1NNFA

Crystal structure analysis of haemophlius influenzae ferric-ion binding protein h9q mutant form
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
308
structure length
308
Chain Sequence
DITVYNGQQKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Iron-utilization periplasmic protein
publication title High Resolution Structure of an Alternate Form of the Ferric ion Binding Protein from Haemophilus influenzae
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 114
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2003-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nnfA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nnfA01
2F7BA 3EHUA 1UQWA 3O2AA 3O29A 4JWXA 3SETA 2UYFA 2REGA 1SVXB 1QKAA 4E0XA 1NMUA 5ICTA 3RUMA 5EHSA 2DYXA 3Q27A 1LAFE 4N6PA 3IJXB 3EF7A 3TEPA 5DVFA 4C1TA 2YJPA 3MW0A 3IORA 1IEJA 1LBCA 1GR2A 2PMSA 5KCJA 1B3EA 3MP1A 1OLCA 1XOCA 4RK2A 3FVKA 3TTLA 2VGQA 1B6HA 2E0SA 2ZYMA 4KR5A 4YB6A 4Z7EA 3O6GA 5DEXA 5B7DA 1JW1A 1Z7ME 1FQFA 4WXJA 4HCYA 1ZLQA 4RY1A 2F6GA 3VVFA 3MAMA 3BBRA 4GXSB 5DVJA 1JQFA 4DLDA 2DVZA 4U21A 3ZKKA 4JBZA 3DP4A 2HAUA 1JW5A 1OVTA 3QUFA 2HQ0A 2HAVA 3C32A 5M2VA 2PT2A 3LSWA 1POTA 1DPPA 1FTMA 2ZNTA 4GXAA 5HPQA 4Z0IA 1P99A 4FIMA 2XXHA 1QJMA 3QSLA 4JWYA 1H43A 3O97A 4GQOA 1BLFA 3GXAA 3GBBA 1B5HA 2F35A 3A09A 1QUIA 5I58A 3TPAA 3T9XB 1FTLA 2QMWA 2Q9TA 3KSXA 3N6TA 4FATA 3FJMA 4YMAA 2V93A 2DXYA 1MXYA 4MBPA 1DMBA 3OXNA 4BLAA 4QFNA 1S50A 2RC7A 3RNNA 3MZBA 1IZ1A 3OD7A 4DZ1A 1BTJA 5CBSA 2VD2A 3FVGA 3CSGA 4IO5A 4MF3A 2DE2A 2Z8EA 4KHZE 3MPKA 4BDQA 5CMBA 2I0BA 3FGSA 4LQ5A 4ZEDA 2Q88A 1RYOA 5I2NA 3K1PA 4PFWA 3IB1A 4NF8A 4JDFA 3H6VA 4OYVA 1QVSA 3MVZA 4X1BA 1B4ZA 1B5IA 3CR9A 4ZDMA 5H8QA 5I57B 3IR1A 5L9OA 2RC8A 4YZZA 3N5LA 4WEDA 3MC2A 2QS1A 3PMXA 5L9MA 5FHMA 2V3UA 1M5BA 3U93A 3KOSA 4DDDA 1Y3QA 2PT1A 4PFYA 3K02A 4MLVA 1OMPA 3H6TA 3HHFA 4IGTA 2O1MA 4F31B 1URSA 5CI5A 4ND9A 4LATA 4POWA 5JTYA 1ZJLA 1H45A 3QIMA 4F18A 3G3HA 3W9VA 5CMMA 4LA9A 3RN8A 4GVOA 5I59A 1ZBMA 2Z22A 1B46A 1LCTA 1B52A 3K6WA 3PPOA 1LSTA 4QSCA 1OQHA 1LLSA 3E4RA 3FZVA 4BDRA 5HM4B 3HPIA 1QKBA 4F19A 1ZTYA 3C36A 3VLUA 3VFJA 1Y3NA 1MPCA 2ZYNA 4OERA 3K6UA 3FD3A 2XXWA 3T93B 1JVXA 5DTBA 1A8EA 2H98A 3IOTA 4U1ZA 3TKDA 3CVGA 2B65A 3M3LA 2ZYKA 3EHTA 3MQ9A 4XKNA 3OO6A 2XXIA 3MP6A 1N0TA 3O6IA 3PUXE 4LZ7A 5I2KA 4H1XA 3I3VA 3FASA 1XVXA 2QS2A 2UVGA 3ZS6A 2F97A 2QMXA 4ZE8A 4MLQA 4EQ9A 1NH7A 5KZTA 1TFAA 4RK9A 4ELPA 4YU0A 3CFZA 1USYH 3VXCA 3H7MA 1LBBA 3DLNA 2QS3A 2Y7PA 3PD9A 1OLAA 1B0HA 5LOMA 4THIA 4RPNA 4ZZEA 3FATA 3I6VA 3G3IA 5H8SA 3KN7A 1IQ7A 4EQ7A 3LR1A 1B3LA 1FW0A 1QUKA 3TELA 3BKIB 1H3DA 3VVEA 3UGWA 1T0KA 4H8JA 1I6QA 3PPRA 1D4NA 3H3GA 1NNFA 4POXA 1SW4A 2F7CA 4EDPA 3IAZA 1QULA 4JWOA 3S9MC 5H8HB 3VXBA 4BDNA 1B1HA 4GL0A 4ZZAA 3OO7A 4O3BA 1NH8A 3SEVA 1IUDA 1DSNA 5JK4A 3W9WA 3TODA 3MUQA 3GBAA 3QUJA 4KPTA 1UTHA 2ANJA 4G8MA 2HZKA 1MXVA 1Z7NE 4DE8A 1LFHA 3KBRA 3IB0A 4NE4A 1OVBA 3PV0E 3OO8A 1QW0A 2H25A 5L9SA 2ESNA 3OEKA 2ABHA 4IO4A 3O9PA 2ONKE 4UACA 3OMBA 4U23A 4NMYA 1JNFA 1R1NA 3MWBA 1M5EA 2Y7IA 4NF6B 3HV1A 4R73A 4F3PA 2Z23A 1XS5A 4R6KA 2HXWA 1XC1A 4RA1A 2RKMA 5AA2D 1USYE 3IO6A 1AL3A 2VP1A 1MDQA 4YB7A 2UVJA 1O63A 2X7QA 1SD3A 4G68A 2WKYA 5A5XA 4EUOA 2I49A 3KFMA 2QSXA 3O6HA 3FXRA 2QPQA 1TT1A 4M4GA 3HN0A 4PQJA 3TQLA 1SW1A 1FQEA 3K00A 3UP9A 4ELRA 2Q8JA 1NL5A 4X48A 1LAXA 3PUYE 2OZZA 1N7XA 1Y20A 1N7WA 2Q2AA 3IL1B 3UORA 3A3CA 4PFTA 3AXFA 2R6GE 2DE4A 3FVNA 3N94A 2DWAA 4ISUA 2H99A 4G4PA 4HW8A 1WVJA 4QRZA 1P1NA 1Y3PA 4IY6A 1XHYA 1PEBA 5DYHA 3R6UA 5TU0A 1UIUA 4PE5B 4ZEBA 3T96B 1LB9A 2NOOA 3TDJA 4LONB 3U72A 2G29A 4I1DA 4G8HA 2XXVA 3S4UA 2V3TA 1MY4A 4C0RA 1MY2A 2I4CA 1JW4A 4H65A 2XX9A 2NVUB 1FTOA 5ISUA 2RCAA 5I57A 2DP8A 1VFDA 1HSLA 1XT8A 4P0IA 3K01A 3VVDA 2NWJA 1IXCA 3MVWA 5FHNA 3QYTA 1CE2A 4YKIA 3HO7A 3TUSA 5ITPA 3CG3A 3MVXA 1S7YA 4N13A 1M5FA 5H8FB 4GOTA 1N76A 4H5GA 2F8DA 4WEPA 2HCAA 1HSJA 5KDTB 4X9TA 4KCDA 4DCXA 3RGYA 2V3QA 3BFUA 1VR5A 4KYEA 2Y7RA 4LQ2A 1RKMA 1A40A 5AA2A 3KOTA 4LVQA 1VE4A 2HZLA 1B9JA 1JETA 2ZNUA 3G3KA 3UIFA 4OVJA 1MH3A 4YICA 4ZS9A 3S9EA 2RF1A 3K1MA 3VDFA 4ELOA 1MY0A 2DWHA 4AQ4A 3CG1A 3EPEA 3OEMA 5FHOA 1BIYA 4HS7A 3RT6B 2PVUA 4O3AA 1NKXA 1PB8A 3IOWA 1JVYA 1QUJA 3K4UA 2XXPA 3V83A 3T9HB 2GH9A 2W7YA 3GZGA 1Q1KA 4R72A 1J1NA 5DEXB 4OTEA 1NNKA 1A8FA 1B3FA 1NNPA 1B58A 4KYDA 2XXYA 3T9VA 3CSBA 1POY1 3B6WA 2XXQA 3BFTA 2F7AA 3KJTA 4PETA 4BDMA 2H5YA 5TPAA 2I58A 1MXZA 1ANFA 1O64A 4YMBA 1D9YA 2F78A 4OENA 1HSEA 5TP9A 1SBPA 2I3WA 2THIA 1ZMGA 2HEUA 3TQWA 1SW5A 4TLMB 2I48A 1B3GA 1MG1A 4WKMA 5AA4A 2CMOA 1SI1A 3SERA 2Y7KA 4GD5A 4HCWA 5H8NA 3RTWB 3OOAA 4NWCA 2A5TB 4R2BA 3FVOA 4KFQA 1MQGA 3H6UA 4FORA 3C31A 4OZ9A 1H44A 1B32A 4GRKA 1I6AA 3D4GA 4GWOA 3G3FA 1M5DA 1MRPA 3M3KA 2ZNSA 5AE4A 3V89B 1MQHA 3UK4A 3D4CA 3C4MA 5EHMA 1ZIUA 5JEIA 2XHDA 4IY5A 4OETA 3V8XB 4ZECA 4P11A 1FTKA 1ZU0A 1EZ9A 5L8DA 5ITOA 5F7VA 2HFBA 1US4A 1II5A 3Q29A 3KZGA 5CBRA 3T22A 3IOVA 4NF5B 2GFEA 1AOVA 1OIBA 3IO4A 4FEBA 4XKQA 5I56B 1MM7A 3E3KA 3V5AA 3RLFE 3C33A 1N3XA 1S9TA 5I2NB 3MZ9A 4NF8B 5K2YA 3SEXA 3IOUA 3OSQA 1YAEA 3FIRA 3KJ7A 1O7TA 3SEWA 2G93A 3SKPA 4PFUA 3RTFB 1JEUA 1Q35A 3IJOB 4FAJA 4AB5A 1RYXA 3HHGA 4MFIA 1GGGA 1SW2A 4NF6A 1URDA 1AIVA 3USDA 3EN3A 4GFRA 4FJPA 4NEDA 2DOJA 1EU8A 4G2ZA 1MS7A 3T66A 3UA8A 3G3GA 1SQYA 4GF8A 4RYAA 4YKPA 3PMVA 2LAOA 2B3FA 3T9UA 2O7UA 2P1SA 3TCFA 2F5XA 1LCFA 2QS4A 4Q30B 2FA7A 4IO6A 5FTIA 2DS9A 5I59B 1SYHA 2YPNA 1MM6A 1P1WA 2DVCA 1UTBB 2H9BA 5I84A 1MPDA 3TAJA 4FEDA 2O1LA 1A7LA 2ZMBA 3Q26A 2F36A 1A54A 1FQBA 3G3JA 3ILUB 5ICQA 1B40A 1Y4CA 1B5JA 2DQVA 1MY3A 4F1VA 4C1UA 3TYHA 2AYSA 3EHSA 3TFLA 1GTKA 4KQPA 4LZ5A 1A99A 3H4ZA 2DSFA 4H0WA 2DXRA 2OLBA 5EYFA 4DCYA 1UIVA 3LBSA 4KI0E 2ONSA 3ZSFA 4IB2A 2F34A 3N26A 2XD2A 4IGRA 4OXVA 2OCUA 3SDFA 2Y7WA 3RPWA 1N04A 1P1QA 3IX1A 4RXLA 3TTRA 2F6PA 3C34A 2E1SA 5DVIA 2I6EA 1I69A 2D5WA 2ONRA 2I4BA 1IXGA 1L5TA 3P7IA 3QXMA 4YB5A 1P1OA 1JEVA 1B4HA 2RC9A 3WAEA 1B1XA 3VLVA 2R71A 4EQBA 2XXUA 1SI0A 4GLIA 4F1UA 3OELA 2BJJX 3O66A 4O3CA 4F3SA 1LAHE 2Q2CA 4LP2B 3HSTA 5BUUA 2UXAA 1LB8A 1EZOA 4F3BA 3RY3A 5AA3A 3M8UA 1PC3A 5KDTA 4ESWA 2VD3A 2I0CA 3FV1A 4OFOA 3OENA 1VFEA 4ZEKA 5CC2A 1YPNA 4QF9A 3S9NC 2ZXTA 4BDLA 4U22A 3A3UA 3B7DA 1UTHB 5IAIA 3K1NA 1NNTA 2M8CA 2DWIA 3K2DA 1PDAA 3F11A 1H76A 2XXRA 3KG2A 1PBPA 4LUBA 3EQ1A 4OEUA 1MH4A 2I3VA 1B2HA 1TXFA 3CFLA 1GV8A 1FQAA 3VE1B 1LGBC 3PMWA 2FYIA 1M5CA 3FJGA 1A55A 4FE8A 3IB2A 4U4XA 2OJTA 3E9XA 5B70A 3MBPA 4QHQA 3KGCA 3U92A 2X26A 5CM6A 1MXXA 3W15C 2QJEA 4QSDA 5CMCA 4I8CA 4Q8RA 1LAGE 1R9LA 2Q89A 1FQDA 1Y1MA 4XIGQ 4NF4B 4XKPA 3S9LC 4G77A 3K6VA 2DWJA 2KLFA 2V25A 4G68B 2O6AA 3TTMA 1R9QA 5A5XB 5IKBA 3MZ1A 4EXLA 3FJ7A 2V84A 4R74A 1TWYA 4GL8A 1BP5A 4E0WA 2QRYA 5ELVA 2A5TA 3S2VA 3PUWE 1B3HA 2Y84A 2D21A 3DM0A 4KYSA 3H6WA 4R75A 3IK6B 3TTKA 3TCGA 1LFGA 4R9GA 1WDNA 4DXCA 1Y9UA 4ECFA 4H8IA 1P1UA 2FNCA 2XD3A 3LUYA 1I6BA 4F1YA 1XVYA 2PBWA 2PYYA 1MDP1 5FTHA 1FTJA 1DTGA 4TOZA 3TMGA 1R6ZA 2IA4A 4NF5A 5KCJB 2Z8DA 1B7HA 3ZKLA 4OHNA 2GRVA 2R9JA 5I56A 1PBQA 1F9BA 1EZPA 4H67A 3U94A 1AH5A 3SEYA 3Q28A 3TZAA 2ZYOA 3M3FA 1WODA 4YKJA 4ELQA 1DOTA 4OMBA 2VHAA 4R9FA 4U4SA 3H03A 3FUZA 1Y4TA 3DP6A 4EF1A 4HTGA 3R26A 3I5OA 4F22A 1FQCA 1SYIA 4F29A 4R6HA 3GLBA 3N6UA 4X1DA 4TLLB 4F3GA 3UN6A 3VV5A 4PP0A 1IIWA 4BDOA 2O51A 3OO9A 3PUZE 4OFJA 3LSLA 5K2XA 3L6GA 4DXUA 2OBGA 4RNSA 2YLNA 5AA1A 3QAXA 5I58B 4YAHX 5H8HA 1B7ZA 4JB7A 4JSDA 3VLWA 4L17A 1KWHA 3PGFA 5DT6A 4F39A 4U1OA 1UTBA 1VSOA 3B6TA 1PB9A 4R6YA 4H5FA 2X7PA 2PX1A 3KEIA 4JXIA 5AA2B 1D9VA 3SESA 3C35A 2O69A 4QFKA 4G8NA 3MPLA 3ONMA 3LSFB 2IEEA 2OWTA 2QL3A 3ILTB 4ONYA 2GHBA 2NUVA 2OK2A 4JSOA 1LFIA 1SDXA 1CB6A 1DTZA 2NXOA 4EXKA 2B3BA 4F2QA 2XXXA 4GIZA 5HBCA 4ZEIA 1MXUA 3H06B 2D3IA 2REJA 4R2FA 1NFTA 2DE3A 2RINA 3LSXA 1IITA 5J1DA 4K3FA 4ZE9A 3C9HA 4Q0CA 4QFOA 3MJNA 3PU5A 3QK6A 4QFPA 2AIXA 3PPQA 1MY1A 5H8QB 2XX8A 3CFXA 1B7UA 1IXHA 1ZKBA 3SEUA 4RPOA 3JYRA 4OESA 5TPAB 3U8QA 1MXWA 4G68C 2VOZA 3RQTA 3U1OA 1FCKA 4DIGA 1BKAA 5TP9B 3PUVE 1YTVA 5JTYB 3FXUA 4IO3A 1GVCA 1URGA 4UA8A 1ELJA 4RJZA 1B0LA 5F1QA 1MQJA 3LC8A 2AL4A 5AA4B 2Z8FA 5BWJA 4M1VA 5H8NB 4IO2A 1D3KA 4FECA 1TFDA 2CZLA 2O84X 2OWSA 3G7WA 2UVHA 4KD5A 4YKKA 4QSEA 4QFLA 3MVYA 2O68A 2XXTA 1US5A 4XXUA 4OEVA 4ZEFA 2ALUA 3PD8A 3K0VA 3ECRA 3TCHA 5CRYA 1AMFA 4ESXA 3HCQA 1PB7A 2AL5A 2O7IA 4NTLA 2RCBA 1ATGA 1N3WA 2XX7A 4H6DA 3PPPA 3CIJA 4KCCA 2A5SA 3JZJA 2GHAA 3DP8A 4N07A 3CI8A 5I2KB 4AB6A 1OQGA 3CRBA 3DELB 3PPNA 3JV9A 1DPEA 4OWDA 3B6QA 4I62A 3FV2A 4I9DA 1IXIA 3Q25A 4Q5TA 4MH5A 3KN8A 4NWDA 3OSRA 3ODBA 1MPBA 1Y1ZA 1B05A 2H4IA 4OFLA 2UVIA 3WAFA 3L6HA 3FXQA 4XTCQ 3TTNA 3KSJA 3R7XA 4F2OA 1MQIA 4XKRA 4U2RA 5CMKA 2P2AA 4EF2A 1MQDA 1YCJA 2P0SA 4IO7A 4NF4A 3K6XA 3RT8A 5H8FA 4TQUQ 3KN3A 3MP8A 3E13X 2UYEA 1N84A 4DXBA 3O28A 4LZ8A 4OQOA 1EH3A 4P0GA 1B51A 3THIA
