  5H8F A;  1EZP A;  4BDN A;  2BJI A;  1MDP 1;  3PPR A;  3A3U A;  1N3X A;  4LZ7 A;  3TOD A;  3G7W A;  2ZXT A;  4WED A;  1B3L A;  4F3G A;  2XWK A;  1H76 A;  1ZIU A;  3MP6 A;  4GOT A;  1MQG A;  1JW4 A; 
#chains in the Genus database with same CATH homology
 2PMS A;  3CSG A;  4R74 A;  4R9F A;  3MUQ A;  4ZZE A;  4C1U A;  1B7Z A;  3O6G A;  3V83 A;  4MBP A;  4DIG A;  1F9B A;  3TCH A;  5AA2 B;  4L17 A;  5IKB A;  2DSF A;  2I3W A;  2ZYM A;  3QUJ A;  4KHZ E;  4LQ2 A;  3QIM A;  3TCG A;  1Y20 A;  1IEJ A;  3KSX A;  3SER A;  3E13 X;  1IIW A;  4YB7 A;  5AA2 D;  2HFB A;  1MXX A;  2Q2A A;  1MH3 A;  3M8U A;  3PD9 A;  2DQV A;  3IOT A;  3OSR A;  4U22 A;  1OLA A;  3LSL A;  2HZL A;  3TPA A;  4EXK A;  1R1N A;  3VVF A;  1MXU A;  3H06 B;  3SKP A;  4R73 A;  4EDP A;  4R6K A;  1H3D A;  4ELR A;  5B7D A;  1LCF A;  4ESW A;  3DP6 A;  2HEU A;  1TT1 A;  5HBC A;  2THI A;  1NH8 A;  4GL0 A;  4EF2 A;  4G8M A;  2V3Q A;  3IOV A;  2QMW A;  3RUM A;  1LB8 A;  2I49 A;  4OTE A;  3VLV A;  1FTJ A;  3M3K A;  3EF7 A;  3FUZ A;  5HM4 B;  4GRK A;  4YKP A;  2I0C A;  1XVX A;  1IXI A;  3IB2 A;  3MBP A;  1LFH A;  2XXT A;  5KCJ B;  4O3C A;  3K1M A;  1II5 A;  1LFI A;  1LAG E;  1QKA A;  1QUK A;  2ZMB A;  3CR9 A;  3IB0 A;  4WXJ A;  3QAX A;  3SEX A;  1Y1Z A;  2F78 A;  2P2A A;  4TLL B;  1B51 A;  3N26 A;  4ZEK A;  1TFD A;  3ECR A;  5TP9 B;  1HSJ A;  2QRY A;  4PFW A;  3RQT A;  3WAF A;  4IO3 A;  4ECF A;  4YAH X;  3CFL A;  3EQ1 A;  2UVG A;  5ICQ A;  3BBR A;  4U21 A;  4JSD A;  4QHQ A;  3H6V A;  1NNP A;  4P0G A;  3S2V A;  3MP1 A;  2IEE A;  3Q28 A;  2XXH A;  1GVC A;  2QS1 A;  4BDQ A;  1OLC A;  4H0W A;  4MFI A;  3CSB A;  1MY1 A;  5A5X B;  1A8E A;  3I5O A;  3GZG A;  3LUY A;  2QS3 A;  4Z7E A;  1M5C A;  1ANF A;  2XD3 A;  3MW0 A;  5DVF A;  1N7X A;  2PBW A;  5H8H B;  1ZLQ A;  2UVJ A;  2DWJ A;  3R26 A;  2R71 A;  1MG1 A;  1I6A A;  3LC8 A;  2H98 A;  4POX A;  3T9U A;  5EHS A;  1Q1K A;  2UYF A;  1FQA A;  4P11 A;  2QMX A;  3KBR A;  4EQ9 A;  5KZT A;  1LLS A;  3FXR A;  4JWY A;  1FTK A;  4EQB A;  5BWJ A;  1EZO A;  1NH7 A;  