5I84A

Structure of the xanthomonas citri phosphate-binding protein phox
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
314
structure length
314
Chain Sequence
DVTGAGASFIYPVMSKWSADYNAATKKQVNYQSIGSGGGIAQIKAASVDFGSSDAPLKPEELAAAGLAQFPSVIGGVVPVVNVPGIAAGTLKLDGKTLGDIFLGKVSTWNDPAIAALNPGVKLPEGKITVVHRSDGSGTSFNFTNYLSKVNPDWKGKVGEGTAVQWPTGIGGKGNEGVAAYVKQIKGGIGYVELSYALQNKMAYTAMKNAAGKFVQPSDETFAAAANSADWGTAKDFYLVMTNAAGDNAWPITATNFILVQKKPKNPAGLKNTLEFFRWVYTKGDAQAKQLDYVPLPDTLVTQIEAYWAKNLPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Phosphate-binding protein PstS
publication title A gene duplication in phosphate-binding proteins from pho regulon of Xanthomonas citri: functional and structural studies
rcsb
source organism Xanthomonas axonopodis pv. citri
total genus 81
structure length 314
sequence length 314
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5i84A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5i84A02
4PQJA 1A55A 2V3TA 4U22A 4ZZAA 1EU8A 3FJMA 4GL0A 2D3IA 3PPOA 3T9HB 4TQUQ 1GGGA 1DSNA 1FTLA 3E9XA 3H6VA 1Y3NA 1R1NA 3BFTA 5CRYA 4XKRA 4HCWA 5KCJA 1F9BA 4FECA 4M1VA 3P7IA 1B5IA 5I57A 1MXXA 4NF8A 2UVIA 2ZMBA 3KN8A 4G8NA 1ZMGA 4RPOA 1A54A 2X26A 4OMBA 5I58B 4KCDA 4WXJA 1B1HA 2ZYOA 4DZ1A 1UIVA 3R6UA 3QIMA 4R73A 2F8DA 1LAFE 3MBPA 3N6TA 4JXIA 2R6GE 5L9SA 2ABHA 3V5AA 1LSTA 3LBSA 4U4XA 4F29A 2RCBA 3E4RA 3SEXA 4R75A 3K4UA 2XXHA 3H4ZA 3K6WA 1QVSA 3KN7A 1IZ1A 3RNNA 4ZEKA 2V3QA 3H3GA 3CFLA 3EPEA 3FD3A 1DPPA 1MS7A 4RPNA 4DLDA 3MW0A 1ZBMA 2O51A 1IEJA 3DP4A 2HAUA 3O6GA 3Q25A 1M5FA 1PB8A 4NWCA 3MVXA 4H0WA 1RYXA 1B05A 2V25A 4N07A 3G7WA 3PV0E 3PMXA 3TKDA 2PBWA 3H03A 4OEUA 1FQBA 3LUYA 1OVBA 1NMUA 4TLLB 4JSDA 1DOTA 4AB5A 1MY4A 2GHAA 5I2KB 3LSXA 4JWOA 3T66A 5AA2B 3BKIB 2ALUA 4DDDA 5LOMA 4PETA 4KQPA 3ECRA 1ZKBA 3IOWA 1ZLQA 1SQYA 1L5TA 1MY1A 3VDFA 1CB6A 2DVCA 3SETA 1N7XA 2Q2CA 3MWBA 2YLNA 1ZIUA 4NF6B 4OETA 4X48A 2X7PA 4KD5A 3H7MA 2FNCA 4U23A 3MZ1A 5HM4B 1D4NA 1I6BA 4IO4A 3PU5A 4OZ9A 1QJMA 3FIRA 3TTNA 3U8QA 1UTBB 2QS4A 4P11A 3A09A 3RPWA 1JVXA 3UK4A 4HW8A 5I59A 2XXRA 3DELB 2B3BA 4JWYA 5J1DA 1QUKA 1USYE 2XXXA 2G29A 3FJ7A 4YZZA 3SEWA 1QKAA 1MXWA 2ONSA 3VLWA 5FHMA 3CIJA 3IAZA 1A8FA 3VVEA 1DTGA 3SESA 2O7UA 3U1OA 1HSEA 3MP1A 4H8JA 4RNSA 3C32A 4GXAA 1O7TA 2H4IA 1P1QA 3FVOA 1ATGA 3SEYA 2VGQA 5CMBA 1VFEA 4BDRA 2XXYA 2DWHA 2QMWA 1AH5A 4QSCA 1NNTA 1N7WA 2OWTA 4F2OA 2PX1A 3CR9A 3OEMA 1MQDA 4LZ8A 3GBAA 4NF4B 3KOTA 5F7VA 1LBBA 3G3FA 3OO9A 1NNPA 1EZPA 1URSA 3ZS6A 4QFKA 3OD7A 2XXPA 5DTBA 1PBQA 3HCQA 3S2VA 3PUYE 4Q8RA 4HS7A 3C34A 1FTKA 5BWJA 3ILUB 5HPQA 4OESA 1EH3A 3PMWA 3N5LA 4RJZA 2RINA 3EN3A 1MQHA 3KEIA 4RXLA 3LC8A 1B3GA 2M8CA 5AE4A 5I56A 4R9GA 1FQEA 4OHNA 3QSLA 2FA7A 3T93B 3FJGA 3HO7A 5M2VA 2PT1A 4FORA 2RC7A 3AXFA 2LAOA 4YICA 1BLFA 2RKMA 4EF1A 5ELVA 3K0VA 4KHZE 3OENA 3L6GA 1JW4A 3K6XA 5DEXA 4ECFA 4F3SA 1OVTA 2F35A 3G3HA 4I8CA 2D21A 4X1BA 1I6QA 3S9NC 3K02A 4JB7A 4FAJA 1B40A 4FE8A 5JTYA 3MUQA 1UTHA 2DWIA 4U1OA 2GHBA 4F3GA 2O84X 2F7BA 1B3FA 2QS3A 4L17A 1B3LA 2YJPA 1MM6A 5CMCA 1Y1ZA 4ELQA 1ELJA 4F31B 3HN0A 5EYFA 3CG3A 4OVJA 2OZZA 5ITPA 4F3PA 4P0IA 3IO6A 4GQOA 4KFQA 1N76A 4YU0A 4PFWA 4DCXA 2F36A 1LFHA 2ESNA 4RYAA 4XKPA 5ICQA 1LAGE 1SI0A 1SW1A 1SI1A 4EUOA 1PC3A 4DXBA 1R9QA 3UA8A 1MY3A 4Q5TA 3O28A 2O6AA 3TTLA 4DIGA 5I2NB 4BDLA 1QW0A 2HCAA 4XTCQ 2Z8FA 1B4ZA 2THIA 1TT1A 1IQ7A 3B7DA 3M3KA 5H8QB 4X9TA 1POY1 3IOVA 4ZZEA 1AIVA 1N84A 1LLSA 4MBPA 3O2AA 4H67A 4NWDA 2HFBA 1XS5A 3QUJA 3EHSA 1JVYA 5EHMA 5KDTA 3F11A 2IEEA 3C9HA 1WODA 4R72A 5CMKA 3UN6A 2ONRA 4KPTA 3I3VA 5AA2D 3RLFE 4YAHX 2I3WA 2HAVA 2DE3A 4R2BA 3UP9A 4C1UA 5FHNA 2F7AA 2WKYA 2CMOA 5A5XB 1SVXB 4XKNA 1A99A 3MVZA 4YMBA 3G3IA 3DP6A 3C31A 4LA9A 1VSOA 3TDJA 2Z8EA 4NF5B 4OFOA 5H8NB 3H6UA 1H43A 5AA4B 3IL1B 4LQ2A 3OSRA 2V84A 1B5JA 4NMYA 4U1ZA 1TXFA 1LAHE 4U21A 3TMGA 3E3KA 1HSLA 3D4CA 3IB2A 5I58A 5CM6A 1MXZA 5ICTA 1SBPA 4YB5A 5KCJB 2DE4A 3LSLA 4FIMA 1SW4A 1OLAA 3IJXB 1FTMA 1A8EA 1N3XA 1CE2A 4ND9A 1USYH 1MQIA 2Z23A 1Q1KA 3ODBA 4ZEFA 1UQWA 2V3UA 3KBRA 3H6TA 1H3DA 4ELRA 1URDA 2O68A 1Y20A 3EQ1A 3K00A 1MRPA 1XHYA 2Q2AA 5CBRA 2Z8DA 1SW5A 2NOOA 4KR5A 2O1LA 3OO7A 3CSGA 3MP6A 1P1WA 1LBCA 3TTRA 1PEBA 1XVXA 5TPAB 3KJ7A 2Q88A 5FTIA 3TQWA 2VOZA 4BDQA 2PMSA 3KSXA 3LR1A 1JNFA 3GXAA 1SYIA 5L9OA 1B58A 3SDFA 3QUFA 4F1UA 3FVKA 5HBCA 1FCKA 2XHDA 2ZNSA 3FUZA 2R9JA 2P2AA 5I2KA 5ITOA 5AA2A 1B51A 1QULA 3HV1A 1AMFA 2UVHA 4ZECA 4N13A 3H06B 4F2QA 4N6PA 2P0SA 3T96B 3FXUA 3D4GA 2QPQA 4ZE9A 3OELA 5CC2A 1YAEA 1GV8A 3HHFA 2XX9A 3OMBA 3B6TA 1O63A 1DTZA 2D5WA 1JEUA 3JYRA 2RC8A 4WKMA 1XOCA 3RN8A 4X1DA 1N3WA 1B5HA 2DXRA 4NF6A 2XX8A 1II5A 1LCFA 4MF3A 1ANFA 1Y4CA 3K1NA 1S7YA 5K2XA 1US4A 5DYHA 4ESXA 4U2RA 3KJTA 2NXOA 3RUMA 1BTJA 1LAXA 1SD3A 2OBGA 4YKKA 3V8XB 2VD3A 4IGRA 1IXCA 1UTBA 3FXQA 4QFOA 1I69A 1NH8A 1T0KA 1TWYA 1URGA 1FTJA 4FEDA 2OK2A 3QYTA 2ZYKA 2I4CA 1R9LA 4H5GA 2UVJA 3FV2A 3ZSFA 2UYFA 3KSJA 3T9XB 4QHQA 2DWJA 3S4UA 3MZBA 1QUJA 5CI5A 4OEVA 4GXSB 2Q8JA 4THIA 1H45A 3KGCA 4G4PA 2ZXTA 4IY6A 1B52A 1BIYA 2I58A 5I59B 1LCTA 4IO7A 4QSDA 3IX1A 3TTKA 2HZKA 4GL8A 3MJNA 5IKBA 1Y1MA 1LGBC 4QFLA 2DOJA 3TCGA 1B7UA 4OERA 5DVJA 3SERA 2I4BA 3N94A 3RT6B 1PB9A 4ONYA 2VP1A 4NF4A 1J1NA 4KI0E 2CZLA 3PUXE 1N04A 4O3CA 1B0LA 3FZVA 3IJOB 2ONKE 3S9LC 3FASA 3MVYA 2F78A 3ZKKA 1NL5A 4LATA 3IB1A 2Y7RA 4Z7EA 2XXUA 3CFZA 4Q30B 2R71A 3FATA 5L9MA 4JSOA 3G3KA 4Z0IA 4OYVA 5AA3A 3TCFA 4IO3A 1YPNA 4G68A 3TFLA 1AOVA 1B3EA 1NH7A 1WDNA 1B4HA 4ZEIA 3V89B 1MQGA 3Q29A 3T9VA 3K2DA 5DVFA 3Q28A 1MPDA 1US5A 1XVYA 2PVUA 4OFJA 5TU0A 1S50A 4ELOA 3CSBA 2W7YA 3PPNA 5FTHA 3GLBA 1NNKA 1VE4A 1ZU0A 4GF8A 4H6DA 1D3KA 3TODA 1NKXA 2F97A 4F19A 3S9MC 1ZTYA 5I56B 4C1TA 3RY3A 3MVWA 3TELA 1H44A 4PFTA 3PGFA 3I6VA 1JQFA 2AL4A 2QRYA 2H5YA 3MC2A 4MFIA 2DS9A 3IK6B 2XXIA 4WEDA 2DWAA 3K01A 2E1SA 4GOTA 2GRVA 1PDAA 1B6HA 4OQOA 4PFUA 4ELPA 2DP8A 4H5FA 2XX7A 1H76A 5B7DA 2X7QA 2Y7IA 4ZEBA 4TLMB 3MAMA 2DQVA 4IO6A 1Y3PA 4UACA 1FTOA 3U72A 1RYOA 1M5EA 3KOSA 2YPNA 5H8HB 2AYSA 1VFDA 1YCJA 2B65A 2QMXA 3C35A 3IORA 2UXAA 4U4SA 2QSXA 1IIWA 3M3FA 3OXNA 5I2NA 3TAJA 4K3FA 4PP0A 2XXWA 3W9WA 4GLIA 3ONMA 1GVCA 1B0HA 4EQBA 5H8FB 4R2FA 2KLFA 3T9UA 4F1VA 5TP9B 2RC9A 5CBSA 1MDP1 3PUVE 3KZGA 3HPIA 3UORA 3PD9A 4KYEA 4R6HA 1PB7A 2F7CA 3BFUA 2PYYA 2I3VA 1FQCA 1IXGA 4F22A 4H8IA 1NNFA 2A5SA 3SEUA 2UVGA 1JW5A 3U94A 4IGTA 4PE5B 1I6AA 3N26A 1FW0A 2FYIA 5A5XA 3TTMA 1VR5A 1LB8A 4M4GA 1M5DA 4QFPA 3FVGA 2A5TB 3K1PA 3PUZE 2HZLA 3MZ9A 4XIGQ 4NTLA 3VXBA 3K6UA 4OWDA 3C36A 1MH3A 3L6HA 4O3BA 2B3FA 4G8MA 5AA4A 3GBBA 3TYHA 1B46A 2NVUB 2QL3A 1B32A 2P1SA 4OENA 1MPBA 4MLVA 2I6EA 4GWOA 3UIFA 3EF7A 2HXWA 4JBZA 2OJTA 2H9BA 3V83A 3PPPA 4BDNA 3Q26A 5K2YA 1B7HA 4GIZA 3MP8A 1B7ZA 3MQ9A 3Q27A 3CFXA 4OFLA 4DE8A 2O69A 3O6IA 5I57B 3M8UA 4TOZA 1SW2A 4NF8B 4AQ4A 2NWJA 3UGWA 2O7IA 1JW1A 3C4MA 3M3LA 1Y4TA 4EF2A 1IXHA 3KFMA 3DLNA 3CRBA 2QS2A 2BJJX 4DXUA 3A3UA 1MXVA 3TCHA 1UIUA 1IUDA 3QXMA 3LSFB 4LZ7A 4MH5A 4FATA 5DT6A 1GTKA 5TPAA 5BUUA 4C0RA 2REJA 1MQJA 4F39A 4ESWA 1LB9A 2GH9A 2VHAA 1D9VA 4LVQA 1OQHA 3CVGA 4ZEDA 3JV9A 2UYEA 1P1NA 4IO5A 3E13X 4RA1A 1MXYA 4YKJA 3DM0A 4ISUA 3RTWB 5JEIA 2QS1A 3K6VA 4YMAA 5DVIA 3GZGA 1EZOA 2Q9TA 3C33A 3FXRA 3TZAA 3RGYA 3VVDA 4I1DA 1Z7NE 2OLBA 1MG1A 1IITA 3R26A 1FQAA 4HTGA 3IOTA 4I62A 1OQGA 1XT8A 3PPRA 2XXVA 2I48A 4I9DA 3O9PA 3SKPA 1OIBA 1NFTA 4YB7A 4E0WA 1BKAA 1O64A 1B2HA 3ZKLA 2Y7WA 2VD2A 3CG1A 4ZE8A 2ZNTA 3IR1A 3O6HA 4QFNA 3HHGA 4E0XA 3KG2A 4H1XA 3MPKA 2H99A 5I84A 4BDMA 4OXVA 3KN3A 4WEPA 1LFGA 4KYSA 1MM7A 1JETA 5L8DA 4Q0CA 2XXQA 4JWXA 4YB6A 4DXCA 4RK9A 4G77A 1P99A 4F18A 2REGA 1Y9UA 2DXYA 5KZTA 2HQ0A 4F3BA 5F1QA 5FHOA 1FQDA 2DYXA 3G3GA 5JK4A 3U92A 1DMBA 2QJEA 2Y7PA 3DP8A 1GR2A 4QRZA 3TUSA 1MH4A 4RY1A 2F6PA 2OWSA 4RK2A 1EZ9A 1B1XA 4G2ZA 4IO2A 3VLUA 1QUIA 1M5CA 3T22A 3RQTA 1WVJA 2ZYNA 2ANJA 4MLQA 1XC1A 2F34A 3IB0A 1SDXA 3K1MA 4F1YA 4LQ5A 3LSWA 3OO8A 4AB6A 3VFJA 1QKBA 3IO4A 1M5BA 1OMPA 1RKMA 4P0GA 3PMVA 3VVFA 3W15C 4GVOA 2XXTA 1MDQA 3R7XA 2DVZA 4KCCA 5H8SA 4R9FA 4ZDMA 2G93A 2HEUA 4YKPA 3VLVA 3EHUA 4KYDA 3WAFA 2XD3A 4GFRA 4G8HA 2RCAA 1B3HA 3RTFB 4R6YA 3CI8A 2Y84A 3VV5A 2H25A 1POTA 2GFEA 4H65A 2Y7KA 3O66A 4R6KA 3FV1A 1Y3QA 4EQ7A 3MPLA 2DSFA 3TQLA 2NUVA 1PBPA 2H98A 5B70A 4IY5A 4G68B 4POXA 4QSEA 1MY2A 1BP5A 1Z7ME 1N0TA 3N6UA 4NE4A 1JEVA 1KWHA 4LONB 3VXCA 2AL5A 2O1MA 2Q89A 4DCYA 3FGSA 3OO6A 5ISUA 3O29A 4O3AA 1P1UA 5CMMA 4BDOA 3USDA 1S9TA 4HCYA 5DEXB 4BLAA 1MPCA 2F6GA 1B9JA 3FVNA 2V93A 1Q35A 4FJPA 4GRKA 3B6WA 3OEKA 3I5OA 2OCUA 2ZYMA 5JTYB 2I0CA 5H8HA 1UTHB 1A7LA 4EDPA 1R6ZA 1LFIA 1DPEA 3VE1B 4EXKA 1SYHA 4OTEA 3W9VA 4LZ5A 2XD2A 2IA4A 4QF9A 3PPQA 4R74A 4GD5A 1MY0A 2Z22A 1MXUA 3RT8A 3JZJA 3A3CA 2F5XA 1FQFA 3TEPA 4XXUA 5H8QA 5H8FA 5EHSA 2PT2A 1HSJA 4G68C 5TP9A 5AA1A 2E0SA 3G3JA 3QK6A 4ZS9A 4YKIA 1TFAA 3THIA 2I0BA 4JDFA 3TPAA 3U93A 3QAXA 3IOUA 4FEBA 2DE2A 3EHTA 2I49A 3HSTA 1AL3A 3O97A 4XKQA 5IAIA 4LUBA 1A40A 2AIXA 3SEVA 4UA8A 3H6WA 2A5TA 2RF1A 3S9EA 4PFYA 1ZJLA 3B6QA 1IXIA 3PD8A 4POWA 3OOAA 4EQ9A 3ILTB 3OSQA 1TFDA 4LP2B 5KDTB 4EXLA 1YTVA 1OLCA 4NEDA 4NF5A 3WAEA 1P1OA 4IB2A 5H8NA 3BBRA 3PUWE 2ZNUA 1D9YA