chains in the Genus database with same CATH superfamily
2F7BA 5LTCA 3EHUA 1UQWA 3O2AA 1FPBA 3O29A 4JWXA 3SETA 2UYFA 1LBVA 2REGA 1SVXB 1QKAA 4E0XA 1NMUA 4OVPA 2KQZA 5ICTA 3RUMA 5EHSA 2DYXA 3Q27A 1LAFE 4N6PA 1NV6A 3IJXB 3EF7A 3TEPA 1JP4A 5DVFA 2XA5A 4C1TA 2YJPA 3MW0A 3IORA 4MEVA 1IEJA 1FRPA 1LBCA 1GR2A 2PMSA 2WEFA 5KCJA 1B3EA 3MP1A 1OLCA 1XOCA 4OA4A 4RK2A 3FVKA 3TTLA 2VGQA 1B6HA 2E0SA 2ZYMA 4KR5A 4YB6A 4Z7EA 3O6GA 5DEXA 5B7DA 1JW1A 1Z7ME 1FQFA 1NUXA 4WXJA 1EYJA 4HCYA 1ZLQA 4RY1A 2F6GA 4PAKA 3VVFA 4MX6A 3MAMA 3BBRA 4GXSB 5DVJA 1JQFA 4DLDA 2DVZA 4PC9A 4U21A 3ZKKA 4JBZA 3DP4A 2HAUA 1JW5A 1OVTA 3QUFA 2HQ0A 2HAVA 3C32A 5M2VA 2PT2A 3LSWA 1POTA 1DPPA 2XWVA 1INPA 1FTMA 2ZNTA 4GXAA 5HPQA 4Z0IA 1P99A 4FIMA 2XXHA 1QJMA 2MKZA 3QSLA 5ET5A 4JWYA 1H43A 3O97A 4GQOA 1BLFA 3GXAA 3GBBA 2P3NA 1B5HA 2F35A 3A09A 1QUIA 5I58A 3TPAA 3T9XB 2DDKA 1FTLA 3FBPA 2QMWA 2Q9TA 1FSAA 3KSXA 3N6TA 4FATA 3FJMA 4YMAA 2V93A 2DXYA 3RPLA 1MXYA 4MBPA 1DMBA 3OXNA 3QMFA 4BLAA 4QFNA 1S50A 2RC7A 3RNNA 3MZBA 1IZ1A 3OD7A 1LBXA 1NV1A 4DZ1A 4PFBA 1BTJA 5I7IA 5CBSA 2VD2A 3FVGA 1YZ0A 3CSGA 4IO5A 4MF3A 2DE2A 2Z8EA 4KHZE 3FXBA 3MPKA 4BDQA 5CMBA 2I0BA 3FGSA 4LQ5A 4I3YA 4ZEDA 2Q88A 1RYOA 1DBZA 5I2NA 3K1PA 4PFWA 3IB1A 4NF8A 4JDFA 3H6VA 4OYVA 2F3BA 4JVIA 5IZ3A 1QVSA 3MVZA 4X1BA 2HPGA 1B4ZA 1K9YA 1B5IA 3CR9A 4ZDMA 5H8QA 2XWOA 5I57B 3IR1A 5L9OA 2RC8A 4YZZA 2CEYA 4O8MA 3N5LA 4FBPA 4WEDA 3MC2A 2QS1A 3PMXA 5L9MA 5FHMA 2V3UA 1M5BA 3U93A 3KOSA 4DDDA 1Y3QA 2PT1A 4PFYA 3K02A 1FJ9A 4MLVA 1OMPA 3H6TA 3HHFA 3D1RA 4IGTA 2O1MA 4F31B 4P9KA 1URSA 5CI5A 4ND9A 4LATA 4POWA 5JTYA 1ZJLA 3LV0A 1H45A 3QIMA 4F18A 3G3HA 3W9VA 5CMMA 4LA9A 3RN8A 4GVOA 5I59A 1ZBMA 2Z22A 1B46A 2FIXA 1LCTA 4HE0A 1B52A 3K6WA 3PPOA 4GX6A 1LSTA 4QSCA 1OQHA 1LLSA 2PFYA 3E4RA 3FZVA 4BDRA 5HM4B 3HPIA 1QKBA 4F19A 1ZTYA 3C36A 3VLUA 5EQ8A 3VFJA 1Y3NA 1MPCA 4PGPA 2ZYNA 4OERA 3K6UA 3FD3A 5J16A 1KA1A 2XXWA 3T93B 1JVXA 5DTBA 1A8EA 4MJOA 2FVZA 2H98A 1RDXA 3IOTA 4U1ZA 4PFRA 3TKDA 2QVUA 3CVGA 2B65A 3M3LA 2ZYKA 3EHTA 3MQ9A 4XKNA 1AWBA 3OO6A 2XXIA 3MP6A 1N0TA 3O6IA 3PUXE 4I40A 4LZ7A 5I2KA 4H1XA 3I3VA 3FASA 4MHFA 1XVXA 2QS2A 2UVGA 3ZS6A 2F97A 2QMXA 4ZE8A 4MLQA 4EQ9A 1NH7A 5KZTA 1D9QA 1TFAA 4RK9A 4ELPA 4YU0A 3CFZA 1USYH 4HE2A 3VXCA 3H7MA 2FBPA 1LBBA 3DLNA 2QS3A 2Y7PA 3PD9A 1OLAA 1B0HA 5LOMA 4THIA 2WYPA 4RPNA 4ZZEA 2FIEA 3FATA 3I6VA 2L5VA 3G3IA 4PBHA 5H8SA 3KN7A 1IQ7A 4EQ7A 3LR1A 1B3LA 1FW0A 1QUKA 3TELA 3BKIB 5IM2A 1H3DA 3VVEA 3UGWA 2CZKA 1T0KA 4H8JA 1I6QA 3PPRA 1D4NA 3H3GA 1NNFA 4POXA 1SW4A 2CEXA 2F7CA 4EDPA 3IAZA 1QULA 4JWOA 3S9MC 5H8HB 4OVRA 2WBBA 3VXBA 4BDNA 1B1HA 4GL0A 4ZZAA 3OO7A 4O3BA 1NH8A 3SEVA 1IUDA 1DSNA 2PCRA 5JK4A 3W9WA 3TODA 3MUQA 3GBAA 3QUJA 4KPTA 1UTHA 2ANJA 4G8MA 2HZKA 1FPFA 1MXVA 1Z7NE 4DE8A 4NF0A 1LFHA 3KBRA 3IB0A 4NE4A 1OVBA 5IGAA 3PV0E 3OO8A 1QW0A 2H25A 5L9SA 2ESNA 2PFZA 3OEKA 2ABHA 1NV2A 4IO4A 3O9PA 4MIJA 4MCOA 2ONKE 4GX4A 1IMBA 4UACA 3OMBA 1FPDA 3BIGA 4U23A 4NMYA 1JNFA 1KA0A 1R1NA 3MWBA 1M5EA 2Y7IA 5EQ9A 4NF6B 3HV1A 4R73A 5IZ1A 4F3PA 2Z23A 1XS5A 4R6KA 2HXWA 1XC1A 4RA1A 2RKMA 5AA2D 1USYE 3IO6A 1AL3A 2VP1A 1MDQA 4YB7A 2UVJA 1O63A 2X7QA 1SD3A 4G68A 2WKYA 5A5XA 4EUOA 4X8RA 2I49A 3KFMA 2QSXA 4O7MA 3O6HA 3FXRA 2QPQA 3KC1A 1TT1A 4NN3A 4M4GA 3HN0A 4PQJA 3TQLA 1SW1A 1FQEA 3K00A 3UP9A 4ELRA 1LEVA 1LBZA 4NX1A 2Q8JA 3ROJA 1NL5A 4X48A 1LAXA 2GQ1A 5EQAA 3PUYE 1NV7A 2OZZA 1N7XA 1Y20A 1N7WA 2Q2AA 3IL1B 3UORA 3A3CA 4N4UA 4MMPA 4PFTA 3AXFA 2R6GE 2DE4A 3FVNA 3N94A 2DWAA 3BIHA 4ISUA 2H99A 4PDHA 4G4PA 3IFAA 4HW8A 1WVJA 4QRZA 1P1NA 1Y3PA 4IY6A 1FBCA 1XHYA 4NAPA 5T3JA 1NV5A 4N91A 1PEBA 5DYHA 3R6UA 5TU0A 1UIUA 4PE5B 4ZEBA 3T96B 1LB9A 2NOOA 3TDJA 4LONB 3U72A 2G29A 1DK4A 4I1DA 1RDZA 4G8HA 2XXVA 3S4UA 2V3TA 2WYKA 1MY4A 4C0RA 1NV0A 1MY2A 1FBGA 2I4CA 1JW4A 4GX3A 4H65A 1Q9DA 2XWKA 2XX9A 2NVUB 1FTOA 5ISUA 4NQ8A 2WX9A 2RCAA 5I57A 2DP8A 1G0HA 1VFDA 1HSLA 1XT8A 4DI3D 4P0IA 3K01A 3VVDA 2NWJA 1IXCA 3MVWA 4HE1A 5FHNA 3QYTA 1CE2A 4YKIA 3HO7A 3TUSA 3E78A 5ITPA 3CG3A 3MVXA 1S7YA 4N13A 1M5FA 2B4MA 5H8FB 4GOTA 1N76A 4H5GA 2F8DA 4WEPA 2HXRA 2HCAA 1HSJA 5KDTB 4X9TA 4KCDA 4DCXA 1FPGA 4MAGA 3RGYA 2V3QA 3BFUA 1VR5A 4KYEA 4XFEA 2Y7RA 4LQ2A 1RKMA 1A40A 5AA2A 3KOTA 4N8GA 4LVQA 1VE4A 2HZLA 1B9JA 1JETA 5I5PA 2ZNUA 3G3KA 3UIFA 4OVJA 1MH3A 4YICA 4ZS9A 3S9EA 1NV4A 4P3LA 2RF1A 3K1MA 3VDFA 2R8TA 4ELOA 5EQ7A 1MY0A 2DWHA 4AQ4A 3CG1A 3EPEA 3OEMA 5FHOA 1BIYA 4HS7A 3RT6B 2HHMA 2PVUA 4O3AA 1NKXA 4NG7A 1PB8A 3IOWA 1JVYA 1QUJA 3K4UA 2XXPA 3V83A 3T9HB 2GH9A 3T0JA 2W7YA 4N8YA 3GZGA 1Q1KA 4GWYA 4R72A 1J1NA 5DEXB 1NUWA 4PFIA 4OTEA 1NNKA 1A8FA 1B3FA 1NNPA 1B58A 4KYDA 2XXYA 3T9VA 3CSBA 1POY1 3B6WA 3E79A 2XXQA 3BFTA 2QVRA 2F7AA 3KJTA 4PETA 4BDMA 2H5YA 5TPAA 2I58A 1MXZA 1ANFA 1O64A 4YMBA 1D9YA 1FPLA 2F78A 4OENA 1HSEA 5TP9A 1SBPA 2I3WA 2THIA 1ZMGA 2HEUA 5ESYA 3TQWA 1SW5A 4TLMB 1IMCA 1K9ZA 2I48A 1B3GA 1MG1A 4WKMA 5AA4A 2CMOA 4I3EA 1SI1A 4G61A 3SERA 2Y7KA 4GD5A 1VDWA 4HCWA 5H8NA 1RDYA 3RTWB 3OOAA 4NWCA 2A5TB 4P8BA 4R2BA 3FVOA 4KFQA 1MQGA 3U65A 3H6UA 4FORA 3C31A 4OZ9A 1H44A 1B32A 4GRKA 1I6AA 3D4GA 4GWOA 5I3SA 3G3FA 1M5DA 1MRPA 3M3KA 2ZNSA 5AE4A 3V89B 1MQHA 3UK4A 5A5LA 3D4CA 3C4MA 1FBPA 5EHMA 1ZIUA 5JEIA 2XHDA 4N15A 4IY5A 4OETA 3V8XB 4ZECA 4P11A 1FTKA 1ZU0A 1EZ9A 5L8DA 5EYHA 5ITOA 5F7VA 2HFBA 1US4A 1II5A 3Q29A 3KZGA 5CBRA 3T22A 3IOVA 4NF5B 2GFEA 1AOVA 1OIBA 3IO4A 3GYYA 1YXIA 4FEBA 4XKQA 5I56B 1MM7A 3E3KA 3V5AA 3RLFE 3C33A 1N3XA 1S9TA 5I2NB 3MZ9A 4NF8B 4PE3A 5K2YA 3SEXA 2CZHA 3IOUA 3OSQA 5IZ3B 1YAEA 3FIRA 3KJ7A 1O7TA 3SEWA 2G93A 3SKPA 4PFUA 3RTFB 1JEUA 1Q35A 3IJOB 4FAJA 4AB5A 1RYXA 2QVVA 4DI4B 3HHGA 4H46A 4AS4A 4MFIA 1GGGA 1SW2A 1IMEA 4NF6A 1URDA 1AIVA 3USDA 3EN3A 4GFRA 3RYDA 4FJPA 4NEDA 2DOJA 1EU8A 4JVDA 4G2ZA 5FBPA 1MS7A 3T66A 3UA8A 3G3GA 2OX3A 1SQYA 4GF8A 4RYAA 4YKPA 3PMVA 2LAOA 3T1BA 2Y5LA 2B3FA 3T9UA 4KXPA 2O7UA 2P1SA 3TCFA 4NHBA 2F5XA 1LCFA 2QS4A 4Q30B 2FA7A 4IO6A 5FTIA 2DS9A 5I59B 1SYHA 2YPNA 1MM6A 4N81A 4PAFA 1P1WA 2DVCA 1UTBB 2H9BA 5I84A 1MPDA 3TAJA 4FEDA 2O1LA 4N6KA 1A7LA 2ZMBA 3Q26A 2F36A 1A54A 1FQBA 3G3JA 3ILUB 5ICQA 1B40A 1Y4CA 1B5JA 2DQVA 1CNQA 1MY3A 4F1VA 4C1UA 3TYHA 2AYSA 3EHSA 3TFLA 1GTKA 4KQPA 4LZ5A 1A99A 1NV3A 3H4ZA 2DSFA 4PDDA 4H0WA 2DXRA 2OLBA 5EYFA 3MSTA 4DCYA 1UIVA 3LBSA 4KI0E 4PAIA 2ONSA 3ZSFA 1FPJA 4IB2A 2F34A 3N26A 2XD2A 4IGRA 4OXVA 4HXVA 2OCUA 3SDFA 2Y7WA 3RPWA 1N04A 4N6DA 1G0IA 1P1QA 2VPNA 2QFLA 3IX1A 4RXLA 3TTRA 2F6PA 3C34A 2E1SA 5DVIA 2I6EA 5ET7A 1I69A 4N17A 2D5WA 2ONRA 1KZ8A 2I4BA 1IXGA 1L5TA 3P7IA 3QXMA 4YB5A 1P1OA 1JEVA 1B4HA 1NUZA 4GBVA 2RC9A 3WAEA 1B1XA 2WBDA 3VLVA 2R71A 4EQBA 2XXUA 1SI0A 4GLIA 4F1UA 3OELA 2BJJX 3O66A 2Q74A 4O3CA 4F3SA 1LAHE 2Q2CA 4LP2B 3HSTA 5BUUA 2UXAA 1LB8A 1EZOA 4F3BA 3RY3A 5AA3A 1NUYA 3M8UA 2ZZWA 1PC3A 4QXDA 5KDTA 4ESWA 2VD3A 2I0CA 3FV1A 4OFOA 3MYUA 3OENA 1VFEA 4ZEKA 5CC2A 1YPNA 4QF9A 3S9NC 2ZXTA 4BDLA 4U22A 3A3UA 3B7DA 1UTHB 5IAIA 2B4LA 3K1NA 1NNTA 2M8CA 2DWIA 3K2DA 1PDAA 2CZIA 3F11A 1IMFA 1H76A 2XXRA 3KG2A 4AS5A 1PBPA 3IFCA 4LUBA 3EQ1A 4OEUA 1MH4A 2I3VA 4OVQA 1B2HA 1TXFA 3CFLA 5ET6A 1DCUA 4PF6A 4GWWA 1LBYA 1GV8A 1QGXA 1FQAA 3VE1B 2JJKA 1LGBC 3PMWA 2FYIA 1M5CA 3FJGA 1A55A 4FE8A 3IB2A 4U4XA 1LBWA 2OJTA 3E9XA 5B70A 4MNIA 3MBPA 4QHQA 3KGCA 3U92A 2X26A 5CM6A 3PTYA 1MXXA 3W15C 2QJEA 4QSDA 5CMCA 4I8CA 4Q8RA 1LAGE 1R9LA 2Q89A 3LUZA 2KR0A 1FQDA 1Y1MA 4XIGQ 4NF4B 4XKPA 3S9LC 2F3DA 4G77A 4PGNA 3K6VA 2DWJA 2KLFA 2V25A 4G68B 2O6AA 3TTMA 3SZPA 1R9QA 5A5XB 3CHGA 3MZ1A 5IKBA 4EXLA 3FJ7A 2V84A 4O7IA 4R74A 1TWYA 4GL8A 1BP5A 4E0WA 2QRYA 5ELVA 2A5TA 3EKIA 3S2VA 3PUWE 1B3HA 1FBHA 1YYZA 2D21A 2Y84A 4MNPA 3DM0A 4KYSA 3H6WA 4R75A 3IK6B 3TTKA 3TCGA 1LFGA 4P1LA 4R9GA 2V4CA 1WDNA 4DXCA 1Y9UA 4ECFA 4H8IA 1P1UA 2FNCA 2XD3A 3LUYA 1I6BA 4F1YA 1XVYA 2PBWA 2PYYA 1MDP1 1SPIA 5FTHA 1FTJA 1DTGA 4TOZA 3TMGA 1R6ZA 2IA4A 4NF5A 5KCJB 2Z8DA 1B7HA 3ZKLA 4OHNA 2GRVA 2R9JA 5I56A 