4QF9 A;  3PMV A;  2I58 A;  3TAJ A;  1AIV A;  2PT2 A;  4OFO A;  3T66 A;  1NMU A;  1XHY A;  3JV9 A;  4X1B A;  3N6T A;  1ELJ A;  5H8Q B;  4IB2 A;  2R9J A;  3ZKL A;  1P99 A;  3FJG A;  4G68 B;  4KYD A;  3SET A;  1BTJ A;  4I1D A;  4FE8 A;  2GH9 A;  1US5 A;  3GBB A;  5I56 B;  2QJE A;  4ZE9 A;  3B7D A;  2F6P A;  3CG1 A;  5H8N A;  2XX7 A;  1MM7 A;  2AL4 A;  2F6G A;  4R2B A;  4U1Z A;  3U92 A;  5AA3 A;  1XC1 A;  4NF6 B;  5DEX B;  5A5X A;  4LQ5 A;  1LB9 A;  1O64 A;  1TWY A;  2HXW A;  2OBG A;  3MJN A;  1NL5 A;  3KZG A;  4LVQ A;  1LAX A;  4MLQ A;  4OET A;  2I48 A;  5H8F B;  3PPN A;  4QFP A;  4F1V A;  3RPW A;  3VLU A;  1A7L A;  2DS9 A;  3K0V A;  1RKM A;  1CB6 A;  1DPP A;  3EHU A;  1USY E;  1YPN A;  1LAF E;  1USY H;  1AMF A;  4NTL A;  5DEX A;  4FOR A;  4ZEC A;  1VE4 A;  4EQ7 A;  2OWT A;  1S50 A;  3KG2 A;  4I9D A;  1UIU A;  4LP2 B;  4ZZA A;  1B5I A;  4WEP A;  1CE2 A;  1MM6 A;  2XXP A;  3MWB A;  5FHO A;  1LBB A;  3UGW A;  3G3K A;  1B05 A;  2DE4 A;  3C9H A;  4KFQ A;  1SQY A;  1Y4C A;  4NF5 B;  2XXU A;  1IZ1 A;  1EH3 A;  2P0S A;  4LZ5 A;  2ABH A;  2O1M A;  3I6V A;  3SEY A;  2DVC A;  1B3E A;  4EF1 A;  1SDX A;  3A3C A;  3RY3 A;  5AA4 A;  3FGS A;  1H44 A;  3C35 A;  1SD3 A;  1DPE A;  1RYO A;  3MZ1 A;  4RA1 A;  4N6P A;  4GL8 A;  4F1Y A;  3PUZ E;  5JEI A;  1Y9U A;  2OZZ A;  2PX1 A;  2RC8 A;  3G3I A;  3PMX A;  3VLW A;  2GHA A;  2F7A A;  3MAM A;  4YMA A;  4TQU Q;  3T96 B;  3DLN A;  2DXR A;  3FJ7 A;  4R9G A;  1L5T A;  4DXU A;  1B2H A;  1SBP A;  3N6U A;  4QFN A;  3T9H B;  2NVU B;  2H9B A;  4KI0 E;  1JVX A;  5AA1 A;  1B46 A;  3RT6 B;  4GLI A;  1O7T A;  3LSF B;  3TDJ A;  1H45 A;  1Z7M E;  3F11 A;  3Q29 A;  2ONR A;  3RN8 A;  4GWO A;  3SEW A;  3TYH A;  3PPP A;  3H3G A;  4EUO A;  4OFJ A;  3K1P A;  3ODB A;  4KQP A;  2QS2 A;  2R6G E;  4OHN A;  4GXA A;  3O9P A;  1MQH A;  2Z8D A;  3KSJ A;  1B5J A;  5L9O A;  2O68 A;  2ZYO A;  5ITP A;  1WOD A;  4NF8 A;  4TOZ A;  2LAO A;  3USD A;  1WVJ A;  1JEV A;  2IA4 A;  4KR5 A;  4ZE8 A;  3PV0 E;  5I2N A;  2FYI A;  2Q2C A;  2REG A;  1PEB A;  1LST