chains in the Genus database with same CATH superfamily
4PQJA 1A55A 2V3TA 4U22A 4ZZAA 4MCOA 1EU8A 3FJMA 4GL0A 2D3IA 3B50A 3PPOA 3T9HB 4TQUQ 1GGGA 1DSNA 1FTLA 3E9XA 3H6VA 1Y3NA 1R1NA 3BFTA 5CRYA 4XKRA 4HCWA 5KCJA 1F9BA 4FECA 4MNCA 4M1VA 3P7IA 1B5IA 4PF6A 5I57A 1MXXA 4NF8A 2UVIA 2ZMBA 3KN8A 4PF8A 4G8NA 1ZMGA 4RPOA 1A54A 2X26A 4OMBA 5I58B 4KCDA 4WXJA 1B1HA 2ZYOA 4DZ1A 1UIVA 3R6UA 3QIMA 4R73A 4GX4A 2F8DA 1XI6A 1LAFE 3MBPA 3N6TA 1SPIA 4JXIA 2R6GE 5L9SA 3BIGA 2ABHA 4PFBA 3V5AA 1LSTA 3LBSA 4U4XA 4F29A 2RCBA 3E4RA 3SEXA 1LBZA 4R75A 4PDHA 3K4UA 2XXHA 3H4ZA 1FBEA 3K6WA 1QVSA 3KN7A 1IZ1A 3RNNA 1NUZA 4ZEKA 2V3QA 3H3GA 4P3LA 5IZ1A 1G0HA 3CFLA 3EPEA 3FD3A 4NG7A 1DPPA 1MS7A 4RPNA 4DLDA 3MW0A 1ZBMA 2O51A 1IEJA 3DP4A 2HAUA 3O6GA 3Q25A 1M5FA 1PB8A 4NWCA 3MVXA 4H0WA 1RYXA 1B05A 3QMFA 2V25A 4N07A 3G7WA 3PV0E 3PMXA 3TKDA 1NV6A 1CNQA 2PBWA 3D1RA 3H03A 4OEUA 1FQBA 3LUYA 4PE3A 1OVBA 1NMUA 4FBPA 4TLLB 4DI4B 4JSDA 1DOTA 4AB5A 2XWIA 1BK4A 1MY4A 4O7MA 2GHAA 2OWZA 5I2KB 3LSXA 4JWOA 3T66A 5AA2B 3BKIB 2ALUA 2WBDA 4DDDA 5LOMA 4PETA 4KQPA 3ECRA 1ZKBA 3IOWA 1ZLQA 4PFIA 2VPOA 1SQYA 1L5TA 1MY1A 5EQ8A 2VPNA 1NV1A 4N17A 3VDFA 1CB6A 2DVCA 3SETA 1N7XA 2PFYA 3IFCA 2Q2CA 1K9ZA 1FPGA 3MWBA 2YLNA 1ZIUA 4NF6B 4OETA 4X48A 2X7PA 4KD5A 3H7MA 2FNCA 4U23A 3CHGA 3MZ1A 4P56A 4P1EA 5HM4B 3FXBA 1D4NA 1I6BA 4IO4A 3PU5A 4OZ9A 1QJMA 3FIRA 3TTNA 3U8QA 4N81A 1UTBB 2QS4A 4P11A 1NV3A 3A09A 2CEYA 3RPWA 1JVXA 3UK4A 4HW8A 5I59A 2XXRA 3DELB 2B3BA 2VT5A 4JWYA 5J1DA 1QUKA 1USYE 2XXXA 2G29A 2ZZWA 3FJ7A 4YZZA 3SEWA 1FPEA 1QKAA 1MXWA 5IGAA 2ONSA 3VLWA 4JVDA 5FHMA 3CIJA 3IAZA 1A8FA 3VVEA 1DTGA 3SESA 2O7UA 3U1OA 1HSEA 3MP1A 4H8JA 4RNSA 2BJIA 1VDWA 3C32A 1LBWA 4GXAA 1O7TA 1EYKA 2H4IA 1P1QA 3FVOA 1ATGA 3SEYA 2VGQA 5CMBA 1VFEA 4BDRA 2XXYA 4X8RA 2DWHA 5EQ9A 2QMWA 3MSTA 1AH5A 4QSCA 1NNTA 1N7WA 2OWTA 1RDXA 4F2OA 2PX1A 3LUZA 3CR9A 3OEMA 1MQDA 4LZ8A 2FIXA 2MKZA 3GBAA 4NF4B 3KOTA 5F7VA 1LBBA 4PBQA 3G3FA 3OO9A 1NNPA 1FBPA 1EZPA 2CZHA 3A29A 4GX6A 5J16A 1URSA 3ZS6A 4PBHA 4QFKA 3OD7A 2XXPA 5DTBA 1PBQA 3HCQA 3S2VA 2PCRA 3PUYE 4Q8RA 2Q74A 4HS7A 3C34A 1FTKA 5BWJA 3GYYA 3ILUB 5HPQA 2OX3A 4OESA 1EH3A 3PMWA 3N5LA 1FPKA 4RJZA 2RINA 3T1BA 3EN3A 1MQHA 3KEIA 4RXLA 3LC8A 1B3GA 2FVZA 2M8CA 5EQ7A 5AE4A 5I56A 4R9GA 1FQEA 4OHNA 3QSLA 3KBZA 2XXKA 2FA7A 3T93B 3FJGA 3HO7A 5M2VA 2PT1A 4FORA 2RC7A 3AXFA 2LAOA 4YICA 1BLFA 4GWZA 2RKMA 3NOHA 4EF1A 5ELVA 3K0VA 4KHZE 3OENA 3L6GA 1JW4A 3K6XA 5DEXA 4ECFA 4GWSA 4F3SA 1OVTA 3B8BA 2F35A 3G3HA 4I8CA 2D21A 4N8YA 1I6QA 4X1BA 3S9NC 3K02A 4JB7A 4FAJA 1B40A 4PCDA 4FE8A 5JTYA 3MUQA 1UTHA 2DDKA 2DWIA 4U1OA 2GHBA 4F3GA 2O84X 2F7BA 1B3FA 2QS3A 1LEVA 4L17A 1B3LA 2YJPA 1MM6A 5CMCA 2GQ1A 1Y1ZA 4ELQA 1ELJA 4F31B 4NX1A 3HN0A 5A5LA 5EYFA 3CG3A 4OVJA 2OZZA 5ITPA 4F3PA 4P0IA 2P3VA 3IO6A 4GQOA 4KFQA 1N76A 5IZ3A 4YU0A 4PFWA 4DCXA 2F36A 1LFHA 2ESNA 4RYAA 4XKPA 5ICQA 1LAGE 1SI0A 1RDYA 1SW1A 1SI1A 4EUOA 1PC3A 4DXBA 1R9QA 4QBAA 1FBHA 3UA8A 1MY3A 2XWVA 4Q5TA 3O28A 2O6AA 3TTLA 4DIGA 4HE0A 5I2NB 4BDLA 1QW0A 2HCAA 4XTCQ 2Z8FA 2FIEA 1B4ZA 2THIA 1TT1A 1IQ7A 3B7DA 3M3KA 5H8QB 4X9TA 4I3EA 4OANA 1POY1 3IOVA 4ZZEA 1AIVA 5I7IA 1N84A 1LLSA 4MBPA 3O2AA 1FPBA 4H67A 4NWDA 2HFBA 4GWWA 1XS5A 3QUJA 1FBFA 3EHSA 1FPJA 1JVYA 5EHMA 5KDTA 3F11A 1NUWA 1Q9DA 2IEEA 3C9HA 1WODA 4R72A 5CMKA 3UN6A 2ONRA 4KPTA 3I3VA 5AA2D 3RLFE 4YAHX 2I3WA 2WYPA 2HAVA 2DE3A 4R2BA 3UP9A 2CZKA 4C1UA 5FHNA 2F7AA 2WKYA 2CMOA 5A5XB 1SVXB 4XKNA 1A99A 3MVZA 4YMBA 4PC9A 3G3IA 3DP6A 3C31A 4LA9A 1VSOA 3TDJA 2QVRA 2Z8EA 4NF5B 4OFOA 2F3DA 5H8NB 3H6UA 1H43A 4JVCA 5AA4B 3IL1B 4LQ2A 3OSRA 2V84A 1B5JA 4NMYA 4U1ZA 1TXFA 1LAHE 4U21A 3TMGA 4NF0A 3E3KA 1HSLA 3D4CA 3IB2A 5I58A 5CM6A 1MXZA 5ICTA 3HFUA 1SBPA 4YB5A 5KCJB 2DE4A 4PFRA 3LSLA 3ISPA 4FIMA 4O8MA 1SW4A 1OLAA 1FBGA 3IJXB 1FTMA 1A8EA 1N3XA 1CE2A 4ND9A 1USYH 1MQIA 2Z23A 4P47A 1Q1KA 3ODBA 4ZEFA 1UQWA 4X04A 2V3UA 3KBRA 3H6TA 1H3DA 4ELRA 1URDA 2O68A 1FPFA 1EYIA 1Y20A 3EQ1A 3K00A 4OVQA 4MJOA 1MRPA 1XHYA 2Q2AA 5CBRA 4NHBA 2Z8DA 1SW5A 2NOOA 4KR5A 2O1LA 3OO7A 3CSGA 4PAIA 3MP6A 1P1WA 1LBCA 3TTRA 1PEBA 1XVXA 5TPAB 3KJ7A 2Q88A 1G0IA 5FTIA 3TQWA 2VOZA 4BDQA 2PMSA 4GWYA 3KSXA 3LR1A 1JNFA 3GXAA 1DBZA 1SYIA 5L9OA 1B58A 3SDFA 4MIJA 2B4MA 3QUFA 4F1UA 3FVKA 5HBCA 1FCKA 2XHDA 2ZNSA 3FUZA 4N8GA 2R9JA 2P2AA 5I2KA 5ITOA 5AA2A 1B51A 1QULA 4KXPA 3HV1A 4OVSA 1AMFA 4MMPA 2UVHA 4ZECA 3LV0A 4N13A 3H06B 4QXDA 4F2QA 4N6PA 2P0SA 3T96B 3FXUA 3D4GA 2QPQA 4ZE9A 4AS5A 3OELA 5CC2A 1YAEA 1GV8A 3HHFA 2XX9A 3OMBA 1FBDA 1IMFA 3B6TA 4PDDA 1O63A 1DTZA 5IZZA 2D5WA 1JEUA 3JYRA 2RC8A 4WKMA 1XOCA 3RN8A 4X1DA 1N3WA 1B5HA 2DXRA 4NF6A 2XX8A 1II5A 1LCFA 4MF3A 1ANFA 1Y4CA 3K1NA 1S7YA 5K2XA 1US4A 5DYHA 4ESXA 4U2RA 3KJTA 2NXOA 3RUMA 4P1LA 1BTJA 1LAXA 1SD3A 2OBGA 4YKKA 3V8XB 4PAKA 1RDZA 2VD3A 4IGRA 1IXCA 1UTBA 3FXQA 4QFOA 1I69A 1KA0A 1NH8A 4P8BA 4NGUA 1T0KA 1TWYA 4HXVA 5FBPA 1URGA 1FTJA 4FEDA 2OK2A 3QYTA 2ZYKA 2I4CA 1R9LA 4H5GA 2UVJA 4PAFA 3FV2A 3ZSFA 2UYFA 3KSJA 3T9XB 4QHQA 2DWJA 3S4UA 3MZBA 1QUJA 5CI5A 4OEVA 2Q8MA 1FPIA 4GXSB 2Q8JA 4THIA 4IR8A 2KR0A 1IMBA 1H45A 3KGCA 4N4UA 4G4PA 2ZXTA 4IY6A 1YZ0A 1B52A 1BIYA 2I58A 5I59B 1LCTA 4IO7A 4QSDA 3IX1A 3EKIA 3TTKA 2HZKA 4GL8A 3MJNA 5IKBA 1Y1MA 1LGBC 4QFLA 2DOJA 3TCGA 1B7UA 4OERA 5DVJA 4AS4A 4O94A 3SERA 2I4BA 3N94A 3RT6B 2XWKA 1PB9A 4ONYA 2VP1A 4NF4A 2HHMA 1J1NA 4KI0E 2CZLA 3PUXE 1NV5A 1N04A 2R8TA 4O3CA 1B0LA 1LBVA 4XEQA 3FZVA 3IJOB 2ONKE 3S9LC 3FASA 3MVYA 4N6KA 2F78A 3ZKKA 1NL5A 4LATA 3IB1A 2Y7RA 4Z7EA 2XXUA 3MYUA 3CFZA 4Q30B 2R71A 3FATA 5L9MA 1FBCA 4JSOA 3G3KA 4Z0IA 4OYVA 5AA3A 4I40A 3TCFA 4IO3A 1YPNA 4GBVA 4G68A 3TFLA 1AOVA 1B3EA 1NH7A 1B4HA 1WDNA 4XFEA 4ZEIA 3V89B 1MQGA 3Q29A 3T9VA 3K2DA 5DVFA 3Q28A 1MPDA 1US5A 5EYGA 1XVYA 4P9KA 2PVUA 4OFJA 5TU0A 1S50A 4ELOA 3CSBA 2W7YA 3PPNA 5FTHA 3GLBA 1NNKA 1VE4A 1JP4A 1ZU0A 4GF8A 4H6DA 1D3KA 3TODA 1NKXA 2WYKA 2F97A 1YYZA 4OVRA 4F19A 3S9MC 1ZTYA 5I56B 4C1TA 3RY3A 4G61A 3MVWA 3TELA 1H44A 4PFTA 3RPLB 3PGFA 3I6VA 1JQFA 2AL4A 2QRYA 2L5VA 2H5YA 3MC2A 4MFIA 2DS9A 3IK6B 2XXIA 4WEDA 2DWAA 3K01A 2E1SA 4GOTA 2GRVA 3KC0A 1PDAA 1B6HA 1FJ9A 4OQOA 4PFUA 2HPGA 4ELPA 2DP8A 1K9YA 4H5FA 2XX7A 1H76A 2WEFA 5B7DA 2X7QA 4MHFA 4H46A 2Y7IA 2FHYA 4ZEBA 4TLMB 3MAMA 2DQVA 1IMDA 4IO6A 1Y3PA 4UACA 2QVUA 1FTOA 1IMCA 3U72A 1RYOA 1M5EA 3KOSA 2YPNA 5H8HB 2AYSA 1VFDA 1YCJA 2B65A 2QMXA 1FJ6A 3C35A 3IORA 4HE1A 2UXAA 3RYDA 4U4SA 2QSXA 1IIWA 3M3FA 4MX6A 3OXNA 1DK4A 5I2NA 3TAJA 4K3FA 4GWUA 4PP0A 2XXWA 3W9WA 4GLIA 3ONMA 1GVCA 1IMAA 5IZ3B 1B0HA 4EQBA 5H8FB 4R2FA 2KLFA 3T9UA 5EYHA 4F1VA 4H45A 5TP9B 2PFZA 4LN5A 3BIHA 2RC9A 1NUXA 5CBSA 5F24A 1MDP1 3PUVE 3KZGA 4HE2A 3HPIA 3UORA 3PD9A 4KYEA 4R6HA 1PB7A 2F7CA 3BFUA 4PGNA 2PYYA 2I3VA 1FQCA 1IXGA 4F22A 4H8IA 1NNFA 2A5SA 3SEUA 2UVGA 1JW5A 4XF5A 3U94A 4IGTA 4PE5B 1I6AA 1NV7A 4NQ8A 3N26A 2QVVA 1FW0A 2FYIA 5A5XA 3TTMA 1VR5A 1LB8A 1KZ8A 4M4GA 1M5DA 4QFPA 1IMEA 3FVGA 2A5TB 3K1PA 2JJKA 3PUZE 2HZLA 3MZ9A 4XIGQ 4NTLA 2FBPA 3VXBA 3K6UA 4OWDA 3C36A 1MH3A 3L6HA 4O3BA 1LBYA 2B3FA 4G8MA 5AA4A 3FBPA 3GBBA 3TYHA 1B46A 2NVUB 2QL3A 1FPDA 1B32A 2P1SA 4OENA 1MPBA 2KQZA 4MLVA 2I6EA 4GWOA 3UIFA 3EF7A 2HXWA 5EQAA 4JBZA 2OJTA 2H9BA 3V83A 3PPPA 4BDNA 3Q26A 5K2YA 1B7HA 4GIZA 3MP8A 1B7ZA 2B4LA 3MQ9A 3Q27A 3CFXA 4OFLA 4DE8A 2O69A 3O6IA 5I57B 3M8UA 4TOZA 1SW2A 4NF8B 1LBXA 4AQ4A 2NWJA 3UGWA 2O7IA 1QGXA 1JW1A 3C4MA 1FRPA 3M3LA 1Y4TA 4EF2A 1IXHA 3KFMA 3DLNA 3CRBA 2QS2A 4DI3D 2BJJX 1EYJA 4DXUA 3A3UA 1MXVA 3TCHA 1UIUA 1IUDA 3QXMA 3LSFB 4MEVA 4LZ7A 4MH5A 4NAPA 4FATA 5DT6A 1GTKA 5TPAA 3PTYA 5BUUA 4C0RA 2REJA 2ZZVA 1MQJA 4F39A 4ESWA 1LB9A 2GH9A 2VHAA 1D9VA 4LVQA 2Y5KA 1OQHA 3CVGA 4ZEDA 3JV9A 2UYEA 1P1NA 4MAGA 