1PBQA 1F9BA 1EZPA 4H67A 3U94A 1AH5A 3SEYA 3Q28A 1FBEA 1XI6A 3TZAA 2ZYOA 4H45A 4QBAA 3M3FA 1WODA 4YKJA 4ELQA 1FPIA 1DOTA 4PBQA 4OMBA 2XWIA 2VHAA 3B8BA 4R9FA 4U4SA 3H03A 3FUZA 1Y4TA 3DP6A 4EF1A 4HTGA 3R26A 1FJ6A 1IMDA 3I5OA 4F22A 1FQCA 1SYIA 4F29A 4R6HA 3GLBA 4PCDA 3A29A 4PTKA 3N6UA 4X1DA 5F24A 4TLLB 4F3GA 3UN6A 3VV5A 4PP0A 1IIWA 2ZZVA 4BDOA 4GWZA 2O51A 3OO9A 3PUZE 4OFJA 3LSLA 5K2XA 3L6GA 4DXUA 2OBGA 4RNSA 5IZZA 2YLNA 5AA1A 3QAXA 5I58B 4YAHX 5H8HA 1B7ZA 2OWZA 5ET8A 4JB7A 4JSDA 3VLWA 4L17A 1KWHA 3PGFA 5DT6A 4F39A 4U1OA 1UTBA 1VSOA 3B6TA 1PB9A 4GWUA 4R6YA 4H5FA 2X7PA 2PX1A 3KEIA 4JXIA 5AA2B 1D9VA 3SESA 3C35A 2O69A 3RPLB 4QFKA 4G8NA 3MPLA 1BK4A 3ONMA 3LSFB 2IEEA 2OWTA 2QL3A 3ILTB 4ONYA 2GHBA 2NUVA 2OK2A 4JSOA 1LFIA 1SDXA 5EYGA 1CB6A 1DTZA 4P1EA 2VPOA 2NXOA 4EXKA 2B3BA 4F2QA 1FPEA 5DW8A 2XXXA 3ISPA 4GIZA 5HBCA 4ZEIA 1MXUA 3H06B 2D3IA 2REJA 4PF8A 4R2FA 1NFTA 2DE3A 2RINA 3LSXA 4JVCA 2ZZXA 1IITA 5J1DA 4K3FA 4ZE9A 3C9HA 4Q0CA 4QFOA 3MJNA 3PU5A 3QK6A 4QFPA 2AIXA 3PPQA 1MY1A 5H8QB 1FTAA 2XX8A 3CFXA 1B7UA 1IXHA 1ZKBA 3SEUA 4RPOA 1NI9A 3JYRA 4X04A 1FBFA 5LDZA 4OESA 5TPAB 3U8QA 1IMAA 3B50A 1MXWA 4G68C 2VOZA 3RQTA 4UABA 3U1OA 1FCKA 2Q8MA 4DIGA 1BKAA 5TP9B 3PUVE 4XEQA 1YTVA 5JTYB 3FXUA 4IO3A 1GVCA 1URGA 4UA8A 1ELJA 4RJZA 1B0LA 5F1QA 1MQJA 3LC8A 2AL4A 5AA4B 4GWXA 2Z8FA 5BWJA 3KC0A 4M1VA 4MNCA 1EYIA 5H8NB 4IO2A 4NGUA 1D3KA 4FECA 1TFDA 2CZLA 2O84X 4O94A 2OWSA 3G7WA 2UVHA 2Y5KA 4KD5A 4YKKA 4QSEA 4QFLA 4OVSA 3MVYA 3KBZA 2O68A 2XXTA 1US5A 4XXUA 4OEVA 4ZEFA 2ALUA 3PD8A 3K0VA 3ECRA 2P3VA 3TCHA 4P47A 3HFUA 4GWSA 5CRYA 1AMFA 4ESXA 3HCQA 1PB7A 2AL5A 2O7IA 4NTLA 2RCBA 1ATGA 1N3WA 2XX7A 4H6DA 3PPPA 3CIJA 4KCCA 2A5SA 3JZJA 2GHAA 3DP8A 4N07A 3CI8A 5I2KB 4AB6A 1OQGA 3CRBA 3DELB 3PPNA 3JV9A 1DPEA 2FHYA 4OWDA 3B6QA 4I62A 4OANA 3FV2A 4I9DA 4XF5A 1IXIA 3Q25A 4Q5TA 4OVTA 4MH5A 3KN8A 4NWDA 1EYKA 3OSRA 3ODBA 4P56A 1MPBA 1Y1ZA 1B05A 2BJIA 2H4IA 4OFLA 2UVIA 4LN5A 3WAFA 3L6HA 3NOHA 4IR8A 3FXQA 4XTCQ 3TTNA 4GBWA 3KSJA 3R7XA 4F2OA 1MQIA 4XKRA 4U2RA 5CMKA 2P2AA 4EF2A 1MQDA 1YCJA 2P0SA 4IO7A 4NF4A 3K6XA 3RT8A 5H8FA 4TQUQ 2XXKA 3KN3A 3MP8A 3E13X 2UYEA 1FPKA 1N84A 4DXBA 3O28A 1FBDA 4LZ8A 4OQOA 1EH3A 4P0GA 1B51A 3THIA 2VT5A
chains in the Genus database with same CATH topology
2F7BA 3EHUA 1UQWA 3O2AA 3O29A 4JWXA 3SETA 2UYFA 2REGA 1SVXB 1QKAA 4E0XA 1NMUA 5ICTA 3RUMA 5EHSA 2DYXA 3Q27A 1LAFE 4N6PA 3IJXB 3EF7A 3TEPA 5DVFA 4C1TA 2YJPA 3MW0A 3IORA 1IEJA 1LBCA 1GR2A 2PMSA 5KCJA 1B3EA 3MP1A 1OLCA 1XOCA 4RK2A 3FVKA 3TTLA 2VGQA 1B6HA 2E0SA 2ZYMA 4KR5A 4YB6A 4Z7EA 3O6GA 5DEXA 5B7DA 1JW1A 1Z7ME 1FQFA 4WXJA 4HCYA 1ZLQA 4RY1A 2F6GA 3VVFA 3MAMA 3BBRA 4GXSB 5DVJA 1JQFA 4DLDA 2DVZA 4U21A 3ZKKA 4JBZA 3DP4A 2HAUA 1JW5A 1OVTA 3QUFA 2HQ0A 2HAVA 3C32A 5M2VA 2PT2A 3LSWA 1POTA 1DPPA 1FTMA 2ZNTA 4GXAA 5HPQA 4Z0IA 1P99A 4FIMA 2XXHA 1QJMA 3QSLA 4JWYA 1H43A 3O97A 4GQOA 1BLFA 3GXAA 3GBBA 1B5HA 2F35A 3A09A 1QUIA 5I58A 3TPAA 3T9XB 1FTLA 2QMWA 2Q9TA 3KSXA 3N6TA 4FATA 3FJMA 4YMAA 2V93A 2DXYA 1MXYA 4MBPA 1DMBA 3OXNA 4BLAA 4QFNA 1S50A 2RC7A 3RNNA 3MZBA 1IZ1A 3OD7A 4DZ1A 1BTJA 5CBSA 2VD2A 3FVGA 3CSGA 4IO5A 4MF3A 2DE2A 2Z8EA 4KHZE 3MPKA 4BDQA 5CMBA 2I0BA 3FGSA 4LQ5A 4ZEDA 2Q88A 1RYOA 5I2NA 3K1PA 4PFWA 3IB1A 4NF8A 4JDFA 3H6VA 4OYVA 1QVSA 3MVZA 4X1BA 1B4ZA 1B5IA 3CR9A 4ZDMA 5H8QA 5I57B 3IR1A 5L9OA 2RC8A 4YZZA 3N5LA 4WEDA 3MC2A 2QS1A 3PMXA 5L9MA 5FHMA 2V3UA 1M5BA 3U93A 3KOSA 4DDDA 1Y3QA 2PT1A 4PFYA 3K02A 4MLVA 1OMPA 3H6TA 3HHFA 4IGTA 2O1MA 4F31B 1URSA 5CI5A 4ND9A 4LATA 4POWA 5JTYA 1ZJLA 1H45A 3QIMA 4F18A 3G3HA 3W9VA 5CMMA 4LA9A 3RN8A 4GVOA 5I59A 1ZBMA 2Z22A 1B46A 1LCTA 1B52A 3K6WA 3PPOA 1LSTA 4QSCA 1OQHA 1LLSA 3E4RA 3FZVA 4BDRA 5HM4B 3HPIA 1QKBA 4F19A 1ZTYA 3C36A 3VLUA 3VFJA 1Y3NA 1MPCA 2ZYNA 4OERA 3K6UA 3FD3A 2XXWA 3T93B 1JVXA 5DTBA 1A8EA 2H98A 3IOTA 4U1ZA 3TKDA 3CVGA 2B65A 3M3LA 2ZYKA 3EHTA 3MQ9A 4XKNA 3OO6A 2XXIA 3MP6A 1N0TA 3O6IA 3PUXE 4LZ7A 5I2KA 4H1XA 3I3VA 3FASA 1XVXA 2QS2A 2UVGA 3ZS6A 2F97A 2QMXA 4ZE8A 4MLQA 4EQ9A 1NH7A 5KZTA 1TFAA 4RK9A 4ELPA 4YU0A 3CFZA 1USYH 3VXCA 3H7MA 1LBBA 3DLNA 2QS3A 2Y7PA 3PD9A 1OLAA 1B0HA 5LOMA 4THIA 4RPNA 4ZZEA 3FATA 3I6VA 3G3IA 5H8SA 3KN7A 1IQ7A 4EQ7A 3LR1A 1B3LA 1FW0A 1QUKA 3TELA 3BKIB 1H3DA 3VVEA 3UGWA 1T0KA 4H8JA 1I6QA 3PPRA 1D4NA 3H3GA 1NNFA 4POXA 1SW4A 2F7CA 4EDPA 3IAZA 1QULA 4JWOA 3S9MC 5H8HB 3VXBA 4BDNA 1B1HA 4GL0A 4ZZAA 3OO7A 4O3BA 1NH8A 3SEVA 1IUDA 1DSNA 5JK4A 3W9WA 3TODA 3MUQA 3GBAA 3QUJA 4KPTA 1UTHA 2ANJA 4G8MA 2HZKA 1MXVA 1Z7NE 4DE8A 1LFHA 3KBRA 3IB0A 4NE4A 1OVBA 3PV0E 3OO8A 1QW0A 2H25A 5L9SA 2ESNA 3OEKA 2ABHA 4IO4A 3O9PA 2ONKE 4UACA 3OMBA 4U23A 4NMYA 1JNFA 1R1NA 3MWBA 1M5EA 2Y7IA 4NF6B 3HV1A 4R73A 4F3PA 2Z23A 1XS5A 4R6KA 2HXWA 1XC1A 4RA1A 2RKMA 5AA2D 1USYE 3IO6A 1AL3A 2VP1A 1MDQA 4YB7A 2UVJA 1O63A 2X7QA 1SD3A 4G68A 2WKYA 5A5XA 4EUOA 2I49A 3KFMA 2QSXA 3O6HA 3FXRA 2QPQA 1TT1A 4M4GA 3HN0A 4PQJA 3TQLA 1SW1A 1FQEA 3K00A 3UP9A 4ELRA 2Q8JA 1NL5A 4X48A 1LAXA 3PUYE 2OZZA 1N7XA 1Y20A 1N7WA 2Q2AA 3IL1B 3UORA 3A3CA 4PFTA 3AXFA 2R6GE 2DE4A 3FVNA 3N94A 2DWAA 4ISUA 2H99A 4G4PA 4HW8A 1WVJA 4QRZA 1P1NA 1Y3PA 4IY6A 1XHYA 1PEBA 5DYHA 3R6UA 5TU0A 1UIUA 4PE5B 4ZEBA 3T96B 1LB9A 2NOOA 3TDJA 4LONB 3U72A 2G29A 4I1DA 4G8HA 2XXVA 3S4UA 2V3TA 1MY4A 4C0RA 1MY2A 2I4CA 1JW4A 4H65A 2XX9A 2NVUB 1FTOA 5ISUA 2RCAA 5I57A 2DP8A 1VFDA 1HSLA 1XT8A 4P0IA 3K01A 3VVDA 2NWJA 1IXCA 3MVWA 5FHNA 3QYTA 1CE2A 4YKIA 3HO7A 3TUSA 5ITPA 3CG3A 3MVXA 1S7YA 4N13A 1M5FA 5H8FB 4GOTA 1N76A 4H5GA 2F8DA 4WEPA 2HCAA 1HSJA 5KDTB 4X9TA 4KCDA 4DCXA 3RGYA 2V3QA 3BFUA 1VR5A 4KYEA 2Y7RA 4LQ2A 1RKMA 1A40A 5AA2A 3KOTA 4LVQA 1VE4A 2HZLA 1B9JA 1JETA 2ZNUA 3G3KA 3UIFA 4OVJA 1MH3A 4YICA 4ZS9A 3S9EA 2RF1A 3K1MA 3VDFA 4ELOA 1MY0A 2DWHA 4AQ4A 3CG1A 3EPEA 3OEMA 5FHOA 1BIYA 4HS7A 3RT6B 2PVUA 4O3AA 1NKXA 1PB8A 3IOWA 1JVYA 1QUJA 3K4UA 2XXPA 3V83A 3T9HB 2GH9A 2W7YA 3GZGA 1Q1KA 4R72A 1J1NA 5DEXB 4OTEA 1NNKA 1A8FA 1B3FA 1NNPA 1B58A 4KYDA 2XXYA 3T9VA 3CSBA 1POY1 3B6WA 2XXQA 3BFTA 2F7AA 3KJTA 4PETA 4BDMA 2H5YA 5TPAA 2I58A 1MXZA 1ANFA 1O64A 4YMBA 1D9YA 2F78A 4OENA 1HSEA 5TP9A 1SBPA 2I3WA 2THIA 1ZMGA 2HEUA 3TQWA 1SW5A 4TLMB 2I48A 1B3GA 1MG1A 4WKMA 5AA4A 2CMOA 1SI1A 3SERA 2Y7KA 4GD5A 4HCWA 5H8NA 3RTWB 3OOAA 4NWCA 2A5TB 4R2BA 3FVOA 4KFQA 1MQGA 3H6UA 4FORA 3C31A 4OZ9A 1H44A 1B32A 4GRKA 1I6AA 3D4GA 4GWOA 3G3FA 1M5DA 1MRPA 3M3KA 2ZNSA 5AE4A 3V89B 1MQHA 3UK4A 3D4CA 3C4MA 5EHMA 1ZIUA 5JEIA 2XHDA 4IY5A 4OETA 3V8XB 4ZECA 4P11A 1FTKA 1ZU0A 1EZ9A 5L8DA 5ITOA 5F7VA 2HFBA 1US4A 1II5A 3Q29A 3KZGA 5CBRA 3T22A 3IOVA 4NF5B 2GFEA 1AOVA 1OIBA 3IO4A 4FEBA 4XKQA 5I56B 1MM7A 3E3KA 3V5AA 3RLFE 3C33A 1N3XA 1S9TA 5I2NB 3MZ9A 4NF8B 5K2YA 3SEXA 3IOUA 3OSQA 1YAEA 3FIRA 3KJ7A 1O7TA 3SEWA 2G93A 3SKPA 4PFUA 3RTFB 1JEUA 1Q35A 3IJOB 4FAJA 4AB5A 1RYXA 3HHGA 4MFIA 1GGGA 1SW2A 4NF6A 1URDA 1AIVA 3USDA 3EN3A 4GFRA 4FJPA 4NEDA 2DOJA 1EU8A 4G2ZA 1MS7A 3T66A 3UA8A 3G3GA 1SQYA 4GF8A 4RYAA 4YKPA 3PMVA 2LAOA 2B3FA 3T9UA 2O7UA 2P1SA 3TCFA 2F5XA 1LCFA 2QS4A 4Q30B 2FA7A 4IO6A 5FTIA 2DS9A 5I59B 1SYHA 2YPNA 1MM6A 1P1WA 2DVCA 1UTBB 2H9BA 5I84A 1MPDA 3TAJA 4FEDA 2O1LA 1A7LA 2ZMBA 3Q26A 2F36A 1A54A 1FQBA 3G3JA 3ILUB 5ICQA 1B40A 1Y4CA 1B5JA 2DQVA 1MY3A 4F1VA 4C1UA 3TYHA 2AYSA 3EHSA 3TFLA 1GTKA 4KQPA 4LZ5A 1A99A 3H4ZA 2DSFA 4H0WA 2DXRA 2OLBA 5EYFA 4DCYA 1UIVA 3LBSA 4KI0E 2ONSA 3ZSFA 4IB2A 2F34A 3N26A 2XD2A 4IGRA 4OXVA 2OCUA 3SDFA 2Y7WA 3RPWA 1N04A 1P1QA 3IX1A 4RXLA 3TTRA 2F6PA 3C34A 2E1SA 5DVIA 2I6EA 1I69A 2D5WA 2ONRA 2I4BA 1IXGA 1L5TA 3P7IA 3QXMA 4YB5A 1P1OA 1JEVA 1B4HA 2RC9A 3WAEA 1B1XA 3VLVA 2R71A 4EQBA 2XXUA 1SI0A 4GLIA 4F1UA 3OELA 2BJJX 3O66A 4O3CA 4F3SA 1LAHE 2Q2CA 4LP2B 3HSTA 5BUUA 2UXAA 1LB8A 1EZOA 4F3BA 3RY3A 5AA3A 3M8UA 1PC3A 5KDTA 4ESWA 2VD3A 2I0CA 3FV1A 4OFOA 3OENA 1VFEA 4ZEKA 5CC2A 1YPNA 4QF9A 3S9NC 2ZXTA 4BDLA 4U22A 3A3UA 3B7DA 1UTHB 5IAIA 3K1NA 1NNTA 2M8CA 2DWIA 3K2DA 1PDAA 3F11A 1H76A 2XXRA 3KG2A 1PBPA 4LUBA 3EQ1A 4OEUA 1MH4A 2I3VA 1B2HA 1TXFA 3CFLA 1GV8A 1FQAA 3VE1B 1LGBC 3PMWA 2FYIA 1M5CA 3FJGA 1A55A 4FE8A 3IB2A 4U4XA 2OJTA 3E9XA 5B70A 3MBPA 4QHQA 3KGCA 3U92A 2X26A 5CM6A 1MXXA 3W15C 2QJEA 4QSDA 5CMCA 4I8CA 4Q8RA 1LAGE 1R9LA 2Q89A 1FQDA 1Y1MA 4XIGQ 4NF4B 4XKPA 3S9LC 4G77A 3K6VA 2DWJA 2KLFA 2V25A 4G68B 2O6AA 3TTMA 1R9QA 5A5XB 5IKBA 3MZ1A 4EXLA 3FJ7A 2V84A 4R74A 1TWYA 4GL8A 1BP5A 4E0WA 2QRYA 5ELVA 2A5TA 3S2VA 3PUWE 