A;  4AQ4 A;  3IJO B;  4GF8 A;  4C0R A;  4AB5 A;  3TUS A;  1FTL A;  5FHM A;  1B0H A;  3D4C A;  4F3B A;  5CBR A;  2NXO A;  1OVT A;  4QFO A;  4OVJ A;  5L9S A;  1PBQ A;  3B6Q A;  3H7M A;  1HSL A;  3K01 A;  1B58 A;  4G2Z A;  1N3W A;  3O6H A;  1GTK A;  3H4Z A;  1B9J A;  1ZMG A;  2KLF A;  3HCQ A;  3EHS A;  1DTZ A;  1GV8 A;  3C31 A;  2Z23 A;  2I6E A;  2DE2 A;  3O66 A;  3W15 C;  5CC2 A;  1QUI A;  3DM0 A;  1LBC A;  2ZNT A;  3FVN A;  1IXG A;  4R6H A;  4H65 A;  4BDO A;  3TTL A;  5H8H A;  2RCB A;  3K6U A;  3EHT A;  4JB7 A;  4ELO A;  1MQI A;  1SI0 A;  2FNC A;  2HCA A;  1SW2 A;  2VP1 A;  1DOT A;  3E9X A;  3FVO A;  4JSO A;  2O7I A;  1WDN A;  3FVK A;  3TEP A;  1O63 A;  1OVB A;  2X7Q A;  3V5A A;  5I58 B;  2QPQ A;  2RCA A;  1URS A;  1JW5 A;  4NF6 A;  3ONM A;  3TTN A;  2FA7 A;  1SVX B;  4ELP A;  3KN7 A;  3B6T A;  1IXC A;  3FXQ A;  3K1N A;  5K2X A;  3CFX A;  3MZB A;  1JNF A;  3OEM A;  2Y7R A;  1JEU A;  3T9X B;  1EZ9 A;  3M3F A;  3IOU A;  5I56 A;  1A55 A;  4QSC A;  4LA9 A;  1SW5 A;  4GIZ A;  4DDD A;  1MDQ A;  3KFM A;  3PU5 A;  1QUL A;  2VOZ A;  4DCY A;  3PUW E;  4N13 A;  2O6A A;  4DXC A;  1ZTY A;  4F2O A;  5H8N B;  5IAI A;  4LUB A;  4DZ1 A;  4RY1 A;  4MLV A;  3VVD A;  1D3K A;  4PET A;  1LCT A;  1MH4 A;  1N04 A;  1GR2 A;  1A54 A;  3OEL A;  4Q5T A;  3OEN A;  1ZBM A;  3DP4 A;  1OIB A;  3R7X A;  1PB9 A;  1B4Z A;  3WAE A;  1SYI A;  4FED A;  1VFE A;  3TMG A;  3THI A;  1QW0 A;  3IOW A;  1B7U A;  3QXM A;  5ELV A;  3K02 A;  3OD7 A;  4OEN A;  2UXA A;  3VVE A;  4F22 A;  2OCU A;  3O6I A;  4H5F A;  4JDF A;  1N7W A;  1AH5 A;  4K3F A;  4H8I A;  2B3F A;  1MS7 A;  1B3F A;  1D9V A;  3H6U A;  3KOS A;  4FIM A;  5KDT B;  4NE4 A;  4RNS A;  3FD3 A;  2I4B A;  5I57 B;  3B6W A;  3BFT A;  3IL1 B;  2O69 A;  4G68 A;  2RC9 A;  4H8J A;  4O3B A;  1KWH A;  4XXU A;  3H6W A;  2G29 A;  5AA4 B;  3GBA A;  3OO6 A;  2VD3 A;  1I6Q A;  2ZNS A;  1UTB A;  4OMB A;  4ELQ A;  2UVH A;  3PUX E;  3H6T A;  1VFD A;  4R75 A;  1DMB A;  1MY3 A;  1FQB A;  2AIX A;  3IX1 A;  1QVS A;  2PT1 A;  2DP8 A;  2XHD A;  4XKR