4IO5A 3E13X 4RA1A 1MXYA 1NV2A 1NUYA 2CEXA 4YKJA 3DM0A 4ISUA 3RTWB 5JEIA 2QS1A 3K6VA 2P3NA 4YMAA 5DVIA 3GZGA 1EZOA 2Q9TA 3C33A 3FXRA 3TZAA 1DCUA 3RGYA 3VVDA 4I1DA 1Z7NE 2OLBA 1MG1A 3T0JA 1IITA 3R26A 2V4CA 1FQAA 4HTGA 3IOTA 4I62A 1OQGA 1XT8A 3PPRA 2XXVA 2I48A 4I9DA 3O9PA 3SKPA 1OIBA 1NFTA 4YB7A 4E0WA 1BKAA 1O64A 1B2HA 3ZKLA 2Y7WA 2VD2A 5ESYA 3CG1A 4ZE8A 2ZNTA 3IR1A 3E78A 3O6HA 4QFNA 3HHGA 4E0XA 4MNIA 3KG2A 4H1XA 3MPKA 2H99A 5I84A 4BDMA 4OXVA 2WX9A 3KN3A 4WEPA 1LFGA 4KYSA 4GX3A 1MM7A 1JETA 5L8DA 4Q0CA 1NV0A 2XXQA 4JWXA 5I5PA 4YB6A 4DXCA 4RK9A 4G77A 1P99A 4F18A 2REGA 3ROJA 1Y9UA 1INPA 2DXYA 4O7IA 5KZTA 2HQ0A 4OVTA 4F3BA 5F1QA 5FHOA 1FQDA 2DYXA 3G3GA 5JK4A 3U92A 1DMBA 2QJEA 2Y7PA 3DP8A 1GR2A 4QRZA 3TUSA 1MH4A 4RY1A 2F6PA 2OWSA 4RK2A 1EZ9A 1B1XA 4NN3A 4G2ZA 4IO2A 3VLUA 1QUIA 5DW8A 1M5CA 3T22A 3RQTA 1WVJA 2ZYNA 2ANJA 4MLQA 1XC1A 2F34A 3IB0A 1SDXA 3U65A 3K1MA 4F1YA 4LQ5A 3LSWA 3OO8A 4AB6A 3VFJA 1QKBA 3IO4A 1M5BA 1OMPA 3SZPA 1RKMA 4P0GA 3PMVA 3VVFA 3W15C 4GVOA 2XXTA 1MDQA 3R7XA 2DVZA 4KCCA 5H8SA 1KA1A 4R9FA 4ZDMA 2G93A 1NI9A 2HEUA 4YKPA 1FSAA 3VLVA 3EHUA 4KYDA 2ZZXA 1YXIA 1AWBA 3WAFA 2XD3A 4GFRA 5T3JA 4G8HA 2RCAA 2WBBA 1B3HA 3RTFB 2QFLA 4R6YA 3CI8A 2Y84A 5IM2A 3VV5A 2H25A 4OA4A 1D9QA 1POTA 4OVPA 2GFEA 4H65A 2Y7KA 3O66A 4R6KA 3FV1A 1Y3QA 2HXRA 5LTCA 4EQ7A 3MPLA 2DSFA 3E79A 3TQLA 2NUVA 1PBPA 2H98A 5B70A 4IY5A 4G68B 4POXA 4QSEA 2F3BA 5ET5A 1MY2A 1BP5A 3RPLA 1Z7ME 1N0TA 3N6UA 4NE4A 1JEVA 4N91A 1KWHA 4LONB 2XWOA 4GBWA 3VXCA 2AL5A 5ET8A 4PGPA 2O1MA 2Q89A 4DCYA 3FGSA 4N6DA 3OO6A 5ISUA 3O29A 4O3AA 1P1UA 5CMMA 4BDOA 3USDA 1S9TA 4HCYA 5DEXB 4BLAA 1MPCA 2F6GA 1B9JA 3FVNA 4UABA 2V93A 1Q35A 4FJPA 4GRKA 3B6WA 3OEKA 3I5OA 2OCUA 1NV4A 2ZYMA 4GWXA 2I0CA 5H8HA 5JTYB 1UTHB 1A7LA 4EDPA 1R6ZA 1LFIA 1DPEA 4I3YA 3VE1B 4EXKA 5I3SA 1SYHA 4OTEA 3W9VA 2CZIA 4LZ5A 2XD2A 2IA4A 4QF9A 1FPLA 3PPQA 5ET6A 4R74A 4GD5A 1MY0A 2Z22A 4N15A 1MXUA 3RT8A 3JZJA 3A3CA 2F5XA 1FQFA 3TEPA 4XXUA 5H8QA 5H8FA 5EHSA 2PT2A 1HSJA 4G68C 5TP9A 3IFAA 5AA1A 2E0SA 4JVIA 3G3JA 1FTAA 3QK6A 4ZS9A 4YKIA 1TFAA 3THIA 2I0BA 4JDFA 3TPAA 3U93A 3QAXA 4MNPA 3IOUA 4FEBA 2DE2A 3EHTA 2I49A 3HSTA 1AL3A 3O97A 4XKQA 5IAIA 4LUBA 1A40A 2AIXA 3SEVA 4UA8A 3H6WA 2A5TA 2RF1A 2Y5LA 3S9EA 4PFYA 1ZJLA 3B6QA 1IXIA 3PD8A 4POWA 3OOAA 4EQ9A 3ILTB 2XA5A 3OSQA 1TFDA 4LP2B 5KDTB 3KC1A 4EXLA 1YTVA 5LDZA 1OLCA 4NEDA 4NF5A 4PTKA 1P1OA 4IB2A 5H8NA 3WAEA 3BBRA 3PUWE 5ET7A 2ZNUA 1D9YA
chains in the Genus database with same CATH topology
4PQJA 1A55A 2V3TA 4U22A 4ZZAA 1EU8A 3FJMA 4GL0A 2D3IA 3PPOA 3T9HB 4TQUQ 1GGGA 1DSNA 1FTLA 3E9XA 3H6VA 1Y3NA 1R1NA 3BFTA 5CRYA 4XKRA 4HCWA 5KCJA 1F9BA 4FECA 4M1VA 3P7IA 1B5IA 5I57A 1MXXA 4NF8A 2UVIA 2ZMBA 3KN8A 4G8NA 1ZMGA 4RPOA 1A54A 2X26A 4OMBA 5I58B 4KCDA 4WXJA 1B1HA 2ZYOA 4DZ1A 1UIVA 3R6UA 3QIMA 4R73A 2F8DA 1LAFE 3MBPA 3N6TA 4JXIA 2R6GE 5L9SA 2ABHA 3V5AA 1LSTA 3LBSA 4U4XA 4F29A 2RCBA 3E4RA 3SEXA 4R75A 3K4UA 2XXHA 3H4ZA 3K6WA 1QVSA 3KN7A 1IZ1A 3RNNA 4ZEKA 2V3QA 3H3GA 3CFLA 3EPEA 3FD3A 1DPPA 1MS7A 4RPNA 4DLDA 3MW0A 1ZBMA 2O51A 1IEJA 3DP4A 2HAUA 3O6GA 3Q25A 1M5FA 1PB8A 4NWCA 3MVXA 4H0WA 1RYXA 1B05A 2V25A 4N07A 3G7WA 3PV0E 3PMXA 3TKDA 2PBWA 3H03A 4OEUA 1FQBA 3LUYA 1OVBA 1NMUA 4TLLB 4JSDA 1DOTA 4AB5A 1MY4A 2GHAA 5I2KB 3LSXA 4JWOA 3T66A 5AA2B 3BKIB 2ALUA 4DDDA 5LOMA 4PETA 4KQPA 3ECRA 1ZKBA 3IOWA 1ZLQA 1SQYA 1L5TA 1MY1A 3VDFA 1CB6A 2DVCA 3SETA 1N7XA 2Q2CA 3MWBA 2YLNA 1ZIUA 4NF6B 4OETA 4X48A 2X7PA 4KD5A 3H7MA 2FNCA 4U23A 3MZ1A 5HM4B 1D4NA 1I6BA 4IO4A 3PU5A 4OZ9A 1QJMA 3FIRA 3TTNA 3U8QA 1UTBB 2QS4A 4P11A 3A09A 3RPWA 1JVXA 3UK4A 4HW8A 5I59A 2XXRA 3DELB 2B3BA 4JWYA 5J1DA 1QUKA 1USYE 2XXXA 2G29A 3FJ7A 4YZZA 3SEWA 1QKAA 1MXWA 2ONSA 3VLWA 5FHMA 3CIJA 3IAZA 1A8FA 3VVEA 1DTGA 3SESA 2O7UA 3U1OA 1HSEA 3MP1A 4H8JA 4RNSA 3C32A 4GXAA 1O7TA 2H4IA 1P1QA 3FVOA 1ATGA 3SEYA 2VGQA 5CMBA 1VFEA 4BDRA 2XXYA 2DWHA 2QMWA 1AH5A 4QSCA 1NNTA 1N7WA 2OWTA 4F2OA 2PX1A 3CR9A 3OEMA 1MQDA 4LZ8A 3GBAA 4NF4B 3KOTA 5F7VA 1LBBA 3G3FA 3OO9A 1NNPA 1EZPA 1URSA 3ZS6A 4QFKA 3OD7A 2XXPA 5DTBA 1PBQA 3HCQA 3S2VA 3PUYE 4Q8RA 4HS7A 3C34A 1FTKA 5BWJA 3ILUB 5HPQA 4OESA 1EH3A 3PMWA 3N5LA 4RJZA 2RINA 3EN3A 1MQHA 3KEIA 4RXLA 3LC8A 1B3GA 2M8CA 5AE4A 5I56A 4R9GA 1FQEA 4OHNA 3QSLA 2FA7A 3T93B 3FJGA 3HO7A 5M2VA 2PT1A 4FORA 2RC7A 3AXFA 2LAOA 4YICA 1BLFA 2RKMA 4EF1A 5ELVA 3K0VA 4KHZE 3OENA 3L6GA 1JW4A 3K6XA 5DEXA 4ECFA 4F3SA 1OVTA 2F35A 3G3HA 4I8CA 2D21A 4X1BA 1I6QA 3S9NC 3K02A 4JB7A 4FAJA 1B40A 4FE8A 5JTYA 3MUQA 1UTHA 2DWIA 4U1OA 2GHBA 4F3GA 2O84X 2F7BA 1B3FA 2QS3A 4L17A 1B3LA 2YJPA 1MM6A 5CMCA 1Y1ZA 4ELQA 1ELJA 4F31B 3HN0A 5EYFA 3CG3A 4OVJA 2OZZA 5ITPA 4F3PA 4P0IA 3IO6A 4GQOA 4KFQA 1N76A 4YU0A 4PFWA 4DCXA 2F36A 1LFHA 2ESNA 4RYAA 4XKPA 5ICQA 1LAGE 1SI0A 1SW1A 1SI1A 4EUOA 1PC3A 4DXBA 1R9QA 3UA8A 1MY3A 4Q5TA 3O28A 2O6AA 3TTLA 4DIGA 5I2NB 4BDLA 1QW0A 2HCAA 4XTCQ 2Z8FA 1B4ZA 2THIA 1TT1A 1IQ7A 3B7DA 3M3KA 5H8QB 4X9TA 1POY1 3IOVA 4ZZEA 1AIVA 1N84A 1LLSA 4MBPA 3O2AA 4H67A 4NWDA 2HFBA 1XS5A 3QUJA 3EHSA 1JVYA 5EHMA 5KDTA 3F11A 2IEEA 3C9HA 1WODA 4R72A 5CMKA 3UN6A 2ONRA 4KPTA 3I3VA 5AA2D 3RLFE 4YAHX 2I3WA 2HAVA 2DE3A 4R2BA 3UP9A 4C1UA 5FHNA 2F7AA 2WKYA 2CMOA 5A5XB 1SVXB 4XKNA 1A99A 3MVZA 4YMBA 3G3IA 3DP6A 3C31A 4LA9A 1VSOA 3TDJA 2Z8EA 4NF5B 4OFOA 5H8NB 3H6UA 1H43A 5AA4B 3IL1B 4LQ2A 3OSRA 2V84A 1B5JA 4NMYA 4U1ZA 1TXFA 1LAHE 4U21A 3TMGA 3E3KA 1HSLA 3D4CA 3IB2A 5I58A 5CM6A 1MXZA 5ICTA 1SBPA 4YB5A 5KCJB 2DE4A 3LSLA 4FIMA 1SW4A 1OLAA 3IJXB 1FTMA 1A8EA 1N3XA 1CE2A 4ND9A 1USYH 1MQIA 2Z23A 1Q1KA 3ODBA 4ZEFA 1UQWA 2V3UA 3KBRA 3H6TA 1H3DA 4ELRA 1URDA 2O68A 1Y20A 3EQ1A 3K00A 1MRPA 1XHYA 2Q2AA 5CBRA 2Z8DA 1SW5A 2NOOA 4KR5A 2O1LA 3OO7A 3CSGA 3MP6A 1P1WA 1LBCA 3TTRA 1PEBA 1XVXA 5TPAB 3KJ7A 2Q88A 5FTIA 3TQWA 2VOZA 4BDQA 2PMSA 3KSXA 3LR1A 1JNFA 3GXAA 1SYIA 5L9OA 1B58A 3SDFA 3QUFA 4F1UA 3FVKA 5HBCA 1FCKA 2XHDA 2ZNSA 3FUZA 2R9JA 2P2AA 5I2KA 5ITOA 5AA2A 1B51A 1QULA 3HV1A 1AMFA 2UVHA 4ZECA 4N13A 3H06B 4F2QA 4N6PA 2P0SA 3T96B 3FXUA 3D4GA 2QPQA 4ZE9A 3OELA 5CC2A 1YAEA 1GV8A 3HHFA 2XX9A 3OMBA 3B6TA 1O63A 1DTZA 2D5WA 1JEUA 3JYRA 2RC8A 4WKMA 1XOCA 3RN8A 4X1DA 1N3WA 1B5HA 2DXRA 4NF6A 2XX8A 1II5A 1LCFA 4MF3A 1ANFA 1Y4CA 3K1NA 1S7YA 5K2XA 1US4A 5DYHA 4ESXA 4U2RA 3KJTA 2NXOA 3RUMA 1BTJA 1LAXA 1SD3A 2OBGA 4YKKA 3V8XB 2VD3A 4IGRA 1IXCA 1UTBA 3FXQA 4QFOA 1I69A 1NH8A 1T0KA 1TWYA 1URGA 1FTJA 4FEDA 2OK2A 3QYTA 2ZYKA 2I4CA 1R9LA 4H5GA 2UVJA 3FV2A 3ZSFA 2UYFA 3KSJA 3T9XB 4QHQA 2DWJA 3S4UA 3MZBA 1QUJA 5CI5A 4OEVA 4GXSB 2Q8JA 4THIA 1H45A 3KGCA 4G4PA 2ZXTA 4IY6A 1B52A 1BIYA 2I58A 5I59B 1LCTA 4IO7A 4QSDA 3IX1A 3TTKA 2HZKA 4GL8A 3MJNA 5IKBA 1Y1MA 1LGBC 4QFLA 2DOJA 3TCGA 1B7UA 4OERA 5DVJA 3SERA 2I4BA 3N94A 3RT6B 1PB9A 4ONYA 2VP1A 4NF4A 1J1NA 4KI0E 2CZLA 3PUXE 1N04A 4O3CA 1B0LA 3FZVA 3IJOB 2ONKE 3S9LC 3FASA 3MVYA 2F78A 3ZKKA 1NL5A 4LATA 3IB1A 2Y7RA 4Z7EA 2XXUA 3CFZA 4Q30B 2R71A 3FATA 5L9MA 4JSOA 3G3KA 4Z0IA 4OYVA 5AA3A 3TCFA 4IO3A 1YPNA 4G68A 3TFLA 1AOVA 1B3EA 1NH7A 1WDNA 1B4HA 4ZEIA 3V89B 1MQGA 3Q29A 3T9VA 3K2DA 5DVFA 3Q28A 1MPDA 1US5A 1XVYA 2PVUA 4OFJA 5TU0A 1S50A 4ELOA 3CSBA 2W7YA 3PPNA 5FTHA 3GLBA 1NNKA 1VE4A 1ZU0A 4GF8A 4H6DA 1D3KA 3TODA 1NKXA 2F97A 4F19A 3S9MC 1ZTYA 5I56B 4C1TA 3RY3A 3MVWA 3TELA 1H44A 4PFTA 3PGFA 3I6VA 1JQFA 2AL4A 2QRYA 2H5YA 3MC2A 4MFIA 2DS9A 3IK6B 2XXIA 4WEDA 2DWAA 3K01A 2E1SA 4GOTA 2GRVA 1PDAA 1B6HA 4OQOA 4PFUA 4ELPA 2DP8A 4H5FA 2XX7A 1H76A 5B7DA 2X7QA 2Y7IA 4ZEBA 4TLMB 3MAMA 2DQVA 4IO6A 1Y3PA 4UACA 1FTOA 3U72A 1RYOA 1M5EA 3KOSA 2YPNA 5H8HB 2AYSA 1VFDA 1YCJA 2B65A 2QMXA 3C35A 3IORA 2UXAA 4U4SA 2QSXA 1IIWA 3M3FA 3OXNA 5I2NA 3TAJA 4K3FA 4PP0A 2XXWA 3W9WA 4GLIA 3ONMA 1GVCA 1B0HA 4EQBA 5H8FB 4R2FA 2KLFA 3T9UA 4F1VA 5TP9B 2RC9A 5CBSA 1MDP1 3PUVE 3KZGA 3HPIA 3UORA 3PD9A 4KYEA 4R6HA 1PB7A 2F7CA 3BFUA 2PYYA 2I3VA 1FQCA 1IXGA 4F22A 4H8IA 1NNFA 2A5SA 3SEUA 2UVGA 1JW5A 3U94A 4IGTA 4PE5B 1I6AA 3N26A 1FW0A 2FYIA 5A5XA 3TTMA 1VR5A 1LB8A 4M4GA 1M5DA 4QFPA 3FVGA 2A5TB 3K1PA 3PUZE 2HZLA 3MZ9A 4XIGQ 4NTLA 3VXBA 3K6UA 4OWDA 3C36A 1MH3A 3L6HA 4O3BA 2B3FA 4G8MA 5AA4A 3GBBA 3TYHA 1B46A 2NVUB 2QL3A 1B32A 2P1SA 4OENA 1MPBA 4MLVA 2I6EA 4GWOA 3UIFA 3EF7A 2HXWA 4JBZA 2OJTA 2H9BA 3V83A 3PPPA 4BDNA 3Q26A 5K2YA 1B7HA 4GIZA 3MP8A 1B7ZA 3MQ9A 3Q27A 3CFXA 4OFLA 4DE8A 2O69A 3O6IA 5I57B 3M8UA 4TOZA 1SW2A 4NF8B 4AQ4A 2NWJA 3UGWA 2O7IA 1JW1A 3C4MA 3M3LA 1Y4TA 4EF2A 1IXHA 3KFMA 3DLNA 