1B3HA 2Y84A 2D21A 3DM0A 4KYSA 3H6WA 4R75A 3IK6B 3TTKA 3TCGA 1LFGA 4R9GA 1WDNA 4DXCA 1Y9UA 4ECFA 4H8IA 1P1UA 2FNCA 2XD3A 3LUYA 1I6BA 4F1YA 1XVYA 2PBWA 2PYYA 1MDP1 5FTHA 1FTJA 1DTGA 4TOZA 3TMGA 1R6ZA 2IA4A 4NF5A 5KCJB 2Z8DA 1B7HA 3ZKLA 4OHNA 2GRVA 2R9JA 5I56A 1PBQA 1F9BA 1EZPA 4H67A 3U94A 1AH5A 3SEYA 3Q28A 3TZAA 2ZYOA 3M3FA 1WODA 4YKJA 4ELQA 1DOTA 4OMBA 2VHAA 4R9FA 4U4SA 3H03A 3FUZA 1Y4TA 3DP6A 4EF1A 4HTGA 3R26A 3I5OA 4F22A 1FQCA 1SYIA 4F29A 4R6HA 3GLBA 3N6UA 4X1DA 4TLLB 4F3GA 3UN6A 3VV5A 4PP0A 1IIWA 4BDOA 2O51A 3OO9A 3PUZE 4OFJA 3LSLA 5K2XA 3L6GA 4DXUA 2OBGA 4RNSA 2YLNA 5AA1A 3QAXA 5I58B 4YAHX 5H8HA 1B7ZA 4JB7A 4JSDA 3VLWA 4L17A 1KWHA 3PGFA 5DT6A 4F39A 4U1OA 1UTBA 1VSOA 3B6TA 1PB9A 4R6YA 4H5FA 2X7PA 2PX1A 3KEIA 4JXIA 5AA2B 1D9VA 3SESA 3C35A 2O69A 4QFKA 4G8NA 3MPLA 3ONMA 3LSFB 2IEEA 2OWTA 2QL3A 3ILTB 4ONYA 2GHBA 2NUVA 2OK2A 4JSOA 1LFIA 1SDXA 1CB6A 1DTZA 2NXOA 4EXKA 2B3BA 4F2QA 2XXXA 4GIZA 5HBCA 4ZEIA 1MXUA 3H06B 2D3IA 2REJA 4R2FA 1NFTA 2DE3A 2RINA 3LSXA 1IITA 5J1DA 4K3FA 4ZE9A 3C9HA 4Q0CA 4QFOA 3MJNA 3PU5A 3QK6A 4QFPA 2AIXA 3PPQA 1MY1A 5H8QB 2XX8A 3CFXA 1B7UA 1IXHA 1ZKBA 3SEUA 4RPOA 3JYRA 4OESA 5TPAB 3U8QA 1MXWA 4G68C 2VOZA 3RQTA 3U1OA 1FCKA 4DIGA 1BKAA 5TP9B 3PUVE 1YTVA 5JTYB 3FXUA 4IO3A 1GVCA 1URGA 4UA8A 1ELJA 4RJZA 1B0LA 5F1QA 1MQJA 3LC8A 2AL4A 5AA4B 2Z8FA 5BWJA 4M1VA 5H8NB 4IO2A 1D3KA 4FECA 1TFDA 2CZLA 2O84X 2OWSA 3G7WA 2UVHA 4KD5A 4YKKA 4QSEA 4QFLA 3MVYA 2O68A 2XXTA 1US5A 4XXUA 4OEVA 4ZEFA 2ALUA 3PD8A 3K0VA 3ECRA 3TCHA 5CRYA 1AMFA 4ESXA 3HCQA 1PB7A 2AL5A 2O7IA 4NTLA 2RCBA 1ATGA 1N3WA 2XX7A 4H6DA 3PPPA 3CIJA 4KCCA 2A5SA 3JZJA 2GHAA 3DP8A 4N07A 3CI8A 5I2KB 4AB6A 1OQGA 3CRBA 3DELB 3PPNA 3JV9A 1DPEA 4OWDA 3B6QA 4I62A 3FV2A 4I9DA 1IXIA 3Q25A 4Q5TA 4MH5A 3KN8A 4NWDA 3OSRA 3ODBA 1MPBA 1Y1ZA 1B05A 2H4IA 4OFLA 2UVIA 3WAFA 3L6HA 3FXQA 4XTCQ 3TTNA 3KSJA 3R7XA 4F2OA 1MQIA 4XKRA 4U2RA 5CMKA 2P2AA 4EF2A 1MQDA 1YCJA 2P0SA 4IO7A 4NF4A 3K6XA 3RT8A 5H8FA 4TQUQ 3KN3A 3MP8A 3E13X 2UYEA 1N84A 4DXBA 3O28A 4LZ8A 4OQOA 1EH3A 4P0GA 1B51A 3THIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F7B A;  3EHU A;  1UQW A;  3O2A A;  3O29 A;  4JWX A;  3SET A;  2UYF A;  2REG A;  1SVX B;  1QKA A;  4E0X A;  1NMU A;  5ICT A;  3RUM A;  5EHS A;  2DYX A;  3Q27 A;  1LAF E;  4N6P A;  3IJX B;  3EF7 A;  3TEP A;  5DVF A;  4C1T A;  2YJP A;  3MW0 A;  3IOR A;  1IEJ A;  1LBC A;  1GR2 A;  2PMS A;  5KCJ A;  1B3E A;  3MP1 A;  1OLC A;  1XOC A;  4RK2 A;  3FVK A;  3TTL A;  2VGQ A;  1B6H A;  2E0S A;  2ZYM A;  4KR5 A;  4YB6 A;  4Z7E A;  3O6G A;  5DEX A;  5B7D A;  1JW1 A;  1Z7M E;  1FQF A;  4WXJ A;  4HCY A;  1ZLQ A;  4RY1 A;  2F6G A;  3VVF A;  3MAM A;  3BBR A;  4GXS B;  5DVJ A;  1JQF A;  4DLD A;  2DVZ A;  4U21 A;  3ZKK A;  4JBZ A;  3DP4 A;  2HAU A;  1JW5 A;  1OVT A;  3QUF A;  2HQ0 A;  2HAV A;  3C32 A;  5M2V A;  2PT2 A;  3LSW A;  1POT A;  1DPP A;  1FTM A;  2ZNT A;  4GXA A;  5HPQ A;  4Z0I A;  1P99 A;  4FIM A;  2XXH A;  1QJM A;  3QSL A;  4JWY A;  1H43 A;  3O97 A;  4GQO A;  1BLF A;  3GXA A;  3GBB A;  1B5H A;  2F35 A;  3A09 A;  1QUI A;  5I58 A;  3TPA A;  3T9X B;  1FTL A;  2QMW A;  2Q9T A;  3KSX A;  3N6T A;  4FAT A;  3FJM A;  4YMA A;  2V93 A;  2DXY A;  1MXY A;  4MBP A;  1DMB A;  3OXN A;  4BLA A;  4QFN A;  1S50 A;  2RC7 A;  3RNN A;  3MZB A;  1IZ1 A;  3OD7 A;  4DZ1 A;  1BTJ A;  5CBS A;  2VD2 A;  3FVG A;  3CSG A;  4IO5 A;  4MF3 A;  2DE2 A;  2Z8E A;  4KHZ E;  3MPK A;  4BDQ A;  5CMB A;  2I0B A;  3FGS A;  4LQ5 A;  4ZED A;  2Q88 A;  1RYO A;  5I2N A;  3K1P A;  4PFW A;  3IB1 A;  4NF8 A;  4JDF A;  3H6V A;  4OYV A;  1QVS A;  3MVZ A;  4X1B A;  1B4Z A;  1B5I A;  3CR9 A;  4ZDM A;  5H8Q A;  5I57 B;  3IR1 A;  5L9O A;  2RC8 A;  4YZZ A;  3N5L A;  4WED A;  3MC2 A;  2QS1 A;  3PMX A;  5L9M A;  5FHM A;  2V3U A;  1M5B A;  3U93 A;  3KOS A;  4DDD A;  1Y3Q A;  2PT1 A;  4PFY A;  3K02 A;  4MLV A;  1OMP A;  3H6T A;  3HHF A;  4IGT A;  2O1M A;  4F31 B;  1URS A;  5CI5 A;  4ND9 A;  4LAT A;  4POW A;  5JTY A;  1ZJL A;  1H45 A;  3QIM A;  4F18 A;  3G3H A;  3W9V A;  5CMM A;  4LA9 A;  3RN8 A;  4GVO A;  5I59 A;  1ZBM A;  2Z22 A;  1B46 A;  1LCT A;  1B52 A;  3K6W A;  3PPO A;  1LST A;  4QSC A;  1OQH A;  1LLS A;  3E4R A;  3FZV A;  4BDR A;  5HM4 B;  3HPI A;  1QKB A;  4F19 A;  1ZTY A;  3C36 A;  3VLU A;  3VFJ A;  1Y3N A;  1MPC A;  2ZYN A;  4OER A;  3K6U A;  3FD3 A;  2XXW A;  3T93 B;  1JVX A;  5DTB A;  1A8E A;  2H98 A;  3IOT A;  4U1Z A;  3TKD A;  3CVG A;  2B65 A;  3M3L A;  2ZYK A;  3EHT A;  3MQ9 A;  4XKN A;  3OO6 A;  2XXI A;  3MP6 A;  1N0T A;  3O6I A;  3PUX E;  4LZ7 A;  5I2K A;  4H1X A;  3I3V A;  3FAS A;  1XVX A;  2QS2 A;  2UVG A;  3ZS6 A;  2F97 A;  2QMX A;  4ZE8 A;  4MLQ A;  4EQ9 A;  1NH7 A;  5KZT A;  1TFA A;  4RK9 A;  4ELP A;  4YU0 A;  3CFZ A;  1USY H;  3VXC A;  3H7M A;  1LBB A;  3DLN A;  2QS3 A;  2Y7P A;  3PD9 A;  1OLA A;  1B0H A;  5LOM A;  4THI A;  4RPN A;  4ZZE A;  3FAT A;  3I6V A;  3G3I A;  5H8S A;  3KN7 A;  1IQ7 A;  4EQ7 A;  3LR1 A;  1B3L A;  1FW0 A;  1QUK A;  3TEL A;  3BKI B;  1H3D A;  3VVE A;  3UGW A;  1T0K A;  4H8J A;  1I6Q A;  3PPR A;  1D4N A;  3H3G A;  1NNF A;  4POX A;  1SW4 A;  2F7C A;  4EDP A;  3IAZ A;  1QUL A;  4JWO A;  3S9M C;  5H8H B;  3VXB A;  4BDN A;  1B1H A;  4GL0 A;  4ZZA A;  3OO7 A;  4O3B A;  1NH8 A;  3SEV A;  1IUD A;  1DSN A;  5JK4 A;  3W9W A;  3TOD A;  3MUQ A;  3GBA A;  3QUJ A;  4KPT A;  1UTH A;  2ANJ A;  4G8M A;  2HZK A;  1MXV A;  1Z7N E;  4DE8 A;  1LFH A;  3KBR A;  3IB0 A;  4NE4 A;  1OVB A;  3PV0 E;  3OO8 A;  1QW0 A;  2H25 A;  5L9S A;  2ESN A;  3OEK A;  2ABH A;  4IO4 A;  3O9P A;  2ONK E;  4UAC A;  3OMB A;  4U23 A;  4NMY A;  1JNF A;  1R1N A;  3MWB A;  1M5E A;  2Y7I A;  4NF6 B;  3HV1 A;  4R73 A;  4F3P A;  2Z23 A;  1XS5 A;  4R6K A;  2HXW A;  1XC1 A;  4RA1 A;  2RKM A;  5AA2 D;  1USY E;  3IO6 A;  1AL3 A;  2VP1 A;  1MDQ A;  4YB7 A;  2UVJ A;  1O63 A;  2X7Q A;  1SD3 A;  4G68 A;  2WKY A;  5A5X A;  4EUO A;  2I49 A;  3KFM A;  2QSX A;  3O6H A;  3FXR A;  2QPQ A;  1TT1 A;  4M4G A;  3HN0 A;  4PQJ A;  3TQL A;  1SW1 A;  1FQE A;  3K00 A;  3UP9 A;  4ELR A;  2Q8J A;  1NL5 A;  4X48 A;  1LAX A;  3PUY E;  2OZZ A;  1N7X A;  1Y20 A;  1N7W A;  2Q2A A;  3IL1 B;  3UOR A;  3A3C A;  4PFT A;  3AXF A;  2R6G E;  2DE4 A;  3FVN A;  3N94 A;  2DWA A;  4ISU A;  2H99 A;  4G4P A;  4HW8 A;  1WVJ A;  4QRZ A;  1P1N A;  1Y3P A;  4IY6 A;  1XHY A;  1PEB A;  5DYH A;  3R6U A;  5TU0 A;  1UIU A;  4PE5 B;  4ZEB A;  3T96 B;  1LB9 A;  2NOO A;  3TDJ A;  4LON B;  3U72 A;  2G29 A;  4I1D A;  4G8H A;  2XXV A;  3S4U A;  2V3T A;  1MY4 A;  4C0R A;  1MY2 A;  2I4C A;  1JW4 A;  4H65 A;  2XX9 A;  2NVU B;  1FTO A;  5ISU A;  2RCA A;  5I57 A;  2DP8 A;  1VFD A;  1HSL A;  1XT8 A;  4P0I A;  3K01 A;  3VVD A;  2NWJ A;  1IXC A;  3MVW A;  5FHN A;  3QYT A;  1CE2 A;  4YKI A;  3HO7 A;  3TUS A;  5ITP A;  3CG3 A;  3MVX A;  1S7Y A;  4N13 A;  1M5F A;  5H8F B;  4GOT A;  1N76 A;  4H5G A;  2F8D A;  4WEP A;  2HCA A;  1HSJ A;  5KDT B;  4X9T A;  4KCD A;  4DCX A;  3RGY A;  2V3Q A;  3BFU A;  1VR5 A;  4KYE A;  2Y7R A;  4LQ2 A;  1RKM A;  1A40 A;  5AA2 A;  3KOT A;  4LVQ A;  1VE4 A;  2HZL A;  1B9J A;  1JET A;  2ZNU A;  3G3K A;  3UIF A;  4OVJ A;  1MH3 A;  4YIC A;  4ZS9 A;  3S9E A;  2RF1 A;  3K1M A;  3VDF A;  4ELO A;  1MY0 A;  2DWH A;  4AQ4 A;  3CG1 A;  3EPE A;  3OEM A;  5FHO A;  1BIY A;  4HS7 A;  3RT6 B;  2PVU A;  4O3A A;  1NKX A;  1PB8 A;  3IOW A;  1JVY A;  1QUJ A;  3K4U A;  2XXP A;  3V83 A;  3T9H B;  2GH9 A;  2W7Y A;  3GZG A;  1Q1K A;  4R72 A;  1J1N A;  5DEX B;  4OTE A;  1NNK A;  1A8F A;  1B3F A;  1NNP A;  1B58 A;  4KYD A;  2XXY A;  3T9V A;  3CSB A;  1POY 1;  3B6W A;  2XXQ A;  3BFT A;  2F7A A;  3KJT A;  4PET A;  4BDM A;  2H5Y A;  5TPA A;  2I58 A;  1MXZ A;  1ANF A;  1O64 A;  4YMB A;  1D9Y A;  2F78 A;  4OEN A;  1HSE A;  5TP9 A;  1SBP A;  2I3W A;  2THI A;  1ZMG A;  2HEU A;  3TQW A;  1SW5 A;  4TLM B;  2I48 A;  1B3G A;  1MG1 A;  4WKM A;  5AA4 A;  2CMO A;  1SI1 A;  3SER A;  2Y7K A;  4GD5 A;  4HCW A;  5H8N A;  3RTW B;  3OOA A;  4NWC A;  2A5T B;  4R2B A;  3FVO A;  4KFQ A;  1MQG A;  3H6U A;  4FOR A;  3C31 A;  4OZ9 A;  1H44 A;  1B32 A;  4GRK A;  1I6A A;  3D4G A;  4GWO A;  3G3F A;  1M5D A;  1MRP A;  3M3K A;  2ZNS A;  5AE4 A;  3V89 B;  1MQH A;  3UK4 A;  3D4C A;  3C4M A;  5EHM A;  1ZIU A;  5JEI A;  2XHD A;  4IY5 A;  4OET A;  3V8X B;  