A;  2XXR A;  5I57 A;  3N94 A;  2G93 A;  3L6G A;  4HCY A;  1VSO A;  2NOO A;  3IB1 A;  4IO5 A;  1M5B A;  2W7Y A;  1SW4 A;  4O3A A;  5M2V A;  3VDF A;  4E0W A;  3KJ7 A;  4GD5 A;  4F3S A;  1S7Y A;  1NNF A;  3FV1 A;  4LON B;  2NWJ A;  1ZKB A;  3RGY A;  1M5E A;  3UK4 A;  4YMB A;  5CM6 A;  4M1V A;  1MPB A;  4YB5 A;  3LSX A;  1XVY A;  3TKD A;  2DWI A;  1BIY A;  2XXI A;  3CI8 A;  2QL3 A;  4ZEF A;  1A8F A;  3QYT A;  4F2Q A;  3VXB A;  1I69 A;  4F31 B;  2H5Y A;  3G3H A;  1B3G A;  1SI1 A;  2I0B A;  1FQC A;  2OLB A;  3FVG A;  3KGC A;  4NF4 A;  1MPC A;  3IK6 B;  1UTH B;  3VE1 B;  3A09 A;  4RYA A;  3OOA A;  4BDM A;  5ISU A;  3TQL A;  1M5D A;  3MVX A;  2XXW A;  4OEU A;  1D4N A;  4XKQ A;  1MXY A;  5HPQ A;  4FAT A;  5I59 B;  5I58 A;  3HN0 A;  3FAT A;  4FAJ A;  3I3V A;  3Q27 A;  3RTF B;  3T9V A;  1JET A;  1S9T A;  2GRV A;  3GLB A;  3O97 A;  3QK6 A;  4H6D A;  4X48 A;  4YKI A;  5L8D A;  5I2K B;  5TPA A;  4LZ8 A;  1JVY A;  4FEC A;  5TU0 A;  1B1H A;  3CFZ A;  4Q0C A;  1XOC A;  3RT8 A;  1P1U A;  4OQO A;  1BLF A;  3Q26 A;  4G4P A;  2RC7 A;  4DE8 A;  4OEV A;  2Q8J A;  3R6U A;  3BFU A;  5CMC A;  2DXY A;  2O51 A;  5F7V A;  2DWH A;  5K2Y A;  2OWS A;  4DLD A;  3W9W A;  3P7I A;  1POY 1;  4X1D A;  3HO7 A;  5FHN A;  3TFL A;  5J1D A;  5CMM A;  5ITO A;  3EN3 A;  4YIC A;  4P0I A;  2A5S A;  4I62 A;  4IO2 A;  3S9M C;  4DXB A;  2QS4 A;  3KOT A;  1PB7 A;  3LSW A;  2Y84 A;  3U93 A;  3ILU B;  5LOM A;  2Y7P A;  1YTV A;  3ZKK A;  1HSE A;  4M4G A;  5CBS A;  3MVZ A;  5JK4 A;  3S9L C;  4QSE A;  4E0X A;  3PMW A;  3T22 A;  4ZED A;  4PFU A;  2HAV A;  2WKY A;  1LAH E;  2F97 A;  3PGF A;  4H1X A;  3UIF A;  1RYX A;  3VV5 A;  2ANJ A;  4GQO A;  1Y3Q A;  2DOJ A;  2YPN A;  3M3L A;  3MP8 A;  4NF8 B;  4U2R A;  3TEL A;  5DVJ A;  1MXZ A;  2ONK E;  1US4 A;  4U1O A;  1NFT A;  4UA8 A;  3W9V A;  3BKI B;  3HV1 A;  2B3B A;  3K00 A;  1P1Q A;  2ZYN A;  3OO8 A;  1URG A;  2GFE A;  2VGQ A;  5FTH A;  2O1L A;  3IAZ A;  3CVG A;  1AOV A;  3MPK A;  4HS7 A;  3TQW A;  1IXH A;  4IO7 A;  1MQD A;  4FEB A;  4G68 C;  1QJM A;  