3CRBA 2QS2A 2BJJX 4DXUA 3A3UA 1MXVA 3TCHA 1UIUA 1IUDA 3QXMA 3LSFB 4LZ7A 4MH5A 4FATA 5DT6A 1GTKA 5TPAA 5BUUA 4C0RA 2REJA 1MQJA 4F39A 4ESWA 1LB9A 2GH9A 2VHAA 1D9VA 4LVQA 1OQHA 3CVGA 4ZEDA 3JV9A 2UYEA 1P1NA 4IO5A 3E13X 4RA1A 1MXYA 4YKJA 3DM0A 4ISUA 3RTWB 5JEIA 2QS1A 3K6VA 4YMAA 5DVIA 3GZGA 1EZOA 2Q9TA 3C33A 3FXRA 3TZAA 3RGYA 3VVDA 4I1DA 1Z7NE 2OLBA 1MG1A 1IITA 3R26A 1FQAA 4HTGA 3IOTA 4I62A 1OQGA 1XT8A 3PPRA 2XXVA 2I48A 4I9DA 3O9PA 3SKPA 1OIBA 1NFTA 4YB7A 4E0WA 1BKAA 1O64A 1B2HA 3ZKLA 2Y7WA 2VD2A 3CG1A 4ZE8A 2ZNTA 3IR1A 3O6HA 4QFNA 3HHGA 4E0XA 3KG2A 4H1XA 3MPKA 2H99A 5I84A 4BDMA 4OXVA 3KN3A 4WEPA 1LFGA 4KYSA 1MM7A 1JETA 5L8DA 4Q0CA 2XXQA 4JWXA 4YB6A 4DXCA 4RK9A 4G77A 1P99A 4F18A 2REGA 1Y9UA 2DXYA 5KZTA 2HQ0A 4F3BA 5F1QA 5FHOA 1FQDA 2DYXA 3G3GA 5JK4A 3U92A 1DMBA 2QJEA 2Y7PA 3DP8A 1GR2A 4QRZA 3TUSA 1MH4A 4RY1A 2F6PA 2OWSA 4RK2A 1EZ9A 1B1XA 4G2ZA 4IO2A 3VLUA 1QUIA 1M5CA 3T22A 3RQTA 1WVJA 2ZYNA 2ANJA 4MLQA 1XC1A 2F34A 3IB0A 1SDXA 3K1MA 4F1YA 4LQ5A 3LSWA 3OO8A 4AB6A 3VFJA 1QKBA 3IO4A 1M5BA 1OMPA 1RKMA 4P0GA 3PMVA 3VVFA 3W15C 4GVOA 2XXTA 1MDQA 3R7XA 2DVZA 4KCCA 5H8SA 4R9FA 4ZDMA 2G93A 2HEUA 4YKPA 3VLVA 3EHUA 4KYDA 3WAFA 2XD3A 4GFRA 4G8HA 2RCAA 1B3HA 3RTFB 4R6YA 3CI8A 2Y84A 3VV5A 2H25A 1POTA 2GFEA 4H65A 2Y7KA 3O66A 4R6KA 3FV1A 1Y3QA 4EQ7A 3MPLA 2DSFA 3TQLA 2NUVA 1PBPA 2H98A 5B70A 4IY5A 4G68B 4POXA 4QSEA 1MY2A 1BP5A 1Z7ME 1N0TA 3N6UA 4NE4A 1JEVA 1KWHA 4LONB 3VXCA 2AL5A 2O1MA 2Q89A 4DCYA 3FGSA 3OO6A 5ISUA 3O29A 4O3AA 1P1UA 5CMMA 4BDOA 3USDA 1S9TA 4HCYA 5DEXB 4BLAA 1MPCA 2F6GA 1B9JA 3FVNA 2V93A 1Q35A 4FJPA 4GRKA 3B6WA 3OEKA 3I5OA 2OCUA 2ZYMA 5JTYB 2I0CA 5H8HA 1UTHB 1A7LA 4EDPA 1R6ZA 1LFIA 1DPEA 3VE1B 4EXKA 1SYHA 4OTEA 3W9VA 4LZ5A 2XD2A 2IA4A 4QF9A 3PPQA 4R74A 4GD5A 1MY0A 2Z22A 1MXUA 3RT8A 3JZJA 3A3CA 2F5XA 1FQFA 3TEPA 4XXUA 5H8QA 5H8FA 5EHSA 2PT2A 1HSJA 4G68C 5TP9A 5AA1A 2E0SA 3G3JA 3QK6A 4ZS9A 4YKIA 1TFAA 3THIA 2I0BA 4JDFA 3TPAA 3U93A 3QAXA 3IOUA 4FEBA 2DE2A 3EHTA 2I49A 3HSTA 1AL3A 3O97A 4XKQA 5IAIA 4LUBA 1A40A 2AIXA 3SEVA 4UA8A 3H6WA 2A5TA 2RF1A 3S9EA 4PFYA 1ZJLA 3B6QA 1IXIA 3PD8A 4POWA 3OOAA 4EQ9A 3ILTB 3OSQA 1TFDA 4LP2B 5KDTB 4EXLA 1YTVA 1OLCA 4NEDA 4NF5A 3WAEA 1P1OA 4IB2A 5H8NA 3BBRA 3PUWE 2ZNUA 1D9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQJ A;  1A55 A;  2V3T A;  4U22 A;  4ZZA A;  1EU8 A;  3FJM A;  4GL0 A;  2D3I A;  3PPO A;  3T9H B;  4TQU Q;  1GGG A;  1DSN A;  1FTL A;  3E9X A;  3H6V A;  1Y3N A;  1R1N A;  3BFT A;  5CRY A;  4XKR A;  4HCW A;  5KCJ A;  1F9B A;  4FEC A;  4M1V A;  3P7I A;  1B5I A;  5I57 A;  1MXX A;  4NF8 A;  2UVI A;  2ZMB A;  3KN8 A;  4G8N A;  1ZMG A;  4RPO A;  1A54 A;  2X26 A;  4OMB A;  5I58 B;  4KCD A;  4WXJ A;  1B1H A;  2ZYO A;  4DZ1 A;  1UIV A;  3R6U A;  3QIM A;  4R73 A;  2F8D A;  1LAF E;  3MBP A;  3N6T A;  4JXI A;  2R6G E;  5L9S A;  2ABH A;  3V5A A;  1LST A;  3LBS A;  4U4X A;  4F29 A;  2RCB A;  3E4R A;  3SEX A;  4R75 A;  3K4U A;  2XXH A;  3H4Z A;  3K6W A;  1QVS A;  3KN7 A;  1IZ1 A;  3RNN A;  4ZEK A;  2V3Q A;  3H3G A;  3CFL A;  3EPE A;  3FD3 A;  1DPP A;  1MS7 A;  4RPN A;  4DLD A;  3MW0 A;  1ZBM A;  2O51 A;  1IEJ A;  3DP4 A;  2HAU A;  3O6G A;  3Q25 A;  1M5F A;  1PB8 A;  4NWC A;  3MVX A;  4H0W A;  1RYX A;  1B05 A;  2V25 A;  4N07 A;  3G7W A;  3PV0 E;  3PMX A;  3TKD A;  2PBW A;  3H03 A;  4OEU A;  1FQB A;  3LUY A;  1OVB A;  1NMU A;  4TLL B;  4JSD A;  1DOT A;  4AB5 A;  1MY4 A;  2GHA A;  5I2K B;  3LSX A;  4JWO A;  3T66 A;  5AA2 B;  3BKI B;  2ALU A;  4DDD A;  5LOM A;  4PET A;  4KQP A;  3ECR A;  1ZKB A;  3IOW A;  1ZLQ A;  1SQY A;  1L5T A;  1MY1 A;  3VDF A;  1CB6 A;  2DVC A;  3SET A;  1N7X A;  2Q2C A;  3MWB A;  2YLN A;  1ZIU A;  4NF6 B;  4OET A;  4X48 A;  2X7P A;  4KD5 A;  3H7M A;  2FNC A;  4U23 A;  3MZ1 A;  5HM4 B;  1D4N A;  1I6B A;  4IO4 A;  3PU5 A;  4OZ9 A;  1QJM A;  3FIR A;  3TTN A;  3U8Q A;  1UTB B;  2QS4 A;  4P11 A;  3A09 A;  3RPW A;  1JVX A;  3UK4 A;  4HW8 A;  5I59 A;  2XXR A;  3DEL B;  2B3B A;  4JWY A;  5J1D A;  1QUK A;  1USY E;  2XXX A;  2G29 A;  3FJ7 A;  4YZZ A;  3SEW A;  1QKA A;  1MXW A;  2ONS A;  3VLW A;  5FHM A;  3CIJ A;  3IAZ A;  1A8F A;  3VVE A;  1DTG A;  3SES A;  2O7U A;  3U1O A;  1HSE A;  3MP1 A;  4H8J A;  4RNS A;  3C32 A;  4GXA A;  1O7T A;  2H4I A;  1P1Q A;  3FVO A;  1ATG A;  3SEY A;  2VGQ A;  5CMB A;  1VFE A;  4BDR A;  2XXY A;  2DWH A;  2QMW A;  1AH5 A;  4QSC A;  1NNT A;  1N7W A;  2OWT A;  4F2O A;  2PX1 A;  3CR9 A;  3OEM A;  1MQD A;  4LZ8 A;  3GBA A;  4NF4 B;  3KOT A;  5F7V A;  1LBB A;  3G3F A;  3OO9 A;  1NNP A;  1EZP A;  1URS A;  3ZS6 A;  4QFK A;  3OD7 A;  2XXP A;  5DTB A;  1PBQ A;  3HCQ A;  3S2V A;  3PUY E;  4Q8R A;  4HS7 A;  3C34 A;  1FTK A;  5BWJ A;  3ILU B;  5HPQ A;  4OES A;  1EH3 A;  3PMW A;  3N5L A;  4RJZ A;  2RIN A;  3EN3 A;  1MQH A;  3KEI A;  4RXL A;  3LC8 A;  1B3G A;  2M8C A;  5AE4 A;  5I56 A;  4R9G A;  1FQE A;  4OHN A;  3QSL A;  2FA7 A;  3T93 B;  3FJG A;  3HO7 A;  5M2V A;  2PT1 A;  4FOR A;  2RC7 A;  3AXF A;  2LAO A;  4YIC A;  1BLF A;  2RKM A;  4EF1 A;  5ELV A;  3K0V A;  4KHZ E;  3OEN A;  3L6G A;  1JW4 A;  3K6X A;  5DEX A;  4ECF A;  4F3S A;  1OVT A;  2F35 A;  3G3H A;  4I8C A;  2D21 A;  4X1B A;  1I6Q A;  3S9N C;  3K02 A;  4JB7 A;  4FAJ A;  1B40 A;  4FE8 A;  5JTY A;  3MUQ A;  1UTH A;  2DWI A;  4U1O A;  2GHB A;  4F3G A;  2O84 X;  2F7B A;  1B3F A;  2QS3 A;  4L17 A;  1B3L A;  2YJP A;  1MM6 A;  5CMC A;  1Y1Z A;  4ELQ A;  1ELJ A;  4F31 B;  3HN0 A;  5EYF A;  3CG3 A;  4OVJ A;  2OZZ A;  5ITP A;  4F3P A;  4P0I A;  3IO6 A;  4GQO A;  4KFQ A;  1N76 A;  4YU0 A;  4PFW A;  4DCX A;  2F36 A;  1LFH A;  2ESN A;  4RYA A;  4XKP A;  5ICQ A;  1LAG E;  1SI0 A;  1SW1 A;  1SI1 A;  4EUO A;  1PC3 A;  4DXB A;  1R9Q A;  3UA8 A;  1MY3 A;  4Q5T A;  3O28 A;  2O6A A;  3TTL A;  4DIG A;  5I2N B;  4BDL A;  1QW0 A;  2HCA A;  4XTC Q;  2Z8F A;  1B4Z A;  2THI A;  1TT1 A;  1IQ7 A;  3B7D A;  3M3K A;  5H8Q B;  4X9T A;  1POY 1;  3IOV A;  4ZZE A;  1AIV A;  1N84 A;  1LLS A;  4MBP A;  3O2A A;  4H67 A;  4NWD A;  2HFB A;  1XS5 A;  3QUJ A;  3EHS A;  1JVY A;  5EHM A;  5KDT A;  3F11 A;  2IEE A;  3C9H A;  1WOD A;  4R72 A;  5CMK A;  3UN6 A;  2ONR A;  4KPT A;  3I3V A;  5AA2 D;  3RLF E;  4YAH X;  2I3W A;  2HAV A;  2DE3 A;  4R2B A;  3UP9 A;  4C1U A;  5FHN A;  2F7A A;  2WKY A;  2CMO A;  5A5X B;  1SVX B;  4XKN A;  1A99 A;  3MVZ A;  4YMB A;  3G3I A;  3DP6 A;  3C31 A;  4LA9 A;  1VSO A;  3TDJ A;  2Z8E A;  4NF5 B;  4OFO A;  5H8N B;  3H6U A;  1H43 A;  5AA4 B;  3IL1 B;  4LQ2 A;  3OSR A;  2V84 A;  1B5J A;  4NMY A;  4U1Z A;  1TXF A;  1LAH E;  4U21 A;  3TMG A;  3E3K A;  1HSL A;  3D4C A;  3IB2 A;  5I58 A;  5CM6 A;  1MXZ A;  5ICT A;  1SBP A;  4YB5 A;  5KCJ B;  2DE4 A;  3LSL A;  4FIM A;  1SW4 A;  1OLA A;  3IJX B;  1FTM A;  1A8E A;  1N3X A;  1CE2 A;  4ND9 A;  1USY H;  1MQI A;  2Z23 A;  1Q1K A;  3ODB A;  4ZEF A;  1UQW A;  2V3U A;  3KBR A;  3H6T A;  1H3D A;  4ELR A;  1URD A;  2O68 A;  1Y20 A;  3EQ1 A;  3K00 A;  1MRP A;  1XHY A;  2Q2A A;  5CBR A;  2Z8D A;  1SW5 A;  2NOO A;  4KR5 A;  2O1L A;  3OO7 A;  3CSG A;  3MP6 A;  1P1W A;  1LBC A;  3TTR A;  1PEB A;  1XVX A;  5TPA B;  3KJ7 A;  2Q88 A;  5FTI A;  3TQW A;  2VOZ A;  4BDQ A;  2PMS A;  3KSX A;  3LR1 A;  1JNF A;  3GXA A;  1SYI A;  5L9O A;  1B58 A;  3SDF A;  3QUF A;  4F1U A;  3FVK A;  5HBC A;  1FCK A;  2XHD A;  2ZNS A;  3FUZ A;  2R9J A;  2P2A A;  5I2K A;  5ITO A;  5AA2 A;  1B51 A;  1QUL A;  3HV1 A;  1AMF A;  2UVH A;  4ZEC A;  4N13 A;  3H06 B;  4F2Q A;  4N6P A;  2P0S A;  3T96 B;  3FXU A;  3D4G A;  2QPQ A;  4ZE9 A;  3OEL A;  5CC2 A;  1YAE A;  1GV8 A;  3HHF A;  2XX9 A;  3OMB A;  3B6T A;  1O63 A;  1DTZ A;  2D5W A;  1JEU A;  3JYR A;  2RC8 A;  4WKM A;  1XOC A;  3RN8 A;  4X1D A;  1N3W A;  1B5H A;  2DXR A;  4NF6 A;  2XX8 A;  1II5 A;  1LCF A;  4MF3 A;  1ANF A;  1Y4C A;  3K1N A;  1S7Y A;  5K2X A;  1US4 A;  5DYH A;  4ESX A;  4U2R A;  3KJT A;  2NXO A;  3RUM A;  1BTJ A;  1LAX A;  1SD3 A;  2OBG A;  4YKK A;  3V8X B;  2VD3 A;  4IGR A;  1IXC A;  1UTB A;  3FXQ A;  4QFO A;  1I69 A;  1NH8 A;  1T0K A;  1TWY A;  1URG A;  1FTJ A;  4FED A;  2OK2 A;  3QYT A;  2ZYK A;  2I4C A;  1R9L A;  4H5G A;  2UVJ A;  3FV2 A;  3ZSF A;  2UYF A;  3KSJ A;  3T9X B;  4QHQ A;  2DWJ A;  3S4U A;  3MZB A;  1QUJ A;  5CI5 A;  4OEV A;  4GXS B;  2Q8J A;  4THI A;  1H45 A;  3KGC A;  4G4P A;  2ZXT A;  4IY6 A;  1B52 A;  1BIY A;  2I58 A;  