4ZEC A;  4P11 A;  1FTK A;  1ZU0 A;  1EZ9 A;  5L8D A;  5ITO A;  5F7V A;  2HFB A;  1US4 A;  1II5 A;  3Q29 A;  3KZG A;  5CBR A;  3T22 A;  3IOV A;  4NF5 B;  2GFE A;  1AOV A;  1OIB A;  3IO4 A;  4FEB A;  4XKQ A;  5I56 B;  1MM7 A;  3E3K A;  3V5A A;  3RLF E;  3C33 A;  1N3X A;  1S9T A;  5I2N B;  3MZ9 A;  4NF8 B;  5K2Y A;  3SEX A;  3IOU A;  3OSQ A;  1YAE A;  3FIR A;  3KJ7 A;  1O7T A;  3SEW A;  2G93 A;  3SKP A;  4PFU A;  3RTF B;  1JEU A;  1Q35 A;  3IJO B;  4FAJ A;  4AB5 A;  1RYX A;  3HHG A;  4MFI A;  1GGG A;  1SW2 A;  4NF6 A;  1URD A;  1AIV A;  3USD A;  3EN3 A;  4GFR A;  4FJP A;  4NED A;  2DOJ A;  1EU8 A;  4G2Z A;  1MS7 A;  3T66 A;  3UA8 A;  3G3G A;  1SQY A;  4GF8 A;  4RYA A;  4YKP A;  3PMV A;  2LAO A;  2B3F A;  3T9U A;  2O7U A;  2P1S A;  3TCF A;  2F5X A;  1LCF A;  2QS4 A;  4Q30 B;  2FA7 A;  4IO6 A;  5FTI A;  2DS9 A;  5I59 B;  1SYH A;  2YPN A;  1MM6 A;  1P1W A;  2DVC A;  1UTB B;  2H9B A;  5I84 A;  1MPD A;  3TAJ A;  4FED A;  2O1L A;  1A7L A;  2ZMB A;  3Q26 A;  2F36 A;  1A54 A;  1FQB A;  3G3J A;  3ILU B;  5ICQ A;  1B40 A;  1Y4C A;  1B5J A;  2DQV A;  1MY3 A;  4F1V A;  4C1U A;  3TYH A;  2AYS A;  3EHS A;  3TFL A;  1GTK A;  4KQP A;  4LZ5 A;  1A99 A;  3H4Z A;  2DSF A;  4H0W A;  2DXR A;  2OLB A;  5EYF A;  4DCY A;  1UIV A;  3LBS A;  4KI0 E;  2ONS A;  3ZSF A;  4IB2 A;  2F34 A;  3N26 A;  2XD2 A;  4IGR A;  4OXV A;  2OCU A;  3SDF A;  2Y7W A;  3RPW A;  1N04 A;  1P1Q A;  3IX1 A;  4RXL A;  3TTR A;  2F6P A;  3C34 A;  2E1S A;  5DVI A;  2I6E A;  1I69 A;  2D5W A;  2ONR A;  2I4B A;  1IXG A;  1L5T A;  3P7I A;  3QXM A;  4YB5 A;  1P1O A;  1JEV A;  1B4H A;  2RC9 A;  3WAE A;  1B1X A;  3VLV A;  2R71 A;  4EQB A;  2XXU A;  1SI0 A;  4GLI A;  4F1U A;  3OEL A;  2BJJ X;  3O66 A;  4O3C A;  4F3S A;  1LAH E;  2Q2C A;  4LP2 B;  3HST A;  5BUU A;  2UXA A;  1LB8 A;  1EZO A;  4F3B A;  3RY3 A;  5AA3 A;  3M8U A;  1PC3 A;  5KDT A;  4ESW A;  2VD3 A;  2I0C A;  3FV1 A;  4OFO A;  3OEN A;  1VFE A;  4ZEK A;  5CC2 A;  1YPN A;  4QF9 A;  3S9N C;  2ZXT A;  4BDL A;  4U22 A;  3A3U A;  3B7D A;  1UTH B;  5IAI A;  3K1N A;  1NNT A;  2M8C A;  2DWI A;  3K2D A;  1PDA A;  3F11 A;  1H76 A;  2XXR A;  3KG2 A;  1PBP A;  4LUB A;  3EQ1 A;  4OEU A;  1MH4 A;  2I3V A;  1B2H A;  1TXF A;  3CFL A;  1GV8 A;  1FQA A;  3VE1 B;  1LGB C;  3PMW A;  2FYI A;  1M5C A;  3FJG A;  1A55 A;  4FE8 A;  3IB2 A;  4U4X A;  2OJT A;  3E9X A;  5B70 A;  3MBP A;  4QHQ A;  3KGC A;  3U92 A;  2X26 A;  5CM6 A;  1MXX A;  3W15 C;  2QJE A;  4QSD A;  5CMC A;  4I8C A;  4Q8R A;  1LAG E;  1R9L A;  2Q89 A;  1FQD A;  1Y1M A;  4XIG Q;  4NF4 B;  4XKP A;  3S9L C;  4G77 A;  3K6V A;  2DWJ A;  2KLF A;  2V25 A;  4G68 B;  2O6A A;  3TTM A;  1R9Q A;  5A5X B;  5IKB A;  3MZ1 A;  4EXL A;  3FJ7 A;  2V84 A;  4R74 A;  1TWY A;  4GL8 A;  1BP5 A;  4E0W A;  2QRY A;  5ELV A;  2A5T A;  3S2V A;  3PUW E;  1B3H A;  2Y84 A;  2D21 A;  3DM0 A;  4KYS A;  3H6W A;  4R75 A;  3IK6 B;  3TTK A;  3TCG A;  1LFG A;  4R9G A;  1WDN A;  4DXC A;  1Y9U A;  4ECF A;  4H8I A;  1P1U A;  2FNC A;  2XD3 A;  3LUY A;  1I6B A;  4F1Y A;  1XVY A;  2PBW A;  2PYY A;  1MDP 1;  5FTH A;  1FTJ A;  1DTG A;  4TOZ A;  3TMG A;  1R6Z A;  2IA4 A;  4NF5 A;  5KCJ B;  2Z8D A;  1B7H A;  3ZKL A;  4OHN A;  2GRV A;  2R9J A;  5I56 A;  1PBQ A;  1F9B A;  1EZP A;  4H67 A;  3U94 A;  1AH5 A;  3SEY A;  3Q28 A;  3TZA A;  2ZYO A;  3M3F A;  1WOD A;  4YKJ A;  4ELQ A;  1DOT A;  4OMB A;  2VHA A;  4R9F A;  4U4S A;  3H03 A;  3FUZ A;  1Y4T A;  3DP6 A;  4EF1 A;  4HTG A;  3R26 A;  3I5O A;  4F22 A;  1FQC A;  1SYI A;  4F29 A;  4R6H A;  3GLB A;  3N6U A;  4X1D A;  4TLL B;  4F3G A;  3UN6 A;  3VV5 A;  4PP0 A;  1IIW A;  4BDO A;  2O51 A;  3OO9 A;  3PUZ E;  4OFJ A;  3LSL A;  5K2X A;  3L6G A;  4DXU A;  2OBG A;  4RNS A;  2YLN A;  5AA1 A;  3QAX A;  5I58 B;  4YAH X;  5H8H A;  1B7Z A;  4JB7 A;  4JSD A;  3VLW A;  4L17 A;  1KWH A;  3PGF A;  5DT6 A;  4F39 A;  4U1O A;  1UTB A;  1VSO A;  3B6T A;  1PB9 A;  4R6Y A;  4H5F A;  2X7P A;  2PX1 A;  3KEI A;  4JXI A;  5AA2 B;  1D9V A;  3SES A;  3C35 A;  2O69 A;  4QFK A;  4G8N A;  3MPL A;  3ONM A;  3LSF B;  2IEE A;  2OWT A;  2QL3 A;  3ILT B;  4ONY A;  2GHB A;  2NUV A;  2OK2 A;  4JSO A;  1LFI A;  1SDX A;  1CB6 A;  1DTZ A;  2NXO A;  4EXK A;  2B3B A;  4F2Q A;  2XXX A;  4GIZ A;  5HBC A;  4ZEI A;  1MXU A;  3H06 B;  2D3I A;  2REJ A;  4R2F A;  1NFT A;  2DE3 A;  2RIN A;  3LSX A;  1IIT A;  5J1D A;  4K3F A;  4ZE9 A;  3C9H A;  4Q0C A;  4QFO A;  3MJN A;  3PU5 A;  3QK6 A;  4QFP A;  2AIX A;  3PPQ A;  1MY1 A;  5H8Q B;  2XX8 A;  3CFX A;  1B7U A;  1IXH A;  1ZKB A;  3SEU A;  4RPO A;  3JYR A;  4OES A;  5TPA B;  3U8Q A;  1MXW A;  4G68 C;  2VOZ A;  3RQT A;  3U1O A;  1FCK A;  4DIG A;  1BKA A;  5TP9 B;  3PUV E;  1YTV A;  5JTY B;  3FXU A;  4IO3 A;  1GVC A;  1URG A;  4UA8 A;  1ELJ A;  4RJZ A;  1B0L A;  5F1Q A;  1MQJ A;  3LC8 A;  2AL4 A;  5AA4 B;  2Z8F A;  5BWJ A;  4M1V A;  5H8N B;  4IO2 A;  1D3K A;  4FEC A;  1TFD A;  2CZL A;  2O84 X;  2OWS A;  3G7W A;  2UVH A;  4KD5 A;  4YKK A;  4QSE A;  4QFL A;  3MVY A;  2O68 A;  2XXT A;  1US5 A;  4XXU A;  4OEV A;  4ZEF A;  2ALU A;  3PD8 A;  3K0V A;  3ECR A;  3TCH A;  5CRY A;  1AMF A;  4ESX A;  3HCQ A;  1PB7 A;  2AL5 A;  2O7I A;  4NTL A;  2RCB A;  1ATG A;  1N3W A;  2XX7 A;  4H6D A;  3PPP A;  3CIJ A;  4KCC A;  2A5S A;  3JZJ A;  2GHA A;  3DP8 A;  4N07 A;  3CI8 A;  5I2K B;  4AB6 A;  1OQG A;  3CRB A;  3DEL B;  3PPN A;  3JV9 A;  1DPE A;  4OWD A;  3B6Q A;  4I62 A;  3FV2 A;  4I9D A;  1IXI A;  3Q25 A;  4Q5T A;  4MH5 A;  3KN8 A;  4NWD A;  3OSR A;  3ODB A;  1MPB A;  1Y1Z A;  1B05 A;  2H4I A;  4OFL A;  2UVI A;  3WAF A;  3L6H A;  3FXQ A;  4XTC Q;  3TTN A;  3KSJ A;  3R7X A;  4F2O A;  1MQI A;  4XKR A;  4U2R A;  5CMK A;  2P2A A;  4EF2 A;  1MQD A;  1YCJ A;  2P0S A;  4IO7 A;  4NF4 A;  3K6X A;  3RT8 A;  5H8F A;  4TQU Q;  3KN3 A;  3MP8 A;  3E13 X;  2UYE A;  1N84 A;  4DXB A;  3O28 A;  4LZ8 A;  4OQO A;  1EH3 A;  4P0G A;  1B51 A;  3THI A; 
#chains in the Genus database with same CATH topology
 2F7B A;  5LTC A;  3EHU A;  1UQW A;  3O2A A;  1FPB A;  3O29 A;  4JWX A;  3SET A;  2UYF A;  1LBV A;  2REG A;  1SVX B;  1QKA A;  4E0X A;  1NMU A;  4OVP A;  2KQZ A;  5ICT A;  3RUM A;  5EHS A;  2DYX A;  3Q27 A;  1LAF E;  4N6P A;  1NV6 A;  3IJX B;  3EF7 A;  3TEP A;  1JP4 A;  5DVF A;  2XA5 A;  4C1T A;  2YJP A;  3MW0 A;  3IOR A;  4MEV A;  1IEJ A;  1FRP A;  1LBC A;  1GR2 A;  2PMS A;  2WEF A;  5KCJ A;  1B3E A;  3MP1 A;  1OLC A;  1XOC A;  4OA4 A;  4RK2 A;  3FVK A;  3TTL A;  2VGQ A;  1B6H A;  2E0S A;  2ZYM A;  4KR5 A;  4YB6 A;  4Z7E A;  3O6G A;  5DEX A;  5B7D A;  1JW1 A;  1Z7M E;  1FQF A;  1NUX A;  4WXJ A;  1EYJ A;  4HCY A;  1ZLQ A;  4RY1 A;  2F6G A;  4PAK A;  3VVF A;  4MX6 A;  3MAM A;  3BBR A;  4GXS B;  5DVJ A;  1JQF A;  4DLD A;  2DVZ A;  4PC9 A;  4U21 A;  3ZKK A;  4JBZ A;  3DP4 A;  2HAU A;  1JW5 A;  1OVT A;  3QUF A;  2HQ0 A;  2HAV A;  3C32 A;  5M2V A;  2PT2 A;  3LSW A;  1POT A;  1DPP A;  2XWV A;  1INP A;  1FTM A;  2ZNT A;  4GXA A;  5HPQ A;  4Z0I A;  1P99 A;  4FIM A;  2XXH A;  1QJM A;  2MKZ A;  3QSL A;  5ET5 A;  4JWY A;  1H43 A;  3O97 A;  4GQO A;  1BLF A;  3GXA A;  3GBB A;  2P3N A;  1B5H A;  2F35 A;  3A09 A;  1QUI A;  5I58 A;  3TPA A;  3T9X B;  2DDK A;  1FTL A;  3FBP A;  2QMW A;  2Q9T A;  1FSA A;  3KSX A;  3N6T A;  4FAT A;  3FJM A;  4YMA A;  2V93 A;  2DXY A;  3RPL A;  1MXY A;  4MBP A;  1DMB A;  3OXN A;  3QMF A;  4BLA A;  4QFN A;  1S50 A;  2RC7 A;  3RNN A;  3MZB A;  1IZ1 A;  3OD7 A;  1LBX A;  1NV1 A;  4DZ1 A;  4PFB A;  1BTJ A;  5I7I A;  5CBS A;  2VD2 A;  3FVG A;  1YZ0 A;  3CSG A;  4IO5 A;  4MF3 A;  2DE2 A;  2Z8E A;  4KHZ E;  3FXB A;  3MPK A;  4BDQ A;  5CMB A;  2I0B A;  3FGS A;  4LQ5 A;  4I3Y A;  4ZED A;  2Q88 A;  1RYO A;  1DBZ A;  5I2N A;  3K1P A;  4PFW A;  3IB1 A;  4NF8 A;  4JDF A;  3H6V A;  4OYV A;  2F3B A;  4JVI A;  5IZ3 A;  1QVS A;  3MVZ A;  4X1B A;  2HPG A;  1B4Z A;  1K9Y A;  1B5I A;  3CR9 A;  4ZDM A;  5H8Q A;  2XWO A;  5I57 B;  3IR1 A;  5L9O A;  2RC8 A;  4YZZ A;  2CEY A;  4O8M A;  3N5L A;  4FBP A;  4WED A;  3MC2 A;  2QS1 A;  3PMX A;  5L9M A;  5FHM A;  2V3U A;  1M5B A;  3U93 A;  3KOS A;  4DDD A;  1Y3Q A;  2PT1 A;  4PFY A;  3K02 A;  1FJ9 A;  4MLV A;  1OMP A;  3H6T A;  3HHF A;  3D1R A;  4IGT A;  2O1M A;  4F31 B;  4P9K A;  1URS A;  5CI5 A;  4ND9 A;  4LAT A;  4POW A;  5JTY A;  