5KDT A;  1TFA A;  2XXX A;  2QSX A;  3H03 A;  3MPL A;  3OXN A;  2DWA A;  4BDL A;  2ZNU A;  4NF4 B;  3ZSF A;  3TTM A;  1J1N A;  2F5X A;  3C4M A;  3PPQ A;  4F18 A;  1MY2 A;  2REJ A;  3CG3 A;  4JBZ A;  3RLF E;  1B4H A;  4EXL A;  4KYS A;  1PB8 A;  1URD A;  3RNN A;  1H43 A;  4RK9 A;  3QUF A;  4BLA A;  1YAE A;  1MXV A;  1LGB C;  2DVZ A;  3HST A;  3UP9 A;  3O2A A;  4YB6 A;  2XXQ A;  1P1O A;  4NWC A;  5EYF A;  1T0K A;  3UOR A;  4ZEB A;  1Y3P A;  4C1T A;  2F7C A;  2Y7K A;  3IO4 A;  5KCJ A;  1MPD A;  3SDF A;  2XXY A;  4R6Y A;  3S4U A;  4U4S A;  1JQF A;  4OER A;  3K4U A;  4AB6 A;  4WKM A;  2Y7W A;  2PVU A;  4H67 A;  4YKJ A;  3RTW B;  1IIT A;  3OEK A;  1MY4 A;  5AA2 A;  2RKM A;  1N84 A;  1UIV A;  1VR5 A;  4OZ9 A;  2RIN A;  2OK2 A;  2P1S A;  4NED A;  3PD8 A;  4PP0 A;  5CRY A;  2O7U A;  2V84 A;  2Y7I A;  5F1Q A;  2D5W A;  2ESN A;  3FAS A;  4RPN A;  2HZK A;  2RF1 A;  5L9M A;  4HCW A;  2V3T A;  1OQH A;  4OXV A;  2YJP A;  2VHA A;  3CIJ A;  4G8H A;  2V93 A;  3OMB A;  5CI5 A;  4Z0I A;  4QSD A;  2Q88 A;  3CRB A;  2CMO A;  4G77 A;  3S9E A;  3V89 B;  1M5F A;  3C32 A;  2D3I A;  2F7B A;  2ZYK A;  3PPO A;  3TTR A;  4F3P A;  4NF5 A;  5EHM A;  3V8X B;  1B40 A;  5CMK A;  3MVY A;  5CMB A;  1QUJ A;  4NWD A;  2GHB A;  1P1W A;  1PDA A;  1SW1 A;  2A5T B;  4IO6 A;  3C33 A;  1N76 A;  3N5L A;  1NKX A;  4I8C A;  2UYE A;  3IO6 A;  4ZEI A;  4POW A;  1TXF A;  5TPA B;  3SEV A;  1B3H A;  1A99 A;  1POT A;  3KEI A;  3K6W A;  4DCX A;  4Q8R A;  4GVO A;  2ALU A;  1D9Y A;  3FIR A;  3FXU A;  2I4C A;  3DEL B;  3JYR A;  4G8N A;  2HAU A;  4F29 A;  5I59 A;  3G3G A;  4HTG A;  4KCD A;  1Y1M A;  4XKP A;  4ND9 A;  1FCK A;  3VFJ A;  2XXV A;  3OSQ A;  1UTH A;  1R9Q A;  3KN3 A;  1B7H A;  1MXW A;  3IOR A;  2AL5 A;  3D4G A;  4JWO A;  2CZL A;  2YLN A;  5DT6 A;  1FQF A;  5H8S A;  5I2K A;  4OES A;  1XT8 A;  1NNK A;  1UTB B;  2UVI A;  1AL3 A;  2F8D A;  4PQJ A;  3K2D A;  4PFY A;  1OQG A;  3U94 A;  1DTG A;  3K6V A;  3AXF A;  4QRZ A;  4IY6 A;  1PC3 A;  1FQE A;  5I84 A;  4R72 A;  3HHF A;  3PUV E;  3FV2 A;  