5I59 B;  1LCT A;  4IO7 A;  4QSD A;  3IX1 A;  3TTK A;  2HZK A;  4GL8 A;  3MJN A;  5IKB A;  1Y1M A;  1LGB C;  4QFL A;  2DOJ A;  3TCG A;  1B7U A;  4OER A;  5DVJ A;  3SER A;  2I4B A;  3N94 A;  3RT6 B;  1PB9 A;  4ONY A;  2VP1 A;  4NF4 A;  1J1N A;  4KI0 E;  2CZL A;  3PUX E;  1N04 A;  4O3C A;  1B0L A;  3FZV A;  3IJO B;  2ONK E;  3S9L C;  3FAS A;  3MVY A;  2F78 A;  3ZKK A;  1NL5 A;  4LAT A;  3IB1 A;  2Y7R A;  4Z7E A;  2XXU A;  3CFZ A;  4Q30 B;  2R71 A;  3FAT A;  5L9M A;  4JSO A;  3G3K A;  4Z0I A;  4OYV A;  5AA3 A;  3TCF A;  4IO3 A;  1YPN A;  4G68 A;  3TFL A;  1AOV A;  1B3E A;  1NH7 A;  1WDN A;  1B4H A;  4ZEI A;  3V89 B;  1MQG A;  3Q29 A;  3T9V A;  3K2D A;  5DVF A;  3Q28 A;  1MPD A;  1US5 A;  1XVY A;  2PVU A;  4OFJ A;  5TU0 A;  1S50 A;  4ELO A;  3CSB A;  2W7Y A;  3PPN A;  5FTH A;  3GLB A;  1NNK A;  1VE4 A;  1ZU0 A;  4GF8 A;  4H6D A;  1D3K A;  3TOD A;  1NKX A;  2F97 A;  4F19 A;  3S9M C;  1ZTY A;  5I56 B;  4C1T A;  3RY3 A;  3MVW A;  3TEL A;  1H44 A;  4PFT A;  3PGF A;  3I6V A;  1JQF A;  2AL4 A;  2QRY A;  2H5Y A;  3MC2 A;  4MFI A;  2DS9 A;  3IK6 B;  2XXI A;  4WED A;  2DWA A;  3K01 A;  2E1S A;  4GOT A;  2GRV A;  1PDA A;  1B6H A;  4OQO A;  4PFU A;  4ELP A;  2DP8 A;  4H5F A;  2XX7 A;  1H76 A;  5B7D A;  2X7Q A;  2Y7I A;  4ZEB A;  4TLM B;  3MAM A;  2DQV A;  4IO6 A;  1Y3P A;  4UAC A;  1FTO A;  3U72 A;  1RYO A;  1M5E A;  3KOS A;  2YPN A;  5H8H B;  2AYS A;  1VFD A;  1YCJ A;  2B65 A;  2QMX A;  3C35 A;  3IOR A;  2UXA A;  4U4S A;  2QSX A;  1IIW A;  3M3F A;  3OXN A;  5I2N A;  3TAJ A;  4K3F A;  4PP0 A;  2XXW A;  3W9W A;  4GLI A;  3ONM A;  1GVC A;  1B0H A;  4EQB A;  5H8F B;  4R2F A;  2KLF A;  3T9U A;  4F1V A;  5TP9 B;  2RC9 A;  5CBS A;  1MDP 1;  3PUV E;  3KZG A;  3HPI A;  3UOR A;  3PD9 A;  4KYE A;  4R6H A;  1PB7 A;  2F7C A;  3BFU A;  2PYY A;  2I3V A;  1FQC A;  1IXG A;  4F22 A;  4H8I A;  1NNF A;  2A5S A;  3SEU A;  2UVG A;  1JW5 A;  3U94 A;  4IGT A;  4PE5 B;  1I6A A;  3N26 A;  1FW0 A;  2FYI A;  5A5X A;  3TTM A;  1VR5 A;  1LB8 A;  4M4G A;  1M5D A;  4QFP A;  3FVG A;  2A5T B;  3K1P A;  3PUZ E;  2HZL A;  3MZ9 A;  4XIG Q;  4NTL A;  3VXB A;  3K6U A;  4OWD A;  3C36 A;  1MH3 A;  3L6H A;  4O3B A;  2B3F A;  4G8M A;  5AA4 A;  3GBB A;  3TYH A;  1B46 A;  2NVU B;  2QL3 A;  1B32 A;  2P1S A;  4OEN A;  1MPB A;  4MLV A;  2I6E A;  4GWO A;  3UIF A;  3EF7 A;  2HXW A;  4JBZ A;  2OJT A;  2H9B A;  3V83 A;  3PPP A;  4BDN A;  3Q26 A;  5K2Y A;  1B7H A;  4GIZ A;  3MP8 A;  1B7Z A;  3MQ9 A;  3Q27 A;  3CFX A;  4OFL A;  4DE8 A;  2O69 A;  3O6I A;  5I57 B;  3M8U A;  4TOZ A;  1SW2 A;  4NF8 B;  4AQ4 A;  2NWJ A;  3UGW A;  2O7I A;  1JW1 A;  3C4M A;  3M3L A;  1Y4T A;  4EF2 A;  1IXH A;  3KFM A;  3DLN A;  3CRB A;  2QS2 A;  2BJJ X;  4DXU A;  3A3U A;  1MXV A;  3TCH A;  1UIU A;  1IUD A;  3QXM A;  3LSF B;  4LZ7 A;  4MH5 A;  4FAT A;  5DT6 A;  1GTK A;  5TPA A;  5BUU A;  4C0R A;  2REJ A;  1MQJ A;  4F39 A;  4ESW A;  1LB9 A;  2GH9 A;  2VHA A;  1D9V A;  4LVQ A;  1OQH A;  3CVG A;  4ZED A;  3JV9 A;  2UYE A;  1P1N A;  4IO5 A;  3E13 X;  4RA1 A;  1MXY A;  4YKJ A;  3DM0 A;  4ISU A;  3RTW B;  5JEI A;  2QS1 A;  3K6V A;  4YMA A;  5DVI A;  3GZG A;  1EZO A;  2Q9T A;  3C33 A;  3FXR A;  3TZA A;  3RGY A;  3VVD A;  4I1D A;  1Z7N E;  2OLB A;  1MG1 A;  1IIT A;  3R26 A;  1FQA A;  4HTG A;  3IOT A;  4I62 A;  1OQG A;  1XT8 A;  3PPR A;  2XXV A;  2I48 A;  4I9D A;  3O9P A;  3SKP A;  1OIB A;  1NFT A;  4YB7 A;  4E0W A;  1BKA A;  1O64 A;  1B2H A;  3ZKL A;  2Y7W A;  2VD2 A;  3CG1 A;  4ZE8 A;  2ZNT A;  3IR1 A;  3O6H A;  4QFN A;  3HHG A;  4E0X A;  3KG2 A;  4H1X A;  3MPK A;  2H99 A;  5I84 A;  4BDM A;  4OXV A;  3KN3 A;  4WEP A;  1LFG A;  4KYS A;  1MM7 A;  1JET A;  5L8D A;  4Q0C A;  2XXQ A;  4JWX A;  4YB6 A;  4DXC A;  4RK9 A;  4G77 A;  1P99 A;  4F18 A;  2REG A;  1Y9U A;  2DXY A;  5KZT A;  2HQ0 A;  4F3B A;  5F1Q A;  5FHO A;  1FQD A;  2DYX A;  3G3G A;  5JK4 A;  3U92 A;  1DMB A;  2QJE A;  2Y7P A;  3DP8 A;  1GR2 A;  4QRZ A;  3TUS A;  1MH4 A;  4RY1 A;  2F6P A;  2OWS A;  4RK2 A;  1EZ9 A;  1B1X A;  4G2Z A;  4IO2 A;  3VLU A;  1QUI A;  1M5C A;  3T22 A;  3RQT A;  1WVJ A;  2ZYN A;  2ANJ A;  4MLQ A;  1XC1 A;  2F34 A;  3IB0 A;  1SDX A;  3K1M A;  4F1Y A;  4LQ5 A;  3LSW A;  3OO8 A;  4AB6 A;  3VFJ A;  1QKB A;  3IO4 A;  1M5B A;  1OMP A;  1RKM A;  4P0G A;  3PMV A;  3VVF A;  3W15 C;  4GVO A;  2XXT A;  1MDQ A;  3R7X A;  2DVZ A;  4KCC A;  5H8S A;  4R9F A;  4ZDM A;  2G93 A;  2HEU A;  4YKP A;  3VLV A;  3EHU A;  4KYD A;  3WAF A;  2XD3 A;  4GFR A;  4G8H A;  2RCA A;  1B3H A;  3RTF B;  4R6Y A;  3CI8 A;  2Y84 A;  3VV5 A;  2H25 A;  1POT A;  2GFE A;  4H65 A;  2Y7K A;  3O66 A;  4R6K A;  3FV1 A;  1Y3Q A;  4EQ7 A;  3MPL A;  2DSF A;  3TQL A;  2NUV A;  1PBP A;  2H98 A;  5B70 A;  4IY5 A;  4G68 B;  4POX A;  4QSE A;  1MY2 A;  1BP5 A;  1Z7M E;  1N0T A;  3N6U A;  4NE4 A;  1JEV A;  1KWH A;  4LON B;  3VXC A;  2AL5 A;  2O1M A;  2Q89 A;  4DCY A;  3FGS A;  3OO6 A;  5ISU A;  3O29 A;  4O3A A;  1P1U A;  5CMM A;  4BDO A;  3USD A;  1S9T A;  4HCY A;  5DEX B;  4BLA A;  1MPC A;  2F6G A;  1B9J A;  3FVN A;  2V93 A;  1Q35 A;  4FJP A;  4GRK A;  3B6W A;  3OEK A;  3I5O A;  2OCU A;  2ZYM A;  5JTY B;  2I0C A;  5H8H A;  1UTH B;  1A7L A;  4EDP A;  1R6Z A;  1LFI A;  1DPE A;  3VE1 B;  4EXK A;  1SYH A;  4OTE A;  3W9V A;  4LZ5 A;  2XD2 A;  2IA4 A;  4QF9 A;  3PPQ A;  4R74 A;  4GD5 A;  1MY0 A;  2Z22 A;  1MXU A;  3RT8 A;  3JZJ A;  3A3C A;  2F5X A;  1FQF A;  3TEP A;  4XXU A;  5H8Q A;  5H8F A;  5EHS A;  2PT2 A;  1HSJ A;  4G68 C;  5TP9 A;  5AA1 A;  2E0S A;  3G3J A;  3QK6 A;  4ZS9 A;  4YKI A;  1TFA A;  3THI A;  2I0B A;  4JDF A;  3TPA A;  3U93 A;  3QAX A;  3IOU A;  4FEB A;  2DE2 A;  3EHT A;  2I49 A;  3HST A;  1AL3 A;  3O97 A;  4XKQ A;  5IAI A;  4LUB A;  1A40 A;  2AIX A;  3SEV A;  4UA8 A;  3H6W A;  2A5T A;  2RF1 A;  3S9E A;  4PFY A;  1ZJL A;  3B6Q A;  1IXI A;  3PD8 A;  4POW A;  3OOA A;  4EQ9 A;  3ILT B;  3OSQ A;  1TFD A;  4LP2 B;  5KDT B;  4EXL A;  1YTV A;  1OLC A;  4NED A;  4NF5 A;  3WAE A;  1P1O A;  4IB2 A;  5H8N A;  3BBR A;  3PUW E;  2ZNU A;  1D9Y A; 
#chains in the Genus database with same CATH topology
 4PQJ A;  1A55 A;  2V3T A;  4U22 A;  4ZZA A;  4MCO A;  1EU8 A;  3FJM A;  4GL0 A;  2D3I A;  3B50 A;  3PPO A;  3T9H B;  4TQU Q;  1GGG A;  1DSN A;  1FTL A;  3E9X A;  3H6V A;  1Y3N A;  1R1N A;  3BFT A;  5CRY A;  4XKR A;  4HCW A;  5KCJ A;  1F9B A;  4FEC A;  4MNC A;  4M1V A;  3P7I A;  1B5I A;  4PF6 A;  5I57 A;  1MXX A;  4NF8 A;  2UVI A;  2ZMB A;  3KN8 A;  4PF8 A;  4G8N A;  1ZMG A;  4RPO A;  1A54 A;  2X26 A;  4OMB A;  5I58 B;  4KCD A;  4WXJ A;  1B1H A;  2ZYO A;  4DZ1 A;  1UIV A;  3R6U A;  3QIM A;  4R73 A;  4GX4 A;  2F8D A;  1XI6 A;  1LAF E;  3MBP A;  3N6T A;  1SPI A;  4JXI A;  2R6G E;  5L9S A;  3BIG A;  2ABH A;  4PFB A;  3V5A A;  1LST A;  3LBS A;  4U4X A;  4F29 A;  2RCB A;  3E4R A;  3SEX A;  1LBZ A;  4R75 A;  4PDH A;  3K4U A;  2XXH A;  3H4Z A;  1FBE A;  3K6W A;  1QVS A;  3KN7 A;  1IZ1 A;  3RNN A;  1NUZ A;  4ZEK A;  2V3Q A;  3H3G A;  4P3L A;  5IZ1 A;  1G0H A;  3CFL A;  3EPE A;  3FD3 A;  4NG7 A;  1DPP A;  1MS7 A;  4RPN A;  4DLD A;  3MW0 A;  1ZBM A;  2O51 A;  1IEJ A;  3DP4 A;  2HAU A;  3O6G A;  3Q25 A;  1M5F A;  1PB8 A;  4NWC A;  3MVX A;  4H0W A;  1RYX A;  1B05 A;  3QMF A;  2V25 A;  4N07 A;  3G7W A;  3PV0 E;  3PMX A;  3TKD A;  1NV6 A;  1CNQ A;  2PBW A;  3D1R A;  3H03 A;  4OEU A;  1FQB A;  3LUY A;  4PE3 A;  1OVB A;  1NMU A;  4FBP A;  4TLL B;  4DI4 B;  4JSD A;  1DOT A;  4AB5 A;  2XWI A;  1BK4 A;  1MY4 A;  4O7M A;  2GHA A;  2OWZ A;  5I2K B;  3LSX A;  4JWO A;  3T66 A;  5AA2 B;  3BKI B;  2ALU A;  2WBD A;  4DDD A;  5LOM A;  4PET A;  4KQP A;  3ECR A;  1ZKB A;  3IOW A;  1ZLQ A;  4PFI A;  2VPO A;  1SQY A;  1L5T A;  1MY1 A;  5EQ8 A;  2VPN A;  1NV1 A;  4N17 A;  3VDF A;  1CB6 A;  2DVC A;  3SET A;  1N7X A;  2PFY A;  3IFC A;  2Q2C A;  1K9Z A;  1FPG A;  3MWB A;  2YLN A;  1ZIU A;  4NF6 B;  4OET A;  4X48 A;  2X7P A;  4KD5 A;  3H7M A;  2FNC A;  4U23 A;  3CHG A;  3MZ1 A;  4P56 A;  4P1E A;  5HM4 B;  3FXB A;  1D4N A;  1I6B A;  4IO4 A;  3PU5 A;  4OZ9 A;  1QJM A;  3FIR A;  3TTN A;  3U8Q A;  4N81 A;  1UTB B;  2QS4 A;  4P11 A;  1NV3 A;  3A09 A;  2CEY A;  3RPW A;  1JVX A;  3UK4 A;  4HW8 A;  5I59 A;  2XXR A;  3DEL B;  2B3B A;  2VT5 A;  4JWY A;  5J1D A;  1QUK A;  1USY E;  2XXX A;  2G29 A;  2ZZW A;  3FJ7 