1ZJL A;  3LV0 A;  1H45 A;  3QIM A;  4F18 A;  3G3H A;  3W9V A;  5CMM A;  4LA9 A;  3RN8 A;  4GVO A;  5I59 A;  1ZBM A;  2Z22 A;  1B46 A;  2FIX A;  1LCT A;  4HE0 A;  1B52 A;  3K6W A;  3PPO A;  4GX6 A;  1LST A;  4QSC A;  1OQH A;  1LLS A;  2PFY A;  3E4R A;  3FZV A;  4BDR A;  5HM4 B;  3HPI A;  1QKB A;  4F19 A;  1ZTY A;  3C36 A;  3VLU A;  5EQ8 A;  3VFJ A;  1Y3N A;  1MPC A;  4PGP A;  2ZYN A;  4OER A;  3K6U A;  3FD3 A;  5J16 A;  1KA1 A;  2XXW A;  3T93 B;  1JVX A;  5DTB A;  1A8E A;  4MJO A;  2FVZ A;  2H98 A;  1RDX A;  3IOT A;  4U1Z A;  4PFR A;  3TKD A;  2QVU A;  3CVG A;  2B65 A;  3M3L A;  2ZYK A;  3EHT A;  3MQ9 A;  4XKN A;  1AWB A;  3OO6 A;  2XXI A;  3MP6 A;  1N0T A;  3O6I A;  3PUX E;  4I40 A;  4LZ7 A;  5I2K A;  4H1X A;  3I3V A;  3FAS A;  4MHF A;  1XVX A;  2QS2 A;  2UVG A;  3ZS6 A;  2F97 A;  2QMX A;  4ZE8 A;  4MLQ A;  4EQ9 A;  1NH7 A;  5KZT A;  1D9Q A;  1TFA A;  4RK9 A;  4ELP A;  4YU0 A;  3CFZ A;  1USY H;  4HE2 A;  3VXC A;  3H7M A;  2FBP A;  1LBB A;  3DLN A;  2QS3 A;  2Y7P A;  3PD9 A;  1OLA A;  1B0H A;  5LOM A;  4THI A;  2WYP A;  4RPN A;  4ZZE A;  2FIE A;  3FAT A;  3I6V A;  2L5V A;  3G3I A;  4PBH A;  5H8S A;  3KN7 A;  1IQ7 A;  4EQ7 A;  3LR1 A;  1B3L A;  1FW0 A;  1QUK A;  3TEL A;  3BKI B;  5IM2 A;  1H3D A;  3VVE A;  3UGW A;  2CZK A;  1T0K A;  4H8J A;  1I6Q A;  3PPR A;  1D4N A;  3H3G A;  1NNF A;  4POX A;  1SW4 A;  2CEX A;  2F7C A;  4EDP A;  3IAZ A;  1QUL A;  4JWO A;  3S9M C;  5H8H B;  4OVR A;  2WBB A;  3VXB A;  4BDN A;  1B1H A;  4GL0 A;  4ZZA A;  3OO7 A;  4O3B A;  1NH8 A;  3SEV A;  1IUD A;  1DSN A;  2PCR A;  5JK4 A;  3W9W A;  3TOD A;  3MUQ A;  3GBA A;  3QUJ A;  4KPT A;  1UTH A;  2ANJ A;  4G8M A;  2HZK A;  1FPF A;  1MXV A;  1Z7N E;  4DE8 A;  4NF0 A;  1LFH A;  3KBR A;  3IB0 A;  4NE4 A;  1OVB A;  5IGA A;  3PV0 E;  3OO8 A;  1QW0 A;  2H25 A;  5L9S A;  2ESN A;  2PFZ A;  3OEK A;  2ABH A;  1NV2 A;  4IO4 A;  3O9P A;  4MIJ A;  4MCO A;  2ONK E;  4GX4 A;  1IMB A;  4UAC A;  3OMB A;  1FPD A;  3BIG A;  4U23 A;  4NMY A;  1JNF A;  1KA0 A;  1R1N A;  3MWB A;  1M5E A;  2Y7I A;  5EQ9 A;  4NF6 B;  3HV1 A;  4R73 A;  5IZ1 A;  4F3P A;  2Z23 A;  1XS5 A;  4R6K A;  2HXW A;  1XC1 A;  4RA1 A;  2RKM A;  5AA2 D;  1USY E;  3IO6 A;  1AL3 A;  2VP1 A;  1MDQ A;  4YB7 A;  2UVJ A;  1O63 A;  2X7Q A;  1SD3 A;  4G68 A;  2WKY A;  5A5X A;  4EUO A;  4X8R A;  2I49 A;  3KFM A;  2QSX A;  4O7M A;  3O6H A;  3FXR A;  2QPQ A;  3KC1 A;  1TT1 A;  4NN3 A;  4M4G A;  3HN0 A;  4PQJ A;  3TQL A;  1SW1 A;  1FQE A;  3K00 A;  3UP9 A;  4ELR A;  1LEV A;  1LBZ A;  4NX1 A;  2Q8J A;  3ROJ A;  1NL5 A;  4X48 A;  1LAX A;  2GQ1 A;  5EQA A;  3PUY E;  1NV7 A;  2OZZ A;  1N7X A;  1Y20 A;  1N7W A;  2Q2A A;  3IL1 B;  3UOR A;  3A3C A;  4N4U A;  4MMP A;  4PFT A;  3AXF A;  2R6G E;  2DE4 A;  3FVN A;  3N94 A;  2DWA A;  3BIH A;  4ISU A;  2H99 A;  4PDH A;  4G4P A;  3IFA A;  4HW8 A;  1WVJ A;  4QRZ A;  1P1N A;  1Y3P A;  4IY6 A;  1FBC A;  1XHY A;  4NAP A;  5T3J A;  1NV5 A;  4N91 A;  1PEB A;  5DYH A;  3R6U A;  5TU0 A;  1UIU A;  4PE5 B;  4ZEB A;  3T96 B;  1LB9 A;  2NOO A;  3TDJ A;  4LON B;  3U72 A;  2G29 A;  1DK4 A;  4I1D A;  1RDZ A;  4G8H A;  2XXV A;  3S4U A;  2V3T A;  2WYK A;  1MY4 A;  4C0R A;  1NV0 A;  1MY2 A;  1FBG A;  2I4C A;  1JW4 A;  4GX3 A;  4H65 A;  1Q9D A;  2XWK A;  2XX9 A;  2NVU B;  1FTO A;  5ISU A;  4NQ8 A;  2WX9 A;  2RCA A;  5I57 A;  2DP8 A;  1G0H A;  1VFD A;  1HSL A;  1XT8 A;  4DI3 D;  4P0I A;  3K01 A;  3VVD A;  2NWJ A;  1IXC A;  3MVW A;  4HE1 A;  5FHN A;  3QYT A;  1CE2 A;  4YKI A;  3HO7 A;  3TUS A;  3E78 A;  5ITP A;  3CG3 A;  3MVX A;  1S7Y A;  4N13 A;  1M5F A;  2B4M A;  5H8F B;  4GOT A;  1N76 A;  4H5G A;  2F8D A;  4WEP A;  2HXR A;  2HCA A;  1HSJ A;  5KDT B;  4X9T A;  4KCD A;  4DCX A;  1FPG A;  4MAG A;  3RGY A;  2V3Q A;  3BFU A;  1VR5 A;  4KYE A;  4XFE A;  2Y7R A;  4LQ2 A;  1RKM A;  1A40 A;  5AA2 A;  3KOT A;  4N8G A;  4LVQ A;  1VE4 A;  2HZL A;  1B9J A;  1JET A;  5I5P A;  2ZNU A;  3G3K A;  3UIF A;  4OVJ A;  1MH3 A;  4YIC A;  4ZS9 A;  3S9E A;  1NV4 A;  4P3L A;  2RF1 A;  3K1M A;  3VDF A;  2R8T A;  4ELO A;  5EQ7 A;  1MY0 A;  2DWH A;  4AQ4 A;  3CG1 A;  3EPE A;  3OEM A;  5FHO A;  1BIY A;  4HS7 A;  3RT6 B;  2HHM A;  2PVU A;  4O3A A;  1NKX A;  4NG7 A;  1PB8 A;  3IOW A;  1JVY A;  1QUJ A;  3K4U A;  2XXP A;  3V83 A;  3T9H B;  2GH9 A;  3T0J A;  2W7Y A;  4N8Y A;  3GZG A;  1Q1K A;  4GWY A;  4R72 A;  1J1N A;  5DEX B;  1NUW A;  4PFI A;  4OTE A;  1NNK A;  1A8F A;  1B3F A;  1NNP A;  1B58 A;  4KYD A;  2XXY A;  3T9V A;  3CSB A;  1POY 1;  3B6W A;  3E79 A;  2XXQ A;  3BFT A;  2QVR A;  2F7A A;  3KJT A;  4PET A;  4BDM A;  2H5Y A;  5TPA A;  2I58 A;  1MXZ A;  1ANF A;  1O64 A;  4YMB A;  1D9Y A;  1FPL A;  2F78 A;  4OEN A;  1HSE A;  5TP9 A;  1SBP A;  2I3W A;  2THI A;  1ZMG A;  2HEU A;  5ESY A;  3TQW A;  1SW5 A;  4TLM B;  1IMC A;  1K9Z A;  2I48 A;  1B3G A;  1MG1 A;  4WKM A;  5AA4 A;  2CMO A;  4I3E A;  1SI1 A;  4G61 A;  3SER A;  2Y7K A;  4GD5 A;  1VDW A;  4HCW A;  5H8N A;  1RDY A;  3RTW B;  3OOA A;  4NWC A;  2A5T B;  4P8B A;  4R2B A;  3FVO A;  4KFQ A;  1MQG A;  3U65 A;  3H6U A;  4FOR A;  3C31 A;  4OZ9 A;  1H44 A;  1B32 A;  4GRK A;  1I6A A;  3D4G A;  4GWO A;  5I3S A;  3G3F A;  1M5D A;  1MRP A;  3M3K A;  2ZNS A;  5AE4 A;  3V89 B;  1MQH A;  3UK4 A;  5A5L A;  3D4C A;  3C4M A;  1FBP A;  5EHM A;  1ZIU A;  5JEI A;  2XHD A;  4N15 A;  4IY5 A;  4OET A;  3V8X B;  4ZEC A;  4P11 A;  1FTK A;  1ZU0 A;  1EZ9 A;  5L8D A;  5EYH A;  5ITO A;  5F7V A;  2HFB A;  1US4 A;  1II5 A;  3Q29 A;  3KZG A;  5CBR A;  3T22 A;  3IOV A;  4NF5 B;  2GFE A;  1AOV A;  1OIB A;  3IO4 A;  3GYY A;  1YXI A;  4FEB A;  4XKQ A;  5I56 B;  1MM7 A;  3E3K A;  3V5A A;  3RLF E;  3C33 A;  1N3X A;  1S9T A;  5I2N B;  3MZ9 A;  4NF8 B;  4PE3 A;  5K2Y A;  3SEX A;  2CZH A;  3IOU A;  3OSQ A;  5IZ3 B;  1YAE A;  3FIR A;  3KJ7 A;  1O7T A;  3SEW A;  2G93 A;  3SKP A;  4PFU A;  3RTF B;  1JEU A;  1Q35 A;  3IJO B;  4FAJ A;  4AB5 A;  1RYX A;  2QVV A;  4DI4 B;  3HHG A;  4H46 A;  4AS4 A;  4MFI A;  1GGG A;  1SW2 A;  1IME A;  4NF6 A;  1URD A;  1AIV A;  3USD A;  3EN3 A;  4GFR A;  3RYD A;  4FJP A;  4NED A;  2DOJ A;  1EU8 A;  4JVD A;  4G2Z A;  5FBP A;  1MS7 A;  3T66 A;  3UA8 A;  3G3G A;  2OX3 A;  1SQY A;  4GF8 A;  4RYA A;  4YKP A;  3PMV A;  2LAO A;  3T1B A;  2Y5L A;  2B3F A;  3T9U A;  4KXP A;  2O7U A;  2P1S A;  3TCF A;  4NHB A;  2F5X A;  1LCF A;  2QS4 A;  4Q30 B;  2FA7 A;  4IO6 A;  5FTI A;  2DS9 A;  5I59 B;  1SYH A;  2YPN A;  1MM6 A;  4N81 A;  4PAF A;  1P1W A;  2DVC A;  1UTB B;  2H9B A;  5I84 A;  1MPD A;  3TAJ A;  4FED A;  2O1L A;  4N6K A;  1A7L A;  2ZMB A;  3Q26 A;  2F36 A;  1A54 A;  1FQB A;  3G3J A;  3ILU B;  5ICQ A;  1B40 A;  1Y4C A;  1B5J A;  2DQV A;  1CNQ A;  1MY3 A;  4F1V A;  4C1U A;  3TYH A;  2AYS A;  3EHS A;  3TFL A;  1GTK A;  4KQP A;  4LZ5 A;  1A99 A;  1NV3 A;  3H4Z A;  2DSF A;  4PDD A;  4H0W A;  2DXR A;  2OLB A;  5EYF A;  3MST A;  4DCY A;  1UIV A;  3LBS A;  4KI0 E;  4PAI A;  2ONS A;  3ZSF A;  1FPJ A;  4IB2 A;  2F34 A;  3N26 A;  2XD2 A;  4IGR A;  4OXV A;  4HXV A;  2OCU A;  3SDF A;  2Y7W A;  3RPW A;  1N04 A;  4N6D A;  1G0I A;  1P1Q A;  2VPN A;  2QFL A;  3IX1 A;  4RXL A;  3TTR A;  2F6P A;  3C34 A;  2E1S A;  5DVI A;  2I6E A;  5ET7 A;  1I69 A;  4N17 A;  2D5W A;  2ONR A;  1KZ8 A;  2I4B A;  1IXG A;  1L5T A;  3P7I A;  3QXM A;  4YB5 A;  1P1O A;  1JEV A;  1B4H A;  1NUZ A;  4GBV A;  2RC9 A;  3WAE A;  1B1X A;  2WBD A;  3VLV A;  2R71 A;  4EQB A;  2XXU A;  1SI0 A;  4GLI A;  4F1U A;  3OEL A;  2BJJ X;  3O66 A;  2Q74 A;  4O3C A;  4F3S A;  1LAH E;  2Q2C A;  4LP2 B;  3HST A;  5BUU A;  2UXA A;  1LB8 A;  1EZO A;  4F3B A;  3RY3 A;  5AA3 A;  1NUY A;  3M8U A;  2ZZW A;  1PC3 A;  4QXD A;  5KDT A;  4ESW A;  2VD3 A;  2I0C A;  3FV1 A;  4OFO A;  3MYU A;  3OEN A;  1VFE A;  4ZEK A;  5CC2 A;  1YPN A;  4QF9 A;  3S9N C;  2ZXT A;  4BDL A;  4U22 A;  3A3U A;  3B7D A;  1UTH B;  5IAI A;  2B4L A;  3K1N A;  1NNT A;  2M8C A;  2DWI A;  3K2D A;  1PDA A;  2CZI A;  3F11 A;  1IMF A;  1H76 A;  2XXR A;  3KG2 A;  4AS5 A;  1PBP A;  3IFC A;  4LUB A;  3EQ1 A;  4OEU A;  1MH4 A;  2I3V A;  4OVQ A;  1B2H A;  1TXF A;  3CFL A;  5ET6 A;  1DCU A;  4PF6 A;  4GWW A;  1LBY A;  1GV8 A;  1QGX A;  1FQA A;  3VE1 B;  2JJK A;  1LGB C;  3PMW A;  2FYI A;  1M5C A;  3FJG A;  1A55 A;  4FE8 A;  3IB2 A;  4U4X A;  