1XS5 A;  1B0L A;  4KPT A;  1Q35 A;  4ZS9 A;  3GXA A;  4JWX A;  1B52 A;  1ZU0 A;  1DSN A;  3U8Q A;  1FW0 A;  2E1S A;  4RPO A;  5DTB A;  1A40 A;  4UAC A;  2DYX A;  4H5G A;  3U1O A;  2V3U A;  3S9N C;  5I2N B;  5ICT A;  2NUV A;  3MC2 A;  3FJM A;  4N07 A;  1BKA A;  3TTK A;  4MH5 A;  1B5H A;  1R6Z A;  3MQ9 A;  4RK2 A;  3T93 B;  2HQ0 A;  1IUD A;  3OO7 A;  4YU0 A;  4U23 A;  4RXL A;  2X7P A;  3IJX B;  3JZJ A;  4OWD A;  3G3J A;  1B1X A;  4X9T A;  1JW1 A;  3KN8 A;  2Z22 A;  4HW8 A;  3DP8 A;  4TLM B;  2E0S A;  4IGT A;  2Z8E A;  2I3V A;  3MVW A;  1ZJL A;  3KJT A;  4ONY A;  3ZS6 A;  1PBP A;  2H25 A;  4R2F A;  5DVI A;  4ZDM A;  1EU8 A;  4PFT A;  1I6B A;  3UN6 A;  1BP5 A;  1YCJ A;  2ONS A;  3HPI A;  3C34 A;  4KCC A;  4QFL A;  4QFK A;  4JXI A;  3U72 A;  4NMY A;  5AE4 A;  4F39 A;  4XTC Q;  5TP9 A;  5BUU A;  3LR1 A;  1ATG A;  4GFR A;  5JTY B;  1MY0 A;  2OJT A;  3G3F A;  3MZ9 A;  4IO4 A;  1Y3N A;  4OYV A;  4PE5 B;  2AYS A;  4THI A;  3FZV A;  4FJP A;  4YZZ A;  5DYH A;  3TZA A;  2Z8F A;  4ISU A;  3VXC A;  1MQJ A;  4BDR A;  2Q9T A;  3PUY E;  2Q89 A;  2XX9 A;  4MF3 A;  4U4X A;  2H4I A;  2PYY A;  5FTI A;  2O84 X;  3C36 A;  5H8F A;  4Q30 B;  2V25 A;  1FQD A;  4LAT A;  3ILT B;  1EZP A;  4F19 A;  1GGG A;  2H99 A;  4RJZ A;  1B6H A;  1N0T A;  2X26 A;  3L6H A;  4OFL A;  1SYH A;  4BDN A;  3Q25 A;  3SEU A;  3LBS A;  5JTY A;  2D21 A;  1MDP 1;  2DE3 A;  2M8C A;  2XD2 A;  1FTO A;  3PPR A;  1LFG A;  1NNT A;  4GXS B;  2F35 A;  3A3U A;  2BJJ X;  1Z7N E;  1N3X A;  2A5T A;  3O29 A;  4LZ7 A;  1FTM A;  1IQ7 A;  3E4R A;  4IY5 A;  2VD2 A;  2F34 A;  3TOD A;  3G7W A;  5H8Q A;  3HHG A;  4ESX A;  2ZXT A;  4WED A;  4F1U A;  3UA8 A;  1B3L A;  4F3G A;  1UQW A;  3TCF A;  1H76 A;  2B65 A;  1MRP A;  1ZIU A;  1B32 A;  1R9L A;  3E3K A;  3O28 A;  4YKK A;  4IGR A;  4XKN A;  1P1N A;  4XIG Q;  3OO9 A;  3MP6 A;  1OMP A;  1Y4T A;  2F36 A;  1QKB A;  4GOT A;  4KD5 A;  3IR1 A;  5B70 A;  2XX8 A;  1MQG A;  3QSL A;  3K6X A;  4KYE A;  3SES A;  3EPE A;  1JW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...