A;  4YZZ A;  3SEW A;  1FPE A;  1QKA A;  1MXW A;  5IGA A;  2ONS A;  3VLW A;  4JVD A;  5FHM A;  3CIJ A;  3IAZ A;  1A8F A;  3VVE A;  1DTG A;  3SES A;  2O7U A;  3U1O A;  1HSE A;  3MP1 A;  4H8J A;  4RNS A;  2BJI A;  1VDW A;  3C32 A;  1LBW A;  4GXA A;  1O7T A;  1EYK A;  2H4I A;  1P1Q A;  3FVO A;  1ATG A;  3SEY A;  2VGQ A;  5CMB A;  1VFE A;  4BDR A;  2XXY A;  4X8R A;  2DWH A;  5EQ9 A;  2QMW A;  3MST A;  1AH5 A;  4QSC A;  1NNT A;  1N7W A;  2OWT A;  1RDX A;  4F2O A;  2PX1 A;  3LUZ A;  3CR9 A;  3OEM A;  1MQD A;  4LZ8 A;  2FIX A;  2MKZ A;  3GBA A;  4NF4 B;  3KOT A;  5F7V A;  1LBB A;  4PBQ A;  3G3F A;  3OO9 A;  1NNP A;  1FBP A;  1EZP A;  2CZH A;  3A29 A;  4GX6 A;  5J16 A;  1URS A;  3ZS6 A;  4PBH A;  4QFK A;  3OD7 A;  2XXP A;  5DTB A;  1PBQ A;  3HCQ A;  3S2V A;  2PCR A;  3PUY E;  4Q8R A;  2Q74 A;  4HS7 A;  3C34 A;  1FTK A;  5BWJ A;  3GYY A;  3ILU B;  5HPQ A;  2OX3 A;  4OES A;  1EH3 A;  3PMW A;  3N5L A;  1FPK A;  4RJZ A;  2RIN A;  3T1B A;  3EN3 A;  1MQH A;  3KEI A;  4RXL A;  3LC8 A;  1B3G A;  2FVZ A;  2M8C A;  5EQ7 A;  5AE4 A;  5I56 A;  4R9G A;  1FQE A;  4OHN A;  3QSL A;  3KBZ A;  2XXK A;  2FA7 A;  3T93 B;  3FJG A;  3HO7 A;  5M2V A;  2PT1 A;  4FOR A;  2RC7 A;  3AXF A;  2LAO A;  4YIC A;  1BLF A;  4GWZ A;  2RKM A;  3NOH A;  4EF1 A;  5ELV A;  3K0V A;  4KHZ E;  3OEN A;  3L6G A;  1JW4 A;  3K6X A;  5DEX A;  4ECF A;  4GWS A;  4F3S A;  1OVT A;  3B8B A;  2F35 A;  3G3H A;  4I8C A;  2D21 A;  4N8Y A;  1I6Q A;  4X1B A;  3S9N C;  3K02 A;  4JB7 A;  4FAJ A;  1B40 A;  4PCD A;  4FE8 A;  5JTY A;  3MUQ A;  1UTH A;  2DDK A;  2DWI A;  4U1O A;  2GHB A;  4F3G A;  2O84 X;  2F7B A;  1B3F A;  2QS3 A;  1LEV A;  4L17 A;  1B3L A;  2YJP A;  1MM6 A;  5CMC A;  2GQ1 A;  1Y1Z A;  4ELQ A;  1ELJ A;  4F31 B;  4NX1 A;  3HN0 A;  5A5L A;  5EYF A;  3CG3 A;  4OVJ A;  2OZZ A;  5ITP A;  4F3P A;  4P0I A;  2P3V A;  3IO6 A;  4GQO A;  4KFQ A;  1N76 A;  5IZ3 A;  4YU0 A;  4PFW A;  4DCX A;  2F36 A;  1LFH A;  2ESN A;  4RYA A;  4XKP A;  5ICQ A;  1LAG E;  1SI0 A;  1RDY A;  1SW1 A;  1SI1 A;  4EUO A;  1PC3 A;  4DXB A;  1R9Q A;  4QBA A;  1FBH A;  3UA8 A;  1MY3 A;  2XWV A;  4Q5T A;  3O28 A;  2O6A A;  3TTL A;  4DIG A;  4HE0 A;  5I2N B;  4BDL A;  1QW0 A;  2HCA A;  4XTC Q;  2Z8F A;  2FIE A;  1B4Z A;  2THI A;  1TT1 A;  1IQ7 A;  3B7D A;  3M3K A;  5H8Q B;  4X9T A;  4I3E A;  4OAN A;  1POY 1;  3IOV A;  4ZZE A;  1AIV A;  5I7I A;  1N84 A;  1LLS A;  4MBP A;  3O2A A;  1FPB A;  4H67 A;  4NWD A;  2HFB A;  4GWW A;  1XS5 A;  3QUJ A;  1FBF A;  3EHS A;  1FPJ A;  1JVY A;  5EHM A;  5KDT A;  3F11 A;  1NUW A;  1Q9D A;  2IEE A;  3C9H A;  1WOD A;  4R72 A;  5CMK A;  3UN6 A;  2ONR A;  4KPT A;  3I3V A;  5AA2 D;  3RLF E;  4YAH X;  2I3W A;  2WYP A;  2HAV A;  2DE3 A;  4R2B A;  3UP9 A;  2CZK A;  4C1U A;  5FHN A;  2F7A A;  2WKY A;  2CMO A;  5A5X B;  1SVX B;  4XKN A;  1A99 A;  3MVZ A;  4YMB A;  4PC9 A;  3G3I A;  3DP6 A;  3C31 A;  4LA9 A;  1VSO A;  3TDJ A;  2QVR A;  2Z8E A;  4NF5 B;  4OFO A;  2F3D A;  5H8N B;  3H6U A;  1H43 A;  4JVC A;  5AA4 B;  3IL1 B;  4LQ2 A;  3OSR A;  2V84 A;  1B5J A;  4NMY A;  4U1Z A;  1TXF A;  1LAH E;  4U21 A;  3TMG A;  4NF0 A;  3E3K A;  1HSL A;  3D4C A;  3IB2 A;  5I58 A;  5CM6 A;  1MXZ A;  5ICT A;  3HFU A;  1SBP A;  4YB5 A;  5KCJ B;  2DE4 A;  4PFR A;  3LSL A;  3ISP A;  4FIM A;  4O8M A;  1SW4 A;  1OLA A;  1FBG A;  3IJX B;  1FTM A;  1A8E A;  1N3X A;  1CE2 A;  4ND9 A;  1USY H;  1MQI A;  2Z23 A;  4P47 A;  1Q1K A;  3ODB A;  4ZEF A;  1UQW A;  4X04 A;  2V3U A;  3KBR A;  3H6T A;  1H3D A;  4ELR A;  1URD A;  2O68 A;  1FPF A;  1EYI A;  1Y20 A;  3EQ1 A;  3K00 A;  4OVQ A;  4MJO A;  1MRP A;  1XHY A;  2Q2A A;  5CBR A;  4NHB A;  2Z8D A;  1SW5 A;  2NOO A;  4KR5 A;  2O1L A;  3OO7 A;  3CSG A;  4PAI A;  3MP6 A;  1P1W A;  1LBC A;  3TTR A;  1PEB A;  1XVX A;  5TPA B;  3KJ7 A;  2Q88 A;  1G0I A;  5FTI A;  3TQW A;  2VOZ A;  4BDQ A;  2PMS A;  4GWY A;  3KSX A;  3LR1 A;  1JNF A;  3GXA A;  1DBZ A;  1SYI A;  5L9O A;  1B58 A;  3SDF A;  4MIJ A;  2B4M A;  3QUF A;  4F1U A;  3FVK A;  5HBC A;  1FCK A;  2XHD A;  2ZNS A;  3FUZ A;  4N8G A;  2R9J A;  2P2A A;  5I2K A;  5ITO A;  5AA2 A;  1B51 A;  1QUL A;  4KXP A;  3HV1 A;  4OVS A;  1AMF A;  4MMP A;  2UVH A;  4ZEC A;  3LV0 A;  4N13 A;  3H06 B;  4QXD A;  4F2Q A;  4N6P A;  2P0S A;  3T96 B;  3FXU A;  3D4G A;  2QPQ A;  4ZE9 A;  4AS5 A;  3OEL A;  5CC2 A;  1YAE A;  1GV8 A;  3HHF A;  2XX9 A;  3OMB A;  1FBD A;  1IMF A;  3B6T A;  4PDD A;  1O63 A;  1DTZ A;  5IZZ A;  2D5W A;  1JEU A;  3JYR A;  2RC8 A;  4WKM A;  1XOC A;  3RN8 A;  4X1D A;  1N3W A;  1B5H A;  2DXR A;  4NF6 A;  2XX8 A;  1II5 A;  1LCF A;  4MF3 A;  1ANF A;  1Y4C A;  3K1N A;  1S7Y A;  5K2X A;  1US4 A;  5DYH A;  4ESX A;  4U2R A;  3KJT A;  2NXO A;  3RUM A;  4P1L A;  1BTJ A;  1LAX A;  1SD3 A;  2OBG A;  4YKK A;  3V8X B;  4PAK A;  1RDZ A;  2VD3 A;  4IGR A;  1IXC A;  1UTB A;  3FXQ A;  4QFO A;  1I69 A;  1KA0 A;  1NH8 A;  4P8B A;  4NGU A;  1T0K A;  1TWY A;  4HXV A;  5FBP A;  1URG A;  1FTJ A;  4FED A;  2OK2 A;  3QYT A;  2ZYK A;  2I4C A;  1R9L A;  4H5G A;  2UVJ A;  4PAF A;  3FV2 A;  3ZSF A;  2UYF A;  3KSJ A;  3T9X B;  4QHQ A;  2DWJ A;  3S4U A;  3MZB A;  1QUJ A;  5CI5 A;  4OEV A;  2Q8M A;  1FPI A;  4GXS B;  2Q8J A;  4THI A;  4IR8 A;  2KR0 A;  1IMB A;  1H45 A;  3KGC A;  4N4U A;  4G4P A;  2ZXT A;  4IY6 A;  1YZ0 A;  1B52 A;  1BIY A;  2I58 A;  5I59 B;  1LCT A;  4IO7 A;  4QSD A;  3IX1 A;  3EKI A;  3TTK A;  2HZK A;  4GL8 A;  3MJN A;  5IKB A;  1Y1M A;  1LGB C;  4QFL A;  2DOJ A;  3TCG A;  1B7U A;  4OER A;  5DVJ A;  4AS4 A;  4O94 A;  3SER A;  2I4B A;  3N94 A;  3RT6 B;  2XWK A;  1PB9 A;  4ONY A;  2VP1 A;  4NF4 A;  2HHM A;  1J1N A;  4KI0 E;  2CZL A;  3PUX E;  1NV5 A;  1N04 A;  2R8T A;  4O3C A;  1B0L A;  1LBV A;  4XEQ A;  3FZV A;  3IJO B;  2ONK E;  3S9L C;  3FAS A;  3MVY A;  4N6K A;  2F78 A;  3ZKK A;  1NL5 A;  4LAT A;  3IB1 A;  2Y7R A;  4Z7E A;  2XXU A;  3MYU A;  3CFZ A;  4Q30 B;  2R71 A;  3FAT A;  5L9M A;  1FBC A;  4JSO A;  3G3K A;  4Z0I A;  4OYV A;  5AA3 A;  4I40 A;  3TCF A;  4IO3 A;  1YPN A;  4GBV A;  4G68 A;  3TFL A;  1AOV A;  1B3E A;  1NH7 A;  1B4H A;  1WDN A;  4XFE A;  4ZEI A;  3V89 B;  1MQG A;  3Q29 A;  3T9V A;  3K2D A;  5DVF A;  3Q28 A;  1MPD A;  1US5 A;  5EYG A;  1XVY A;  4P9K A;  2PVU A;  4OFJ A;  5TU0 A;  1S50 A;  4ELO A;  3CSB A;  2W7Y A;  3PPN A;  5FTH A;  3GLB A;  1NNK A;  1VE4 A;  1JP4 A;  1ZU0 A;  4GF8 A;  4H6D A;  1D3K A;  3TOD A;  1NKX A;  2WYK A;  2F97 A;  1YYZ A;  4OVR A;  4F19 A;  3S9M C;  1ZTY A;  5I56 B;  4C1T A;  3RY3 A;  4G61 A;  3MVW A;  3TEL A;  1H44 A;  4PFT A;  3RPL B;  3PGF A;  3I6V A;  1JQF A;  2AL4 A;  2QRY A;  2L5V A;  2H5Y A;  3MC2 A;  4MFI A;  2DS9 A;  3IK6 B;  2XXI A;  4WED A;  2DWA A;  3K01 A;  2E1S A;  4GOT A;  2GRV A;  3KC0 A;  1PDA A;  1B6H A;  1FJ9 A;  4OQO A;  4PFU A;  2HPG A;  4ELP A;  2DP8 A;  1K9Y A;  4H5F A;  2XX7 A;  1H76 A;  2WEF A;  5B7D A;  2X7Q A;  4MHF A;  4H46 A;  2Y7I A;  2FHY A;  4ZEB A;  4TLM B;  3MAM A;  2DQV A;  1IMD A;  4IO6 A;  1Y3P A;  4UAC A;  2QVU A;  1FTO A;  1IMC A;  3U72 A;  1RYO A;  1M5E A;  3KOS A;  2YPN A;  5H8H B;  2AYS A;  1VFD A;  1YCJ A;  2B65 A;  2QMX A;  1FJ6 A;  3C35 A;  3IOR A;  4HE1 A;  2UXA A;  3RYD A;  4U4S A;  2QSX A;  1IIW A;  3M3F A;  4MX6 A;  3OXN A;  1DK4 A;  5I2N A;  3TAJ A;  4K3F A;  4GWU A;  4PP0 A;  2XXW A;  3W9W A;  4GLI A;  3ONM A;  1GVC A;  1IMA A;  5IZ3 B;  1B0H A;  4EQB A;  5H8F B;  4R2F A;  2KLF A;  3T9U A;  5EYH A;  4F1V A;  4H45 A;  5TP9 B;  2PFZ A;  4LN5 A;  3BIH A;  2RC9 A;  1NUX A;  5CBS A;  5F24 A;  1MDP 1;  3PUV E;  3KZG A;  4HE2 A;  3HPI A;  3UOR A;  3PD9 A;  4KYE A;  4R6H A;  1PB7 A;  2F7C A;  3BFU A;  4PGN A;  2PYY A;  2I3V A;  1FQC A;  1IXG A;  4F22 A;  4H8I A;  1NNF A;  2A5S A;  3SEU A;  2UVG A;  1JW5 A;  4XF5 A;  3U94 A;  4IGT A;  4PE5 B;  1I6A A;  1NV7 A;  4NQ8 A;  3N26 A;  2QVV A;  1FW0 A;  2FYI A;  5A5X A;  3TTM A;  1VR5 A;  1LB8 A;  1KZ8 A;  4M4G A;  1M5D A;  4QFP A;  1IME A;  3FVG A;  2A5T B;  3K1P A;  2JJK A;  3PUZ E;  2HZL A;  3MZ9 A;  4XIG Q;  4NTL A;  2FBP A;  3VXB A;  3K6U A;  4OWD A;  3C36 A;  1MH3 A;  3L6H A;  4O3B A;  1LBY A;  2B3F A;  4G8M A;  5AA4 A;  3FBP A;  3GBB A;  3TYH A;  1B46 A;  2NVU B;  2QL3 A;  1FPD A;  1B32 A;  2P1S A;  4OEN A;  1MPB A;  2KQZ A;  4MLV A;  2I6E A;  4GWO A;  3UIF A;  3EF7 A;  2HXW A;  