1LBW A;  2OJT A;  3E9X A;  5B70 A;  4MNI A;  3MBP A;  4QHQ A;  3KGC A;  3U92 A;  2X26 A;  5CM6 A;  3PTY A;  1MXX A;  3W15 C;  2QJE A;  4QSD A;  5CMC A;  4I8C A;  4Q8R A;  1LAG E;  1R9L A;  2Q89 A;  3LUZ A;  2KR0 A;  1FQD A;  1Y1M A;  4XIG Q;  4NF4 B;  4XKP A;  3S9L C;  2F3D A;  4G77 A;  4PGN A;  3K6V A;  2DWJ A;  2KLF A;  2V25 A;  4G68 B;  2O6A A;  3TTM A;  3SZP A;  1R9Q A;  5A5X B;  3CHG A;  3MZ1 A;  5IKB A;  4EXL A;  3FJ7 A;  2V84 A;  4O7I A;  4R74 A;  1TWY A;  4GL8 A;  1BP5 A;  4E0W A;  2QRY A;  5ELV A;  2A5T A;  3EKI A;  3S2V A;  3PUW E;  1B3H A;  1FBH A;  1YYZ A;  2D21 A;  2Y84 A;  4MNP A;  3DM0 A;  4KYS A;  3H6W A;  4R75 A;  3IK6 B;  3TTK A;  3TCG A;  1LFG A;  4P1L A;  4R9G A;  2V4C A;  1WDN A;  4DXC A;  1Y9U A;  4ECF A;  4H8I A;  1P1U A;  2FNC A;  2XD3 A;  3LUY A;  1I6B A;  4F1Y A;  1XVY A;  2PBW A;  2PYY A;  1MDP 1;  1SPI A;  5FTH A;  1FTJ A;  1DTG A;  4TOZ A;  3TMG A;  1R6Z A;  2IA4 A;  4NF5 A;  5KCJ B;  2Z8D A;  1B7H A;  3ZKL A;  4OHN A;  2GRV A;  2R9J A;  5I56 A;  1PBQ A;  1F9B A;  1EZP A;  4H67 A;  3U94 A;  1AH5 A;  3SEY A;  3Q28 A;  1FBE A;  1XI6 A;  3TZA A;  2ZYO A;  4H45 A;  4QBA A;  3M3F A;  1WOD A;  4YKJ A;  4ELQ A;  1FPI A;  1DOT A;  4PBQ A;  4OMB A;  2XWI A;  2VHA A;  3B8B A;  4R9F A;  4U4S A;  3H03 A;  3FUZ A;  1Y4T A;  3DP6 A;  4EF1 A;  4HTG A;  3R26 A;  1FJ6 A;  1IMD A;  3I5O A;  4F22 A;  1FQC A;  1SYI A;  4F29 A;  4R6H A;  3GLB A;  4PCD A;  3A29 A;  4PTK A;  3N6U A;  4X1D A;  5F24 A;  4TLL B;  4F3G A;  3UN6 A;  3VV5 A;  4PP0 A;  1IIW A;  2ZZV A;  4BDO A;  4GWZ A;  2O51 A;  3OO9 A;  3PUZ E;  4OFJ A;  3LSL A;  5K2X A;  3L6G A;  4DXU A;  2OBG A;  4RNS A;  5IZZ A;  2YLN A;  5AA1 A;  3QAX A;  5I58 B;  4YAH X;  5H8H A;  1B7Z A;  2OWZ A;  5ET8 A;  4JB7 A;  4JSD A;  3VLW A;  4L17 A;  1KWH A;  3PGF A;  5DT6 A;  4F39 A;  4U1O A;  1UTB A;  1VSO A;  3B6T A;  1PB9 A;  4GWU A;  4R6Y A;  4H5F A;  2X7P A;  2PX1 A;  3KEI A;  4JXI A;  5AA2 B;  1D9V A;  3SES A;  3C35 A;  2O69 A;  3RPL B;  4QFK A;  4G8N A;  3MPL A;  1BK4 A;  3ONM A;  3LSF B;  2IEE A;  2OWT A;  2QL3 A;  3ILT B;  4ONY A;  2GHB A;  2NUV A;  2OK2 A;  4JSO A;  1LFI A;  1SDX A;  5EYG A;  1CB6 A;  1DTZ A;  4P1E A;  2VPO A;  2NXO A;  4EXK A;  2B3B A;  4F2Q A;  1FPE A;  5DW8 A;  2XXX A;  3ISP A;  4GIZ A;  5HBC A;  4ZEI A;  1MXU A;  3H06 B;  2D3I A;  2REJ A;  4PF8 A;  4R2F A;  1NFT A;  2DE3 A;  2RIN A;  3LSX A;  4JVC A;  2ZZX A;  1IIT A;  5J1D A;  4K3F A;  4ZE9 A;  3C9H A;  4Q0C A;  4QFO A;  3MJN A;  3PU5 A;  3QK6 A;  4QFP A;  2AIX A;  3PPQ A;  1MY1 A;  5H8Q B;  1FTA A;  2XX8 A;  3CFX A;  1B7U A;  1IXH A;  1ZKB A;  3SEU A;  4RPO A;  1NI9 A;  3JYR A;  4X04 A;  1FBF A;  5LDZ A;  4OES A;  5TPA B;  3U8Q A;  1IMA A;  3B50 A;  1MXW A;  4G68 C;  2VOZ A;  3RQT A;  4UAB A;  3U1O A;  1FCK A;  2Q8M A;  4DIG A;  1BKA A;  5TP9 B;  3PUV E;  4XEQ A;  1YTV A;  5JTY B;  3FXU A;  4IO3 A;  1GVC A;  1URG A;  4UA8 A;  1ELJ A;  4RJZ A;  1B0L A;  5F1Q A;  1MQJ A;  3LC8 A;  2AL4 A;  5AA4 B;  4GWX A;  2Z8F A;  5BWJ A;  3KC0 A;  4M1V A;  4MNC A;  1EYI A;  5H8N B;  4IO2 A;  4NGU A;  1D3K A;  4FEC A;  1TFD A;  2CZL A;  2O84 X;  4O94 A;  2OWS A;  3G7W A;  2UVH A;  2Y5K A;  4KD5 A;  4YKK A;  4QSE A;  4QFL A;  4OVS A;  3MVY A;  3KBZ A;  2O68 A;  2XXT A;  1US5 A;  4XXU A;  4OEV A;  4ZEF A;  2ALU A;  3PD8 A;  3K0V A;  3ECR A;  2P3V A;  3TCH A;  4P47 A;  3HFU A;  4GWS A;  5CRY A;  1AMF A;  4ESX A;  3HCQ A;  1PB7 A;  2AL5 A;  2O7I A;  4NTL A;  2RCB A;  1ATG A;  1N3W A;  2XX7 A;  4H6D A;  3PPP A;  3CIJ A;  4KCC A;  2A5S A;  3JZJ A;  2GHA A;  3DP8 A;  4N07 A;  3CI8 A;  5I2K B;  4AB6 A;  1OQG A;  3CRB A;  3DEL B;  3PPN A;  3JV9 A;  1DPE A;  2FHY A;  4OWD A;  3B6Q A;  4I62 A;  4OAN A;  3FV2 A;  4I9D A;  4XF5 A;  1IXI A;  3Q25 A;  4Q5T A;  4OVT A;  4MH5 A;  3KN8 A;  4NWD A;  1EYK A;  3OSR A;  3ODB A;  4P56 A;  1MPB A;  1Y1Z A;  1B05 A;  2BJI A;  2H4I A;  4OFL A;  2UVI A;  4LN5 A;  3WAF A;  3L6H A;  3NOH A;  4IR8 A;  3FXQ A;  4XTC Q;  3TTN A;  4GBW A;  3KSJ A;  3R7X A;  4F2O A;  1MQI A;  4XKR A;  4U2R A;  5CMK A;  2P2A A;  4EF2 A;  1MQD A;  1YCJ A;  2P0S A;  4IO7 A;  4NF4 A;  3K6X A;  3RT8 A;  5H8F A;  4TQU Q;  2XXK A;  3KN3 A;  3MP8 A;  3E13 X;  2UYE A;  1FPK A;  1N84 A;  4DXB A;  3O28 A;  1FBD A;  4LZ8 A;  4OQO A;  1EH3 A;  4P0G A;  1B51 A;  3THI A;  2VT5 A; 
#chains in the Genus database with same CATH homology
 2F7B A;  3EHU A;  1UQW A;  3O2A A;  3O29 A;  4JWX A;  3SET A;  2UYF A;  2REG A;  1SVX B;  1QKA A;  4E0X A;  1NMU A;  5ICT A;  3RUM A;  5EHS A;  2DYX A;  3Q27 A;  1LAF E;  4N6P A;  3IJX B;  3EF7 A;  3TEP A;  5DVF A;  4C1T A;  2YJP A;  3MW0 A;  3IOR A;  1IEJ A;  1LBC A;  1GR2 A;  2PMS A;  5KCJ A;  1B3E A;  3MP1 A;  1OLC A;  1XOC A;  4RK2 A;  3FVK A;  3TTL A;  2VGQ A;  1B6H A;  2E0S A;  2ZYM A;  4KR5 A;  4YB6 A;  4Z7E A;  3O6G A;  5DEX A;  5B7D A;  1JW1 A;  1Z7M E;  1FQF A;  4WXJ A;  4HCY A;  1ZLQ A;  4RY1 A;  2F6G A;  3VVF A;  3MAM A;  3BBR A;  4GXS B;  5DVJ A;  1JQF A;  4DLD A;  2DVZ A;  4U21 A;  3ZKK A;  4JBZ A;  3DP4 A;  2HAU A;  1JW5 A;  1OVT A;  3QUF A;  2HQ0 A;  2HAV A;  3C32 A;  5M2V A;  2PT2 A;  3LSW A;  1POT A;  1DPP A;  1FTM A;  2ZNT A;  4GXA A;  5HPQ A;  4Z0I A;  1P99 A;  4FIM A;  2XXH A;  1QJM A;  3QSL A;  4JWY A;  1H43 A;  3O97 A;  4GQO A;  1BLF A;  3GXA A;  3GBB A;  1B5H A;  2F35 A;  3A09 A;  1QUI A;  5I58 A;  3TPA A;  3T9X B;  1FTL A;  2QMW A;  2Q9T A;  3KSX A;  3N6T A;  4FAT A;  3FJM A;  4YMA A;  2V93 A;  2DXY A;  1MXY A;  4MBP A;  1DMB A;  3OXN A;  4BLA A;  4QFN A;  1S50 A;  2RC7 A;  3RNN A;  3MZB A;  1IZ1 A;  3OD7 A;  4DZ1 A;  1BTJ A;  5CBS A;  2VD2 A;  3FVG A;  3CSG A;  4IO5 A;  4MF3 A;  2DE2 A;  2Z8E A;  4KHZ E;  3MPK A;  4BDQ A;  5CMB A;  2I0B A;  3FGS A;  4LQ5 A;  4ZED A;  2Q88 A;  1RYO A;  5I2N A;  3K1P A;  4PFW A;  3IB1 A;  4NF8 A;  4JDF A;  3H6V A;  4OYV A;  1QVS A;  3MVZ A;  4X1B A;  1B4Z A;  1B5I A;  3CR9 A;  4ZDM A;  5H8Q A;  5I57 B;  3IR1 A;  5L9O A;  2RC8 A;  4YZZ A;  3N5L A;  4WED A;  3MC2 A;  2QS1 A;  3PMX A;  5L9M A;  5FHM A;  2V3U A;  1M5B A;  3U93 A;  3KOS A;  4DDD A;  1Y3Q A;  2PT1 A;  4PFY A;  3K02 A;  4MLV A;  1OMP A;  3H6T A;  3HHF A;  4IGT A;  2O1M A;  4F31 B;  1URS A;  5CI5 A;  4ND9 A;  4LAT A;  4POW A;  5JTY A;  1ZJL A;  1H45 A;  3QIM A;  4F18 A;  3G3H A;  3W9V A;  5CMM A;  4LA9 A;  3RN8 A;  4GVO A;  5I59 A;  1ZBM A;  2Z22 A;  1B46 A;  1LCT A;  1B52 A;  3K6W A;  3PPO A;  1LST A;  4QSC A;  1OQH A;  1LLS A;  3E4R A;  3FZV A;  4BDR A;  5HM4 B;  3HPI A;  1QKB A;  4F19 A;  1ZTY A;  3C36 A;  3VLU A;  3VFJ A;  1Y3N A;  1MPC A;  2ZYN A;  4OER A;  3K6U A;  3FD3 A;  2XXW A;  3T93 B;  1JVX A;  5DTB A;  1A8E A;  2H98 A;  3IOT A;  4U1Z A;  3TKD A;  3CVG A;  2B65 A;  3M3L A;  2ZYK A;  3EHT A;  3MQ9 A;  4XKN A;  3OO6 A;  2XXI A;  3MP6 A;  1N0T A;  3O6I A;  3PUX E;  4LZ7 A;  5I2K A;  4H1X A;  3I3V A;  3FAS A;  1XVX A;  2QS2 A;  2UVG A;  3ZS6 A;  2F97 A;  2QMX A;  4ZE8 A;  4MLQ A;  4EQ9 A;  1NH7 A;  5KZT A;  1TFA A;  4RK9 A;  4ELP A;  4YU0 A;  3CFZ A;  1USY H;  3VXC A;  3H7M A;  1LBB A;  3DLN A;  2QS3 A;  2Y7P A;  3PD9 A;  1OLA A;  1B0H A;  5LOM A;  4THI A;  4RPN A;  4ZZE A;  3FAT A;  3I6V A;  3G3I A;  5H8S A;  3KN7 A;  1IQ7 A;  4EQ7 A;  3LR1 A;  1B3L A;  1FW0 A;  1QUK A;  3TEL A;  3BKI B;  1H3D A;  3VVE A;  3UGW A;  1T0K A;  4H8J A;  1I6Q A;  3PPR A;  1D4N A;  3H3G A;  1NNF A;  4POX A;  1SW4 A;  2F7C A;  4EDP A;  3IAZ A;  1QUL A;  4JWO A;  3S9M C;  5H8H B;  3VXB A;  4BDN A;  1B1H A;  4GL0 A;  4ZZA A;  3OO7 A;  4O3B A;  1NH8 A;  3SEV A;  1IUD A;  1DSN A;  5JK4 A;  3W9W A;  3TOD A;  3MUQ A;  3GBA A;  3QUJ A;  4KPT A;  1UTH A;  2ANJ A;  4G8M A;  2HZK A;  1MXV A;  1Z7N E;  4DE8 A;  1LFH A;  3KBR A;  3IB0 A;  4NE4 A;  1OVB A;  3PV0 E;  3OO8 A;  1QW0 A;  2H25 A;  5L9S A;  2ESN A;  3OEK A;  2ABH A;  4IO4 A;  3O9P A;  2ONK E;  4UAC A;  3OMB A;  4U23 A;  4NMY A;  1JNF A;  1R1N A;  3MWB A;  1M5E A;  2Y7I A;  4NF6 B;  3HV1 A;  4R73 A;  4F3P A;  2Z23 A;  1XS5 A;  4R6K A;  2HXW A;  1XC1 A;  4RA1 A;  2RKM A;  5AA2 D;  1USY E;  3IO6 A;  1AL3 A;  2VP1 A;  1MDQ A;  4YB7 A;  2UVJ A;  1O63 A;  2X7Q A;  1SD3 A;  4G68 A;  2WKY A;  5A5X A;  4EUO A;  2I49 A;  3KFM A;  2QSX A;  3O6H A;  3FXR A;  2QPQ A;  1TT1 A;  4M4G A;  3HN0 A;  4PQJ A;  3TQL A;  1SW1 A;  1FQE A;  3K00 A;  3UP9 A;  4ELR A;  2Q8J A;  1NL5 A;  4X48 A;  1LAX A;  3PUY E;  2OZZ A;  1N7X A;  1Y20 A;  1N7W A;  2Q2A A;  3IL1 B;  3UOR A;  3A3C A;  4PFT A;  3AXF A;  2R6G E;  2DE4 A;  3FVN A;  3N94 A;  2DWA A;  4ISU A;  2H99 A;  4G4P A;  4HW8 A;  1WVJ A;  4QRZ A;  1P1N A;  1Y3P A;  4IY6 A;  1XHY A;  1PEB A;  5DYH A;  3R6U A;  5TU0 A;  1UIU A;  4PE5 B;  4ZEB A;  3T96 B;  1LB9 A;  2NOO A;  3TDJ A;  4LON B;  3U72 A;  2G29 A;  4I1D A;  4G8H A;  2XXV A;  3S4U A;  2V3T A;  1MY4 A;  4C0R A;  1MY2 A;  2I4C A;  1JW4 A;  4H65 A;  2XX9 A;  2NVU B;  1FTO A;  5ISU A;  2RCA A;  5I57 A;  2DP8 A;  1VFD A;  1HSL A;  1XT8 A;  4P0I A;  3K01 A;  3VVD A;  2NWJ A;  1IXC A;  3MVW A;  5FHN A;  3QYT A;  1CE2 A;  4YKI A;  3HO7 A;  3TUS A;  5ITP A;  3CG3 A;  3MVX A;  1S7Y A;  4N13 A;  1M5F A;  5H8F B;  4GOT A;  1N76 A;  4H5G A;  2F8D A;  4WEP A;  2HCA A;  1HSJ A;  5KDT B;  4X9T A;  4KCD A;  4DCX A;  3RGY A;  2V3Q A;  3BFU A;  1VR5 A;  4KYE A;  2Y7R A;  4LQ2 A;  1RKM A;  1A40 A;  5AA2 A;  3KOT A;  4LVQ A;  1VE4 A;  2HZL A;  1B9J A;  1JET A;  2ZNU A;  3G3K A;  3UIF A;  4OVJ A;  1MH3 A;  4YIC A;  4ZS9 A;  3S9E A;  2RF1 A;  3K1M A;  3VDF A;  4ELO A;  1MY0 A;  2DWH A;  4AQ4 A;  3CG1 A;  3EPE A;  3OEM A;  5FHO A;  1BIY A;  4HS7 A;  3RT6 B;  2PVU A;  4O3A A;  1NKX A;  1PB8 A;  3IOW A;  1JVY A;  1QUJ A;  3K4U A;  2XXP A;  3V83 A;  3T9H B;  2GH9 A;  2W7Y A;  3GZG A;  1Q1K A;  4R72 A;  1J1N A;  5DEX B;  4OTE A;  1NNK A;  1A8F A;  1B3F A;  1NNP A;  1B58 A;  4KYD A;  2XXY A;  3T9V A;  3CSB A;  1POY 1;  3B6W A;  2XXQ A;  3BFT A;  2F7A A;  3KJT A;  4PET A;  4BDM A;  2H5Y A;  5TPA A;  2I58 A;  1MXZ A;  1ANF A;  1O64 A;  4YMB A;  1D9Y A;  2F78 A;  4OEN A;  1HSE A;  5TP9 A;  1SBP A;  2I3W A;  2THI A;  1ZMG A;  2HEU A;  3TQW A;  1SW5 A;  4TLM B;  2I48 A;  1B3G A;  1MG1 A;  4WKM A;  5AA4 A;  2CMO A;  1SI1 A;  3SER A;  2Y7K A;  4GD5 A;  4HCW A;  5H8N A;  3RTW B;  3OOA A;  4NWC A;  2A5T B;  4R2B A;  3FVO A;  4KFQ A;  1MQG A;  3H6U A;  4FOR A;  3C31 A;  4OZ9 A;  1H44 A;  1B32 A;  4GRK A;  1I6A A;  3D4G A;  4GWO A;  3G3F A;  1M5D A;  1MRP A;  3M3K A;  2ZNS A;  5AE4 A;  3V89 B;  1MQH A;  3UK4 A;  3D4C A;  3C4M A;  5EHM A;  1ZIU A;  5JEI A;  2XHD A;  4IY5 A;  4OET A;  3V8X B;  4ZEC A;  4P11 A;  1FTK A;  1ZU0 A;  1EZ9 A;  5L8D A;  5ITO A;  5F7V A;  2HFB A;  1US4 A;  1II5 A;  3Q29 A;  3KZG A;  5CBR A;  3T22 A;  3IOV A;  4NF5 B;  2GFE A;  1AOV A;  1OIB A;  3IO4 A;  4FEB A;  4XKQ A;  5I56 B;  1MM7 A;  3E3K A;  3V5A A;  3RLF E;  3C33 A;  1N3X A;  1S9T A;  5I2N B;  3MZ9 A;  4NF8 B;  5K2Y A;  3SEX A;  3IOU A;  3OSQ A;  1YAE A;  3FIR A;  3KJ7 A;  1O7T A;  3SEW A;  2G93 A;  3SKP A;  4PFU A;  3RTF B;  1JEU A;  1Q35 A;  3IJO B;  4FAJ A;  4AB5 A;  1RYX A;  3HHG A;  4MFI A;  1GGG A;  1SW2 A;  4NF6 A;  1URD A;  1AIV A;  3USD A;  3EN3 A;  4GFR A;  4FJP A;  4NED A;  2DOJ A;  1EU8 A;  4G2Z A;  1MS7 A;  3T66 A;  3UA8 A;  3G3G A;  1SQY A;  4GF8 A;  4RYA A;  4YKP A;  3PMV A;  2LAO A;  2B3F A;  3T9U A;  2O7U A;  2P1S A;  3TCF A;  2F5X A;  1LCF A;  2QS4 A;  4Q30 B;  2FA7 A;  4IO6 A;  5FTI A;  2DS9 A;  5I59 B;  1SYH A;  2YPN A;  1MM6 A;  1P1W A;  2DVC A;  1UTB B;  2H9B A;  5I84 A;  1MPD A;  3TAJ A;  4FED A;  2O1L A;  1A7L A;  2ZMB A;  3Q26 A;  2F36 A;  1A54 A;  1FQB A;  3G3J A;  3ILU B;  5ICQ A;  1B40 A;  1Y4C A;  1B5J A;  2DQV A;  1MY3 A;  4F1V A;  4C1U A;  3TYH A;  2AYS A;  3EHS A;  3TFL A;  1GTK A;  4KQP A;  4LZ5 A;  1A99 A;  3H4Z A;  2DSF A;  4H0W A;  2DXR A;  2OLB A;  5EYF A;  4DCY A;  1UIV A;  3LBS A;  4KI0 E;  2ONS A;  3ZSF A;  4IB2 A;  2F34 A;  3N26 A;  2XD2 A;  4IGR A;  4OXV A;  2OCU A;  3SDF A;  2Y7W A;  3RPW A;  1N04 A;  1P1Q A;  3IX1 A;  4RXL A;  3TTR A;  2F6P A;  3C34 A;  2E1S A;  5DVI A;  2I6E A;  1I69 A;  2D5W A;  2ONR A;  2I4B A;  1IXG A;  1L5T A;  3P7I A;  3QXM A;  4YB5 A;  1P1O A;  1JEV A;  1B4H A;  2RC9 A;  3WAE A;  1B1X A;  3VLV A;  2R71 A;  4EQB A;  2XXU A;  1SI0 A;  4GLI A;  4F1U A;  3OEL A;  2BJJ X;  3O66 A;  4O3C A;  4F3S A;  1LAH E;  2Q2C A;  4LP2 B;  3HST A;  5BUU A;  2UXA A;  1LB8 A;  1EZO A;  4F3B A;  3RY3 A;  5AA3 A;  3M8U A;  1PC3 A;  5KDT A;  4ESW A;  2VD3 A;  2I0C A;  3FV1 A;  4OFO A;  3OEN A;  1VFE A;  4ZEK A;  5CC2 A;  1YPN A;  4QF9 A;  3S9N C;  2ZXT A;  4BDL A;  4U22 A;  3A3U A;  3B7D A;  1UTH B;  5IAI A;  3K1N A;  1NNT A;  2M8C A;  2DWI A;  3K2D A;  1PDA A;  3F11 A;  1H76 A;  2XXR A;  3KG2 A;  1PBP A;  4LUB A;  3EQ1 A;  4OEU A;  1MH4 A;  2I3V A;  1B2H A;  1TXF A;  3CFL A;  1GV8 A;  1FQA A;  3VE1 B;  1LGB C;  3PMW A;  2FYI A;  1M5C A;  3FJG A;  1A55 A;  4FE8 A;  3IB2 A;  4U4X A;  2OJT A;  3E9X A;  5B70 A;  3MBP A;  4QHQ A;  3KGC A;  3U92 A;  2X26 A;  5CM6 A;  1MXX A;  3W15 C;  2QJE A;  4QSD A;  5CMC A;  4I8C A;  4Q8R A;  1LAG E;  1R9L A;  2Q89 A;  1FQD A;  1Y1M A;  4XIG Q;  4NF4 B;  4XKP A;  3S9L C;  4G77 A;  3K6V A;  2DWJ A;  2KLF A;  2V25 A;  4G68 B;  2O6A A;  3TTM A;  1R9Q A;  5A5X B;  5IKB A;  3MZ1 A;  4EXL A;  3FJ7 A;  2V84 A;  4R74 A;  1TWY A;  4GL8 A;  1BP5 A;  4E0W A;  2QRY A;  5ELV A;  2A5T A;  3S2V A;  3PUW E;  1B3H A;  2Y84 A;  2D21 A;  3DM0 A;  4KYS A;  3H6W A;  4R75 A;  3IK6 B;  3TTK A;  3TCG A;  1LFG A;  4R9G A;  1WDN A;  4DXC A;  1Y9U A;  4ECF A;  4H8I A;  1P1U A;  2FNC A;  2XD3 A;  3LUY A;  1I6B A;  4F1Y A;  1XVY A;  2PBW A;  2PYY A;  1MDP 1;  5FTH A;  1FTJ A;  1DTG A;  4TOZ A;  3TMG A;  1R6Z A;  2IA4 A;  4NF5 A;  5KCJ B;  2Z8D A;  1B7H A;  3ZKL A;  4OHN A;  2GRV A;  2R9J A;  5I56 A;  1PBQ A;  1F9B A;  1EZP A;  4H67 A;  3U94 A;  1AH5 A;  3SEY A;  3Q28 A;  3TZA A;  2ZYO A;  3M3F A;  1WOD A;  4YKJ A;  4ELQ A;  1DOT A;  4OMB A;  2VHA A;  4R9F A;  4U4S A;  3H03 A;  3FUZ A;  1Y4T A;  3DP6 A;  4EF1 A;  4HTG A;  3R26 A;  3I5O A;  4F22 A;  1FQC A;  1SYI A;  4F29 A;  4R6H A;  3GLB A;  3N6U A;  4X1D A;  4TLL B;  4F3G A;  3UN6 A;  3VV5 A;  4PP0 A;  1IIW A;  4BDO A;  2O51 A;  3OO9 A;  3PUZ E;  4OFJ A;  3LSL A;  5K2X A;  3L6G A;  4DXU A;  2OBG A;  4RNS A;  2YLN A;  5AA1 A;  3QAX A;  5I58 B;  4YAH X;  5H8H A;  1B7Z A;  4JB7 A;  4JSD A;  3VLW A;  4L17 A;  1KWH A;  3PGF A;  5DT6 A;  4F39 A;  4U1O A;  1UTB A;  1VSO A;  3B6T A;  1PB9 A;  4R6Y A;  4H5F A;  2X7P A;  2PX1 A;  3KEI A;  4JXI A;  5AA2 B;  1D9V A;  3SES A;  3C35 A;  2O69 A;  4QFK A;  4G8N A;  3MPL A;  3ONM A;  3LSF B;  2IEE A;  2OWT A;  2QL3 A;  3ILT B;  4ONY A;  2GHB A;  2NUV A;  2OK2 A;  4JSO A;  1LFI A;  1SDX A;  1CB6 A;  1DTZ A;  2NXO A;  4EXK A;  2B3B A;  4F2Q A;  2XXX A;  4GIZ A;  5HBC A;  4ZEI A;  1MXU A;  3H06 B;  2D3I A;  2REJ A;  4R2F A;  1NFT A;  2DE3 A;  2RIN A;  3LSX A;  1IIT A;  5J1D A;  4K3F A;  4ZE9 A;  3C9H A;  4Q0C A;  4QFO A;  3MJN A;  3PU5 A;  3QK6 A;  4QFP A;  2AIX A;  3PPQ A;  1MY1 A;  5H8Q B;  2XX8 A;  3CFX A;  1B7U A;  1IXH A;  1ZKB A;  3SEU A;  4RPO A;  3JYR A;  4OES A;  5TPA B;  3U8Q A;  1MXW A;  4G68 C;  2VOZ A;  3RQT A;  3U1O A;  1FCK A;  4DIG A;  1BKA A;  5TP9 B;  3PUV E;  1YTV A;  5JTY B;  3FXU A;  4IO3 A;  1GVC A;  1URG A;  4UA8 A;  1ELJ A;  4RJZ A;  1B0L A;  5F1Q A;  1MQJ A;  3LC8 A;  2AL4 A;  5AA4 B;  2Z8F A;  5BWJ A;  4M1V A;  5H8N B;  4IO2 A;  1D3K A;  4FEC A;  1TFD A;  2CZL A;  2O84 X;  2OWS A;  3G7W A;  2UVH A;  4KD5 A;  4YKK A;  4QSE A;  4QFL A;  3MVY A;  2O68 A;  2XXT A;  1US5 A;  4XXU A;  4OEV A;  4ZEF A;  2ALU A;  3PD8 A;  3K0V A;  3ECR A;  3TCH A;  5CRY A;  1AMF A;  4ESX A;  3HCQ A;  1PB7 A;  2AL5 A;  2O7I A;  4NTL A;  2RCB A;  1ATG A;  1N3W A;  2XX7 A;  4H6D A;  3PPP A;  3CIJ A;  4KCC A;  2A5S A;  3JZJ A;  2GHA A;  3DP8 A;  4N07 A;  3CI8 A;  5I2K B;  4AB6 A;  1OQG A;  3CRB A;  3DEL B;  3PPN A;  3JV9 A;  1DPE A;  4OWD A;  3B6Q A;  4I62 A;  3FV2 A;  4I9D A;  1IXI A;  3Q25 A;  4Q5T A;  4MH5 A;  3KN8 A;  4NWD A;  3OSR A;  3ODB A;  1MPB A;  1Y1Z A;  1B05 A;  2H4I A;  4OFL A;  2UVI A;  3WAF A;  3L6H A;  3FXQ A;  4XTC Q;  3TTN A;  3KSJ A;  3R7X A;  4F2O A;  1MQI A;  4XKR A;  4U2R A;  5CMK A;  2P2A A;  4EF2 A;  1MQD A;  1YCJ A;  2P0S A;  4IO7 A;  4NF4 A;  3K6X A;  3RT8 A;  5H8F A;  4TQU Q;  3KN3 A;  3MP8 A;  3E13 X;  2UYE A;  1N84 A;  4DXB A;  3O28 A;  4LZ8 A;  4OQO A;  1EH3 A;  4P0G A;  1B51 A;  3THI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...