5EQA A;  4JBZ A;  2OJT A;  2H9B A;  3V83 A;  3PPP A;  4BDN A;  3Q26 A;  5K2Y A;  1B7H A;  4GIZ A;  3MP8 A;  1B7Z A;  2B4L A;  3MQ9 A;  3Q27 A;  3CFX A;  4OFL A;  4DE8 A;  2O69 A;  3O6I A;  5I57 B;  3M8U A;  4TOZ A;  1SW2 A;  4NF8 B;  1LBX A;  4AQ4 A;  2NWJ A;  3UGW A;  2O7I A;  1QGX A;  1JW1 A;  3C4M A;  1FRP A;  3M3L A;  1Y4T A;  4EF2 A;  1IXH A;  3KFM A;  3DLN A;  3CRB A;  2QS2 A;  4DI3 D;  2BJJ X;  1EYJ A;  4DXU A;  3A3U A;  1MXV A;  3TCH A;  1UIU A;  1IUD A;  3QXM A;  3LSF B;  4MEV A;  4LZ7 A;  4MH5 A;  4NAP A;  4FAT A;  5DT6 A;  1GTK A;  5TPA A;  3PTY A;  5BUU A;  4C0R A;  2REJ A;  2ZZV A;  1MQJ A;  4F39 A;  4ESW A;  1LB9 A;  2GH9 A;  2VHA A;  1D9V A;  4LVQ A;  2Y5K A;  1OQH A;  3CVG A;  4ZED A;  3JV9 A;  2UYE A;  1P1N A;  4MAG A;  4IO5 A;  3E13 X;  4RA1 A;  1MXY A;  1NV2 A;  1NUY A;  2CEX A;  4YKJ A;  3DM0 A;  4ISU A;  3RTW B;  5JEI A;  2QS1 A;  3K6V A;  2P3N A;  4YMA A;  5DVI A;  3GZG A;  1EZO A;  2Q9T A;  3C33 A;  3FXR A;  3TZA A;  1DCU A;  3RGY A;  3VVD A;  4I1D A;  1Z7N E;  2OLB A;  1MG1 A;  3T0J A;  1IIT A;  3R26 A;  2V4C A;  1FQA A;  4HTG A;  3IOT A;  4I62 A;  1OQG A;  1XT8 A;  3PPR A;  2XXV A;  2I48 A;  4I9D A;  3O9P A;  3SKP A;  1OIB A;  1NFT A;  4YB7 A;  4E0W A;  1BKA A;  1O64 A;  1B2H A;  3ZKL A;  2Y7W A;  2VD2 A;  5ESY A;  3CG1 A;  4ZE8 A;  2ZNT A;  3IR1 A;  3E78 A;  3O6H A;  4QFN A;  3HHG A;  4E0X A;  4MNI A;  3KG2 A;  4H1X A;  3MPK A;  2H99 A;  5I84 A;  4BDM A;  4OXV A;  2WX9 A;  3KN3 A;  4WEP A;  1LFG A;  4KYS A;  4GX3 A;  1MM7 A;  1JET A;  5L8D A;  4Q0C A;  1NV0 A;  2XXQ A;  4JWX A;  5I5P A;  4YB6 A;  4DXC A;  4RK9 A;  4G77 A;  1P99 A;  4F18 A;  2REG A;  3ROJ A;  1Y9U A;  1INP A;  2DXY A;  4O7I A;  5KZT A;  2HQ0 A;  4OVT A;  4F3B A;  5F1Q A;  5FHO A;  1FQD A;  2DYX A;  3G3G A;  5JK4 A;  3U92 A;  1DMB A;  2QJE A;  2Y7P A;  3DP8 A;  1GR2 A;  4QRZ A;  3TUS A;  1MH4 A;  4RY1 A;  2F6P A;  2OWS A;  4RK2 A;  1EZ9 A;  1B1X A;  4NN3 A;  4G2Z A;  4IO2 A;  3VLU A;  1QUI A;  5DW8 A;  1M5C A;  3T22 A;  3RQT A;  1WVJ A;  2ZYN A;  2ANJ A;  4MLQ A;  1XC1 A;  2F34 A;  3IB0 A;  1SDX A;  3U65 A;  3K1M A;  4F1Y A;  4LQ5 A;  3LSW A;  3OO8 A;  4AB6 A;  3VFJ A;  1QKB A;  3IO4 A;  1M5B A;  1OMP A;  3SZP A;  1RKM A;  4P0G A;  3PMV A;  3VVF A;  3W15 C;  4GVO A;  2XXT A;  1MDQ A;  3R7X A;  2DVZ A;  4KCC A;  5H8S A;  1KA1 A;  4R9F A;  4ZDM A;  2G93 A;  1NI9 A;  2HEU A;  4YKP A;  1FSA A;  3VLV A;  3EHU A;  4KYD A;  2ZZX A;  1YXI A;  1AWB A;  3WAF A;  2XD3 A;  4GFR A;  5T3J A;  4G8H A;  2RCA A;  2WBB A;  1B3H A;  3RTF B;  2QFL A;  4R6Y A;  3CI8 A;  2Y84 A;  5IM2 A;  3VV5 A;  2H25 A;  4OA4 A;  1D9Q A;  1POT A;  4OVP A;  2GFE A;  4H65 A;  2Y7K A;  3O66 A;  4R6K A;  3FV1 A;  1Y3Q A;  2HXR A;  5LTC A;  4EQ7 A;  3MPL A;  2DSF A;  3E79 A;  3TQL A;  2NUV A;  1PBP A;  2H98 A;  5B70 A;  4IY5 A;  4G68 B;  4POX A;  4QSE A;  2F3B A;  5ET5 A;  1MY2 A;  1BP5 A;  3RPL A;  1Z7M E;  1N0T A;  3N6U A;  4NE4 A;  1JEV A;  4N91 A;  1KWH A;  4LON B;  2XWO A;  4GBW A;  3VXC A;  2AL5 A;  5ET8 A;  4PGP A;  2O1M A;  2Q89 A;  4DCY A;  3FGS A;  4N6D A;  3OO6 A;  5ISU A;  3O29 A;  4O3A A;  1P1U A;  5CMM A;  4BDO A;  3USD A;  1S9T A;  4HCY A;  5DEX B;  4BLA A;  1MPC A;  2F6G A;  1B9J A;  3FVN A;  4UAB A;  2V93 A;  1Q35 A;  4FJP A;  4GRK A;  3B6W A;  3OEK A;  3I5O A;  2OCU A;  1NV4 A;  2ZYM A;  4GWX A;  2I0C A;  5H8H A;  5JTY B;  1UTH B;  1A7L A;  4EDP A;  1R6Z A;  1LFI A;  1DPE A;  4I3Y A;  3VE1 B;  4EXK A;  5I3S A;  1SYH A;  4OTE A;  3W9V A;  2CZI A;  4LZ5 A;  2XD2 A;  2IA4 A;  4QF9 A;  1FPL A;  3PPQ A;  5ET6 A;  4R74 A;  4GD5 A;  1MY0 A;  2Z22 A;  4N15 A;  1MXU A;  3RT8 A;  3JZJ A;  3A3C A;  2F5X A;  1FQF A;  3TEP A;  4XXU A;  5H8Q A;  5H8F A;  5EHS A;  2PT2 A;  1HSJ A;  4G68 C;  5TP9 A;  3IFA A;  5AA1 A;  2E0S A;  4JVI A;  3G3J A;  1FTA A;  3QK6 A;  4ZS9 A;  4YKI A;  1TFA A;  3THI A;  2I0B A;  4JDF A;  3TPA A;  3U93 A;  3QAX A;  4MNP A;  3IOU A;  4FEB A;  2DE2 A;  3EHT A;  2I49 A;  3HST A;  1AL3 A;  3O97 A;  4XKQ A;  5IAI A;  4LUB A;  1A40 A;  2AIX A;  3SEV A;  4UA8 A;  3H6W A;  2A5T A;  2RF1 A;  2Y5L A;  3S9E A;  4PFY A;  1ZJL A;  3B6Q A;  1IXI A;  3PD8 A;  4POW A;  3OOA A;  4EQ9 A;  3ILT B;  2XA5 A;  3OSQ A;  1TFD A;  4LP2 B;  5KDT B;  3KC1 A;  4EXL A;  1YTV A;  5LDZ A;  1OLC A;  4NED A;  4NF5 A;  4PTK A;  1P1O A;  4IB2 A;  5H8N A;  3WAE A;  3BBR A;  3PUW E;  5ET7 A;  2ZNU A;  1D9Y A; 
#chains in the Genus database with same CATH homology
 4PQJ A;  1A55 A;  2V3T A;  4U22 A;  4ZZA A;  1EU8 A;  3FJM A;  4GL0 A;  2D3I A;  3PPO A;  3T9H B;  4TQU Q;  1GGG A;  1DSN A;  1FTL A;  3E9X A;  3H6V A;  1Y3N A;  1R1N A;  3BFT A;  5CRY A;  4XKR A;  4HCW A;  5KCJ A;  1F9B A;  4FEC A;  4M1V A;  3P7I A;  1B5I A;  5I57 A;  1MXX A;  4NF8 A;  2UVI A;  2ZMB A;  3KN8 A;  4G8N A;  1ZMG A;  4RPO A;  1A54 A;  2X26 A;  4OMB A;  5I58 B;  4KCD A;  4WXJ A;  1B1H A;  2ZYO A;  4DZ1 A;  1UIV A;  3R6U A;  3QIM A;  4R73 A;  2F8D A;  1LAF E;  3MBP A;  3N6T A;  4JXI A;  2R6G E;  5L9S A;  2ABH A;  3V5A A;  1LST A;  3LBS A;  4U4X A;  4F29 A;  2RCB A;  3E4R A;  3SEX A;  4R75 A;  3K4U A;  2XXH A;  3H4Z A;  3K6W A;  1QVS A;  3KN7 A;  1IZ1 A;  3RNN A;  4ZEK A;  2V3Q A;  3H3G A;  3CFL A;  3EPE A;  3FD3 A;  1DPP A;  1MS7 A;  4RPN A;  4DLD A;  3MW0 A;  1ZBM A;  2O51 A;  1IEJ A;  3DP4 A;  2HAU A;  3O6G A;  3Q25 A;  1M5F A;  1PB8 A;  4NWC A;  3MVX A;  4H0W A;  1RYX A;  1B05 A;  2V25 A;  4N07 A;  3G7W A;  3PV0 E;  3PMX A;  3TKD A;  2PBW A;  3H03 A;  4OEU A;  1FQB A;  3LUY A;  1OVB A;  1NMU A;  4TLL B;  4JSD A;  1DOT A;  4AB5 A;  1MY4 A;  2GHA A;  5I2K B;  3LSX A;  4JWO A;  3T66 A;  5AA2 B;  3BKI B;  2ALU A;  4DDD A;  5LOM A;  4PET A;  4KQP A;  3ECR A;  1ZKB A;  3IOW A;  1ZLQ A;  1SQY A;  1L5T A;  1MY1 A;  3VDF A;  1CB6 A;  2DVC A;  3SET A;  1N7X A;  2Q2C A;  3MWB A;  2YLN A;  1ZIU A;  4NF6 B;  4OET A;  4X48 A;  2X7P A;  4KD5 A;  3H7M A;  2FNC A;  4U23 A;  3MZ1 A;  5HM4 B;  1D4N A;  1I6B A;  4IO4 A;  3PU5 A;  4OZ9 A;  1QJM A;  3FIR A;  3TTN A;  3U8Q A;  1UTB B;  2QS4 A;  4P11 A;  3A09 A;  3RPW A;  1JVX A;  3UK4 A;  4HW8 A;  5I59 A;  2XXR A;  3DEL B;  2B3B A;  4JWY A;  5J1D A;  1QUK A;  1USY E;  2XXX A;  2G29 A;  3FJ7 A;  4YZZ A;  3SEW A;  1QKA A;  1MXW A;  2ONS A;  3VLW A;  5FHM A;  3CIJ A;  3IAZ A;  1A8F A;  3VVE A;  1DTG A;  3SES A;  2O7U A;  3U1O A;  1HSE A;  3MP1 A;  4H8J A;  4RNS A;  3C32 A;  4GXA A;  1O7T A;  2H4I A;  1P1Q A;  3FVO A;  1ATG A;  3SEY A;  2VGQ A;  5CMB A;  1VFE A;  4BDR A;  2XXY A;  2DWH A;  2QMW A;  1AH5 A;  4QSC A;  1NNT A;  1N7W A;  2OWT A;  4F2O A;  2PX1 A;  3CR9 A;  3OEM A;  1MQD A;  4LZ8 A;  3GBA A;  4NF4 B;  3KOT A;  5F7V A;  1LBB A;  3G3F A;  3OO9 A;  1NNP A;  1EZP A;  1URS A;  3ZS6 A;  4QFK A;  3OD7 A;  2XXP A;  5DTB A;  1PBQ A;  3HCQ A;  3S2V A;  3PUY E;  4Q8R A;  4HS7 A;  3C34 A;  1FTK A;  5BWJ A;  3ILU B;  5HPQ A;  4OES A;  1EH3 A;  3PMW A;  3N5L A;  4RJZ A;  2RIN A;  3EN3 A;  1MQH A;  3KEI A;  4RXL A;  3LC8 A;  1B3G A;  2M8C A;  5AE4 A;  5I56 A;  4R9G A;  1FQE A;  4OHN A;  3QSL A;  2FA7 A;  3T93 B;  3FJG A;  3HO7 A;  5M2V A;  2PT1 A;  4FOR A;  2RC7 A;  3AXF A;  2LAO A;  4YIC A;  1BLF A;  2RKM A;  4EF1 A;  5ELV A;  3K0V A;  4KHZ E;  3OEN A;  3L6G A;  1JW4 A;  3K6X A;  5DEX A;  4ECF A;  4F3S A;  1OVT A;  2F35 A;  3G3H A;  4I8C A;  2D21 A;  4X1B A;  1I6Q A;  3S9N C;  3K02 A;  4JB7 A;  4FAJ A;  1B40 A;  4FE8 A;  5JTY A;  3MUQ A;  1UTH A;  2DWI A;  4U1O A;  2GHB A;  4F3G A;  2O84 X;  2F7B A;  1B3F A;  2QS3 A;  4L17 A;  1B3L A;  2YJP A;  1MM6 A;  5CMC A;  1Y1Z A;  4ELQ A;  1ELJ A;  4F31 B;  3HN0 A;  5EYF A;  3CG3 A;  4OVJ A;  2OZZ A;  5ITP A;  4F3P A;  4P0I A;  3IO6 A;  4GQO A;  4KFQ A;  1N76 A;  4YU0 A;  4PFW A;  4DCX A;  2F36 A;  1LFH A;  2ESN A;  4RYA A;  4XKP A;  5ICQ A;  1LAG E;  1SI0 A;  1SW1 A;  1SI1 A;  4EUO A;  1PC3 A;  4DXB A;  1R9Q A;  3UA8 A;  1MY3 A;  4Q5T A;  3O28 A;  2O6A A;  3TTL A;  4DIG A;  5I2N B;  4BDL A;  1QW0 A;  2HCA A;  4XTC Q;  2Z8F A;  1B4Z A;  2THI A;  1TT1 A;  1IQ7 A;  3B7D A;  3M3K A;  5H8Q B;  4X9T A;  1POY 1;  3IOV A;  4ZZE A;  1AIV A;  1N84 A;  1LLS A;  4MBP A;  3O2A A;  4H67 A;  4NWD A;  2HFB A;  1XS5 A;  3QUJ A;  3EHS A;  1JVY A;  5EHM A;  5KDT A;  3F11 A;  2IEE A;  3C9H A;  1WOD A;  4R72 A;  5CMK A;  3UN6 A;  2ONR A;  4KPT A;  3I3V A;  5AA2 D;  3RLF E;  4YAH X;  2I3W A;  2HAV A;  2DE3 A;  4R2B A;  3UP9 A;  4C1U A;  5FHN A;  2F7A A;  2WKY A;  2CMO A;  5A5X B;  1SVX B;  4XKN A;  1A99 A;  3MVZ A;  4YMB A;  3G3I A;  3DP6 A;  3C31 A;  4LA9 A;  1VSO A;  3TDJ A;  2Z8E A;  4NF5 B;  4OFO A;  5H8N B;  3H6U A;  1H43 A;  5AA4 B;  3IL1 B;  4LQ2 A;  3OSR A;  2V84 A;  1B5J A;  4NMY A;  4U1Z A;  1TXF A;  1LAH E;  4U21 A;  3TMG A;  3E3K A;  1HSL A;  3D4C A;  3IB2 A;  5I58 A;  5CM6 A;  1MXZ A;  5ICT A;  1SBP A;  4YB5 A;  5KCJ B;  2DE4 A;  3LSL A;  4FIM A;  1SW4 A;  1OLA A;  3IJX B;  1FTM A;  1A8E A;  1N3X A;  1CE2 A;  4ND9 A;  1USY H;  1MQI A;  2Z23 A;  1Q1K A;  3ODB A;  4ZEF A;  1UQW A;  2V3U A;  3KBR A;  3H6T A;  1H3D A;  4ELR A;  1URD A;  2O68 A;  1Y20 A;  3EQ1 A;  3K00 A;  1MRP A;  1XHY A;  2Q2A A;  5CBR A;  2Z8D A;  1SW5 A;  2NOO A;  4KR5 A;  2O1L A;  3OO7 A;  3CSG A;  3MP6 A;  1P1W A;  1LBC A;  3TTR A;  1PEB A;  1XVX A;  5TPA B;  3KJ7 A;  2Q88 A;  5FTI A;  3TQW A;  2VOZ A;  4BDQ A;  2PMS A;  3KSX A;  3LR1 A;  1JNF A;  3GXA A;  1SYI A;  5L9O A;  1B58 A;  3SDF A;  3QUF A;  4F1U A;  3FVK A;  5HBC A;  1FCK A;  2XHD A;  2ZNS A;  3FUZ A;  2R9J A;  2P2A A;  5I2K A;  5ITO A;  5AA2 A;  1B51 A;  1QUL A;  3HV1 A;  1AMF A;  2UVH A;  4ZEC A;  4N13 A;  3H06 B;  4F2Q A;  4N6P A;  2P0S A;  3T96 B;  3FXU A;  3D4G A;  2QPQ A;  4ZE9 A;  3OEL A;  5CC2 A;  1YAE A;  1GV8 A;  3HHF A;  2XX9 A;  3OMB A;  3B6T A;  1O63 A;  1DTZ A;  2D5W A;  1JEU A;  3JYR A;  2RC8 A;  4WKM A;  1XOC A;  3RN8 A;  4X1D A;  1N3W A;  1B5H A;  2DXR A;  4NF6 A;  2XX8 A;  1II5 A;  1LCF A;  4MF3 A;  1ANF A;  1Y4C A;  3K1N A;  1S7Y A;  5K2X A;  1US4 A;  5DYH A;  4ESX A;  4U2R A;  3KJT A;  2NXO A;  3RUM A;  1BTJ A;  1LAX A;  1SD3 A;  2OBG A;  4YKK A;  3V8X B;  2VD3 A;  4IGR A;  1IXC A;  1UTB A;  3FXQ A;  4QFO A;  1I69 A;  1NH8 A;  1T0K A;  1TWY A;  1URG A;  1FTJ A;  4FED A;  2OK2 A;  3QYT A;  2ZYK A;  2I4C A;  1R9L A;  4H5G A;  2UVJ A;  3FV2 A;  3ZSF A;  2UYF A;  3KSJ A;  3T9X B;  4QHQ A;  2DWJ A;  3S4U A;  3MZB A;  1QUJ A;  5CI5 A;  4OEV A;  4GXS B;  2Q8J A;  4THI A;  1H45 A;  3KGC A;  4G4P A;  2ZXT A;  4IY6 A;  1B52 A;  1BIY A;  2I58 A;  5I59 B;  1LCT A;  4IO7 A;  4QSD A;  3IX1 A;  3TTK A;  2HZK A;  4GL8 A;  3MJN A;  5IKB A;  1Y1M A;  1LGB C;  4QFL A;  2DOJ A;  3TCG A;  1B7U A;  4OER A;  5DVJ A;  3SER A;  2I4B A;  3N94 A;  3RT6 B;  1PB9 A;  4ONY A;  2VP1 A;  4NF4 A;  1J1N A;  4KI0 E;  2CZL A;  3PUX E;  1N04 A;  4O3C A;  1B0L A;  3FZV A;  3IJO B;  2ONK E;  3S9L C;  3FAS A;  3MVY A;  2F78 A;  3ZKK A;  1NL5 A;  4LAT A;  3IB1 A;  2Y7R A;  4Z7E A;  2XXU A;  3CFZ A;  4Q30 B;  2R71 A;  3FAT A;  5L9M A;  4JSO A;  3G3K A;  4Z0I A;  4OYV A;  5AA3 A;  3TCF A;  4IO3 A;  1YPN A;  4G68 A;  3TFL A;  1AOV A;  1B3E A;  1NH7 A;  1WDN A;  1B4H A;  4ZEI A;  3V89 B;  1MQG A;  3Q29 A;  3T9V A;  3K2D A;  5DVF A;  3Q28 A;  1MPD A;  1US5 A;  1XVY A;  2PVU A;  4OFJ A;  5TU0 A;  1S50 A;  4ELO A;  3CSB A;  2W7Y A;  3PPN A;  5FTH A;  3GLB A;  1NNK A;  1VE4 A;  1ZU0 A;  4GF8 A;  4H6D A;  1D3K A;  3TOD A;  1NKX A;  2F97 A;  4F19 A;  3S9M C;  1ZTY A;  5I56 B;  4C1T A;  3RY3 A;  3MVW A;  3TEL A;  1H44 A;  4PFT A;  3PGF A;  3I6V A;  1JQF A;  2AL4 A;  2QRY A;  2H5Y A;  3MC2 A;  4MFI A;  2DS9 A;  3IK6 B;  2XXI A;  4WED A;  2DWA A;  3K01 A;  2E1S A;  4GOT A;  2GRV A;  1PDA A;  1B6H A;  4OQO A;  4PFU A;  4ELP A;  2DP8 A;  4H5F A;  2XX7 A;  1H76 A;  5B7D A;  2X7Q A;  2Y7I A;  4ZEB A;  4TLM B;  3MAM A;  2DQV A;  4IO6 A;  1Y3P A;  4UAC A;  1FTO A;  3U72 A;  1RYO A;  1M5E A;  3KOS A;  2YPN A;  5H8H B;  2AYS A;  1VFD A;  1YCJ A;  2B65 A;  2QMX A;  3C35 A;  3IOR A;  2UXA A;  4U4S A;  2QSX A;  1IIW A;  3M3F A;  3OXN A;  5I2N A;  3TAJ A;  4K3F A;  4PP0 A;  2XXW A;  3W9W A;  4GLI A;  3ONM A;  1GVC A;  1B0H A;  4EQB A;  5H8F B;  4R2F A;  2KLF A;  3T9U A;  4F1V A;  5TP9 B;  2RC9 A;  5CBS A;  1MDP 1;  3PUV E;  3KZG A;  3HPI A;  3UOR A;  3PD9 A;  4KYE A;  4R6H A;  1PB7 A;  2F7C A;  3BFU A;  2PYY A;  2I3V A;  1FQC A;  1IXG A;  4F22 A;  4H8I A;  1NNF A;  2A5S A;  3SEU A;  2UVG A;  1JW5 A;  3U94 A;  4IGT A;  4PE5 B;  1I6A A;  3N26 A;  1FW0 A;  2FYI A;  5A5X A;  3TTM A;  1VR5 A;  1LB8 A;  4M4G A;  1M5D A;  4QFP A;  3FVG A;  2A5T B;  3K1P A;  3PUZ E;  2HZL A;  3MZ9 A;  4XIG Q;  4NTL A;  3VXB A;  3K6U A;  4OWD A;  3C36 A;  1MH3 A;  3L6H A;  4O3B A;  2B3F A;  4G8M A;  5AA4 A;  3GBB A;  3TYH A;  1B46 A;  2NVU B;  2QL3 A;  1B32 A;  2P1S A;  4OEN A;  1MPB A;  4MLV A;  2I6E A;  4GWO A;  3UIF A;  3EF7 A;  2HXW A;  4JBZ A;  2OJT A;  2H9B A;  3V83 A;  3PPP A;  4BDN A;  3Q26 A;  5K2Y A;  1B7H A;  4GIZ A;  3MP8 A;  1B7Z A;  3MQ9 A;  3Q27 A;  3CFX A;  4OFL A;  4DE8 A;  2O69 A;  3O6I A;  5I57 B;  3M8U A;  4TOZ A;  1SW2 A;  4NF8 B;  4AQ4 A;  2NWJ A;  3UGW A;  2O7I A;  1JW1 A;  3C4M A;  3M3L A;  1Y4T A;  4EF2 A;  1IXH A;  3KFM A;  3DLN A;  3CRB A;  2QS2 A;  2BJJ X;  4DXU A;  3A3U A;  1MXV A;  3TCH A;  1UIU A;  1IUD A;  3QXM A;  3LSF B;  4LZ7 A;  4MH5 A;  4FAT A;  5DT6 A;  1GTK A;  5TPA A;  5BUU A;  4C0R A;  2REJ A;  1MQJ A;  4F39 A;  4ESW A;  1LB9 A;  2GH9 A;  2VHA A;  1D9V A;  4LVQ A;  1OQH A;  3CVG A;  4ZED A;  3JV9 A;  2UYE A;  1P1N A;  4IO5 A;  3E13 X;  4RA1 A;  1MXY A;  4YKJ A;  3DM0 A;  4ISU A;  3RTW B;  5JEI A;  2QS1 A;  3K6V A;  4YMA A;  5DVI A;  3GZG A;  1EZO A;  2Q9T A;  3C33 A;  3FXR A;  3TZA A;  3RGY A;  3VVD A;  4I1D A;  1Z7N E;  2OLB A;  1MG1 A;  1IIT A;  3R26 A;  1FQA A;  4HTG A;  3IOT A;  4I62 A;  1OQG A;  1XT8 A;  3PPR A;  2XXV A;  2I48 A;  4I9D A;  3O9P A;  3SKP A;  1OIB A;  1NFT A;  4YB7 A;  4E0W A;  1BKA A;  1O64 A;  1B2H A;  3ZKL A;  2Y7W A;  2VD2 A;  3CG1 A;  4ZE8 A;  2ZNT A;  3IR1 A;  3O6H A;  4QFN A;  3HHG A;  4E0X A;  3KG2 A;  4H1X A;  3MPK A;  2H99 A;  5I84 A;  4BDM A;  4OXV A;  3KN3 A;  4WEP A;  1LFG A;  4KYS A;  1MM7 A;  1JET A;  5L8D A;  4Q0C A;  2XXQ A;  4JWX A;  4YB6 A;  4DXC A;  4RK9 A;  4G77 A;  1P99 A;  4F18 A;  2REG A;  1Y9U A;  2DXY A;  5KZT A;  2HQ0 A;  4F3B A;  5F1Q A;  5FHO A;  1FQD A;  2DYX A;  3G3G A;  5JK4 A;  3U92 A;  1DMB A;  2QJE A;  2Y7P A;  3DP8 A;  1GR2 A;  4QRZ A;  3TUS A;  1MH4 A;  4RY1 A;  2F6P A;  2OWS A;  4RK2 A;  1EZ9 A;  1B1X A;  4G2Z A;  4IO2 A;  3VLU A;  1QUI A;  1M5C A;  3T22 A;  3RQT A;  1WVJ A;  2ZYN A;  2ANJ A;  4MLQ A;  1XC1 A;  2F34 A;  3IB0 A;  1SDX A;  3K1M A;  4F1Y A;  4LQ5 A;  3LSW A;  3OO8 A;  4AB6 A;  3VFJ A;  1QKB A;  3IO4 A;  1M5B A;  1OMP A;  1RKM A;  4P0G A;  3PMV A;  3VVF A;  3W15 C;  4GVO A;  2XXT A;  1MDQ A;  3R7X A;  2DVZ A;  4KCC A;  5H8S A;  4R9F A;  4ZDM A;  2G93 A;  2HEU A;  4YKP A;  3VLV A;  3EHU A;  4KYD A;  3WAF A;  2XD3 A;  4GFR A;  4G8H A;  2RCA A;  1B3H A;  3RTF B;  4R6Y A;  3CI8 A;  2Y84 A;  3VV5 A;  2H25 A;  1POT A;  2GFE A;  4H65 A;  2Y7K A;  3O66 A;  4R6K A;  3FV1 A;  1Y3Q A;  4EQ7 A;  3MPL A;  2DSF A;  3TQL A;  2NUV A;  1PBP A;  2H98 A;  5B70 A;  4IY5 A;  4G68 B;  4POX A;  4QSE A;  1MY2 A;  1BP5 A;  1Z7M E;  1N0T A;  3N6U A;  4NE4 A;  1JEV A;  1KWH A;  4LON B;  3VXC A;  2AL5 A;  2O1M A;  2Q89 A;  4DCY A;  3FGS A;  3OO6 A;  5ISU A;  3O29 A;  4O3A A;  1P1U A;  5CMM A;  4BDO A;  3USD A;  1S9T A;  4HCY A;  5DEX B;  4BLA A;  1MPC A;  2F6G A;  1B9J A;  3FVN A;  2V93 A;  1Q35 A;  4FJP A;  4GRK A;  3B6W A;  3OEK A;  3I5O A;  2OCU A;  2ZYM A;  5JTY B;  2I0C A;  5H8H A;  1UTH B;  1A7L A;  4EDP A;  1R6Z A;  1LFI A;  1DPE A;  3VE1 B;  4EXK A;  1SYH A;  4OTE A;  3W9V A;  4LZ5 A;  2XD2 A;  2IA4 A;  4QF9 A;  3PPQ A;  4R74 A;  4GD5 A;  1MY0 A;  2Z22 A;  1MXU A;  3RT8 A;  3JZJ A;  3A3C A;  2F5X A;  1FQF A;  3TEP A;  4XXU A;  5H8Q A;  5H8F A;  5EHS A;  2PT2 A;  1HSJ A;  4G68 C;  5TP9 A;  5AA1 A;  2E0S A;  3G3J A;  3QK6 A;  4ZS9 A;  4YKI A;  1TFA A;  3THI A;  2I0B A;  4JDF A;  3TPA A;  3U93 A;  3QAX A;  3IOU A;  4FEB A;  2DE2 A;  3EHT A;  2I49 A;  3HST A;  1AL3 A;  3O97 A;  4XKQ A;  5IAI A;  4LUB A;  1A40 A;  2AIX A;  3SEV A;  4UA8 A;  3H6W A;  2A5T A;  2RF1 A;  3S9E A;  4PFY A;  1ZJL A;  3B6Q A;  1IXI A;  3PD8 A;  4POW A;  3OOA A;  4EQ9 A;  3ILT B;  3OSQ A;  1TFD A;  4LP2 B;  5KDT B;  4EXL A;  1YTV A;  1OLC A;  4NED A;  4NF5 A;  3WAE A;  1P1O A;  4IB2 A;  5H8N A;  3BBR A;  3PUW E;  2ZNU A;  1D9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...